3O26A

The structure of salutaridine reductase from papaver somniferum.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
294
structure length
294
Chain Sequence
RRCAVVTGGNKGIGFEICKQLSSNGIMVVLTCRDVTKGHEAVEKLKNSNHENVVFHQLDVTDPIATMSSLADFIKTHFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEELVKIYEKPEAQELMSETYELAEECLKINYNGVKSVTEVLIPLLQLSDSPRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLANKIPKFQVNCVCPGLVKTEMNYGIGNYTAEEGAEHVVRIALFPDDGPSGFFYDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The atomic structure of salutaridine reductase from the opium poppy Papaver somniferum.
pubmed doi rcsb
source organism Papaver somniferum
molecule tags Oxidoreductase
molecule keywords Salutaridine reductase
total genus 114
structure length 294
sequence length 294
ec nomenclature ec 1.1.1.248: Salutaridine reductase (NADPH).
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3o26A00
1DHRA 4IBOA 5KWEA 3AOEC 3GGPA 2O3JA 1UDCA 3AM5A 2VTEA 3QVXA 1B15A 3NT2A 1E0DA 4LVUA 1PJ3A 4HNHA 3M6IA 4CMKA 5F5NA 3CTMA 1GADO 3OJOA 1Z7EA 3PQDA 2NVBA 4YT5A 2ZB4A 1ONPA 1Z7BA 1H9BA 2JFGA 1CQIA 2HAEA 1LJ8A 1UZLA 3I9OA 5B4UA 3OP4A 4OJNA 5DNAA 4JIGA 4XYLA 4J0EA 2JCVA 1PJLA 5AOVA 3FNHA 1KERA 4J3FA 1OOEA 1GUYA 2ILTA 1OI7A 5JMPA 1XCBA 1C3VA 1WDKA 1ZKMA 1LDNA 2ET6A 5AQ1A 4FC7A 2ZKLA 4ALLA 1O5IA 2HMVA 1GYPA 1GQQA 4FIZA 2NVWA 3BMQA 3AY7A 5JAIA 3FHLA 2R00C 3UN1A 1RJWA 1PTJA 4L75A 2J3KA 5ICMA 3WFJA 1E92A 4LW8A 4DMLA 3IOYA 2WDZA 2ZTVA 5TX7A 2QX7A 4DYDA 5BSFA 4CM8B 2AG8A 1NWCA 3FD8A 2VYND 3AUTA 3ZHYA 3U4DA 1U4SA 4MIOA 4BO4A 1E7WA 1GQYA 2IXAA 4W7HA 5IJZA 3V2HA 3EVTA 1N5DA 3FI9A 4CR6A 3GGOA 5L7WA 5JY1A 4J4HA 1UH5A 2C5AA 4GLOA 1E5LA 2Z5LA 1VE9A 1PIWA 1ZBQA 3DZBA 1MG0A 2HMWA 5KJ6A 4ZICA 2F1KA 3AOGA 3RUIA 3JQFA 7ADHA 2HCTA 3KXDA 1E3LA 5KKAA 4LGVA 1YH3A 2PH5A 1LTHR 3W4JA 3WGIA 4CODB 2I5PO 3DWFA 4RF4A 1E3SA 3G49A 4YB8A 2HJSA 3FNFA 5COAA 4RDIA 3IJPA 1NHWA 4E5YA 3GEGA 3C3XA 4RORA 2EIHA 4GSKA 5JCJD 3ONFA 4ALJA 4RL6A 5C7OO 4MVJE 3OICA 4FPXA 3GPIA 5MDHA 5LDGA 2G76A 2Q1SA 1D7OA 5I8WA 1GUZA 4KMSA 4PG4A 4L4XA 4Y9DA 4UEJA 2X86A 5GZ1A 4IZHA 4PLWA 4QFDA 4GX2A 1DC6A 2B5VA 1BXKA 3RU7A 5L4NA 4QSMA 3RUFA 1KIFA 2CVQA 3ZWOA 5BSEA 3M2TA 3I4CA 3V5NA 3WWYA 5JSFA 4CLDA 1W73A 4NK5A 4GAEA 1LRKA 3MZ0A 5F21A 2RIRA 2JJYA 2BLLA 3GVIA 4CMCA 3E6AA 1KY5A 5L40A 5B12A 3FTPA 4MVJF 2PZMA 4IMPA 4NI5A 2AEFA 1W8DA 3OA0A 3GC6A 4R1NA 4Y6SA 2Y99A 5T8KC 4BGVA 1H0KA 2B0JA 3TDKA 1HYGA 1X7GA 1P31A 3WQRA 5A04A 3OQ1A 5JXWA 3AW9A 3OIFA 3PYMA 2J3JA 4I5DA 3RWBA 2YV1A 2F00A 4AJEA 1B16A 3ZWPA 4CV1A 2YYYA 3I9LA 4MPDA 4ZJUA 2A9FA 4WGGA 3RKRA 4IS3A 1I3NA 2CMDA 5EL0A 1DAPA 2EWMA 4LISA 1Y8QB 1IHYA 4CMGA 3ZNNA 3T4EA 4L73A 5IZCC 1Y8RB 1YONA 1D3AA 4OH1A 4PZDA 2YV2A 4AJNA 3GOHA 4MVJI 2XPCA 3X2FA 4RVHA 5IDWA 1TT7A 5COBA 4Y6PA 5DCYA 1NVTA 3Q9NA 4MVJA 3WYCA 3FF4A 1JQBA 3PQEA 3ZW9A 1R66A 2V6FA 4OL9A 2O3QA 4W99A 2Q3EA 2R00A 3BTOA 2X58A 4BNUA 2V65A 1TI7A 4CQMA 2ZB8A 3KBOA 1Z82A 4JXKA 4ITUA 5B4VA 2HMTA 5TSDA 4FJ1A 4BO8A 1ORRA 5L4LA 1R4MA 2P4HX 3I9NA 3QY9A 1CEQA 3PPIA 3Q9UA 5JDIA 4P4LA 2GN8A 3WQQA 3UF0A 4D43A 4BL5A 1QYCA 2Y1GA 4HBGA 1Y9EA 1HYEA 3CEAA 1T25A 3A14A 1H93A 4J1SA 4BGIA 3EZYA 5A3JA 3LT1A 3WJAA 3T4XA 2Y68A 1A5ZA 1JWBB 3VC7A 1TB4A 3GY0A 3BMCA 3DZJA 4WEOA 1PJ2A 1UDAA 3WX0A 2AW5A 4PLTA 1H94A 3SVTA 4IDFA 2FY8A 1ADGA 3JQDA 3GNSA 3B1KA 4KUGA 4URFA 1WZIA 1MC4A 4QO7A 3DAFA 4BV9A 5CP8A 4BO9A 1JU9A 2DQ4A 5IZ4A 3HUDA 3KUXA 4CM1A 2I6TA 4YJGA 4J1TA 1JKIA 2QRKA 2PTGA 4YXFA 2D2IA 1WPQA 4NQZA 1QRRA 4BNNA 2HMUA 1M66A 2W2LD 4HWKA 1HXHA 1VSUA 3MTGA 4M49A 4DPMA 1F0YA 3G79A 1YL6A 1VL0A 1BSVA 3GEMA 4BB5A 4MKZA 3BMCB 3CMMA 4R9RA 3JQ9A 4R1TA 2B83A 4RO0A 3WQSB 2VT3A 1IE3A 4BGEA 5F5LA 2C20A 4FCCA 1GZ4A 4HNGA 5L7TA 3WYBA 4CM9D 1VPDA 4NZ9A 4WLOA 1PGNA 5U9CA 1AN9A 5JYDA 4IGEA 3TPCA 3OEYA 4E2XA 4YJGB 2UDPA 2DUWA 4NU5A 2PGDA 5IG2A 1T2DA 2YZ7A 3TZCA 4D3DA 1BXZA 5T8KA 1E6UA 5B4TA 2C7GA 3AU9A 1Q2XA 5FI3A 1IPEA 3QWIA 5CDTA 4A7PA 4LN1A 2AE1A 3KEOA 4RPGA 1R16A 3BHMA 4IDBA 4Z9YA 3C24A 1D8AA 1J6UA 1DJQA 3WGZA 3JQAD 1XWFA 2AQ8A 2WJPA 3MJCA 1LBEA 1I2CA 2WYWA 1E6EA 3GG9A 3P19A 1B8UA 1C1DA 4NNJA 2DTEA 1VJ0A 4YA6A 5G0SA 3SJ7A 3W6UA 3WIDA 4B7XA 4CLEA 4DC1A 5C5IA 3PYLA 3TZKA 5L45A 5DP1A 1RYEA 2BH9A 1FDWA 2P2SA 4AFNA 2NADA 1GV0A 3QWAA 2V6MA 4DXHA 3OJEA 5TJHA 1CRWG 1RPNA 2I9PA 4N5LA 1T2CA 1NPYA 4RF3A 4RVSA 8ADHA 4CV0A 2GN9A 3B1JA 5JYEA 4XIYA 1YOVB 3RCBA 1NM5A 2CSUA 3OF2A 4YJFB 3ZHBA 3B20A 1LC3A 1KVRA 5A4DA 4XYEA 1VL8A 1A4UA 4N54A 3VVCA 2C29D 3T7EA 3LLVA 2X6TA 2CFCA 4FD3A 1XQ6A 3U0BA 4J2OA 1OMOA 4BNJA 3V2GA 3NDJA 1PS0A 4AJ2A 3UICA 4NFSA 2BFPA 3RUAA 1BXGA 2OUIA 5CDUA 4KUEA 3U49A 4YAKA 1B2LA 1VJ1A 1Q7CA 3OQ6A 2BFMA 2C2YA 3QW2A 2I76A 4IINA 3W4IA 3OA2A 2IEBA 2WD8A 2C59A 4OKIA 5I7SA 5JNLA 1WW8A 3BMNA 5DOZA 3UFXA 2BMAA 5KNLA 1U28A 2P9CA 3GGGA 1AHHA 2DT5A 1VRWA 1EDZA 4DIOA 1KVUA 1UJMA 5GZ6A 5KIAA 1R6DA 2W2LA 3DZKA 5FI5A 5CG1A 5IDQA 3Q3CA 1SZJG 1U5AA 2GZ3A 4IUYA 1V8BA 4YAGA 1L7DA 1X0VA 5A5EA 1ADFA 4BOYA 3P5SA 2VWQA 1ENPA 4JBHA 4MO2A 1BXGB 1LI4A 4PCVA 3KLMX 4CM6A 3DEYX 3ZWBA 3KLPX 2VOJA 1LC0A 1SOVA 1ISHA 1V35A 1NVGA 1KEPA 1S7CA 3ASUA 3VPHA 4O1MA 3COSA 1HRDA 5G4KB 4K9DA 3FWNA 2XAAA 2E4AA 1N92A 3ON5A 1YQXA 1NFFA 3GHYA 4M55A 1SEPA 4U6QA 5ER6A 3S2EA 3TF5A 1I24A 5G0WA 2Q1UA 3L9WA 3MJVA 3AI1A 2YJZA 1HE3A 1LU9A 1GR0A 2CDCA 1LQTA 4Y98A 3PJDA 1PJ4A 1DSSG 4CUKA 4YT2A 4IS2A 5HRUA 1M6HA 2FN7A 2GLXA 1PQWA 1Z74A 4RQTA 4ZQHA 3WBBA 3OM9A 3Q2KA 3MCVA 1I3KA 4DQXA 3GT0A 5F1OA 1MA0A 1ZFNA 5T67A 2PWZA 2JFHA 2VNSA 4B4OA 4BNMA 1P74A 5BSGA 1NQTA 2BRUA 3NT4A 3LC7O 4O5OA 4RLSA 2CNBA 3KB6A 4YWJA 4ZQGA 2GR9A 5JDCA 3DHNA 3NRCA 3OMLA 4R5HA 2BD0A 3RBXA 4E30A 1A72A 1QR6A 3QJ5A 1HEUA 1EK6A 1I33A 4GX5A 5IZCA 4Y8VA 4JN6B 4EJ0A 3FSRA 1F12A 2QRLA 4MJLA 4D42A 4IDDA 1UXGA 4BHTA 3U5TA 3DFUA 2YQ5A 2RCYA 3DMTA 5KCZA 4XKJA 3GEDA 1MXFA 2RHCA 4A73A 4E32A 4R5MA 3ROQA 4EDFA 4LCEA 2X5JO 4BNFA 4PGFA 4WK6A 1RM3A 5HS6A 4YAEA 4NHEA 2NU8A 3PHLA 3T7CA 3WLEA 4PG8A 1HSZA 4KWIA 1B8VA 5TGDA 3D1LA 3O26A 1PJCA 2P5UA 3L9XA 2UV8A 3RUDA 3WSVA 4CM4A 2C54A 1B3RA 3V8BA 3GQVA 1BDBA 1E3WB 4U8GA 5CG2A 4JROA 1U1IA 2JHFA 4TRMA 4O63O 2VQ3A 2JKVA 3E9NA 2O4UX 1WNTA 3LDHA 4FFOA 4J16A 4AJPA 1ZK1A 1NAIA 1E3EA 3L6OO 1W4ZA 3TJRA 3TN7A 1BWSA 1DIBA 2E37A 4MVJP 4WPGA 4EGFA 1I2ZA 5BNFA 3NJ4A 1PZGA 4ZA2A 4YJDA 3S1LA 3TZ6A 3VOSA 1HYHA 1KVSA 5JC8A 1VLLA 1PGPA 4E5PA 3V1UA 1P1FA 1E5QA 1QORA 1YL7A 4CM4B 5C3MA 2OP1A 3ULKA 3LSYA 4DREA 4C4OA 4W7IA 3DZIA 4LMPA 4XYMA 4TROA 4WEQA 3RC9A 1BW9A 2FSSA 5TIIA 1E7MA 2AQIA 4QXMA 3S2GA 4E5KA 4DTIA 4KQXA 3U4IA 3INRA 4BNYA 5EERA 3UAGA 1HF3A 4YCAA 4B7UA 1PR9A 4CQMB 4D45A 4J2HA 1DEHA 4BO5A 2P68A 1JAYA 1JTVA 3ADOA 3ITDA 3QA9A 4ID9A 4XQCA 5A3VA 1Z6ZA 3HG7A 4Q3BA 5I7VA 4UEOA 4OXKA 1E6WA 3D64A 1EMDA 1DIGA 2R2GA 4YAIA 1WAMA 1JKJA 1XG5A 1ADBA 4IQGA 2GN4A 4F46A 1Y7TA 1G0OA 1QMGA 3FCOA 3I23A 4UULA 2NV6A 4CL8A 5C7IO 3LU1A 4BNGA 1QV7A 3IAHA 4MDHA 1GUFA 4RCVA 1XLTA 4C7JA 3H2ZA 4TZTA 1PQUA 4CQMD 2W4QA 4E33A 2PD4A 1AGNA 2WYUA 1G1AA 3PRJA 3GMDA 1DJNA 3EC7A 2AEMA 3OH8A 4UVHA 4J49A 2A94A 1IUKA 4HKTA 4YVFA 2EV9A 2ZATA 1YJ8A 1J4AA 4PLGA 1V0JA 1MB4A 2EJWA 1BGVA 2YHUA 1XDWA 1LLDA 1R12A 4BS9A 3IP1A 2VYVD 2B69A 5IAAA 4XCVA 3JQ8A 2P91A 4E2WA 3STHA 1FXSA 1BRMA 4ZRNA 4OXNA 3H9JA 4RPLA 2CF5A 3F1LA 3ITKA 3V1YA 2VUUA 1JAXA 4Q3NA 3KSZO 1NWHA 2PGJA 3DZHA 5GY7A 4KTVE 4HX5A 1BTOA 1GL3A 5TT0A 2NNLD 3AOEA 4FFLA 4RGBA 3UHAA 1ZXBA 4G65A 3OFSA 4ALMA 2XXJA 2Y1OA 3ADPA 3CE6A 4PZCA 5TNXA 4RLHA 4ALKA 2EERA 1U3WA 3JSAA 3KSDO 4UUOA 3RBZA 3RVDA 3Q11A 1J49A 2P4QA 1G6KA 1UDBA 3HDYA 4E2YA 2Q99A 2Q1TA 2POQX 1VKOA 2A92A 5DT9A 5KVSA 4BNKA 4P38A 2BFOA 1MFZA 1V6AA 3A4VA 4N5NA 5AVOA 3PHGA 4RZHA 1EVJA 5A02A 4WECA 3SLGA 4O0LA 5DN9A 3C8MA 4EW6A 4IDEA 2C5EA 1JLLA 3RASA 2FMUA 1DFGA 1FDVA 4JJIA 2DTXA 1K6XA 3WLFA 1YB5A 1MXHA 4CR7A 3D3WB 1ZK2A 1H2HA 1NVMB 2X5OA 4EJMA 1PS8A 1ZSNA 2BHLA 2GO1A 4DWVA 5MGBA 1WLYA 1T1SA 1IPFA 1P33A 2IRWA 1ZJZA 3H5NA 1I3LA 3IKTA 3U4CA 5HM8A 2Q46A 3DOJA 4YJFA 5JAQA 3IP3A 4RPHA 5KVCA 4LRTB 4MVJG 3WGTA 1YBAA 5KJEA 1Y5RA 5BNTA 1DBVO 1DOHA 3ETDA 1DC5A 1PR3A 3ZWVA 4AL4A 3DZGA 1TLTA 1R0KA 4G5HA 4N18A 1HE4A 5TJ9A 4ZN6A 1Y81A 3VKVA 4HFJA 4CMIA 3DAPA 3SLKA 2QZ9A 3SX2A 2YW9A 1B7GO 2PD3A 4YT4A 2JCYA 4GSLA 3L4SO 1YKFA 3GDFA 4YQZA 2ZTUA 3PWZA 1O95A 1U8FO 4GH5A 2TMDA 4WLVA 3O8QB 3GFGA 1IOLA 3NGLA 5EESA 5THKA 4FN4A 1EZ4A 2CVOA 1KC1A 3GDGA 4XJTA 8LDHA 1LRLA 3AJRA 3QQPA 5TC4A 2HRBA 2D4AA 3ANNA 3ZV3A 3EK2A 3R3SA 4YEDA 4U0KA 5B1YA 5ENDA 4GVLA 1O0SA 3NTQA 4XDYA 3AK4A 5KJ1A 1HDGO 2DBRA 4MP6A 3G17A 3VHRA 4L0QA 4CMIB 1QYVA 3K96A 3ROKA 4ZGWA 4GI2A 2E6UX 4Q9NA 2PKQO 4UVDA 2PH3A 3FPLA 4FOSA 2NACA 2HDHA 3VDRA 1UZMA 2PGLA 2C0CA 4QTZA 4FGWA 3PFFA 3NTOA 3PVZA 4BIIA 3PTZA 3TSCA 3TZHA 1ZMTA 3BXXA 4XDZA 3VZQA 3PJGA 3CIFA 2WTBA 1SO8A 2WD7A 4TZKA 3HZZA 1NP3A 1PZHA 4ZD6A 1B8PA 1G0NA 4YJHA 3ZWAA 1DC3A 1EQUA 1YVEI 2B36A 1LDYA 1ZSVA 4OQZA 3JQCA 4X54A 3E5RA 1ISGA 3TZQA 1ZCJA 2Q50A 2FR8A 1BG6A 2O2SA 4CL3A 4LMRA 4ND2A 4M54A 4R1UA 1DB3A 4L74A 3RROA 5GMOA 3M1AA 2FPGA 1C0LA 1X13A 3FNEA 3LC1O 4Z9XA 1KC3A 3JQGA 5DP2A 2QG4A 4YYZA 1ENYA 4J6FA 1F14A 3BZUA 3HFGA 2EGGA 5K9ZA 1ID1A 4OOFA 3KYBA 4JBIA 4JJFA 4WE3A 3GLQA 3H2SA 3GVHA 4KUHA 1EQ2A 5I8ZA 1XEAA 1I8TA 3HHPA 5IDYA 3AU8A 1RM4A 4WKGA 3QLJA 1XGKA 3RUCA 3B6ZA 1ZNQO 4DYVA 4PRLA 1ADCA 4RVDA 5AXAA 2Z95A 1N1GA 4MIEA 2WE7A 4R1SA 4W6ZA 3DFZA 1V3VA 3WNQA 3UKOA 3GNQA 3VAZA 3FTNA 4DL9A 3PI7A 4CM7A 1PWZA 3O38A 4BB6A 3QWHA 3BMOB 3JQGB 3OSUA 4P22A 2YDYA 2ZYAA 4NBRA 3M2PA 3I3OA 3I9KA 1YDWA 1U3UA 3SC6A 1KVQA 4Y67A 3N58A 1QXSA 2YY7A 2X4GA 4Z0TA 3WICA 3KV3O 1S6YA 2PNFA 3WGHA 2AEJA 4J4BA 2JL1A 4M1QA 4XGNA 4BO0A 1R4NA 3JQEA 4U7WA 2DFVA 3JQBA 3W8DA 4B4UA 3IC5A 2GDZA 3DBRA 4MIYA 2HO5A 1XSEA 2EKLA 3DMTC 3MJSA 2P9GA 4FJ2A 1ISJA 2OXIA 1U2GA 2IYPA 2Q2VA 2ZIZA 2LDXA 1PZEA 3B1FA 2D3TA 1R4MB 3JQ7B 2W90A 1UP6A 5JFOA 1LA2A 2C07A 2VHYA 1IULA 2A4KA 1FMCA 1NYTA 4N5MA 4Z0PA 2E49A 3C1AA 1M67A 1PWXA 1LDGA 1GTMA 1QYXA 3GAZA 4RF5A 2UYYA 3QVTA 1OZAA 1W0CA 2D5CA 3R0IA 1PL8A 4R54A 4M8SA 1ULSA 3ZWWA 3RFXA 1K2WA 2TMGA 1DIHA 2YV3A 1GQ2A 4OO3A 2VUTA 3W4KA 4B3IA 4M89A 2UAGA 1F06A 3RKUA 4NJOA 2DM6A 4GMFA 3KHUA 4E5NA 3F46A 1EEHA 5JCJA 4DPLA 1NTOA 4MKRA 2E48A 3JD0A 4GWGA 1YB1A 3VPFA 1AHIA 3ZNOA 3R1IA 3D4NA 3OEWA 4AJJA 1VL6A 2CDAA 1PQPA 1XELA 3BTUA 5IFLA 2GCGA 2X9NA 3QVSA 1H6CA 2EP7A 3L0DA 2C2XA 2ZQYA 4FOOA 3SC4A 4HFNA 1DRUA 2DAPA 2EP5A 2QYTA 3PYXA 2NUAA 4XR4A 4D0RA 2H1SA 5JY6A 1OAAA 1O6ZA 2ZB3A 2IZZA 3I6IA 4CUZA 4PFJA 2FOIA 4GGOA 4BKRA 4EUHA 1NHGA 1EBUA 2HK9A 5A9RA 1E7QA 3F47A 1XR3A 4WLEA 5IN4A 1PZFA 4BKUA 2GGSA 1W6UA 2CUKA 1YE3A 4NU6A 3W8EA 4ZQEA 2NSDA 4Q3EA 1EE9A 2I99A 4MVJD 3TQHA 2FR0A 4DLBA 4YACA 4A27A 3E03A 2GD1O 4ND5A 3TOZA 3GPDG 3WXBA 4ZU3A 4M87A 4ND4A 1N7GA 2JD2A 1IHXA 5T57A 4EZBA 1UZNA 4B8ZA 4I1IA 2NWQA 2CZCA 3KYDA 2SCUA 5ENVA 3ORFA 1SB8A 3N74A 2YHIB 3G1TA 5L51A 1BVUA 2ZCVA 4FSHA 1DRWA 2WSBA 2Y0EA 5A05A 2O48X 4MVJM 1NX6A 4WCFC 2OL4A 1LX6A 4WCFA 4CLHA 1BVRA 3HE3A 4E6PA 2EW2A 1VM6A 3HNPA 3OJ0A 2PR2A 1I10A 1V9LA 4LSWA 1I30A 2YDXA 3GNTA 5AXCA 1LEHA 3VH1A 2PY6A 3RUHA 3CZMA 4O6VA 1Q0QA 1F8FA 1A7AA 3AUUA 4QO8A 1LQUA 5ES3A 2W8ZA 4OAQA 4TSKA 1GEEA 2J5RA 4RV9A 1LXCA 4NBTA 1C1XB 1GU7A 5I9LA 1XHLA 2CD9A 1BHSA 2GZ2A 5HS4A 4NJMB 2QW8A 2X8LA 2X7HA 3DHEA 3ENNA 4YDRA 4K26A 3FR8A 2OBNA 4GX1A 1XIVA 4BNTA 1FK8A 4CUJA 4ESOA 4XIJA 5U1PA 4EEXA 1KY4A 3WGGA 4RQUA 3BMQB 4CMEC 2EEZA 4R3NA 4XYGA 2HQ1A 5F3RA 3GA0A 3PLRA 3LVFO 4BO1A 3DB2A 1E7SA 2OP0A 1ZSYA 4FJ0A 3WDSA 5JPIA 3DQPA 2OFPA 4IPTA 3I4FA 1HTBA 5FF9A 3FRJA 4GKVA 3OJLA 2EF1A 3RUEA 4ND3A 1UXJA 3H4VA 3S2IA 2WYVA 1C1XA 4FS3A 4PLZA 4HUJA 2IODA 2Q2WA 5COQA 3TL3A 1R0SA 4RVGA 1FDUA 3VDQA 1F17A 2QRJA 1JN0A 3PWKA 5FWNA 4CPDA 1NR1A 1TA4A 4Q3DA 4DBVO 1K0UA 3S2FA 2ZB7A 1NPDA 4OYRA 3PHIA 2Y1CA 1A9YA 3PDJA 3KRTA 4A26A 1CF2O 1P1RA 3VZPA 2JAHA 5KTKA 1FDTA 2I3GA 3LF2A 1JVBA 3DTYA 3ZHZA 4TQGA 3VH3A 4J43A 1HDXA 1R37A 4NG5A 1PJQA 3CSDA 2AXQA 1Y1PA 1HZZA 1D1TA 1NBOA 1HLDA 1WMAA 5A03A 3MJ4A 1SBYA 3I5MA 4IDGA 1EVZA 5G4KA 3JQAB 3K8ZA 3D0OA 3RFVA 3IUSA 3CUKA 4IQ0A 3PXXA 5T64A 2HKIA 5FEUA 4Q39A 2HU2A 2CF6A 1TEHA 4WOJA 1HLPA 3AY3A 3ZNPA 2NQ8A 1SOWA 1WZEA 4MP3A 3H9UA 1RM5A 5CAEA 1FF9A 4PLHA 5CDYA 4NH4A 2VZ9A 1X1TA 3RAJA 2Y05A 2QIOA 3O9ZA 2QYSA 4GMGA 2EXXA 3MJEA 1UP4A 3L07A 4RPKA 3EY4A 3PZRA 1ZW1A 4TMFA 4CR8A 3JQAA 3WGOA 4II3A 3WFIA 2I66A 1E1NA 3JYQA 3PGJA 3QIVA 4YJHB 9LDBA 3IKVA 5LCXA 4XWYA 1UXHA 3HFSA 1P1HA 2OOSA 2NU9A 5TS3A 1HDYA 1KS9A 4RVUA 4TVBA 2FPIA 3CMCO 5K6AA 3C85A 1R0LA 2FZWA 3E48A 2IXBA 1KEWA 3L6DA 5DCWA 3NGXA 3WR5A 1H6BA 1MX3A 2OO5A 4E12A 1E3JA 4EUEA 1UAYA 3ANMA 3G3EA 4RF2A 9LDTA 1Z73A 1J0XO 1ZUD1 2VZ8A 4KOAA 3TFQA 4ALNA 1Y5MA 2X9VA 4J7XA 4BQRA 2GZ1A 4DGSA 1EE2A 5I7FA 4DLAA 4IXWA 5I9NA 1DLIA 3K73O 4XQEA 2G82A 1E7YA 3WIEA 1ARZA 3RSHA 2H5LA 4BNVA 1HDCA 3DBHA 4J9UE 3ZH2A 3C7AA 4QQRA 5DULA 4JJGA 4EEZA 5ICSA 4D44A 3O4RA 3PJFA 1PS9A 5FFFA 5THQA 1T1RA 2R6JA 4RZIA 2EGHA 1LLQA 3TL2A 5EN4A 4BVAA 4LCJA 1LNQA 4XJSA 1E3IA 5A9SB 5IXSA 3GN1A 4IMRA 4BNZA 2AE2A 4MINA 3L77A 1DO8A 1E7RA 4WNIA 1V3TA 4J91A 4I5FA 4NBUA 4NDNE 1VI2A 2EHDA 3QVWA 4HADA 3JD1A 4JLWA 3PHHA 1YS4A 2XF8A 5KKCA 1E77A 1CERA 1F8GA 1OFGA 1M6WA 2FR1A 2H6EA 4KDFA 4XB1A 4DA9A 5ITVA 1JVSA 5HBRA 1PGJA 4R4JA 4BNLA 1ONOA 3D5TA 3ONDA 3DBHB 2GYYA 3UCFA 3S55A 4B3HA 3N7UA 5C7LO 1QP8A 3PZBA 3CKYA 3DO5A 5T5QA 5EMHA 4IY1A 4XX0A 1H2BA 3E5MA 2ZQZA 4L4RA 5JCXA 2Y1DA 1N7HA 3I52A 5AXDA 3WJ7A 5A9SA 3I6QA 3TWOA 3WBFA 4CMBA 4FBGA 5HWSA 5ADHA 5CEFA 2X0NA 4S1VA 4FC6A 1SB9A 1TXGA 2JCXA 1CYDA 2O7QA 1ZZEA 1Y8QA 4AJIA 4WCDA 5T6BA 3CZRA 4DVJA 2YUTA 3JYNA 4P4GA 5L3ZA 1V3UA 4L4SA 3JYOA 4DUPA 3R6DA 3WWZA 1Q7GA 2O23A 1U2DA 4NFYA 1GAEO 2DU8A 4K6CA 3WOHA 4BO3A 4FFRA 3GN2A 3OECA 4EBFA 2CY0A 4IQ8A 3ROPA 3AI2A 3KEQA 1EUCA 3GMSA 1QLJA 4AICA 4E5MA 3PLNA 1WMBA 1A71A 3K9QO 4XB2A 3VVBA 2PZKA 3OBBA 3PK0A 1YWGO 1MLDA 4A2CA 1PX0A 1P45A 1CIVA 3Q1LA 2BF7A 4JP3A 5HA5A 3BTVA 2EW8A 1GPJA 3K5PA 3RC7A 3KOUA 5DDIP 3WB9A 2Y0CA 1MG5A 1EFLA 1K3TA 1NNUA 1ZEJA 2O4CA 3MEQA 5G0UA 4BNHA 4CV2A 3P2YA 3KYCB 4TKLA 1NASA 3ZV5A 3JQ8B 4JBGA 3KSUA 4JQCA 1SPXA 3FBGA 1PEDA 2BELA 2BFAA 2NTJA 3EW7A 5B37A 4OSOA 3NX4A 1X7DA 1P0FA 5JS6A 1Y6JA 3FBTA 4GX0A 4PG5A 1M2WA 4G2NA 1ZK0A 2B4QA 4OXYA 5JLAA 3JQ9C 2VHVA 4UEKA 1NR7A 5C37A 2IYOA 4R41A 1LDBA 4EI2A 1NQAO 3GVPA 4GLLA 3F6YA 4B4VA 1LSJA 2J5KA 4L9RA 6LDHA 3FNGA 1YOVA 4OOEA 2DPGA 4W9NC 3HADA 1KEUA 1AUPA 4B4WA 2VYVA 3NYWA 3ZU2A 4CLOB 3UUWA 3QP9A 2Q4EA 5JMWA 4RVFA 3OQBA 1LRJA 4R69A 4Z9FA 4YTEA 2X1HA 3PP8A 4AJLA 1HETA 1T4BA 4J1QA 3D4OA 3DXFA 4ND1A 2HMSA 3RJ5A 3H3JA 5K0ZA 2W2KA 2GNAA 2WWRA 4WJZA 2Y93A 4FW8A 3VH2A 2D0IA 1KBZA 1DFHA 3PIIA 3ZDFA 1DHTA 2AA3A 4OKNA 3VKUA 2WE8A 1Q0LA 4I9NA 3C1TA 3LLSA 1Y9AA 4FB5A 3F5SA 3NDRA 4H7PA 4I9HA 4BMSA 4KZPA 1NQOA 1I36A 5LDHA 1GYRA 1ISIA 2IZ0A 1UUFA 3JQ6A 3AM4A 4S3MA 1XA0A 4J7CA 4XZ3A 3RIHA 3WGYA 2AQHA 2BI7A 4DMMA 4QUKA 1DIAA 4IJWA 2GPTA 3RI3A 4RJTA 2DLDA 1WVGA 4B79A 4NBVA 5H82A 4NIMA 4YPOA 2OBYA 3ZN2A 1N1EA 4JP2A 5KVQA 3L4BA 1MC5A 5JO9A 1J5PA 3GVXA 1X7HA 1KOLA 2OHXA 5CDSA 3TOXA 4DIFA 2EJVA 2Z1MA 3F9IA 4FR5A 2OORA 1JDJA 3PWSA 1X0XA 4AJHA 2RHRA 3DBLB 3BHIA 4OMUA 5I9MA 1T2FA 2NU6A 4XRRA 5DBFA 2EKPA 5G0TA 3EZLA 3PFWO 2D8AA 3R3JA 1NXQA 3ASVA 1O8CA 3OHSX 1I3MA 2DC1A 1LDEA 1PU2A 3AFMA 3Q0EA 3CPSA 2VUSA 3DDNA 4Z6KA 4BO2A 1X14A 3OJFA 1HDRA 2JHGA 1VC2A 5G4LA 5L53A 4MOWA 3A1NA 3P2OA 3ZCXA 3PQFA 3ICCA 4ZQBA 1HT0A 2VRBA 1JA9A 2NM0A 1B0AA 2C82A 2QQ5A 1UR5A 2WMDA 3K31A 3WMXA 2XXBA 5TT1A 3WG9A 3GZNB 2O2YA 1IY8A 5H83A 3VZRA 1Z45A 2CDBA 2VHWA 4ALIA 4YR9A 1Q1NA 2Y66A 1T2AA 2B5WA 4ONEA 1QV6A 2VT2A 3BMNB 3PJEA 3V2UA 5ER9A 5EQFA 4BUCA 2VRCD 4JX8A 4AJ4A 4EITA 2GSDA 4YQYA 5JBIA 1H9AA 4PVDA 4AVYA 2FSVA 1JKFA 1Q7BA 3JYLA 1UXIA 2IDZA 4E13A 1PGQA 1C0KA 1Z75A 5CPFA 3GVCA 1T4DA 3AY6A 2D59A 1HE2A 4XEHA 2Q4BA 1T26A 3H9GA 4IZIA 2V6BA 3GZNA 4QEDA 3ZHXA 2O50A 5IF3A 4W9NA 1ISMA 4YT8A 4XGKA 4BKQA 1MFPA 2DBVO 1ML3A 3A06A 2RBEA 1E3WA 1VSVA 4QT0A 3E18A 2JFFA 3LT0A 5CEEA 3OETA 3L6EA 2C7VA 2FP4A 5JDIC 2ZTLA 3X2EA 4QX6A 4CMHA 1FJHA 2X0IA 3JQFC 1DLJA 1EUZA 3DAGA 2J6IA 2PKQP 4HY3A 3ZWNA 1P9LA 3VTZA 3WTCA 2O3UA 1DXYA 3CXRA 1PSDA 3F5QA 4XR9A 5JW6A 3ZU3A 2FHSA 2GASA 4LK3A 4E2ZA 1YQDA 3UCXA 4RDHA 3UGKA 2HK8A 5DBGA 3IDSA 3RJ9A 1C0PA 4J90A 1YO6A 1A9ZA 1GYQA 1C14A 3W1VA 1OC4A 1XQ1A 3F1KA 1YGYA 4Q3CA 4RPJA 4R01A 4D0SA 4YRBA 4B8WA 2G17A 1NAHA 2RAFA 1QLHA 1PGOA 4UVEA 2IZ1A 3IS3A 4HP8A 4PLYA 4PIVA 4BMNA 2X0JA 2OGUA 2ZK7A 2RH4A 2FWMX 4J4TA 4PN3A 3UH1A 3DBRB 1N2SA 4NBWA 4PLPA 4F6LA 3GDOA 1ONNA 4D3FA 4NK4A 1KVTA 1P1KA 3OIDA 3EMKA 3KM0A 4D3SA 2IE0A 4TRJA 4C7KA 1Y8RA 2VNAA 1L1FA 3ONEA 3SBOA 1GZ6A 3AUAA 1LSUA 3E82A 4EJ6A 5CEJA 4DPKA 1RYDA 1U7TA 3KZVA 3TRIA 5CDGA 1XU9A 1OC2A 4E21A 2VYNA 1PJTA 4DIBA 3LYLA 2BGLA 1EFKA 3Q2IA 4MP8A 3FWZA 1GV1A 1TVEA 3W8FA 3TFOA 3ZU4A 2Y1FA 1PJBA 1GFSA 1E1MA 2A35A 2DBQA 1SCUA 1AXGA 1TT5A 1P1IA 3QWFA 4OM8A 5KVVA 4GPD1 3ETEA 3IUPA 3CH6A 4R68A 4W4TA 3SEFA 7MDHA 3LF1A 1ISFA 1P77A 4NMHA 3EVNA 3BAZA 4UVIA 4XYBA 2G5CA 1NQ5A 2D5AA 5LC1A 1EBFA 1ZJYA 4BO6A 4Z0HO 4YAJA 5A9TA 1U8XX 3INGA 3MOGA 3KO8A 4OIMA 4UUPA 4BNIA 5CFZA 3I9JA 3F4BA 5JC1A 4DBZA 4P8RA 3I1JA 4F45A 1DIRA 5H81A 3HWRA 4JK3A 5K6AC 1BW9B 1VJTA 4BNWA 4KQWA 5DCUA 4IJVA 1XU7A 1MP0A 5BT9A 3IMFA 4NPCA 3ZWMA 1U3TA 3H65A 4IGFA 3HDHA 4FDAA 5I7EA 1BDMA 2FRDA 5BR7A 4Q3AA 2HUNA 3ROMA 4F3YA 1AXEA 3H3FA 2VWPA 1O94A 2H63A 5L95A 1UAGA 4BO7A 4DQUA 1LUAA 3MOIA 1DRVA 3HB4X 3K2BA 4LSMA 1KEVA 4L8VA 2OZPA 3V1TC 5JE8A 2Y0DA 5DOVA 3QHAA 5BQFA 4H16A 5A5FA 3WTBA 3M1LA 3NT5A 4J1NA 4E0BA 2X5KO 3U4HA 3DOOA 1YRLA 3MWDB 4J7UA 4WCFB 4AJ1A 1MV8A 4BMVA 2J3HA 4I5GA 2GERA 5BSHA 1K6JA 2VHXA 1O9BA 3QV1A 2J5QA 3BYZA 3EYWA 3H5AA 3JV7A 3ZV4A 1X15A 3GHHA 3D3WA 2OMEA 4GQAA 4CMAA 2V6GA 1NFQA 2AHRA 4AJOA 2CVZA 4WUVA 4P4NA 4D79A 4GWKA 2JAPA 2NU7A 3U9LA 3Q6IA 1YB4A 2EKQA 4TVOA 4XQGA 1M75A 3GR6A 6ADHA 5TRTA 5GZ3A 3K92A 3H5RA 3MTJA 5HTOA 3DMYA 4NJMA 4OSPA 5ILOA 1SAYA 2VZ0A 1EUDA 1UXKA 3INTA 1H6AA 3NJ8A 4BGUA 1KETA 3TNLA 2ZTMA 2VOEA 3JD3A 4A5OA 4ROSA 3OIGA 1PJSA 4UUNA 4I8XA 3D7LA 3L4BC 4CLOA 2B4TO 3BTSA 2PFGA 2ZJ0A 1WP4A 3EDMA 4BKOA 5JO0A 2Y67A 3ANLA 4O59O 2PA3A 2BKAA 3UXYA 1VKNA 3GZ4A 3DBVO 4GL4A 4KTTE 2O3RA 3B70A 1QYWA 3GH3A 5JDCC 2VRCA 2VCYA 3EGOA 2VN8A 4ZHSA 1EK5A 5F1PA 1P1JA 3GAFA 3ZWXA 3E1KA 3ZW8A 4WNCA 3WS7A 3GG2A 2X0RA 4TRRA 2O7SA 1B26A 5L7YA 1MGOA 4CQLB 4UUMA 3ETGA 4IJUA 2JD0A 1P0CA 2HRZA 4II2A 4OGWA 4WOKA 3RFTA 4F6CA 4HV4A 3HJAA 5AYVA 4WLUA 4U5QA 4CMEA 5BNIA 4IDAA 4EUFA 4U0JA 3AWDA 3JTMA 3CINA 2UUPA 2Z1NA 3DR3A 1H6DA 4I08A 4KP7A 3IL2A 3HB5X 1C0IA 4NR0A 4Z3DA 2AG5A 2B37A 5TLSA 3K30A 4CM8A 1N8KA 5KJFA 3O03A 1T2EA 2DTDA 2PK3A 4IXTA 4WLNA 2G0TA 3LK7A 3HDQA 3G0OA 3GFBA 3DBLA 3LC2O 1P3DA 2WEKA 1IL0A 3DHYA 3VPSA 4CMJA 4UREA 1SNYA 4XGIA 3A9WA 3KTDA 3KVOA 4CQLA 1JWAB 2X22A 2E82A 3P7MA 2LDBA 4Y6RA 3IQDB 3A28A 1GY8A 2XOXA 1YXMA 3PEFA 3QE3A 4YRAA 1DDOA 1U4OA 2X9GA 3DL2A 1I0ZA 1B3BA 3PGXA 1U3VA 3GUYA 4BQPA 4LVCA 4K6FA 4R3WA 1ZH8A 3WNVA 4ZRMA 3ZV6A 1I5RA 4KDEA 4N7RA 3C7CB 5IN5A 4ILKA 1IZ0A 5DF1A 3D5QA 5EJ2A 3O8QA 4UVGA 2Y1EA 2ZJ1A 3ZNQA 1HE5A 1SC6A 5CPBA 4QFCA 4WASA 2PZLA 3QVOA 3RU9A 3GRKA 2B4RO 3LQFA 4EYEA 1IZ9A 4ZQFA 3NAQA 4J9VA 4M86A 5DZSA 2AQKA 4PLVA 3AFNA 2NTNA 2UUOA 3F3SA 4PG6A 4UAGA 4J0FA 3WGQA 2Q49A 4CM5A 3S8MA 2UVDA 3ABIA 2HLPA 4FFPA 4B3JA 1GD1O 4PVCA 2DFDA 4L76A 4PRKA 1HKUA 3VPGA 1O89A 1E1KA 4IIVA 3WSWA 2PD6A 3HSKA 4K28A 4H3VA 4R51A 5EQDA 3C7DB 4A0SA 2PZJA 4Z3KA 1EVIA 2VWGA 3FR7A 4MVJH 3RBVA 4AJKA 5L9AA 3ZU5A 4AG3A 3VH4A 1OBFO 3HN2A 4HXYA 1H5QA 2D1YA 1WDMA 1LLCA 2NVUA 2WD7B 2WM3A 1ZMOA 1IB6A 1M76A 1HSOA 2BGMA 3U62A 4CM3A 3ENKA 5CHEA 3ZZNA 3RD5A 1QSGA 5DBIA 1GPDG 1R4NB 3W6ZA 1R15A 2I3AA 2Q45A 5A06A 3HQ4O 4A10A 2FPPA 2FZEA 3DC2A 4PLFA 4XRGA 4QECA 2G1UA 2ZCUA 3NTRA 4IIUA 5F1KA 3RQSA 4D7AA 1JW9B 1YL5A 3JD4A 1HWYA 1HZJA 3GK3A 3FN4A 4E4YA 3QWBA 3JQ7A 4JNKA 4GVXA 3LT4A 1K5HA 5ITWA 2QZZA 1U9JA 3DZFA 3GUCA 4B7CA 2I67A 3HDJA 2VWHA 3LZ6A 3I9MA 4E3ZA 3ZI0A 1D4FA 2RH8A 3PDUA 4JGBA 3UW3A 4K1LA 3SXPA 4HFRA 1LSSA 1WDLA 2NVUB 2ZYDA 1HDZA 2GF2A 4OQYA 3H9EO 2B35A 3NDIA 5EINA 5U4QA 3ST7A 3UOGA 4R16A 4JCOA 1A7KA 3SJUA 4D46A 1AE1A 2GUGA 3E9MA 2DUUA 1YBVA 1PL7A 5JAMA 1L7EA 3JQBC 1B14A 4E31A 3HN7A 1ZIDA 4KWHA 3AM3A 4G81A 1KYQA 1ULUA 1ENOA 2O3SA 3BHJA 1QKIA 2I65A 1PL6A 4FFMA 2BGKA 3BMOA 4TKMA 3EUWA 5G0VA 1WWKA 3K6JA 4DQVA 4R9SA 1ZK3A 4FGSA 3C1OA 3EAGA 3MJTA 1HL3A 3QRWA 2HK7A 3D3EA 4TWRA 5EPOA 3WYEA 3D4PA 2Q2QA 4DLLA 1A27A 1LLUA 1N9GA 4DRYA 4I5EA 2VHZA 3BA1A 2HJRA 1RM0A 3DTTA 2QHXA 1XKQA 2DVMA 3ICPA 2DBZA 4CM9A 4WLFA 3K2EA 3H6KA 4I9UA 3PHJA 5FYDA 5TQVA 3ZWYA 3H9QA 1HDOA 4NFHA 4FQ8A 4HFMA 1SMKA 1TT5B 2DPHA 1Q0HA 2JD1A 3IJRA 4A03A 5IDXA 4GBJA 1ENZA 1D1SA 5KOIA 2YQ4A 1X1EA 1GCOA 1RWBA 1K89A 5ILGA 3WMWA 4DC0A 1LSOA 3JD2A 5EIOA 3KYCA 4XQ9A 1U5CA 4YBZA 4H15A 1DPGA 2BI8A 2DKNA 2H9IA 4CLXA 5AXBA 3UVEA 2YFQA 1CDOA 3NUGA 3U3XA 2ZYGA 3IIEA 4PLCA 2YHIA 2P9EA 3GF4A 5JAZA 4GGPA 3KETA 1XYGA 1N9GB 1YDEA 2PLAA 1ZO8A 1EDOA 1GZ3A 1CJCA 2NLOA 1FDSA 1I32A 2J8ZA 3NKLA 1EVYA 4FFNA 4TRNA 3DONA 5L4SA 1E1LA 4GKBA 2P5YA 4CLRA 2VTDA 1YJQA 3LT2A 3PIDA 1YBMA 5IXYA 2GN6A 3E9QA 4IDCA 4D41A 1CETA 4IM7A 3H7AA 5KJCA 1K6IA 3I83A 3RC2A 4ZVVA 1RKXA 3DOCA 4BNXA 2NQTA 1CQJA 3ZWCA 2O3TA 1NFRA 3NEPX 1QG6A 4YRDA 1I01A 2PV7A 3NV9A 4OHUA 4CJXA 1BMDA 5G2OA 1SEVA 4INAA 1DFIA 4PZEA 2YFHA 4IJKA 1WXDA 3ZGYA 1NPTO 1T24A 1C1DB 1ZXLA 2AMFA 4CLRB 2V7PA 1DC4A 1A4IA 3RC1A 4LRSB 2Q1WA 2W2KB 1IYZA 4U6SA 3H8VA 4PG7A 1UP7A 3E8XA 4MKXA 2J3IA 2W98A 4BV8A 1GDHA 5TF4A 1ZVMA 4XD2A 1DAOA 3UCEA 3FPCA 3G1UA 1MUUA 2EG9A 3JCZA 4CV3A 2HSDA 4W82A 2X23A 3VPXA 2NTVA 1ZK4A 1YQGA 2PKRA 3AUSA 3BIOA 3KYDB 3VTFA 5A1TA 5J23A 1P44A 1LDMA 4BKPA 1GCUA 3MWEB 1ZEMA 4XA8A 3F4LA 2GRAA 1I2BA 1CWUA 1QYDA 3U09A 3AI3A 3VZSA 3QSGA 1U7HA 3JYPA 2IEDA 3EHEA 1GEGA 3GRPA
chains in the Genus database with same CATH superfamily
1DHRA 3SHWA 3MHPA 2O0JA 4DEVA 4QAJA 2WRZA 5CLGA 5CVEA 4ENSA 3DHWC 3TBHA 2AG0A 5IAOA 2Y9PB 1KJIA 3UK6A 5AMXA 2R4QA 4QAQA 4M6WA 1V1RA 2GJ9A 3H5TA 2CL5A 2CUNA 3A9SA 2IYYA 3ZLTA 4XVUA 1Z7BA 1TA9A 3FI0A 2Q6TA 2C95A 1P9WA 3R4CA 1KI4A 1OPRA 2A86A 4PZLA 2OO3A 4TV9F 5B4UA 2HI0A 2ZEJA 2AW3A 2FSGA 1Q6ZA 2H11A 1NM5C 4J0EA 3RS4A 4C20A 1KERA 5C8YA 2JIDA 2ILTA 2O1XA 3G7UA 2MOKA 1XCBA 1H3FA 5CCDA 1FSSA 1RTKA 3DCIA 1WDKA 2ZR8A 3U80A 3MAJA 1SBHA 1NYQA 2CE2X 4LYGA 5KYUA 3UMBA 3C7TA 5I51A 2P69A 2P65A 2D0PB 5HF6A 3WLNA 1ADYA 2RB4A 2M1XA 3BMQA 3HVHA 1GTJ1 4XM1A 3A9RA 3E8SA 2WG2A 1T8WA 4YWHA 2AOXA 3WFJA 4E4TA 1E92A 2HF7A 3I5AA 1V7ZA 4Q4JB 2ZJ5A 3IOYA 2ZTVA 1AIPA 3BREA 2EL7A 1W4CA 3GLRA 2WFLA 1J8YF 1NWCA 1WZNA 1Q0UA 3FD8A 1HG0A 3RJZA 1U4SA 1L7MA 2IXAA 2XGMA 5IJZA 3V2HA 4YRTA 5IF9A 1N5DA 4OHYA 3FJOA 1E5DA 1LPAB 2HL6A 2JIPA 3PD1A 4JB8A 1FLAA 4WA8A 2BE9A 4GLOA 4N8EA 1CJKC 1O2DA 1VE9A 3F3YA 5KINB 3B8HA 2DGDA 1XMIA 2QORA 2GN2A 1J8MF 2JFQA 3MMPA 2I78A 4E1BA 3HM9A 1S2IA 3OO1A 3GROA 3TIXB 3RK4A 3RUIA 3JQFA 3PR1A 3FB4A 3QEKA 5F7OA 2AXPA 2ZJ4A 1ORIA 3LY9A 3KXDA 2PGXA 4LGVA 3SICE 1PG0A 1T0IA 3G9TA 2AKAB 3VV3A 3EXG2 4WMLA 1LTHR 2QRNA 5E6SB 3W4JA 1CULC 4CODB 3DWFA 1DS6A 1GP2A 2AN9A 3HEAA 4Y2HA 1G1MA 5EKDA 2KBFA 2OQRA 3VR6A 4YB8A 2HJSA 5COAA 4K46A 1RQRA 5AJZA 4RDIA 4MI3A 1VKZA 4ACAA 1XL0A 1IBRA 1DBPA 4TV8A 1QGYA 2I80A 4I5IA 4LKOA 2COUA 5IVKA 4RORA 2EIHA 3NNDA 4BFVA 3CRNA 3AILA 3LGSA 1C80A 4TLBA 1KF0A 4NDZA 2C9CA 3GPIA 3ENQA 5J4YA 1GFIA 5LA6F 4P36A 1J42A 2FP4B 1G60A 3OAAD 4Y9DA 1U94A 3QV2A 3CX8A 5D5HA 3WK7A 3UC9A 5BN3B 2A9KA 3RUFA 5L4NA 1JHDA 4OEHA 3UMJA 3M2TA 4D6YA 3V5NA 1XZMA 2Z43A 1W73A 3GQBB 1CDEA 4B2YA 2PX0A 1CUJA 5F21A 2FFJA 1UPTA 2O5VA 2BLLA 3ZKAA 5MN4A 3UJHA 4MR9A 1QIJA 3QU5A 2HUPA 3CTPA 5B12A 4I1PA 1F5SA 4B5LA 4JVOA 3WK8A 5BWCA 1K8ZB 3FTPA 5FPKA 1A5BB 4U02A 4I4IA 4IMPA 1KYVA 4NI5A 1FP1D 1W8DA 2DCMA 1RBYA 2R48A 2Y99A 4UDNA 1H0KA 2G5PA 5CB0A 2B0JA 4RIHA 2O9JA 1X7YB 3SEZA 4RGQA 1GIAA 1SKYB 1UPBA 2FUEA 2W11A 3H17A 4TMKA 4DT1A 3WAJA 2W22A 3W34A 4A82A 1SBQA 5A04A 3OQ1A 3O1LA 2IY8A 3W2EA 3FUXA 3H9BA 1SOUA 2YV1A 2LIVA 4KVFA 3WLQA 4AJEA 1DCKA 2GZHA 2WM2A 3RRYA 4DV2B 1JKMA 3MTDA 1FFBA 2AOTB 4E11A 5BN3A 4TWIA 2IPNA 4GO1A 4ZZ1A 2XWQA 2BM1A 3QVGA 1GGVA 1QE0A 2CMDA 2GD2A 4FFBB 4UHBA 2ZXUA 1YZVA 3PNLA 2RGEA 3VC3A 5DYGA 5J2UF 1M8JA 4R3UC 1GZVA 2V7TA 3A2LA 4WERA 3ZNNA 4R6XA 4MR9B 3T4EA 3JASA 2ACVA 1L7RA 1YONA 2GBFA 4BFSA 3EPJA 4PZDA 3DLCA 2F2TA 5CA0B 5CGZA 4GPAA 3PQ7A 1E32A 1OI2A 2ISQA 3GFRA 3IKMB 1E2PA 1AK1A 2IK8A 2QUKA 1HQDA 4YCBA 1ZIXA 1P2VA 2POCA 4F85A 2EFCB 4P4UA 5LQRA 4D9MA 2YCLA 1EXWA 1L5RA 4Y6PA 1DQYA 1KDPA 2PCJA 2GPJA 3Q9NA 4MVJA 3F9RA 4PZUA 1I3CA 3T54A 1F9EA 5K3DA 3WYCA 1VDMA 5IHXA 4HWTA 3M9XA 1UZUA 4B17A 1OASA 2JLRA 3C1UA 1D0IA 4M9XA 5GIPE 3CZCA 2QUIA 5TQ2A 1UBUS 2NTEA 3PQEA 5TGTA 2GEBA 4OL9A 4OJMX 3U1TA 2DETA 3SU8A 2R00A 1QB8A 4URZR 3ROEA 4Y2RA 3QFCA 3GRRA 1L4YA 5F78A 5FNVB 4DBLC 4PZZA 3KBOA 1Z82A 3NASA 4GBMA 4D3ZA 5TSDA 4FJ1A 4BO8A 1ORRA 2PMFA 4LK2A 4XD7D 1GNRA 3SS9X 2CXSA 3E9CA 5H59A 4P4LA 3NORA 3QOFA 2GN8A 1VYUA 1KHHA 2CLSA 3B3AA 2AJCA 1E2MA 1F1JA 5LDDC 2Y1GA 4ZVOA 5IAKA 5BN4A 2H3EA 2JATA 4M1WA 4YFYA 4M9ZA 3A14A 1FFEA 3QU9A 1H93A 5K0FA 1JV2B 4MGEA 4RA9B 3PG5A 5HUJA 2A5DA 4QXQA 2XMQA 4BX3A 2APJA 3EVBA 2XRMA 4FEAA 3T4XA 1A5ZA 1XU4A 1AURA 2VEDA 4TS1A 2XYRA 3DZJA 5ALYA 5JQWA 4YCCA 1OTXA 5I4CA 2VXOA 4B47A 3MRTA 2IU4A 2R7LA 3DLAA 5E8RA 4NCBA 1L9KA 1OBCA 1H94A 1VLVA 2JLQA 1OIVA 2MINB 3SVTA 3JQDA 6REQB 5HGXA 3N2IA 4M36A 2F8MA 3DMRA 1K88A 4X24A 1E6KA 1WW3A 4I4TA 3FZQA 2Q0XA 2W4IA 3G5LA 1SD5A 1TK9A 4P81A 3BC1A 5CP8A 4BO9A 1PZMA 3HUDA 2CNKA 5DV9A 4CM1A 3HXKA 3MWYW 1UBRS 4X8HA 4HQOA 5BSVA 1D0VA 1TFUA 2DLCX 1X7ZA 4QRIA 2QRKA 3WL7A 1Q1ZA 2PTGA 4N6NA 3SHFA 1OH8A 1RRVA 1GL9B 2PO7A 3ESZA 3HB9A 3KJQA 3LHKA 3NOOA 2LKDA 3NEAA 1J97A 2QT0A 4HS4A 4X1OA 3C6BA 4CI9A 2IS4A 4NYJR 3PIRA 4ESVA 4QYIB 1G20E 3D6NB 3DTVA 1CG6A 4X90A 4XWOA 4DPMA 2ZRIA 4O2LA 1V6CA 4QT4A 5F35A 3M5WA 3ZDEA 4BXOB 1U1FA 3NTVA 2H51A 4GMXA 1W5BA 1UT6A 4MKZA 4M9CA 4EHBA 1KQPA 1RPTA 5CVVA 2CNWD 3TUIC 2MSWA 2VT3A 1DMSA 1IE3A 1TIPA 1IN5A 2ZRBA 1TK2A 3IP5A 5I3ZA 6REQA 1JHYA 4FCCA 4FZ3A 3T9DA 2Q1YA 1GZ4A 5EKTA 1J0AA 3WYBA 2IS1A 1VPDA 2YOFA 4GRAA 1LCIA 3S44A 2X8JA 4RWEA 1AN9A 4IGEA 2W7TA 4O4JF 3OEYA 1N0WA 4E2XA 2C2WA 5DNYB 1RS0A 5EKUA 1A76A 4NU5A 4ZDJA 4M1EA 2YZ7A 1Q1AA 4RIEA 1P4GA 2EFDB 3L8GA 1G3MA 4GFDA 4PYLA 5I7HA 5JWOA 4GEGA 4G3XA 1BN7A 5KTSA 3PI6A 5B4TA 3KOXA 3MGBA 3FFWA 2UZ1A 2OESA 4KODA 1HFJA 1Q2XA 1IPEA 1TADA 3QWIA 1H4QA 1D2AA 4IG4A 3O4JA 13PKA 3QNMA 4BFTA 2Q5JA 2ZSAA 3BHMA 4AJ9A 2QI9C 3HPRA 1P80A 1SK9A 1FNCA 1D8AA 1WEKA 2XB6A 3C24A 3FUWA 5I9BA 3JQAD 2LIPA 3T1OA 2P3OA 3MJCA 3OE7D 1M1XB 1NC1A 1TDJA 2GEKA 4LRQA 1J1UA 2WYWA 3ITEA 1E6EA 2XX3A 3G85A 2I6XA 5G0SA 4Z2YA 5C5IA 5C8VA 3EF3A 4DC1A 1S1MA 5C46F 3EOAI 1C4XA 3PYLA 4ANFA 5L45A 3RVOA 1RYEA 1ADJA 1Z4OA 4KQFA 4L0CA 5HPYB 2ZYRA 2A58A 1T6ZA 2A84A 4TN1A 1QPZA 3GBSA 1F38A 2BF4A 4Q1CA 4YMVA 1FRNA 2DH5A 3ZE2B 4L6CA 1Q15A 4HMPA 4COOA 4DXHA 3I6ZA 3OJEA 3UJDA 2JB9A 4CT5A 2GD6A 3IKJA 4CKYA 1T2CA 1NN0A 1NPYA 4RVSA 3SEAA 1Z7GA 8ADHA 3L3BA 2C3PA 3RCBA 4YJFB 2Z56A 1FSZA 2NU6B 4R84A 4L5AA 3TJMA 4ZCIA 3OX2A 1VL8A 3OT1B 3WKAA 3ZDAA 1R18A 3VU9B 2C29D 5CX1B 4IW3B 3KQUA 1OH7A 2AK3A 4H6VA 4RELA 2CFCA 4Z99A 3HBJA 4RV4A 2IYEA 2JW5A 3IOCA 5ALTA 5EXEA 5BSMA 3KCQA 1SVUA 1S4MA 4H17A 1P7PA 4J2OA 3V2GA 5ICEA 1Z88A 1PS0A 1M34E 3LOPA 4A3SA 4IILA 3DE6X 3CUEF 3FNQA 3OU6A 4QFMA 4QYTA 3I3SR 3RUAA 2CKDA 4RMGA 4W1SA 3RS5A 3SBEA 3LS2A 4F3NA 1CIPA 1HEIA 1PYOA 1CR1A 2XNDD 1Q14A 2M6SA 1AU9A 2BFMA 3QFTA 1XDSA 3QW2A 3SYNA 4CFSA 3T1HB 1R7RA 1KJQA 2P6UA 3OA2A 4ISBA 5IT4A 1I7SB 1FP2A 1RTTA 1E1RA 2C59A 5JNLA 1P2SA 5HMMA 1T4CB 2IWHA 1O8BA 1K27A 1Y4AE 4WK4B 3BJRA 2W2TA 4JITA 2BMAA 3AHGA 4AK9A 1U28A 1YZHA 1T5LA 2J9FB 2VDWA 4DCNA 4KK4A 4DIOA 1DQRA 1Z0AA 1Z26A 3U6KA 1UJMA 5JJ5A 3ZXSA 4IVRA 2W2LA 5BW8A 4S0ZA 2GTIA 1Y5NA 2ZGVA 3GRVA 4GPTA 4NCHA 4OSEA 5J5AA 1BKYA 1C3LA 3M4JA 3M49A 5CT9A 5CLLA 1ADFA 1NMSA 2YZKA 4TYNA 4TQ9A 3P5SA 3HCNA 3CRVA 4MO2A 1J33A 2G07A 3I2JA 4WFKA 3FRIA 3T99A 3MIZA 5JANA 4EQ6A 2I8AA 1OX6A 3DEYX 2Q5HA 3ZWBA 3OZWA 4RY2A 2HR1A 1NVGA 4JWTA 5E3JA 4BP1A 1LB1B 3VPHA 1FNBA 1HRDA 1RXEA 4R8VA 3OLWA 3R76A 1U7XA 1JIVA 3SNHA 4TL8A 3H04A 4KVGA 3LGXA 2OXCA 2E4AA 3RIYA 3EAQA 4HRYA 3FOWA 3ON5A 3S2EA 4U6QA 1NFFA 1IJEA 3GHYA 1SEPA 2VDWB 3A6GA 4HS9A 3THOA 2GM9A 1XDGA 3ORSA 5UKDA 3IIMA 2RGAA 4I66A 3AI1A 3R3HA 4D9HA 1VE3A 1GR0A 2IT1A 1QHFA 3UA3A 4HDNA 2ZWMA 2I71A 1LQTA 3NHRA 3LXMA 3N2GB 4MV5A 4Y30A 1T6YA 1UBNA 3PJDA 4IS2A 4DA6A 2VDKB 5FYQA 4OI2A 1O0CA 1ZH6A 4RQTA 1D8TA 4EEKA 3FZYA 3HN6A 3OM9A 3Q2KA 3N70A 4LXXA 3VO1A 4N9WA 2LGJA 4FDUA 1MA0A 2GH1A 2P8JA 4FE4A 3S7TA 2UYOA 4B4OA 1P74A 4JYBA 5BSGA 5BXYA 5KTPA 2P6MA 1E2JA 1NQTA 1M9NA 2BRUA 7REQA 4ETWA 3KB6A 3QF4B 2I4NA 3C14C 4X3CA 3ZLVA 1M6EX 2R60A 3D6UA 3DBIA 3PRKE 2OWEA 3OQHA 1I33A 1QB7A 4EO9A 2WSMA 5IZCA 1Q6YA 3FSRA 4G23A 1F12A 4K05A 4LBVA 1XK7A 1ILEA 5F98A 2XVYA 2HIAA 5ES4B 3DMTA 4UBOA 3ZDYB 4LRYA 1R50A 5BUCA 1DWUA 5BURA 2F1RA 3GGSA 4TXNA 4R5MA 3SN6A 3ROQA 2WIKA 3FY4A 1E6LA 4LCEA 4WZAA 4WFJA 4GZLA 5LZ5A 3NXSA 4BNFA 4ZHQF 5K09A 5HS6A 3PTLA 1FFAA 1CZUA 4PG8A 1EJ2A 1NATA 1HSZA 1V9SA 1I13A 1B8VA 1UODA 2DQSA 2QMYA 3I1FA 4KWIA 2AZDA 5HKAA 3ZDBA 1FVXA 1UWCA 4MS4A 4QDUA 3L9XA 1HL7A 4PBTA 2XT6A 1QE3A 2IU6A 5JS8A 4DR6B 4FQ7A 4MAFA 4X8MA 1IY1A 3F0TA 1B1CA 4AY5A 2BONA 4X6LA 4X3PA 2C54A 3IURA 3V8BA 4EY5A 2O2ZA 3GQVA 1BDBA 3I9V6 3RVQA 2BT4A 3HH8A 4U8GA 5CG2A 4J0GA 2MMCA 1MRZA 2IYAA 2WLTA 2PWAA 4I8DA 5GONF 3U6BA 4J16A 5TMEA 4BC0A 2D1SA 3Q8LA 2EG5A 1IMJA 4AJPA 3QHPA 3P4YA 3T5TA 1OPXA 3MILA 2O7NA 2AFHE 4LHVA 4Y2SA 3TEMA 2CHFA 2ZRAA 4MVJP 1OKKA 4ZO9A 5I9SA 1KL7A 3U19A 4G0UA 5BNFA 2G3YA 3NJ4A 2NO4A 1PBTA 5L3RA 2QVBA 1SHUX 3TLXA 3G0CA 4DHWA 4XGQA 3VR2A 3WYNA 1E63A 2AJTA 3S1LA 3TZ6A 4IIYA 3DEAA 3IE1A 1JE0A 1VLLA 1PGPA 3PUWA 1NUQA 4FWBA 1QU3A 1QORA 3GJ7A 5DTIA 1GGKA 4D9JA 1YL7A 1T3HA 1Y80A 1II0A 3OFNA 3ZIDA 2AOVA 2OP1A 4NAUA 4C4OA 4W7IA 3Q41A 4JVNA 1ZPDA 1FTYA 2J41A 3V7YA 3CFYA 2ZOSA 3SF0A 3D1JA 3TSYA 4KSBA 2FSSA 3VUFA 5DBHX 1VLJA 2ACEA 2B61A 2QYOA 2PL3A 3TW8A 3ZCVA 6YASA 3WLHA 5JRZA 1UC8A 2XQKA 1P8JA 1IDN1 3GGCA 3HY4A 4KQXA 4BNYA 1JDUA 4YCAA 4RCZA 4X7RA 4C87A 4E09A 3BBLA 4HRXA 1OILA 4D45A 1DEHA 1XAJA 4R2LA 3ZCRA 3ADOA 3C5CA 4DJAA 2JGFA 3ITDA 4XQCA 1Z2PX 3FYHA 3HG7A 1RKUA 1L7PA 2A7QA 1JHRA 3KYIB 4UEOA 4V39A 1E6WA 2V3VA 3D64A 1EMDA 1DIGA 4HNVA 3NCHA 1T3ZA 5CBKA 3U7EB 1WAMA 2WUGA 5BQ3A 1DADA 2DKFA 4K40A 4B4DA 4DIMA 1KDOA 2GAOA 4F46A 1Y7TA 1G0OA 3I23A 4UULA 4TMVA 3JALB 5C7IO 3BPSA 1N25A 1WCYA 5GV8A 1N6KA 1QV7A 2DG2A 5DLEA 5LQKA 4FGKA 4LHZA 4LY9A 4RMNA 2IOHA 1XN1A 4BEJA 1H2ZA 4ZVNA 1PQUA 3FYCA 4CQMD 2LUOA 3MCZA 4PYNA 4R7ZA 3EYAA 4RZSA 2RGRA 2CL7X 3IPRA 4MUEA 4I19A 4RJ2A 3CCCA 2QS9A 4UVHA 3WDKA 2WIAA 1T6XA 2P67A 4YVFA 3U5ZB 1MVNA 1B43A 3OUUA 5M34A 1AD2A 3AR9A 2EBHX 1VPVA 1J4AA 1KFEB 2ZP1A 5AIAA 4HWSA 1XDWA 2IEIA 1CUDA 2ZW9A 4UU7A 4G4GA 5TQ0A 4QBTA 4BS9A 4F8YA 5BR4A 5JOQA 2O8EB 5IAAA 1CLUA 4MPRA 3HR4A 5EP3A 4ZYXA 4LSGA 1TL7C 1FXSA 3H1BA 1BRMA 4ZRNA 4OXNA 1JE1A 1KAQA 2REQA 4MRRA 4R8RA 5HCUA 4R31A 1MAVA 2NZJA 3IEKA 3WSTA 4QKQA 1LV8A 1W8IA 1AGYA 1JQKA 1N2JA 4O4JB 4X61A 3CE9A 4Y0NA 4LJRA 1USIA 1RU3A 2V5VA 4IGKA 4PSKA 1ICIA 4S1TA 2IU3A 5JD5A 5DLDA 3SZLA 4G6ZA 4HX5A 3O91A 3A0UA 4KWTA 1GL3A 3CLUC 4JBNA 2R97A 4QOGA 1OFHA 1PEKE 4G65A 3HKBA 3OFSA 3VJLA 1PHPA 2AUMA 4BECA 3ZDDA 2QGZA 5CLFA 5D5QA 1YJBA 2W8BA 1QIGA 1SCAA 3B12A 4O25A 3TFWA 3JSAA 1U3WA 3WZLA 2AX4A 2GPAA 4UUOA 3TBFA 1R0ZA 1UDRA 4AP5A 1SCQA 1T8SA 2IXTA 2H9AA 1Q3TA 2LW7A 3P32A 3DAOA 2CXRA 2FEWB 3L6UA 2OWDA 2Q99A 1XZEA 3EQ9A 1A82A 3HL0A 5E95A 2V98A 4EJSB 4Z4GA 1VKOA 1Y7IA 3A4TA 1Z38A 2I54A 2BFOA 4P38A 3RLIA 4EAAA 5ADUS 2RKWA 4RPIA 4Z2AA 5CFLA 1SZPA 2O2DA 3WGVA 4Z86A 5H4GA 3TQRA 2QRZA 1EVJA 1FS4A 3SLGA 2C4TA 1XPRA 2PZFA 3NHKA 3HKEB 3LIIA 5DN9A 4DWWA 5SYNA 2ASVA 4EW6A 1BZYA 3OFND 5EP4A 1JLLA 3T9FA 1SA0A 4AXBA 2IITA 1AMOA 4ZXPA 4PXSA 1UKBA 1FFXB 4FK8A 4XQ0A 1DKLA 1JU4A 3EEBA 5KOYA 4CNQA 2V7EA 1VG8A 1FDIA 2IBTA 2ECPA 3FZEA 3D3WB 4XVQA 3E2MA 3NDPA 4KREA 5K4HA 1P9NA 2X5OA 1OLXB 2JGDA 5DYWA 1JFFA 2WV7A 3K6KA 3RYFA 4B9EA 5MGBA 1WLYA 3EMBA 1T1SA 3OOEA 4LUCA 2Y92A 1P33A 1ZJZA 4WNAB 1NZJA 4QYSA 1B6RA 4F2WA 3DMGA 2GZRA 1CUCA 3DOJA 4P7KA 1VL2A 3IP3A 1E9BA 5C8YB 3WGTA 1SC4A 3VR6H 5AJXA 4D4KA 5MFZA 4O4HA 3HU2A 4E22A 3ZWVA 4UM5A 3HTXA 4NOKA 3RTAA 1WUYA 4EI7A 3LNTA 1NRIA 4HB2A 4ZN6A 1S2LA 4DNQA 3QUSA 4CTKA 3VKVA 4HFJA 3OQJA 2VR1A 1A4XA 2YW9A 1B7GO 4HCJA 3SX2A 4YUYA 1YRYE 1I80A 1QHEA 3H5LA 2HCJB 5B3KA 1CE8A 1A2OA 4JLNA 3UAZA 1BS9A 1QFSA 2XVZA 4EW3A 5ALNA 1ZGJA 2OHJA 5F3DA 1UOPA 4WLVA 1NT2A 4MUIA 1T29A 3WB0A 1PFGA 1R3UA 5EIXA 1FTNA 5HUHA 4X6YA 3K16A 2BTEA 3GDGA 1QHHA 4XJTA 4GC9A 1LRLA 2IPOA 4PW0A 4WNAA 3HB1A 4PV7A 4Y2GA 5HIMA 5FV4A 2PV0A 4OJKA 3MTQA 4NOLA 2E5WA 3DZCA 3CF6R 5FOWA 3BE6A 1BDJA 2JI7A 3D5EA 4TS3A 5ENDA 3UFXB 3WAKA 1ZM3A 5B1YA 5JVDA 2HOQA 1EK2A 4CTNA 2CT8A 1AQIA 1QR2A 4OA8A 2O1WA 1T5DX 3AHFA 3PUVA 4U2KA 3AK4A 5KJ1A 2QTFA 3OY7A 1SVKA 2LP4Y 2OD2A 2IPLA 1XQXA 3OT5A 2DBRA 3E0XA 4J0IA 3VHRA 3WGNA 5C1DA 3QMVA 4QODA 3WGKA 4GI2A 1CUXA 1DX9A 3UUFA 4Q9NA 1FBNA 3D6JA 3EQ8A 1NNLA 3ZX5A 3QX9A 1EE1A 2XTJA 3AHEA 3FPLA 1TQDA 3KYJB 4FOSA 1SQFA 1THGA 1XZLA 5E6SA 3U3OA 3WMGA 3BGDA 1S7GA 1X8XA 4M7RA 3VDRA 1FSPA 3RC8A 2PGLA 1KMNA 3E4DA 4B2PA 5JXHA 3PUKA 1MQAA 3OCVA 5AW4A 3NWPA 3NTOA 1CRLA 4XSVA 3PTZA 3LQ1A 2XRYA 4TQUS 4AY3A 1P2GA 1KMHA 3AUFA 3LLCA 2ZUCA 4BN5A 4XDZA 3MT9A 1TOAA 1CUWA 3PJGA 4BATA 2IEYA 1EFRD 2BI4A 2WTBA 3LXUX 3HZZA 4JCCA 4TZKA 5T3YA 3HZHA 2XCTB 1PZHA 5L3QA 1F2UB 4ZD6A 3FA2A 3RYIB 1MOPA 3TLAA 1U5BA 3ILSA 3LG2A 4AMBA 3IT3A 1YVEI 2QU8A 4PSVA 1YTLA 2OORC 1C4KA 1ZSVA 4X54A 5EUQB 3LTNC 3GFSA 3I2YX 2UUAB 1NJFA 2FMFA 1GGHA 1P29A 3DEFA 2FEXA 4MYDA 2WG0A 1E89A 2FR8A 4QPPA 4F3RA 2SNIE 1FYFA 1LPPA 2H4XA 4DCOA 2O2SA 2H2HA 3PFCA 4C22A 3RROA 3FPHA 3I8SA 3TNYA 3M89A 1C0LA 2CMKA 3V8NA 5HJEA 3FNEA 1HQYE 2A5JA 3AEUA 4ZYTA 1KC3A 5DP2A 2QG4A 4YYZA 1AKTA 4MLPA 3LOQA 4UXHA 1JA0A 1F14A 4DRXA 4F71A 2EGGA 5K3AA 1M1YB 3U3ZA 3LOUA 4CTMA 1LTKA 1VHLA 4KUHA 1L4EA 5I8ZA 4B73A 1I8TA 3HHPA 4ZHQB 3G8YA 4KU4A 3QYFA 3BJZA 3QLUC 3A6FA 3KKNA 5ED4A 3QLJA 3NDBB 3B6ZA 4DIUA 4LMBA 3RVBA 3MUOA 3RG8A 1ZNQO 3W05A 2LKCA 2VP4A 4DYVA 4F4IA 3GCGA 4DDMA 4P5PA 5DTJA 5IT5A 1O9GA 2Z95A 1EIWA 1N1GA 2FCAA 1LVGA 2WT8A 2VDVE 2AR0A 2C99A 4R1SA 2JVIA 3CO5A 3DFZA 5FPYA 1M2NA 4UEWA 1V3VA 1YMVA 1KDZA 4BFXA 3EEOA 1A9PA 2W5UA 2RGDA 3UKOA 4NE2A 4ZO7A 4WD3A 4GT1A 4AD8A 2R65A 1UC5B 2QPOA 3LO5A 2VK2A 3QKSA 3SXUB 4N3GA 3Q15C 1PWZA 3L49A 4Q7JB 1PR6A 3AEUB 2QD3A 3MTAA 1V8DA 4P22A 2YDYA 2ZYAA 5K3CA 3VV2A 3HV2A 1ZJ5A 3M2PA 2QT1A 4K9OA 4YREA 2J9GA 3W5HA 4EHAA 3VUEA 4JLVA 3I9KA 3NRJA 4E88A 4OXXA 1WTAA 4KMMA 3SC6A 2P11A 2P6PA 2WNSA 3D31A 4JJZA 4RD0A 1QXSA 4JI8B 1JXQA 3BZBA 5F5XA 5JFGA 2E6KA 3R5TA 2W6JA 1S6YA 1RRMA 1V8FA 2ZUDA 3HGTA 3WGHA 1WEHA 2AEJA 5IUKC 2GWRA 2R1TA 4BBPA 821PA 2NO6A 4XX0B 4ZEMA 1FNMA 1YK0A 3HB7A 3HUEA 2F4VB 4C6TA 5J1SB 2VYFA 1FZQA 4N6OA 3W8DA 3IC5A 1XCOA 2Z2XA 4XJXA 3F2VA 3MXTA 1FJ2A 3CUTA 4O2RA 2EKLA 2D00A 3F6RA 3VHQA 2P9GA 2Y0PA 4O02B 1XK6A 1KEEA 1U2GA 3N86A 2LDXA 2Q2VA 1OXSC 2ZIZA 3B1FA 2D3TA 4LWPA 4B3MB 5HOEA 3H13A 1FOEB 5K0JA 3UTDA 5JFOA 2NN3C 2C07A 2C98A 2VHYA 1FMCA 3HCDA 5HZHA 3QVKA 1I1OA 3UGTA 2PUVA 4MLZA 3UMMA 4FGZA 3A4IA 3C1AA 3W9YA 3SY8A 1LDGA 1VLQA 4ZYVA 3ZQ6A 2UYYA 1OZAA 1W0CA 5KO2A 1YS7A 2GESA 4IHJB 1S2DA 4MYSA 2X8AA 1HR0B 1N5RA 3CEJA 4WBNB 4I3HA 1KWGA 2CNDA 4KGXA 1Y6RA 1DIHA 1GQ2A 2O2GA 3T5AA 1IM5A 2QMEA 4QLAA 1CEEA 2XE8A 1TAQA 3FPFA 3ZTWA 1YZTA 3AF4A 4C4SA 1XCPA 5JCJA 1NIPA 1JKXA 2B2XA 2FF7A 4ZANA 1LQ2A 1NJSA 3BORA 2LVBA 1XYYA 3OF3A 4QPJC 4TLMB 3SCZA 1E2LA 1C30A 3IOBA 3VPFA 3EX7C 1D6JA 1X7ZB 4ILEA 4LZJA 3G2IA 4G01B 4ZV7A 1XO1A 5JRDS 3PENA 1UKZA 5SICE 4BVHA 4OHRA 1NMXA 5IFLA 4HLNA 2B8JA 1MABB 4KR9A 4B85A 1UAAA 3QVSA 1H6CA 3G5UA 4OQNA 3SC4A 5GADl 2GJSA 2C9MA 2QYTA 2GVNA 4OTZA 1LF5A 1KKMA 1O6ZA 4TSRA 4CUZA 5NLLA 4XFKA 4KR6A 2BZ1A 3ABZA 2WZQA 2YVKA 1EBUA 3KKLA 3AIOA 3SJZA 2DQKA 5A9RA 1OHHA 3F47A 4F0JA 1BX0A 4WLEA 1CY4A 3RC3A 1ILWA 1PZFA 4OK3A 2Q3HA 4URWR 1GA1A 4UFNA 2IV3A 2QPLA 4BKUA 3COJA 2I9KA 4XGRA 1N33B 3B1XA 1YZLA 2XB2A 2AS0A 2OGWA 3GUUA 5DWVA 1UMKA 2P9BA 1CPYA 1MQ9A 3NFRA 4Q3OA 3JXEA 3A3KA 3W5VA 4A27A 4DLBA 2DFNA 2AG6A 2QENA 2UZ0A 4WK0B 4ZOQI 4M87A 1FFYA 3ZJYA 2HMYB 3LPNA 4PX5A 1EFVB 3MS4A 4JFRA 4LWZA 4L51A 2P6OA 1YR8A 2V54A 1IHPA 2X5XA 3IPXA 3N74A 4JUIA 2OOKA 2VDRB 3OTHA 2ZCVA 1U8TA 2QQFA 4FSHA 1U2SA 2JJMA 2WSBA 3G9UA 1L4MA 4NHOA 2HBQA 1N6OA 4X66B 3RSQA 1SU6A 1NX6A 4EHLA 2GCOA 2OL4A 3EPHA 2E85A 4WCFA 3UJPA 1BVRA 3DNFA 3HE3A 2Q1XA 3I4LA 4R1PA 2AYYA 1KPGA 1Y9DA 3ESYA 2PR2A 3AEKA 1I4DD 1V9LA 3CQ9A 4B1FA 2YWCA 5G1NA 2PPLA 4S2UA 1OUMA 4FKMA 3RBAA 5AXCA 1LEHA 2L19A 2OCYC 3RUHA 4DLXA 1S1CA 5HJ5A 3NHZA 1F8FA 1A7AA 4GMKA 4OHFA 5ES3A 5B1SA 1N6PA 4GI3A 1Z33A 1GEEA 2J5RA 3L40A 1OIXA 3KWFA 4JYCA 4LYEA 1E20A 3VA7A 1C1XB 3KKEA 2B8WA 3LHDA 4IFIA 4NEHB 5D86A 4C0BA 3U40A 5JSZB 2GZ2A 2LCIA 5JWRA 4DUZB 4NJMB 2GM5A 4GM1A 2PU7A 2SCUB 2V45A 1J9GA 2X8LA 2Y8EA 4MWTA 3TLMA 4YP6A 3ENNA 4MZDA 2XUHA 1ACLA 1OA1A 3U9TA 3MAAC 5E7QA 2YV4A 2HQRA 2OBNA 1XIVA 3PD7A 2CMHA 4ODIA 1FK8A 3QUTA 2R8XA 4KQEA 3UK0A 1KK2A 4ESOA 4EEXA 1DG3A 1H65A 2IHBA 4KBYA 2CHQA 1T6BY 1II8A 2ZYIA 3IUJA 4RQUA 3WGGA 2OC9A 2HQ1A 5F3RA 3A04A 1F4PA 3GA0A 2FLWA 1NXVA 3SEQA 2EC5A 4AN0A 5EXXA 3R9KA 4AO7A 4BEBA 2OP0A 4C3VA 5HFJA 3S28A 3LNCA 2J4CA 4X8OA 3WDSA 1E9SA 2C96A 3DQPA 3QEBZ 4IPTA 3FLEA 1FQOA 4OD0A 1ZCFA 1E9DA 4N7JA 3DDCA 3HP4A 4NZOA 3WI7A 2HXGA 1A96A 1PFVA 2WG1A 2Y4NA 5AVUA 1C7QA 1KSGA 1WHTB 2WUVA 2ZAYA 1C1XA 1SY7A 3HCRA 4G97A 3L18A 5KNDH 1Y1TA 2FSPA 4K7JA 2J3DA 3VU0A 2ZPTX 4TTJA 5COQA 1AM4D 1MZVA 3T3DA 4DFDA 4RVGA 4BLOA 1F17A 3TQTA 4WKBA 3IJ5A 1LBHA 5CT5A 1TA4A 1KS2A 4DBVO 2C7PA 2QZPA 2ZBUA 4K8RB 1NI4B 3BERA 4KXMA 4OYRA 3TRKA 2VYCA 2QTVB 4TT3D 4C21A 2Y1CA 3BN3A 2ZE8A 2BEVA 5HZKA 2JIZD 2BGWA 4DV7B 1HDEA 3C4JA 3WZ2A 1Z07A 5KTTA 3ZHQA 2O8DB 1QPBA 1PTJC 1XDDA 4IRUB 4WKPA 4D9NA 2BSQA 1ZQ1A 2EFGA 4MH0R 4YCLA 4I4TF 2HIGA 3I2IA 3LHFA 1JHPA 3EASA 4ON9A 1FL9A 4J43A 1HDXA 2XD9A 3CSDA 3PXUA 4V0MA 1HZZA 1VG0B 3WAGA 1NBOA 2YWJA 3AY0A 4ARVA 3I5MA 4RMJA 2DWPA 4C7MA 1QTQA 4KE6A 4PWZA 4Y9SA 4R81A 3E9RA 3IEPA 4MITA 3FHJA 3CUKA 4MYHA 5IC4A 2F8LA 1ZIOA 2L69A 5T64A 1E2HA 4A8HA 2VRWA 1ZGBA 4D5EA 1ZD5A 3UV3A 4WOJA 4X95A 3K70C 3HBAA 4V03A 2M32A 2A33A 3MIIA 4UPVA 3W6NA 4NE9A 4L85A 2JI6A 5CDYA 3D6FA 4YMGA 3C6ZA 1X1TA 3ER6A 3ZI7A 4TMZA 1YZKA 1XTSA 2QIOA 1KZ4A 2D13A 2EOAA 4DLRA 4ENQA 2IP4A 4R83A 1CVIA 1E69A 1ZWLA 1UL1X 3ICVA 3U4GA 2EXXA 2GYWA 3MJFA 1UP4A 5LQSA 1Y1QA 4RPKA 3PZRA 4HLDA 1XDUA 2ODPA 4TMFA 3BSYA 2XA9A 4N3CA 5HSGA 2B7BA 1ODTC 4II3A 3WFIA 5IMSA 1F7VA 3JVVA 3QIVA 9LDBA 3FMGA 4XE5A 4CUKA 5ARBA 5BUQA 3BXZA 4KDCA 4MGYR 5TS3A 2OQVA 4I36A 4BDTA 3FLAA 2O0HA 4Q9AA 3SX0A 3CMCO 3HDVA 3B8EA 1WVMA 4X92A 1R0LA 2FZWA 1O57A 3E48A 3LRPA 3ILVA 1MIOB 5DCWA 3TQQA 3EGDB 4C4ZA 3NBXX 1AV6A 2VHEA 2P2ZA 3O95A 4HVTA 4LOKA 4OJTA 5ALJA 1WQ1R 4L22A 4FILA 4ABYA 1ACMA 4RF2A 4QFBA 2HDWA 3FMFA 3KL2A 5J2UA 1Z73A 1FQWA 1RADA 2QPAA 1Y5MA 4IUCS 3DPIA 4BQRA 5A7FA 2JLUA 1X7XA 1AS2A 4AO8A 4EIWA 3E70C 4IXWA 5I9NA 5KNCH 1VLHA 4HLCA 4XQEA 2O8BB 5DIZA 3ADBA 2F1JA 5HZGA 2CB0A 3E61A 3PXCX 3RSCA 3KHTA 4DJDC 3JARB 2ATCA 4HDQB 2IDJA 3NJRA 4F9TA 1FA9A 5L6LB 4GKAA 3SZGA 5J3JA 3I1IA 4LHSA 1FMLA 4YECA 4RZIA 5BN5B 3SG0A 4IIBA 3TL2A 3P94A 1CQPA 5IM5A 1PNOA 2QKYA 2WINI 1J8VA 3HCFA 2PBRA 1HUQA 2HX1A 2YJTD 1BCRB 1C3EA 1MJNA 3GB9A 3OD1A 3HY6A 4NNOA 1J7JA 4HC4A 3Q1KA 1QJCA 4I5FA 5SY6A 1E2IA 4M2LA 1NVWQ 4HADA 1JHQA 2QGNA 4WADA 3U4QA 4I3GA 3JD1A 1EUQA 5HBGA 1G4UR 2I29A 3DF7A 1YS4A 4BVGA 5FA8A 4X6UA 5BWLA 1CERA 1TAUA 3U44A 4R8SA 5D01A 1B8OA 4M0EA 1GZUA 2QR3A 4LNHA 5FLEX 1JVSA 2GTHA 1WQ4A 2WJIA 1J07A 4LY0A 1GG2A 2XLCA 4R4JA 4TMTA 4UATA 1TYCA 1ONOA 3CGGA 4BNLA 4JKOA 5CK5A 4RJJA 1MX5A 3DBHB 2GA9A 2XA2A 2EHJA 1N1MA 1QP8A 1ESCA 3ETJA 3PZBA 4ZCRA 5SYMA 1KMCA 4LBYA 4DMGA 1JWLA 1WCXA 3CKYA 2ECKA 4IY1A 1CZRA 4Q1BA 2XMGA 2OBBA 3UNXA 8AT1A 1Z2AA 5DE3A 5CM8B 4JKYA 1BA2A 3ZX4A 4FR0A 2F9FA 1N7HA 3TSZA 1CLEA 1N8TA 1YMUA 3TW8B 3HCOA 3WJ7A 1PAUA 2RHWA 2QLLA 5ALDA 3JZMA 3LFUA 3CX6A 1JG7A 5CFPA 5ADHA 1G66A 4N0DA 2ZRQA 1LX7A 5DRTA 1W0JD 4FYHA 2JCXA 1CYDA 5JYBA 4AJIA 4WCDA 4G5GA 4D0LB 5EWMA 4BE9A 4JI2B 1EDBA 2O5RA 2BY4A 4S1NA 4DVJA 2B20A 1IVSA 2YUTA 2ZSDA 3JYNA 4N8DA 1SUCA 1CK4A 4EPYA 2CEKA 5IJ0B 4L4SA 3K70D 1H8HD 2V5UA 2QTMA 3PE6A 1G4AE 1Y7HA 3KEFA 1RWWA 1GAEO 4ZRDA 5K05A 2DU8A 2RI1A 2OCLA 2J3MA 3GN2A 3L7BA 1E3TA 4CKEA 3UKJA 4IQ8A 3A11A 3RFCA 2PX5A 4URVR 3GMSA 1QLJA 4AICA 5A3RA 2EWWA 3PLNA 3PVCA 5DM1A 1A71A 3S8YA 2CVHA 5TQ2B 4WXYB 1UPAA 3L7CA 4XB2A 4ZOEA 1ZRMA 2CFIA 2PZKA 2WJVA 3ISJA 1YWGO 3OBBA 3PK0A 1SOMA 1DIOB 1AK2A 1PX0A 4HWOA 5H70A 4A2CA 1CIVA 4QTUB 4UNIA 3DWEX 3CNOA 3Q1LA 1NLMA 5ESDA 2W70A 4JP3A 3S6JA 1CYEA 3HVKA 3STUA 4MO9A 3VNSA 3RC7A 1CC1S 3TIGA 1U80A 2BTQA 3WB9A 4AKIA 3GJZA 1AG9A 1EFLA 1K3TA 5G0UA 4BNHA 3U44B 2IE8A 2XZTA 4PAGA 4F3TA 3C3CA 4LYFA 1CU1A 1NASA 4TKLA 1QRSA 1JAIA 1USWA 4JBGA 4D0GA 3KSUA 3AKEA 4TS4A 2IXGA 3V8RA 1UFVA 3E7FA 4V24A 2FA9A 2HF8A 4Y9TA 4B34A 2V3CC 1KO4A 4UE2A 3LY7A 5J4LA 4L5JA 3Q7PA