3O26A

The structure of salutaridine reductase from papaver somniferum.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
294
structure length
294
Chain Sequence
RRCAVVTGGNKGIGFEICKQLSSNGIMVVLTCRDVTKGHEAVEKLKNSNHENVVFHQLDVTDPIATMSSLADFIKTHFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEELVKIYEKPEAQELMSETYELAEECLKINYNGVKSVTEVLIPLLQLSDSPRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLANKIPKFQVNCVCPGLVKTEMNYGIGNYTAEEGAEHVVRIALFPDDGPSGFFYDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Salutaridine reductase
publication title The atomic structure of salutaridine reductase from the opium poppy Papaver somniferum.
pubmed doi rcsb
source organism Papaver somniferum
molecule tags Oxidoreductase
total genus 114
structure length 294
sequence length 294
ec nomenclature ec 1.1.1.248: Salutaridine reductase (NADPH).
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3o26A00
3GEDA 3C7DB 3JYOA 1CRWG 5AXBA 1PJ2A 3TZKA 5TNXA 4JLWA 1WDMA 3V1TC 3FD8A 2P9EA 1U4SA 4XX0A 1KERA 4G65A 2V6FA 4UULA 1B8VA 3JQBC 1Q2XA 1FDUA 4INAA 4UREA 3K8ZA 3AU8A 1JQBA 4EUHA 3ON5A 3F47A 2PA3A 2WWRA 3EC7A 1XKQA 2FZEA 2R6JA 3HN2A 5JDCA 1KS9A 3LC7O 4HY3A 1P1IA 1GUZA 3FN4A 3PYXA 3PHIA 1WZIA 5ENDA 1ISHA 1G0NA 1X7GA 5LC1A 3V8BA 5IDWA 5TGDA 1T2CA 1E3WA 3RUIA 1IULA 1PZEA 5JW6A 4CV2A 1YL7A 4JJIA 3H9QA 3GA0A 1LTHR 1Y8QB 1HDXA 4YT4A 3WQSB 3QVSA 4BNXA 3OETA 3WMXA 3JQCA 2V65A 1DFHA 1C0IA 3CIFA 1ZVMA 1NR7A 4J6FA 4ZQBA 1WZEA 5KCZA 1PL8A 3BTUA 1GYPA 4NQZA 1ZXLA 3UCEA 4DQVA 2FRDA 5G0TA 4ZGWA 3WGHA 1OC4A 4R1UA 4QTZA 3CINA 2GN8A 1NFFA 4IJKA 4C7JA 1LRJA 4FJ1A 4YT5A 1GPDG 1Y1PA 1DRVA 3UN1A 3I6QA 1ZUD1 4NBRA 2PKQO 3ANNA 4IQ0A 2GF2A 3DFUA 1YL5A 3I83A 4D79A 3A9WA 4U5QA 2RBEA 4NI5A 4CLEA 1LSSA 4CLHA 3KYDA 1B26A 1Q7GA 4FJ2A 5JPIA 4B8WA 4OSOA 1Z73A 1GDHA 3NT2A 3V2GA 4K9DA 3COSA 5KOIA 3ZHBA 1EVYA 1SZJG 3JQGB 3NJ4A 4BMSA 1C0KA 2EWMA 3OECA 5LCXA 4FSHA 3OJOA 3DZHA 4IINA 4W99A 3OFSA 1BDBA 4BNLA 5DOVA 4R1NA 5HM8A 3D1LA 1AGNA 2PZJA 3M1LA 2A4KA 3UCFA 1LC0A 4MKXA 5EINA 3RQSA 4YQYA 4BO8A 5BSEA 3MJSA 1JA9A 3RUHA 3GFGA 3F46A 4MIEA 2EG9A 3DTTA 4B7XA 2I99A 3PLNA 2GCGA 3AI3A 4WLFA 3WYEA 2F1KA 4TRMA 4FCCA 4CL8A 3M1AA 1IOLA 4DLBA 3D3EA 1WDKA 4B3HA 4E33A 1N5DA 2H9IA 2HUNA 1MFZA 3BA1A 4MVJP 4CMIA 3FR8A 4CUJA 4D3FA 3JTMA 2IYOA 5TJHA 4EEZA 4AJKA 4PLZA 3WTCA 5CHEA 1E3IA 3C7CB 2OBYA 2CF5A 5F5NA 3ZHXA 3GNSA 3ZGYA 3OA0A 2AHRA 2CVQA 3HSKA 4FC6A 2GR9A 1KEVA 8LDHA 1PGPA 3INRA 4OXYA 5COQA 1OI7A 1QKIA 4MVJE 4GSLA 3S1LA 3RU9A 2VWQA 4O63O 3OJ0A 1E77A 1PL7A 2YDXA 1EVJA 3UOGA 1SAYA 3R1IA 4CMJA 2BH9A 4YAJA 3LK7A 1HYGA 1FDTA 4JROA 4YAEA 1SNYA 1NQ5A 4J90A 5A02A 3R6DA 1U5CA 2DBVO 2QYSA 2I6TA 3VH4A 3MJVA 1I3LA 3DDNA 1Y8RB 1R6DA 1BSVA 2QRLA 2NVUA 3A4VA 3D0OA 4LVUA 5TF4A 2I66A 2BFPA 2E4AA 2Y1CA 4ND5A 1NM5A 4Q3DA 1ZNQO 1VM6A 1BXGA 2WDZA 4YRBA 4CMAA 4ND4A 1MLDA 3KSUA 1QV6A 3PJDA 3GGPA 1Y9EA 3VH3A 4A5OA 1SPXA 5CG1A 3QLJA 1EQ2A 4DLLA 2X0JA 3H2ZA 3TZCA 1ZK1A 2HMSA 4M86A 5FWNA 1WW8A 1OZAA 3TOZA 3AY6A 4FOSA 4IGEA 4QT0A 2NV6A 2EXXA 4BKOA 2QG4A 4A03A 1M76A 1UH5A 5IDYA 3KRTA 4Z0TA 4BS9A 1GV1A 1N7HA 5CFZA 5I7FA 4RDHA 3TFQA 1F14A 3VPSA 1LU9A 3AM5A 2AG8A 2ZJ1A 1IHXA 2JAPA 4R51A 2DFDA 2P5YA 2XOXA 1QV7A 4PZCA 2Y1OA 4BO4A 1YH3A 3GFBA 1YDWA 3D5TA 3E5RA 4R68A 5DBIA 3RC7A 1U28A 2VYND 4OXKA 1R37A 3LSYA 4IJUA 4JQCA 4YJHB 1PR3A 2O23A 4NMHA 1JAYA 4R41A 4PRLA 3ZW9A 1FDSA 1H5QA 1VI2A 2HO5A 3LQFA 4I9HA 1NQOA 3ZNQA 5G0VA 5K6AC 4D0SA 4BKPA 4WEOA 4BNUA 2Y67A 3LC2O 3V1YA 2DU8A 3QWFA 4GPD1 5DBFA 3T7EA 2G17A 5COBA 3Q6IA 2UVDA 2UDPA 1IL0A 1ZK0A 3GVIA 5CAEA 3AK4A 3GC6A 1ENYA 3CMCO 3IP1A 1PTJA 5L7YA 4A27A 2Y93A 3A06A 2OO5A 2ZTUA 1R12A 2VQ3A 4XWYA 4MVJM 4BNMA 1Z7EA 1E1LA 1PR9A 4RQUA 3PHHA 4E5KA 1A5ZA 2Y05A 2DM6A 1NTOA 2ZYDA 4CQMB 1OMOA 3T4EA 2Y1GA 4YACA 2R00A 4XB1A 4BGUA 3F4LA 1HDCA 2WSBA 3PDJA 1MC5A 4FGSA 4ZVVA 4AVYA 2IZZA 2GN4A 5B4UA 1H6BA 1E6WA 5COAA 1MGOA 1T2FA 1A9ZA 3AY7A 3DXFA 2LDBA 3JQAB 1VRWA 1IZ0A 5GZ1A 4M54A 3HADA 4BKQA 4JP2A 2JD1A 5DP2A 2QRJA 1UXKA 5JSFA 3FNGA 4XQ9A 5G0UA 1QXSA 2EGHA 2PTGA 1E7YA 2YQ5A 4HBGA 3UF0A 3OIDA 4LCEA 4RVDA 4ZRMA 4TVBA 4II2A 2ZB7A 3WIDA 5L9AA 4FBGA 3DL2A 3AFNA 1Y81A 1F8GA 5H83A 4RZHA 4LMRA 3F1KA 1HKUA 3W1VA 1KVSA 3GPIA 1LBEA 2OMEA 1DDOA 1T25A 1C14A 3RUEA 4BO0A 3DZFA 3MEQA 3NGLA 3MJ4A 1DSSG 1RM0A 1ZK2A 2B37A 4J7XA 3RCBA 3I9OA 5ER9A 4E2YA 5KKCA 3B6ZA 4U6SA 3LYLA 2PZKA 4WPGA 5CPFA 4DYVA 4OQYA 4IQ8A 2JL1A 1GTMA 1JVBA 4FGWA 2O7QA 1R4NB 3N74A 3DONA 3U4IA 4BNIA 4E12A 5TSDA 4XJTA 4XZ3A 1PWZA 4OXNA 4BGVA 1O6ZA 4PLCA 3L9XA 3PHGA 1CDOA 4LSMA 3UGKA 5KVCA 1ISIA 1D7OA 3AUTA 2VZ8A 3WLEA 3ASVA 4CMCA 4IMRA 1KY5A 1YBVA 1VJ1A 5CPBA 5TLSA 1E6UA 2BHLA 4CLDA 1BDMA 3EZYA 1DO8A 3QIVA 3LT4A 3WTBA 4DPMA 4EW6A 2YHIA 4YAIA 3I9KA 4LK3A 1EUZA 1D3AA 3ETGA 3INGA 3L6OO 2GYYA 4WK6A 5EMHA 3VZSA 1Q7BA 5AXDA 1JDJA 3EAGA 4PG4A 2ILTA 1J5PA 3NT4A 3ZHZA 1Y8QA 1Z75A 3N58A 4MVJI 3ZCXA 1RJWA 3H3JA 1E6EA 5TRTA 1NASA 1A71A 3FSRA 4S1VA 5H82A 1E3WB 1I5RA 4FS3A 2X4GA 2CDAA 2ZCUA 2WYUA 3ROQA 4DL9A 2HU2A 3KEQA 1ZJYA 1VKNA 1D1TA 1UDCA 3QA9A 1ZCJA 3QQPA 2AW5A 4M55A 2AEJA 4RQTA 3QVTA 5AXAA 2W98A 3WX0A 1UDAA 1QORA 5F1PA 4CODB 3P2YA 3U0BA 3Q11A 5JYDA 4H15A 3OMLA 5BSGA 3WSWA 5L3ZA 1K5HA 4NU6A 4ALNA 1PSDA 2C54A 1B16A 1U3UA 1U9JA 1J4AA 4RF3A 2Y99A 3WGYA 4NBWA 2DTDA 3JD2A 2W90A 4DIOA 1DOHA 2Z5LA 4E13A 4E2WA 5L4SA 3KYDB 5LDGA 1GEEA 3FF4A 2GZ3A 3FPCA 1PGQA 1JW9B 4BKRA 4DGSA 3H3FA 3LT1A 4WLOA 4B7UA 1J0XO 4CPDA 3I4FA 2B4QA 5GZ6A 1HZZA 1BW9A 4OL9A 2PZMA 4UUPA 3ZWWA 4ZJUA 4MINA 5LDHA 4CQLA 1DAPA 3RC1A 3Q3CA 4ROSA 5KJ1A 4IBOA 3H5NA 3PDUA 1ADFA 4J91A 5I9NA 1K2WA 3GVCA 3LF2A 4NIMA 4YCAA 1P3DA 3C8MA 4FIZA 3DQPA 1KYQA 4AICA 1GFSA 3ABIA 4CR7A 1O9BA 2IZ0A 1WNTA 3GLQA 1EMDA 2FMUA 3C85A 1V9LA 4U0JA 1SB8A 4DPKA 1HDRA 1F06A 4RVSA 1XLTA 1Q1NA 5G0SA 4AJHA 1ZFNA 4CMIB 1Y5MA 5T5QA 4B79A 1IYZA 2X22A 4J4HA 2HKIA 4PLFA 1P33A 3KVOA 3L0DA 4A73A 3ZWAA 5JDIA 4J0EA 1PGNA 2AA3A 3HN7A 1ULUA 3WS7A 3F1LA 1LUAA 3O9ZA 3DO5A 4EBFA 5FFFA 5DCUA 1Y8RA 2EJVA 4WASA 1NBOA 4K26A 1R0LA 1PJTA 3HDQA 3PLRA 3EW7A 1MV8A 1LDYA 1GQ2A 4Q9NA 5KVVA 4YDRA 3OHSX 1LDMA 3OP4A 4YA6A 1T4DA 3RSHA 2GD1O 2Y0DA 3ONDA 2VYVA 2X0RA 5B12A 4FDAA 2NVUB 1SCUA 3QJ5A 5KVSA 3NDIA 4A10A 3NAQA 4YXFA 4Q3BA 4J4BA 3ZI0A 2QHXA 1BXGB 3WYBA 2AMFA 2Y0CA 4GBJA 1AE1A 1B3BA 1EK6A 1MFPA 1PZFA 4K1LA 1PS9A 2RH8A 3IS3A 3BIOA 4HFJA 4J7CA 2AE2A 2AEMA 1SBYA 4GWKA 7MDHA 1NWHA 4RPGA 3D7LA 3GHHA 3S2IA 3RKUA 1Q0HA 5CDTA 2AQIA 2JCYA 2A35A 1NVTA 3QHAA 3GDOA 2J5QA 4D43A 4ALKA 3KZVA 3EDMA 4NBTA 1NNUA 1E1MA 2HRBA 3DTYA 3NDRA 2HJRA 2VN8A 3DHNA 4YJGB 3ZU5A 4JP3A 4N54A 5A9SB 4BNVA 4LVCA 3QSGA 4X54A 1WMAA 1O89A 3GNTA 4LGVA 4FB5A 3AW9A 1IY8A 3O03A 2GNAA 3CXRA 4BO6A 4HXYA 2OOSA 1KVQA 4GLLA 3TQHA 5CDGA 4I9UA 3JD4A 3IKTA 2V6GA 2G5CA 3KOUA 2Q1SA 1UAGA 1UXJA 3B1FA 1T24A 2CNBA 5DF1A 4LN1A 3S2EA 4PGFA 4PZEA 1O8CA 1NPTO 1EBUA 2GLXA 3AY3A 4YJFB 1PGOA 2NU7A 3EUWA 4BB6A 2E6UX 2BI8A 2NTJA 5DBGA 3SXPA 1OAAA 2Y1EA 5C7LO 4QX6A 4HADA 5U1PA 4MVJF 4ZD6A 1JWBB 2DLDA 4F6LA 4CLOB 2DFVA 2HQ1A 4LW8A 2RHRA 3ORFA 3QVWA 4XDZA 4CQMA 1P0FA 3WGZA 3TZHA 4R1TA 4XQCA 4D44A 3WNVA 4RPHA 1HF3A 1H94A 1LDBA 3N7UA 2RIRA 3CZRA 3ZWPA 3BHMA 1ZZEA 4G2NA 3UVEA 1GR0A 3OBBA 5JCJD 1CERA 1OC2A 3PJFA 3O8QA 4MPDA 4YT2A 3WSVA 3JQAA 1E7RA 3MCVA 3WB9A 3NYWA 2PY6A 2YQ4A 1VL0A 1I36A 5G0WA 2VNAA 5DCYA 4P4NA 2ZB4A 5MGBA 1HEUA 1RYDA 4KQXA 3AWDA 5I8WA 3FHLA 3MOIA 1XCBA 4BO1A 3HDHA 1PS0A 2Y1DA 4Z0PA 4WLNA 5JLAA 1ADGA 3E9QA 4KWIA 3WQQA 2D5CA 1EUDA 1I2ZA 1R66A 3OICA 4YBZA 3SLGA 1NFQA 1PJQA 5I7EA 3OSUA 3PGXA 4N5MA 1YJQA 3DB2A 4RF5A 4IXWA 3MTJA 3G1TA 2CD9A 1PQPA 4U0KA 1O95A 2XXJA 3FPLA 4MDHA 3ZV6A 3U9LA 3GGGA 3HQ4O 1Q0LA 1T2EA 3ASUA 1LLCA 4IM7A 1ZH8A 4FW8A 1R4NA 2X1HA 5U4QA 4EEXA 4UEJA 4GGOA 3P2OA 3H9UA 3RBVA 2PV7A 4ND1A 4M8SA 1SMKA 2X9NA 2OUIA 4BV9A 3G17A 2SCUA 3ROMA 3KV3O 2EKLA 5CDUA 3TL2A 3CSDA 1U2DA 2O48X 1UXHA 3PIIA 2VTDA 7ADHA 1G6KA 4PLYA 3ITDA 3RROA 3U4CA 4J3FA 1FDWA 1HSZA 1GPJA 2IDZA 5EPOA 1T1RA 5I7SA 1AXEA 2CY0A 4JJGA 2Q99A 1FMCA 3LT2A 1LA2A 4J7UA 3UUWA 3WICA 4EGFA 4OOEA 3ENNA 2PGJA 4H7PA 1BMDA 1ID1A 3KO8A 4IPTA 4JIGA 1PQWA 2QIOA 3OQBA 3K6JA 1P74A 1GAEO 4QFDA 4XIJA 1A4UA 1R15A 3FNFA 3IKVA 3W8DA 4CV1A 2P68A 5BNIA 2YHIB 3D3WB 3WMWA 2RHCA 4BNJA 4CLXA 1GZ3A 5JFOA 3RU7A 1V3VA 1XQ6A 1QLHA 3WYCA 2E48A 5B37A 3EZLA 3VOSA 1EQUA 4AJNA 2BKAA 1ZKMA 5I9LA 3JD3A 1YO6A 1E3LA 3JQ7B 1XG5A 4NBVA 2NVBA 2X0IA 2FSVA 3OQ6A 5T6BA 1DBVO 2GUGA 1K6JA 4ALJA 2H1SA 4QXMA 4AFNA 3LLVA 2Z1NA 3L4BC 4BO9A 2JD0A 4YT8A 4R5HA 1YOVA 1I2CA 1C1DB 4MVJA 1VSVA 1ULSA 2YV1A 4B4WA 1Q7CA 4NK5A 3IMFA 3ZU3A 4XGNA 4Z9XA 2NADA 4DVJA 4AJIA 1NAHA 2YZ7A 1H6AA 1JKFA 3I9JA 4OKNA 3FCOA 2X5JO 4RL6A 3BMNA 1LRKA 5TIIA 2J3JA 1E3JA 1F8FA 1Z45A 5EL0A 1MA0A 1P1FA 5F5LA 1YXMA 3B1JA 1MG5A 4XB2A 3NX4A 4E32A 3SJ7A 4XGIA 3R3SA 2VWPA 3CUKA 1MG0A 4R4JA 1CJCA 2B36A 4NFSA 4R54A 4E0BA 3MJEA 5IZCA 4GL4A 1WMBA 1IPFA 1XU7A 1PJSA 3L9WA 3PXXA 1HZJA 3E82A 4WE3A 2C7GA 4Z3DA 1NXQA 1I10A 1OOEA 1U5AA 3GUCA 2OP0A 4RO0A 1M66A 4ILKA 1HLPA 2VRBA 2VTEA 1BW9B 1YB1A 2Y66A 4KMSA 3G49A 1HE2A 3ENKA 3WGIA 3GMDA 4Z9FA 5DP1A 2NLOA 4NZ9A 1ML3A 4EI2A 2ZB3A 3ITKA 4CQLB 5KJEA 3AI2A 3VHRA 2YJZA 3QWIA 2O3JA 5KVQA 4DTIA 2H63A 4FPXA 1NHGA 4J43A 2P4HX 3D4NA 1PJ4A 3P5SA 2RAFA 4J1QA 4DA9A 1YS4A 4ITUA 3VZQA 3U5TA 4GSKA 1DHTA 1ENOA 5G4KA 2EKPA 3PQDA 5A9TA 3WOHA 4P38A 4BO2A 2ZK7A 3K2EA 4PCVA 3PIDA 3WWZA 4XR9A 4IDDA 4O0LA 4RVUA 4MP6A 5J23A 4QUKA 2H5LA 5A3VA 2G82A 3OIFA 3GUYA 5A03A 5JNLA 1I32A 4JNKA 4Y98A 3B20A 5JMWA 4XCVA 1M6WA 2CUKA 2DAPA 2JFGA 1G0OA 1GYRA 1S7CA 5ITVA 3G3EA 3JV7A 2Q2VA 2YW9A 4BNHA 5JDIC 4DBZA 4TMFA 3IDSA 1DPGA 1I3MA 3F6YA 4P4GA 1GUYA 2GZ1A 1MB4A 4OMUA 2YHUA 4LMPA 5IXSA 3ETEA 4GI2A 2YYYA 4CJXA 1DJQA 3TJRA 4K28A 3TZ6A 6LDHA 5KNLA 4YTEA 1DFGA 1G1AA 4MVJG 3RIHA 1A72A 3DZBA 1DC4A 4J49A 1I3NA 4AJ2A 1TVEA 4R3WA 2NM0A 4LISA 2W2LA 4DREA 2FP4A 3KLMX 3MJCA 4DMMA 3KXDA 1A4IA 3M2PA 4CM9A 4GQAA 4BNKA 3WR5A 1H6DA 1LDEA 5IDQA 2WD7A 2CFCA 3OEWA 4KTTE 4Y6RA 1B2LA 1E0DA 1PQUA 5JO0A 3GVXA 3RUFA 3PPIA 4DMLA 2C29D 2EHDA 2FR8A 3HZZA 3NJ8A 5IN4A 2AQKA 3E8XA 5L7WA 1H0KA 2FWMX 2Q46A 4J9UE 2J3HA 2X0NA 5L7TA 1TXGA 3Q9UA 4W7IA 4ND3A 4YJGA 1P0CA 4CR8A 4OH1A 4XJSA 2W2KA 5A9SA 1QYVA 4I5EA 2C5AA 3I1JA 1E7WA 4PLGA 3H8VA 4DQUA 4YR9A 3WGQA 2EW2A 5A1TA 3ROPA 4L4XA 1LQTA 2VHVA 3NTQA 4Z0HO 1YBMA 2C7VA 3GK3A 3KB6A 3RBXA 2IYPA 1DB3A 1PU2A 1H6CA 1GU7A 3PP8A 4PG8A 4YJFA 3RASA 4BMVA 3ETDA 4S3MA 4ZQFA 3RWBA 1CF2O 1PIWA 1SOWA 2OZPA 4OOFA 1RM5A 4RPLA 5DZSA 4HFMA 1U4OA 4A7PA 4RDIA 3DZJA 3C1TA 4CM8A 5JCXA 4CLOA 2J3IA 1NX6A 1XQ1A 2HAEA 1YJ8A 4M87A 4ZA2A 3RVDA 3PFFA 2AQHA 3HE3A 3TZQA 2O3QA 5B4TA 4OSPA 1Z74A 4NFHA 5F21A 1DJNA 1X1EA 3E48A 2O2YA 5G4LA 2FR1A 2EKQA 2ZTVA 5BNTA 4BB5A 1ZSNA 3WLFA 1X7HA 2G1UA 5AOVA 1WDLA 4DC0A 3ZWXA 4OM8A 5G2OA 4GKBA 3LDHA 3ICPA 4TSKA 3JQFC 4GX0A 2A92A 4ID9A 3GRKA 2BELA 1MXHA 2OHXA 1XDWA 3SC4A 3JCZA 3VDRA 4IDCA 3O8QB 4WCFB 4WCFC 3NT5A 4PLVA 3VZRA 1I24A 1JN0A 3GGOA 3K2BA 3MWDB 1JTVA 3X2EA 1ISFA 4KZPA 4WOJA 3RFVA 3VAZA 5JC8A 4WCDA 1ADBA 5A05A 5A06A 5I7VA 1R4MA 1ZEJA 3VPXA 1B0AA 3UXYA 4E6PA 1U7HA 1YQDA 1DC5A 2EV9A 3DHEA 3UH1A 4DYDA 1H9AA 1B14A 4OKIA 3WFJA 4D46A 1DLJA 2ZIZA 1QP8A 4Y67A 4RPKA 5HBRA 3WQRA 2PGDA 4BGEA 4Y8VA 4OIMA 3AUSA 1HT0A 3JD0A 3H2SA 1QMGA 2GSDA 3QWAA 5BT9A 3NV9A 3DZGA 4J0FA 4CMHA 4GX5A 1VKOA 1M75A 1GL3A 2IEDA 5EJ2A 4XGKA 1N7GA 2CDCA 1CETA 4ND2A 2B35A 1VLLA 4PLTA 4JCOA 2G76A 2IE0A 4HWKA 3I4CA 1V3UA 4KUHA 4PIVA 2I5PO 4BNNA 5T57A 5DULA 5JY6A 5IXYA 1S6YA 4CV3A 4W7HA 3OM9A 2BLLA 2FN7A 2NU6A 3ZHYA 2AQ8A 3JYPA 3VPFA 2BFOA 3D3WA 2ZTLA 4YRAA 5CDYA 3OEYA 1E7QA 5DN9A 2Q3EA 1HYEA 1ZIDA 3U3XA 2VT2A 4BO7A 3AOEC 1V0JA 4FOOA 3VH1A 8ADHA 3KM0A 4DUPA 3EYWA 2O2SA 1QR6A 2POQX 3HJAA 5FYDA 4FFLA 5TT0A 4FC7A 1OFGA 1N8KA 1GV0A 4NJMA 4RF2A 4I5FA 1TT5A 3VPGA 5CEFA 3MJTA 4R1SA 4RVHA 2OL4A 5FI3A 3JQ7A 2IZ1A 4U8GA 3ST7A 4QSMA 1C0PA 4BNWA 5BNFA 3L4BA 1YGYA 4TZTA 3BAZA 3IL2A 2OBNA 2DQ4A 3VKUA 3PJGA 1C1DA 3HFGA 1ZW1A 4JGBA 5KWEA 4KDFA 3TN7A 2D5AA 2DBRA 2UUPA 2PZLA 4L0QA 3GDFA 4UVHA 4J2HA 4XYEA 4CL3A 2VOJA 5L95A 4BOYA 5L4NA 2O3UA 2Y1FA 3PWKA 5EIOA 3JSAA 2PR2A 2EERA 2RCYA 3LZ6A 1YOVB 3RKRA 3DHYA 5JAMA 2UUOA 3A28A 2BF7A 5FI5A 1SC6A 2X7HA 2VRCA 5A5FA 1DC3A 3GN2A 1ONNA 1EFKA 1LDNA 3OJLA 3H9GA 1ENPA 1LLDA 2PNFA 5BSHA 1BGVA 3LC1O 4NHEA 2HRZA 3BMNB 2A9FA 1L1FA 1DFIA 1YB5A 2NVWA 2JJYA 5DT9A 3H7AA 3L77A 1BVUA 3ZV4A 1ZSYA 5K0ZA 1KVTA 3QVXA 1P45A 1VL8A 1ARZA 4EUFA 3QW2A 3PJEA 3K9QO 2FPPA 5ICSA 5IZCC 3ZN2A 1D1SA 3I6IA 1LXCA 3RUAA 2D59A 2BGKA 5A5EA 1DIAA 4HX5A 4PG6A 5ADHA 1SB9A 3EVTA 1LNQA 2LDXA 3O38A 5JS6A 1TB4A 5HWSA 1AHIA 2FOIA 5T64A 4BO3A 1DXYA 1QYCA 2ZTMA 3VTZA 4Y9DA 2P91A 4E30A 3HG7A 3GHYA 4R9SA 4ALIA 2AXQA 4UAGA 1I0ZA 2GRAA 4JBHA 4CM6A 5IDXA 1U1IA 2HJSA 2CSUA 3RBZA 2Q1UA 2NU8A 5JMPA 2WMDA 1GQQA 1Y7TA 4JXKA 3K31A 3DC2A 4ZICA 4L73A 3SBOA 2Q4EA 3VDQA 1BXKA 3ZU2A 3PHJA 4E5MA 1XHLA 3GRPA 3GVHA 3CKYA 4HNGA 2B4RO 5G4KB 3M6IA 2J5RA 2PD4A 3BMOA 1LDGA 2ZATA 4B3IA 2DC1A 1EK5A 4WLVA 4DLAA 4G5HA 5JAZA 4R69A 4O1MA 3JQ9C 4J16A 2PKRA 4TRRA 2YY7A 3RFTA 4I5GA 3DMYA 2Q2WA 4MKRA 4PLWA 3GT0A 3K5PA 4M49A 4IMPA 3HHPA 4Q3AA 1YQXA 1Y6JA 1ADCA 5C7OO 5F3RA 4E4YA 4CMKA 5HS4A 2B69A 4GAEA 1X13A 4L9RA 3H5RA 4MKZA 3OH8A 3GQVA 3W8FA 2GPTA 4HFRA 4I5DA 1KIFA 5THKA 3W6ZA 3WJAA 3FBGA 3ZNOA 4OAQA 1JU9A 4L8VA 1LLQA 1E1NA 3HUDA 5I9MA 4OYRA 4MOWA 1I8TA 4FJ0A 2HK7A 4R3NA 3ZNNA 4XRRA 1XIVA 2WD7B 2DVMA 4GWGA 1K0UA 3DMTA 3FTNA 3M2TA 4QFCA 4BVAA 3H9JA 2QW8A 1AN9A 4D0RA 3IAHA 3KTDA 4WLUA 1MXFA 1LQUA 4PLHA 1AHHA 1UXIA 2VYVD 3UW3A 1IPEA 4KP7A 1Y9AA 3FRJA 3STHA 3T7CA 1GY8A 2D0IA 3V2UA 2Q1TA 2VHWA 3UKOA 3DFZA 1I2BA 3OJFA 2P2SA 1N9GA 4Q39A 1EVZA 1QRRA 1ZJZA 1NWCA 2W2KB 5L40A 3Q2KA 3AOGA 4L76A 2Z1MA 4YB8A 3WDSA 1H9BA 4AJLA 3E03A 1PEDA 2JHGA 4LRTB 4W9NC 3KBOA 1YVEI 3FBTA 3K96A 2X6TA 1FDVA 4WOKA 5L4LA 1N1GA 1X14A 3MOGA 1XA0A 3ZWMA 2Y0EA 3BYZA 2Y68A 5JE8A 2C5EA 4J1SA 3I9NA 2BFMA 2I67A 2D2IA 4BO5A 1Z7BA 3RC9A 1K89A 4JBGA 3UICA 1CYDA 2PD6A 3SVTA 4NPCA 1E92A 4FFMA 5BSFA 3CE6A 4H16A 1QYXA 5DCWA 4IY1A 4CM8B 2WM3A 3GEMA 4W6ZA 3PHLA 3WFIA 2ET6A 3QV1A 3EHEA 1SEVA 4N7RA 2BD0A 4D7AA 5JC1A 1KC3A 3EK2A 2X58A 1HSOA 1LJ8A 2WD8A 5KJ6A 3JQFA 4AJEA 3GH3A 1B7GO 3RI3A 4IDFA 4L4SA 4YPOA 3PWZA 2I65A 4QEDA 2JCVA 3JD1A 1ZBQA 2ZB8A 4WCFA 3D5QA 2FY8A 3A1NA 1KVRA 1TT7A 2CMDA 4TRJA 5KJCA 3QWBA 4GKVA 4R9RA 4XKJA 4ESOA 4CQMD 4UUNA 2Q2QA 5L45A 1IB6A 3ADOA 3WBFA 3GDGA 1RWBA 2RH4A 2BGLA 5ILOA 3UHAA 2P4QA 3GY0A 2DUUA 5KKAA 4J1NA 1BG6A 4IDBA 3AM3A 5TT1A 2HDHA 1R4MB 3IUPA 1DLIA 1X0VA 1EBFA 3JQAD 4ZQGA 4UVGA 1GCUA 3TFOA 4FFOA 5IAAA 4J1TA 2WEKA 2HK9A 4O6VA 4LRSB 4BHTA 3CPSA 3C1AA 4OHUA 2IEBA 3NDJA 4YVFA 1ZK3A 2UYYA 2YV3A 1GZ4A 3F9IA 3HNPA 4FFPA 4IJVA 4F45A 1LSUA 1BHSA 4RVGA 1OBFO 2VHYA 2VUTA 4CM1A 4WNIA 2WJPA 5C37A 2ZKLA 3KUXA 2PKQP 1B8UA 1EDOA 4BNZA 4D3SA 4R16A 3S2GA 4GVXA 5HTOA 4N5NA 3K92A 4B8ZA 3X2FA 2XPCA 3IIEA 3L4SO 5KTKA 1WPQA 1HE3A 1DIRA 1HETA 3AOEA 2X9GA 4M89A 3F5SA 2QQ5A 4L75A 3DAFA 2C20A 4R5MA 4TKMA 4BQRA 4L74A 3HWRA 4E5NA 2B5VA 1Y5RA 2C82A 4JK3A 3DEYX 4BV8A 2D8AA 2TMGA 3DWFA 3B70A 1BRMA 4FFRA 1AUPA 1KEUA 2ZQYA 4TZKA 5C3MA 4TRNA 3BMQA 5EESA 1HYHA 1F17A 2JAHA 1YBAA 1DRWA 1GADO 5ICMA 5TJ9A 4B4OA 5A04A 3TF5A 4Q3EA 4NJMB 1TT5B 3DBVO 2P9GA 3CMMA 1AXGA 3DR3A 5EN4A 4WNCA 1UZLA 4WEQA 1IHYA 2I9PA 4UVEA 5CG2A 2AEFA 4BNFA 2UAGA 4OJNA 4BMNA 1E3SA 3DZIA 4G81A 1ZMOA 4CUZA 3UCXA 5C5IA 3RUCA 3PFWO 4W82A 4J9VA 2V6BA 5MDHA 1GD1O 1U3VA 1UXGA 2X86A 4NNJA 4I9NA 3ZWCA 5DDIP 3FR7A 3PYMA 2EJWA 4OO3A 3AJRA 4PRKA 1PS8A 1CQIA 4PVCA 2WTBA 4F6CA 4KOAA 4BUCA 1EVIA 3C24A 3P19A 3VVBA 4EITA 5KIAA 4CM3A 1UZNA 4E3ZA 2FSSA 2NQ8A 3BMCB 3NKLA 3I9MA 4MVJD 3RUDA 1H2BA 4RJTA 1FXSA 4MIYA 1UP6A 1DIBA 4ZN6A 4E2XA 2NNLD 3HDYA 1YB4A 1HDGO 3KSZO 3VVCA 4B7CA 1L7EA 3D4OA 1ZSVA 2OORA 1SEPA 1ZEMA 2DUWA 4CMEC 3I3OA 1PJBA 4B4UA 1YRLA 2HMUA 4MVJH 5AXCA 4KQWA 4CUKA 3GNQA 3LVFO 4XYMA 1P1HA 4F3YA 3ONEA 4EYEA 4FFNA 5TX7A 3KEOA 2OFPA 3C7AA 2O3SA 1DRUA 4DRYA 1V6AA 1H93A 4B3JA 4CM4A 5IG2A 2V6MA 2YUTA 4IIUA 2HMWA 3EGOA 4WLEA 4AJOA 1XSEA 4YQZA 1YL6A 1CEQA 1PL6A 3DZKA 3L6DA 2P9CA 4MO2A 1UDBA 4Y6PA 2EF1A 4RVFA 5JO9A 3GVPA 3PQEA 5GZ3A 3GZ4A 3MZ0A 3W4JA 2XXBA 3W8EA 2FZWA 1X15A 3FTPA 3O4RA 4XYGA 2CDBA 3JQ9A 1P1JA 4K6CA 1O0SA 2VNSA 3DAGA 4QQRA 5CDSA 4QO8A 2E49A 1EE9A 4GVLA 3BMOB 3UFXA 4XYBA 4DXHA 2QX7A 3P7MA 2NSDA 4UVDA 2EP7A 2NWQA 1ONOA 4N5LA 4CLRB 3EVNA 2W8ZA 4ONEA 4FN4A 2DPHA 2B4TO 2DTEA 1EE2A 2X5OA 2QRKA 3BTOA 4BNTA 4JN6B 3ZV3A 2CF6A 3SEFA 2EIHA 4YAKA 4RORA 2E37A 3ANMA 3GAFA 3IOYA 2P5UA 1HWYA 2XF8A 3E18A 3KYCA 4UEOA 4EJ0A 4EJMA 5AQ1A 3WXBA 1E1KA 1EFLA 1NR1A 3ZWBA 3ZV5A 3RJ9A 4RPJA 4DQXA 5IN5A 1XELA 2IXBA 3DBRA 1W73A 3OF2A 4YYZA 1CIVA 4RCVA 1KETA 2Q45A 1V35A 1P31A 4U6QA 4CMGA 5T8KA 1EZ4A 2HLPA 1NFRA 4E5YA 3KETA 1B15A 2C2XA 1JAXA 2D1YA 4I8XA 3GZNA 1YQGA 2VHXA 2O3TA 2WE8A 3I52A 4PLPA 2I3GA 1VE9A 3Q1LA 4Z9YA 3DMTC 2VZ9A 1RM3A 2W2LD 3VTFA 3AUAA 4IXTA 1T26A 1P44A 5ITWA 4CM9D 1QSGA 5HS6A 3U4HA 4C4OA 1LSJA 1MX3A 1V8BA 4NK4A 3QE3A 5HA5A 3TL3A 3W4KA 3WGGA 3T4XA 3JQEA 4W9NA 3I9LA 3AFMA 2VYNA 3TDKA 1LLUA 1UP7A 2GDZA 4ZQHA 1N9GB 1HDZA 2WYWA 3K30A 3E9NA 4RZIA 3VPHA 4AG3A 3ZNPA 4DIFA 3JYQA 4K6FA 3SX2A 1ONPA 5JXWA 2O7SA 3PZBA 1T2AA 1ISMA 5AYVA 3RD5A 2O50A 4D3DA 5CEJA 1HRDA 5JBIA 4KUEA 4XDYA 4KWHA 2NQTA 1P77A 2GGSA 1T2DA 1HXHA 3C1OA 4GX1A 2HSDA 1DEHA 4NDNE 3IC5A 3IJRA 2B83A 3BHIA 1GEGA 2X8LA 4AJJA 2J6IA 3DBHA 3H5AA 1P1RA 2GO1A 1ENZA 3I23A 4AL4A 3OJEA 5L53A 1RM4A 3S55A 4JBIA 5H81A 2C59A 3GAZA 4IUYA 4YAGA 3GF4A 1EUCA 2VZ0A 4P4LA 4KDEA 2CVOA 2NACA 3JQ8B 3ULKA 1D4FA 1NPDA 1W8DA 3MTGA 3VZPA 4BL5A 5IJZA 4JX8A 2IXAA 3PRJA 1WVGA 3PK0A 4MJLA 3ZWYA 1ISGA 4BGIA 4QECA 1U7TA 3I5MA 1LSOA 1FJHA 4Y6SA 2PFGA 2FR0A 3BTSA 1T1SA 3WGTA 4DWVA 3INTA 4NBUA 2ZJ0A 4JJFA 3DAPA 3NRCA 3RAJA 3DBLB 1VL6A 5K9ZA 4AJ4A 1XR3A 3JYLA 1N2SA 2GN9A 1UUFA 3GEGA 2IODA 4IDGA 4P8RA 4IZIA 1I30A 1NHWA 1Z82A 1MUUA 1UR5A 2FPIA 3O26A 3CTMA 3K73O 1GCOA 1X0XA 3H65A 1BWSA 4Q3NA 4AJPA 4PFJA 3JQDA 1LEHA 3QVOA 3GG9A 1QYDA 5ILGA 3TSCA 4HNHA 2Q4BA 4M1QA 2VUUA 4FR5A 4GMGA 4ZU3A 1RKXA 3LT0A 3PTZA 1LX6A 3QWHA 4ALMA 1KY4A 1VSUA 1M67A 5KJFA 1JWAB 1K6IA 1KOLA 4IS3A 3S2FA 1LC3A 3W4IA 3NUGA 5IZ4A 1K3TA 2VOEA 1I33A 2G0TA 3AUUA 2WE7A 1C1XB 2FPGA 3AM4A 3SJUA 3GMSA 1JLLA 1PWXA 4GMFA 5JAQA 1EDZA 3S8MA 4H3VA 3NTRA 4LCJA 4OGWA 3BXXA 3NTOA 3RFXA 4XIYA 3F3SA 1R16A 1CWUA 1YONA 3ZWOA 1L7DA 4BNGA 3G79A 3VH2A 3JQBA 4CM5A 4XQEA 3GOHA 2XAAA 5TQVA 1D8AA 2JFHA 5I8ZA 1H2HA 4BIIA 1W4ZA 1CQJA 1A7AA 4HUJA 3WIEA 1C0LA 5A9RA 2PLAA 2B5WA 2BFAA 4GH5A 5T67A 4NFYA 5THQA 2DT5A 1PZGA 1PJ3A 2EGGA 3BMQB 4PG5A 1BXZA 1TEHA 1U3WA 2O4CA 3ZWNA 4HV4A 3H4VA 5CP8A 4XRGA 5DOZA 1HDYA 1I01A 4RF4A 4GX2A 5JDCC 1XEAA 1GZ6A 3IP3A 1WP4A 1IE3A 2AE1A 1NQAO 3DOCA 3BZUA 1WWKA 3WGOA 3U49A 4RGBA 4WJZA 2F00A 2FHSA 3QRWA 4XA8A 4TKLA 1Z6ZA 4KUGA 6ADHA 3HDJA 1TI7A 2GN6A 2WYVA 2ZQZA 3E6AA 3V5NA 1P9LA 3F5QA 1HTBA 3KSDO 4UUOA 3TNLA 3BMCA 3PI7A 4RLHA 2Q50A 4NG5A 3G1UA 3EMKA 2NUAA 1JKIA 1RYEA 1F12A 1N92A 5BR7A 3PZRA 3NGXA 1WAMA 2Q49A 1T4BA 1ZXBA 1C3VA 4IS2A 3R0IA 4LSWA 5EQDA 3KYBA 4CMEA 5FF9A 1A9YA 2IRWA 4HP8A 1GUFA 3PWSA 4IIVA 4BQPA 9LDTA 1O5IA 1VPDA 4MP3A 4U7WA 4WGGA 4PG7A 2QZ9A 4YRDA 2VRCD 5ES3A 5GY7A 1I3KA 3U09A 4NH4A 3JQGA 1ORRA 5HRUA 1O94A 3RC2A 1M6HA 1KEPA 3D64A 5ER6A 3WWYA 1A7KA 3L07A 4EZBA 1FK8A 1W0CA 2D3TA 4GLOA 3V2HA 1DIHA 4XD2A 2CVZA 2GASA 4AJ1A 4PZDA 3WG9A 1R0SA 2DKNA 2HMVA 3ADPA 3CH6A 5BQFA 4IQGA 4D42A 4CM4B 5JYEA 2GZ2A 2HK8A 1SOVA 4E5PA 2VT3A 1RPNA 2C2YA 2ZCVA 1YWGO 4II3A 3KHUA 3KLPX 1ZK4A 1JVSA 2UV8A 4TQGA 3GR6A 2PD3A 2PH3A 4BNYA 2JHFA 4CLRA 2C07A 1E7MA 5IFLA 1VJ0A 4A26A 3GG2A 1MP0A 3ZH2A 3Q0EA 2EP5A 4CR6A 1YE3A 1A27A 4TVOA 4IJWA 3FI9A 2OP1A 3R3JA 3ZU4A 5A3JA 5B4VA 1PGJA 3ZW8A 3NEPX 4IGFA 1UZMA 4GGPA 1GQYA 2O4UX 5ENVA 4DBVO 2J3KA 3JYNA 4KTVE 4EUEA 2VUSA 3U4DA 1F0YA 3L6EA 1XWFA 3ZWVA 1QG6A 1P1KA 4QO7A 3FNEA 3KYCB 2BMAA 3IQDB 1J49A 2HMTA 3OIGA 1B3RA 1QYWA 1UAYA 3HFSA 3MWEB 5L51A 3V1UA 4PN3A 3PYLA 2CZCA 4UEKA 1EEHA 3D4PA 4B4VA 4XYLA 1KC1A 3BTVA 3DBRB 4D41A 1UJMA 2YFHA 1VJTA 3GPDG 4J4TA 4WKGA 3TOXA 4E31A 2DBQA 1TA4A 5F1KA 3BHJA 2A94A 5TS3A 5T8KC 5F1OA 1XU9A 3WBBA 3LF1A 4A2CA 5U9CA 3H9EO 3GZNB 1E7SA 1NAIA 1FF9A 4IDAA 2JCXA 2YDYA 3QP9A 4HFNA 5A4DA 1Q0QA 2C0CA 3Q2IA 1LI4A 4XEHA 5FEUA 3C3XA 2VWGA 2Q1WA 1JKJA 3FWZA 5AVOA 2BGMA 3QY9A 1U2GA 1M2WA 1WXDA 1X7DA 2X9VA 2GERA 2X5KO 3ONFA 4NJOA 4ZHSA 2I76A 1UP4A 2DPGA 2X23A 4PVDA 9LDBA 1BVRA 2EEZA 4DIBA 1PX0A 3LLSA 1NYTA 2J5KA 1U8FO 3LU1A 1VC2A 4O59O 4C7KA 3DOOA 4CV0A 5B1YA 4YEDA 4O5OA 2VHZA 1J6UA 2D4AA 4DC1A 1YKFA 2DBZA 5TC4A 2PK3A 4TROA 1YDEA 4ZRNA 3GN1A 4UVIA 2QYTA 4YJHA 3W6UA 4NU5A 2I3AA 5IF3A 3E1KA 2H6EA 2VCYA 4D45A 2PGLA 3Q9NA 2Z95A 4OQZA 4E2ZA 5K6AA 4HKTA 3U62A 1GYQA 1W6UA 1N1EA 1XGKA 1IZ9A 4A0SA 1DHRA 1R0KA 3DBHB 1HDOA 3JQ8A 3DOJA 3IJPA 1NQTA 2OXIA 2ZYGA 2OGUA 4MP8A 1WLYA 2EW8A 3H6KA 3HB5X 2HCTA 2VWHA 3IUSA 1NP3A 5JCJA 3PGJA 3OQ1A 5DNAA 4YWJA 3PVZA 4R01A 3ANLA 3SC6A 5GMOA 4L4RA 4ZQEA 4Z6KA 3TWOA 1LRLA 1IUKA 4NR0A 1E3EA 5EQFA 2ZYAA 3VC7A 5JY1A 1PJLA 1PJCA 3UAGA 1HE4A 2QZZA 4CMBA 3ZZNA 4E21A 2TMDA 4J2OA 1DC6A 2AG5A 3DBLA 3ZDFA 1E5LA 4P22A 4WUVA 3TPCA 1KVUA 1B8PA 1NVMB 1HL3A 4RV9A 1NPYA 1HLDA 2E82A 1SO8A 2B0JA 4XQGA 4XR4A 3B1KA 3HB4X 3G0OA 1HE5A 4EDFA 2NU9A 4URFA 1QLJA 3CEAA 1ZO8A 4W4TA 1PZHA 2JFFA 4TWRA 5EERA 4DPLA 5CEEA 1XYGA 2JKVA 1ZMTA 2R00C 3SLKA 3JQ6A 4FD3A 1X1TA 3RJ5A 1BTOA 1KBZA 3ICCA 2BRUA 2DTXA 2V7PA 3ROKA 4F46A 4UUMA 4N18A 3FWNA 3A14A 4Z3KA 2YV2A 1U3TA 2W4QA 2R2GA 3E5MA 4CM7A 1K6XA 3WNQA 4Q3CA 2BI7A 3PQFA 3OA2A 4I1IA 1E5QA 1TLTA 1C1XA 1DIGA 3EY4A 4MIOA 3PEFA 1MC4A 2NTVA 4IDEA 1NVGA 1KEWA 4YJDA 2PWZA 3WJ7A 4EJ6A 2JD2A 3VKVA 4WECA 1U8XX 2O3RA 4FQ8A 2YFQA 4I08A 4RLSA 3TRIA 2J8ZA 3AU9A 1V3TA 3F4BA 3FNHA 5JAIA 3AI1A 3CZMA 3E9MA 5C7IO 4ALLA 1ISJA 1DAOA 4BKUA 2NTNA 2PH5A 4IZHA
chains in the Genus database with same CATH superfamily
2JDID 3QBTA 3GEDA 1FNBA 2V55B 3TZKA 3D8SA 2PAFA 1W94A 1CUVA 4MI1A 1U4SA 3H1FA 1LJUA 2D5IA 2XUFA 1E2MA 2VEDA 2ZR9A 3A4TA 4UULA 3FFXA 3JQBC 1Q2XA 1NW4A 4UREA 3AESB 3N2IA 4KI7A 4NNOA 1QQ6A 2F3QA 3QG5A 1OLXB 2PA3A 2WWRA 3EC7A 5JDCA 4G97A 4P0TA 2OQRA 3K6SA 3GGDA 1NXWA 4I50F 4ESVA 2XAUA 1VIDA 3PHIA 1WZIA 2ID4A 4JJAA 1ISHA 2VATA 4PPQA 1F2UB 1UDXA 2WWVD 3TBKA 2GCNA 5A6SB 5C0OE 3V8BA 2OD7A 2CXPA 3H2YA 2JFPA 4MJXA 5HCIA 1W4AA 2EP8A 2Z6VA 3PFIA 3LKZA 1IULA 1PZEA 1SD2A 2SNIE 2BV3A 5E38A 1Q3HA 3UMFA 4AWXA 2IPXA 4PTYA 4N76A 3B1ZA 3HJHA 2XEXA 3BQNB 3NBXX 4IRXA 1CUSA 1LTHR 2N1MA 3OPXA 5HQJA 2GZAA 5CB6A 3V33A 3VC3A 3T3OA 1AKUA 2C2ZA 3V8VA 1BWRA 2A1TR 2GPSA 4WXMA 4B8YA 3OETA 2YXBA 3QMMA 3CIFA 3OPYI 1NR7A 2H08A 4KRGA 4I6JA 4WKBA 4ZQBA 5B1HA 3LVBA 3N9IA 4JUIA 5BQ3A 5KCZA 2EWVA 4DZTA 3UCEA 4DQVA 1AKTA 4NQZA 3B6JA 2FRDA 4OHRA 3Q3IA 5ELLA 2RCNA 2XQJA 2YR0A 1RYYA 2Y77A 3TEJA 1LRJA 4J0HA 5IC4A 2WM9B 4MK4A 4OQXA 4MR7A 1OV4A 5T4FA 4NBRA 1DV1A 1Y1TA 3NBMA 4G56A 4OHCA 3RSZA 3U5ZB 3OWOA 4CIAA 1MC1A 2GF2A 3JZFA 5CAEB 1YL5A 3LDAA 4GBMA 1R0CA 1N5LA 3P8ZA 1C7ZA 1KE1A 4D79A 3TR5A 4ER3A 2F55A 1ZM3A 1CUIA 4GMXA 4RHFA 4CLHA 4ZJYA 2HNBA 3PKZA 5KX5B 1Q7GA 3P9ZA 1Z5GA 2A7XA 5JPIA 1Z6TA 4I4CA 1KHTA 4OSOA 1EZZA 2Q3LA 1GDHA 1JPJA 3IB6A 3NT2A 4RD2A 2OUKA 2DPLA 2WABA 3W3AD 3DEIA 3PNQA 4MUJA 5KOIA 1PNRA 3ZHBA 3QEKA 3NJ4A 1L5YA 3A37A 4BMSA 1C0KA 4FKMA 2EWMA 5FLKA 1YZHA 221PA 3FVTA 3DZHA 4E7OA 5J2TB 1XNQB 5E1BA 4LV8B 4R1NA 3TECE 1ZKDA 3M1LA 2GCIA 4G4GA 4D3XA 1SKAA 3G89A 3IQEA 1EQAA 2XHEA 3UCFA 3LUKA 1AGPA 3WMFA 3R8CA 1W0KD 4M9SA 3STUA 3W3AH 3RQSA 2DFPA 1TAGA 2FN8A 3BICA 4QDUA 3ZLBA 4ZVSA 3MJSA 1M2JA 1SR8A 3GA5A 3WGKA 1MB0A 1YFZA 4GDMA 3U9SA 3D6JA 1Z6QA 2OV8A 2EG9A 4MIEA 5ESRA 4CBVA 4NX2A 2GCGA 3WYEA 5BMVF 2GPWA 2F1KA 5B30A 3M1AA 1IOLA 2WLTA 1T91A 3OD5A 3D3EA 4B3HA 4DLBA 2H9IA 3BA1A 1D4ZA 3LOUA 4ZAXA 3FOWA 4CMIA 4CUJA 3K4QA 1QH8B 4KMRA 4D3FA 2QVXX 4EEZA 1R27A 4AMYA 2GN0A 4UTXA 5IASA 4ZC1A 4PLZA 3HCBA 1XDZA 5CHEA 3C14C 3TRJA 5F5NA 4ZXPA 3GNSA 4DSTA 1MRZA 4AB1A 2P2CA 4B3GA 1EP3B 1N1DA 4UKDA 4XGRA 1PGPA 1WO8A 8LDHA 3INRA 2R8RA 4TMZA 1IG3A 3CUSA 1UPUA 3NHZA 4GSLA 2ZI7A 3AP2A 2X2OA 3SCZA 5HX7A 4O63O 2WQZA 4CKBA 1PL7A 2QG9A 4JFAA 1FMTA 3OEEA 2VSFA 4P3OA 3IDFA 3MCTA 2PX5A 3OT1A 3R1IA 4KVFA 5KYVA 2GXUA 3TTSA 1ULAA 5BQXA 2CXNA 1J24A 2M6SA 1ITZA 1HYGA 1FDTA 1M2EA 3Q0IA 1SNYA 3GYGA 4J90A 4JROA 4RJKA 4YAEA 3VPAA 4D9KA 1UBOS 2GPAA 1E79D 3KXKA 4C89A 3ZVNA 2PSHA 5B7GA 1QCCA 1RACA 3TIVA 1R6DA 2GXSA 3C8ZA 3IHWA 1Y8CA 3R5JA 4M7RA 2H3HA 2NVUA 4LVUA 4Y1FA 2XXAA 3BMXA 2I66A 3JVDA 2E4AA 4FVTA 4QJIA 2NPIA 3JAWB 1BX1A 1Z26A 4MRMA 5TQ0B 5CLHA 3TLZA 2JFNA 3V8MA 4G37A 3SZOA 2C98A 2P4UA 1WETA 1DQPA 1YZKA 4IFBA 3TCKA 5HF8A 5I51A 3IMGA 2ZI6A 2ZW9A 6YASA 3AL2A 3OTGA 3I45A 3GGPA 2IXGA 3WGJA 1R18A 3U0VA 3VH3A 1RLMA 1YVRA 2QA5A 4E07A 1B6GA 3H2ZA 1K5DA 1ZK1A 2DX7A 4M86A 3J7AC 2JB9A 1QRUA 2B8NA 4I2VA 1OZAA 4MW1A 3GRVA 3B9PA 1R10A 2IUEA 2J9YB 3AY6A 1N8SA 3L0YA 4FOSA 5CT5A 4QT0A 4BKOA 4BWYA 4F4FA 1TK3A 3BRWD 4KHZA 1EVLA 3CISA 3ZDRA 4FNOA 3LPLA 4A03A 4DLSA 5CDFE 3AJDA 2IDKA 3E22A 5KPDA 2DB3A 3AM5A 3B36A 5CVUA 5SZHB 1QGUA 3MA0A 4GI5A 3GLFB 5BP7A 3BDAA 3SYNA 4Z99A 2JCSA 2AFVA 4JUDX 2WOOA 2XOXA 3TZBA 5EUBA 5FO0A 5M3BA 3ESDA 4IGKA 3A1UA 4NOMA 4DCJA 4HLUC 1PFWA 3RFCA 1MV5A 5FT9A 5CA1F 2K6GA 4MB6A 1EG7A 4DJFC 3T5PA 2VYND 4F4UA 3EULA 3BN3A 3LSYA 1ID8A 4L3OA 2E87A 5ADUS 5TVKA 2OBLA 2RKBA 1JFFA 3KPJA 3R4VA 5A4JA 2WPDD 3P9PA 3F74A 1FUYB 4OHBA 1J39A 1D9XA 1JIIA 1MO2A 1H5QA 2JF0A 2P7HA 2HO5A 1X74A 3LQFA 3NH6A 3H1BA 2YN0A 3DW3X 4L51A 4D0SA 1SIBE 1SUFA 2ZYVX 2DU8A 3QWFA 3A26A 4MMZB 4UXIA 4XTRA 3T7EA 2H1OA 3LCRA 4GLFA 2G17A 5IVKA 4B6JA 1YULA 5LZ8A 2EBHX 1IL0A 1DXHA 1ZK0A 4M1KA 5EZYB 4YPFA 4CEJA 3EJ6A 1P7WA 1BYUA 3CMCO 2QGFA 1L7RA 1Z18A 1GL9B 1W49A 2ASVA 1Q20A 4NCHA 2ZT7A 3CUVA 3DCJA 3FNBA 3A6ZA 4ZEOA 5AVYA 1QHSA 1MNQA 1VGRA 1R12A 2VQ3A 4JI3B 3K72B 5KWIA 2FPWA 4P2GA 3Q7RA 1S2LA 1E1LA 1UBLS 3IPCA 1KZ4A 2Y05A 2DM6A 2ZYDA 3DYIA 1RP1A 3FMVA 4G26A 4G4SO 4I14A 4N82A 2CVHA 1V7PC 3RU2A 2G5TA 1AC5A 2R00A 1A5SB 1JIVA 1Q0RA 1RNLA 1YDFA 3AILA 3F4LA 4GR5A 2JPDA 4KLZA 3OMWA 2PGXA 1ZOLA 3JZMA 1P5FA 5LXTF 4AVYA 4KNYA 5KDOA 3UO8B 1AS0A 4RGQA 3GJQA 1KZ7B 1LS6A 3PE6A 3FDZA 4JT8A 1E6WA 2FN4A 2EYQA 2IUFA 2V5VA 4XLZA 5COAA 2FF5A 1T2FA 5BYKA 2CN1A 3MN1A 2QJWA 1SQFA 2X8WA 1IAQA 4DG8A 2LDBA 5JHGB 5LMCA 1N5OX 2HHHB 1UZUA 3GCGA 1F0NA 1OLSB 4N6GA 3PPWA 2O8DB 4PU0A 3C6XA 1HT3A 3T3NA 4PYIA 3FNGA 2QX8A 5I3CA 2BRUC 3B82A 3G5UA 1E7YA 2YQ5A 3ESZA 4HQ0A 3OIDA 2WZQA 1PE0A 1W59A 2FPMA 2C7OA 1T6BY 2P79A 3B89A 3CSUA 2XE7A 3LG2A 4M9XA 4UPDA 1CYEA 1WZCA 3MCWA 3EIXA 3DL2A 4FBGA 4Q02A 5L9AA 1F8GA 1DKUA 1G5RA 3ZVKA 4LMRA 3F1KA 3WBKA 2DFNA 2PPLA 3F3YA 5K0SA 1KVSA 3I05A 1JEAA 3W2HA 1C41A 2F90A 2OMEA 4YUYA 1DDOA 4ZQCB 3QUQA 3LPCA 3AEKB 3RRJA 2P78A 4HZGA 1W9MA 1C4KA 4TTJA 5M29A 5F98A 1CRQA 4QGGA 1CRLA 3BG5A 2LCQA 1MQ8B 1DSSG 4J7XA 1ZK2A 3RCBA 2ZSKA 2JJ2D 4B87A 4CG3A 4D3ZA 4E2YA 3I73A 5KKCA 3ZHRA 2UYQA 2DUJA 1TU0A 3OOYA 4MR9A 4I3HA 1IOVA 4IQ8A 4EZIA 4AI6A 4XM0A 3F4KA 1GTMA 3N75A 4Q1EA 5EGSA 3CO0S 2PUEA 2LNDA 3VSEA 1R4NB 3N74A 4QUEA 3JTEA 5GINE 3ESCA 1U1FA 2E5WA 5TSDA 1F48A 1XLVA 4KQKA 1P2UA 1PWZA 3QFHA 4K6HA 2N0SA 4BGVA 4ESEA 2BMEA 2QUHA 4RD6A 1QK3A 2AFHA 3L9XA 5A5DA 1TKRA 4LSZA 3UGKA 6PFKA 4K9KA 5HKKD 1TW2A 5TGZA 3T1YB 4IMRA 1CD5A 1PFQA 2ICAA 5CPBA 1CUUA 1DJLA 2BHLA 5EMKA 2HCJB 4FDUA 3C6BA 3BRQA 1Q17A 1H22A 3QIVA 5U4XA 2ECOA 2F48A 2XW6A 4EVSA 2JKYA 3ROXA 2EJTA 4F85A 1ZHOA 3EODA 3L6OO 3ETGA 4WK6A 5EMHA 3OU2A 2AXEA 1JFVA 1SRRA 2IBTA 1G8YA 1J5PA 1Q1AA 3FHOA 3K0FA 2XB8A 4NSNA 4BP9A 3L0IB 3K6SB 1Y8QA 4PQEA 2AWNA 1L8QA 3JR7A 4GM1A 3DE1X 3ZE0B 1E6EA 4EUSA 5TRTA 3O9VA 1A71A 2OOKA 3HO8A 4KV9A 1AJEA 4KBYA 3GPBA 1XTTA 2CDAA 2I33A 1IM5A 1FXWA 2ZCUA 2BGWA 3KWMA 1UFVA 3SHQA 1HNWB 1I1QB 3T94A 1ZJYA 2QU7A 2RGXA 4BPBA 3A6FA 3TI9A 4EG4A 4HWOA 5CYFA 1UF9A 2IOFA 4M55A 4ZEVA 2AEJA 3BWVA 3QVTA 1HKHA 4RQTA 5KC8A 3U81A 3ZKWB 1Y1KE 2Q5JA 4U2BA 2OQIA 2X9QA 2P3OA 3WX0A 1SVNA 1QORA 4V1CA 4O1HA 4PRYA 4K6KA 1W36B 4QUBA 3SS9X 1LD3A 4H15A 1OHHD 4LNUA 5L3ZA 1GLNA 2H4ZA 1XA4A 3E53A 2PUBA 1Y3BE 1M8PA 4ALNA 2O8EB 1N5KA 1U3UA 2JIRA 4RF3A 3WO1A 3R0QA 5C8ZA 2DTDA 1EFTA 2W4IA 4MR7B 1M2NA 2XT9A 1NQXA 3LX4A 4HLDA 2W90A 1DOHA 5LZ4A 2VH2A 3G2PA 3DTVD 5EJAA 4DCUA 3NC1C 1C9NA 1XRPA 3PDCA 3W34A 1C9JA 4EMBA 3G59A 3NNNA 4I4TA 4KIWA 3C16C 5LXTA 1XPJA 3U6KA 3IBYA 2QMZA 5LDGA 3VVMA 3WWOA 1KR5A 3FPCA 4DDVA 1XV5A 2WUGA 3GLGA 1JEOA 1II9A 3OZBA 4BKRA 1CB7A 3QENA 3W5AA 1XTRA 1X2EA 3I6MA 2KE5A 3I4FA 3IAEA 4FUQA 4CN8A 2B4QA 4U02A 1HZZA 3H18A 5G1NA 3CNOA 4NCAA 2PZMA 4UUPA 3E7DA 4HYYA 5EKXA 4JKOA 1DXOA 1SBZA 4AF6A 4MINA 4D2IA 1RXVA 4JJEA 2FWRA 2JI9A 4DVGA 2G9UA 2LKDA 1XJWA 2VYCA 4C05A 5KJ1A 1ADFA 4Z2AA 3IA7A 5LOVF 4B74A 1P2GA 4NIMA 4CIWA 4JLSA 1MMFB 1P3DA 1O94D 1U6IA 4OP2A 3V2IA 5AKEA 3EXFA 3DQPA 2DULA 4FIZA 3PLAE 3T8YA 1PWYE 4AICA 1GFSA 2P6NA 3FDJA 2TSYB 3BL6A 1YZUA 4ZOQI 1U8UA 4ZT3A 1UFQA 3LWZA 2BR3A 4WZBB 2FMUA 1IK4A 2GD0A 2WINI 3C85A 4OYHA 1V9LA 4MWTA 2OR3A 4ZOLF 1SB8A 4JBLA 3UJ8A 3EZ7A 1DG1G 1VMIA 3RKSA 5A0FA 3UTCA 2CLDX 4CMIB 2J6HA 2HWUA 3O73A 4B79A 4EPWA 4HAUA 1BN6A 1J2UA 2CMKA 3RR2A 2BPOA 4A3SA 5KHOC 4PLFA 2NSYA 3G5AA 3L0DA 3QE2A 2IEGA 3FSGD 3K2QA 4HQKA 4TTPA 2XIJA 2HZBA 1NULA 2PUTA 5HUQA 1JSLA 2R86A 2VCEA 2JIQA 2HJ9A 4PQFA 2JAQA 2QT0A 3VNRA 1TD1A 4RH1A 2C2WA 3R8FA 1LUAA 1N2OA 2OCAA 3ABZA 3OLXA 3KQMA 1Q7TA 2E4WA 5DCUA 4CKBB 1Y8RA 4REOA 3A32A 1V2GA 3FUCA 1PT6A 2WY2D 2L82A 1R0LA 2D1TA 4FSDA 3HDQA 1T9AA 3N87A 3EW7A 3QELA 1FDIA 2JATA 3RABA 5B55A 5DJ5A 3PHCA 4HDMA 4YMIA 3VSAA 2PSFA 5BMOA 3AVOA 4RLQA 4DLXA 1CULC 2GNOA 4EA8A 1L0BA 3GCWA 2FW1A 2ZB2A 1OF1A 3ENZA 3CNLA 2X3FA 3MWKA 2PRIA 3AJEA 1SRQA 2L2QA 5ALPA 3WHPA 4EELA 1HYBA 1T4DA 2Y4OA 3UOAB 2GD1O 2Y0DA 4I50B 3LVRE 2J0SA 3UMBA 4YV7A 4DCSA 1QWSA 5H16A 4FDAA 2XXAB 2NVUB 1MQAA 5AJYA 3IEUA 1SCUA 5KVSA 1ZVVA 4Q9IA 1NVEA 2VDRB 1FS4A 4OXQA 4YXFA 3DOFA 4Q3BA 4J4BA 1P9NA 2FQWA 3BD9A 2GZRA 4GOJA 4YUXA 1B3BA 3I3SR 1FL9A 5FXMA 1ECFA 4HFJA 4DDTA 4J7CA 4RETA 3MD0A 3VSDA 4GEKA 4ZCQA 4ERNA 3DEAA 2G6BA 5JFTA 2W6CX 5HE9A 3RF6A 4R2HA 1IBCA 4FP9A 4DJDC 1IIRA 4GWLA 4ZZIA 2PUDA 1KJZA 1G20E 2J5QA 2O1EA 3H11A 3ZDZB 2OXTA 2FEAA 2QKYA 5P21A 1FYWA 1LW6E 2HRBA 3NDRA 4I1UA 2PU5A 2VN8A 1Z2PX 5H3HA 3E22B 3R9IA 3I2FA 2CHQA 2R1TA 4H0CA 3C8HA 3S1LA 3VI3B 1KYIA 2ZDHA 4FB5A 1EWVA 1O89A 1Z8DA 1IY8A 1GQRA 4DLKA 3HJBA 4JLPA 4BX9A 3ZS9A 1RXYA 5CNKA 5AWFC 1VFNA 2OOSA 3IE2A 3TQHA 4YAOA 4UTPA 5BNWA 3E3OA 3JD4A 4F3CA 3K15A 1NBIA 3IKTA 3MRSA 4TS3A 3THRA 1UAGA 2GNPA 1IZ7A 1NURA 1EE1A 1ODIA 3BSWA 3MS4A 4GLJA 4HAWA 2DR0A 4LN1A 5AK4A 1QKJA 3JWJA 5J58A 2O8FA 4DUYB 4RJ2A 4L85A 4MUFA 3TTXA 1T10A 1N7IA 1VPLA 5ALRA 1F1BA 3EUWA 2E6UX 2NTJA 2RAUA 2BHRA 4ZVKA 2EYUA 2C0PA 3TQRA 1OCEA 3RRYA 4DN6A 5KYGA 3G2KA 2O1WA 4E3WA 2DFVA 3HJRA 5K3OA 3T1QA 1P0FA 3CLHA 4KI0A 9MHTA 3STXA 3WGZA 2P2ZA 4HZUA 4XQCA 1QK5A 4MARA 2I3BA 1ZQ1A 5DHAA 2NZ8A 3EIUA 2INGX 3CZRA 4KIFA 3ZWPA 4G2NA 2OO5C 4QOJA 4HNTA 3ZXSA 1M0WA 5E7MA 5HJ7A 2EL9A 5JCJD 4LBVA 1TZKA 2XZLA 1L7BA 1U0NA 2WI8A 4Y1EA 4ZOLA 1HV8A 1JLRA 4EGJA 1ODFA 2JZNA 2RHTA 4QBHA 5LNK1 3KZXA 5TPWA 1RIFA 2L17A 4FHCA 1YKGA 2A9QA 1CK4A 3WB9A 3OURA 1RQ7A 2PY6A 4B3CA 3FW1A 4MROA 1I36A 4DQDA 4DV7B 4G0XA 1AV7A 1WG8A 2L19A 5LBUA 2PUGA 1EFVA 4JV5B 3FDZB 3O7WA 3O8DA 5IAJA 3TTTA 3CR7A 3K0BA 3RFUA 3VV2A 4EMSA 1HEUA 1RYDA 2VRNA 4TM8A 3T12A 3MOIA 5DHRA 4EIWA 2CJPA 2FDRA 2GQ0A 4A6XA 1SC3A 2W6ID 3HDHA 1PS0A 2WYHA 5G1PA 4TYNA 2Y1DA 2CJYA 4NU8X 5JLAA 5AVQA 4LF7B 4UM8B 1TF2A 3AFIA 1I2ZA 3QXSA 4YBZA 5EMNA 5A3QA 2XMSA 4LQDA 3PDHA 4X20A 1M5TA 2A0UA 3D2LA 3OOHA 3EGCA 5CK4A 1N34B 4RF5A 4QPDA 1RXSA 3MTJA 5H9VA 3D8HA 1PQPA 1X9GA 1WQ4A 1FQJA 4L27A 1O95A 1RQLA 2XXJA 3FPLA 4MRAA 3ZDYB 3ZV6A 4K8OA 2XRZA 3FLEA 1WUTA 3JQPA 4IM7A 3ND8A 3QU9A 5JTUA 1GPLA 2OGTA 4UEJA 1U9IC 2DHCA 4EF5A 2NSLA 3CQ9A 5C52B 1FRNA 1JFTA 4AIRA 4HVAA 2V8OA 4Z0NA 1K98A 2OUIA 3G17A 4F04A 3PQ3A 1S89A 1PJRA 2EKLA 4LJ5A 5CDUA 2QLTA 1R6UA 3MS7A 4LOAA 3TL2A 5C9ZA 1UT8A 1UXHA 2OG2A 4RPIA 3VMFA 5KYWA 2V7QA 3I61A 2LIPA 3ITDA 4GM4A 1MAUA 4BWFB 2BL4A 4X8HA 3BFJA 2AFHB 2FN3A 3FF1A 5BR8B 1G291 2GAJA 4JJGA 4YLGA 3LT2A 4J7UA 3WISA 2FKNA 4YP5A 5DHQA 1D0VA 1NXVA 1SKMA 2R11A 1E3DA 1JG3A 3L6RA 1PQWA 5CBPA 4DR2B 4RULA 1KI9A 2C61A 3JWEA 4TL8A 1G8MA 5ALSA 4WADA 1JFRA 5BNIA 3AF0A 3W8DA 2P68A 1WSWA 4O2RA 1PV1A 1P4RA 4PYRA 3O31A 1GLGA 4Z2YA 3RU7A 1QLHA 3WLTA 4EL5A 2FUKA 3WZLA 2YWDA 5CA1B 1AKVA 1JE1A 2I71A 2ZAIA 1AV6A 3GLIB 3RT9A 5K7SA 3CZCA 1YO6A 3EG9B 3JD3A 5CFOA 1WDTA 2XZPA 2NVBA 2RGBA 3A1EA 5FWXB 3OQ6A 4HCJA 5ILQA 1A9PA 3D8RA 3SBDA 4OP3A 4QXMA 5JNSA 4PAMA 4AW9A 1F51E 2YICA 2XOEA 3ZE7A 1L5GB 2YOGA 3L4BC 2BDUA 3WRXA 2G9QA 3IVCA 1C1DB 3FTDA 1EZ1A 3QVKA 2XKAA 2YV1A 1XB2A 2HWXA 4B4WA 1VE6A 3QLVC 4A8JC 1Q7CA 1V71A 3FBWA 2HA2A 3T1TA 3D7NA 1JFLA 2G71A 3GRCA 4MUKA 5CRIA 3ZU3A 3JWPA 4DVJA 4GNRA 1XXHA 3AQ4A 2C5GA 1H6AA 1JKFA 4CIBA 3RU3A 2LBPA 2Z58A 2X5JO 3T1OA 1US8B 2F43A 1NNI1 4UHHA 1QOZA 1S2OA 2QAJA 2DT8A 1U8CB 3ZBQA 1Z45A 2C1ZA 2WYOA 2ZTHA 3TLAA 2VF5X 1W19A 3T1VA 5LKRA 1GNLA 1P9WA 4XB2A 2VDKB 4JUFA 4B3RB 1CUAA 1O3YA 3UAVA 3RF7A 4E4RA 4DR4B 4R4JA 4RK1A 1CJCA 2B36A 3OX3A 4LE1A 4NFSA 4E0BA 2PGNA 3VR6D 2GCPA 3EGXA 3BULA 3UV7A 4G0YA 5LXTB 2UXCB 2HA6A 3BKXA 1NI4B 1N6RA 1EGQA 3CZAA 4ARAA 3CRQA 4YS6A 5ADVA 5HBGA 1ECGA 1TLFA 4Z3DA 3GLGB 1I10A 3GUCA 3R5KA 2Z6AA 3A25A 2V0CA 3L0BA 1VRVA 2QTLA 1RFGE 1JHPA 1OGIA 1O57A 2VTEA 1EM6A 2Y66A 1TM2A 1Z5PA 4WT7A 3CA8A 1YAHA 3VR6H 1DQNA 2PYZA 3GMDA 4MWEA 2C4WA 2QPAA 2NLOA 3NUQA 1ML3A 4Z9FA 1RBZA 2ZB3A 1KMCA 4G0VA 3CE9A 1PJZA 2YJZA 3PUVA 1XD2A 1P0QA 1S8FA 4UZFA 4DC9A 2OQ2A 4FPXA 1FTYA 4J43A 2P4HX 3D4NA 1PJ4A 3P5SA 3HBMA 4GXNA 4NCNA 4YWHA 4BBZA 3EXFB 3LNCA 2QW1A 2BBSA 3BX1A 3CCCA 3WDLA 1ENOA 4NWIA 3ZE1B 5CJ2A 3GPLA 5JS8A 3PQDA 1ZAYA 3WOHA 2HW8A 2J6BA 4FGLA 1FC0A 2HY7A 3WZ2A 5BRNA 4RVUA 2WM8A 4MP6A 2WHPA 4NS1A 3IKJA 3K0CC 2YWEA 1IQ0A 4EFDA 4WIAA 3BXEA 4HB4A 2ACKA 2XZDA 3VYUB 3UWOA 5JNLA 4JNKA 1NF3A 3FWYA 4X62B 1NN3A 3LQKA 1I6KA 2CUKA 3T54A 4BRWA 1S7CA 4C43A 1JRLA 4FYYA 3HZOA 3TUIC 2Q2VA 2YW9A 5JDIC 2ZSFA 3GEEA 4OREX 3L02A 2OCYC 4GPZA 5DLDA 3UA3A 2GZ1A 1NL3A 4EKEA 1U8EA 2IITA 4OMUA 3RG8A 2EZUA 1Y4AE 5IXSA 4PQGA 5GADl 5C8DA 3C1UA 1G21E 4MVXA 2AR0A 3USES 3AVXA 2YYYA 3E84A 1H5UA 1VLZA 4EY5A 4O1IA 3TZ6A 2MSCB 3QXCA 1T9GR 4UU8A 3ZI4A 5IKEA 3QELB 5KNLA 1DFGA 3KPYA 2ZKIA 2I80A 4HDMB 3ZLTA 1A72A 1ZGAA 2XYPA 4WK0B 3R8XA 4AJ2A 4DA8A 4DIUA 4H1UA 2AR7A 3IVXA 1A0OA 2NM0A 4LV6A 5HMMA 2LWIA 2YOFA 3KLMX 4DREA 4DM4A 4DMMA 2FV8A 1FLVA 1A4IA 2H1FA 3MWGA 3TTUA 4YMLA 5LD2C 1JT9A 1WU7A 2E5LB 2ZUFA 2K87A 4F4CA 4D8TA 3H3XA 1SCUB 1CIPA 1EGMB 4YMTA 3CZ4A 4ZU6X 3RUFA 3TMYA 1Z13A 1PLJA 5FBLB 2WSSD 1GKLA 2CZGA 3B60A 4OK3A 4Z5XA 4G4SP 1M2GA 4MV8A 2Q46A 4RF4A 2COUA 1Z12A 5DK6A 5IDVA 4DQKA 1TXGA 2DHQA 3HC7A 3O6VA 4NZPA 4WX2B 2FRVA 4B44A 1VXOA 2RDMA 2W42A 3TLGA 1F6BA 4FQ5A 4REQA 1EFHA 2W2KA 1GTZA 2GFHA 2FX5A 3DJFA 2C1EA 2C5AA 3O8LA 4PLGA 3H8VA 4DQUA 4BB9A 5FBKA 3DL0A 4L4XA 4KLCA 2VHVA 3STYA 1P0IA 4QXPA 3H11B 3FGPA 4B6SA 5KNDD 1BEEA 1X19A 2H5EA 1Z2DA 3ZIAA 4QBTA 2C7VA 4NABA 1AUVA 3BS4A 2FDCA 1NRIA 2VL7A 3C3AA 1OX4A 1AKMA 4MJ3A 1GG2A 2R1TB 2XRYA 3VPBA 1E59A 4F7DA 2AK3A 1JGTA 4LJLA 1DB3A 5BSRA 1H6CA 5E8JA 1T3TA 1YR2A 1E61A 1K7EB 3SQOA 1IBSA 2OG1A 3K1TA 1SXGA 4PG8A 4GECA 1KSHA 4YJFA 4ZYVA 3OM0A 2ARKA 3RNOA 4DNXA 3DAHA 1U6KA 4RPLA 5FPTA 3PPYA 1VYHA 1YUBA 2PMWB 3C1TA 1N2GA 4KKVA 2YN2A 4NP6A 5H5JA 1XQ1A 3C3YA 3K6RA 4CLOA 1APBA 2A0XA 4E1BA 2HAEA 3AETB 2I6FA 4M9ZA 4BMZA 5HPYB 2YIJA 3CPJB 1E96A 3EH1A 4ZA2A 3ZZ0A 1PQYA 4ARVA 2UZ1B 2GXAA 4EW2A 4HEJA 1I7DA 3IO3A 1XN4A 1DJNA 1X1EA 3EIQA 3K53A 4K2HA 2XUAA 4ZCRA 2FR1A 2CXOA 2EKQA 5LOVB 2Q8PA 1P8AA 4DV0B 1Q14A 2G1UA 1M6YA 4QLAA 1SUSA 1PV4A 5AOVA 1AT1A 1WDLA 1UK9A 4M88A 3ZWXA 4OM8A 3ZQ4A 4LS3A 3AHCA 2NGRA 1FSGA 2RJNA 2HPZA 2B99A 1S0UA 2E18A 3CNNA 1M6VB 4QYTA 3CIOA 4RKEA 4TSRA 4WNYA 4AMGA 5JLJA 3SSMA 5A3SA 4HPWA 1WHSB 2R7KA 3KT6A 3FPFA 5BSKA 2CNOA 4GX0A 1VDMA 2A92A 3QU4A 3VU3A 3N3BC 4ZOLB 1MXHA 3ZDAA 4D80A 4LEIA 4CT0A 1A77A 1RC1A 3BPSA 4IDCA 1Y63A 2C92A 1XRQA 2OECA 4WCFB 3NHRA 2IELA 3MWDB 3PQCA 3FNRA 3WIOA 3WA7A 3RFVA 3O82A 1KDYA 1XCGB 1ZZGA 2QTRA 4P36A 5K45A 2GH1A 2P6OA 4F96A 5E3HA 3BH0A 5A05A 3BWMA 2YHSA 3ORHA 4US0R 1ZEJA 2IBMA 3A6JA 1O54A 1B0AA 3W9UA 2QQEA 1U7HA 3W5JA 4E6PA 3DHEA 3UH1A 1H9AA 4MWSA 1PEAA 2FPOA 3DH0A 4II7A 2QTFA 3HMKA 1C29B 4HDQB 4U2FA 1IB0A 1QP8A 2NT4A 1JIXA 1RQRA 3G5LA 1DBWA 2OCKA 1TJPB 3SSNA 4X20B 4HVLA 1UWLA 4M9RA 4BGEA 2WHRA 2H7VA 3I64A 1WUIS 1NXOA 4NNPA 1QE0A 4OHXA 4J75A 1CY6A 1YRWA 2C9DA 4RIGA 4RKFA 3RW9A 1Z36A 3T1HB 4KXYA 1A5BB 1P4SA 4L3VA 1C5KA 4RDXA 2IEDA 5ALKA 5ESDA 2HLDD 3BGSA 1SXJC 2ZSJA 3WLSA 4PLTA 2ERCA 4H3KB 2Q9UA 3L8MA 1V3UA 4MQEB 1WHTB 1T36A 1KJYA 1QKKA 1EX9A 1YNOA 3IAFA 4HRYA 3K0EA 2VDOB 2JZCA 3KD2A 3L8CA 1EXMA 4G5SA 4C30A 4W5WA 4M2LA 5DXAA 4CV3A 3B8HA 4PE5B 4TWZA 2XYQA 1K8ZB 5EE5B 4BMCA 2BLLA 2FN7A 3N8NA 2NU6A 2NXEA 3AEQA 1NNLA 5KYWB 3OCXA 4O4JF 4OGFA 5JXGA 1CW2B 3VPFA 4YRAA 3D3WA 1R1DA 4D74A 2OCPA 4LZWA 4PWYA 4KXMA 3ESXA 1ZIDA 2HA4A 2P9YA 2VT2A 1TZJA 1T13A 3DMNA 3N1UA 4BO7A 3VH1A 1ZIYA 2R8YA 3KM0A 4WXHA 4P1ZA 4ZCIA 1KFBB 1L3CA 2PMEA 5CBPB 3IR5A 1GV0A 3DXZA 4NJMA 3IP5A 4I5FA 2QY6A 4NF2A 4Q9AA 3VPGA 3VRHA 5CEFA 4RVHA 5ES4B 5FI3A 1V47A 3FM9A 3M49A 1WDWB 4KQ6A 4F5DA 4U8GA 4OXIA 3VQTA 2QVCA 4EF4A 1F6WA 5EJMA 5AKJA 3HXOA 1ECJA 2XE6A 4NYJQ 1P4GA 4BNWA 4BQQA 3AJ8A 4TLBA 5BNFA 4OI1A 2I4IA 1U0GA 1EX1A 2YBEA 4TZTA 1JXQA 5TB5A 2DQ4A 1KXJA 3NWPA 4X66B 3HFGA 4N48A 1ZW1A 4JGBA 4KJZA 1EWKA 2EIXA 1WY5A 4P2BA 5BWMA 1F3OA 2D5AA 4L5AA 4DXDA 1Z17A 2ZE5A 1QIFA 4GG1A 1OXUA 1E1QD 4E08A 4YYEA 5E6SA 1JIQA 1OWNA 2QY9A 2RJOA 3NWOA 4J2HA 4KBGA 4MVWA 3WYAA 4A6DA 3ADCA 2O59A 4BOYA 4CCYA 1XFAA 5EIOA 2PEZA 4OAPA 2IPMA 3LZ6A 3NCHA 3EZ2A 5JAMA 2R8XA 3A3NA 3DHYA 3RK0A 1TM5E 3FB4A 1TECE 1ZJWA 4TMWA 3MPUA 5IHXA 2VRCA 1DC3A 4QOEA 5CGZA 5JYCA 2XGMA 3GBPA 1BWPA 3EPHA 3OJLA 1XD9A 3H9GA 1QTNA 3A7EA 4J03A 1LLDA 1ZONA 2PX3A 2WU3A 4Q5IA 4UBLA 4DCPA 1XXHB 4M99A 3UV3A 1Q7EA 5CB4F 1NN5A 5L3SA 1MN6A 3I5AA 2A9FA 4I1RA 1L1FA 4NC9A 5EWMA 2XJ4A 4ZDWA 3H7AA 1BVUA 3ZV4A 4IMIB 4JYBA 4XFDA 5K0ZA 3W5BA 1WKVA 1PK7A 5AKXA 1COWA 1U31A 2EQ5A 3G6KA 4UMFA 2I4RA 4DWWA 4EUFA 5ITSA 1KJ8A 2GK3A 3QW2A 2FPPA 5ICSA 5AMXA 3DWEX 4EA9A 1BOOA 2O0HA 3I6IA 3EGEA 1JQLB 2BGKA 2D1RA 4HGYA 1DIAA 1X1BA 1AGRA 1IHOA 3I6ZA 1ULBA 4PG6A 1ZCBA 1JJ7A 1YUMA 3NM5A 4X6XA 1RRGA 4N3CA 3WWCA 1XZQA 2RKOA 3U3JA 1OJLA 1TB4A 2EFJA 5HWSA 5JS6A 1WR8A 4BO3A 3GJYA 3VTZA 1II0A 4N5IX 2IIVA 1RXWA 3K8OE 1IY2A 4Y9DA 3TBHA 3HG7A 3GHYA 4Q66C 4EYQA 3EXHA 4U39A 3TG8A 4M7WA 2AXQA 2CLHB 4JB2A 1JJBA 1YRBA 2IUTA 1JALA 2J3MA 4RIEA 4JBHA 4CM6A 4B2PA 1XD2B 2HJSA 2Q3DA 3TLKA 4GPTA 2Q1UA 2QTZA 4WZAA 3EGWA 5AUNB 3K31A 2ZIFA 3G5TA 3UEOA 3VU0A 4EFLA 5BUSA 5F7XA 2Q4EA 4J2TA 1R0ZA 2YRFA 1BXKA 1KGDA 3SXUA 4BCDA 5B3AA 3QVGA 4TQ9A 3SN6A 1V4VA 3LUBA 3M6IA 3ZQ6A 4QNMA 3KKOA 1XLWA 3BMOA 1C81A 3KVVA 3TRDA 2HA0A 1L7PA 3QX8A 1M34A 1T2VA 1FYFA 1LBQA 2YJTD 1Z47A 4LHZA 4ZV4A 4FW9A 3EC2A 3C5CA 2V6IA 3AERB 4KSCA 4TRRA 5DLEA 4K9RA 2YY7A 2HA5A 4EA6A 1RVV1 3RFTA 3ZX4A 1C7EA 2G9ZA 4ARZA 2WU1A 1XT6A 1K63A 4I5GA 4ZCTA 5IUNC 1DWOA 2FU5C 2YH2A 3W3ZB 4Y3UA 1AQUA 1PQ4A 3K0AB 1S7GA 4WN9A 1XE3A 2C77A 3QOWA 2P40A 2VJOA 2R68A 2ZU0C 3OWHA 4N5HX 4M0CA 2IF0A 3UFXB 2LVBA 1L3IA 4JI1B 3RK1A 4O4JA 4S24A 4F97A 5FCDA 4DE5A 5K8CA 3MTDA 1OLUA 1M2OA 3W9YA 4YDSA 1BX3A 1ESZA 1X13A 4ETIA 3H5RA 3KOWA 3LBHA 1EGAA 3T9EA 4ENWA 5FJIA 3GQVA 3UNXA 4I5DA 5AKYA 2O54A 5KWSA 4JQYA 1GRQA 3ELYA 1Y7LA 4DB4A 2IYSA 4UZEA 5KHLB 4BE9A 5AW1A 1ZH2A 2ZQ5A 3KU1A 4L4YA 1ZU5A 1CRPA 1U1EA 3MUNA 4M1WA 2R8PA 3QLEA 4OAQA 5CVEA 5KSZA 4W5RA 1LLQA 3PC6A 4RACA 3S7TA 3KYJB 1AVTA 1VMEA 1ULTA 2JG3A 4JJZA 5I9MA 1FFAA 1CR0A 2WMNB 4M8NE 3EX7C 2F8SA 2FWAA 1O6BA 4HEHA 3RV4A 1RWMA 3ZNNA 5FI0B 3LW8A 1P29A 3RS8A 2DVMA 2J0VA 3ABRB 4BLRA 4BVAA 2GBLC 5BSVA 4AN1A 1LK7A 2GYVA 1YDMA 1AN9A 1RYFA 3DBOB 3JYHA 1R9GA 4LOHA 4Y6QA 3DT6A 5KYUA 1MXFA 3QEOA 4PLHA 3ZY4A 3UTDA 4GKJB 3UW3A 3CVOA 1Z8NA 2VP4A 2WB4A 2HSGA 3FRJA 4FILA 4IR7A 4JT4A 4M7OA 5EIFA 3T9BA 3VUEA 5CFMA 9ATCA 3UKOA 1JU3A 4BTEA 4HDNA 2DJIA 3DP7A 4Q39A 1EVZA 3TLGB 4REQB 4RGVA 1SUDA 1ZJZA 5IJ0A 2W2KB 3KSRA 1ZRSA 1YQ9A 1GZSA 3M5WA 3N39C 1W29A 5IH7A 3OIVA 1RYBA 2X9LA 3PBKA 4Z86A 4V24A 3S2UA 2HEIA 5KDLA 2QPOA 3GJXC 1PEDA 5F1YA 5LKAA 4F5ZA 4MQBA 3TE6A 4LF4B 5KS2A 1L9XA 1YVEI 5C4GB 1JKXA 5D86A 1MJNA 1FDVA 3ADKA 2OHHA 3UJ3X 3CLSC 1TYDE 1N1GA 4OD0A 2X77A 4ETNA 4MITA 5B58C 5CYGA 1DAHA 5KKNB 4DDKA 1SZDA 4OQFA 3I9NA 4G2TA 3RVRA 1Z7BA 1U0TA 2PD6A 3GDWA 3NLLA 3KCNA 4ZT6A 3CW8X 4GE3A 4C5AA 3E7FA 5HRCA 1D5CA 1EH5A 1VECA 2XUHA 1QYXA 4QDTA 4IY1A 3KVRA 2PLWA 2WM3A 5DCWA 3VR2D 3W2FA 4D8XA 3QV1A 3P2IA 1JIUA 5EE0A 4URWR 1SEVA 2GHTA 5TMDA 6AT1A 1FS6A 3PU6A 3CKKA 4C6TA 3EVAA 4WY5A 4DLWA 5JC1A 2F6RA 2OK7A 1QHEA 1XVLA 2VA9A 4BVLA 4WI1A 3C48A 2HBRA 1WKCA 3JQFA 3WKDA 3D3KA 3U44A 3AVTA 1QM5A 3L5OA 4LHSA 4MNTA 4XVQA 4IDFA 2VF2A 3DVSX 1QCYA 5MN5A 2JFVA 2NTEA 1IXZA 1K9VF 2QNIA 1L5FA 3JD1A 4KAAA 3FNIA 5B58T 3QEMA 1EFRD 1T8SA 2CMDA 1GZ7A 1TK9A 3QWBA 1DO2A 3EIWA 1L5KA 2XYRA 3ESAA 4CQMD 3ZI7A 4KR9A 5LBIA 2AFIA 3QTTA 3ADOA 3LKVA 3NTVA 4MKGA 4WJKB 4ZHQF 3ZE9A 1NOKA 5E2IA 2ZXFA 3PQ2A 2XT6A