3O26A

The structure of salutaridine reductase from papaver somniferum.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
294
structure length
294
Chain Sequence
RRCAVVTGGNKGIGFEICKQLSSNGIMVVLTCRDVTKGHEAVEKLKNSNHENVVFHQLDVTDPIATMSSLADFIKTHFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEELVKIYEKPEAQELMSETYELAEECLKINYNGVKSVTEVLIPLLQLSDSPRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLANKIPKFQVNCVCPGLVKTEMNYGIGNYTAEEGAEHVVRIALFPDDGPSGFFYDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The atomic structure of salutaridine reductase from the opium poppy Papaver somniferum.
pubmed doi rcsb
source organism Papaver somniferum
molecule tags Oxidoreductase
molecule keywords Salutaridine reductase
total genus 114
structure length 294
sequence length 294
ec nomenclature ec 1.1.1.248: Salutaridine reductase (NADPH).
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3o26A00
2G76A 1ISFA 3GC6A 1H2HA 3I6QA 1DDOA 3AOGA 1OOEA 1T2EA 2O3UA 4J43A 4M87A 2IZZA 4URFA 5G4KB 3FNHA 1SBYA 3RCBA 2YZ7A 1UJMA 3WYEA 2YQ5A 1I3KA 3LT0A 4NR0A 4C7JA 3AJRA 2D0IA 2ZQYA 3IJPA 5J23A 3I4CA 3L0DA 3SX2A 1KVUA 4FFOA 1UR5A 4WECA 1UDAA 4FBGA 4EDFA 4XB2A 3DTYA 3LK7A 1BWSA 1U2GA 2WJPA 5B12A 2C5EA 2J5QA 4IQGA 5EERA 3VH1A 3AI1A 4J91A 1JAXA 2QZZA 4B8WA 2DPHA 3W4KA 3R0IA 1ZSYA 1IYZA 2VT3A 1VSVA 3DFZA 1O95A 4UVHA 4CUZA 4JGBA 3F4BA 4R01A 4HNHA 4HUJA 4GAEA 1Z6ZA 2Q1TA 3ZDFA 3GGGA 4D44A 1E7QA 4W6ZA 3I23A 5I7EA 3OHSX 4J4HA 2B69A 4O6VA 3S2FA 5KJEA 3JQBC 1K2WA 4R5MA 2JFHA 4R16A 1I01A 2X0NA 3GFBA 5BT9A 4CMIB 4UAGA 1N9GB 4IM7A 2O23A 1RPNA 3IKVA 2HMWA 3D3WA 4RZIA 2A92A 3WMXA 2I76A 3H65A 4XIYA 1J6UA 4B4OA 2DLDA 4U0JA 1UXGA 4FIZA 1ZVMA 1I2ZA 5L4SA 4IQ8A 1QKIA 3GMSA 4CR7A 1IL0A 1IE3A 3G0OA 4O0LA 4MJLA 3OIFA 3GDOA 3GEMA 2I9PA 2PA3A 2UAGA 4ITUA 3UVEA 4DMLA 3K30A 2ZYDA 1I2CA 3PZRA 5IXSA 2DBVO 4E4YA 3GVIA 4H16A 4QFDA 2NQTA 4PG6A 3PLNA 4BKPA 3JQ8A 3BHJA 4Z0TA 5I9MA 2YV3A 1C0KA 1E7MA 2H1SA 4PLPA 3WICA 1UH5A 4ZRMA 1E6UA 4ZRNA 4MIEA 1LXCA 3ENNA 3PHLA 4J7UA 1YJQA 3WJ7A 4JK3A 1R4NB 3ZW8A 2NU7A 1GDHA 3ZWPA 1ULUA 3DHEA 2JCYA 1MXFA 2UVDA 1A4UA 3D4OA 3I3OA 1E6WA 2FWMX 2F1KA 3NT5A 1DRVA 5TJ9A 1EUZA 2VOJA 2YDYA 4F3YA 5L40A 2VN8A 2VHZA 2YV2A 4YT8A 2G1UA 1O9BA 1I3MA 3DZHA 3NRCA 2IYPA 1A72A 3E1KA 3IS3A 1U3UA 4AJEA 4DPMA 3WIEA 4FFPA 5EMHA 4MP6A 3H9EO 4DLLA 2CDBA 2DT5A 4TSKA 1HDZA 5T5QA 3QWAA 1KYQA 5I7FA 4JLWA 5JCJA 4XRRA 1W8DA 3V8BA 1IB6A 2YDXA 2VWGA 4AJPA 4CLRB 1V8BA 1T2FA 1GZ4A 1P77A 4Q3AA 3WMWA 4IDDA 3AK4A 3LZ6A 5F21A 5FF9A 3VVBA 4IPTA 3A28A 5EQDA 1VKOA 2BFPA 2IE0A 4NPCA 4JBGA 4MIYA 3QRWA 1LLDA 1KIFA 3T4EA 2AQIA 3ZNPA 3H3JA 1CQJA 1GR0A 1UZMA 3NV9A 3ULKA 1GPDG 1LRJA 1CDOA 3ZI0A 5JCXA 2FZWA 4GSKA 2O7QA 5I8ZA 4AG3A 4XA8A 1U7HA 3NT2A 1MA0A 1JWBB 2PLAA 2Z1MA 2VTEA 4CQMD 5EPOA 1TEHA 5ADHA 1PR3A 3D0OA 4BV8A 1BXZA 1VSUA 1UXIA 5I7SA 1X0VA 2BKAA 4L76A 1HSOA 2VTDA 2DBQA 4S3MA 4B79A 5JXWA 5ENVA 1PGNA 4J0FA 4J3FA 5T57A 3OJEA 3BZUA 3H9GA 4QUKA 4KDEA 5IZ4A 1TVEA 4K28A 4YQZA 4R41A 5B4TA 5KNLA 2EKLA 3ANMA 1P9LA 3ZU4A 3QW2A 1G0OA 4N5LA 2GN4A 5KVSA 3H5RA 5HBRA 3ZWVA 1K6JA 4D43A 1A27A 4GKBA 3GH3A 5DDIP 1K0UA 3E18A 1LQUA 1E7SA 4BKUA 3N74A 4CPDA 4XEHA 3TL2A 4MVJD 4J2HA 4XJSA 1ZFNA 4UREA 4PG7A 1E1MA 3KBOA 4E31A 4WOKA 1NNUA 2ZB8A 5IF3A 5KJ6A 1PJLA 3PWSA 3Q3CA 5H82A 3OA2A 3VZSA 4QO8A 1JW9B 2VYNA 3B1KA 5BNTA 3PYMA 4CODB 5EIOA 4TKMA 1LQTA 3JQAB 1QG6A 1T26A 1GEGA 1F12A 2AA3A 1OAAA 4BQRA 1QYDA 1R0LA 5CFZA 1YXMA 3AI3A 3PWZA 3UN1A 5KVVA 1GL3A 3Q9UA 7MDHA 2V65A 4RGBA 3WTBA 5DN9A 2JHGA 3DHNA 1HDOA 4GLLA 1D7OA 3DBRB 2GZ1A 4RV9A 4KUGA 4BGEA 2HMSA 2Y1GA 3OSUA 5EN4A 1DIRA 1PWZA 2Q1SA 3OMLA 2WYUA 5TNXA 2GPTA 2BGMA 3K92A 3PGJA 1DRUA 4DVJA 1VJTA 1LRLA 1NR1A 4WE3A 1XR3A 2ZCVA 3PDJA 4WCFC 3K2BA 1ONNA 5F1KA 2FPGA 4Z3DA 1I0ZA 2EJWA 3LC2O 2YJZA 1B2LA 1ISMA 1VJ0A 2PGJA 3ABIA 1GUZA 4CMJA 1Q2XA 3LT1A 1WAMA 2PH5A 3WWYA 3QA9A 3ZWXA 3NTQA 4PZDA 3ZWBA 4ND5A 2EJVA 2O3QA 1DHTA 2GLXA 3AOEA 4OAQA 1YVEI 2TMDA 3F47A 4QTZA 3GRPA 1EE2A 3AW9A 2JD1A 3WBFA 3O8QA 2Q2VA 1H9BA 3PTZA 1PR9A 4CJXA 3E48A 1ID1A 3NDJA 3D7LA 5C5IA 1XYGA 1BDMA 3WQRA 4U6QA 4HFNA 3RFVA 5JY1A 1NPYA 3R1IA 5CG2A 3RUEA 2YFQA 2OGUA 1JKJA 3AU8A 1WZEA 4YPOA 1IZ0A 3PZBA 2UUPA 3RC2A 3A9WA 1ISIA 5H81A 1ZBQA 4BS9A 2VRCA 1SC6A 3EZLA 4JX8A 1WP4A 4FB5A 1NPTO 2FN7A 3RUDA 2VHVA 4P38A 1B3RA 4HFRA 3ZV4A 4TMFA 2Q50A 1XQ1A 4YEDA 2X0RA 4EGFA 3JV7A 2IZ0A 3ZHZA 1GYPA 4RLHA 5JAMA 4LN1A 2V7PA 4ZD6A 4AVYA 3V1UA 3QJ5A 3VHRA 4ZQHA 1D1SA 4YT2A 2B5VA 5K0ZA 2P4QA 1CRWG 5KJFA 4P22A 2HRBA 3NUGA 1ISGA 4PLFA 1ZXBA 3N7UA 2PZJA 2Y99A 2JAPA 1NM5A 1GQQA 1PQPA 5I8WA 3PQFA 4Z0HO 4NBRA 3GOHA 1LUAA 1B0AA 3FBGA 5JAQA 1QLHA 1HKUA 3RASA 3TOZA 5GZ1A 2VHWA 4BGIA 1XKQA 1GAEO 1DC5A 4FJ0A 4GX5A 2NU8A 1EK6A 2C2XA 4CM9A 4Y9DA 3P5SA 2SCUA 2FR1A 1PL6A 2ZJ1A 1IHXA 5HM8A 2H63A 2GF2A 4M8SA 3HUDA 1FDSA 4CV1A 3H9JA 1EVJA 3KOUA 4I1IA 4BOYA 1Z7BA 2QZ9A 2NNLD 2HAEA 4GX2A 3HB5X 2YFHA 3H5NA 3CPSA 4FFMA 1A4IA 2R2GA 1LNQA 1M6WA 3JYLA 3GZNB 2VYND 1XU7A 1JAYA 1VL8A 4Q3EA 1E1NA 1YQGA 1WXDA 2Q4EA 3VH2A 1Q0LA 4CM7A 3BMOB 4Q39A 1HL3A 3K73O 5DT9A 2AEMA 2WD8A 1C1DA 4YAJA 5AOVA 3ZU5A 2G5CA 3ONEA 4CUKA 3MWEB 4YXFA 4NU5A 3ZHBA 3ZWYA 1QRRA 3TOXA 4DYDA 4WASA 4OXKA 3ASVA 1KVTA 1KVSA 5ER9A 3HG7A 3ZWAA 4E5MA 1GEEA 1W4ZA 2I67A 1O8CA 3BHIA 1ZCJA 3BTVA 2NUAA 4GX1A 1X1TA 1I8TA 1MGOA 2OOSA 1I5RA 3WGZA 1HZJA 3K6JA 4NJMB 1F8GA 1WNTA 2BFAA 1P33A 2UDPA 2DC1A 1CF2O 2Y1OA 2EEZA 4YDRA 1LSJA 3IJRA 3PHIA 2GNAA 3ZWMA 1N9GA 2HK9A 3U4HA 2VT2A 4NFHA 3HJAA 4IXTA 4BNHA 2JJYA 5IN5A 3ICCA 1HZZA 3FN4A 4TROA 4BO0A 3CE6A 3RC9A 3TL3A 5I9NA 3W6UA 1UXJA 2FMUA 4UULA 4GWGA 2O50A 4O5OA 3ONFA 4ALJA 2ZB3A 4FSHA 3HE3A 3X2FA 1ZK3A 5JFOA 4NFYA 4BNUA 5U4QA 4PLYA 1WDKA 1E3WB 1QYWA 3GAZA 4E5NA 3KEQA 3GRKA 1P3DA 2RCYA 1PGJA 3HZZA 3JQGB 5L7YA 5JW6A 1HDCA 2J6IA 4M49A 4D3FA 3UICA 4Z6KA 3GNSA 4RL6A 2D59A 4L4SA 5KCZA 5ICSA 4RPLA 1U4OA 3I9NA 3RUIA 4YCAA 2EERA 4RVFA 1U28A 4YTEA 3JD3A 1HYEA 4RF4A 5A3VA 3VTFA 2VHYA 3KYCB 4BNFA 4DQVA 4DQUA 5G0UA 1XU9A 5JCJD 1DAPA 3DZKA 1NFRA 2CD9A 3PQEA 4FGWA 4D0SA 4ZU3A 2EP7A 5L53A 2BLLA 1CWUA 1DBVO 1QYVA 1OI7A 3UW3A 2OP0A 2AXQA 3IP3A 1EE9A 4DIOA 3TFQA 1DAOA 5LC1A 4ALLA 3HWRA 2PY6A 3MCVA 4GKVA 4ZJUA 3IUSA 4E5KA 2Y05A 3E03A 2UUOA 3GA0A 2VWQA 3CINA 4YAGA 3ZV5A 3FD8A 3NJ8A 4GVLA 3DTTA 5A05A 3KRTA 4EJ6A 3O4RA 3GAFA 3L07A 4NQZA 1PJCA 4IDBA 3I83A 3ANNA 4PG8A 2VYVA 5T6BA 3JQ7B 1DJQA 4J1QA 4I5GA 4I5EA 5JAZA 5BSHA 4XYMA 3G17A 4RPJA 4YRDA 3QVSA 2YW9A 5ITWA 1L7EA 3QQPA 5DP1A 1UZNA 2C7GA 3MTJA 3RUAA 4J90A 5KKCA 1O6ZA 2E82A 3FBTA 3PYXA 4CLEA 5JYDA 1HDYA 1SOWA 3JCZA 3JQ9A 4I9HA 5B37A 4QEDA 1KVQA 1P1HA 2BHLA 4B7UA 4BO5A 3UCEA 2C59A 2BI8A 1SEVA 4E5PA 3PJGA 5JY6A 2HLPA 3F9IA 4KTTE 4L4XA 5LCXA 5T8KC 1JDJA 3BIOA 1NHGA 1GV1A 1I3NA 4IJKA 1G1AA 1HE4A 4RVDA 4OQYA 2O3JA 4NBTA 2A35A 2HJSA 1AUPA 1I10A 4MIOA 3ZNNA 1PQWA 2CUKA 2ZTUA 3DOJA 4MPDA 4ONEA 4S1VA 3WFJA 1C1DB 1ENZA 2G17A 1HYGA 1DC6A 1I32A 1PZEA 1AXGA 3ZNOA 1DIGA 4K1LA 3VH3A 3ORFA 3IMFA 3O03A 1PZGA 4DPKA 3RFXA 3WNVA 2XOXA 3SLKA 1F8FA 1YE3A 1LX6A 3CIFA 8LDHA 4NIMA 3MZ0A 5BQFA 3PRJA 1BSVA 1J49A 2NM0A 3DR3A 4W99A 3NDRA 3V1TC 3JD4A 1H93A 1E3EA 1R4MB 4BVAA 4IUYA 3GLQA 4XGNA 1PJTA 4EI2A 3CMCO 3CZRA 3GNQA 1LDMA 1X7GA 3NTRA 3DMYA 3KTDA 3QLJA 1WPQA 5GZ3A 1KY4A 3A06A 2VZ0A 3S55A 3GG9A 3PIDA 4G5HA 1YBVA 3AM4A 1X15A 2EV9A 4R54A 1R0SA 2C29D 2I5PO 3OBBA 4ZQFA 2QHXA 5BNFA 1HE3A 1LC3A 3E9MA 5AXAA 2V6BA 3RC7A 3OFSA 3L4BA 1XIVA 1E7WA 4OHUA 1OC2A 4WGGA 4PIVA 2PH3A 4OL9A 1Z7EA 3PVZA 1FJHA 3GUCA 4WOJA 1YBAA 2FPPA 4IIVA 4MVJF 2NTNA 2BRUA 3VZRA 5ILOA 2IRWA 1GUFA 3HN7A 2BF7A 4W4TA 3D5TA 1XCBA 4AJ4A 5B1YA 1PIWA 5AXCA 4AJLA 1GZ6A 4Q9NA 1GYQA 3E9QA 4DUPA 3I9OA 4E3ZA 1Q7GA 2GASA 5JO9A 5L45A 4Q3BA 3M2PA 4CLOB 4IS3A 3ZGYA 1YQXA 2JD2A 4KWHA 5L3ZA 3TZQA 2EG9A 2X0JA 3Q2KA 3WQSB 3ZZNA 4HWKA 5BNIA 4EUEA 1V3TA 2HKIA 3KHUA 3E9NA 1VI2A 3VZPA 4OIMA 4TRJA 4RF3A 1MXHA 4MKZA 3KO8A 1NR7A 2EW8A 3D5QA 1LJ8A 4MVJG 4XJTA 3WGGA 1V3VA 4NHEA 3WX0A 1ZW1A 1P74A 1Y5RA 4FFNA 1E7YA 2VCYA 4BNIA 3GVCA 1MUUA 4QECA 4FJ1A 5K6AA 2DTEA 1P0FA 3WXBA 1DXYA 5JYEA 3SXPA 4E13A 5G0VA 1DB3A 3RBXA 1AHHA 1O5IA 2BH9A 3CZMA 3ETDA 4YAEA 2V6GA 1ENYA 2UYYA 2CFCA 3QWBA 3PWKA 4R68A 3LU1A 1U4SA 4L0QA 3VPXA 3BMCA 1OC4A 4KDFA 5CDTA 2CZCA 1MG5A 2ZTMA 1LTHR 3CKYA 3HDHA 4XYGA 2VUTA 4AFNA 2IDZA 5CEJA 3LYLA 5KTKA 4BO2A 2EF1A 4M54A 4EYEA 4D41A 4OMUA 3JQBA 4I5DA 4GWKA 5L4LA 1ZH8A 4TRNA 5A9RA 3OJOA 2DTDA 4M89A 4W7HA 3B20A 4OH1A 4CLXA 1H5QA 2Y66A 4RF5A 1HT0A 3EMKA 1YOVB 2O2SA 2NACA 2O4UX 3ENKA 1X14A 5L9AA 2NU6A 1S6YA 1RKXA 2QG4A 4E6PA 3RQSA 3WDSA 3U5TA 3JYNA 1Q1NA 2QW8A 4CMHA 5B4VA 4XYBA 2HK7A 1DEHA 1W73A 2R00A 5DOZA 2HMTA 1Y1PA 3ZN2A 3O8QB 4OOFA 2GN9A 4XGIA 4ALIA 4DL9A 2BFOA 4B4VA 3N58A 3ZU2A 3PQDA 1DOHA 1B8UA 4CM4A 4IMPA 4W82A 2XF8A 1Q7BA 1GTMA 3K2EA 3QVXA 3RJ9A 5BSEA 4BKOA 1FDWA 4YRBA 2GYYA 3KLMX 2FP4A 4B4WA 5AVOA 4BO4A 5AXBA 2DFDA 1ADBA 1DRWA 3TQHA 3VKUA 4MOWA 4Y8VA 1A71A 2ZATA 1IZ9A 1EDOA 3KYCA 1NYTA 4NK4A 4WCFA 5IJZA 5F3RA 1R4MA 3B1JA 4WLFA 5THKA 4CM1A 4DBZA 2C07A 4YJHA 1P1KA 1Z73A 3V2UA 3VVCA 1ZUD1 4BNMA 1I33A 3DQPA 3MJSA 4XCVA 1ADGA 2JAHA 3C1AA 1R12A 4JN6B 1IULA 1RYDA 3OQBA 3DWFA 3H7AA 3HB4X 1FDVA 4GPD1 5K6AC 1EEHA 3L4SO 1X13A 4KTVE 1RM3A 4ILKA 4DMMA 5DULA 4R4JA 3M2TA 4WLNA 1X7HA 3ST7A 4XYLA 4YJGA 2J5KA 3IL2A 1WW8A 2WD7B 4U7WA 4OXNA 4RPHA 4GI2A 3H8VA 3L6DA 1YO6A 5ER6A 3Q0EA 3GK3A 5HS4A 3LDHA 1V0JA 2FR0A 2V6FA 4L8VA 2ZB7A 2VQ3A 4HNGA 2E48A 4HFJA 1LSSA 2PWZA 2HSDA 2NU9A 3IOYA 4L4RA 2O3RA 4YJDA 3H5AA 2C7VA 5TQVA 1E3IA 1LA2A 2X4GA 4AJIA 4RPKA 3WLFA 4CL3A 5A1TA 2O7SA 3JTMA 4WNCA 3MTGA 2WD7A 4OSPA 5TJHA 3Q1LA 2P2SA 4Y67A 5I9LA 3T4XA 2JL1A 3NGXA 3U09A 2XAAA 1UXHA 3F5QA 3L6OO 2RHRA 1R16A 2ZCUA 4DIBA 3NYWA 3PPIA 2JFFA 4A7PA 2D5AA 4W7IA 4YB8A 2WSBA 4R9RA 1EFKA 4XIJA 3RAJA 3U4IA 4LSWA 4YR9A 4W9NC 9LDTA 2X23A 4OGWA 2Y1CA 4XD2A 4P8RA 4XYEA 2D1YA 2X0IA 4DRYA 3EC7A 5L7WA 4P4GA 2CY0A 4MVJE 3W6ZA 4EJ0A 3BXXA 5A4DA 1YDEA 1X0XA 5T64A 4AICA 1H6CA 3GN2A 5BSFA 4RLSA 3FNEA 4QO7A 5DZSA 2OHXA 3R6DA 4RVSA 3PYLA 4IBOA 2W2KB 5EQFA 1KVRA 1MC5A 3GUYA 5TF4A 4D79A 3DZFA 3ZW9A 1Y5MA 3AUSA 4QX6A 4BB5A 1VC2A 3HN2A 1C3VA 1ZK0A 2P9CA 3C85A 4OQZA 3DFUA 3HFGA 4QQRA 5CP8A 4HBGA 4D3SA 1SB8A 2A4KA 4YAIA 3AU9A 2Q3EA 1GADO 5ENDA 2EWMA 3OJ0A 5U1PA 5HRUA 1PX0A 2PD3A 3O38A 2JKVA 4MKXA 4RCVA 3ZCXA 2FSSA 1ZIDA 2JCVA 4XX0A 1T24A 4YJFA 3FHLA 5JBIA 3JYOA 2PK3A 1HE5A 3M1AA 3RC1A 1YB5A 1VL0A 2Y68A 3FWNA 4HXYA 2X9VA 4PLZA 3QWFA 5TT0A 4JXKA 2R00C 4LCEA 2ILTA 2QRKA 2C5AA 2W90A 1JKIA 4Q3DA 3JSAA 4YJFB 1HLDA 4CMKA 1QV7A 4RZHA 2OBNA 4MKRA 1T1RA 3QWIA 4AJOA 1PZFA 3IQDB 4CQMB 4PN3A 1IUKA 1RJWA 1W6UA 2I3GA 3QWHA 4GLOA 4KP7A 3WSWA 3EYWA 2I99A 3FPCA 4H7PA 4Z9YA 3ZWNA 3D4NA 3K31A 1ZK4A 4P4NA 3EUWA 4LK3A 3KXDA 2ZK7A 4ESOA 5IDWA 2AG8A 1PQUA 1ISHA 4XR4A 2GZ3A 1T2CA 2AQ8A 5HWSA 2D2IA 3UH1A 5IZCC 3P2OA 3TNLA 1N1EA 1P1FA 4CQLB 4FPXA 3VZQA 4G65A 1R0KA 4KMSA 3LSYA 4CMCA 3JQGA 2P4HX 1NXQA 3OICA 2EXXA 3I9JA 1M76A 4PRKA 5JDCC 3IP1A 5GY7A 1R15A 3WGHA 2GCGA 1P1RA 2B0JA 5JS6A 2AEFA 5A9TA 1WMAA 4BO8A 1M66A 1V6AA 1Z82A 4R3NA 3HNPA 3BA1A 4BGVA 1KBZA 3INGA 1HDRA 4IDCA 4R3WA 4OJNA 1QORA 4R9SA 1U7TA 4DREA 1DPGA 4XR9A 4ZA2A 4FFRA 2OMEA 2AQKA 3OP4A 4FOOA 1YS4A 4GSLA 5DNAA 4J1NA 3ETGA 3ADOA 3M6IA 1CERA 1Z75A 3OQ1A 3TJRA 2VNAA 1VL6A 3AM3A 3I6IA 2WYVA 3BTOA 3JQFC 5A04A 3BTSA 3OJLA 4N18A 1S7CA 1B3BA 2O4CA 3WS7A 1YL7A 3HFSA 1Q0HA 4UVGA 4FC7A 3HDQA 2X7HA 4CLRA 1Y8QB 1WDLA 4BO7A 1RM4A 4EUHA 5KOIA 4XQCA 1T25A 2W2KA 1J4AA 1ONPA 1SO8A 1A9ZA 2QIOA 2YHIA 4RQTA 4MO2A 3CEAA 3EVNA 1LC0A 3A14A 3F6YA 1U9JA 5I7VA 4PCVA 5DOVA 1VM6A 4G2NA 1C0LA 2Y1FA 4GMFA 4D0RA 2Q2QA 3L77A 1D3AA 3JQCA 1E3WA 3UAGA 1PJ3A 3KVOA 2ZIZA 1GFSA 1LU9A 1UP7A 2VYVD 2Y0EA 2FSVA 3OA0A 1DIHA 3V5NA 4YA6A 1CJCA 4JJFA 1ZMOA 3QIVA 4N54A 4E12A 3E6AA 4R51A 3JQFA 5L51A 3AWDA 1TT7A 1TT5A 4KWIA 4B3HA 4Z0PA 4RDIA 4RVGA 4KQWA 3DO5A 2POQX 1F17A 3L9XA 5JPIA 2NTVA 1HWYA 2ZKLA 3OECA 3DAGA 4QFCA 4WCDA 4ZGWA 3GEGA 4O1MA 3L6EA 4JNKA 4FGSA 4JJGA 2IODA 1AN9A 4B4UA 1KEPA 2D4AA 3DOOA 3FF4A 3RBZA 3A4VA 2IEDA 4U0KA 3RD5A 3MJVA 2OL4A 4BKRA 4CMEC 3GPIA 1PS9A 2EP5A 3HDJA 2WWRA 3C1TA 1E6EA 3MEQA 1C0IA 4HADA 3MOIA 4NBVA 4J9UE 2P9EA 1F06A 4HX5A 5EESA 5JC8A 4HP8A 3K9QO 4Z9XA 3RKUA 2O2YA 2W8ZA 3ROPA 4RF2A 4B3IA 1PJ4A 3FTPA 3INRA 1XLTA 4AJKA 1LLQA 5F1OA 1PTJA 3BMNB 5ES3A 1Y7TA 3GHHA 4DC0A 4IDAA 4M86A 3PDUA 3QVWA 4UVEA 3H2SA 4PG5A 3GEDA 2AW5A 3OM9A 1BXGB 2V6MA 2CDAA 5A5EA 5CHEA 4CL8A 3EY4A 4CM6A 1EDZA 2AEJA 3D3WB 2RBEA 5DCWA 4U8GA 2GGSA 5CDYA 3RI3A 5JC1A 2NSDA 1FXSA 2VRBA 1N8KA 1B16A 3RSHA 1YQDA 3WJAA 1EMDA 4D3DA 4D46A 1BXGA 1UXKA 1XELA 1YL5A 2G82A 2X8LA 1SB9A 4I8XA 1PGOA 3MJ4A 4NBUA 3T7CA 3JQEA 3UCXA 4XQEA 4BNVA 5IAAA 5JMPA 1O89A 5KIAA 4O59O 2P5UA 3JQDA 1PU2A 1O0SA 2VUSA 2NQ8A 2QRLA 3P2YA 2HU2A 4J2OA 1E3LA 1AXEA 2VUUA 3DOCA 3F1LA 5DCUA 5F5LA 1P1IA 4F45A 3U4CA 2CMDA 5CDSA 1Y8RB 3PK0A 1Q0QA 3DMTA 4ZICA 2E4AA 3D1LA 1NQTA 2C2YA 3JD2A 4MVJM 3TWOA 4II3A 4CM5A 4J49A 1N7GA 3I5MA 3O26A 3S2IA 4IGEA 1GQYA 1GV0A 3FSRA 3SC6A 5FFFA 4CM8A 4LRTB 3H2ZA 4J6FA 1NBOA 1N1GA 2ZTVA 5DP2A 1BW9B 3UCFA 3AUAA 2OO5A 4YRAA 5ICMA 4ND1A 3V1YA 1LBEA 1PGQA 3GPDG 4DGSA 1IY8A 2EKPA 2Q1UA 3ADPA 4CMGA 2E49A 4AJHA 4MVJP 1KEVA 1ZEMA 2CVQA 3RUFA 5AXDA 1SAYA 4IZHA 5CG1A 4Q3NA 1Z74A 3EW7A 4YYZA 2YUTA 3KV3O 1SEPA 3QVTA 4ALNA 3DZIA 2Y67A 3HHPA 4GGOA 1JN0A 2W4QA 4IXWA 3OIDA 4LMRA 5COBA 1X7DA 1DFGA 1XWFA 2PZKA 5IZCA 2UV8A 4HV4A 3LF2A 1I24A 2Q49A 5TRTA 3WWZA 3WIDA 4XB1A 1ISJA 3R3JA 4ZQBA 1NFQA 3TDKA 2G0TA 4NDNE 1K6IA 1ZZEA 2A9FA 3SLGA 3CXRA 3C24A 4XZ3A 5DBIA 2Y0DA 4ZQGA 1HDGO 2Q99A 1ZK1A 1HRDA 4A73A 1U3VA 3JQ7A 1H0KA 3VDQA 3W4IA 2PGDA 4K6CA 4KZPA 2H9IA 1ZJZA 4Z9FA 2CVZA 2CDCA 5JDIA 1PGPA 2AE2A 3UXYA 1SOVA 3L9WA 1HF3A 2CF5A 3HQ4O 2NVWA 4CR8A 1NTOA 2PTGA 3PGXA 1XDWA 1H94A 1Y81A 3AFMA 3B6ZA 1Y9AA 2VRCD 4LGVA 3RKRA 3V2HA 5A3JA 9LDBA 4GH5A 4PVDA 1EVIA 4I9NA 1BDBA 1NQ5A 3PI7A 4IJWA 3OIGA 5DF1A 4ZHSA 4UEKA 3P19A 2WMDA 3EAGA 1M2WA 4HKTA 4IZIA 2X9GA 3FCOA 5LDGA 2XXJA 1I3LA 4EZBA 5CDGA 4ALMA 1UDCA 3RUHA 4CUJA 2Y1EA 4WUVA 4HFMA 1KC1A 3WYCA 2I66A 2J3HA 4CR6A 4BO3A 1EZ4A 1HSZA 5JMWA 4A2CA 4PLHA 1MFZA 1XG5A 2B83A 2Q45A 4LW8A 1EBFA 2LDXA 3E82A 2W2LA 4OOEA 1YOVA 2YY7A 4UVIA 4NJMA 4ID9A 4NBWA 4UEJA 3WQQA 4RO0A 1SNYA 5TGDA 1JQBA 1ENOA 3PXXA 3T7EA 5HA5A 2J5RA 3D4PA 1K6XA 2HK8A 1C1XA 1T4DA 2GN6A 1GPJA 1M6HA 1A7KA 4N7RA 4PLTA 4XQGA 3HADA 3DBHA 1GY8A 1IPFA 1LSOA 3NAQA 4R1NA 1D4FA 2B36A 1BW9A 4DBVO 2PZLA 4IY1A 4EEXA 3CUKA 3SJUA 3VPSA 4D42A 2HCTA 2Z1NA 5JAIA 3FI9A 4IDGA 3DDNA 1EVZA 1JVSA 1LRKA 3KETA 1HTBA 3AY7A 1YH3A 4ND2A 4MVJI 5G0SA 1NASA 1U3WA 4CMEA 5U9CA 1MC4A 3OETA 3JD1A 1JVBA 1Y8RA 1QYCA 1JWAB 1GD1O 2VNSA 4F6LA 6LDHA 3R3SA 3WR5A 2DTXA 2HO5A 3DBLA 4FJ2A 3GVXA 1W0CA 4XKJA 3DONA 4MVJA 4RVHA 4A03A 3GDGA 3D3EA 3ZWOA 1Y8QA 2P5YA 3F1KA 4NFSA 1TI7A 1SPXA 1BVRA 2BFMA 3IDSA 2X58A 4EEZA 3DXFA 3MWDB 1DLIA 3SJ7A 4GGPA 4Z3KA 3WG9A 2JCXA 3LC7O 2HJRA 4XWYA 2YV1A 5TIIA 4BO1A 4OXYA 2OBYA 2W98A 1KY5A 4N5MA 2X22A 5ILGA 1JTVA 4TRMA 4FOSA 4GX0A 3KSDO 1R6DA 3KLPX 3QP9A 4DXHA 5CEFA 2X5OA 2Q4BA 5LDHA 3FPLA 2Q46A 1DC3A 1P45A 1H6AA 1NWCA 3STHA 4A5OA 4CQMA 3AOEC 4TQGA 3AM5A 5C7OO 1N7HA 4FDAA 3AUTA 5KKAA 3C3XA 3MJTA 3LT2A 4TVBA 3W8FA 2NV6A 1ADFA 4A10A 3GR6A 3WBBA 3G1TA 3LC1O 2RAFA 4R1TA 7ADHA 3UOGA 4EITA 2F00A 4J16A 2OFPA 1LDYA 2D3TA 3PHHA 1HLPA 4IDEA 4INAA 1GZ3A 3QHAA 1WMBA 1NVTA 2I6TA 2NWQA 1EK5A 2HMVA 4TVOA 3FTNA 5DBGA 2I3AA 3U0BA 5THQA 1K89A 1HE2A 2J3KA 4BKQA 2EGGA 4JROA 4OSOA 4BB6A 4FS3A 3VDRA 1U5AA 1DIAA 2BMAA 4NU6A 3JQ6A 3RIHA 1C14A 1DIBA 3WGIA 4ROSA 5CDUA 2W2LD 1CEQA 3BMQA 3PFFA 2P91A 1U8FO 3JYPA 3LQFA 4K6FA 1NHWA 3DHYA 3NT4A 3Q2IA 2YHUA 4WEOA 3RWBA 2A94A 1LLUA 3DAPA 4OKNA 3VKVA 1M67A 2GO1A 4Y6SA 2OP1A 3PEFA 1NP3A 1Q7CA 5TX7A 2DQ4A 2PFGA 1CETA 1P0CA 3NTOA 5ITVA 3VOSA 3UUWA 1ZJYA 4G81A 4IJVA 1KETA 1NAIA 2WM3A 3DBHB 4AJ2A 3EDMA 4RJTA 4PZCA 3H3FA 4J1SA 4YBZA 2WTBA 1AGNA 2CF6A 1LSUA 5JLAA 1HEUA 3QE3A 1PJBA 1T4BA 2AMFA 3FNGA 4BNLA 1ZKMA 3ITKA 1EUCA 4L9RA 4UUMA 2DBZA 1PL8A 1U8XX 4J0EA 3I9MA 3IKTA 1LDBA 3WOHA 4XGKA 5FEUA 2BGLA 1A5ZA 4FD3A 1ZXLA 3GDFA 1JLLA 1E3JA 4CV0A 4WJZA 4IINA 3GG2A 1AE1A 1H6BA 4TKLA 3SBOA 1J5PA 5H83A 4KUEA 3WGTA 2P68A 4B7XA 2IZ1A 2ZYGA 5BSGA 3KYBA 3DB2A 4II2A 3U49A 4YJHB 4M1QA 5A9SB 4FC6A 1B14A 4CMAA 3GQVA 3TRIA 3GMDA 3JQ9C 5GMOA 1FDUA 1HXHA 1NFFA 2ZYAA 1ZSNA 2FOIA 2X6TA 4BHTA 1MFPA 3FRJA 4MP3A 1QYXA 2H5LA 1YB4A 3H6KA 2AG5A 1E5LA 3ICPA 5MDHA 2X1HA 3Q11A 3VPFA 4IQ0A 2O3TA 1U3TA 4ZVVA 2RIRA 4J7CA 4WEQA 4WLVA 1B15A 5TT1A 1GQ2A 4YJGB 2FPIA 4B8ZA 1IPEA 2ZQZA 3MOGA 1FDTA 5A03A 3KSZO 3OF2A 4BO9A 3DZGA 1YDWA 2PV7A 4WPGA 3WFIA 4FW8A 4A0SA 4BNGA 1IOLA 2VWHA 3K8ZA 3G79A 1V9LA 5G4KA 1DFHA 2C54A 5C7LO 4AL4A 4I9UA 1PL7A 3KUXA 5KVQA 2FZEA 1Y9EA 5EL0A 3WSVA 4U6SA 1E1KA 4BNKA 2NVUB 5T8KA 3ZH2A 3FR7A 3ETEA 1YBMA 5FWNA 3TFOA 4NG5A 4CMIA 4F46A 4U5QA 4PLVA 3NDIA 4CV2A 3RVDA 3C8MA 2O3SA 2ZB4A 3S2GA 1I2BA 3BHMA 4I5FA 1G6KA 2EHDA 1RYEA 1K3TA 4IJUA 4GVXA 4DTIA 4PLCA 2HUNA 3KSUA 1A7AA 2XPCA 3G3EA 4BMVA 1MG0A 1T2AA 1KS9A 2PZMA 4KQXA 4CLOA 2B4RO 3COSA 1R66A 3KYDB 2P9GA 4WK6A 4J9VA 5L4NA 3E5MA 1PSDA 4E2WA 1YL6A 4WLOA 4WLUA 1FF9A 3BMOA 1B8PA 3A1NA 3B70A 1NVGA 3GNTA 2PKRA 2X5KO 1ZK2A 5IDXA 1DC4A 3U9LA 3W4JA 4FCCA 4MP8A 3EGOA 1ENPA 1ZMTA 4JJIA 1E92A 3L4BC 1UAYA 2FRDA 3ROQA 1E0DA 3C7DB 4Y6RA 1J0XO 1F0YA 3TF5A 3ZHXA 2DKNA 3ROKA 2PGLA 1T2DA 3WLEA 2EIHA 1KC3A 1LI4A 3WGYA 3ZU3A 3PIIA 4IIUA 1YJ8A 4YAKA 4L74A 2DU8A 1DSSG 1MV8A 4CQLA 3QSGA 1E1LA 1YB1A 4R69A 4E0BA 2BELA 2DFVA 2GD1O 2B35A 3VPGA 1N2SA 3MJEA 1B26A 1DLJA 1E3SA 3PHJA 3JQ8B 4C7KA 1EQ2A 1BVUA 4TWRA 4BNXA 1UUFA 1L7DA 3TZCA 3RBVA 1WZIA 2OZPA 4ND3A 4PFJA 1B7GO 4CV3A 5IDQA 3U3XA 5MGBA 4YACA 2Z95A 3OJFA 4N5NA 4E30A 3DBLB 2Y93A 2HQ1A 4L73A 2Q1WA 1Z45A 3C7CB 4KUHA 1EVYA 4BNZA 1XGKA 3TN7A 1F14A 1TXGA 2WEKA 3OEWA 4BO6A 4YWJA 4YT4A 1YRLA 1E7RA 4BNNA 4DLBA 3ZWWA 3UGKA 1BMDA 1YKFA 3DAFA 3AFNA 1ONOA 1LDEA 4Y98A 2HRZA 1ML3A 1UDBA 2E6UX 3DMTC 4AJNA 4CM4B 1T1SA 3PFWO 4LCJA 3NJ4A 1QMGA 4JIGA 1I36A 3GVHA 3W1VA 2EKQA 2Z5LA 3JD0A 4IS2A 4IDFA 5BR7A 1ZSVA 3OQ6A 4CM3A 1HETA 5KJ1A 4B3JA 1R4NA 3ZNQA 4LSMA 1GUYA 4J1TA 1V3UA 2FHSA 1P1JA 5IXYA 1ULSA 3V2GA 2PD6A 1TA4A 5GZ6A 2WE8A 2AE1A 2DBRA 1KEWA 4X54A 4LVCA 3PJDA 4BNJA 4OM8A 2O48X 1EBUA 2GSDA 3GHYA 4D7AA 4MDHA 3EHEA 3GZ4A 4RQUA 3H4VA 4PVCA 4CLHA 4JP3A 4DWVA 4B7CA 4LRSB 4LISA 4BNWA 4ALKA 2RHCA 1LEHA 1OZAA 2PKQP 1NPDA 1TT5B 1ZO8A 3G49A 1KOLA 3FR8A 3I1JA 2X5JO 1RWBA 4J4TA 5G2OA 4RDHA 4NMHA 4CM9D 4ZQEA 4E2ZA 2PNFA 3K5PA 4OO3A 1D8AA 1YGYA 3TSCA 1ZNQO 2YYYA 3JYQA 1N5DA 3GVPA 1R37A 3D64A 3WGQA 4OYRA 3F3SA 3IC5A 4DC1A 1QR6A 1L1FA 2JD0A 1FK8A 4PZEA 1NX6A 3AY3A 1LLCA 4XQ9A 1MB4A 1DFIA 4PGFA 4PLWA 1WLYA 4NNJA 4LMPA 4UUOA 3I9LA 1DO8A 3F5SA 3K96A 5A5FA 5IG2A 2GUGA 1G0NA 2CNBA 5HS6A 3VAZA 3RROA 3IUPA 3QV1A 4GQAA 5AQ1A 1CIVA 3ON5A 4JBHA 5COAA 1VLLA 3CTMA 1MP0A 1ZEJA 3W8DA 4C4OA 2IXAA 4BNYA 2J3IA 4UEOA 5FI3A 3TZKA 3VC7A 2C0CA 3E5RA 3PLRA 5TSDA 5KJCA 5JSFA 2R6JA 1JKFA 3H9UA 4LVUA 2D5CA 4D45A 1UZLA 1BG6A 2WDZA 4GBJA 1LDNA 5IFLA 1PEDA 3WGOA 2B4QA 3JQAA 4KOAA 3GF4A 3TZ6A 1EQUA 1AHIA 1XEAA 2PKQO 3B1FA 3ANLA 3GFGA 2HDHA 1GYRA 1H6DA 2B37A 3SC4A 2J3JA 4O63O 4NH4A 4FQ8A 1HDXA 3IIEA 3I9KA 3UF0A 1WWKA 1KERA 2CSUA 3ROMA 1BHSA 1N92A 1ORRA 3DBVO 1VE9A 3NKLA 5G4LA 3Q9NA 3BMNA 4JQCA 3ZV3A 2GN8A 4TZTA 4GL4A 2X9NA 4WCFB 3W8EA 4IGFA 1NQOA 4R5HA 1PS8A 2GR9A 3GN1A 4E32A 3BTUA 3MJCA 1B8VA 4OKIA 3PJEA 5F1PA 4DA9A 3UHAA 6ADHA 1IHYA 1OFGA 2DUUA 1A9YA 2FY8A 4CM8B 1YONA 3C7AA 1XQ6A 1JU9A 1VPDA 2OORA 2NADA 3ONDA 2DM6A 4EBFA 4FN4A 2DUWA 3C1OA 5C7IO 1SZJG 5T67A 4JBIA 1QSGA 2I65A 3TZHA 2GDZA 5L7TA 2J8ZA 2QYTA 2VHXA 5TC4A 4E2YA 1C1XB 4DLAA 1X1EA 3LLSA 4DQXA 1RM0A 3U62A 2CVOA 1D1TA 5AYVA 1XHLA 3WYBA 1VJ1A 2Q2WA 2Y0CA 2E37A 2OUIA 4A26A 5JDCA 1OBFO 3IAHA 8ADHA 4J7XA 5A06A 4BNTA 5CAEA 2DPGA 3GGPA 4P4LA 2ZJ0A 4ND4A 4A27A 4BQPA 2IYOA 4WKGA 3F46A 4RVUA 2Y1DA 3JQAD 3QVOA 1EFLA 4CMBA 2LDBA 3AI2A 3GT0A 4R1UA 2RH8A 2WE7A 3PJFA 3RU7A 5A9SA 3X2EA 4M55A 3H9QA 1RM5A 4RORA 1P44A 4RPGA 5IN4A 2NVUA 3O9ZA 1Y6JA 3INTA 4FR5A 3G1UA 2OXIA 2YHIB 4PLGA 3BYZA 4H3VA 1UP6A 3I4FA 3GZNA 1TB4A 3QY9A 4R1SA 5DBFA 1GU7A 3OH8A 4EUFA 1P31A 4BGUA 1DJNA 3DZJA 1NQAO 2EGHA 3FNFA 3HDYA 4TZKA 3SVTA 3BMCB 4Y6PA 1OMOA 1QP8A 3VH4A 2QQ5A 2DVMA 3Q6IA 1BXKA 4AJ1A 1UAGA 1QV6A 3WTCA 2BGKA 4BIIA 3RU9A 3OEYA 4F6CA 4XDZA 4DYVA 4AJJA 2AQHA 4NZ9A 2HMUA 1XA0A 2X86A 3LF1A 3EZYA 3KZVA 3DC2A 3TPCA 1NWHA 1BGVA 5IDYA 3LLVA 4NI5A 1GCUA 3CH6A 3VPHA 4UVDA 1BRMA 1E5QA 1LDGA 4FFLA 3ASUA 2B5WA 3U4DA 3GGOA 4L75A 2JFGA 1MLDA 1TLTA 4DIFA 4WNIA 4YT5A 4BUCA 2VOEA 3ZV6A 2JHFA 3KEOA 3S8MA 2GRAA 3DZBA 4XRGA 1VRWA 2XXBA 1PJSA 1BTOA 4CLDA 4IMRA 4GMGA 2C20A 2VZ9A 1MX3A 1U2DA 4UUPA 3ZWCA 3AY6A 1ARZA 3P7MA 4JP2A 4BL5A 3DL2A 3NEPX 2YQ4A 4TRRA 2FR8A 2GERA 4E21A 3DEYX 2BI7A 3I52A 2WYWA 4Q3CA 1YWGO 4UUNA 5KVCA 2QYSA 1PJ2A 1O94A 4E33A 2QRJA 2RH4A 3ZHYA 1V35A 1CQIA 4J4BA 4PG4A 5JNLA 1ADCA 1FMCA 4QT0A 3RUCA 4QSMA 3S1LA 2EW2A 2TMGA 1NAHA 4MVJH 2NVBA 2B4TO 1U5CA 3CMMA 2NTJA 5A02A 4I08A 3ITDA 1HYHA 1GCOA 3S2EA 5TLSA 5CPBA 1H2BA 2D8AA 4QXMA 1XSEA 3AUUA 2H6EA 5C37A 1PS0A 2PR2A 4DPLA 3KM0A 3HSKA 5KWEA 4EJMA 1QLJA 3M1LA 4K9DA 4H15A 2QX7A 3LT4A 4BV9A 3LVFO 3F4LA 1UP4A 4YVFA 1VKNA 4BMNA 1NVMB 2DAPA 2ZTLA 5CEEA 3BMQB 5COQA 2VWPA 3FWZA 4W9NA 2C82A 3KB6A 3EVTA 1PJQA 5FI5A 4BMSA 2PD4A 2VZ8A 4PRLA 4XDYA 5HTOA 5EINA 3RFTA 4NK5A 4NJOA 3SEFA 5K9ZA 1PZHA 5JO0A 1M75A 5G0WA 5CPFA 1EUDA 1KEUA 2NLOA 2IXBA 3GY0A 3UKOA 1I30A 5B4UA 1E77A 2BD0A 3BAZA 1WDMA 3WB9A 3NX4A 3VTZA 3PHGA 5JE8A 1H9AA 5G0TA 1DHRA 5JDIC 1QXSA 4K26A 2ET6A 4E5YA 5TS3A 3RJ5A 3WNQA 4ZN6A 2IEBA 4YQYA 5DCYA 3DBRA 3NGLA 5EJ2A 3PP8A 3E8XA 4WLEA 4HY3A 4JCOA 5F5NA 5FYDA 5C3MA 1SCUA 4E2XA 4MINA 2GZ2A 1WVGA 3CSDA 3EK2A 1C0PA 2AHRA 1JA9A 4EW6A 3UFXA 1CYDA 5L95A 1SMKA 1U1IA 3KYDA 1K5HA 1PWXA
chains in the Genus database with same CATH superfamily
2G76A 5DO9A 4FT4A 1VJGA 3GC6A 3OC0A 1G7RA 2G67A 3AOGA 1G9XA 2RB4A 3AMVA 3N2IA 1T2EA 3EWSA 3WLPA 2LP4Y 1ZGHA 4L4ZA 4Q4JA 4DXAA 2G63A 4J43A 3SZLA 4B82A 4B3TB 3V6LA 4LGMA 1TX4B 3OBIA 1N77A 1VJ5A 2XNHA 2YXBA 1EFUA 3PXCX 4QXQA 2VKQA 2ZIAA 4JYZA 3LLMA 2GA8A 1AUVA 1MJFA 2YBDA 2WYHA 1I3KA 2YQ5A 1ESNA 1K27A 1EXVA 4NATA 3DXXA 2IS6A 3AJRA 5J23A 4A0GA 2D1QA 1TZMA 3HYTA 3L0DA 3KAPA 3CNLA 3HTXA 4WH0A 4WECA 3V8VA 3NHMA 3ND8A 3A6LA 3FDZA 2IYWA 3LK7A 1BWSA 5B12A 1MV5A 3CVJA 3MXOA 4F56A 3U7GA 3IPRA 3V3TA 3VBCA 5EERA 5A0TA 4UHEA 1GGFA 1EM8A 2HBZA 1YZUA 1R2QA 2IW1A 1CQZA 5IAGA 4EMBA 3DFZA 3BRCA 3PUVA 4NHOA 4WV3A 4Y3UA 3TR6A 4EMTA 3ADDA 3M5CA 1XYYA 3NBFA 2BOVA 3NKFA 4R01A 4R7TA 4W5RA 2FQ1A 4AU1A 1B42A 2XBLA 3GRRA 1Z4MA 3GGGA 3ZDFA 3SS7X 1SWWA 3G85A 3AZOA 1KSGA 5A2GA 4DHWA 4LYDA 3LKVA 2H2GA 3OHSX 1TEXA 3IPCA 2B69A 2B1GA 4UKDA 4XQ0A 1LK5A 3RYHA 2QORA 1Z13A 4ZQIA 3S2FA 5BNWA 1JXOA 4TMYA 2L18A 2JFHA 1M7HA 2R6HA 2WZDA 1IBRA 3OOSA 4UU8A 4EFLA 2OCYC 2X0NA 2J3MA 4IXNA 5HGJA 2A9VA 4L4UA 1JPUA 2F3UA 4HXFB 2YJTD 4DV4B 3KWJA 3PA8A 3HU3A 1Z4OA 1VCIA 4MEBA 1ONBA 1YNSA 2P6PA 3PITA 4QGBA 2VJMB 1RDFA 2I76A 2WM9B 3GGCA 3JRNA 1LVUA 3QBJA 4U0JA 1R5BA 4U63A 4FIZA 3E9RA 2C8JA 4KJXA 1I2ZA 1J24A 1U3GA 4RLQA 1IN5A 4ZGGA 2BZ1A 4CR7A 4MYRA 4LNUB 1NKVA 2P1RA 4L7QA 5K3FB 5K8IA 3BBPA 3C4QA 4P54A 5AIBA 2PU7A 2GHIA 3H99A 1W5SA 4MCHA 2PSSA 2UAGA 1EJ0A 2C97A 3K30A 1SRQA 3L01A 1I2CA 1W35A 2DBVO 1ODFA 5DI9A 2AD5A 3UJHA 5SICE 4F92B 1JQKA 2BFDA 4QFDA 1SK8A 2OBLA 2QGFA 3AF3A 5F12A 5B53A 4BQSA 4PG6A 3PLNA 1WDWB 4BKPA 1FA9A 5EVCA 3QEBZ 3F7MA 1XAGA 4GNKA 2W9XA 3U3MA 1PBNA 2IU4A 1EFHA 1UZAA 1PI3A 1NW5A 4KO8A 5JR3A 2ZI4A 3A31A 1R6BX 3Q2OA 2G77B 4WESA 4WOBA 3SSAA 3EH1A 5JZSA 3A1VA 2DQSA 1KU6A 2A4MA 4MIEA 2E4ZA 3PHLA 4MRPA 3Q3VA 2WDPA 4D0LB 3JVVA 3WJ7A 3JQPA 5EJ8A 4K8RB 4DV5B 4JLNA 5J2UB 2YJ3A 3CLUD 4JBNA 1V16B 4HSEA 1D8TA 2AOTB 3H16A 1GDHA 3GU3A 1ULUA 5ALDA 1K92A 2Q7OE 5BN5A 3QZUA 5H9VA 1ZLXA 2IHUA 4C0BA 5CCDA 4DMRA 3GLFB 5LMNB 5GIPE 1MXFA 2AV6A 1O3YA 3HL0A 3I3OA 3CNQS 3QVKA 1P9WA 2YNMD 1RCFA 2ZETA 3D54D 3DZDA 3ZD9A 1AGRA 1EUZA 2YDYA 3DXYA 4N8EA 4TXHA 4XWTA 4JT4A 4EVRA 5L40A 2YV2A 1JDTA 1TLFA 5EJAA 1DCMA 2TECE 5ALTA 1MT3A 1RHUA 3OE1A 4GOMD 5TPZD 3UTCA 3VTAA 4EATA 2CCGA 4Q1VA 2Z2IA 1A72A 3IS3A 4US0R 3ZIAD 3WIEA 3PQ4A 1EIZA 4MP6A 3H9EO 3NEYA 4DS3A 2H16A 3C6BA 1F8YA 2HIMA 2CDBA 1PJZA 1PL0A 5K45A 2DT5A 1B1CA 3A6HA 5ED0A 4YASA 3BJMA 2K7FA 4U1RA 3P2IA 1JIVA 2ZUFA 3Q15C 1TKAA 4IIDA 2FEAA 4UMFA 5FD8A 5HF9A 3ZPXA 5KQMA 5JVDA 1IB6A 1KJWA 1EH5A 2GD6A 2VWGA 2WV7A 1VCMA 3N7AA 4B4DA 8GPBA 3N2GB 4QG7A 3K6SB 1KBQA 1SFRA 2EF0A 2XWBF 3A9VA 4IDDA 3W06A 5F21A 1I9GA 3FGZA 2XGSA 4JITA 4JENA 1ZUNB 4KVAA 2FWJA 1CP3A 3AEUB 1O8BA 3S0JA 3WKBA 2WKSA 3HGTA 4U2GA 4FOPA 2IE0A 4JBGA 4MIYA 2CVHA 1SQ0A 2XOKA 4P98A 5FOSA 1NDQA 2OT3B 3AONB 1KIFA 3LNTA 3T4EA 5JOQA 3ZNPA 1F4VA 3GRFA 3H3JA 2QRNA 4GYKA 2XOEA 3FPJA 3ZE7A 1RBMA 4DUGD 4N65A 1D7AA 1XVLA 2HC9A 2G9NA 2O07A 3QLUA 5JCXA 2VSQA 4GSKA 4JI3B 5L7WA 4KLAA 1KQ3A 2O5EA 4X71A 4UMDA 1N2CA 4OK6A 5E4TA 4QYMA 2PLAA 4LYYA 3KYIB 5SYAA 5JQGF 1KARA 1U99A 3PC8A 2QTZA 2CMHA 1BXZA 1VSUA 1AIPA 4B3DA 4G9EA 4ZMSA 1NUSA 2FEPA 4IJQA 1HSOA 2DB3A 3UQYS 2FPRA 1PLJA 4S3MA 2AXEA 1L8XA 1W36B 1X7WB 1JHXA 1PGNA 1SVSA 3G7NA 3GLRA 1E4EA 1ZIXA 3IAM6 4J3FA 2QQ0A 2JGNA 4CE6A 4A15A 4QUKA 3BZUA 1TVEA 4ZXFA 4E11A 4KAXA 1WV1A 3OOHA 3STWA 5FBLB 3V9PA 3ANMA 4AECA 3RTEA 1P9LA 3ZU4A 1CVLA 2MJLA 3HZOA 4PQGA 4DIDA 1LV8A 2ORWA 3L0ZA 2HXYA 3PUIA 5CHYA 2QDXA 2G3YA 5KYVA 4HDMB 3ZWVA 4DMHA 1PT8A 2GCIA 1A27A 4GKBA 4HAVA 1I7QB 2H18A 2CV1A 1Q3HA 3RT7A 2J9YB 3PPVA 1WPGA 3DAOA 3RS5A 4XEHA 4MVJD 1BN7A 4XJSA 3OTWA 2Q3CA 4A0HA 1P81A 3NC0C 3O8OB 4LC1A 4PG7A 4Z2AA 3GBSA 4GR4A 4IGAA 2Q29A 4JCCA 2Z04A 5ALSA 3LDUA 3Q3CA 1FMLA 3T3PB 5H4HA 3ELYA 2VYFA 5GM2A 3V8MA 5BNTA 3L3BA 4M9ZA 3SYLA 1JZSA 4CODB 3T5DA 4Q1AA 1CU1A 2AKYA 3JQAB 1T26A 4TYMA 2Z9DA 2R8OA 2RGEA 2RK4A 3S2YA 1F12A 2AA3A 1OAAA 2R1TA 5CM2Z 5CFZA 5CXUA 1M5TA 3UN1A 1UT6A 2HHAA 3TDMA 3UIEA 2WG1A 5K0GA 2UU9B 4GRDA 7MDHA 3U0VA 4P36A 1L8AA 1QUEA 1W36D 1IEWA 1L7RA 2JHGA 2GWHA 3KR0A 3TAHA 1HDOA 4GLLA 5F23A 4JUDX 2QNRA 4HYQA 5E6UB 4KPEC 1GWNA 2P69A 4RV9A 4KUGA 1YD7A 3BS4A 3IHLA 2AI2A 5TNXA 2J5BA 1QE0A 3K92A 1DRUA 3Q7EA 1MCZA 4UCWA 5FWYB 1OLUA 1M73E 3H8SA 5F35A 1TUEA 4WE3A 1G291 2R8PA 3L43A 3PDJA 4WCFC 2WAOA 1ONNA 2YZMA 5F1KA 4YGXB 3T3GA 2FPGA 2PX6A 1I0ZA 6REQA 1OTYA 4XAQA 3G5TA 2YJZA 2IPOA 3A4TA 4INJA 3CVWA 3ABIA 3LHSA 3B6IA 3KT6A 3PDWA 2HTEA 3DL0A 3CVVA 4KACA 1C9NA 1H69A 1UINA 3ECAA 1RC0A 4PC2A 3ZWXA 3NTQA 1EFVB 1YVUA 3R3UA 2HNAA 3BXZA 2YJ4A 3QMPA 4OAQA 1G17A 2O3QA 2GLXA 3TRDA 2WU8A 3VSBA 3EN0A 2MSCB 1B0UA 1LVGA 1Q84A 1EE2A 1F38A 1RMQA 2FEWB 2Z2JA 2ZJ3A 3BDVA 1YA4A 3GRPA 4NZYA 3O8QA 2Q2VA 3WBFA 3NDBB 1PR9A 4CJXA 1QHGA 1ID1A 3NDJA 2ISCA 3TGWA 4XGRA 3OZIA 4XUEA 3WGVA 4U6QA 1RQNA 2Y4OA 1ORHA 1B43A 1JFVA 1SCUB 2P0AA 3IJEB 3PNBA 2JFYA 3R1IA 3BRWA 2YFQA 4ND6A 5TQ0A 2Q5FA 1WZEA 5CLQA 4ER5A 2VQFB 1IZ0A 4R31A 1IWOA 2G1AA 3HKDB 2KI5A 1MEOA 3DMNA 1NXWA 5GOTA 2LBPA 4N7JA 3RC2A 3HKCA 3A9WA 1ISIA 3JZDA 1E2EA 1HI9A 3LSTA 3RANA 3WNCA 4DFDA 1OFUA 1UMCB 4BS9A 2VRCA 1QTNA 1RYNA 1R6TA 4Y9RA 2X2EA 4AI6A 1W2GA 4HRVA 5EJFA 4IILA 3WLAA 2K2QB 4DMCA 5ULLA 2XB9A 3G2JA 1B3RA 4P38A 4Z53A 4E03A 3F78A 2VJAA 1AS2A 4EGFA 4CT0A 4X64B 4U7JA 3GJ4A 3OZ7A 2WQZA 4H7JA 4Q05A 4MUXA 4P9NA 4ZD6A 4AVYA 3PEYA 1HFEL 1DXQA 3QJ5A 1L3IA 3UOWA 3AINA 3RYHB 2B4AA 4RKWA 5DASA 2AW3A 2V8BA 4RU1A 2AUMA 2P4QA 3R5JA 5K0ZA 1MOQA 2SKCA 1X1QA 3FUCA 4P22A 5KJFA 2ZM6B 1HG1A 1ZXBA 4PLFA 1WJGA 4RHEA 3ZD6A 2B8NA 3KZOA 2Y99A 1OYWA 2NYRA 5H0IA 2VSXA 1ISPA 2GCNA 5BSMA 4DLVA 3ZOKA 1JIQA 5I8WA 3OSZA 4KR2A 4MV4A 3EVAA 3T34A 2VATA 3UM9A 2OC9A 4F4JA 2QJOA 3W34A 2DP4E 1B0AA 2X13A 2A78A 2XTJA 2CFOA 3U3DA 1VSQA 2QUBA 1RVV1 3NPAA 2RBGA 1GPBA 3KQPA 1NOIA 3NHSA 1E89A 1I0IA 4NP6A 4BVHA 5GZ1A 1GAEO 3VRHA 4JL5A 3SF8B 2WUDA 2NU8A 2UZ1B 4LWZA 1FVHA 1KO8A 2C2XA 2RI6A 3BMXA 3NHWA 4Y9DA 4JLBA 2BDUA 2ZJ1A 3HGQA 1JPJA 2MSKA 4P7FA 1HLGA 4FDTA 4G1FA 1V4NA 2Q6KA 3HUDA 1ZI9A 1E6CA 2QUAA 3H9JA 2LNDA 2ZJZA 1HT3A 2OHGA 3KOUA 1WCIB 3JZFA 1AQYA 4DA6A 3ILHA 2E85A 1N5JA 3P2JA 4UFPA 4BJ1A 3CPSA 2ZVPX 3F9CA 2R2GA 3B36A 3PNLA 4MTCA 1LNQA 1E2LA 5C31A 3R74A 4ZCQA 1W2WB 2VYND 3K0FB 3UOAB 5I48A 3FFWA 5KSYA 4WNAA 4ILEA 1X2EA 2C96A 1LZKA 1WXDA 1YQGA 1C7IA 2Q4EA 4WESB 1D2HA 3BMOB 4X5OA 4XH9B 4ZOQI 2OMKA 4BCCA 3K73O 3GMIA 1VDZA 3IAEA 5FQNA 2ZXEA 1NXVA 1JA1A 2B9EA 5KYTA 3AG6A 1C1DA 1NT4A 4RE6A 1IY2A 2VJNA 2H1VA 3CRVA 3ZU5A 2GCEA 1VGRA 4GXTA 2C94A 4WXMA 2EJBA 4CUKA 3ORSA 4YXFA 1E9VA 1FQWA 1L9KA 1QVVA 5EYPB 3TOXA 4Z4QA 2ZIWB 2BSQA 1G18A 4YDQA 5A5VA 3E7FA 4NCBA 1E79D 1NBAA 4L15A 5JRDS 2X2PA 3HCNA 4WBSA 3KT8A 2I67A 4JKIA 2PUCA 3KTAB 2NUAA 2J46A 3K8OE 5FNVF 3M81A 2ZOSA 2OOSA 1GDDA 1I5RA 5I4IA 3K6JA 1LWOA 1W36C 2E87A 1JDNA 4ZV9A 3KHKA 5BV1A 2RE8A 4LOLA 4KXWA 3AG5A 1P2FA 4FGJA 1E60A 1CF2O 3EC2A 3C97A 4FMCF 4YDRA 4BQFA 1BMFA 1MNAA 3IJRA 3OZCA 2GNAA 3PPXA 2CNDA 2HK9A 4RZ2A 1P39A 3LDAA 1FUUA 2QNBA 2FWNA 4NFHA 2RB5A 3TSOA 3VR3D 1EESA 4IXTA 3K9GA 3IT2A 4W7SA 3EGXB 2W6IA 1HZZA 1TO1E 1UKAA 1YQQA 1U2TA 3CE6A 3P52A 1JFTA 5AOBA 5I9NA 1DXOA 1NI3A 2QN2A 3DNPA 4BC1A 3PS9A 4HWGA 1GTSA 2ZB3A 4C03A 1RPJA 1DEXA 1V1MA 3UAWA 4HNRA 3V1MA 1SOUA 3U5ZB 4NFYA 2CV2A 5U4QA 4GKAA 4HUQA 4JVSB 1AY0A 4Y2HA 2DJ5A 2GT1A 1M2OA 1ICEA 3CT6A 3GAZA 1DX4A 3RV3A 3WKAA 1P3DA 2JLAA 4QU0A 1PGJA 2CXXA 1CQIB 5ELXA 1HDCA 3THYB 4MWGA 3ADBA 1CD5A 4RL6A 4G86A 4L4SA 2PUJA 1OXUA 4Z1MA 1YRHA 4YCAA 1H85A 3DV9A 4RVFA 4XPIA 4KQMA 5CYOA 1U28A 1XDSA 3ACCA 2JHAA 2UZ4A 2XHZA 3OZVA 4Q7MB 4I50F 4YHHB 1PNRA 1DAPA 5JUWA 2QTRA 2XVYA 1OA1A 2FMFA 2D2VA 3R6WA 1BH2A 4Y0AA 3RTGA 4DJEC 3M7IA 4K6HA 2V7VA 3PR2B 2AJ8A 4B6JA 2BEUA 3FCCA 3QX7A 1UMCA 3HV2A 4RZUA 3T61A 4KMOA 2IV3A 1M2NA 3IP3A 3M9XA 3H1TA 2HN9A 4M1TA 1DBIA 4YMIA 1QAMA 5KO2A 4ALLA 1JBEA 2CXOA 3FZQA 4IDHA 4JXXA 5AOCA 2RGGA 3OT4A 3IBFA 5FNVB 4GKVA 5EJGA 5ALHA 3TW0A 2PUAA 3B6KA 3E03A 4Y6GB 2GD0A 5CJ2A 2VWQA 2GAFA 3VKFA 1HNXB 4OLHA 1QHFA 2ZYIA 1M7GA 3IT3A 2IYQA 3ZEAA 3H5OA 3L07A 4NQZA 3BICA 4E7OA 1KI9A 3GEBA 3I83A 5AW1A 3KD3A 4G24A 5FHRA 4ZAXA 4PG8A 2VYVA 3OIUA 3JQ7B 7AT1A 2ZBQA 3L02A 2C95A 1DJQA 3H6HA 4PX3A 2GBGA 4I5EA 5F98A 2F9FA 3VSCA 5BSHA 3FCEA 1CEYA 5TARA 3HJGA 3LBYA 5LQMA 4YRDA 3CWZA 3TTUA 2DH5A 5I47A 1FUIA 1FTYA 3QQPA 1ZUNA 3ZTYA 5AO9A 4DABA 5LZ9A 3UMVA 2ZE5A 5KKCA 3T52A 2Z2ZA 3FBTA 3VR4A 1NU6A 3CU5A 1PR2A 4XUGB 4IEIA 5B37A 1P1HA 4LRWA 2C0PA 3OY2A 4BO5A 1KDRA 1PK7A 1UMBB 4YUVA 3I62A 2UUAB 1PNQA 4KQ2A 4NDZA 8AT1A 3PSAA 5CH5A 4KQIA 3AETB 4KTTE 1G5HA 5ALKA 4ZKEA 5JS8A 3UJ7A 1JDJA 2OCBA 3BIOA 2YVAA 3H2KA 3L8MA 3D8RA 1N8NA 4FYYA 2PDAA 5CFQA 1M6VB 4IJKA 1JEAA 5AJVB 1QTRA 4RVDA 3DOIA 2A35A 4GI7A 1IQ0A 2GK7A 4MIOA 4RY9A 5C8YA 4R8LA 1CUHA 2KYRA 3HP1A 2R6GA 3O94A 1C1DB 3WFJA 4PN7A 4PIPA 1ENZA 1PZEA 3NBMA 2H9AA 1AXGA 3HUUA 2VCHA 3LIPA 2A84A 1CS0A 4LOHA 1DIGA 4UDNA 5WRFA 3ZNOA 2BKEA 3ORFA 4JQSA 4WTOA 1PZGA 3L1VA 4DPKA 2YYAA 3QLTA 2AJBA 2XOXA 3B12A 3NATA 3DCNA 4NEGA 1F8FA 1IM5A 2VP0A 1JZQA 4R7GA 4FWTA 4JBXA 4O3MA 2XUJA 2VSFA 4TL8A 5DLQC 1IMJA 1WVMA 3S2SA 4B45A 1P3Y1 1QZZA 3O4JA 1QF6A 3CIFA 2JC3A 4JLPA 4M8IA 2HV8A 4MYSA 1IIBA 1Z0DA 1BSVA 4WFKA 1J49A 3TJMA 3DR3A 3VOTA 1PVOA 5KSPA 3JD4A 1H93A 4LE0A 3ZK9A 4W5HA 4DCOA 3GLQA 3MS4A 4UQPA 1QRUA 1W581 1DKOA 2REOA 4C43A 4COKA 2VBGA 3KTDA 5GZ3A 3D4IA 2WJVA 3A06A 4R05A 2WZCA 2XMBA 3VNVA 5T3UA 2EV9A 5KTTA 2XT0A 2QLBA 4D56A 4D3YA 2QHXA 2V55B 4OSEA 4PNHA 1T8SA 4H59A 1UBCA 4Y1GA 5BNFA 5SZJA 3REOA 2VS1A 1R1DA 1NMSA 2B94A 2E55A 4X1YA 3VNRA 1XD8A 3NHJA 3I05A 1FEZA 3BSWA 3OFSA 1BC5A 4OI2A 4Q9LA 1XIVA 2IOQA 2X1VA 1FBTA 2XMRA 2C92A 2FG6C 4URVR 1B8NA 4PIVA 3WZMA 5H4GA 1XTBA 3GJZA 4R2HA 1V5GA 1Z7EA 1Z88A 2JBAB 2YZGA 4IICA 1FJHA 2FPPA 4MVJF 4OBWA 3Q8KA 3LOUA 2H57A 4JSTA 4R1LA 4O2RA 2D2EA 2IRWA 3TDKA 1PV1A 2A0FA 2AJLI 2BF7A 2NU7B 1PDVA 3R76A 4W4TA 2W8BB 2WOJA 5C51B 1V48A 3D5TA 4QGFA 4LK2A 4QC2A 2OLJA 4KQFA 5B1YA 2CT8A 1GZ6A 1TQ6A 2XLBA 1CUJA 2IYVA 4Q9NA 1IN6A 2XDQB 3MYYA 3T7SA 1FLDA 1CUFA 4MVCA 2J9XB 3JZIA 2DHCA 1CSEE 3GCGA 3DOHA 4CM8A 4IKPA 2YWXA 5L45A 4Q3BA 2PMEA 2PEZA 4IS3A 1GGHA 1L1QA 3PQ2A 3OLZA 1TA9A 5L3ZA 1BCRB 3G9XA 2GS9A 3ET4A 2ECQA 4D6XA 3Q2KA 1XPJA 3WQSB 4HWKA 4CXMA 2YWBA 5K5EA 2IITA 2QLNA 5C46F 2YN2A 4N12A 3P2MA 2HNBA 2Z6UA 4JVMA 1V3TA 5AM1A 1QDUA 1QE3A 2BDTA 3B51X 4Q12A 1N57A 3E9NA 4YFYA 4OY3A 1BCSA 1R0ZA 3FMGA 4TRJA 4RF3A 2OV8A 4EG5A 1Z8HA 1ZOLA 3L6RA 2X3UA 4E70A 1Y6FA 2EW8A 3D5QA 3N6XA 4MVJG 4FKZA 1M72A 1X1DA 2Q3FA 1U9ZA 1V3VA 1QGUA 2JLYA 2FSUA 4NHEA 4CDGA 1ZW1A 1Y5RA 4FFNA 1QS0B 5C35A 3FTCA 2IU3A 4QECA 1D0VA 3C98A 4LHXA 1XJQA 2GBPA 4B3CA 3FAZA 2DTEA 1P0FA 4ZCLA 1GRVA 2FX5A 3SXPA 4BN5A 2EFCB 4IVPA 2XECA 4LC0A 3GWGA 1Q50A 1Z16A 1AHHA 1P7WA 3ETDA 2GILA 3CZMA 4WFJA 1YZHA 5F77A 1CS4C 4YAEA 2W58A 5SY6A 4B6OA 1G3MA 2CFCA 1WHTA 2FZ5A 1L7XA 2JW5A 1TQ8A 2PUVA 3UZUA 2R5WA 1FUKA 5KHAA 3T1QA 2PMKA 2YJGA 1MG5A 2ZTMA 4DG8A 4QPZA 2QU8A 1QRSA 2J67A 2IDZA 5BVHA 5K0CA 1LPNA 3MWYW 621PA 2VJCA 1SVUA 1Q1AA 1MAUA 1XQXA 3GARA 4AKEA 1ZJ6A 1UDWA 4EW1A 2EYQA 4KWEA 1ZH8A 4PQFA 4TRNA 3OJOA 2EIXA 2P79A 5CUQA 5EIBC 4D9HA 5CB4F 4BBPA 2AJDA 3LP5A 4RF5A 1E2KA 4BUJA 3EMKA 4JZYA 3TB4A 4ZI7B 2NACA 1YTUA 1X14A 3UHJA 1G3QA 2NU6A 3TIIA 1RKXA 2QG4A 1Y4UA 2WIAA 3G2MA 4JC0A 3F73A 3S1AA 3H1EA 1ZBDA 2ZT7A 4F5WA 1RXWA 2ZZMA 5B4VA 3K35A 2OG2A 2PWPA 1NF3A 4XYBA 2I7CA 1WCWA 5I6DA 3I34X 2E18A 2W70A 5KHOC 1SVOA 2GN9A 4XGIA 2GYUA 1KK2A 1ZJJA 1DV1A 3N58A 4B4VA 2PBFA 2GXQA 3ZU2A 1ZVKA 3PQDA 4C9BA 1DOHA 4LWOA 4FHDA 1NVDA 1K9SA 4LRUA 3NDPA 1NC3A 2Q1YA 4IJ5A 5C4GB 3I30X 3PNMA 2DHEA 4W82A 5LKRA 1ZAKA 2A33A 3B1XA 3EC1A 3K2EA 3TNYA 1FDWA 4YRBA 2GYYA 3KLMX 4OHCA 4AXXA 3NNSA 3EGXA 3JS5A 4UBLA 2ZI6A 4ENUA 5MN5A 4FINA 3DNFA 2DFDA 5DNDA 1DRWA 4LRYA 1A9TA 3T15A 4ICIA 4MOWA 2AG0A 4Y8VA 3NUQA 4NK4A 1J8FA 1NYTA 2CWDA 2PUWA 3HLKA 4BFWA 2JFQA 1W49A 4HH3C 4J2TA 4MRNA 3BXEA 4A6PA 2HUPA 4CM1A 2MDTA 3N2KA 4YJHA 2J0UB 3KV1A 1KR2A 1DEKA 1OE0A 3LQ2A 5F7XA 4LJ4A 1I33A 4FN5A 3NORA 1MU0A 1OXSC 1XHEA 3GQBA 2MU1A 1SRRA 4JN6B 3F8WA 3LCUA 2H7CA 3KLOA 4C08A 4WKNA 3H0EA 3KSRA 1QP4A 1PWEA 3R4CA 2MSEB 1IULA 3EHDA 3KB1A 3DD1A 1JJAA 3H7AA 3HB4X 1E61A 3PKZA 5YASA 5B55A 2DFKB 1CR0A 3O47A 1UBEA 2QM0A 3E8MA 1EEHA 5K3FA 5KNDA 2WTUA 1X13A 2WAXA 3OIWA 4HDQB 2ACVA 4K9OA 3URKA 2ONCA 2BBTA 1X38A 5DULA 3A9CA 3LXUX 4DMMA 3ZWQA 4I4IA 3PXUA 1W1IA 4FDVA 4YJGA 3IL2A 3TXXA 2N46A 3FOAA 4DDTA 4U7WA 2WD7B 1SBQA 4C7VA 3LPAA 4LXIA 3QKSA 1UEXC 2E21A 1LBHA 3Q0EA 3GK3A 2MSLA 5D1NA 3PI6A 4UQOA 2YHSA 5HKLA 5A6SB 4S04A 2XA1A 1QF9A 1NRXA 4HNGA 1GUDA 3HB1A 3BJEA 5FA6A 5HQJA 1P73A 1LSSA 1XD2B 3IOYA 3JAKB 4YJDA 4EZEA 3EPLA 3H5AA 5DN6D 5JY1A 5GONF 1D5CA 4DQ0A 2X4GA 4RPKA 4CL3A 5A1TA 4WNCA 3GLVA 5KPJA 5AP9A 4RSRA 2JL1A 2XAAA 4HWPA 3HEBA 4JJZA 5P8WA 3ZLTA 2J4DA 2ORIA 2ZCUA 4P7GA 1CY7A 1VE5A 2ODWA 4YB8A 3U44B 4EIWA 2C9YA 1NUUA 1FXWF 1VFPA 3WDLA 4EX6A 5DLDA 2O9JA 3CUSA 4I14A 3W9SA 1SKBA 1XRPA 3AETA 1XVVA 4RTLA 4P8RA 4KSYA 3CRMA 3L0CA 4XYEA 1I7DA 1CRQA 1M2GA 3LNCA 2P1ZA 3OCVA 3W6ZA 4EJ0A 1LB1B 3VV2A 1PNVA 1AF7A 1IOWA 1FP4A 1YDEA 4N4AA 2AFHB 3SVZA 3GLIA 1IDN1 2O2XA 2P8JA 1M6EX 3NQ41 2QJFA 1IG0A 2YN0A 1T36A 4M6WA 4QO7A 1RRKA 4EJFA 4AY2A 1Z4LA 4DDVA 3VHQA 5TF4A 1A5BB 1KVRA 4TLLB 2QRUA 3F67A 3ZW9A 4D9MA 2JZCA 1F48A 1L5OA 4MPTA 4QBKA 1MQ8B 3HN2A 1C3VA 4LJ7A 3EPPA 5CP8A 1L3CA 4HXEB 4KLZA 4QQRA 4BVGA 1G21E 4B76A 1SB8A 3RC8A 3STUA 4ZI2A 2C1XA 1M0WA 3H2IA 5ENDA 2FMIA 5FCDA 5FJJA 3ISTA 3ISVA 4C4YA 2VPXA 4O4LA 1PX0A 1MRSA 1JF8A 1ZH0A 2FSSA 3I92A 2QTWB 1ABBA 4RACA 4FE7A 3MB5A 5JASA 1MIOB 3EPRA 2NAPA 2ODQA 3NH6A 4GM0A 3NM5A 3IV9A 1FJXA 1VL0A 3R6LA 5AW2A 4KV7A 2QQFA 3D8HA 3QWFA 4MRAA 1SXPA 3EZFA 5EKXA 1EGVB 2B4YA 2H59A 4LIPD 1OIXA 5KTYA 3ZJ4A 2Z98A 2W90A 2Z8YM 5HK8A 3KSBC 3FSJX 3JSAA 4Q3DA 4YJFB 3A4NA 3TLYA 2JGDB 3R09A 1QV7A 3K09A 4OI4A 4RZHA 3ESRA 4S1NA 1B76A 1GNVA 2NSYA 1T1RA 3QWIA 4PIMA 2DGDA 5E9JA 4AJOA 1JA0A 4PN3A 5C8VA 5B2ZA 1VKRA 3CWCA 3BWXA 3EFEA 3DE7X 2V7QA 4GLOA 3WSWA 2WHYA 4KP7A 3EYWA 4A1FA 1NI4B 2I99A 1VIVA 1ZH4A 4RESA 4Z9YA 5D5HA 4LI0A 3A9RA 5BQ5A 1A69A 2RKWA 3ITNA 3K31A 5CT8A 3H97A 2QXYA 3BXGA 4JB0A 4Z4CA 2AUTA 1MN6A 2F8MA 2JJ2D 3DFIA 1ZUHA 3EUWA 4LK3A 2P40A 3G0CA 4RH0A 4REQA 4U39A 4Q9KA 4EHDA 3I61A 4UASA 2ZK7A 4X20B 3FUVA 3A04A 3CW8X 5ALPA 3UJAA 2AG8A 1PQUA 1ZXXA 1ISHA 3LY5A 2OSBA 3SYMA 4DYHA 3MLAA 3IX7A 2AQ8A 3NTXA 3TINA 5TDHA 2D2IA 4BU1A 5HWSA 5DM2A 3G2QA 3N87A 3P2OA 3N3BC 4C1NA 3X1DA 4FPXA 2JGRA 4FE4A 3VZQA 2BRUC 3DKRA 1Q0ZA 5H1YA 1ILWA 3VR1A 3AJ9A 4IEEA 2ZR7A 1DEAA 2ZIEA 3PKJA 5DTEA 4CMCA 2FXIA 2G6TA 4G23A 4BC0A 1G42A 1ZOIA 1JYSA 4CIVA 4DLTA 3AF5A 2EXXA 1M76A 4PRKA 1Q6YA 3IP1A 3KD2A 3P0RA 1HE8B 3NOOA 2QD1A 5H3LA 3VJKA 1EJBA 4X60A 3ZDRA 4CKWA 5JS6A 2NZJA 5IS2A 2HV9A 4HTAA 2D74A 1WMAA 4JYMA 4R3NA 3H1BA 1MX5A 4LHZA 3HLYA 3BD8A 4U9IS 3O21A 1Q5PA 1WSDA 1JKXA 1XWWA 1YULA 2QTBA 4MUBA 5ILQA 4BGVA 4P7JA 1I6KA 1YVRA 3L93A 3BDAA 1Y6QA 3OU7A 4OJNA 3PEEA 2XT9A 4BVJA 3F71A 4AF7A 1JHRA 4PFQA 2O0JA 1JYEA 1WQ4A 2I2BA 4HDNB 3L6CA 2M6RA 3O8NA 1U9CA 4GSLA 5IARA 5CLGA 4QJ4A 4M7OA 1AQJA 2XBUA 4G4SO 3OQ1A 2REQB 4MI1A 3ZD7A 3ESBA 1VL6A 5FOXA 5LQNA 5LD2C 2JH9A 5T4HA 3JQFC 5TVGA 3BTSA 3OJLA 3ZIUA 4E7PA 1S7CA 3CLTC 4LOKA 1UBHS 2LW7A 1FTGA 1JR3D 1SG0A 3O4FA 3P97A 4HEA6 4C0KA 5IVKA 4MI6A 1FFGA 5L3SA 1V8DA 2A5FA 1IBLB 1WDLA 4LTMA 1WVIA 4PZUA 2WWWA 5EXTA 2AYYA 4HN2A 3ZIDA 2Q62A 5K4HA 1S8NA 3HWX1 2W2KA 4PF1A 4ZZ3A 1Y4SA 5DHFA 3UEOA 4RQTA 1T2NA 2XRFA 2CNKA 3CEAA 4OQNA 3WSTA 2Y3IA 1F0KA 2TSYB 1G8AA 5BSKA 3KKNA 3F6YA 4MMYB 4PCVA 3NBXX 3T5AA 3OHPA 2RHOA 3GOQA 4G2NA 4KXQA 5HF8A 5AVKA 5JQWA 1NR5A 4GMFA 4NENB 3OZUA 1PT9A 4RIGA 3K9CA 3E3MA 1D3AA 4BQEA 3T5CA 1Z26A 4AS1A 4MQ4A 4N0PA 5EE5B 3L8GA 1E3WA 1LPAB 2H7XA 3G02A 3I0ZA 3HRHA 2D3WA 3KVOA 3UAGA 5EFOA 1LU9A 1UP7A 2VYVD 1YZYA 2BZGA 2ZE8A 1KHTA 2Y0EA 4RZSA 5BURA 5C8ZA 2VTBB 1NXOA 4DY4A 1T35A 2QR5A 3RABA 5JCOA 5TMBA 1UPXA 1CJCA 2PGXA 1O7JA 1P7CA 2WIKA 2NUPB 3KKEA 4N54A 4E12A 2KBFA 3AIIA 3WHIA 5BP7A 1TT5A 1Q77A 4CCYB 2PCJA 4D82A 4PZAA 3BERA 3KXKA 5AVVA 16PKA 3FFBA 1XPUA 2DERA 4WI1A 1O57A 2I6UA 2B1RA 3PUXA 1A1SA 3CYFA 2ZKLA 4KQ6A 3B1VA 2C1ZA 3DAGA 1ZISA 4OHOA 4EGSA 4D25A 1E1CA 3E4CA 4O1MA 1K5DA 3R7WA 2HQRA 4QHYA 4JNKA 2Q28A 4JJGA 3OPQA 4PTZA 3RSSA 4PNEA 1KEPA 5JTTA 3RBZA 3CNNA 3LUBA 4U0KA 1N4DA 4CMEC 3IDAA 2IL1A 5J47A 1IJFA 3HDJA 4EYKA 2WWRA 3C1TA 1J7JA 1TJYA 2XVXA 3GJ3A 1PJ8A 2H29A 2HLNA 1PFUA 3MT0A 3K9HA 2P9EA 1AZTA 1TMKA 2EFEB 4IGKA 4KU4A 4HX5A 2COUA 3D6FA 3E27A 3MRXA 2H17A 4HP8A 4Z9XA 2F4VB 2W8ZA 1VG9B 4TTVA 1THGA 1FFYA 1MH1A 1G8GA 3CEMA 1LLQA 3BMNB 1UODA 4MQUA 3WO1A 3QQ5A 3GHHA 1ZL2A 2WIBA 3C6KA 2WJGA 2Y4NA 2XKJE 4UVEA 5H80A 3H2SA 2WD9A 2YWRA 3LDGA 4PG5A 4TKUB 1M8PA 2W42A 2V9ZA 4CL8A 3EY4A 3CFYA 3SHWA 3X43A 1P0IA 3NHAA 2Z6QA 3VUFA 4US1R 3FCYA 2IUTA 4U8GA 1EXWA 2GGSA 3PL5A 4JMLA 3CEPB 2VAPA 2I22A 4PSUA 3WZLA 1FXSA 2VRBA 1GZSA 2J0SA 4HYTA 1EMDA 2ZAGA 3KAJA 4WY5A 2M1XA 2XZPA 3WWOA 3HKEB 3KQYA 2IU0A 2VQEB 1BXGA 2G82A 1XELA 1RFGE 1J0EA 1KJIA 3LTEA 4JLAA 2WJ6A 3LQ4A 4PYJA 3S8EA 2NAFA 2QLTA 1U4NA 4LHVA 1E18A 4NC9A 1FLNA 3I32A 4FR2A 3IODA 1WABA 1US8B 3ZY3A 1L2TA 3ZXUB 3GFOA 3A0RB 3IGFA 4UC0A 1RYYA 1XCMA 1LX7A 2D62A 1RPAA 2W2VA 2BE9A 5FTKA 3RYIB 3SSNA 1WXEA 4JXJA 1AT1A 3FDJA 4J0KA 5JSUA 3Q72A 2PRIA 5GJBA 2HU2A 2R1TB 3E9EA 1E3LA 1AXEA 4JSRA 5DCUA 4F45A 1F7VA 3IO5A 1XZLA 4TS4A 5DSTA 1GRQA 1Y8RB 4DM7A 4YV0A 2C4VA 3DMTA 3B3JA 5DM70 3D1LA 1JDZA 1HOTA 3TWOA 1XQWA 3F6RA 1Z12A 4II3A 3TYXA 4EZIA 2Y2UA 2NYVA 2BC9A 1OXVA 1N7GA 1QCCA 4YALA 1GQYA 1GV0A 2HDNB 1SU4A 3KZNA 3RSZA 2AL7A 4D4MA 1CQPA 4GPZA 3OZAA 4QXPA 4BMYA 1N1GA 1DAKA 2OBFA 3HP4A 3VI3B 2BMWA 1BW9B 1NLFA 1YC5A 1LPSA 1LS6A 3LV8A 3N6RA 4UFNA 4UM7A 2YWJA 3AUAA 3QKTA 1M33A 3RIEA 5KTNA 4QNMA 1RU3A 3GPDG 1IY8A 2C31A 3CE9A 2N1BA 4FWIB 5F51A 3RQIA 4BVBA 4CMGA 2ZYRA 3UMJA 1GFZA 3RVMA 2OHFA 1J2EA 1T6NA 1KO7A 2QTCA 5AXDA 4TL7A 1SAYA 3DDWA 3RRMA 5L3SB 3IDQA 2YUTA 2AN4A 3MRSA 1JMYA 5M04A 1AHPA 4ALNA 1YE5A 2WG2A 2QAGC 3DZIA 2Y67A 3KJGA 3MMXA 4ML3A 4GPAA 4J76A 5EIFA 4GGOA 5F7OA 3GUUA 3OIDA 1GR1A 1TFRA 5COBA 3SNHA 3L40A 2NQ2C 4QOHA 3KXIA 3UK7A 1RWPA 4B44A 4F5EA 1BFUA 1F9EA 2R1VA 1GN8A 1SU8A 3GD5A 1GQFA 1OFIA 2DLCX 2Q49A 2VK8A 3EF1A 5CM9C 1A82A 2H4ZA 2IY9A 5F3WB 4XB1A 1IZZA 3C74A 4KDCA 4EB6B 1IN4A 3TKAA 3VJMA 2KE5A 1RZVA 4W5TA 1IC6A 5G1PA 2V74B 3EFBA 4EYSA 3ADCA 1UKEA 3MRVA 4BLRA 2PX0A 4D4JA 3W5DA 2GPNA 4XZ3A 4MWSA 2AI1A 1CVIA 2F3SA 3UKJA 1ZK1A 4HCJA 1HRDA 2VC2B 4A73A 3GI1A 2YL2A 4MQ5A 1NX9A 1XMPA 1ZM2A 4HLQB 2ERXA 2OXEA 4Z4FA 1TO2E 3CRZA 4V39A 3QXGA 1DDGA 2PGDA 1RYFA 3H19A 4UBMA 2H9IA 4UAJA 5ANRB 4F4UA 3J81k 3NVMB 4OQEA 5AVWA 2F55A 1PGPA 2AE2A 3UXYA 3ZXYA 2PQ2A 4J3JA 1X80A 3P0EA 4CR8A 1VCNA 3F0TA 3N86A 4MH0R 5T64A 1XDWA 1Y81A 3K2QA 3KKQA 3QYPA 4BJ5A 3O8OA 4R1MA 1JTFA 1RMTA 1KYZA 2QU7A 3KUKA 3KCNA 3LUHA 4GPIB 4PVDA 1JQLB 4QU5A 3S5JA 2NG1A 3TBFA 3ZY2A 1BDBA 5KYGA 1M1YA 3B38A 3OIGA 5HMLA 1WZCA 2C58A 4HJRA 3MSCA 1POWA 5GONA 3AVYA 4B85A 1M2WA 4IZIA 4M4SA 5DN6A 3F6PA 1W4BA 5AK4A 3IURA 2XQKA 5K2OA 5AVXA 5HRAA 1EJ2A 1KJ8A 2Y1EA 1AKVA 1CJKC 2WYOA 3PE6A 4HFMA 4J0JA 2JGLA 2FJPA 3N8GA 4UEWA 3UUFA 3WYCA 4YCNA 3IE0A 4RPCA 4BXOA 1J1ZA 3RK0A 3R3HA 5ICGA 2C5HA 1OPXA 2IEAA 1EZ4A 2R1UA 5G53C 1AKQA 2I80A 3OOJA 3V4OA 2RCNA 1HSZA 1KHHA 5JNUA