3O26A

The structure of salutaridine reductase from papaver somniferum.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
294
structure length
294
Chain Sequence
RRCAVVTGGNKGIGFEICKQLSSNGIMVVLTCRDVTKGHEAVEKLKNSNHENVVFHQLDVTDPIATMSSLADFIKTHFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEELVKIYEKPEAQELMSETYELAEECLKINYNGVKSVTEVLIPLLQLSDSPRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLANKIPKFQVNCVCPGLVKTEMNYGIGNYTAEEGAEHVVRIALFPDDGPSGFFYDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Salutaridine reductase
publication title The atomic structure of salutaridine reductase from the opium poppy Papaver somniferum.
pubmed doi rcsb
source organism Papaver somniferum
molecule tags Oxidoreductase
total genus 114
structure length 294
sequence length 294
ec nomenclature ec 1.1.1.248: Salutaridine reductase (NADPH).
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3o26A00
4EUEA 3KO8A 4J16A 1O95A 1XQ1A 2EV9A 3G1TA 3JYOA 2O4CA 2QYTA 3NV9A 3PHGA 5KCZA 2JCVA 4YA6A 1M6WA 4JBGA 2W98A 4XJTA 4EUHA 4Z6KA 3AI3A 5H83A 3U62A 3C7CB 1C1DA 3EGOA 4J6FA 1K89A 1NPTO 2Q2VA 4CJXA 4BB6A 3DQPA 4AVYA 4E21A 4A2CA 4E31A 4FC6A 1X0XA 5F21A 1XIVA 4XDYA 3ICPA 1LNQA 2XXJA 4EEXA 3G17A 4WGGA 2EF1A 4RPLA 1B26A 3EAGA 4LVCA 4Z0TA 3S2FA 4J9VA 3TPCA 4IMRA 1PJBA 2HKIA 4W9NA 1I2ZA 1YL7A 2QRLA 4OXKA 1ISJA 5DT9A 5HM8A 9LDBA 4R3WA 1PWZA 1YVEI 3MJVA 4QO8A 2R00C 5CAEA 1P33A 3EMKA 2Q46A 5ILGA 1CETA 4JK3A 4WOKA 1N9GB 1SOVA 1UH5A 4FFRA 4D43A 1DO8A 4CQMB 4I8XA 3JQ7A 3ZU4A 2HRZA 4RDIA 1GPJA 3DTTA 2AEJA 2LDBA 5DBIA 4Y6RA 1ZJZA 2NVWA 4XQEA 4Y67A 4UVEA 3RUCA 3H7AA 4IINA 1YBMA 5L95A 4CV2A 4H15A 4GQAA 3VZPA 3Q3CA 4PIVA 3TSCA 1IY8A 4MJLA 5JLAA 3WYEA 4JBHA 1WP4A 4UVHA 1W73A 5L4LA 2IRWA 3JQ6A 1LDEA 3OECA 3ZWMA 3OSUA 1WWKA 3F3SA 4YJFB 3TZHA 5K0ZA 2DTEA 3N74A 3QVOA 1B2LA 1NM5A 1ZK2A 4RVFA 3GRKA 4GX0A 3AI1A 3OHSX 3GUCA 2BGKA 3RQSA 1QYVA 5IAAA 4G81A 3TOZA 5I7VA 1ML3A 2Z1NA 2VUSA 3WNVA 5KKCA 3RASA 2J3IA 2ZB3A 3GPDG 5ENDA 5B4UA 2ZB7A 4BL5A 2DBZA 3PP8A 4RF5A 4CL3A 4D7AA 3TNLA 2V6FA 1U4OA 3SXPA 3MJ4A 4GBJA 2VT3A 3N58A 1WMAA 4DLBA 4PLFA 2HMWA 4DPMA 4XQCA 4DPKA 4YTEA 3QSGA 1U3TA 3ZNPA 5JNLA 4XB1A 1EVJA 1WZEA 3PVZA 5IF3A 5IZCC 3GVCA 1XELA 3KVOA 3U0BA 1W8DA 4HY3A 4DTIA 3GF4A 3L6EA 2NTNA 1QYWA 3E9QA 3LT0A 4WEOA 1ZMTA 4RO0A 5U1PA 2IZZA 3OETA 3DAPA 2Z1MA 1R4MA 1LC0A 4WLEA 1CIVA 3WDSA 1J5PA 1KEUA 2C54A 1ISMA 3I23A 2WYUA 3I9OA 3LF1A 2A9FA 1ENZA 1A9ZA 5EQDA 4S3MA 4U6QA 3V2UA 2Q4EA 2YV2A 3DBRA 5JS6A 2C2XA 1HKUA 4CLDA 1E7RA 1LEHA 4DPLA 1IZ9A 2Y99A 3ZV5A 5C7IO 1LQTA 1NP3A 1VE9A 3UKOA 2FN7A 3KYDA 4M54A 4AJKA 5BT9A 4BNMA 3JQDA 3QIVA 3AFMA 4FFPA 4BNWA 2CDAA 3JQFC 4HNHA 4K6FA 1V8BA 3CEAA 3E9NA 5K6AA 3K9QO 2ZCVA 3LZ6A 2X5OA 1PX0A 1VJTA 4L9RA 1P0CA 4IM7A 1H6CA 1P1RA 4YRDA 2XPCA 4YPOA 1U1IA 2TMDA 4CM8B 4CLRB 3QQPA 4AJLA 3FR8A 4H16A 3NTQA 4RF4A 4S1VA 4UVIA 3RI3A 1YQGA 2IYPA 2UDPA 2GZ1A 3FPCA 2O48X 1E7WA 3T7EA 4DQUA 1J6UA 2DQ4A 1BGVA 3HDQA 1B0AA 4J0EA 1U28A 1EQUA 3VPHA 4DC1A 4ALNA 2ZB4A 4RLSA 3ULKA 1SB9A 3GMDA 3KRTA 4J7CA 1XGKA 1YGYA 1YXMA 4E5MA 3FN4A 3L0DA 4KP7A 3K6JA 2HO5A 1T2CA 3COSA 2JHFA 2IZ0A 3WFIA 3ENKA 4KDFA 3UW3A 3NKLA 4FR5A 2C82A 3UUWA 4J7UA 3VPXA 1TI7A 5FEUA 3PDUA 5JBIA 5G4KA 2QIOA 5THKA 3ZWAA 2O2SA 1T1RA 1M67A 1PS0A 4FOSA 4JX8A 2Y0DA 1F0YA 1M2WA 1I24A 3R6DA 4YQYA 3WYCA 4CLHA 3NUGA 4Z0HO 3UCEA 3ZV4A 1C0IA 4PLTA 3OBBA 5I9LA 4EBFA 3Q9UA 2J5QA 4ZQHA 3CZMA 3K2BA 2D2IA 2IXBA 1T25A 5TSDA 4WNIA 3NAQA 1Z82A 4NBTA 4OAQA 1HE3A 2OHXA 4E5YA 5CEJA 3KBOA 3C8MA 1QYXA 1HDGO 4IDBA 4YAKA 2Y1EA 1IZ0A 4L4SA 4P22A 3VC7A 1N5DA 1DIHA 4YT4A 5JY1A 1U8XX 1HDOA 3L4SO 2WE8A 3M2PA 4J9UE 3W4KA 2OP0A 3CXRA 4FPXA 1Q0HA 3L77A 1UXHA 2UAGA 1HEUA 5F3RA 4ESOA 4R41A 3TOXA 1LSSA 4TKLA 4A26A 1PGQA 5TJHA 5FI5A 3M2TA 5ILOA 2XAAA 4J1NA 4XB2A 2P9GA 2P4HX 3H9UA 3ZWNA 2PD4A 5I7FA 5JO0A 4IDAA 3GNQA 3DZBA 2GGSA 1RWBA 4BB5A 5AYVA 4YT8A 1K0UA 1UJMA 4ITUA 3IL2A 1ZZEA 3ORFA 4ZD6A 2P9EA 1E0DA 3PGJA 4OSOA 3RAJA 3BMNA 3GQVA 4NHEA 2JAHA 1E6EA 5ES3A 1RKXA 1ZH8A 3GEMA 1ZK1A 5I9MA 3I9KA 3M1AA 3FD8A 4WEQA 4CPDA 2B83A 2VWQA 1TA4A 2X0RA 2DT5A 1JKJA 4YCAA 2OOSA 1DEHA 2HAEA 3VHRA 3AUAA 1P0FA 3UHAA 3JD4A 1D7OA 3F6YA 1DOHA 5JE8A 1E77A 1BXZA 2X22A 3W8FA 3OA0A 2DBQA 3HFSA 5AXAA 3SBOA 3FWZA 1E5LA 2O3SA 3T4EA 4XGKA 1CDOA 1J49A 3HSKA 5F5NA 3RBVA 3WQRA 4YWJA 3K73O 4MP3A 4CMAA 3O03A 4PCVA 2AEMA 3ZU5A 4WKGA 1UDAA 4LRTB 3OMLA 4GI2A 2WD7B 3L6OO 3RUHA 5JPIA 1ZK4A 3BMOB 4WCFB 2E37A 4BO8A 3VVCA 4DLAA 4PG6A 4CM4B 1E1KA 4EITA 8LDHA 1R37A 3DBVO 4MIYA 3DMYA 3INGA 5HWSA 1A7KA 4XYBA 5A03A 4A73A 3ANNA 3QY9A 5MGBA 1LDBA 4QECA 1NFFA 2ZJ0A 4ZVVA 1UXKA 1XU7A 1HYHA 1M66A 3GNTA 5DDIP 2X86A 4IY1A 1U3WA 3H6KA 1NNUA 4PZEA 4AICA 1E92A 2E4AA 3KYCA 2CSUA 3IS3A 1I32A 3C1AA 5L3ZA 2DBVO 3AM5A 3TN7A 3FBTA 1RM0A 4KTTE 3ZV6A 2BH9A 1A72A 3LK7A 1YONA 4EJ6A 4FIZA 1A5ZA 2Y1GA 5CEFA 1D1SA 1KVRA 1GYRA 2BGLA 1GQYA 1LSOA 1ZBQA 1SCUA 3H5AA 1Y1PA 1E3LA 3PHHA 4R69A 5A9SB 4BO9A 2Q2WA 4AJOA 1W4ZA 5BR7A 2VWHA 2B4QA 2VWGA 3E8XA 1GL3A 2PR2A 3MCVA 3ZNNA 3VTFA 3JTMA 5HTOA 1MXFA 4MKRA 2I9PA 3BAZA 4R1NA 3LT4A 2UUOA 1LX6A 3NEPX 1OMOA 1R15A 1A4UA 1K6JA 3WFJA 5A4DA 3U5TA 5GZ3A 1KBZA 4HKTA 1Q0QA 2O4UX 5L7YA 1FJHA 3EDMA 2EIHA 2BFAA 4D3SA 2O3RA 3B1KA 4RLHA 1YH3A 1BXGB 1D3AA 1LI4A 1LJ8A 3EHEA 4OIMA 4PLGA 2P4QA 2AQIA 3AY3A 1GCUA 3E48A 1P1FA 2EW8A 3JCZA 4ONEA 4UVDA 3KM0A 3WIDA 1WPQA 1NPDA 2ZATA 5J23A 5TS3A 3W4IA 3GVXA 3MJTA 1U5AA 3FF4A 4Q3CA 3TRIA 3I4CA 4UEKA 4UEOA 3VVBA 1VSUA 4YVFA 1CWUA 4J91A 3DBHB 4EGFA 3H5NA 3RFXA 2GYYA 3H9JA 2D8AA 2NV6A 4Y9DA 1OBFO 5KVVA 3L07A 1WZIA 4IJUA 4CUKA 5CDGA 1B16A 5C3MA 3TQHA 1A27A 1ENPA 1BW9B 1C1XA 4ID9A 4WOJA 3O8QA 4WE3A 4M49A 1MX3A 1NBOA 1PS9A 2VYVA 3WGTA 3TZCA 3X2EA 3WOHA 4DRYA 1XCBA 2X4GA 3JYNA 4N5NA 3UN1A 5JDIC 4HBGA 2DC1A 3F1KA 3VH2A 3ZI0A 3G0OA 4FFOA 4GL4A 4D42A 4E3ZA 3KYBA 2BRUA 5L7WA 5G0UA 2W4QA 4FFNA 4Q3BA 4EYEA 5A06A 3K8ZA 5JSFA 3IAHA 1MGOA 1YDEA 4KOAA 6ADHA 5JMWA 2QW8A 1R4NA 3ENNA 3BTUA 3AUTA 2FZEA 5ER9A 4ALKA 1NAIA 2HK9A 4I5DA 1CERA 4UAGA 4ZGWA 3U09A 5B12A 1PGOA 2C20A 1PL7A 1YOVB 2VOJA 2PK3A 1PQWA 4XEHA 3P5SA 1PS8A 2G1UA 3D4OA 3WXBA 5CEEA 3NJ4A 2VYVD 4PRKA 4OH1A 4D45A 3ONEA 3GC6A 5JC8A 2Y05A 1PQPA 4A03A 1WXDA 4E2XA 4JP2A 2D5AA 2GRAA 5T5QA 4P38A 4E2ZA 2GERA 4I9NA 2PFGA 3I1JA 3C1TA 1BDMA 5G0WA 3WIEA 1H9AA 4L75A 4CMGA 3ETGA 3MJSA 4NFSA 1NHWA 3KV3O 1DC5A 3EYWA 3ZHYA 5AOVA 2PGLA 1E1MA 2V6BA 5JDCC 4BNTA 4TZKA 4W82A 4YBZA 4NQZA 3OP4A 3UCXA 4BQRA 4ND1A 1Z75A 2GUGA 4WK6A 5TJ9A 1EK6A 3FTPA 3C85A 3ZZNA 5L4SA 3ZWWA 2DBRA 2I99A 1BXKA 2BGMA 2WYWA 2VHYA 4M89A 3LLSA 2F00A 1DLJA 3ETDA 4IDCA 2SCUA 3PIDA 4A0SA 4NJMB 4OGWA 4MVJP 1NR1A 3NX4A 2Q45A 1SZJG 4O59O 3AY6A 4YAIA 3KETA 2VN8A 4RVUA 5FYDA 3WJ7A 1XKQA 4FJ0A 1NR7A 4PLCA 1MC4A 2YV3A 1N9GA 3LT2A 4CQMA 1BSVA 1ZXLA 3PRJA 3JD2A 1UXJA 4GKVA 4K28A 4WCDA 3LVFO 7ADHA 1A9YA 3U3XA 3HN7A 4GVXA 1PTJA 3R1IA 4JN6B 5IN4A 2OO5A 3LQFA 4J90A 5KVCA 4CM5A 2IZ1A 2RIRA 1DRVA 2CNBA 1JDJA 1KS9A 5B4VA 3I6QA 4ZQFA 2O3QA 1OZAA 1I0ZA 1EE2A 3KEQA 2GN4A 4NU6A 4M8SA 5BNIA 4P4NA 2EW2A 4U5QA 2ZQYA 4NFHA 1U3UA 3PYXA 5T57A 4YJGB 4B4OA 3H3JA 4YJFA 4PZCA 3CH6A 1O6ZA 5TLSA 3H3FA 3GVPA 3JD3A 4N54A 1P31A 1MP0A 2EG9A 1UZMA 3FBGA 2G5CA 3DHNA 4A5OA 3FNGA 3I9JA 2NNLD 4BMVA 4ALMA 2J5RA 1WW8A 1E6WA 3ZH2A 2NU8A 4CR6A 4W9NC 3KSUA 1HDYA 5KWEA 1B8UA 1HZJA 5IDYA 2YV1A 3P19A 3ZDFA 4BO4A 1QLJA 3B70A 4UUMA 2EGHA 1X1EA 2VNAA 4J4BA 2VZ8A 4R1SA 5EMHA 1AHIA 1PJ4A 4CQMD 2C07A 2O3JA 1GQ2A 3EY4A 6LDHA 4E6PA 1QXSA 4HFRA 1O9BA 3OM9A 4Q9NA 1F06A 2EKQA 4YRBA 3ROPA 5JCJA 3DZHA 2NU9A 4YT5A 4O63O 3AW9A 4TQGA 4CQLB 1QG6A 3S55A 4CODB 3MOGA 4FFLA 4YAJA 4BO7A 5A04A 1T4DA 3IUPA 3QE3A 3AWDA 1G6KA 4JROA 4XKJA 1P9LA 1IHXA 4R54A 2NADA 3E5MA 2XOXA 1PR9A 4J43A 2J3KA 2X5JO 5DULA 1PJSA 2BI7A 4OKIA 3TZQA 3QV1A 3R3JA 1F17A 2Q50A 5LDGA 3ZWVA 3IUSA 2OORA 3C7DB 4FQ8A 4LK3A 4C4OA 3RSHA 2HU2A 1NAHA 3K31A 4L73A 4UUOA 3KTDA 1PGPA 2Y1FA 5JAMA 1DIRA 1KOLA 3QWHA 1VSVA 1G0OA 2PZMA 1VKNA 3BTVA 3G3EA 2UVDA 4NDNE 4OSPA 5FF9A 4IJVA 5L45A 3WGHA 2B5VA 4OOFA 2QZZA 4AJNA 4Z9FA 3TJRA 4QQRA 2ZK7A 4Q3NA 5JCJD 4R01A 1GD1O 5DBGA 4CM8A 3PK0A 4CLRA 3NJ8A 3AM3A 3OEWA 1JWBB 1YB4A 2VTEA 1X0VA 4FCCA 3ANLA 1T26A 1H0KA 1VJ0A 2C2YA 2JFGA 3DB2A 2I3GA 2YHUA 3CSDA 4ZU3A 2Z95A 2ILTA 3PHLA 1SO8A 2P5YA 2WSBA 1NYTA 2D1YA 2B5WA 3GG9A 4JGBA 1XYGA 3K5PA 5TQVA 4PLPA 1DXYA 4DYVA 4XQGA 2DM6A 4R51A 3WB9A 3WQSB 1OC4A 3MWEB 4R5HA 3EVNA 1E7QA 1JAYA 2HUNA 4DQXA 1IULA 1BHSA 5EQFA 2VHVA 5T6BA 5G4LA 2X9NA 3Q0EA 1V6AA 2I3AA 3EZLA 2P5UA 3ADPA 2OMEA 2PZLA 5K6AC 4LRSB 3BMQB 3D1LA 4E32A 1A4IA 5TNXA 3B20A 1TEHA 3F46A 3H9GA 2IE0A 4URFA 4YJHB 4C7KA 5HRUA 2FHSA 3HN2A 2YZ7A 4MP8A 4GGOA 4B7XA 4OKNA 4L74A 3U9LA 3OJFA 4BUCA 4HNGA 3WSVA 3BHJA 4IXWA 4C7JA 3DOJA 4IUYA 2NVUB 2AQKA 4HFJA 3RC7A 3UOGA 3NT4A 3NDIA 1ZK0A 3O38A 1OFGA 2PA3A 1LLDA 2JFFA 2Q4BA 3VH3A 1A71A 4XIYA 2EP7A 3W8DA 4PFJA 1E3JA 1SB8A 3VPGA 3GLQA 4PN3A 2Q2QA 1E5QA 4YB8A 4CR8A 1FXSA 5CP8A 1T2EA 1GQQA 3A9WA 3HNPA 2H9IA 2NU7A 4LVUA 3H2ZA 3EC7A 3QWAA 1WDLA 3WGIA 3PQDA 4FBGA 3GAFA 1GYQA 1R16A 2YW9A 3NDJA 2C0CA 2YDYA 3MTGA 4YDRA 3UXYA 3LT1A 1B14A 5I8WA 3PWKA 3GVIA 3L9WA 4Q3EA 5F5LA 1GR0A 1H94A 1KY4A 3ONDA 1VPDA 2ZTVA 3KXDA 2G0TA 3E6AA 2YYYA 2Q1TA 2A35A 3PLNA 1XEAA 3SLKA 5G0SA 4BVAA 3LF2A 1W0CA 5TGDA 3GMSA 4FD3A 4NK5A 3WGZA 1P3DA 5DOVA 5A3JA 1X1TA 1GY8A 1HRDA 2VRBA 4M86A 1PQUA 2FPGA 3OIDA 1N1EA 4EDFA 2WMDA 3R3SA 2G17A 4QT0A 4NIMA 4MO2A 1RPNA 1DAPA 1HTBA 3GOHA 4BOYA 2EERA 1K6XA 2NUAA 2NWQA 2ZYDA 2B69A 3HUDA 3PWSA 5IJZA 2X7HA 4YT2A 1ZMOA 1JKFA 1DRWA 4BS9A 1E1NA 3BZUA 2RBEA 1UP6A 4NBWA 4D3FA 3V1YA 4BQPA 7MDHA 3E03A 3BMCB 3O9ZA 3ST7A 2FSSA 2WD7A 4ALLA 4CM1A 3HDYA 1GV0A 2YJZA 3BMOA 4WCFA 2WTBA 3D5QA 5AXDA 4CM4A 1BTOA 3OQ6A 1O89A 2CVZA 2C29D 1I36A 1NFQA 4UVGA 3QVSA 2FSVA 2HK8A 1MG0A 3A1NA 3PWZA 4FSHA 4GMGA 1BMDA 1IE3A 1SAYA 3I4FA 1ZUD1 3LYLA 4TZTA 4D41A 4E2YA 3HZZA 2E48A 4MDHA 4NPCA 3F5SA 4IQ0A 4M55A 1Z6ZA 4GX2A 4OQZA 1DC6A 1YRLA 1ONOA 2Q3EA 3KB6A 1JVBA 5BSFA 1HETA 1I2BA 1ZEMA 4JQCA 4LMRA 3ADOA 4J1TA 4RZIA 2V7PA 1IL0A 1JQBA 2X9VA 2B35A 1MUUA 1GUZA 2OZPA 1RYDA 3WBBA 1ISHA 1T1SA 3RBZA 3Q9NA 4BO6A 4D3DA 1DSSG 3F9IA 4CL8A 2FY8A 1JVSA 2H6EA 4UEJA 5A9SA 1I33A 4N18A 3KSZO 2PKQO 1YL5A 2X8LA 3NGXA 3N7UA 4WLNA 3OICA 4A10A 1S7CA 1QV7A 3I9MA 4XIJA 1C14A 2VYNA 4U8GA 3FHLA 4YACA 3JQAB 3RCBA 3GZ4A 3WTCA 1ULSA 3PFFA 3IC5A 3WX0A 4CM6A 2X0JA 3SJUA 3U4IA 4NBUA 4JJFA 4K6CA 1IUKA 2VT2A 4WLFA 5DCUA 5EN4A 3JD0A 5JAQA 5LCXA 4B8WA 4PLYA 3DONA 3PI7A 1NVGA 4F46A 2BFOA 1YB1A 3QA9A 1MFPA 3DDNA 3CMCO 3I9NA 1MC5A 1JN0A 1HLDA 1Q2XA 1LLQA 4GGPA 2OBYA 5A05A 1BXGA 2JCXA 4E5PA 1JTVA 4CUJA 5CFZA 1I30A 4IDFA 3SVTA 5U9CA 3WR5A 3CIFA 3AUUA 1EUDA 3ZNOA 4B79A 2JKVA 2B37A 3ANMA 5F1OA 2RAFA 4Y6SA 4QTZA 1NWCA 3ZWCA 2DVMA 1TB4A 3DBHA 1T4BA 4II3A 2C7VA 4RPKA 3WWZA 1U8FO 2QHXA 4ND2A 2VYND 1X15A 2FZWA 4RPGA 1NVMB 5JFOA 4D46A 4O6VA 2PH5A 1BW9A 2HJRA 1B8PA 2VZ9A 3NT2A 3RJ9A 1PZGA 5CDTA 3WLEA 5JYEA 1X14A 3DOOA 1R66A 3IMFA 1B15A 4QSMA 3WJAA 2HLPA 3M6IA 3TFOA 3GY0A 1DAOA 1NQ5A 3DR3A 3RD5A 3IQDB 2NM0A 3OJLA 1WLYA 2FP4A 5ENVA 1WAMA 1UDBA 4FS3A 5FFFA 1LUAA 3ZWXA 1HXHA 2NVBA 2AG8A 4BNLA 1VKOA 2GASA 1XWFA 5AXBA 3ZCXA 2GN6A 3ITKA 1V0JA 1P1KA 4DMLA 2GPTA 3STHA 4BNGA 5A9TA 3JQEA 3MEQA 3ITDA 1MFZA 3I83A 4E12A 2Y0CA 1KIFA 2PH3A 4IZHA 1CJCA 1E3WB 1PSDA 2FWMX 4BNXA 4U0KA 2Y68A 5L7TA 1EUCA 2JL1A 1ONNA 2GZ2A 1UR5A 1YOVA 4B3IA 5IDQA 1P44A 5JC1A 1ZSVA 5C5IA 1HDRA 3HDJA 4K1LA 3ZN2A 3E18A 4IQ8A 3WGYA 3AK4A 3BYZA 2QQ5A 5FI3A 2BELA 1F14A 3JQ9A 4XGNA 4PG4A 3PFWO 4JJIA 3DXFA 1EK5A 4IIVA 2DFDA 1GZ3A 1HT0A 3ICCA 4XYGA 1FDVA 4PLHA 2AQHA 2PD3A 5DCWA 3WLFA 3ON5A 4BV9A 1I2CA 2QX7A 3QW2A 1HYEA 2GR9A 1VRWA 4GWGA 4ROSA 1KY5A 5JO9A 3O26A 1HDXA 3DZIA 3AM4A 3EK2A 3V5NA 3ZW9A 3A4VA 3CTMA 3PPIA 4W99A 4LSWA 2IXAA 4EJMA 1YWGO 1EZ4A 4HADA 5DN9A 4ZA2A 3TZ6A 4BMNA 2FPPA 4QFCA 4W6ZA 3GK3A 1JW9B 4J7XA 1KC1A 4BO2A 3SC6A 4E5NA 2NTVA 2WD8A 3VAZA 1JLLA 4IGEA 4UREA 5IG2A 1YQXA 1N2SA 2BF7A 2G76A 3SLGA 3IJPA 2J8ZA 3S2GA 2PY6A 4ND4A 4Z3KA 1L7EA 1BRMA 1AN9A 4TKMA 2FRDA 2A94A 4AJ4A 3H5RA 1C0LA 2JHGA 3HWRA 1SC6A 4NJMA 2JJYA 4KDEA 4YQZA 3B1JA 3RC9A 3UCFA 3ONFA 2X6TA 2R2GA 5TC4A 3IJRA 3ROMA 5MDHA 4WNCA 2I66A 1R0SA 4R9RA 2HQ1A 3RU7A 3PIIA 4BKQA 3OQ1A 2Y66A 2O3UA 5TT1A 5I9NA 2WWRA 1FK8A 4N7RA 4F45A 3HJAA 4GX5A 1XDWA 1HSOA 1MG5A 3IIEA 4P4LA 2CFCA 1MB4A 2WJPA 3KSDO 3H2SA 4XDZA 2HMTA 3G49A 2VNSA 1MLDA 3VH1A 4IJKA 4NMHA 4OQYA 1SNYA 5B37A 3UICA 1P74A 3K30A 5JXWA 1PWXA 4PVDA 3HG7A 5JAIA 4LMPA 4M87A 4YJGA 4XRGA 1UZLA 4RF2A 1X13A 4GMFA 2EHDA 1Q7BA 3GHYA 3DO5A 1ISFA 1F12A 1KEVA 3TFQA 3QVWA 1YO6A 2JD1A 1H2BA 1TXGA 5CDSA 4PVCA 4R4JA 1TT5B 4YYZA 5DNAA 4NI5A 5GZ1A 4JIGA 4QXMA 2PZJA 3RC1A 2BHLA 4DBVO 1HE2A 4MVJI 2X23A 2O3TA 5IXYA 5COBA 1PGNA 4WLOA 4EZBA 2ZCUA 1BVRA 1NFRA 1Q1NA 2FPIA 2VOEA 3E82A 4WUVA 4R3NA 4NG5A 2DPHA 2FMUA 1EEHA 1NQAO 4Z0PA 4D44A 2NQTA 2AEFA 4ZJUA 4TWRA 1QR6A 1X7GA 4DC0A 3AFNA 1GV1A 4R9SA 1ZSNA 3FPLA 2HMUA 2HRBA 4U0JA 3RIHA 4CQLA 2Y1CA 3E1KA 2H1SA 4BNVA 5BQFA 5KVQA 3DTYA 1Y81A 3JYLA 1LDYA 3FRJA 4Z9YA 2Q1WA 5L53A 1PZEA 5T64A 4TMFA 2QRJA 4DXHA 5THQA 4R5MA 3PJGA 4RVSA 2DAPA 3WTBA 4KUHA 3HHPA 1C0PA 4GSKA 2OFPA 2X58A 3DBLB 3HADA 5JCXA 2AG5A 4E4YA 3JQBC 5GMOA 3MWDB 3EVTA 3QJ5A 3F4LA 3ABIA 4I08A 4LW8A 4DVJA 3AI2A 5B1YA 3V2HA 9LDTA 1K3TA 1T24A 1VL0A 1E7YA 4BIIA 4YAEA 1PJ2A 4WECA 1DBVO 3GDGA 1PU2A 1HDCA 2ZYAA 3VZRA 1GTMA 1ADFA 3UAGA 3AOGA 2PWZA 2GN9A 1EFKA 2VTDA 3DZGA 1KERA 3KHUA 5C7OO 1GDHA 3F4BA 3OJ0A 5T67A 2GCGA 3PQEA 3ETEA 2LDXA 4D0RA 4O1MA 3DMTA 4XGIA 5EINA 4RQUA 1GZ6A 3F47A 1Y8QB 4AJEA 1XA0A 2OBNA 4AJJA 3RJ5A 4FW8A 1LXCA 3B1FA 4AG3A 3JQ8B 4RL6A 5CDYA 2E6UX 3OJOA 3VH4A 2NTJA 4Y98A 4KQWA 3U4CA 3I6IA 1EDOA 4RORA 3GPIA 2X0IA 5JMPA 4PGFA 3AU8A 2CY0A 5IDWA 4BNYA 4NNJA 1DJNA 4CMIB 3U4DA 1SEVA 4YJDA 4MKZA 1E3IA 3OQBA 3C24A 3SX2A 2EJWA 3SJ7A 4RCVA 1Z7EA 2XXBA 4ZQEA 1IPFA 1ZK3A 1QSGA 5IDXA 4MVJF 1E7SA 3BMQA 2B36A 4YJHA 4IMPA 2NU6A 5F1PA 3HDHA 5I7EA 3NTRA 1OAAA 1KYQA 1Y8RB 2B0JA 4JBIA 3FWNA 1U5CA 1JKIA 3JQBA 5DP2A 4RDHA 3WMWA 4CMEA 3VDQA 5U4QA 2NVUA 1BWSA 4LN1A 4WLUA 3VKVA 5TF4A 1DHTA 1L7DA 4MVJH 4CLOB 1DIBA 1NVTA 2CF6A 2DLDA 2PGJA 2ZB8A 3D3WB 4IBOA 5KJCA 5L40A 3MZ0A 4TRJA 3ZWYA 3RWBA 2IYOA 2CD9A 2OUIA 4NBVA 4MPDA 2AHRA 8ADHA 3EW7A 2VWPA 1J0XO 2OL4A 3EZYA 5BNTA 4GLLA 4ALJA 1V3TA 2VZ0A 3O4RA 1K2WA 4J2HA 1ORRA 3L4BC 1KVTA 4BNHA 2O2YA 1R6DA 1R0KA 1N1GA 1LU9A 1SPXA 1UP4A 4MINA 4K9DA 2RCYA 3CE6A 1ARZA 4L0QA 4W4TA 4CMHA 2OGUA 1UDCA 3DEYX 3GEGA 4GAEA 3TL3A 1GAEO 5AQ1A 3HB5X 4WLVA 3Q1LA 5HS6A 3RUFA 2CMDA 3ZWBA 1ZEJA 2EWMA 1I5RA 4IDDA 1DFHA 2V6MA 1U2GA 1CRWG 3I52A 4GSLA 3MJEA 2WE7A 4RGBA 4RVGA 2D3TA 4J2OA 5A1TA 4J0FA 4RVHA 1VC2A 4AJPA 5A9RA 4HXYA 3RFTA 1PJTA 2GZ3A 2Q99A 1HZZA 4B7CA 4BO5A 1H9BA 2IDZA 3GA0A 1NTOA 1Y6JA 3DHYA 2HCTA 2YQ5A 4UUNA 2AQ8A 1QLHA 4XA8A 2H63A 2D5CA 3CMMA 4YXFA 5EIOA 3DZJA 5DOZA 4BO3A 4B8ZA 1I01A 4IJWA 2I76A 4TRNA 3JD1A 4BO1A 4FGSA 3CKYA 3BMCA 1FMCA 3FNHA 2QG4A 2D0IA 4BV8A 1XQ6A 4EUFA 4TVOA 1LC3A 2FOIA 1YJ8A 5TX7A 4G5HA 2I65A 3FI9A 4NFYA 3L6DA 4GH5A 4HFNA 3W6ZA 5CG2A 4II2A 3AOEA 3U4HA 5TRTA 4ALIA 3RC2A 4DMMA 4B4WA 1K5HA 2DTXA 1BG6A 2W2KB 4N5LA 2IODA 1E1LA 1U4SA 1H2HA 1CEQA 4ZRMA 3BIOA 2UV8A 1ADGA 3I9LA 3L4BA 3VOSA 4CMCA 1WMBA 4DGSA 4E33A 1I8TA 1LA2A 2HMVA 2RHRA 1EBUA 1XLTA 4DLLA 3JQGB 3JYPA 1T2FA 1Y9AA 4XYEA 4KUEA 1ULUA 5T8KA 2I5PO 1Z74A 2ZTUA 1N7GA 4MVJE 4MVJG 2EJVA 1LDMA 3VPFA 1IPEA 2O7SA 1D8AA 1G0NA 1LRKA 1GEGA 1E7MA 3QWBA 1JAXA 1KVUA 4M1QA 4WCFC 2JAPA 3F1LA 2JCYA 3JQAA 3PYLA 1V3VA 3GZNB 4AJ2A 4E13A 3M1LA 5DF1A 3EUWA 4B3HA 2BKAA 2E82A 2V6GA 4LCJA 3DOCA 2H5LA 1CYDA 1RM5A 4Q3DA 3FNEA 4KUGA 4FB5A 3WGGA 3IP1A 4ZRNA 3UGKA 1H93A 2AXQA 4HP8A 1Y7TA 4J4TA 1ZKMA 3VKUA 3D5TA 1LBEA 3LC1O 1BDBA 2X1HA 5H81A 5TIIA 1HLPA 1MV8A 3OA2A 3UVEA 3IOYA 3PLRA 3PJFA 4J1QA 4PLZA 3WYBA 4RVDA 3LU1A 4F3YA 4G2NA 2YHIB 2ZYGA 3VZQA 1P45A 1IYZA 4GPD1 4GVLA 5KTKA 3K92A 1V3UA 1UXGA 2QZ9A 1NWHA 4FOOA 5IFLA 1DDOA 2X9GA 4IXTA 1H6DA 1V35A 2X0NA 4QO7A 4INAA 2PD6A 1XSEA 1Z45A 2J3JA 3ASUA 5KJ6A 1P77A 1PIWA 2RH4A 1H6AA 1PR3A 4JNKA 4TVBA 4E5KA 5FWNA 1SBYA 3Q2IA 1U7HA 3G1UA 5CPFA 1DJQA 3VDRA 2AE2A 3BA1A 3JQAD 3AY7A 4CM3A 2EKPA 3A06A 4AJHA 4E0BA 5DP1A 1AGNA 2A4KA 2BI8A 3F5QA 4MVJA 3TL2A 4DA9A 5DCYA 2R00A 2PKRA 3LC7O 3DAGA 3H65A 1NPYA 3UFXA 3WGOA 2IEBA 4CM9A 1VL8A 1QYDA 4LGVA 1A7AA 1QP8A 1ZVMA 3A14A 1AXEA 1EFLA 3GDFA 4PG8A 3UF0A 4WJZA 3GR6A 4FGWA 3MTJA 1QRRA 3PHIA 3QVXA 4XZ3A 1DRUA 3DHEA 3E5RA 3RKRA 3HFGA 3V2GA 4F6CA 1O94A 1LDNA 2AE1A 3OEYA 5AVOA 1DIAA 3TDKA 1LQUA 3MJCA 1I3MA 3B6ZA 5JW6A 3ROQA 1C1DB 2IEDA 1N92A 3BTSA 5COAA 1E3WA 1KEPA 3C3XA 3R0IA 3ZU3A 4XYLA 3ZHZA 1ZJYA 5HA5A 4DL9A 4NK4A 5IXSA 3GGGA 5KNLA 2WM3A 4FFMA 5LC1A 4KZPA 5G0TA 2Y93A 1EVIA 1NHGA 5G0VA 1P1IA 1FDSA 3IP3A 3A28A 3PYMA 4FDAA 1GYPA 1UUFA 4MVJD 3DZFA 3GVHA 4R1UA 2FR1A 4CM9D 1EMDA 2YQ4A 2JD0A 2YY7A 1ISGA 4WPGA 4EW6A 1M76A 3W6UA 1HSZA 4CMJA 2POQX 3RUAA 5AXCA 1QKIA 2CDBA 4PG7A 1QMGA 3QRWA 5A02A 3S1LA 5KJ1A 3ROKA 5ICMA 5IZCA 1PJ3A 3JQ7B 4MIEA 2E49A 4X54A 5BSGA 3C1OA 3K2EA 3QWFA 2DPGA 3DWFA 3I3OA 2F1KA 4HWKA 4QFDA 4CR7A 4E2WA 3NYWA 2HDHA 1TT7A 4U7WA 3ZHBA 3Q2KA 3OH8A 5JYDA 4CLEA 5HS4A 1WDKA 4Q39A 1VI2A 2CDCA 1R0LA 2Y1OA 1C3VA 2RH8A 5EESA 4J4HA 1I3KA 5G2OA 1UZNA 3KLMX 5EJ2A 4OYRA 3D4PA 1EUZA 2AW5A 1UAYA 1XU9A 3BXXA 4JLWA 1FDTA 1EBFA 4HUJA 1YL6A 1ZXBA 2BLLA 4CLXA 1ZCJA 1YBVA 4GX1A 2FR8A 1ENYA 1ISIA 4IDEA 4OXYA 1VL6A 3BHMA 4JJGA 1LLCA 3JQ9C 4J49A 3V1TC 2QYSA 3JQFA 2JFHA 2PGDA 4O5OA 4AJ1A 3DL2A 2AA3A 3AUSA 1MA0A 3AU9A 3OF2A 3RKUA 1PJCA 3FCOA 5ITVA 3CINA 4I9UA 2VUUA 3WNQA 3GNSA 1RJWA 1L1FA 1XHLA 1HE5A 2HK7A 3ZWPA 1NX6A 1ADCA 3DC2A 3QVTA 4R1TA 4KWHA 5K9ZA 4Y6PA 3OFSA 1EE9A 1QYCA 2PNFA 3KZVA 4IPTA 4L4XA 2D4AA 1ONPA 3V8BA 1HF3A 1NQTA 2GLXA 4EJ0A 1R4MB 3DAFA 4CV3A 5L4NA 2O7QA 4J1SA 2GD1O 3TWOA 1DPGA 2WYVA 3D0OA 1EDZA 1VM6A 3L9XA 4NR0A 1O0SA 3IKVA 2XF8A 4BKUA 1HE4A 1JU9A 3NRCA 4GWKA 3MOIA 4DIFA 2ET6A 1TT5A 2ZTMA 3DBRB 4MP6A 4OM8A 4XWYA 2Y1DA 4XR4A 4RQTA 3ZU2A 3JQCA 4TROA 3W4JA 4I5FA 3ZHXA 2WDZA 3GT0A 3Q11A 5COQA 1GZ4A 1I10A 1IOLA 2GDZA 1M75A 2ZJ1A 3KYDB 5KVSA 4R16A 4YR9A 3S2EA 4BO0A 1M6HA 2C59A 4E30A 5ER6A 5KKAA 2FR0A 1SEPA 3ASVA 4KQXA 1YQDA 4TRRA 3ZGYA 1JWAB 4KTVE 5ICSA 5EL0A 4PZDA 3PJEA 1JA9A 1YJQA 1H5QA 2VQ3A 4XD2A 2PKQP 4P4GA 4AJIA 3DZKA 1ID1A 3VPSA 3GAZA 3WWYA 1AXGA 5ITWA 5F1KA 4HV4A 4DQVA 1IHYA 1EVYA 1Z73A 2X5KO 4YEDA 2DUUA 5CG1A 1E3EA 1LSJA 4W7IA 4WASA 1N7HA 1YE3A 4ZN6A 4BGEA 1ZW1A 4BMSA 3D7LA 5TT0A 3GGOA 3DFUA 1B3BA 3WG9A 3WQQA 4PRLA 3DBLA 4NH4A 4H7PA 2HJSA 3D4NA 1I3LA 4OMUA 4ND5A 3AJRA 4U6SA 1OOEA 2VRCA 3CZRA 1KC3A 2EEZA 4IIUA 3VZSA 4BKOA 1T2AA 4LISA 3S2IA 4B7UA 4B4VA 4DREA 3OJEA 3QHAA 5G4KB 1HWYA 4A7PA 3IKTA 5C7LO 2YFHA 1PJLA 3CPSA 1HYGA 4R68A 3TZKA 3RFVA 2VUTA 2I67A 5DZSA 5HBRA 4D0SA 2CVQA 2DKNA 4CV1A 3ZV3A 3IDSA 3TF5A 2VHXA 5I8ZA 1GEEA 4NU5A 1CF2O 4PLWA 3HB4X 1RM4A 1WNTA 2DFVA 5GZ6A 4BKRA 4K26A 1D4FA 1Y8QA 3U49A 3KEOA 2ZIZA 2YUTA 2EP5A 3JQ8A 4XYMA 3INTA 4RJTA 4BGUA 3H4VA 4GKBA 2JD2A 3W1VA 3OIGA 1PJQA 1D1TA 4I5EA 1MXHA 4CM7A 5KJEA 1PL6A 3JYQA 2VRCD 1TVEA 5A3VA 4BNJA 4CMIA 4FN4A 1R12A 3GDOA 2CUKA 2W90A 4BNIA 4YAGA 1B8VA 1Q7CA 3V1UA 1ZSYA 3E9MA 3GN1A 1UXIA 3FR7A 2BD0A 4PG5A 3GFGA 4NZ9A 4HX5A 3WSWA 4BKPA 5C37A 4JXKA 5IN5A 1X7DA 3SEFA 4ND3A 4BGVA 1B7GO 2EGGA 4QEDA 1CQIA 1E6UA 1Q7GA 3PJDA 2UYYA 1Y9EA 4GLOA 1PGJA 3D3EA 4YRAA 3BMNB 4BNZA 1Y8RA 1ZIDA 3H8VA 1GUFA 4PLVA 4IZIA 1GFSA 3P2OA 2PZKA 2P68A 4P8RA 3DMTC 4IS3A 4OL9A 1LDGA 5ADHA 4N5MA 1GPDG 5JY6A 4CLOA 1E3SA 1F8GA 2VHZA 3X2FA 3H9QA 5L9AA 1DFIA 4OHUA 3D3WA 4XJSA 4O0LA 3FSRA 4L4RA 4OXNA 3FTNA 3PDJA 3GUYA 2A92A 2R6JA 3LC2O 2O23A 2P91A 4A27A 5B4TA 4I5GA 5CHEA 3VTZA 3HE3A 4IGFA 2J3HA 1VLLA 2P9CA 1Y5RA 3PXXA 4H3VA 3RVDA 5DBFA 2AMFA 2TMGA 4OJNA 3NGLA 4UUPA 4CUZA 1QORA 2GSDA 4L8VA 4DBZA 2J6IA 4IQGA 4MOWA 4I9HA 3D64A 1U9JA 4EI2A 5A5FA 1LTHR 1N8KA 4BGIA 1LLUA 2HMSA 3WGQA 2C5AA 1AUPA 3JSAA 4DIBA 3UH1A 1YBAA 1RYEA 5I7SA 3I5MA 1EVZA 2V65A 3P2YA 1T2DA 2D59A 4I1IA 1BVUA 4CMEC 3OIFA 1OC2A 3LDHA 5A5EA 3PTZA 1AE1A 2VHWA 2GNAA 1GUYA 4F6LA 1CQJA 3PQFA 4LSMA 2B4TO 4B4UA 3KYCB 2DTDA 2NACA 4QX6A 4Y8VA 1ZO8A 2P2SA 3ZW8A 2Y0EA 1FF9A 3QP9A 4RF3A 1PL8A 1Y5MA 4DWVA 2W2LA 2EKLA 3P7MA 2OXIA 4FJ2A 3PEFA 4G65A 1DFGA 1F8FA 1LRLA 1P1JA 1XR3A 3BHIA 4CMBA 2HSDA 4OOEA 2G82A 2QRKA 2WEKA 3KOUA 4RPJA 3RU9A 5BSEA 1NXQA 1ADBA 1KVSA 2BFMA 4Z9XA 3BTOA 4MVJM 4NJOA 3K96A 5BNFA 4Z3DA 2ZQZA 2CZCA 2EXXA 1EQ2A 5KJFA 5EPOA 4HFMA 2O50A 5LDHA 4FC7A 2I6TA 4BNKA 1X7HA 3T4XA 5EERA 5KOIA 2DU8A 1KEWA 1YDWA 1SMKA 2ZKLA 1VJ1A 3WBFA 1YKFA 4BNUA 3H9EO 2W8ZA 5JDIA 2Q49A 2CVOA 2OP1A 1DC3A 2BFPA 2W2KA 3T7CA 4CV0A 2YFQA 2Q1UA 3LSYA 2PTGA 3LLVA 1O8CA 4IS2A 3PZBA 5CDUA 3GFBA 5CPBA 3KLPX 4RZHA 1FDWA 4W7HA 4Q3AA 3INRA 3WICA 4BHTA 1UAGA 2W2LD 3JQGA 1FDUA 1U7TA 1I3NA 3NTOA 1YS4A 4XX0A 1DLIA 4J3FA 1B3RA 1IB6A 2Z5LA 3GN2A 2J5KA 4TRMA 5L51A 5BSHA 5IZ4A 1OI7A 4DIOA 3GHHA 3GRPA 3ZNQA 1GADO 3RUIA 2RHCA 1WDMA 1C0KA 4MIOA 1WVGA 4XR9A 3GZNA 4XRRA 1KVQA 5JAZA 2Q1SA 4LCEA 4NBRA 1ZNQO 1GCOA 4BNFA 1KETA 1Q0LA 2NSDA 4KWIA 4UULA 4BNNA 2VCYA 1H6BA 3HQ4O 4D79A 1C1XB 3S8MA 4EEZA 3NDRA 4FJ1A 2PLAA 3C7AA 1HL3A 3O8QB 3RUDA 2GO1A 3PZRA 3AOEC 3WMXA 4AL4A 2PV7A 3GG2A 4MKXA 2B4RO 3RUEA 4ZICA 1LRJA 3Q6IA 4JP3A 1V9LA 4QUKA 3FNFA 1LSUA 1UP7A 3GEDA 3CUKA 3QLJA 4XQ9A 5KIAA 1U3VA 1ZFNA 2C5EA 1QV6A 4RV9A 2GN8A 4ILKA 3G79A 1HDZA 2YHIA 4KMSA 4DYDA 2YDXA 1S6YA 4DUPA 4XCVA 2CF5A 4CMKA 1DHRA 1K6IA 3SC4A 3WS7A 4AFNA 5JDCA 1G1AA 5H82A 2Y67A 4RPHA 4TSKA 1DIGA 3PGXA 1PEDA 2NQ8A 1TLTA 3DFZA 1R4NB 1PZFA 5T8KC 1YB5A 3KUXA 3GH3A 1ENOA 1O5IA 4L76A 4B3JA 3GGPA 1J4AA 4JCOA 1P1HA 1NASA 1DB3A 2UUPA 5GY7A 3QWIA 1W6UA 4ZHSA 1GU7A 3PHJA 1XG5A 3RROA 1Z7BA 1U2DA 2C7GA 1RM3A 1PZHA 3NT5A 1DC4A 4ZQBA 2DUWA 1SOWA 2GF2A 4ZQGA 2ZTLA 1AHHA 3RBXA 3JV7A 3ZWOA 2BMAA 3W8EA 1NQOA 4IDGA 2NLOA 4OO3A
chains in the Genus database with same CATH superfamily
1XZKA 1NMEA 2FEMA 4MA4A 3G1TA 4GOOD 2GEBA 5H70A 3M9WA 4OB7A 2VAWA 5DMXA 2GMWA 2VK2A 1R6XA 4OA5A 4ZOLB 3IILA 4ZTBA 3PHGA 4H7HA 4R2KA 1EXVA 2JCVA 2D54A 2W98A 2OV2A 2A0XA 4WZAA 2YZKA 3SF8A 2P69A 4Q4AB 4K88A 4A6EA 1L5VA 3SQOA 4EZEA 3E27A 2YYSA 1A5TA 1NSFA 1UBUS 2CNKA 3DC7A 3DL4A 3EZGA 5FQOA 1VOTA 3BM5A 4CKXA 1C1DA 2ZRCA 3T5GA 1UC5B 3GJZA 5CNMA 3GROA 4CJXA 3WBKA 4E21A 4K9OA 4F4CA 1GTVA 3S27A 2N75A 1NUPA 1X0XA 1ODIA 2HRDA 2R7AA 4TTSA 2GOYA 4WK0B 3F49S 4CL2A 4BLOA 2I0FA 1JKMA 2XXJA 3G17A 4R1OA 4WGGA 5JYCA 2EF1A 1CXZA 3EAGA 4G0MA 2JFWA 1AQIA 3F6RA 4Q3KA 2YBDA 5EE0A 4MQFA 3H1EA 3GBSA 1PF7E 3OLQA 4V02A 1WPXA 4GYYA 4J29A 4W9NA 3ZUGA 1KOFA 1TKRA 5HM8A 4X6YA 1PBTA 3GFSA 1MN6A 1VIVA 4MW2A 9LDBA 1XNGA 3AONB 1PWZA 3GDWA 4QGHA 2XCQA 4R3WA 1M0TA 3C2QA 4N47A 2GBLC 2QRVA 1N7IA 1KARA 1P33A 1I1QB 1XZBA 3BFKA 5EKSA 5H7XA 1CETA 2NYRA 2YHBA 1MHTA 3ZDAA 3RS9A 2HWUA 2MINA 3Q7IA 4D43A 4CQMB 4I8XA 3K9HA 3IP7A 4EFMA 1ZAYA 1M8JA 4RDIA 1GPJA 3DTTA 2AEJA 1T2VA 2LDBA 5KC9A 2XDQA 1ICIA 3AO0B 5CVVA 2NVWA 2XQJA 4LSGA 4UVEA 4Y67A 3H7AA 4IINA 1YBMA 1JFLA 4JT8A 5AHWA 1B76A 1YRAA 4FE7A 4UBNA 2JKZA 4H15A 2V96A 1GGMA 3TTYA 4NCJA 2YICA 3L01A 3W9YA 2GK7A 4MUFA 4U7JA 3PV0A 3Q4GA 5ALFA 4UM9B 1JLHA 4QE3A 1W73A 2BE7A 3PKIA 5DNDA 2BKXA 2GK3A 2J9YB 2RIPA 4EOGA 1YJBA 1T8WA 2HMAA 2Q6KA 1M6YA 1WWKA 2QTNA 4YJFB 5DYIA 3CCFA 3E05A 2DTEA 4X1OA 5BNZA 1ZK2A 3GRKA 3VZDA 3RFFA 2I2FA 4WZBA 1D2EA 1VCHA 3GUCA 4GYKA 1DX9A 2GD2A 5ECDA 1J24A 2CXQA 1DG1G 1TYDE 1X7YA 4FDTA 4G81A 3ZXXA 4I2NA 4I6JA 5I7VA 4B80A 2NU8B 5KKCA 2W37A 2GT1A 1VXRA 3OZRA 4BZQA 3U7FB 1H3NA 4DXDA 2YXBA 1Y98A 1A1VA 1BHQ1 3PDIA 5A3VA 2ZYHA 4CI0B 1RPJA 4D7AA 1X70A 5H80A 5LQNA 2UZ3A 1AG9A 1CQZA 1WR8A 2VT3A 3N58A 4XQCA 3QSGA 2HF8A 1IBLB 4XB1A 1N7JA 1EVJA 3PVZA 1MO2A 2P2LA 3KVOA 1B73A 2H3HA 3BXEA 1N6PA 4RKWA 2KQUA 1JS1X 1ODTC 2NTNA 4QU8A 1O0CA 2ZDQA 1I1OA 1R7RA 2CHVA 4MZXA 4TVKA 4WEOA 3FKJA 4RO0A 2IZZA 1GPBA 3OETA 4U7HA 4FLFA 2NT3A 2ZULA 4WLEA 2I54A 4GM1A 3I62A 4K2HA 3CVYA 5KOJB 1J5PA 4LTDA 4X20B 1KEUA 3R6GA 1RPTA 3Q2OA 4W5WA 3STWA 3I23A 4US1R 3HJNA 3GLHE 1FFBA 2A9FA 1ENZA 4AZSA 4W5OA 4JUCA 2VDNB 2Z6QA 4IIGA 2R1UA 4S3MA 2Q4EA 4Q93A 1NRIA 4O4JA 1KI6A 4B3DA 1JQEA 2K5UA 4OVKA 3K0AB 3OC0A 3N0XA 2FSGA 4FCWA 2AMLA 3PNOA 4L85A 1W59A 3O4HA 1AZWA 1FXWA 3ISVA 4KZKA 4CLDA 1M73E 4DPLA 3EXIA 3GLFA 4EX7A 5C7IO 1NBMA 2W4MA 1HTTA 1TJYA 1VE9A 3UKOA 2EQ5A 2FN7A 3KYDA 5AJUA 3IO5A 1XZQA 4BNMA 2W83A 3JQDA 3QIVA 2ZIGA 2XCIA 4FFPA 1O97D 2O0LA 4HNHA 4FYWA 3YASA 2XWQA 5J58A 3LZ6A 1VRVA 4N82A 2VHEA 3QNUA 4EEKA 1H6CA 1LV7A 3JS5A 2O07A 3FH0A 2PX0A 2XPCA 4YRDA 2B0CA 3GT3A 2TMDA 3VR5A 5GVSA 3B3FA 2IPNA 4NG4A 3RHTA 4B9AA 1KE1A 2OHIA 1QGUB 4H16A 4QG3A 3NTQA 1FUUA 1LVUA 2DCUA 1SPBS 3ESAA 3OCYA 3B53X 2HV9A 1LPBB 3S8EA 3T7EA 1DELA 1KH3A 4W1SA 4MV4A 1F3LA 4I36A 1WSWA 3T99A 4JELA 3M33A 3DTVD 5ECGC 3ULKA 1TTQB 3A1EA 1ORDA 4DM4A 5AVQA 1GO2A 5HZGA 3AILA 1ORIA 5MF6A 4GRDA 3C8HA 4A8JC 4F5YA 2A9QA 1X7WA 1MEOA 3CH7A 3ETLA 3OIYA 4E5MA 3L0DA 3OHMA 3K6JA 3WWDA 1ZU5A 2G25A 1A2BA 1BQ3A 2HO5A 3ELYA 1RXEA 5AFSA 5FWYA 2W58A 1UEJA 5ESXA 3ENKA 3FDXA 4KDFA 1OAOA 4AZ3B 4FCTA 3I4LA 1EVLA 3ROTA 1LPMA 3ECAA 5JBIA 4BQFA 1UMKA 1XT6A 4JX8A 2Y0DA 1NYQA 4NYIQ 4TXMA 3WYCA 2Y0BA 3NHPA 4KWCA 1RXUA 3W34A 4LK2A 1XTQA 4IMIB 4L51A 1M1UA 4PYJA 2ORED 5LM3A 4I3FA 1Z6XA 3Q9UA 4HRYA 1W93A 2KE5A 5JECA 4BU1A 5GJBA 1NURA 4JUFA 4OBEA 1N2EA 3CZMA 1ZPDA 5CIYA 2ZVPX 2D2IA 4ARZB 4W5NA 4B71A 5GINE 1RLMA 3NAQA 4N0EA 2XMZA 3BFXA 2AFHE 1HE3A 3COYA 4HLDA 3CF0A 4YAWA 4BWGA 2QV0A 2XT6A 2K4MA 1F2UA 2GEKA 1H1LB 1JEQA 1FPQA 1WZNA 2ON6A 4RELA 3IUJA 1C4XA 1NX9A 4P22A 2OLKA 1GA4A 1Q1AA 4QJ5A 2H31A 4QEZA 1M34E 3GJ7A 4O3MA 4PNHA 4J9UE 3W4KA 2YOFA 2V5VA 1XEXA 4R83A 1ZN8A 4FPXA 2PGXA 2ZS8A 6CHYA 5I5EA 4JI1B 2AW3A 3VNRA 1JHXA 2WHEA 1ZLXA 3TOXA 1LSSA 2BEWA 3RS2A 5DSXA 4KKXB 2FXVA 2FWBA 2PU5A 2NU7B 3SS9X 1XD8A 2XMQA 4P3XA 5JO0A 3H9UA 4FGLA 1PT9A 1SD5A 2YNMC 2QN2A 3M34A 4YJKA 1XQVA 1CRZA 4ABTA 1RWBA 5T4FA 3KIPA 4MCIA 3T52A 3T95A 2V1UA 3IL2A 4HQRA 2P79A 3OMXA 1UAAA 3FCSB 2O8DA 4P36A 4WN9B 3KPUA 2GQ0A 3A6ZA 4ZD6A 3GBVA 1GSIA 3RAJA 3BMNA 4OHPA 5TXGA 3ODPA 2I2WA 4RZ3A 4XTCS 1UBCA 4LJ5A 4BLQA 1ZK1A 2CWDA 3M1AA 4QU5A 3FD8A 2O2CA 3IVMA 4HD8A 1G5FA 1OHHA 3SHTA 2EGUA 1K6MA 4DMHA 3BIWA 2XQVA 4WBNA 1OH7A 4YCAA 1FSZA 2DY0A 4D56A 4Y2PA 2HAEA 2GH1A 3AUAA 3GFRA 1HR0B 3UHAA 4BQEA 1D7OA 1L7OA 1IZ8A 1DOHA 2QZ4A 3F6YA 3H18A 4HMOA 3U40A 2AZ4A 5KDOA 5LP1A 1KNQA 1OFTA 5AKLA 4KN5A 4D96A 2ZZNA 5AXAA 2XXAB 4JLAA 3SBOA 2D1SA 1XJWA 3T4EA 4E4RA 4BZXA 1FSGA 3HSKA 1S1CA 3WQRA 1EHYA 2I2CA 5FRDA 3K73O 1KQOA 1O2DA 2HQSA 3GO4A 1F8YA 2C8VA 1YVPA 3DLAA 4H4EA 4HDCA 4B83A 5KCMA 1WEKA 4AB1A 3KPVA 5KUTA 4BO8A 8LDHA 2PRIA 3DE0X 1JJVA 1FEZA 1MAVA 2BZ0A 4R2LA 2FFHA 1OH5A 3INGA 5EIBD 5HWSA 3JAWB 4ON9A 5ECYA 5A03A 4B81A 3QX7A 3QY9A 1L2TA 4EB6A 5MGBA 2W00A 1P73A 1TZMA 3PR3A 3GT7A 3MHTA 3UB4A 1PR1A 2NZVG 2ZRHA 4NCNA 5K01A 2ACWA 1J39A 1M66A 4TYYA 1VPTA 2B1RA 4CCAA 1PYDA 2IELA 2X86A 1FLNA 4IY1A 2FVYA 1Y4AE 1UJNA 2RH9B 3QU2A 4PTZA 2Q62A 4HLUC 2F90A 3H6KA 3N76A 4JGIA 5I48A 4U2EA 1MVNA 4AICA 1OLXA 3B5EA 1Q11A 2Q5EA 2W11A 4Y2GA 4WK4B 4BMYA 2LVBA 4Y2QA 1Q0UA 4RHFA 4AUNA 1RM0A 2R9VA 1ULHA 3R9WA 1GCAA 4XCQA 5DW3A 3R8XA 1IBCA 3LK7A 1YONA 1KBQA 4YH1A 1F8XA 4B44A 4ZHQA 1D1SA 2XZTA 3OAAD 4GDFA 1SCUA 3A4IA 4OLBA 4L6IA 1DKPA 4N3AA 1DTSA 4H27A 2L2QA 3QEOA 5DHTA 5JU6A 3AF2A 4R69A 5J5VA 3OF5A 2IF0A 4BMZA 2C98A 2CYAA 2JJ2A 3GV0A 2VWHA 2B4QA 3SKVA 4A2PA 4FX2A 4BZZA 1PD1A 1O96A 1SBIA 4FGKA 2K7FA 2WVJA 3EMBA 1ILWA 2R6DA 4C7BA 5HTOA 1FC0A 1VG0B 2ZBFA 4MKRA 2I9PA 2DUJA 2PWBA 4R1NA 2J3QA 4R8LA 3LT4A 2UUOA 4IF4A 1R9MA 3SIXA 3NEPX 4EF6A 3WFJA 4MK4A 3O8LA 5A4DA 1WU8A 1Y1QA 3NOVA 1IXSB 4HKTA 4AUKA 4BX9A 3WAJA 3VJRA 1N2ZA 1FOEB 5JJKA 5LKRA 2O4UX 4RE5A 3ZYZA 5FA8A 4Y6LA 2EIHA 1FFHA 2BFAA 2CGEA 5B6PA 4B43A 5B1DA 3WLJA 3RC8A 5GVRA 1LD3A 3T4UA 3QPDA 3MINA 3WA6A 2PSJA 3UMFA 2WJ4A 2BFCB 2XWBF 3LECA 1BXGB 1D3AA 3M9LA 5IUKC 4HGRA 2P4QA 4MR7A 4YASA 3UM9A 2OYSA 3L8MA 2OTCA 3E48A 4LNUB 3VUEA 4KH1A 3JCZA 4L7QA 4XXHA 3ZVRA 5J23A 1EUDB 5IC5A 3PQ6A 1DQNA 2EFHB 1V3QE 1ZICA 1QWOA 5LOVA 4I6EA 3TLKA 4AX4A 1E1RA 2JI4A 4JS0A 1L3IA 1C9EA 2OZKA 4Q3CA 5EHQA 4E1AA 4TYPA 1C7JA 1OXBB 3DBHB 3EWAA 4AIIA 2ZUEA 3RFXA 1J33A 3FPJA 3VU9A 5KSWB 4B2IA 4Y9DA 4I7EA 3TZEA 2WTNA 4DSNA 1Y1TA 5FR2A 4BC1A 5F64A 5IAKA 5C3MA 2YWEA 2HDOA 3TQHA 2F8MA 1ENPA 1C1XA 4ID9A 3FPEA 2O1EA 4FCVA 3WOVA 3OPYB 3L92A 1JPVA 4M49A 3L7NA 2P3OA 5KYWA 1NBOA 3W6PA 4C1BA 2X2PA 1O7JA 3TZCA 3ZJYA 4BFLA 3U1BA 1PNQA 3UWOA 2H1OA 2UUAB 3IKMB 3JYNA 1QTRA 4IH1A 1OFUA 4DSOA 2BP7A 2VSOA 5JFTA 1RXVA 3C3KA 3F1KA 3ZI0A 3V8MA 1MZVA 2BM1A 4EI9A 4M0EA 1E63A 4YRJA 1TADA 3P9YA 4ZEWA 3F73A 4LDQA 4FFNA 3N7TA 5A06A 5I47A 3HKBA 4P33A 2QKYA 1IN7A 4CKCA 4RHUA 1YZTA 3IMEA 3MSXA 4E88A 1KMCA 1MGOA 3CZ5A 4K9SA 2QW8A 3ENNA 2FMKA 3P0JA 4AP6A 4HQNA 4ALKA 2FZEA 5ER9A 2N1MA 4L0MA 1NAIA 4JUIA 4PQFA 2HK9A 3PNVA 4MKIA 4CEJB 2HW8A 2FW6A 4ZGWA 2W6JD 5CD1A 2DRIA 4ND7A 5B12A 1L4YA 2QG9A 4LGCA 2PEZA 1QP7A 3GLGB 3SDZA 2PQ2A 4MUKA 1N33B 2GHRA 1P6QA 1PDVA 1PL7A 1USGA 1II8B 1VB5A 1YOVB 2QN7A 3IKLA 3ERCA 3UV7A 5IJAA 3GJYA 1PQWA 3AUJB 1NW7A 4YJ3B 5DYTA 4DZZA 4BE9A 1CJMA 1PS8A 3EFOA 1XA3A 3FMFA 3MWGA 4KYTA 4LGYA 4Q4JB 2W6CX 5IAJA 4UCWA 3TZBA 3WXBA 4OH1A 3ONEA 3HKEB 2Q29A 4A03A 3LUGA 5CLHA 3STUA 4JP2A 4ZCSA 2GRAA 1HK7A 1LS1A 3ZHTA 1KYZA 1U9IC 3LBIA 3I1JA 1H2AS 1HEYA 3HA3A 2ZBGA 3ADDA 4ZOLA 1Q6YA 2F7SA 4L8YA 5CR9A 1M0EA 2W9XA 1NDHA 1S9DA 3PUJA 2O6HA 1H9AA 1SQ5A 1SRQA 2WF9A 3MLAA 1SU7A 1Y8CA 2BY4A 2J3EA 3ETGA 2I22A 3K09A 3KV3O 1DC5A 4BJHB 3DM5A 5BV2P 1CRPA 2PGLA 1E1MA 1OZHA 4ZEMA 2IE8A 5JDCC 1GN9A 4EVRA 2QM0A 4YBZA 3HCFA 4BQRA 5TPZD 4BMXA 2GUGA 1WBDA 2FPPB 4WK6A 1EK6A 3FTPA 3X2SA 1DWUA 3N6XA 4JP1A 4HNTA 1M5UA 3C5CA 1I2AA 1OPRA 4PSCA 2WYWA 1P5FA 2VHYA 2YZMA 2RGNA 4N5IX 3LLSA 4IIDA 1GPKA 4WH0A 1RXSA 2ZCJA 4MH0R 5AW2A 2QYOA 3ILXA 3TO5A 2KM1A 4U2CA 2EWVA 1V11B 2LW7A 4HN4B 1W4RA 3NX4A 4OGWA 4REMA 3UOAB 2KLBA 5A0VA 5FYDA 3WJ7A 4FJ0A 4A6PA 2ZE7A 2X0KA 4DDWA 2WIJA 4CKYA 4BLTA 4QBFA 3IQEA 2KWIA 1T1EA 3HJHA 3WK6A 2WWFA 1ZXLA 4G09A 4CQMA 3JD2A 4ZPXA 4EW3A 3E9ZA 3LVFO 5I7UA 3ND7A 4HJXA 4M2LA 3U3XA 4O4JF 2JH8A 4R9UC 1VG9B 3WBJA 3R1IA 3P94A 4JJAA 4JN6B 5IN4A 3EUAA 3LQFA 4DSZA 5KVCA 4U9UA 3FUWA 1U1DA 1IN8A 2XUQA 2QRNA 1E4EB 1MO3A 3G0BA 3OFND 1B42A 2WLTA 2JI9A 5DTMA 1CK4A 1GTL1 4KGXA 2O3QA 1E1YA 2HT1A 2PIAA 2XYVA 2Z2KA 1EFDN 3OLWA 3VYTB 3LIIA 2GN4A 3BH7A 4LJRA 4P4NA 1N0VC 2IYAA 4JBXA 2V3CC 1U3UA 3HYRA 3PYXA 1EGAA 3PUZA 5DNWA 4HGZA 3FPAA 2WA1A 4YJFA 4BWVA 1OVMA 2XMCA 3CH6A 1A8IA 2G70A 2Y2UA 3OOJA 3QLVA 1JFSA 2YVUA 2XDAA 4KGVA 5LVAA 3Q85A 4KNYA 2G5CA 3DHNA 4L07A 2ZR7A 4J2TA 4BXOB 3RIYA 2IYEA 3G59A 3EQ9A 3D6FA 4I4LA 5JAHA 4LXIA 2DPLA 2XZLA 3ZH2A 2COEA 3DKVA 2P7IA 1V4NA 2NU8A 2Z57A 3L7DA 4W9NC 4YJ2B 1AKEA 3D43A 4KU4A 1B8UA 3F97A 5D1HA 5IDYA 1L0BA 3P19A 4J6EA 4B0PA 5C5CA 5JJBA 2NOAA 1KZ1A 1WMDA 3H6HA 4J4BA 1A2QA 2M9MA 1M7HA 2FPUA 2C07A 2O3JA 1GQ2A 4UUAA 1HNNA 1T1GA 2O57A 3OKPA 4HFRA 4WXMA 3W1WA 3OM9A 2EKQA 3TSAA 3KXIA 3HB0A 3WLIA 2CB9A 5JHGB 5JCJA 3MFYA 4RFLA 4UTOA 1O87A 1PLLA 1A96A 1TYZA 2BM0A 2ZSFA 3IEKA 1E9SA 4RULA 3I45A 3S55A 3MOGA 1UBGA 5CLIA 1K92A 1UBSB 2GM5A 3QE3A 3ZI4A 1G6KA 3KKEA 5KOJA 4EKDA 3I34X 3NC0C 2DQKA 2F1IA 1P9LA 2QP3A 4IL5A 4MS4B 4X20A 1Z47A 3OFVA 1MGPA 3E5MA 1MT0A 1SFRA 1NNEA 1PR9A 4RLQA 2ANBA 2YCBA 2ZVDA 4I3HA 1I7NA 2BI7A 3Q12A 2I8AA 5DX0A 3TZQA 1Z6PA 3OOWA 3AV3A 3R76A 5L6MB 5CFRA 5LDGA 1XCPA 3K0AA 2ETXA 2OORA 4FQ8A 1N2JA 4G9BA 4LK3A 4HGOA 2EJCA 3RSHA 3TOSA 3TRHA 4A8TA 3UT0A 1NAHA 2BFEB 3K31A 3KR1A 4L73A 4A6XA 3RV4A 1YQ9A 2A1UB 1L5HB 4N6NA 4QU0A 4QUGA 1DIRA 2P6MA 2TMYA 3IERA 3UFBA 5JXGA 3NHUA 4OH7A 3X3HA 1G7RA 2MIIA 2CHEA 4E15A 3BTVA 4FEGA 4BVBA 1II0A 4F84A 4RQAA 1JDNA 1LNSA 1N5LA 1GRQA 3BORA 4IJVA 3CLTC 4OSPA 4QARA 5FF9A 4K86A 2B5VA 3ANXA 5HP4A 4AY2A 1SU6A 4WIAA 3TSYA 7YASA 3WNCA 1IEVA 2VZEA 2J6BA 2IOFK 5H3HA 4QTTB 1NRXA 4R01A 2I6UA 5DBGA 4JLKA 5CU7A 4RCYA 4QREA 4HEQA 4HWPA 2HIGA 1NBEA 1ESNA 1QGUA 1YQWA 1VL1A 4ZALA 3AM3A 4FHDA 5FULA 2G1KA 2E5FA 2V59A 1DCTA 2I6GA 3GJ5A 1X0VA 4H6XA 4KSCA 4FILA 1T26A 5ARDA 5BRAA 1IVYA 1VJ0A 4DJTA 4ZU3A 2OQ2A 3BGIA 2AOUB 2Y0PA 3BFJA 2Z95A 3LKDA 2FW9A 1D1QA 1SO8A 1Z2AA 5EXXA 1W25A 2P5YA 1NYTA 3SKXA 3K5PA 4C29A 1QJCA 2I7TA 2WR8A 3ESCA 2OB2A 5BMOA 3HXQA 2WUDA 3IVRA 4R51A 4YONB 5ALMA 3WVNA 5CXSA 3T34A 2ZRJA 3M6MD 4ZANA 4E09A 1XD9A 1E7QA 3FCUB 1B2RA 2P6OA 4AZ3A 4ZI7F 3HVUA 2FN9A 4DQXA 4FHEA 1Q20A 3VC3A 1FNBA 3HYTA 4MCJA 5FL3A 3NHJA 2DHQA 4ZVQA 4IYJA 4PPGA 1UWKA 1TAHA 1YU6A 2H4ZA 1USWA 3LM8A 3Q0EA 5LP6F 3CN7A 1KNXA 4AROA 1LVHA 1C2TA 3ESYA 3EZLA 2OMEA 3QNWA 5EJFA 4ZU6X 5FO1A 4XX0B 4EHNA 1IHPA 2GI4A 2POCA 4PPQA 4C7KA 2IE0A 4R8KA 4ARZA 2YN4A 2FHSA 3I58A 4M88A 3HN2A 4A82A 4MP8A 4TLMB 4GGOA 1U63A 3DKPA 3U9LA 2Q5OA 3ZEIA 1I7QB 2PRZA 3HUTA 4DSTA 1AKQA 1H1LA 3TTXA 1UQUA 4MUHA 2BKLA 4IXWA 1BN7A 2YRFA 1QZ3A 3SJAA 1JSXA 2HBYA 3CLUD 1G8PA 4HFJA 5AIBA 1L8OA 3T1NA 4NOJA 1L7AA 3A2MA 5K3FB 2O8BB 1PT8A 4KQ2A 1SUWA 2JFFA 2FLVA 2HPHA 2FSVC 2MSEB 3CUTA 4N8DA 4H1WA 1A71A 4XIYA 5E6RB 3G7SA 1Z5PA 5E4FA 2EZ4A 3QPBA 4PFJA 3VPGA 3EGIA 2R8RA 4KJXA 3KOXA 2RHJA 4DANA 1P80A 1Z17A 2ERXA 5DNUA 2CD7A 1V5FA 4HDKB 5FWAA 3ITNA 5AM4A 1KO1A 3ZKAA 2NU7A 3K4PA 4WKPA 3OIUA 2PKWA 3N86A 1T9GR 1SG6A 3EC7A 4LVUA 3UYKA 4AP5A 2ZRNA 4YWHA 1H5UA 3DS8A 4MULA 2J3DA 1OAOC 2JGKA 1MNAA 4N6OA 2ORVA 3E2PA 1W4LA 3MUFA 3DCNA 1N57A 2ACEA 5GTDA 5KYUB 1QGED 2IUFA 2YDYA 5HKAA 1W4BA 2AFRA 4LQDA 4WN9A 3A31A 5I45A 3BJIC 5EFZA 1Z0SA 1IHUA 3QNMA 3PWKA 1ZCAA 1BRTA 3QTTA 1A4RA 1QQ7A 3E53A 3LXUX 1IUOA 4RAOA 3DA8A 2ZTVA 2RGAA 5LBIA 1Q3TA 2G0TA 2GA8A 4Q9HA 2FXIA 2YYYA 2VTKA 1C5KA 3PLNA 2IS1A 2ZIXB 2EFCB 3IALA 3SLKA 4GKKB 3VJKA 2V7UA 4Z4IA 1W0CA 3IUMA 3GMSA 4FD3A 5E0OA 3UJAA 2BDUA 2C4UA 1J2EA 5JDCA 1X39A 3ER6A 1M83A 4M86A 3OIDA 2FEWB 1XJQA 1B00A 2WMDA 3R3SA 2PUDA 1ADYA 1RLIA 1U9ZA 4FKMA 4QXAA 4D92A 1KWGA 2YBEA 3BWEA 2VZLA 3LOUA 4BOYA 5BN4A 4ZYUA 2VRNA 1K6XA 2R48A 1P0IA 2VDVE 5G1PA 4JSRA 3D0RA 2XXAA 4KN8A 3CH4B 5JEEA 4ZVMA 5KTPA 2TYSB 1IOWA 2QGZA 1V39A 2RI0A 2GPWA 2ZWMA 2R6R1 3GFPA 4JHLA 4L5JA 4TN1A 4BS9A 2C7RA 4D3FA 1EFHA 1JR3D 4Q48A 3ZQ6A 4HGPA 4RSGA 3ESRA 2IWHA 5C80A 1XXHA 5KNBH 2FSSA 2WICA 4CCYB 1GV0A 3MWKA 1G5TA 2HUPA 3D7SA 5IBQA 3D5QA 5AXDA 4DJ5X 4K6OA 1KSGA 1X1BA 4PANA 4CIBA 3JQPA 1JECA 1JQ3A 1V7CA 5FAXA 3O1IC 3BA6A 3KZCA 2GEJA 4OI4A 4QOGA 2NYVA 2MSKA 3JAWA 3N8IA 1BDJA 3U7EB 5CA0F 5ADWA 3OHPA 2VDQB 4BMOB 1GRVA 3DMGA 3AY0A 2D00A 1ZUD1 3OOEA 4TZTA 3NIBA 2GD6A 2E48A 4MDHA 4NPCA 4RY8A 2CZGA 5DEIA 3WWEA 5BOSA 1LNZA 2IT1A 3SR4A 2CVPA 1W49A 4GX2A 3ILVA 3HV0A 4U9HS 2VUIB 1H0RA 3ND8A 4OTZA 5E4TA 1IN1A 2I6QA 3PT9A 3KB6A 5CGZA 3F5DA 1PRYA 3TIVA 4M21A 1OTHA 2BDEA 3FTCA 3AINA 3OPNA 1ZEMA 4ZC8A 1SBCA 4UQPA 5I51A 4J1TA 4V0QA 5J2UB 4BJ3A 3BN3A 3ILYA 1QB7A 3MAAC 2FPLA 3R4VA 1J2YA 4RD4A 5J2TF 1LBSA 4DA4A 1PVDA 1RE0A 3TGPA 2IYLD 3IODA 1SIUA 4KPYA 1NLUA 3OJCA 1GUZA 2QR3A 1RYDA 4G2TA 4NDZA 1T1SA 3EXHB 1C4WA 1LJLA 3Q9NA 1W6RA 3GRZA 9ABPA 4CL8A 3SZ3A 3H13A 4QWWA 5HIAA 2H6EA 1UANA 4UEJA 3NRJA 1R9GA 4G37A 5FP0A 1XZAA 2RHOA 4HZUB 2X8LA 2JASA 1IUPA 3HO6A 3N7UA 3OICA 4OUDA 1QV7A 1ZUHA 4WWHA 2J32A 2VYNA 2X41A 2DSTA 2VSFA 4N6GA 3NAMA 3FJOA 3SYKA 4CM6A 3IC5A 2PWPA 5AI0A 2Q1XA 1F38A 2QU8A 4BVEA 5E7JA 1PK7A 2PO7A 2ZU0C 4XOIA 1QG0A 3U4IA 3V48A 4NBUA 3N0RA 4EW2A 4D3XA 4GVPA 3IRUA 4K6CA 5DCUA 2BFDB 4WLFA 5ADUS 1TM2A 1FDRA 1JVNA 3O4GA 4F2DA 5IVPA 1BMFD 5G3ZA 2HFJA 2BFOA 4RGYA 2XECA 3QA9A 3RO7A 2FVXA 3AVWA 3JWGA 1MC5A 1GAWA 3QVMA 3AIKA 1JQDA 1QX3A 4JNCA 3OLYA 2BFCA 5A05A 4DLTA 3DNMA 1BXGA 4PONA 4E5PA 3OQJA 1U0FA 1M6NA 4ZQIA 3R24A 2AD5A 2X3FA 3RSCA 3UJ8A 2Z0MA 3O3OB 4IDFA 4LNUA 2GTHA 3D6VA 3GH1A 4OFBA 5AKHA 4F5ZA 3VR6D 3AUUA 4DBLE 1VTKA 4HQFA 1EUDA 4X97A 3WL5A 3ZNOA 3K0CA 1T1IA 1PK8A 1R00A 5JMTA 5KYGA 1RHUA 2I4OA 1K4MA 1Y3CE 3KV1A 5HVNA 1NWCA 3GFTA 3QX9A 1ONBA 3F90A 1OFVA 4I55B 2PS9A 4KNWA 3SQWA 3K70C 1PJZA 5H3CA 4DARA 4PICA 5HKKD 3DBHA 4RPKA 1MAUA 1T4BA 2Y1KA 3KQYA 5CVEA 1IBMB 3LUHA 4IRUB 3TLYA 4KPFC 3WA7A 4B6RA 2L18A 4ZEOA 3EGDB 3B9QA 4J94A 2KPOA 2J33A 1IY9A 1SOMA 1I4EB 2C00A 2GPBA 3FVQA 3OLZA 1THZA 2DWPA 1B8PA 1VBFA 4Q19A 4Q9KA 3WIVA 4D1YA 3OPYA 2BDTA 3PS9A 1AXRA 1O9GA 1Y7HA 1QQ6A 4Z7JA 4FS8A 2BZ1A 2ECOA 3OZFA 3LUPA 4D8YA 3CSUA 1NQ5A 1KI1A 5EE1A 1RAAA 5D5HA 3RD5A 3LP5A 1O1YA 4DUGA 4YRMA 2A0UA 3B1XA 1VL2A 3IBTA 3O31A 2A9KA 4ZT6A 5CFPA 1LUAA 2AWOA 5FTWA 4CTOA 3REOA 4EPWA 3CXUA 3AZOA 2AG8A 2PGNA 3N8HA 1L7BA 4QPCA 4BNLA 1PD0A 1QF7A 1VKOA 2YXEA 1A50B 3U4MA 5L95A 3WGMA 2WFAA 2CXOA 4HEA1 4KXYA 3BCRA 2QI9F 2LBPA 4CL0A 1P1KA 4RJLA 4DMLA 2J1LA 1XNHA 1QDEA 2G88A 2I7DA 4PC7A 3JQEA 4XH9B 3ITDA 3I83A 2Z8YA 2JLAA 2Y0CA 1JQKA 3F5MA 3K1TA 5J4VA 1AHPA 4CEJA 1CJCA 4Z3OA 1JDVA 1I1NA 1PSDA 4JUBA 3K0SA 4NS1A 3GLGA 2R3SA 3GD7A 2GZ2A 1YOVA 4B3IA 1AH2A 3HBLA 4PFSA 3OUUA 1WQ3A 3TQFA 5EJ8A 2ZFUA 4V2IA 3G0CA 3HACA 1ZI6A 4YJ3A 1ATIA 5HF9A 4IQ8A 1ABFA 3PVSA 1COWA 1VIAA 3BYZA 3DULA 1P7CA 4Q4JA 4RMJA 4DDUA 2QSYA 3M1YA 4XGNA 2Q6VA 3VV2A 1CUSA 1Q3KA 3QKUA 1AB6A 3DXFA 1WULS 4IIVA 2Q4TA 5IH7A 3TS1A 1J1ZA 1P5RA 2WZCA 4XFKA 4KR7A 5IJ9B 3KJNA 4PLHA 2PX3A 2AQHA 2DECA 3DCJA 3ZQUA 3ON5A 1P9RA 2HADA 4OK3A 2GR9A 1FQKA 1I14A 2HK6A 2Q8PA 4RZUA 4UMVA 4MQ5A 4ROSA 3SX4A 1J56A 2VNJA 2YJ5A 3R4CA 1KY5A 1Y1RA 1MO5A 4GXRA 1L4MA 3OFJA 4UXIA 5EWJB 4D25A 3V5NA 3ICQB 1E1CB 1OFIA 1E2DA 1FBTA 3CVUA 1JHDA 2PKXA 3IDFA 2Z1DA 3I72A 2IX9A 2F64A 3CTMA 3RTEA 2IPAB 3W90A 1I7PA 2WRZA 4LMBA 1M1NB 2XYGA 4HRVA 4NSNA 4W99A 3FZEA 3ZK7A 4AZ0B 4XJXA 3O7WA 5IBCA 4JH0A 2IXAA 3OJXA 4G1CA 4K8RB 3ETHA 2KYRA 4ZA2A 2HWWA 1SCJA 2YH2A 3QXXA 4RHEA 4S12A 3WLSA 5J1SB 2FPPA 4JI8B 4Q00A 5EMKA 3SYLA 3NBFA 1NXPA 3DE7X 4JXZA 2RHHA 4PX3A 1NRJB 1G8KA 1WMSA 2VPWA 4GOLD 4XWWA 2NTVA 3GPLA 2CMFA 1E89A 4IGEA 3BWBA 2AH5A 1IQPA 1YQXA 1R2QA 4E14A 2C4KA 3MYYA 2BKVA 3IJPA 4ZO4A 3HYCA 2EBFX 2PY6A 1DX4A 3O47A 2M32A 5DX8A 5LA6B 3S2GA 4Z3KA 1D6JA 3DDZX 1JP7A 3O73A 2QUHA 4QXOA 3BOSA 3P4UA 2QR2A 2A94A 4PC2A 3WQBA 1NULA 4HS4A 4BRUA 1V11A 3TEFA 3GLSA 1YZVA 3I2YX 4QFBA 5ALPA 3RC9A 3WL3A 4GM0A 1SXIA 1ABEA 4L5BA 1AURA 1L4LA 3VXKA 5B2EA 5KHLB 4IICA 2YY5A 1FLDA 1R6TA 4DN6A 3BRCA 1SXJB 3EMVA 2IEAA 1YK1A 2I66A 2HHLA 4X45A 1ZM3A 1RKVA 2O14A 5CYPA 4EHFA 3TMYA 2Q41A 2QLFA 2FQWA 3AR8A 2Y66A 3MXTA 3NH9A 4JL8A 4WADA 1DJMA 2ZJAA 3VU0A 4C5AA 2WWRA 1FK8A 5I9BA 3MWJA 5JZBA 1WCIB 2JHAA 1HSOA 4P4LA 3FOAA 1BH6A 5KNBD 2XE4A 2CFCA 5ARBA 2WJPA 4N0PA 2JVJA 1EXMA 1E4EA 1PAUA 3EVDA 4AD8A 2HMTA 4QDOA 2OA0A 4R2HA 1G20E 3K09C 3ESQA 2V3VA 2R5WA 1JSRA 4LIPD 4OQYA 5CXQA 5BRJA 4O4LA 4U2GA 4RTNA 3SQXA 1T8PA 3K30A 5JI3E 2YQZA 1NQWA 2PWYA 5LNK1 1T5DX 1LI7A 4U5XA 5IJ0B 4GMFA 3ZBTA 3CZ4A 3ROZA 3SIPA 1P2GA 3DO5A 4OJTA 1EZ1A 1TTHA 1AQJA 3CIOA 1WSDA 2JD1A 2XTJA 4BXOA 3A1SA 1FS6A 2QD2A 2WPNA 1V8DA 2RHGB 4R4JA 2RGNC 4YYZA 1JAHA 5DNAA 4NI5A 1NXTA 2YXPX 2SICE 3RC1A 3TAXA 4D4KA 3LG2A 2YV4A 5JRDS 4YJ2A 2IZ5A 5COBA 4EZBA 4YMUA 2XH8A 3GIWA 5EWMB 4JVSB 2XMPA 2HA0A 4C4AA 2QI9C 2WYOA 4EA8A 1DTWB 4E1VA 3VAYA 4CFSA 3VA7A 3DP7A 4IV5A 3E82A 3ZHVA 3D7NA 3K1ZA 4FDLA 5JH7F 1QO9A 5K8CA 1KFJB 1X9IA 4ZJUA 1H85A 2VP6A 1KP2A 1QR6A 2E4YA 1UKZA 1RRPA 1O3YA 1UJ5A 1WXWA 2ZRIA 2NUTB 4DMRA 4JB8A 5K2MA 4MWDA 2EX4A 1BJRE 2HMUA 2HRBA 2WNSA 2Z98A 1QHFA 4YAOA 1CX9B 3RIHA 1IIBA 1CFZA 3E1KA 5IJWA 4IOJA 4MQEB 2F1JA 3N39C 4YIKA 4DMUB 1Y81A 3WDKA 3M9XA 3JYLA 1LDYA 1GPLA 3FRJA 1II9A 1UPUA 3FI0A 4MS4A 3TJMA 5GIOE 4MGEA 2Q1WA 2WKRA 1IEWA 4GM4A 1V8OA 2C7BA 3VYUB 2VJBA 1GDDA 2XOKD 2JGFA 3CNLA 3M4YA 4R5MA 4XB6B 4RVSA 5THQA 4BZPA 5FOTA 2D1FA 3EF0A 3QLVC 4QYWA 3RJZA 1Q22A 4E1BA 4NF2A 1E94E 4IWYA 3HADA 5CH3A 1MRSA 3A2LA 2G83A 3P9PA 4PNZA 2WAXA 4MRAA 2BFEA 4E4YA 4F5WA 3KPYA 2A1UA 3EVTA 1L5HA 3P2MA 2X42A 2VXOA 4JXJA 5C51B 1P2BA 1K3TA 2WSSA 5U4XA 5IYZB 4GZMA 1VL0A 4BIIA 2HJWA 1NW4A 4YAEA 5EQTA 3OSZA 4BVGA 4KIFA 3IURA 1RC0A 3A25A 2G8LA 3H5IA 3GDGA 2A78A 4EYGA 5BNWA 4DV7B 1CEYA 1M7BA 3P0FA 4QELA 3VZRA 2GCNA 2OENG 2JFQA 1SCQA 2PWZA 3R3XA 2GN9A 3WLQA 4DILA 4IUBS 2BOVA 1W8IA 1UOEA 3DZGA 4G41A 4LI3X 5E3JA 2D06A 3FX2A 5FADA 5T67A 3M4XA 4C9BA 4D0RA 2QTBA 2Z9BA 2DUMA 4O1MA 4XGIA 3A11A 1JR4A 2ZXEA 5EINA 4AF7A 1SCAA 5IAEA 1FZQA 1W46A 4M38A 3UY4A 3PFKA 2OBNA 4DJJA 2AOUA 1V2GA 3RJ5A 1LXCA 3DHWC 3H0CA 1UT5A 3JQ8B 1KF0A 2XMGA 3H86A 5AVVA 1AO0A 3PT5A 4HAZA 4RENA 3VH4A 3ZEAA 4Z53A 4KQWA 1IN5A 1U1FA 2H18A 1QIHA 4UM8B 1CE8B 1CR1A 2FETA 2PUBA 1V25A 5FTKA 4BX2A 2QAIA 1JFFB 4PGFA 2XIJA 1SQGA 4DLUA 3BCUA 4BNYA 4NNJA 4YC7A 4BBZA 3TCXB 3R3VA 1WZUA 2YVKA 4MDFA 3DH0A 1FTWA 2J48A 1OBHA 1IJFA 1E3IA 3OQBA 1U81A 3SJ7A 1V1MB 2V58A 2RK4A 4F93B 2YOGA 1Z7EA 2EAUA 4ZQEA 4ZREA 2OGTA 1G21B 1WY5A 3AF5A 3UB2A 2VSNA 1OAKA 1E20A 4JENA 5KS2A 1E7SA 2ODAA 1NSTA 1YR8A 4DV2B 2B36A 4PAOA 3C14C 1V71A 2C95A 3DF7A 4IMPA 4L4UA 1L7VC 4IDNA 4ZP1A 3VGPA 1KDOA 1EWRA 1OAAA 1Y4UA 2C94A 4M8NE 2W6ID 1DMRA 4PCLA 4QASA 2XA9A 2IS6A 1KYQA 3FB4A 4H1VA 4KIJA 4ER0A 4WOPA 1SQFA 5EJAA 2FMXA 4JYCA 3AQIA 2MSDB 4JBIA 4LYHA 2GTPA 2J5BA 4C5CA 4PCAA 1VIMA 5DP2A 621PA 6AT1A 3MUNA 3CF6R 5DGDA 4QPNA 4D4MA 2WJJA 1ZR2A 1KQPA 2YR0A 4H1UA 4LV5B 4YP7A 5K3FA 1DHTA 2IS2A 5B3AA 3TLCA 2OAEA 4BX3A 4CLOB 4TV9A 1XDUA 4CE6A 2CF6A 1VHDA 3C87A 3D3WB 3EH2A 4IBOA 5E6RA 2V7QD 4CRWB 1JH9A 3KSBC 3ICEA 3ZWYA 3WV5A 1KBOA 4KR6A 2IYOA 2CD9A 3DWGA 4HDKA