3O26A

The structure of salutaridine reductase from papaver somniferum.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
294
structure length
294
Chain Sequence
RRCAVVTGGNKGIGFEICKQLSSNGIMVVLTCRDVTKGHEAVEKLKNSNHENVVFHQLDVTDPIATMSSLADFIKTHFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEELVKIYEKPEAQELMSETYELAEECLKINYNGVKSVTEVLIPLLQLSDSPRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLANKIPKFQVNCVCPGLVKTEMNYGIGNYTAEEGAEHVVRIALFPDDGPSGFFYDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Salutaridine reductase
publication title The atomic structure of salutaridine reductase from the opium poppy Papaver somniferum.
pubmed doi rcsb
source organism Papaver somniferum
total genus 114
structure length 294
sequence length 294
ec nomenclature ec 1.1.1.248: Salutaridine reductase (NADPH).
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3o26A00
3QWBA 2EKQA 1ORRA 1JDJA 2GN8A 4R1SA 5ENDA 1UJMA 3JQEA 1SOVA 2NLOA 5DF1A 3I9LA 4RF3A 5A1TA 2NSDA 3AUAA 3JYOA 1GCOA 4IDCA 3WGQA 1ZK3A 1U4SA 1WZEA 4INAA 4BNMA 3CE6A 1U28A 4NI5A 3SJUA 3F46A 4OAQA 2ZATA 2Q99A 4W99A 5L53A 4N5MA 1YQXA 2YJZA 4IJWA 1T2CA 3FF4A 1R4MB 2VHYA 4H15A 3WMWA 4BNFA 1P77A 4GSLA 3DBLA 1BSVA 4HFNA 3GN1A 4MP8A 4XGNA 4TWRA 2IXAA 1V3UA 4EBFA 1LLUA 2HMTA 2P4QA 1GPDG 4YDRA 1Z45A 1PGPA 4DQXA 4E5KA 1GEEA 4CM9D 4BNIA 2VWPA 3HUDA 2X5OA 9LDBA 3FR8A 1E7MA 1NP3A 1CIVA 1PGQA 3PIIA 5T6BA 1NYTA 3K31A 4K9DA 3I23A 4D7AA 5A9TA 4WEOA 2UUPA 2Y67A 4WNCA 3Q9NA 4A7PA 3PQEA 2FSVA 1FDUA 3E82A 1L7DA 4Q39A 5FYDA 4MVJF 4QEDA 4CMEC 2JAPA 5T8KA 3K96A 5G0TA 3IOYA 3ZWAA 2EP7A 2FR0A 3ZWYA 2VNSA 3V1YA 2DBRA 2WYWA 1ZEJA 3BMCB 4ZRMA 4YAJA 4ND4A 1ZKMA 3VHRA 4B3HA 3B1FA 4J7CA 4P22A 5C7OO 5KOIA 1LJ8A 1U2GA 5EJ2A 3RUIA 3C24A 4H7PA 4ZU3A 1BRMA 4ZJUA 4IIVA 2GRAA 4B79A 1Z82A 3HG7A 3K92A 3NT2A 1G6KA 1EBFA 1EE2A 5TF4A 4ZICA 1BVUA 1HDYA 4A73A 1E1MA 1XU7A 3ZHZA 5JAZA 2ET6A 3WYBA 3TFQA 3D7LA 1NQTA 1F14A 4G2NA 3FTNA 1LBEA 2W2LD 1OC2A 2VCYA 5B4VA 1R15A 2BHLA 3TDKA 4GI2A 1A7KA 3KZVA 1RM5A 2IEDA 2Y1CA 4RF5A 3PVZA 5T57A 4IZIA 3E5MA 2VZ9A 1HETA 4U6QA 4BKUA 3AI1A 2HMWA 1KEWA 2ZTLA 3SEFA 2Y66A 1HDXA 1GQQA 4BNJA 1PJBA 1X7HA 4FC6A 2C7GA 1E77A 3AUUA 3MJTA 1ZXBA 2TMGA 3QWAA 1DEHA 2O3RA 1MUUA 4OGWA 2Y1DA 5JO9A 3T7CA 4D0RA 3VDRA 1Z7EA 3DL2A 4J1SA 1M2WA 1PJ2A 3PLRA 1F8GA 2BGLA 3OQ1A 1PL7A 3GUYA 2P68A 1U3WA 3W4KA 3C3XA 4O59O 4AJEA 3P19A 4MIYA 4GWKA 4BO9A 4JLWA 2BFPA 5L3ZA 3AK4A 2DKNA 4AJOA 4E32A 5KWEA 1R0KA 4RZIA 5GY7A 2WEKA 2G0TA 3C7DB 3GEMA 5DBIA 1T2DA 1B8VA 3GF4A 1Y8QA 4E12A 1M67A 4ESOA 2DTDA 1GV0A 4GBJA 4UUMA 3IL2A 4BGVA 2RAFA 4DGSA 1QYWA 1ZO8A 4LN1A 5DDIP 3VVCA 5JLAA 4CR8A 1E3EA 3B1KA 2OP0A 2V6GA 4H3VA 4MIOA 4EJ0A 4RQUA 2J3IA 8LDHA 5U9CA 2C29D 3KB6A 4LMRA 1D3AA 1WDLA 1UAYA 4CMBA 4URFA 3T7EA 4LGVA 4UUOA 4CMGA 4ID9A 1B8UA 2CNBA 3DOOA 2VZ0A 3G17A 1I36A 4I9NA 4FFRA 4OQZA 3D5QA 4J3FA 1JAXA 2NACA 3ASVA 2Q4BA 3GFGA 3UGKA 2DC1A 3ROMA 3DWFA 3NJ4A 5DBGA 3FTPA 4CMAA 1N1EA 3OH8A 1X15A 3Q0EA 4FR5A 3WR5A 4HY3A 3DZKA 3KYDA 2X9GA 3TN7A 3MJVA 2Q45A 4OJNA 1Z73A 4DC1A 4WCFA 3UCXA 1W73A 4JJIA 1AXGA 3TZKA 4U0JA 4Z6KA 4ND5A 1BTOA 1MC4A 1BXGA 4W7HA 4FW8A 4BV8A 2Y68A 4TZKA 1P1RA 1FDWA 2CVQA 1V0JA 2Z1MA 4RDHA 5ITVA 4B4OA 1KVTA 3PTZA 2JHGA 1YBAA 1HT0A 3GHHA 3AM5A 3BMQB 4BO3A 1UXKA 1JU9A 3VPGA 2Y05A 2YFQA 3G0OA 4DXHA 1O6ZA 1RM3A 1XWFA 4JGBA 2E82A 1X13A 5J23A 1SZJG 1H93A 2EEZA 2WYVA 4YJFA 3ENKA 2NADA 4NG5A 2YV1A 1X7DA 2HQ1A 5DCUA 2PA3A 3D4NA 2AQHA 1N2SA 3TNLA 4GMFA 2PLAA 3N74A 4JBIA 4LISA 1C3VA 2AEJA 2C54A 2IYPA 4IDEA 4CMCA 4II2A 2DFDA 4L75A 4E2WA 1X1EA 1MGOA 2ZB8A 1Z75A 4L74A 2OORA 2UVDA 2EIHA 1LLQA 1ULSA 4XA8A 1XGKA 4Y9DA 2W2KA 1K6IA 2YYYA 3G79A 2RHRA 5FEUA 1M6WA 2V6MA 3FI9A 1DOHA 3U3XA 2AE1A 3NV9A 3DTYA 1I3NA 3AI2A 2VRBA 3FSRA 4I9UA 3D3WA 3IKTA 4ILKA 4QXMA 3L4BC 4XYLA 2PKRA 1SOWA 2G82A 1ZK2A 2FRDA 3WSVA 3OQBA 3BTUA 3I1JA 5ILOA 4HNHA 1NM5A 1R4NA 2CUKA 1ISFA 3VKUA 2GZ3A 4S1VA 4GQAA 3H65A 4JK3A 3GDOA 3A9WA 5HTOA 1K2WA 4YA6A 3MEQA 2WD7B 3WICA 3RFTA 5C37A 4YPOA 2OOSA 3K6JA 1Z74A 3F1LA 3GZNB 3AWDA 2Q1WA 5HM8A 1JN0A 2IE0A 3OM9A 1WMBA 3F4LA 2BFOA 3W4IA 1HLPA 5JYDA 3HN7A 2POQX 4WLNA 1P1HA 2ZQYA 4PLVA 3WGGA 1C14A 3WJ7A 5JC1A 3B70A 1YQDA 3OP4A 1Q0LA 2O3QA 4CUZA 3JV7A 1WVGA 3RU7A 3ITDA 5JNLA 3DAGA 1CYDA 4YTEA 3O03A 2VN8A 4W9NA 2CD9A 5IN5A 4ND1A 3RUCA 4DYVA 3FHLA 3ZWMA 3GRKA 1F12A 2FPGA 3H9EO 2HRZA 3PHHA 1NQOA 4TQGA 3VPHA 3PFFA 4JX8A 4LVUA 4EUEA 3RFVA 3VPXA 4GAEA 4PLHA 4RF2A 3QRWA 3WX0A 1RYDA 4OKNA 3K30A 3WJAA 2Z1NA 4GSKA 3I5MA 3JYNA 2P5UA 4XCVA 1KOLA 5GZ6A 2NVUA 4HXYA 4Y6RA 4MVJD 4FGWA 2EKPA 3PFWO 4E13A 4LW8A 3I83A 2X0NA 4UVDA 4R54A 2VYVD 3RC9A 3RUFA 2EG9A 3Q1LA 4PFJA 3RQSA 1PS8A 5CP8A 4DTIA 2JKVA 3I6IA 4WCFC 4OMUA 3AY6A 3FWNA 2G17A 1ZVMA 3KLMX 4QUKA 4RVHA 5DP2A 3GGOA 1U2DA 3DBLB 2QX7A 2FN7A 3G49A 1JVSA 5AXDA 4AVYA 3VH3A 4UVIA 3KO8A 5BR7A 1VJTA 1I3KA 1A72A 3MZ0A 4CQMD 3ETGA 1SCUA 3D5TA 4ITUA 3S2EA 2TMDA 1BXKA 2PH5A 3DO5A 1KETA 5A04A 3L0DA 2VQ3A 3OA0A 2X58A 4CL8A 4NK4A 1SBYA 1IL0A 5K6AC 2ZK7A 2Q46A 1UXJA 1VL0A 1X0VA 4BNZA 1SC6A 1AUPA 4XR4A 3ZV4A 3FN4A 2CVZA 4OSOA 5U1PA 3PHJA 3BXXA 1ONOA 2BGKA 3VOSA 2X0RA 5BQFA 2FR1A 4I5DA 3H3JA 4RVDA 3VAZA 1GFSA 3ZWCA 2VWQA 3M6IA 3NAQA 4MKXA 2F1KA 2X86A 3EC7A 3VC7A 4J49A 4GMGA 4TSKA 5DCWA 5CPFA 3MCVA 4OM8A 4MJLA 3GPIA 3PLNA 4RVUA 1PWZA 3W1VA 1QYVA 1GU7A 4XB1A 3DHNA 3ORFA 4GL4A 3FBTA 4CMIB 3WFIA 3ZHYA 1OAAA 1QMGA 1PL6A 7ADHA 4TKMA 1DDOA 2FSSA 1VSVA 2GPTA 3IMFA 1B14A 1O9BA 4BQRA 3ICCA 3OIGA 3Q6IA 3U5TA 2HLPA 3PI7A 4JJFA 2BH9A 4DMMA 1H6CA 1XHLA 3ZWBA 5I7SA 3ZV6A 4CMJA 4W82A 1GZ4A 2PD3A 3VDQA 1XYGA 3NRCA 4DL9A 5CDSA 1T25A 1GDHA 1LTHR 4YCAA 4E33A 3D4PA 1C1DA 1YL7A 3G1TA 4DQVA 2E37A 1SB9A 4BNXA 1ONPA 4XDYA 2GDZA 4XR9A 3ONFA 1I32A 3TZCA 5L7TA 3PXXA 3H5RA 5EPOA 1MB4A 2EXXA 2NTNA 4Q3EA 1NVGA 1XKQA 3E5RA 3UN1A 1UH5A 4F6CA 4GVLA 1IB6A 3JQ7B 5G0WA 4AJNA 4RV9A 1EMDA 5CDYA 3OICA 4F6LA 1A5ZA 4K26A 3ZV3A 1LSOA 1U3TA 1U8XX 3DBRA 1B3BA 4WOJA 1E1LA 5KJ6A 5A06A 1DFIA 3GGGA 3OBBA 4BB5A 2BFMA 4W6ZA 4NR0A 5BSEA 1EFKA 1DIHA 5ICMA 1DC4A 4B8WA 2HCTA 4WCDA 3VZRA 4DBZA 4GLLA 3LT1A 1GYQA 3KXDA 4IDAA 1YVEI 2BD0A 5JFOA 3D64A 3GNTA 3FD8A 5ER9A 4CMKA 5TJ9A 2XF8A 2ZB3A 1KVSA 4UEOA 4QSMA 5IAAA 3ANNA 2IYOA 1P1KA 4D3FA 3K2EA 1R16A 4YQZA 1UP6A 4Z9XA 2QRKA 3WGTA 4M8SA 2GF2A 1SNYA 3T4XA 5IDWA 4YR9A 3E1KA 4CLDA 3U9LA 1YB1A 2V65A 4F3YA 1EE9A 1E5QA 3CMCO 2FZEA 4IS3A 4YJHA 4I8XA 3WIEA 3IQDB 3PRJA 3GA0A 5L4SA 3S2FA 3ETEA 2DM6A 3DONA 3HN2A 4AJHA 5TNXA 3B6ZA 4LRTB 5HBRA 3TFOA 3OFSA 1UDCA 1N9GB 3SJ7A 3GMDA 3D4OA 4CUJA 3KYDB 3JTMA 1GZ6A 4PN3A 3QLJA 5IDQA 4WCFB 4HX5A 4KUEA 2J8ZA 3U4IA 3R0IA 4L8VA 4WKGA 1BDMA 3BMQA 1BXGB 4B7XA 5IXSA 3ADOA 1Z6ZA 2IXBA 3NTQA 2RHCA 1H9AA 4U8GA 1XQ6A 4BKQA 3NEPX 2BLLA 2NVBA 4W7IA 3BMOB 4WLEA 1DC5A 2RIRA 1K6XA 3PYLA 1QYXA 4CMEA 1HL3A 4E2YA 5CHEA 4OOFA 1P31A 3DAFA 4CM8A 3H4VA 4J4BA 4Q9NA 3KETA 2O2SA 4QFCA 3UCEA 2DUUA 1K89A 2AQ8A 4QT0A 4D46A 4YT4A 1ARZA 1LDGA 1H2HA 4NJOA 1W6UA 3OJOA 4X54A 4OH1A 1E7RA 5AOVA 3VH4A 4PRKA 2HK9A 2BGMA 4NMHA 4YJFB 1A9YA 4HV4A 1DSSG 3I9JA 1VLLA 2GYYA 4WE3A 2C5EA 5H83A 2H9IA 1ISMA 2GCGA 4HFRA 2ZTVA 4O5OA 4PLYA 4PGFA 5LCXA 4PLGA 1XR3A 4BO7A 3M2TA 1JVBA 4RPLA 2A92A 3VH1A 1X0XA 4WJZA 1CQIA 1NQ5A 3OEYA 4J1NA 3GG9A 4EYEA 1NPDA 3C85A 1O94A 2W2KB 1ZH8A 4DYDA 2DTXA 1Q7BA 1AE1A 2DPHA 1YBMA 1HEUA 2EHDA 2X23A 5EESA 5A05A 1GYPA 4BO5A 5A5EA 3INTA 3JQ8A 3NTRA 3MJSA 5F1PA 2FHSA 4NBRA 5BSFA 2I76A 3D3WB 3RKUA 3QY9A 3I9OA 4RORA 3RAJA 3GC6A 3GNSA 4BVAA 3C7CB 2H6EA 5B1YA 3I4FA 3GEDA 1A9ZA 1WDKA 3HDHA 3WLEA 1R4NB 3HFSA 3GZNA 1E6UA 5ITWA 3MJ4A 1JQBA 4M55A 4PZCA 4UUPA 1BWSA 1YOVA 1DIGA 2C07A 4YVFA 4OHUA 4N18A 4PLFA 4WNIA 2NU9A 4YRAA 1NNUA 2ZTMA 3RUAA 4B7CA 1VJ1A 2VHZA 3NT5A 3E9NA 3M1LA 1DRVA 3T4EA 3ENNA 5IN4A 1GUYA 4LCEA 1NAHA 3GPDG 4KWHA 4BMSA 3MOGA 3WYCA 1E6EA 1H94A 4ZQFA 4EDFA 4I08A 1YS4A 2NU8A 5KJEA 2H5LA 4EJMA 1MX3A 4ZN6A 4CV1A 5I7EA 3AY3A 3H7AA 3HSKA 4BNVA 1DRWA 4FB5A 4PLTA 2QW8A 1T1SA 4BNHA 3JQDA 4E2XA 1PJCA 3X2EA 1ML3A 4RF4A 3ULKA 2AG8A 1JKIA 3PGXA 4UULA 4FQ8A 4FFLA 2YQ4A 2BKAA 5JCJA 5F5LA 5ADHA 3KBOA 4PG7A 1PS9A 2EGGA 2I3AA 1HE2A 2B36A 2IODA 3AFNA 4JN6B 5IDXA 4M54A 3SXPA 4ALLA 2PD4A 4AG3A 2XOXA 3FNEA 2R2GA 4UUNA 4MVJE 4DQUA 1I3MA 4BL5A 2NVUB 3LF2A 1P1FA 3JD1A 3PJDA 5AVOA 1MFPA 4P8RA 1HDRA 1P0CA 3NT4A 3R3SA 1VKNA 5KTKA 1YKFA 1DHRA 1E7WA 3S8MA 3DBVO 5KJFA 4CPDA 4LSMA 2PZLA 1EZ4A 2ZTUA 1ZFNA 2GASA 3ZU4A 3GVPA 3U09A 1U7TA 4NU6A 2G5CA 1LLCA 1P0FA 3JQCA 4TRNA 4HKTA 2VTDA 3SVTA 3AFMA 4OKIA 3TJRA 4Q3DA 4KMSA 5KCZA 4BNLA 2B35A 3PQFA 2O2YA 3RUEA 2PK3A 3O8QA 4TKLA 2NV6A 1LDNA 2AQIA 4J4TA 1KERA 1QSGA 2ZJ0A 4LCJA 1SEPA 5ES3A 1DC3A 3TQHA 5JYEA 2UYYA 4D79A 4U7WA 1UXHA 1DLIA 4QX6A 1F0YA 2D5CA 2WD8A 5CEEA 2O7QA 5CDGA 2W90A 1Q0QA 2C5AA 1YO6A 4RVGA 4E3ZA 4D44A 3UVEA 2GNAA 3FRJA 5TIIA 4CMIA 2NVWA 4DPLA 2QRLA 3UUWA 4MINA 4WLFA 3QVTA 4BHTA 5FFFA 3INRA 3RBVA 4O0LA 5T5QA 2UUOA 1FXSA 2VRCA 2B5VA 3P2YA 1JKFA 3E8XA 4R68A 1T26A 5CEJA 3CIFA 4IUYA 2DBZA 4CQLA 1E5LA 2AMFA 4Q3NA 4RPJA 4MP3A 4RLHA 1IZ0A 5TT1A 2YHIA 4MPDA 4ALIA 3L4BA 3ZWXA 2JD0A 4P38A 4WLVA 2W8ZA 3LC7O 1ZJZA 2QG4A 2I9PA 4XJTA 3O9ZA 4KDFA 4PLZA 1S7CA 3DHEA 4MOWA 1HE5A 2Z5LA 2VHWA 3DMYA 5G2OA 5U4QA 1CJCA 1PJLA 4AJIA 2C2YA 4E30A 1ZCJA 2WE8A 2B69A 5G4LA 4NHEA 2AE2A 4AJLA 3JQ7A 3WYEA 4ZQEA 1ZXLA 4JQCA 5TC4A 1U4OA 1DFHA 4YT5A 1MP0A 3QIVA 4BQPA 2DQ4A 1C1DB 3COSA 4J2OA 5AXAA 1BGVA 1TEHA 4DC0A 1G1AA 4KUHA 3DTTA 2GN4A 1OBFO 1Y9EA 2Q2QA 4BNNA 1OMOA 2AXQA 1PGOA 2OUIA 1ISGA 5CDTA 3W6ZA 3QVSA 1KEVA 3PZBA 4O1MA 3DBRB 2JD2A 4ND3A 5BNIA 1VJ0A 2W2LA 3PJFA 1D1SA 3GY0A 5CAEA 2PD6A 2D59A 1I2ZA 3FR7A 3KEOA 1RPNA 4MDHA 4PZEA 4XEHA 3ZWNA 4CM5A 4BGUA 1UDBA 3L6EA 1TXGA 2WTBA 3PJEA 3Q9UA 2CF6A 5JAMA 1HDZA 1I24A 3OSUA 3PP8A 4DLBA 1YL6A 5L51A 1DRUA 1SMKA 3I9MA 2X9VA 5COQA 4CLXA 1J0XO 4IQGA 2Q2WA 4D41A 5JSFA 2J5RA 1HWYA 1A4UA 4FFPA 2EKLA 1YH3A 1OOEA 2HKIA 1NPTO 1ADFA 3BAZA 3ON5A 2J3HA 2XPCA 4R01A 1DAOA 1UR5A 3EY4A 3IUPA 4YQYA 3NX4A 2PGJA 3P5SA 3RKRA 4A5OA 1CRWG 3QA9A 3EDMA 1J6UA 3JQAD 3F5QA 2P91A 1Y6JA 4RZHA 1DJQA 4NJMA 3JQFC 2O50A 1L1FA 1ZEMA 1U8FO 2LDBA 4NU5A 4DUPA 3S1LA 1KEPA 1N9GA 5CPBA 2DBQA 1XELA 5L4LA 4I9HA 3V2HA 4YJHB 2ZYGA 1LX6A 1T2FA 1C0LA 2DPGA 3EYWA 4FCCA 3FBGA 4FJ1A 4YAGA 3JD2A 4CLOA 3KSZO 5HS4A 1HSZA 1WPQA 1MC5A 1X7GA 1WNTA 1B26A 2BELA 4ZGWA 1LDBA 1EK5A 1P33A 1LQUA 4D42A 5CEFA 3K9QO 4AJ4A 2VOJA 2H1SA 3HDJA 3ABIA 3K73O 1O0SA 4PIVA 1RYEA 1BXZA 1Y8RA 2JAHA 3VH2A 1UUFA 2X7HA 3VPSA 2FMUA 2O48X 3AOGA 3GVIA 1CERA 2VWGA 4L4SA 2QQ5A 3E9QA 5K6AA 3NDRA 1ZUD1 3LDHA 3LSYA 3ETDA 3WQRA 1LDMA 1ZW1A 1NXQA 4PCVA 1FF9A 3QV1A 3GAFA 3BHJA 1NASA 5C5IA 3L9WA 4CLRA 3GNQA 3DAPA 2X22A 4DLAA 4CM8B 5JCXA 2O3JA 2PWZA 1LEHA 3MJEA 1EQUA 4UEKA 5DULA 1K0UA 4NFHA 2HSDA 3V1TC 4D3SA 2C20A 3IAHA 3RC7A 5IZ4A 1PJTA 1ISHA 4WPGA 3WFJA 3RI3A 3ZHXA 4DBVO 1LRJA 1AHHA 2A35A 2R00C 2FPPA 4XJSA 1Y1PA 4FFMA 2J6IA 2DLDA 1MA0A 2B0JA 4HUJA 4NBUA 5EINA 5TJHA 4KUGA 8ADHA 5I7FA 1FDSA 2PV7A 1GCUA 1KC1A 4GKVA 1PGNA 2O3UA 4YRDA 4MO2A 1IPEA 1HSOA 4PG6A 5EIOA 1EUCA 4J91A 4HP8A 1Q1NA 1E1KA 2D1YA 2X4GA 3F5SA 3ZW8A 1PTJA 2LDXA 4L4XA 3D3EA 1P3DA 4Z0TA 3OIDA 3PDUA 2FY8A 2VUTA 3JQ8B 4TRMA 4HFJA 4J1TA 3CTMA 4YACA 3LT4A 3EVTA 4YT2A 2HMSA 4A0SA 4GGOA 4YB8A 1LRKA 1QXSA 2AW5A 4KTVE 2ZCUA 3OETA 1DHTA 5I9LA 3IUSA 3LLVA 3PPIA 1B8PA 1WXDA 4MVJH 3H5AA 2JHFA 2HMVA 2OXIA 2P9EA 1NR1A 1V8BA 1YOVB 2GGSA 5G4KA 4B4VA 3GT0A 4J0EA 4MKZA 1GV1A 4I5FA 1H0KA 1I5RA 2QYSA 2W98A 4B8ZA 2RH4A 3E18A 4XYEA 1ISJA 2RBEA 4G5HA 4AJPA 1GQ2A 4GVXA 4L0QA 2FOIA 2VHVA 3NGLA 4Z3DA 1R12A 4Y6PA 1A71A 3GZ4A 1Q7CA 3ZCXA 4I5EA 3AJRA 4ZHSA 1WLYA 2UDPA 4Q3AA 2AA3A 1LXCA 4GX5A 2QRJA 5AYVA 3TOZA 5I8WA 3U0BA 3ZZNA 3WLFA 1AN9A 2JCVA 2Q1UA 4CR7A 4CV2A 2RCYA 2XXJA 3D0OA 1LSSA 1YDWA 4UVGA 5KJCA 3A14A 1KVQA 3GMSA 4DIFA 3CKYA 3DZJA 3TPCA 1YRLA 1XDWA 2BFAA 2HDHA 1TT5A 1GYRA 5B37A 2YDXA 1C1XB 1AGNA 1M75A 2VWHA 4FJ0A 3OJLA 4DIOA 3X2FA 4MP6A 3HHPA 1ENYA 2Q4EA 1LU9A 3P2OA 3I6QA 1Q2XA 4R3WA 1H2BA 3NGXA 2BF7A 1HZZA 1RJWA 3C1TA 1GPJA 3MTJA 1QV6A 3KHUA 4HFMA 3EZLA 3CSDA 4L4RA 4N54A 1JKJA 4BNUA 3INGA 1HTBA 3GRPA 3H9GA 2EW8A 5DT9A 1LA2A 2FR8A 5H81A 2ZQZA 4R41A 4KQXA 2Y93A 5HA5A 3NDJA 2B37A 4WK6A 1VL8A 2AG5A 3SC6A 4EITA 1D4FA 1I2CA 3MWDB 5AXBA 1B7GO 1YB5A 4MVJA 4NFSA 3O26A 4TRRA 4CODB 2X5JO 2GERA 5F1OA 3O8QB 1U5AA 3I4CA 1ZK1A 2VYVA 1DAPA 2OZPA 3LU1A 3PEFA 1OFGA 4XB2A 4GWGA 2B4RO 1ISIA 2O4CA 2Y1FA 1LUAA 5JMPA 3GK3A 5GMOA 1DIRA 5B4UA 1VPDA 1VE9A 2AHRA 2YFHA 5CDUA 3CUKA 5EN4A 4ALNA 4MKRA 2C0CA 3AW9A 3NJ8A 3W4JA 2B5WA 1FMCA 3VZQA 4UREA 4CQMA 3F3SA 2GR9A 2EF1A 4JIGA 4OQYA 3TWOA 4CMHA 4FPXA 3VZSA 3GDGA 4A03A 3JCZA 3HZZA 4J7UA 3RC1A 2JL1A 5I9MA 3MJCA 4WOKA 5DOVA 4BO1A 1XLTA 4CQLB 3BTOA 4A2CA 2ILTA 3BA1A 2YHIB 4D3DA 2WE7A 2GO1A 4J9VA 5CFZA 1PJSA 1PZEA 1WZIA 5EQDA 4FOSA 3WGIA 3AOEC 3ZV5A 3FNGA 4KQWA 3KTDA 2VYND 3WTCA 3H5NA 1P9LA 2ZIZA 1YONA 3JQBC 3VZPA 4ND2A 1I2BA 3N58A 1E3SA 1UXGA 4JP2A 1IPFA 4AL4A 1B2LA 4R1UA 4U0KA 5IF3A 4BIIA 4KWIA 3OF2A 2GN6A 2A9FA 2PGLA 5JXWA 1ZSVA 2Q1SA 1TLTA 2JCYA 2GSDA 1T24A 4QECA 4RPGA 4HADA 4CUKA 1KBZA 1U3VA 1PS0A 1W4ZA 4W4TA 1PEDA 3GVCA 1OZAA 4IJVA 3KVOA 1GD1O 2P2SA 1NFFA 3MOIA 2B83A 4GLOA 4MIEA 3IC5A 1HYEA 1NAIA 4Y67A 4IPTA 3AU8A 1QV7A 4CM3A 1JWAB 7MDHA 3L4SO 1ADBA 3E9MA 4XQCA 1QYCA 1H6DA 3AM3A 5EMHA 3TSCA 1PIWA 3SC4A 4YJDA 2O7SA 1MG5A 2Q3EA 1EK6A 3BHIA 1D7OA 1K3TA 1HRDA 1DIAA 1DLJA 3E6AA 3PK0A 4AJ1A 1ZNQO 4L9RA 4TMFA 1EUZA 1J49A 3FNHA 1MXFA 2HO5A 1VKOA 1MXHA 4A10A 4BUCA 5BSHA 1EVYA 4N5LA 1DPGA 3EK2A 5IXYA 3WB9A 4FFOA 2PGDA 3BTVA 1IUKA 3QWIA 4CM7A 1MFZA 3PGJA 3RSHA 4NJMB 3V2UA 4FFNA 5KNLA 2PZMA 1D1TA 1YGYA 4WGGA 4XZ3A 2QZ9A 4OXYA 2WM3A 3UICA 1GZ3A 3K5PA 4II3A 4XDZA 5A3VA 4F45A 2EWMA 4EJ6A 4WLUA 5BSGA 1P45A 1WW8A 3C7AA 2YW9A 4CLOB 4EUHA 1ZK4A 1ONNA 1UP7A 1WAMA 4O63O 1DB3A 1RWBA 4NBVA 2DUWA 1G0OA 4OSPA 3IP3A 4P4NA 3MWEB 3UW3A 4RO0A 1PJQA 3BZUA 4RLSA 4Z0PA 2IDZA 2D0IA 1LDEA 3L77A 3PZRA 4R3NA 4PZDA 4LMPA 5I8ZA 2SCUA 3TZHA 1Y8RB 1PSDA 1Q7GA 2V6FA 3VTZA 4YXFA 3DZIA 3EHEA 3RUHA 1NTOA 1PWXA 3FPLA 1QYDA 5B4TA 2D3TA 2E49A 4D0SA 4DPKA 1FK8A 5A5FA 2O3SA 2Q50A 4CLRB 3JSAA 4NBWA 4QO7A 5TRTA 3H8VA 4KTTE 5B12A 2A4KA 2YHUA 2E6UX 4IDDA 5TS3A 2OFPA 1KS9A 1HXHA 2J3KA 2NWQA 3QQPA 3GUCA 4DIBA 3G1UA 5C7LO 4NZ9A 4J9UE 3S2GA 4BGIA 5T64A 1GUZA 4YJGA 5DOZA 4RGBA 4TROA 4NPCA 2EGHA 5JDIA 2I3GA 1XU9A 2WWRA 5IZCC 1LI4A 4KZPA 3AM4A 3DFZA 1T4BA 1TVEA 2ZCVA 1JA9A 1RM4A 3OQ6A 1C0PA 4XQ9A 2Q49A 3ONDA 3V2GA 2BRUA 1YB4A 4QQRA 4U5QA 1Q0HA 1BG6A 1E1NA 1H5QA 3H6KA 4KDEA 4L73A 3LC2O 4ZA2A 3EMKA 2NUAA 3H2ZA 2ZB7A 2Z95A 5L7WA 4FDAA 1E3IA 1GUFA 1E7YA 3WNQA 3OHSX 4JP3A 4YBZA 3HJAA 1XSEA 6ADHA 2X8LA 3ZNPA 5G4KB 1EVJA 3TZQA 1H6AA 2CY0A 2PZJA 5JCJD 4IZHA 3KUXA 3KEQA 5L9AA 1HDOA 1E6WA 2OGUA 1W8DA 3ZU5A 4Y98A 4XX0A 2DT5A 1EFLA 5HS6A 3WWYA 4AICA 4B7UA 3A4VA 4JCOA 4B3JA 2Y1EA 4IMRA 9LDTA 1Y5RA 3RFXA 3ZU2A 1O5IA 1E7SA 4IJKA 5DP1A 1B0AA 2OO5A 2JFFA 3JYPA 1HLDA 4J43A 4GGPA 3ICPA 4M87A 3U62A 1PJ4A 1Y5MA 4Z0HO 3DEYX 3K2BA 5JW6A 1NR7A 5FI5A 1SAYA 3I9NA 1PGJA 4E4YA 4PG5A 2VNAA 1VC2A 4TRJA 4XYMA 5COAA 1U5CA 3DHYA 3GQVA 1C1XA 1UDAA 3QW2A 3JQ9A 4OIMA 4QFDA 3F9IA 2B4QA 4NNJA 4M1QA 3JYLA 1MV8A 3JQFA 3B20A 3OA2A 3U4HA 3V8BA 1J5PA 4E0BA 3D1LA 1JW9B 3P7MA 3ROPA 3UFXA 4I1IA 1TT5B 3PYXA 4K28A 4DVJA 1JWBB 3KYBA 2PNFA 3EZYA 3GG2A 3GN2A 3RCBA 3NDIA 3RROA 3HQ4O 4BKOA 3QSGA 4BNGA 4CL3A 5JBIA 3HNPA 2JFHA 2DTEA 5F3RA 2YUTA 1EUDA 1HDGO 4YAEA 1TI7A 4BNWA 1E3JA 1L7EA 2WJPA 1CDOA 3JYQA 3ZW9A 3LLSA 5F21A 1X1TA 4IDBA 1PR9A 2YQ5A 1N92A 3WDSA 3QP9A 3C8MA 4LK3A 5JAQA 4BO6A 1MLDA 4C7JA 1YE3A 5IJZA 3QJ5A 4OXKA 4ZQGA 1ZK0A 1VSUA 2NM0A 4FSHA 1IYZA 1IOLA 3F4BA 2IRWA 2VRCD 4EZBA 2HRBA 1QP8A 1LDYA 3RJ9A 2W4QA 5G0UA 1A7AA 2CDAA 3L6DA 5T67A 5GZ1A 4O6VA 5ILGA 4K6CA 4XIJA 4EGFA 1R37A 4QTZA 2XAAA 1PU2A 1K6JA 3LC1O 4D43A 4L76A 3A1NA 3ZI0A 2Y0DA 4MVJG 5A3JA 4RQTA 3IJRA 1LC3A 4CM9A 1YL5A 3QWHA 4NDNE 4G65A 3LZ6A 1OI7A 1V35A 1GL3A 4IS2A 5TQVA 5JDCA 2R00A 2ZYDA 1JLLA 1U9JA 1ENPA 1CF2O 5JDIC 1R66A 2FZWA 1F8FA 4I5GA 5A4DA 4A27A 1SPXA 4CQMB 2PKQO 3AUSA 1XIVA 2P4HX 4RCVA 1M6HA 4S3MA 4DWVA 3IIEA 1BW9A 1ENZA 3DDNA 4PG4A 2OHXA 3B1JA 3E03A 4DA9A 1E3LA 2EJWA 1M66A 4C4OA 6LDHA 2GLXA 4JBGA 1UZLA 2I65A 5A9SA 3WGZA 4FN4A 3LK7A 3C1AA 1B15A 5C3MA 2IZZA 4RPKA 4XRRA 5JO0A 4JJGA 5JC8A 4ZVVA 2GN9A 2JFGA 3RU9A 1YQGA 1UP4A 1NWCA 3NKLA 2PFGA 4MVJM 4BGEA 1U7HA 4LRSB 4JBHA 1M76A 1NHGA 4P4LA 2ZYAA 1V3VA 2I6TA 3OMLA 1K5HA 3QVXA 3SBOA 3UOGA 2C7VA 1DJNA 2HAEA 3LT2A 1GADO 1PJ3A 1ZBQA 4P4GA 4BS9A 4R69A 1TA4A 5L45A 4R51A 5KJ1A 3AU9A 5DZSA 4DREA 1HDCA 2R6JA 3PQDA 4BO2A 3H9QA 3VKVA 4XIYA 4UVEA 1EVZA 4E5NA 3BMNB 3I3OA 4R9SA 1NPYA 2I5PO 3ZHBA 3ANMA 3EAGA 4IQ0A 4PLCA 2OBNA 2FPIA 1NX6A 1PZHA 3GH3A 1TB4A 3KV3O 1E7QA 1QRRA 3V1UA 4AFNA 4YYZA 2BI8A 2DBVO 4R4JA 1J4AA 3DBHB 5I7VA 4E5YA 4CV3A 1BMDA 1HE4A 2DFVA 3WBBA 1A4IA 2F00A 3I9KA 3JQ9C 4AJKA 1YJ8A 2WMDA 1NVMB 1D8AA 2HU2A 4HWKA 3HWRA 1TT7A 4BO0A 4CM4A 4RJTA 3TL3A 3DQPA 3PWZA 2D8AA 4OXNA 4FGSA 3RWBA 3PHGA 3PHLA 2NTJA 3QWFA 4CR6A 1LQTA 3GLQA 1LSJA 1H9BA 4ZQHA 1NFRA 4GH5A 2CFCA 5G0VA 5MDHA 3KYCA 1KC3A 4JXKA 3DC2A 1P1JA 1EBUA 4E5PA 3U4DA 3WGHA 1XEAA 1QKIA 1DXYA 2QZZA 1T2EA 3ZWOA 1XA0A 5KVVA 4Z9FA 3WSWA 1C0IA 3H2SA 3ZN2A 4J2HA 2WYUA 4IXWA 3DZBA 5KKAA 4Z3KA 3M2PA 5I9NA 5LDHA 1GQYA 5A02A 4OYRA 4XYBA 2VZ8A 1XCBA 1N7HA 3W8EA 2HJSA 1ENOA 3JQAA 2Y1GA 3GAZA 3CMMA 3GOHA 1QR6A 4PRLA 2DU8A 2D4AA 1UAGA 4RDIA 3KOUA 2V6BA 3HFGA 3H3FA 1ULUA 3HB4X 2PH3A 4KOAA 4FIZA 4IY1A 3DZFA 3KRTA 3UH1A 5T8KC 5LDGA 2FWMX 2VOEA 2PR2A 3F6YA 5JDCC 1P1IA 1YBVA 4IGEA 4BKRA 3UKOA 1ZMTA 1PQWA 2OMEA 2X1HA 2Y1OA 4YJGB 2ZB4A 4GX1A 1HKUA 4EW6A 1CEQA 1PZFA 1X14A 4EUFA 2GZ1A 3NYWA 4QO8A 5CG1A 1QG6A 2NQTA 4IDFA 5FI3A 4BMVA 3R3JA 2GD1O 1N1GA 3U49A 1S6YA 1E3WB 3RUDA 4R5MA 3WGOA 2QHXA 3DFUA 3DB2A 2OP1A 2NQ8A 3PWKA 2H63A 2D5AA 3QHAA 3KSUA 4XGKA 5DBFA 3AOEA 5DCYA 1WMAA 2J3JA 4IINA 3WQQA 4BNTA 1VRWA 4OL9A 5IFLA 3IS3A 4CLEA 1ADGA 1NFQA 3E48A 2X9NA 5HRUA 3FPCA 3JQBA 3LQFA 5TX7A 3F47A 3Q2KA 5FWNA 1GTMA 1Y9AA 4TVOA 2X0IA 1Y7TA 3G3EA 3TL2A 3ST7A 4GX0A 1LNQA 4XQGA 3EW7A 4RPHA 1V3TA 2UAGA 4N7RA 4ALJA 2CDBA 4ZD6A 1U1IA 5KIAA 4NFYA 1EEHA 4F46A 2PY6A 1RM0A 3JQGB 1NWHA 3WGYA 2X0JA 5ICSA 2UV8A 1IZ9A 4M86A 1AXEA 5DN9A 4XKJA 2NU6A 5KVQA 1JTVA 5EERA 3RJ5A 1VL6A 2YZ7A 3WG9A 3CZMA 2IZ1A 4IXTA 1T1RA 5THQA 1LRLA 5JY1A 3KSDO 3TOXA 2AEFA 3QVWA 5IG2A 4M49A 3LT0A 1NBOA 5THKA 4CJXA 3FCOA 2E4AA 4WLOA 3NUGA 3HB5X 1H6BA 2J5QA 2JJYA 2EV9A 4PLWA 5KVSA 4FS3A 1U3UA 3C1OA 1R0SA 3BMOA 2VT3A 3R6DA 1EQ2A 2DAPA 3TRIA 1V9LA 4LVCA 1AHIA 2C2XA 3AUTA 3JD4A 4IGFA 3RBXA 4E31A 1HE3A 3HDYA 5GZ3A 3IDSA 3A28A 3HE3A 3DZGA 2J5KA 1MG0A 2CVOA 2CF5A 2GZ2A 1DC6A 3FNFA 3VVBA 3W8DA 2OBYA 2C59A 4EI2A 2O3TA 3DOCA 3V5NA 4K6FA 4EEZA 3SLGA 1GR0A 4JROA 4B4WA 1Z7BA 1QLJA 1R4MA 4ROSA 1JAYA 4BB6A 1B3RA 5ENVA 3UXYA 1IHYA 4EEXA 3ZNNA 3WMXA 1QORA 5EL0A 1W0CA 3PHIA 3M1AA 1N8KA 3ADPA 3ONEA 1P44A 4OOEA 2PKQP 2VUUA 1PZGA 1QLHA 3CINA 4XYGA 1PR3A 3DR3A 3OJFA 2NU7A 3I52A 1FDVA 1SO8A 3W8FA 3GGPA 5JE8A 3RD5A 4R1TA 1CETA 2P9GA 4FBGA 1SEVA 1WDMA 2QIOA 1ZMOA 3O4RA 4GKBA 5L7YA 3W6UA 1IHXA 3ZWWA 4J0FA 3PWSA 3DZHA 2C82A 2YDYA 1KVUA 1NHWA 1RKXA 5BT9A 2FP4A 1F17A 4DLLA 3STHA 3S55A 4HBGA 4BNYA 3BMCA 3JD0A 3PJGA 4WEQA 3H9JA 3O38A 1FDTA 1YXMA 3AI3A 1SB8A 5TGDA 1I8TA 4R5HA 3DXFA 5JAIA 5BNTA 3OJEA 3GDFA 4J1QA 4MVJP 4BV9A 4BOYA 3CXRA 4IDGA 2B4TO 4M89A 2VT2A 5IZCA 1UZNA 4BNKA 2EJVA 4FC7A 4R1NA 2Y0CA 4B4UA 3EUWA 2PTGA 3WWZA 3DOJA 2WDZA 4CM6A 1BW9B 3BHMA 4IQ8A 2NTVA 4N5NA 1P74A 3ASUA 3DMTA 4YAKA 3HDQA 3WXBA 3UAGA 5A9SB 4NK5A 1GY8A 2I67A 4FOOA 5A03A 1VM6A 1IULA 2AQKA 1WWKA 3WQSB 1R6DA 4ALKA 3JD3A 3ZWPA 1LSUA 4UVHA 1T2AA 4DMLA 4C7KA 1UXIA 1VI2A 1UZMA 1KYQA 1ZSYA 3SLKA 4PVCA 3BYZA 4A26A 2CDCA 5KKCA 1DBVO 1OC4A 3WOHA 3ZNOA 1I10A 2DVMA 1LC0A 2G76A 1HF3A 2I66A 4XRGA 1YDEA 1XQ1A 3WNVA 3BMNA 4FJ2A 3LF1A 3GVXA 3OJ0A 4OO3A 1C0KA 2YV3A 5AQ1A 2HK8A 1PQPA 1R0LA 2CSUA 3BTSA 4BO4A 3IKVA 2X5KO 1HYHA 1KVRA 3S2IA 4KP7A 4BO8A 1EDZA 3DBHA 2D2IA 5HWSA 3OECA 4MVJI 3PYMA 4Y8VA 2G1UA 4RL6A 1O89A 5C7IO 2HMUA 3H9UA 2VYNA 4AJ2A 4JNKA 3CZRA 3LYLA 4W9NC 3KM0A 1Y8QB 2YY7A 1KY4A 4DPMA 4H16A 2E48A 1O95A 1ZIDA 5IDYA 4ONEA 4PVDA 4WECA 1I01A 3WIDA 4NQZA 3LVFO 2RH8A 4YWJA 4E6PA 2EERA 1CWUA 3RBZA 4J4HA 4J6FA 4UEJA 3RASA 4CM4B 2VTEA 4YAIA 5MGBA 3PIDA 3Q11A 2JCXA 4NIMA 3ZGYA 1E92A 1GEGA 3NTOA 4LSWA 4NBTA 2P9CA 2WSBA 3U4CA 3F1KA 3PDJA 2Y0EA 4TVBA 3GR6A 5L4NA 2BMAA 2EW2A 3MTGA 3EVNA 1KEUA 3KYCB 5BNFA 5K9ZA 4CM1A 5JS6A 3AY7A 4J16A 1XG5A 3ROKA 4XGIA 3QVOA 3HADA 2P5YA 1CQJA 4CLHA 1ZSNA 1NVTA 3Q3CA 4YEDA 3WS7A 4XQEA 2V7PA 4GPD1 4YT8A 1F06A 4IIUA 2HK7A 4RVSA 5EQFA 5L40A 2NNLD 3FWZA 4RVFA 4IBOA 4G81A 1LLDA 1O8CA 3L6OO 5F5NA 3GHYA 2HUNA 4DRYA 3CPSA 3R1IA 3JQAB 4TZTA 4CV0A 3L9XA 3OEWA 4Q3CA 1BDBA 2AEMA 2O4UX 3ANLA 3ROQA 1EVIA 1ZJYA 2YV2A 3N7UA 5JY6A 2BI7A 1YWGO 2CMDA 1N7GA 1A27A 1IY8A 3RC2A 5KVCA 4IJUA 5H82A 4PG8A 4IMPA 3SX2A 5TT0A 4IM7A 1FJHA 2ZJ1A 5CG2A 1KIFA 4WASA 4AJJA 3CH6A 5G0SA 4J90A 3Q2IA 5A9RA 1BHSA 1ADCA 3GFBA 3ZNQA 3IJPA 3ZWVA 1E3WA 1EDOA 3ZH2A 4ZQBA 1BVRA 1I33A 1IE3A 5FF9A 2QYTA 4R9RA 4E5MA 4Y6SA 3ZDFA 1G0NA 3A06A 3DMTC 3CEAA 4D45A 2Q2VA 2JD1A 4XD2A 2VHXA 2O23A 3WBFA 5AXCA 3OIFA 4UAGA 4YRBA 4BMNA 3UF0A 2CZCA 3K8ZA 2I99A 5TLSA 2ZKLA 1I30A 1ZZEA 4E21A 4FD3A 4ALMA 3TF5A 5JPIA 4PLPA 1DFGA 5K0ZA 3JQGA 5LC1A 2WD7A 1I3LA 4U6SA 1HZJA 2PZKA 4BKPA 3TZ6A 4HNGA 3WTBA 4B3IA 1Y81A 1KY5A 4XWYA 1NQAO 3ZU3A 3VPFA 2X6TA 3UHAA 5ER6A 2IEBA 3BIOA 3QE3A 5TSDA 1DO8A 3RIHA 1I0ZA 2Q1TA 1GAEO 1HYGA 5F1KA 4E2ZA 1E0DA 2A94A 5L95A 4WUVA 1DIBA 2EP5A 1YJQA 5JMWA 1PL8A 2XXBA 3GEGA 4R16A 5COBA 4Q3BA 4Z9YA 3VTFA 1B16A 2GUGA 3JQ6A 4NH4A 2OL4A 5DNAA 3ITKA 1ID1A 1PQUA 3IP1A 1T4DA 2Y99A 1N5DA 4J7XA 4ZRNA 3EGOA 4GX2A 3UCFA 3L07A 4K1LA 2VUSA 3RVDA 1V6AA 3KLPX 3GVHA 1WP4A 2HJRA 1PX0A 2IZ0A
chains in the Genus database with same CATH superfamily
5KKNB 3E4CA 1JDJA 3DMNA 3TVDA 1ATIA 3FJOA 2DULA 1UJMA 2ZJOA 2E3JA 1M2JA 3I9LA 4RF3A 1N5LA 2NSDA 5CJJA 3ZK9A 5A1TA 5AVKA 3TTWA 2ZUVA 4ZO7A 1ZK3A 1Q6YA 2QPLA 1U4SA 1QIDA 2ZR7A 3LKVA 5GGXA 4BNMA 3EZ9A 2XZDA 4BN5A 1NSYA 2WQ6A 1IPHA 4HAIA 4NI5A 3HFRA 3G0IA 3SJUA 3F46A 2CLDX 4G3XA 5LD2B 2JAUA 3K94A 1SKYB 4B3FX 4BTLA 5FQOA 5L53A 2Z5FA 3F2VA 5BQXA 4DLPA 4J16C 1EGVB 3G59A 4PR3A 1C7FA 1GRCA 1T2CA 1XI2A 3BHNA 3IIJA 4EA9A 1KOGA 1JQJC 4H15A 4EATA 2HLNA 1QK5A 4JKYA 5AR1A 2PUEA 3D7KA 4NBKA 2CKMA 2VJNA 4RMHA 5FAKA 1J24A 1K8ZB 4HFNA 3V80A 1JKMA 3I37X 4D56A 4G1VA 3H0EA 3VV3A 1K88A 3IHTA 3RNOA 3NHPA 1EJ6A 4BNIA 1N78A 3GA7A 4P08A 2UUBB 1AMUA 9LDBA 2B98A 2I91A 2HBZA 3FR8A 1NP3A 3K8QA 1CIVA 4LTNA 3PIIA 3G0BA 1F60A 5T6BA 4OCZA 4D92A 5EJ4A 3OCJA 2QORA 5A9TA 4Z4EA 2Y0BA 1YKSA 3Q9NA 3SE0A 2AN9A 5JZ9A 2WJAA 1V1JA 1SCUB 5B64A 2FSVA 1FDUA 3A4NA 3E82A 3I34X 5FYDA 4Y2JA 4E09A 2HF9A 4MVJF 5JCOC 2XUJA 1AGRA 4ZYUA 4C2TA 1QFZA 3HYSA 4LGCA 2JAPA 3EDYA 5T8KA 2C7BA 1M83A 2N3ZA 2IPMA 3K96A 5G0TA 5KTPA 3ZWAA 1U3DA 4EFNA 3IBYA 4E5UA 3V4PB 4MRNA 3D02A 4KLZA 3BMCB 3HXOA 1N6RA 1W4AA 1ZKMA 3KFVA 4ND4A 3VHRA 4I2NA 3TLXA 1H05A 4ARUA 1AURA 1CJVC 4YH1A 1PLJA 1NBMA 1QHIA 1J33A 1YCGA 3C3DA 4NCXA 1IMJA 3SIXA 3V8EA 5K8JB 1GHTA 1U2GA 3EGCA 5EJ2A 5EJIA 4IJ5A 4FINA 3AGPA 4PQEA 3NC4A 3PHCA 4HLNA 1D4AA 1XMQB 5EIHA 1BRMA 3LXUX 1WBBA 2GRAA 3V34A 1F0PA 1QH9A 1Z82A 4D9CA 3QFSA 4HDMA 4E03A 3UWDA 3GLKA 1EE2A 2QRVA 2QN8A 3HMQA 1BVUA 1Q1EA 4MAMA 4ZICA 4AIIA 2XT9A 1VG9B 5DH9A 4A73A 4JOCA 5IBPA 4PYRA 1BOOA 1N0IA 4PIMA 3M70A 2B4KA 5DXJA 4HNAB 1JBKA 1QZZA 1YU9A 2UVQA 4X97A 3WYBA 2J0UB 1VCNA 3TE7A 3D7LA 5IFKA 1DBPA 3HXMA 4GNKA 4FZ3A 2BHLA 4I1SA 2C9BA 2ZFUA 2FWRA 1J00A 1KO7A 2AJ8A 3JWPA 1A7KA 1L7XA 3N6XA 4XI9A 3FZGA 3H2BA 4F8EA 5EIXA 4IZIA 3E5MA 1N9ZA 5LUBA 3CHYA 2Q6TA 4ZREA 4EPRA 2HMWA 3KSBC 1JLRA 2Y66A 1NXPA 4RD1A 1T15A 3HGTA 2ZZKA 4A16A 1GQQA 2PUHA 1MAWA 4BNJA 3MJTA 1ZXBA 1YGPA 3QWAA 1UQTA 4DR6B 1NNSA 1MUUA 5JO9A 4D0RA 1Z7EA 4J1SA 1PJ2A 2XE8A 1ZD5A 5B6IA 3WWPA 1L8AA 4IYRA 3GUYA 1GZ5A 3C3XA 4IIXA 3BWDD 4O59O 4AJEA 4AXBA 4GWKA 4K8OA 3ONNA 4BO9A 5ILQA 1AIPA 2JBAA 5B1HA 4E32A 3T0FA 4B0OA 1R0KA 1R2QA 2NUBA 3EXHB 5AKIA 3NXKA 5GY7A 3SJZA 2TYSB 3C7DB 2YS6A 4MI3A 5IAJA 3A37A 1Y8QA 4ESOA 1M67A 3I0NA 6NULA 5KTMA 5EWLB 4MICA 1W0KD 4RZQA 3OCYA 1WMFA 3NHBA 4W63A 2DTDA 3UG7A 4HN4B 3W3AD 1EWQA 1X92A 2E55A 3LVBA 4BGVA 5BO5A 3IL2A 4DGSA 1WU8A 4RKWA 4BPBA 3B9PA 1CPYA 3ZDRA 2CXOA 2PYZA 3I3SR 3NVKI 3E3NA 1E3EA 3L1JA 4H3VA 2R96A 4G0NA 4OBBA 1SUEA 2C29D 2BFFA 3NH9A 1D3AA 1HE1C 4KQ6A 2AC2A 3L1VA 1FXUA 2AD5A 3K0FB 4URFA 1U7UA 3T7RA 3Q3JB 4JU9A 1MPTA 1UPXA 4WW0A 3T7EA 3WY9A 4CMGA 1OQAA 1B8UA 1N2BA 3DOOA 5FJIA 2QSUA 4MR8B 1I36A 4R8SA 3FMIA 4FFRA 1XZDA 3D5QA 3UT5A 2W5UA 3K4PA 2Z9BA 2VBFA 1IN8A 1QVZA 3ASVA 1T34A 5HUJA 5FTJA 2VJPA 1FP1D 5DFAA 4C5AA 4NULA 4ETMA 2ISQA 5KEIA 3W5JA 4TTAA 4LE1A 4LZPA 4ENTA 3PXAA 4WK0B 1N1EA 3EN0A 2C2GA 3WR5A 3KYDA 3BXZA 4GYJA 4RKQA 3ANTA 2G7ZA 4LQDA 1Z4IA 5K0TA 3LUFA 2Q5IA 4GOND 4WCFA 1W73A 1AXGA 1RXCA 1TZMA 4ND5A 4AG5A 1MC4A 2RFLA 3VMMA 4NBSA 4W7HA 5EXPA 4FW8A 1Y5IA 4KN5A 2Y68A 4BV8A 1P5FA 3NPAA 1WD5A 2J5XA 3IQWA 3O93A 4FHEA 4L0CA 2XTAA 5ICGA 4J0QA 4LJSA 4YMVA 2CVQA 3V4OA 2ZG6A 4G01B 4X1KA 3STTA 1Z34A 2XQIA 3DE6X 2XJ4A 3P20A 5K45A 4ILEA 3PTZA 1BKSB 3GJ6A 1YBAA 5BUSA 4C0XA 1DDIA 2RBGA 4QUHA 4WIAA 1D1PA 4X7MA 1C4KA 3EUEA 4UHEA 3PDIA 4H1TA 4GI3A 1OLUA 1O6ZA 2HBRA 3B6IA 4XLLA 3PDHA 1XWFA 4CCSA 3CF4G 2JIZD 1BQ4A 1VMAA 4A2QA 3R7FA 1FFBA 3JPYA 2JJQA 3NBUA 5DTEA 2V96A 1E9BA 2WYVA 1RQGA 1FX0B 4BLPA 1V7QA 4NG5A 1KHHA 5CFQA 1U2EA 1X7DA 3CLUC 3D7RA 2YYSA 1LFDB 2PA3A 2AQHA 3D4NA 5DCUA 1U65A 1BEZA 3N74A 4PANA 1C3VA 2AEJA 2IYPA 4II2A 4L75A 4LZOA 3KFXA 4ZDKA 4C4YA 5KOJB 2DFTA 1GPNA 1MGOA 4YCNA 4BQEA 2ZKIA 4DNOA 2C9CA 5D5QA 4D96A 4QC2A 1V8OA 3B9QA 2GH1A 1X7WA 2YNMD 2AFIB 4DUGD 3OLQA 3A9UA 2RHRA 2FN9A 3C3CA 2ZJZA 5DU2A 4E3WA 3REQB 1B6SA 1A5BB 1DOHA 5JQWA 3TW8A 3NBZC 1ODIA 1MJFA 3AI2A 3M3DA 1ONBA 2VRBA 1XB2A 3G2IA 4N0MA 5KAPA 3CA8A 3MBOA 1RLIA 1J0DA 3AEQA 4J0GA 3L4BC 4QXMA 3RGGA 1SOWA 3HXLA 1ZK2A 2AC4A 3LNCA 3DLBA 3BTUA 5ILOA 4IAOA 1JAZA 3E23A 1FB5A 4KDCA 3T3EA 3UUEA 4B4DA 5JD4A 4HNHA 1NM5A 2ZR0A 1AS2A 3D8TA 4Z4FA 1L2TA 2XB9A 2XDYA 2CUKA 3KJHA 4P3PA 3R7LA 4F2PA 2Z4TA 4G0UA 2YINC 1PG2A 4GQAA 3E7FA 3S3TA 1L5VA 3H65A 4TV8A 2PWPA 2JC3A 4BGDA 4PC6A 5CLLA 1CF4A 2F8MA 2GS9A 4CM3A 1R00A 5AVSA 5DWDA 2H7VA 3F6EX 1L3CA 4N12A 1A77A 1GKLA 2PX4A 4YPOA 3SVLA 2Q9BA 2C94A 2VPTA 2WF9A 1Z74A 2I87A 3DP7A 4J3JA 4BQFA 4YX9A 1TCCA 1G8JA 3CVVA 5HM8A 1NUAA 4RZ3A 3OM9A 4Q16A 1AG9A 4TSRA 3CNOA 3BL6A 3W4IA 2HC9A 4WLNA 5JYDA 4JV5B 2WAMA 1TFRA 1DXOA 1C14A 3UC9A 4X1OA 3WJ7A 1PT5A 1AF7A 4DNFA 3RHTA 2PJZA 1YQDA 4ZT4A 1XCMA 5ARBA 2JJ8A 4ZVQA 3U1TA 2WNIA 2WZBA 4UDXX 2RGWA 3UHPA 4CUZA 1E0KA 2QSZA 3O2JA 1UFRA 3AR9A 5JNLA 1CYDA 4ZVLA 3O03A 1WBDA 5REQB 2CD9A 1GOTA 3L4JA 4LJ5A 2WKPA 3AESB 3H5IA 1F3OA 1M8FA 3NBXX 3SSOA 3ZWMA 5K7SA 3RAFC 2RHGB 3EYAA 4W5OA 2PLWA 4JJ4A 2IWRA 4J29A 1NQOA 5B6PA 1GCGA 4G24A 1TGYA 3CU5A 3HY4A 5BV0A 4I1YA 4EUEA 4Y18A 1Y7IA 2DP4E 3BFKA 4RF2A 1JFSA 3CZ4A 2WF5A 1RYDA 2IEAA 3WJAA 3CLKA 3A6GA 2Q5JA 2LCQA 4GEGA 1N5IA 2ZQ5A 2FX2A 1RE1A 3LAWA 1VA5A 1MJNA 1XRRA 3RG2A 4I6JA 4GWLA 2VKTA 2EKPA 2HJWA 2OB1A 3IA2A 1OU4A 1WXXA 3IEMA 3U7FB 4C6HA 1EGAA 1QZXA 1TUBA 2L18A 1F4VA 3FLBA 3IPRA 4L57A 2H2DA 2VYVD 4ZAFA 3RC9A 4UBKA 2XSZA 3W5BA 3EWSA 2BH2A 4G0VA 2AT1A 1AZLA 2VF2A 3QX7A 4MI1A 3C7TA 5CP8A 2QYHA 4Q6WA 2XB4A 2OD9A 3L7DA 3LLMA 3R5JA 4CIDA 2DWCA 3KR1A 3VKGA 3KLMX 4AO6A 4B3CA 5IK2D 4FB4A 3WWEA 3A9TA 1Z12A 2OM2A 4E6EA 1U2DA 2WPNA 3DBLB 4G4IA 4HDOB 4CWAA 1CX9B 1JFLA 1Q3HA 3VH3A 4AVYA 4BTEA 4CQMD 1JDZA 1PYGA 1SCUA 1XMVA 3S2EA 2Z57A 2TMDA 2O9JA 3E9CA 5AW1A 3E05A 3EPRA 2PSFA 1SURA 4W5JA 2H1OA 1ZD8A 3OA0A 3MUOA 4NK4A 1RAGA 5DHAA 3RVQA 2V9CA 4WKCA 3TL3A 2ZK7A 2OTCA 5HMMA 3A58B 1VL0A 1QGOA 3H42B 4FHFA 3A7DA 3AMVA 1AUPA 4XR4A 4FDTA 1JSZA 3JW8A 4XGQA 2BGKA 5JVDB 5B7GA 5BQFA 1VE1A 2FR1A 4I5DA 3H3JA 2XGSA 3VAZA 2YIDA 3IE1A 2VWQA 3M6VA 4U9IS 5BVHA 1TIPA 4QJ5A 2CLKB 4MKXA 3NAQA 1QF9A 2J07A 5LIPA 4ZGBA 3S7TA 4ER7A 1P8AA 3EC7A 4XIFA 1H3EA 3V4VB 4J49A 3AJAA 3EWNA 4GMGA 4TSKA 3L6RA 3WZMA 1T1EA 1L1EA 1TYZA 2Z2XA 1MO3A 4OM8A 5CPFA 5LA6A 1G18A 4B6PA 2WU3A 5AW7A 1QYVA 2D5IA 4ZEOA 2J0UA 3DHNA 5DTMA 3QTTA 2CMHA 4HDQB 3FBTA 2OR3A 2X0FA 2JEOA 3KELA 1OAAA 2OC9A 4L5JA 4FHCA 3BFXA 3F78A 1CZRA 1DDOA 4LJ9A 3FFXA 4C7BA 3TL6A 2C5GA 3KXPA 4WCVA 4BWGA 2RGNC 2WSMA 3FCEA 3SIPA 3N2LA 5EWJA 3Q6IA 3E8SA 5FT9A 3RIYA 4CF5A 1N5MA 3PI7A 1UK7A 4EIWA 4JJFA 3Q0IA 5CR9A 2V98A 2ISCA 4ZANA 4ME6A 4YPFA 1WSWA 5K0ZA 4DT1B 3BB4A 4RD6A 4Z7QB 5C32A 3TM5A 1CFJA 2PD3A 4IP0A 1LD3A 4H1VA 2G06A 3HWWA 1J8FA 3P94A 4DL9A 1T25A 4HS4A 4BP8A 1T35A 3C3AA 1C1DA 1KKLA 2ABWA 2AJLI 4HB0A 1W46A 3TMYA 2HDNB 3BWYA 2NGRA 1I32A 1WW2A 3ESDA 2RK3A 3PC8C 4QJ4A 2EL9A 1CJSA 3AR2A 4KSYA 4ARBA 3MG9A 2GZDA 2H57A 3OLYA 5JG7A 4EEKA 4F6CA 2C8KA 2PMKA 2FH5B 4BQOA 2KBFA 4YJKA 3R0JA 1O95D 1DKPA 3DSRA 4ROTA 5AKXA 1BH2A 3GO4A 1U3TA 2EKZA 1WS6A 3DBRA 2PPVA 3EQZA 3L0CA 2FCRA 3VHQA 4XM2A 3D5EA 3FSGA 4NCKA 5THXA 1APBA 3DB1A 4ZYYA 1CUSA 3LKBA 1QRUA 2R87A 4B8WA 2ZVQX 1IY2A 2SHKA 3LG2A 1GYQA 4PHTA 1PJAA 2HW8A 3MB5A 2VDRB 1PNTA 3FD8A 4LBZA 4XD7D 1O8BA 1U6JA 1YC5A 3K0FA 3I6YA 1XJ5A 2ZB3A 3R0QA 1YJBA 3CWZA 4DHEA 3CPEA 3HDGA 5HHTA 3L06A 4RXTA 3TD9A 3ANNA 1D5CA 4RH0A 1NVXQ 1OV4A 5HIIA 2IYOA 1P1KA 1V6SA 1C9NA 1R16A 3ZDEA 3ZTTA 4Z9XA 2QRKA 3N59A 4UNNA 4BRWA 1QVRA 3IQZA 1Y1SA 4GPZA 3RANA 1Y98A 1TRHA 2CJWB 2HJ9A 3UY4A 4Z4QA 5IVPA 4P5PA 5IDWA 1B0ZA 4YR9A 5F2EA 3D59A 5J1SB 2O8VA 4KR0A 1MC1A 2CL6X 2IS4A 1USKA 1W4RA 2BTQB 2I2WA 2P2NA 1YB1A 1LPMA 4Z1MD 1ZIOA 3IVCA 1CJTC 1GZVA 1E5QA 1GL9B 1VJGA 2DR0A 3NHSA 4YJHA 3RO7A 3U17A 4KZKA 5BSMA 2IW1A 1N2EA 1Q44A 5L4SA 1XYYA 3ZGVA 5DYTA 1UBUS 1XRLA 4QKQA 1Z56C 2DM6A 3L93A 3BMXA 2BL4A 3DONA 2IZ5A 3RARA 5TNXA 2OLKA 1U11A 2ZB2A 1AK2A 4ZPXA 3ZU6A 4KYVA 1SCKA 5E7MA 1N9GB 3WSTA 2WWYA 4HR7A 1HZZC 3SJ7A 4OQPA 1ZONA 1G2PA 1TLFA 3D4OA 4PGHA 1BEUB 5BQ3A 7GPBA 3OZAA 2A9OA 2WUVA 3QV2A 1EFPB 4PN3A 1KJYA 1WHSA 4HQLA 4RIGA 1WF3A 2XYQA 2Z09A 5IDQA 3WO1A 5FCDA 1KJ9A 3R0IA 1UC9A 3ZK8A 3CJTA 1ABFA 2FR8C 1JG7A 4X62B 2CNDA 4ZCRA 5CA0B 4PTYA 4PAWA 4DA6A 2ZRMA 3ADOA 3N8KA 4B83A 1PJZA 4BKQA 2L82A 4DARA 4N48A 1YZLA 2NZWA 3D31A 2G3YA 4XGRA 2ZSIA 1SBIA 4YO8A 5TMDA 1FX0A 3CLSD 3VJKA 1QYXA 1JIUA 5K8LA 1ZVJA 4I0WB 4B6JA 4PCLA 3HN6A 3N7AA 1X2BA 4OOFA 1P31A 3DAFA 1U1GA 3PPXA 5DSXA 3WP1B 3G0CA 4Q9NA 3KETA 3ENQA 1IBSA 2O2SA 3PG5A 4QFCA 4KWCA 5HQJA 2CE7A 2F3QA 3UCEA 4D46A 4EHDA 2ATEA 4YT4A 1ARZA 1H2HA 1W6UA 4OH1A 5KOJA 1CP3A 5HM6A 1AA9A 2Q3FA 4PX3A 3ASZA 3EVEA 2NYAA 1A9YA 1HE8B 1T43A 2BCJQ 3I9JA 4HX9A 3I53A 2ZJBA 5H83A 5DNWA 4G4GA 1BJRE 4LY6A 1VIAA 4L8GA 3SM9A 2GCGA 3FWYA 3NYQA 3IP6A 1JTFA 4PLGA 5CVJA 1XR3A 1V7PC 1HEYA 2MIIA 4EAAA 1L4FA 2A92A 2EW1A 3VZDA 3WNDA 4EQ6B 5K8UA 3HXPA 1G21B 3BXEA 4PYMA 4FFVA 5BMVB 1KQGA 1B23P 2J9ZB 1A8UA 4WJZA 1CQIA 2O2CA 3CB4A 3OEYA 3P9QA 1G8FA 5CDTA 2JDID 2GB4A 2W2KB 3ZDYB 1ZH8A 3D2CA 3RVOA 2DTXA 2XVMA 4HXFB 1C30B 3ACDA 1GTVA 2WKQA 1Z33A 2X23A 1GYPA 1XLTC 1S5PA 2B7CA 2WHQA 1X8JA 3INTA 4LTMA 4RKYA 3U1VA 3U7QB 4PTZA 3MJSA 5F1PA 2E4WA 2R6DA 4NBRA 1NN0A 5H59A 1ORTA 3EIWA 2X3UA 3GC6A 4LXXA 1C9EA 2D2FA 1GRRA 1E61A 5GOTA 1N75A 3GEDA 2SECE 3K0CC 1WDKA 1V41E 3CYFA 4P53A 2I2XB 3KR2A 4M9UA 3MJ4A 4M55A 5KDLA 2PGIA 3HBLA 3NBMA 4QOIA 4Q7JB 2C07A 4BATA 2WSIA 1QKKA 1M8JA 4KGDA 3B85A 4YRAA 1OJ7A 2ZTMA 3DDCA 2GJAA 1VJ1A 3FCAA 3K35A 2GPWA 3DOIA 2QUZA 1UBLS 4TV9A 5EHIA 3CRZA 3T4EA 4HZIA 3G2OA 3BK7A 3H2JA 4RMGA 4E5VA 2XB2A 5FJJA 5A3RA 3L0OA 2HRDA 2RC5A 3AETA 1NAHA 4RE5A 4JMLA 1F8XA 1K0FA 2GN1A 5REQA 1Y89A 1E6EA 1H94A 1M34E 3HXKA 1GPH1 2XZPA 2FKAA 1G8KA 4HDCA 4I08A 5CGZA 3KCQA 4I6GA 1PNVA 2H5LA 4EJMA 3RSLA 3CZAA 1DT3A 4M8IA 5EP2A 4NY1A 1DRWA 1ZGJA 4PLTA 4H6XA 3D1JA 4WJLA 4OXQA 3X0DA 4BNHA 3T34A 1RQXA 4DY4A 1ML3A 1E2HA 4JLSA 3ULKA 4DMUB 5BVGA 1TM5E 3BK2A 4ZMRA 5AM2A 3DL4A 4UULA 5FIUA 4FFLA 4TOIA 7MHTA 2FPGB 1F2VA 1BYUA 2HCFA 3BFPA 3KBOA 3IAS1 3RYHB 1UQRA 4EPYA 1N6HA 2I3AA 4UAUA 5FLEX 1JTEA 4AO8A 4ZI7B 3AFNA 4JN6B 3SDBA 4I1PA 3UMRA 5EUQB 1C29B 4L5BA 1G2IA 1N0WA 1T9HA 2R2GA 5DE3A 2OGZA 3O3CA 4M9SA 1WL8A 4JUCA 4WZBB 3RAGA 2QLLA 3EIOA 3GGSA 3LF2A 1NF3A 5D5HA 2XJ9A 3MT8A 5A3QA 4KE6A 2G8LA 1Y48E 4DXAA 4F3TA 1JU4A 4EO9A 5DEIA 1HDRA 2B30A 3BX1A 3NT4A 1NI5A 4QYXA 3VSEA 4AN1A 1YKFA 1DHRA 2DH5A 2QTAA 3N05A 3TGPA 3HKEB 1JFFB 5F9MA 2YXNA 2JJMA 1SVLA 3MT9A 4DANA 3ILHA 2VH1A 4LSMA 1T9GS 3RK4A 1FP4A 2QB5A 2OAP1 2FDCA 2CD7A 2QL6A 3WZ2A 3CZ9A 1M8GA 3HC7A 4PW0A 4Q9LA 4JLKA 4CNBA 3GVPA 1OFVA 3BCHA 4FNMA 3U09A 4NYMR 4MKFA 1YZUA 3NM5A 2C99A 2KI5A 3KE8A 4P1ZA 1B8NA 5H4GA 5B30A 2PH1A 5DTRA 4OKIA 4OFXA 4RYLA 5FWDA 5GAJA 2BKVA 2O0KA 3L0SA 3MWDA 3WQBA 2VHQA 4DMCA 4YRZA 5KCZA 3RFUA 4O4JA 3H04A 1Y3AA 1PWEA 2NV6A 4LCJA 4FR0A 2ZJ0A 5JYEA 1SEPA 4QLAA 1DC3A 4OEHA 3LT5A 4JFAA 1I13A 1G9TA 5T4BA 1UXHA 1L3IA 4NSNA 1QC5B 3TI7A 3O83A 3P0FA 2WD8A 1UIRA 2XCTB 2B9EA 1FS4A 2QLBA 1N6LA 3L0ZA 4QYWA 3V1KA 1TCVA 3KJFA 2HDWA 4TMWA 5EZQA 3E2IA 3EVCA 3KJXA 1W2HA 2ZAOA 3U26A 2VSNA 3QKTA 2CV0A 1FQKA 5KQRA 5FO1A 5C4MA 5E6RA 3R9XB 1KOJA 2VNJA 4DPLA 3TD6A 2AN4A 1JR6A 2ERXA 1I4OA 2G70A 2QUAA 3QVTA 1PYOA 4C7OB 4JYPA 5FFFA 4H08A 5AUNB 2N1BA 2PUJA 5B55A 1J2RA 1G4UR 3HBMA 1FXSA 2AZDA 2VRCA 2D0PB 3CRW1 3OUZA 5AKZA 2B5VA 3R7NA 4G67A 1IBCA 7YASA 1KSFX 2PX2A 5FAXA 2FG6C 2DBZA 2ZDGA 3EXFB 4HPJB 1ZRNA 2J46A 1J2UA 1ZLYA 4Q3NA 1OGJA 3HVKA 3EFOB 4KO1S 4MP3A 5LLTA 3ND8A 4RLHA 4MO9A 3ITEA 3IE2A 1W19A 1IZ0A 5E7IA 1LFAA 2YHIA 4ALIA 3SWWA 3BJZA 5CTJA 2H4HA 1ZOLA 4DTCA 4RD4A 2W8ZA 1R50A 3OCXA 3RYIB 3MC1A 1Z0IA 4B5KA 2I9PA 1TTQB 1M1ZA 4EG8A 3LP5A 2UUAB 3PBKA 4B4UA 4UDYX 1OAOC 4FBLA 3WRVA 1Y4DE 2ZAGA 1Z8HA 4KDFA 2O5RA 4IIJB 1LZLA 3VU9A 5U4QA 1CJCA 1J8DA 1PJLA 1YRBA 2C2YA 2C0QA 1ZESA 2V7EA 1YRHA 4REOA 3IVRA 4AJIA 1ZGHA 2B69A 4MIKA 3CJQA 4NHEA 3GCGA 1SD5A 2OCGA 2EFJA 3OEHD 4FGLA 5BY2A 3K2QA 1ZXLA 4BQPA 2JCBA 1U8ZA 1DFHA 4XSHA 5TC4A 1UBMS 2YICA 3GRYA 4HAZA 4J2OA 4QRIA 3EPKA 1K86A 1NQUA 1TEHA 1Z5UA 4UM7A 4YY3B 3EVDA 4TTRA 5AESA 2VPWA 3DTTA 2GN4A 4QVKA 3A1VA 1Y9EA 4HWOA 3H5WA 1OMOA 1IY0A 3EGXB 5JECA 2CDNA 5KNCH 1PGOA 2VNIA 3CVOA 4LY3A 4WRRA 1JYEA 3W6ZA 2R6R1 1KEVA 4CEHA 3HWX1 2GN0A 1M72A 2IEGA 1QIEA 2M32A 4MW2A 3D8UA 3NWPA 3I62A 1ND6A 2B8TA 2W2LA 2ZSAA 1H5NA 1D1SA 5J40A 5CAEA 2E89A 2C92A 1EK1A 1MRZA 1FQJA 1VZ3A 1ZM2A 3H4IA 4IR7A 4XEHA 3AEXA 2C96A 2ZM6B 4I1RA 1RACA 4P5EA 3RSQA 4PXSA 4CM5A 4JD5A 1VECA 2VATA 1S8OA 2HM7A 3KFLA 4B71A 2WTBA 4LWPA 1VG0B 4GPEA 2KHZA 2HWXA 5JAMA 1SXJE 3OSUA 1W9MA 2ZXFA 3U44B 3HP4A 4DLSA 1SMKA 5IJ9B 5KYKA 2JFWA 2UZ0A 2X9VA 4IQGA 4BFUA 4D41A 4Q9KA 3I2HA 1JSXA 1PJRA 2PXAA 3DW1X 1SVSA 1ZOSA 1P18A 3KUDA 4UBMA 5GJVC 4DE5A 4YUAA 2EHJA 1XTKA 1RIIA 2BMJA 2XPCA 3A25A 1DAOA 1BS2A 4HPWA 3IUJA 4TM7A 4YQYA 5FKJA 5K51A 2IF2A 3ZQUA 1N2OA 4A5OA 3NEJA 1YDMA 3SFTA 1K5GA 4BIMA 1PNOA 4LBWA 4O3MA 1IEXA 1J6UA 2A88A 5DHUA 3P2IA 2WICA 3OZRA 3L1IA 1DJQA 1HGXA 1M1NA 1TECE 2ZE5A 4NJMA 1T0PA 2O50A 4ZAXA 1L1FA 2JIOA 4ZOLF 1COWA 3ZQ4A 3KXLA 5ALSA 1IWPB 3PKJA 3S1LA 4JL5A 3N9IA 4R1PA 4YUYA 4KPUA 1N9GA 5CPBA 4ED9A 4U7DA 2FRXA 5J2UF 3NAZA 1H23A 1E5XA 5JTUA 1IUPA 1LX6A 1T2FA 1U9IA 4LBVA 4A6DA 2AYYA 2ORYA 5HS4A 3ETCA 3HO8A 1T8SA 4HNQA 3RF7A 4JBYA 5FBHA 2YN2A 2ZRIA 1P19A 1IHDA 3D8RA 3F6RA 3SPXA 2R1ZA 3UANA 1P33A 3MWEA 4HQNA 1LQUA 4X92A 5DT2A 3WWDA 1FX1A 1WB4A 2GD0A 1JEEA 1K1EA 2IP4A 4RD3A 4AYTA 3SYNA 3UPUA 1CDDA 1EFTA 1X42A 2Q5QA 2XUGA 5DW3A 3TW6A 3FFBA 1Q11A 1VB5A 1JG2A 2AOUA 4NICA 3TNDA 4CBVA 2X7HA 3VPSA 1W4LA 1E6LA 2HPZA 4Z8YA 5K01A 1DE0A 1X80B 1K75A 1W5TA 1FRZA 4MR9B 2VWGA 4JP8A 3K1TA 4IVPA 4L4SA 4NS4A 4O4HB 3ZLTA 5TQ2B 1AKWA 2ZM5A 5FULA 4LF4B 4PC7A 5LZ7A 3T0IA 1X6VA 3MERA 4M60A 3AY0A 2XZOA 1ZW1A 4Q9JA 3QV1A 3EEQA 1FYWA 2ORWA 3FYDA 4I8IA 3H05A 5SV2A 3R3HA 5C5IA 3L9WA 2G83A 3OCUA 2OGSA 4R40A 4A8JA 4EGJA 2FEWB 3T5GA 3DYIA 1QP7A 3TG2A 4DLAA 4H7JA 4CM8B 1KMCA 3EDCA 3NAGA 5KNCA 3ZE0B 1Z5VA 2ID7A 3UH0A 3EA4A 3MJEA 1KFCB 1QBKC 3GI1A 3K5HA 2QTBA 1Y4SA 4RD2A 1SIUA 4UEKA 3SSMA 5LVAA 5K3FA 2C00A 3IAHA 4QGGA 1V8PA 1ISHA 2ZU0C 1R5BA 3H19A 4U2CA 5E4YA 2CXRA 2R8OA 1ILEA 1AHPA 4WPGA 1L3BA 2XBLA 1I6MA 4MB2A 1LRJA 3WXMA 3ZHXA 3HWSA 4QPJC 4HB4A 5TJHA 1C30A 1MA0A 1QWOA 2DLDA 3BSSA 3A6LA 1VIVA 4UXIA 4N3GA 5EINA 5LZ8A 2QTNA 3ETHA 5EJEA 1KC1A 2AUNA 4A6XA 1DJPA 3MWFA 3ISJA 1AZTA 3WK7A 2RK6A 4AURA 1L4NA 2GJSA 3EDQA 3G8BA 3PGLA 3Q9SA 4NJEA 4B87A 4PG6A 3WB1A 1IDOA 4FTWA 1N3LA 2FEAA 4URZR 4XWOA 4RJ2A 4HP8A 4MGIR 4I9GA 2SBTA 5DI3B 2NO7A 3LL7A 1YUNA 3O91A 1P3DA 1RXIA 1W88B 2V4ZA 3PDUA 2FY8A 3K72B 4QUDA 5SICE 3CB2A 4C08A 4J1TA 3CTMA 4N6NA 1OA0A 2YYAA 5EFOA 1OJLA 3WBJA 2H1FA 4A0SA 2WD9A 3FFWA 2MYNA 2AW5A 4AWAA 4B3DA 2B8JA 3RFCA 2BBTA 3OETA 1EFHA 4JFRA 3OSZA 3LPLA 3FWKA 4JGGA 4Y6QA 2X5XA 3IUSA 4M1EA 3EPLA 4R2LA 3LLVA 5CBPB 2WU0A 3IIIA 1YQUA 2MHCA 5EQJB 3EXIA 1WXDA 3FPGA 4MVJH 3SDZA 3FTFA 3BH0A 2OXIA 3CVUA 3ZCRA 4TYYA 2Z0MA 4GU5A 3IEKA 5G4KA 3BICA 4B4VA 3U19A 4AKGA 4C7MA 4JQZA 3GT0A 1GV1A 1H2ZA 3OZFA 2ZIVB 1H0KA 4DDVA 3SJAA 3PX2A 5BURA 4EGCB 1ISJA 1G66A 4MWDA 1V39A 3OD5A 4RGYA 3RIEA 3RV4A 2HA5A 1Z4MA 3KG2A 1L7QA 3AUJB 4M83A 1GQ2A 2XCRB 1XRSB 2VHVA 5KWVA 4MDFA 4Z3DA 1A5TA 2BM1A 1YZHA 4GR4A 4TWIA 5B3JC 1TC1A 1C4XA 3ZCXA 4WAUA 4Y6OA 5HE8A 2W0SA 3VMFA 1WUHS 3JVEA 2Z1DA 1ZVQA 3C8UA 1TDJA 2WABA 4O2LA 2QRPA 3RYHA 4Q3AA 4BBZA 1MX1A 2QRJA 3TQIA 4TUYB 2EVWX 3WLFA 1AN9A 4YRMA 4WESA 3LIPA 4B45A 4BX0A 1NQWA 4D8YA 1UPAA 1YDWA 4J0IA 3G8YA 4UVGA 2P65A 3D4LA 5KJCA 2PT6A 3H7IA 4WZBA 3QVJA 4NDAA 3CKYA 4E07A 5FLXA 3DZJA 1EH5A 1BFUA 4UFOA 3R7AA 2B8NA 1HLFA 1KZ1A 3GBSA 5ERXA 3TRDA 5J4YA 5KU1A 2BFAA 1DKUA 1V1RB 3AF2A 2GBIA 1WEHA 2NZUG 4QBKA 4WNYA 4R9UC 1Q0SA 4IICA 3TDMA 2QT1A 4JSRA 4LKOA 5MN6A 1C1XB 1JFFA 1RYMA 2VWHA 3OJLA 4LF9B 5GWXA 3DV0B 4MP6A 2HI0A 3BS4A 3HHPA 4V0SA 5CT6A 1LU9A 3X2FA 3LRPA 1Q2XA 3QYFA 3HVHA 2CVHA 1I7QB 2A9RA 5AVVA 1P5JA 1WR8A 1BHQ1 4FGKA 1Q7TA 2BF7A 5LZ5A 1EVQA 3UFXB 1CUCA 1JIJA 1FRVA 3C1TA 3FH0A 1GPJA 3H5OA 3MTJA 1UODA 3KHUA 4DV4B 4KK4A 2BFBB 1FTYA 2AZMA 3LGSA 5HMLA 4E51A 5CIQA 3ZYZA 2XRFA 1M8PA 2D5BA 1SULA 1WP9A 4IDPA 1LA2A 5KPDA 3HCFA 2I2AA 2OOKA 2VA9A 1AQIA 5KNBD 3F71A 4EKNB 3OLZA 2FVYA 5JT1A 4TTIA 1QC5A 1SQ5A 1RZRA 2D2XA 1H4TA 4LHEA 4V0RA 2CXQA 3VAAA 4GXTA 1I2CA 2RGEA 3BWMA 1YB5A 2B2CA 1RT9A 3FVTA 1W5EA 2Q3HA 3O4JA 1EFRD 4MVJA 4Q1BA 5EZYB 3B53X 1IZYA 2DETA 4HLQB 2R7LA 1OXVA 1U5AA 3I4CA 2N1MA 3R9XA 1TO2E 2OZPA 3LU1A 3UB3A 1CW2B 3UO8B 1QS0A 4UQPA 4K03A 4LV8B 2W9XA 1RWKA 2B4RO 3EIUA 2VAMA 1ISIA 3MTAA 4PZUA 4BZXA 2IELA 4C7OA 2Y1FA 4AZTA 5JMPA 2BR5A 4QDOA 1DIRA 4PX2A 5B4UA 1PR4A 3IVAA 4KXFB 1J8QA 2D2EA 3MUEA 2AHRA 1BMFD 4DDMA 1HQYE 4LRYA 4EJSB 3IIKA 2PUGA 2PMBA 4EQZA 1KH3A 1JHZA 3NJ8A 3I9V6 2GEBA 1M2VA 4CKBA 2DF8A 2IEYA 1RCTE 4TS1A 4UREA 1DBIA 1C7ZA 3F3SA 2EU8A 2EF1A 3CWQA 4EY5A 4BXOB 4FPXA 4JR0A 3NIWA 2CFTA 5JCPA 3AUFA 3HZZA 3K1JA 1KP2A 5IP5A 2EZ9A 2RHJA 4HH0A 3RC1A 3L2OB 9MHTA 4IIJA 2V5AA 1PQ4A 3BTOA 1D2NA 2OHGA 3C16C 4A2CA 3GYBA 2ILTA 5IHXA 5A6SA 2P0AA 1CU1A 3AI7A 3BA1A 2E6KA 3OTGA 3ZHCA 2RH9B 1FMJA 2WE7A 1BS1A 4FCWA 4RYDA 1DV1A 3AEKA 1IM8A 4P92A 4C2BA 4E08A 4YUXA 5A0VA 1ZBDA 3RIXA 1WZIA 3C6BA 2H17A 3AFOA 4FOSA 5EQDA 3ZV5A 4POOA 3MRTA 3FDFA 5LBIA 3KYJB 5JHGB 2OZEA 3EHDA 5FH9A 2WOJA 3KTDA 2VYND 3UK0A 4JBNA 3UENA 5EI5A 4AY5A 2JLBA 1LBHA 3EGXA 4XM1A 1MENA 2VDOB 4ZO4A 4MRMA 5F7JA 1E3SA 1QJ4A 1IPFA 2KLBA 1DWQA 4UUAA 4ICIA 4R1UA 5IF3A 4FLFA 4N41A 4KWIA 3AVTA 3OQIB 2A9FA 3DEJA 5ALVA 2Q1SA 4FHZA 2UZ1B 1C80A 4JOSA 4IHJA 3W6OA 2QN2A 2EX4A 2WMYA 4RHCA 2OFXA 1FYEA 5IDVA 4UEQA 1PS0A 2Z3WA 3GRUA 4FMBB 1TU3A 3JVDA 3HVIA 4K5QA 4Q24A 4RGVA 2P0YA 1OZAA 4PPNA 3REGA 3FZEA 3EEFA 1Y7HA 3MOIA 2JK1A 2YL2A 2YWDA 4FOTA 1GNSA 1US8B 2B83A 3DO6A 5IJ9A 4Y67A 3GCZA 4W8GA 3DAYA 2VCEA 1SJ9A 3LZCA 3R5KA 4KE7A 1DAIA 4NMWA 2WZQA 4RETA 3TDNA 4BQSA 3N1UA 3WHIA 1H6DA 2IUSA 1IBLB 3PQ7A 5AQEA 1PIWA 1G42A 2VO1A 3KB1A 4UMFA 3BDAA 4Z86A 2O7SA 3X1YA 3BHIA 1D7OA 4MV7A 3OM8A 3FJYA 2BKUA 2DUJA 2H52A 5FV7A 1YDHA 2RHTA 3PIRA 3LP8A 3T94A 1EUZA 4CG1A 1N2XA 4P4SB 4BUCA 3OQPA 2IXDA 3IB3A 1EVYA 4COKA 4L3WA 2I3ZA 5IMBA 4DV3B 4I3GA 3WB9A 4LXYA 2QZ4A 3BTVA 1TW3A 2CFSA 1QRAA 1ES9A 3QKSA 3ZWQA 4B6EA 4FFNA 1AKVA 1OBVA 3PB3A 1Q17A 1JIXA 1YGYA 2ZWOA 4O33A 4LBYA 2FN4A 1W76A 4XZ3A 2WG2A 4OXYA 2QTRA 2WBLC 3UICA 1K7SN 3QLVA 3LTNC 1GZ3A 3GUUA 3COJA 1Q0PA 2X3YA 3EOAI 4NEHB 4XDZA 4B6QA 2I22A 4QOGA 5IAKA 3CT6A 1X1AA 4EJ6A 2Y1LA 2ZUBA 2ZRGA 2AOTB 2OV3A 4GECA 2H2FA 4KQJA 1ZK4A 1YR9A 1X80A 4MR9A 4NBVA 3A0RB 4HT3B 3FOAA 2YZMA 2ZRKA 3HEBA 4P4NA 2F9MA 1T3SA 4EI7A 2FF7A 4Q4JA 3BXFA 2A59A 1NXWA 3L77A 1LDEA 3IAEA 3UXEA 1OLXA 2VNHA 2A5DA 3ESCA 5I8ZA 3TLYA 5BWMA 1AK9A 1Y8RB 3HNRA 4S35A 1DAGA 2E5WA 3MMNA 4F1WA 2TS1A 1GT6A 4NZYA 3VTZA 3HJHA 2WIDA 2WJVA 4YXFA 1IATA 3DZIA 1NTOA 1PWXA 3U3KA 1JBQA 2OVBA 3NHWA 3DOHA 1JV2B 2CWDA 2E49A 2IWHA 1IWOA 3MWJA 1N0HA 1CVIA 1ESEA 3WL6A 4ECEA 1TZKA 1GNTA 4F4UA 4F96A 1U1FA 5IJ0B 5A71A 1A2OA 4MR7A 4W8HA 4CLRB 2UZ4A 1QHGA 5LYYA 2PCJA 3UJHA 2DXIA 1TJ5A 2XWPA 2WFZA 1C1HA 2YHUA 2ZI6A 3KKEA 4IDDA 4W7SA 5HGJA 2R66A 2AN1A 2IV2X 3T8YA 1MX9A 4DIBA 4ES6A 4J9UE 3DBIA 5GONB 4XW2A 4EPWA 4KHPB 4O2AB 2QJOA 3H2YA 1ZD2P 4LY9A 4YJGA 5DOZA 5G53C 1PWHA 3Q4GA 5JISA 4TYWA 1PNQA 5KQGA 4WBSA