3O26A

The structure of salutaridine reductase from papaver somniferum.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
294
structure length
294
Chain Sequence
b'RRCAVVTGGNKGIGFEICKQLSSNGIMVVLTCRDVTKGHEAVEKLKNSNHENVVFHQLDVTDPIATMSSLADFIKTHFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEELVKIYEKPEAQELMSETYELAEECLKINYNGVKSVTEVLIPLLQLSDSPRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLANKIPKFQVNCVCPGLVKTEMNYGIGNYTAEEGAEHVVRIALFPDDGPSGFFYDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Salutaridine reductase
publication title The atomic structure of salutaridine reductase from the opium poppy Papaver somniferum.
pubmed doi rcsb
source organism Papaver somniferum
molecule tags Oxidoreductase
total genus 114
structure length 294
sequence length 294
ec nomenclature ec 1.1.1.248: Salutaridine reductase (NADPH).
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3o26A00
3PIIA 2I65A 3GMSA 5KJFA 2B0JA 4XR9A 1GFSA 3UAGA 2Y0EA 4MVJE 3Q3CA 3QVTA 4YT2A 4R3NA 8LDHA 4ROSA 2UUPA 1F17A 4FIZA 4IXTA 4PVDA 3KBOA 1MB4A 1X7GA 3NT5A 4MINA 5IXSA 3E5RA 1BG6A 4G2NA 4OOFA 1X15A 5I9LA 4RZHA 2Q50A 3DZHA 3RASA 4JJIA 3RVDA 3UOGA 1DHTA 3L4BA 1Z6ZA 3VDQA 3ONEA 4CM4B 2AG5A 4LSMA 1LNQA 1MC4A 4BNWA 1Y9AA 5F5NA 4N5LA 3VDRA 1WPQA 5DN9A 3K8ZA 2HMUA 5L7YA 1OZAA 1KIFA 4FJ2A 5TX7A 3ZWNA 4IZHA 4CM6A 1HYEA 5L45A 3FNGA 4J7UA 2O23A 2WYUA 3UVEA 2Q4BA 5DOZA 2EJVA 4GH5A 3U09A 5ER9A 4KDFA 4AJ2A 3H9UA 3U4IA 2X0NA 3RUHA 3KSZO 5T64A 3GRPA 5B4VA 2VHXA 1WMBA 2EXXA 4MIYA 3KEOA 3ZNPA 4RCVA 1FDTA 4YACA 2HRBA 5DP1A 1N2SA 1MLDA 4OJNA 3I6IA 4TRMA 3UUWA 5IN4A 3NDIA 4FBGA 1SCUA 5TT1A 4R9RA 5KJ6A 1QLJA 4OQYA 4HNGA 3WMWA 3WBBA 4OIMA 4ZQHA 3NUGA 1MGOA 4O1MA 3GC6A 2H1SA 4P4GA 3PJFA 3DBLB 4BV9A 1EE9A 4Q3DA 4IY1A 3RC1A 1O5IA 4II2A 5KJEA 3HADA 3OHSX 1CRWG 3RUIA 5ICSA 5EQDA 1W4ZA 2Z5LA 3DMYA 2ZTMA 1EZ4A 3TL2A 2NU8A 1DFHA 3D5TA 5A9RA 4E2ZA 4AJHA 1CDOA 1UAGA 4Q9NA 4B7CA 2V6FA 4IGFA 2Z95A 3EZLA 1GPDG 1QV6A 3UICA 1O89A 3OBBA 1RYEA 2NQ8A 5U9CA 1JLLA 2OP1A 3ONFA 5DZSA 1QMGA 2BFPA 4II3A 3NGXA 4HKTA 2B4TO 2E49A 2DPHA 4L4SA 4L75A 4E21A 4P38A 2ZATA 2ZJ0A 1BRMA 4OO3A 2PKQP 4BO7A 4KUGA 4D42A 3GGGA 3TZHA 3PHGA 4NQZA 2HJRA 3DHNA 2C5EA 1C0KA 3D3WB 1Y8RB 5JCJD 5LDHA 2V6BA 1E77A 3B70A 2I99A 1P1RA 4CMEC 1P9LA 2PV7A 2ILTA 3RCBA 1QLHA 4ZQGA 3OQ1A 4XQGA 3ZNQA 2W98A 3RBVA 3JQ7A 2GYYA 4YWJA 2IEDA 4BNGA 1PJCA 4H15A 3ONDA 4FD3A 2P2SA 1C1DA 1VC2A 2YZ7A 1ISMA 1V8BA 3I6QA 4CMCA 1SO8A 3GK3A 2BI8A 2CVZA 4BO6A 3GHHA 3N7UA 1JW9B 3PPIA 3JV7A 1DB3A 3WICA 3WGYA 2NU7A 4PFJA 4CJXA 4ND4A 2XOXA 2VCYA 2O3JA 4ONEA 4PRLA 5JAMA 1GUYA 3F4LA 4TKMA 5JCJA 4MVJH 2AQIA 2J5RA 3OICA 2GGSA 3DHEA 4EUFA 4Z9XA 2AQ8A 2X22A 2GRAA 1U7HA 4R1UA 4Y6RA 2O2YA 3O8QB 3KYCB 2R00C 4PG7A 1ZK0A 1HL3A 2V7PA 4IQ0A 3ZU3A 4B3IA 1DRUA 2GUGA 5TJ9A 1ARZA 3WX0A 4BQRA 1SEVA 4ZQBA 4BVAA 3LVFO 5ITWA 3ZW9A 1I10A 3DBHA 4R4JA 2PD6A 3JCZA 4KP7A 4Q3BA 4BGVA 4E13A 3H3JA 3S55A 1VL0A 4FR5A 3QRWA 4HX5A 4NU6A 5AXBA 1B0AA 2ZJ1A 4R51A 1MXFA 5TQVA 4BMSA 3OJFA 3GH3A 3A06A 3I1JA 3VH3A 3UH1A 4DQVA 1DXYA 1GV0A 2P91A 2GF2A 3GEMA 4BIIA 5I9NA 1ZXBA 2C2YA 1WDLA 1YXMA 4WLVA 5A9SA 3PIDA 1P0FA 3RD5A 1VLLA 4IDBA 4CMAA 2D5CA 5G4KB 4MVJP 1BW9B 1ENPA 1I0ZA 1LJ8A 1UUFA 2Y93A 1UDCA 3R3JA 3DO5A 1HYGA 4IZIA 3FNHA 1F8GA 1YDEA 3VZRA 5KNLA 3FI9A 3NJ4A 1LRKA 1P33A 3ROPA 2TMDA 1PJSA 4FSHA 3HWRA 4QFDA 5GMOA 3ITKA 3R1IA 1YJQA 5L4LA 2JD1A 5CDGA 3U62A 2QQ5A 1TT5B 1YQDA 2VYND 4UUOA 1MFZA 5JSFA 4A0SA 1DIAA 1BDMA 5ILOA 3NAQA 1B14A 1BGVA 2EKPA 4DLAA 5JS6A 3JD4A 3OJOA 3TN7A 3G49A 1QYCA 3JSAA 4UAGA 2B4RO 3I23A 2Y0DA 4I5EA 5A3JA 4CUZA 2J3IA 3GHYA 1XCBA 3ZV4A 2AE1A 4RVHA 4FC7A 1IY8A 4D7AA 3FCOA 2FY8A 3VKVA 1XQ1A 3GEDA 1N8KA 3GLQA 2OO5A 2PZMA 3I4CA 4U6QA 3VKUA 4BKRA 1Z74A 4OGWA 3H8VA 4NI5A 1NR7A 5L40A 1EBUA 2NUAA 3ADOA 4RO0A 1U2DA 5C7LO 1QYWA 5KVSA 1T4BA 3IIEA 3PWZA 4ND5A 2O3TA 2WD8A 5BNTA 1IL0A 1OBFO 2H5LA 4I9UA 4CM4A 3U49A 3ZV3A 2EKLA 2VYNA 3GUCA 4O0LA 1Z7EA 3ADPA 5GZ3A 3I83A 4IDFA 1T2CA 4JBIA 3RKUA 4F46A 6ADHA 1PWXA 3UXYA 1HETA 4NPCA 4I5DA 2C82A 5IG2A 3C1OA 2VHVA 5AXAA 4LCJA 1LI4A 3QP9A 1GU7A 1U3UA 3QSGA 4W7HA 1R0LA 1E7WA 2I67A 4CL3A 4E3ZA 3RIHA 1NM5A 1UXIA 2OHXA 3ICCA 1P31A 2X23A 4ND1A 4TVOA 1HXHA 3PDJA 4R68A 2YV2A 2DTDA 1BVUA 1PJ4A 3HFSA 4BKQA 2BD0A 4CQLB 2GASA 5IXYA 2NADA 1OC2A 1XU9A 1PQWA 5JDIC 1UP4A 1PL6A 3I9NA 3OP4A 3D4NA 4E30A 2Z1MA 4BNMA 5JNLA 3BTVA 2HDHA 5CDYA 2WE7A 3DFZA 3GPDG 3DBLA 1JN0A 3D0OA 4YJDA 3DZIA 2GERA 2BI7A 4B8ZA 4DBZA 3CMCO 2Q3EA 4WCDA 3DB2A 5COQA 1PWZA 1W0CA 2UAGA 5BSHA 3ABIA 4BGEA 4HFJA 3VTZA 5I7FA 3FR7A 5DCWA 2DBZA 4CLOB 5DT9A 3GEGA 4ZGWA 1AXGA 1RM4A 2QZ9A 4K9DA 4CPDA 1GY8A 4U5QA 5JAZA 1N9GB 3UCFA 2Y99A 1YB4A 2ZB7A 1NHWA 3OQBA 1LDEA 1WZIA 2I9PA 3V1YA 4DREA 1B7GO 4CV2A 1ZMOA 4LMPA 2X4GA 2Q2QA 4IBOA 3V5NA 4ZN6A 1UDAA 3P2OA 4FFNA 2AMFA 2QIOA 4FS3A 4RQUA 3Q6IA 1BXKA 1WXDA 3ZU2A 2UUOA 2HAEA 4OSOA 2AQKA 4IDCA 5DBIA 3KETA 3DONA 1A9ZA 3HB5X 1A5ZA 4AG3A 3LDHA 5CPBA 1Y8RA 2EJWA 4E0BA 2OBNA 1PS8A 3GQVA 4NFYA 5IZCA 5U1PA 4CM8A 3LT4A 1LLCA 3PLNA 5FWNA 5G0VA 3TZCA 3D4OA 3M1AA 3VZPA 4Q3CA 4RPHA 4YT5A 2CF5A 5DCUA 3WG9A 1GV1A 1LSSA 1AHHA 3BHIA 3LU1A 4RF2A 5DDIP 4MOWA 2AQHA 4IS3A 4S3MA 2FPIA 4JBGA 5L95A 3GGPA 1EVIA 3GA0A 4EJ0A 1TA4A 2NNLD 3Q2IA 1LBEA 9LDTA 3MWDB 4A7PA 3L4SO 1N1GA 2BELA 2YV3A 4L73A 1ZSVA 2JKVA 1EUZA 3MJ4A 4K6CA 3ZCXA 4GMFA 4WNIA 2IEBA 3WBFA 4UULA 5B4TA 4TROA 2ZYAA 2F1KA 3QWBA 3RAJA 2VT2A 5A3VA 1N92A 3F4BA 5I9MA 1HSOA 1WDMA 3ZWAA 2B83A 4UEJA 3SBOA 2O50A 1ZO8A 2W2LD 3FPLA 1HDRA 1NBOA 1ZFNA 5HA5A 2QHXA 3O8QA 3TZKA 2BGLA 2PA3A 1YBVA 4M86A 3B1KA 1P1FA 4W6ZA 3EW7A 2Q46A 3W8FA 4ZRMA 4GI2A 4RVSA 3OH8A 3RBXA 3RFVA 2A4KA 4NK4A 3WGHA 2QRKA 5F5LA 3MWEB 4CM7A 3OJ0A 3FNFA 1WNTA 1EDZA 2Q2VA 2EEZA 4MVJM 4WEQA 1DIHA 5G4LA 3U4CA 4GMGA 2P5YA 3QWAA 2W2KB 4IQ8A 4WLEA 1XWFA 3CE6A 3VPHA 1XYGA 2AEFA 3UF0A 5CDSA 2CDBA 2I3GA 5LDGA 1L7EA 2Y66A 3ZN2A 1DDOA 1CQJA 1QORA 1E3WB 4KUHA 2ZYGA 3L6OO 4RVDA 5G4KA 1RJWA 3I5MA 3C7DB 2VYVA 3V2UA 3A4VA 3GF4A 3VPFA 3RKRA 2W2LA 1ZIDA 5CG1A 1Z82A 1EVJA 4DMMA 1G0NA 4ALMA 3WGGA 3E8XA 4XRGA 4RDHA 5ENDA 1Z75A 3RROA 3PZBA 4ALKA 1R37A 2AE2A 4PLGA 2PD4A 5IF3A 1SBYA 2VRCA 3WJAA 4J2OA 1KETA 5F3RA 1GR0A 2I6TA 2DQ4A 1LDGA 5ER6A 4PVCA 3MTGA 1TT5A 4MVJI 4R01A 4YRDA 4AL4A 4IIUA 1CERA 3HDYA 4BB6A 4KWHA 4YEDA 3WS7A 3DAPA 3NYWA 3SC6A 3EMKA 4O6VA 1PTJA 3NT2A 5CG2A 2IZZA 3WGIA 3AU8A 4E6PA 4J7XA 3QWFA 2Q1UA 1VKOA 3NJ8A 4J7CA 4W99A 2BH9A 2XXJA 2EW8A 1MXHA 4PRKA 3GR6A 3ZHYA 4DPMA 3GVXA 1OI7A 5K6AA 5A4DA 5CAEA 2IDZA 1GCOA 1R16A 2UYYA 5JPIA 5JW6A 1SPXA 4BNKA 5G0UA 1V9LA 5JAIA 4E2YA 3VVCA 5KVVA 1XSEA 4DQUA 2F00A 1KC1A 1H6AA 1NAIA 3GDFA 1C3VA 3OECA 5TT0A 3L9WA 4UUPA 1PQPA 2JCYA 4ZICA 3WFIA 1YDWA 3TDKA 5I7VA 2RHRA 1VL6A 4M55A 3B1JA 1LC3A 1T2FA 1RKXA 1Y1PA 3AK4A 4WGGA 3CTMA 3WYEA 1C1DB 4J90A 3AI3A 4GGOA 4YDRA 3F9IA 2FOIA 2X5KO 4YBZA 4K1LA 3AU9A 3F6YA 5TJHA 3DZJA 3LLSA 2PZLA 3HQ4O 5F21A 4BNUA 2JD2A 2ET6A 3K73O 3ON5A 4BNZA 5I7SA 3UN1A 4N54A 3BIOA 1D8AA 1I32A 2W90A 2FR8A 1QXSA 1U3TA 1OFGA 3TRIA 4CQLA 1XR3A 1M6WA 2DPGA 5B1YA 1BSVA 3QVSA 3MEQA 2HK8A 1KOLA 1GYQA 1ADFA 2VNAA 4J4BA 2D5AA 4CLRB 2C59A 3OQ6A 2YHUA 5C37A 2YQ4A 3BTUA 2WSBA 2IYOA 5BT9A 5IDWA 1PGJA 3RUDA 2E48A 3BZUA 5JMPA 4OMUA 1J49A 4QTZA 3AUUA 4HFRA 3S1LA 1IULA 4LK3A 1QRRA 4FOSA 2HMSA 1LTHR 4BNJA 1TXGA 4ZA2A 3RC9A 2Q1WA 5KJCA 4E32A 4DWVA 4EITA 1EK6A 4CLOA 4IPTA 4BNIA 1E7SA 1JWBB 1CJCA 2VWPA 1K2WA 2O3QA 4KTVE 3ZWWA 3H9GA 3ROKA 1N9GA 2PH3A 3WWZA 1I33A 4BO9A 4Q3EA 3M2TA 1UZLA 4QEDA 3AOEA 1HDOA 4W9NC 4MP6A 4KQXA 1YL6A 1BHSA 5F1KA 2WWRA 4JP3A 3U4DA 5EQFA 3OFSA 4WLNA 1E92A 4QX6A 1JKFA 4RVGA 2GO1A 4TRRA 1XDWA 4CLEA 3HFGA 4EYEA 1NQ5A 3WXBA 5KTKA 1C0IA 2DFDA 2OZPA 2FHSA 3PJGA 4GGPA 3F5QA 5FI3A 4PN3A 2P9EA 1NPDA 5B12A 4J9UE 4ND2A 1H2BA 3F5SA 1XELA 1GZ3A 4XYLA 1M6HA 3C8MA 3A14A 1YS4A 4XGKA 4Z3DA 4DTIA 1FF9A 4GPD1 3AJRA 2EV9A 3HDQA 3KHUA 4E2XA 3OF2A 3QQPA 2J3HA 3ANNA 4CLHA 1B3RA 3PLRA 2C0CA 2VHWA 3EVTA 1Y7TA 4J0FA 2C07A 4Q3NA 4TSKA 5DULA 3TZ6A 3OIFA 5JYDA 1X7DA 3EHEA 1XEAA 3HZZA 3LQFA 3RFTA 3E6AA 3Q9NA 4NR0A 2I5PO 3MOGA 3CZRA 2E4AA 4F45A 1HYHA 4LW8A 4GWKA 4R69A 4AJKA 1HDZA 3F47A 4E31A 4XYMA 1E7YA 3ZU5A 3BXXA 3TFQA 1WMAA 3C7CB 1WDKA 5T8KC 4CM9D 3ENNA 1V3VA 1DC4A 2QZZA 1LQUA 4U6SA 5A03A 1LU9A 4XKJA 1B2LA 4BKUA 4NBRA 1YL7A 3TL3A 5DOVA 3INRA 5JY6A 4O59O 2ZTLA 3FTPA 2EKQA 3PQDA 3EAGA 3P5SA 1D3AA 1RWBA 4AJLA 4LRTB 3TF5A 2ZTVA 4JP2A 4PGFA 2GN4A 4BNXA 4E5NA 3CMMA 3FPCA 3O38A 5L7WA 4E5PA 2W8ZA 1IPFA 2AHRA 2Q4EA 5CP8A 4AJ1A 4LMRA 3AM3A 1ENOA 2HMTA 5CEEA 1HLPA 1WP4A 3C85A 2Q1SA 4KZPA 1Q7GA 2ZYDA 1HTBA 3BMOB 5JY1A 4PLZA 3ASVA 2YY7A 4WCFC 5TGDA 4YJHB 1EVZA 2W2KA 4CM9A 1LLDA 1NQTA 3K96A 3FSRA 3F1KA 1I5RA 3FRJA 1HE3A 2H6EA 3IDSA 1E3WA 3CXRA 3PDUA 3D3EA 3E9MA 1OAAA 3DMTC 4OL9A 3ZWBA 1P1JA 3RUEA 3PI7A 2YW9A 3DZGA 1ULUA 3DBRB 5EESA 3WQSB 3QVXA 3RUAA 3LC7O 1UZMA 2SCUA 2DU8A 1VSVA 4NBUA 2VN8A 4XGIA 3JQ8B 1E3EA 3AY6A 3KRTA 4I08A 4JXKA 1YGYA 3LYLA 5G0WA 1NFRA 4TVBA 3AUTA 2C29D 4YYZA 1EDOA 1H93A 2NWQA 1BXZA 3H2SA 3IJRA 1PZEA 3U9LA 3ZHXA 4UVDA 3GZ4A 4WEOA 1SEPA 1T26A 1JDJA 1H9AA 1O95A 1DLJA 3E9QA 5G2OA 3JQ9A 2OP0A 2P9GA 1PJ3A 2YYYA 3FBGA 2C20A 2Q49A 2BGKA 4YJGA 4TKLA 1LDMA 4XA8A 1F0YA 5IZ4A 1E1LA 2VUTA 1I01A 2H63A 3GDOA 3NDJA 2POQX 3WYBA 2R2GA 4DC1A 5HRUA 1PJLA 3G3EA 4A2CA 3ORFA 3A9WA 4D0RA 4IINA 2PLAA 5L51A 3WIDA 4MDHA 3SXPA 5C7IO 3CSDA 3D7LA 4XX0A 1JKJA 5JDCC 1SB8A 3RUCA 1T24A 2HRZA 4CM8B 2R6JA 5ES3A 2BF7A 4CUJA 1IE3A 3MJTA 4E33A 5DP2A 4JLWA 5CEFA 1GZ6A 1I3LA 4A03A 1YWGO 1AN9A 4I9NA 1Q0LA 2WD7B 3GDGA 4DIFA 4OYRA 2NU9A 2X1HA 3SVTA 2WE8A 3FNEA 5H83A 4LGVA 1HKUA 3JQFA 1PSDA 1QKIA 3K30A 3I52A 2HO5A 4Z9FA 3GOHA 1JTVA 4GX0A 3W4IA 1PEDA 3VPSA 3OEYA 1NXQA 3C24A 2O3SA 4H3VA 7MDHA 3PEFA 1E5LA 3O26A 4XZ3A 4GVXA 1I3NA 3WLEA 4A5OA 1I36A 4DUPA 3KTDA 5EERA 4HWKA 3AW9A 1HT0A 3DC2A 1I2ZA 2PZKA 1D1TA 1G6KA 3P2YA 2C7GA 2DLDA 3CPSA 2CNBA 2RH8A 1L7DA 2X9VA 5MGBA 2C7VA 1WLYA 4YAGA 1DAOA 2UDPA 4Z0PA 3GNQA 2FZWA 4HUJA 4A27A 1KEVA 2CZCA 4IS2A 4NBWA 4R3WA 1MG5A 3KB6A 5FI5A 2J5KA 3L0DA 5AQ1A 3QV1A 4FFRA 1MV8A 1Q0HA 1I24A 3BHJA 3GPIA 5JO0A 3JYOA 2GLXA 4UEKA 4CLRA 5KOIA 4DYDA 1JKIA 4YR9A 5AOVA 3DHYA 3WB9A 3DXFA 4LCEA 1IPEA 4J3FA 2Z1NA 1GQYA 3G1UA 5A04A 3PXXA 1K0UA 4XR4A 4WNCA 4FFLA 3JD1A 4AJIA 1GTMA 2YFQA 4CR7A 4QFCA 4B4VA 4EW6A 3H9EO 2CFCA 2G5CA 3BYZA 4U7WA 1ZSNA 1XA0A 4CLXA 3EYWA 3SLGA 1UZNA 4AJ4A 2G82A 4EUHA 4AJEA 3ANMA 4IJVA 4Y67A 1DJQA 2PGLA 1T1RA 1GYPA 1ORRA 4K26A 5C7OO 3KOUA 1H2HA 1AUPA 1O8CA 2BGMA 4NG5A 5THQA 3BAZA 3DTTA 4JX8A 4J4TA 6LDHA 1DAPA 3KSUA 3ZZNA 4UREA 3F1LA 4NFHA 3EZYA 4CMJA 3H5RA 3JTMA 1X14A 4B4WA 3DDNA 3HNPA 4DIBA 3FF4A 1LQTA 1EK5A 3LC1O 3GFBA 4NJOA 5TLSA 1W8DA 2HQ1A 3QE3A 1LRLA 3S8MA 2D4AA 2I66A 3EGOA 2W4QA 3LK7A 2EERA 1OMOA 1QYVA 1Y5RA 3DAGA 4YPOA 2NVUB 2TMGA 4IDGA 3GAFA 2J3JA 1IOLA 1QV7A 4JIGA 3HDJA 1FDUA 3M1LA 5DBFA 3DTYA 4JN6B 4N5NA 4EBFA 4R54A 2YHIB 3KYBA 4E4YA 2Q45A 1ZJYA 3BTSA 3WR5A 3JD2A 4NH4A 4D46A 4D3SA 3EK2A 1HE4A 2B5VA 3I9LA 3KXDA 4IDAA 4BL5A 3GG2A 1ZVMA 3PHHA 3O9ZA 1J6UA 4JROA 4UVEA 4URFA 1W73A 3ZWCA 2PY6A 3PVZA 2PNFA 4LISA 3RU7A 1PX0A 4MP8A 1RM0A 1YVEI 4XD2A 1TEHA 3WDSA 5ADHA 1ZCJA 1LDNA 3L77A 2O3UA 4R5MA 1E1MA 1ONNA 4D45A 1GUFA 2NVBA 1XU7A 5K9ZA 4ZQFA 4G81A 3JQBC 4XGNA 4JBHA 2CMDA 2A92A 4B3HA 3TJRA 2HUNA 3H3FA 3NTRA 3B6ZA 3EDMA 4FC6A 2IXAA 3IKTA 1NWHA 1GZ4A 4YAJA 2CVQA 5GY7A 1NQOA 3BMOA 1NFQA 3OIDA 2LDBA 3BMCB 4YJHA 3DR3A 3RI3A 5KKAA 4PLWA 3LC2O 4KMSA 2DVMA 1I30A 1H0KA 4OXNA 2O7SA 4BNTA 2IRWA 3W8DA 5CEJA 1ID1A 3MJSA 4PLFA 4P4LA 3OEWA 1XIVA 4BHTA 5ICMA 3EUWA 1SAYA 3VH2A 4WOJA 1YOVB 3DBRA 3QWIA 2AA3A 4CODB 3TOZA 4B4OA 3Q11A 4J1NA 3ZWYA 4YVFA 2A35A 3HB4X 4XYGA 3G1TA 1T2EA 4OAQA 5EJ2A 3PJEA 4I1IA 4X54A 3JQ8A 2GR9A 1GADO 2CDAA 2XAAA 3JQ6A 4B7UA 1B15A 2O4CA 2R00A 2GZ2A 2YUTA 4QXMA 5IDXA 5ENVA 1UDBA 3PHJA 1VI2A 2BFOA 2EF1A 4M87A 1NQAO 5C5IA 3OJEA 4MJLA 3P7MA 4R1SA 4RV9A 3WTBA 4C7KA 4BNLA 4GVLA 3H5AA 3MJCA 1QR6A 1N7GA 1DC6A 5BSEA 1EUDA 2V6GA 4B7XA 4CM1A 5JBIA 4RVUA 4J1TA 3LF2A 1FXSA 4WK6A 3EVNA 4J91A 1LSUA 3DBVO 2X5OA 3T7CA 1NPTO 3UHAA 3WSWA 4JQCA 2EP7A 5CDUA 1F8FA 1PU2A 1O0SA 2WD7A 2WTBA 3ZW8A 1VE9A 4ZHSA 1BWSA 3DWFA 1HZJA 1D7OA 3E48A 4U0JA 3R3SA 4ZVVA 3QLJA 4GKBA 1E3IA 4FCCA 2DTEA 1UP7A 1EQ2A 2Y67A 5I7EA 2YFHA 4HV4A 3G17A 4DL9A 2B5WA 4FGWA 3D5QA 1NVGA 1QYDA 1HSZA 2B4QA 1AGNA 1EMDA 3R0IA 3WJ7A 2X0IA 4BNFA 5FF9A 1D4FA 1YB1A 2GSDA 1ZZEA 1E3SA 2OBYA 4PZCA 5L4NA 3U5TA 2AEMA 1O9BA 4J0EA 1B3BA 1ADGA 1LDYA 4YQZA 3ETEA 3NTQA 4EZBA 4EUEA 4IJUA 2VYVD 4YAEA 5T57A 4XCVA 1BTOA 3VAZA 1TLTA 1K3TA 1R4MB 2B36A 3ZGYA 4GBJA 3NT4A 1A4UA 4YCAA 3CH6A 4IMRA 3WSVA 2B35A 4RF3A 4KTTE 4NDNE 1K6JA 4XB1A 1YQGA 4RJTA 2WEKA 2VRCD 2EWMA 1KVUA 2JFGA 1U2GA 2I3AA 1T2AA 5JYEA 1EFLA 2CUKA 5KIAA 1M76A 4KQWA 1HDCA 2DBRA 2FR1A 1NVMB 2CSUA 2RIRA 4PLPA 4ZRNA 3VH4A 1AHIA 3CUKA 4YT8A 5MDHA 2VWQA 4XYEA 4RPGA 2NTVA 4QSMA 1X0VA 3JD0A 3OJLA 5F1OA 1HZZA 3WGOA 4CV3A 1MFPA 2FZEA 3HG7A 4WLUA 3WMXA 4M54A 1KVQA 1KVSA 3GMDA 3RC2A 2VOEA 2B37A 2X6TA 1M67A 1GDHA 4XIJA 4UEOA 1XKQA 2JHGA 2X0RA 2JJYA 2IYPA 2WMDA 3D4PA 1YKFA 3F46A 4K6FA 3SC4A 4MIOA 2OOSA 4XDYA 4XJSA 2XF8A 4K28A 3HUDA 1HDXA 1RM5A 1NAHA 3GY0A 1PZGA 4LRSB 5JDIA 3NKLA 1ISFA 1C14A 2X86A 5GZ6A 3ZU4A 5HBRA 1R4NB 5A5EA 2D1YA 1HF3A 3WOHA 5CDTA 5F1PA 1KY4A 3QY9A 3VPXA 1IUKA 2G0TA 4Y6PA 3KLMX 2FWMX 3TZQA 3VZSA 2VHZA 2NVUA 4M8SA 3KZVA 2DM6A 5HS6A 3EY4A 2I76A 1ISJA 3UGKA 1E1NA 4YJGB 3RFXA 3IQDB 4PLHA 1BDBA 2YHIA 2J6IA 1YJ8A 3MCVA 4N18A 3VOSA 5H82A 5BNIA 5AVOA 1TVEA 1JU9A 2GN6A 2P5UA 3H6KA 4GWGA 3GRKA 4ND3A 4W7IA 3U0BA 2CF6A 7ADHA 5J23A 2JL1A 3GVIA 2DKNA 1A9YA 3K2EA 4ID9A 3ROQA 1JWAB 3W4KA 3JQDA 4CV0A 2V65A 4DC0A 2VOJA 2AXQA 2GDZA 2JAPA 3L4BC 4UUMA 4Y6SA 1C0LA 3CZMA 5G0TA 2VRBA 4XB2A 3ANLA 4J4HA 4YB8A 4Z0HO 3IP1A 4FFMA 4KWIA 3WTCA 4RPJA 2GD1O 1NASA 2CD9A 5A9TA 3M2PA 1U3VA 3I9JA 3ZWXA 4C7JA 2ZK7A 1SNYA 3WGZA 1E1KA 3S2EA 4W82A 3VZQA 2IXBA 1PL7A 4NIMA 4ZQEA 4R5HA 4F3YA 3IC5A 5AXCA 1W6UA 3AM4A 1GAEO 1LXCA 4TRJA 5A5FA 1PGNA 4UVHA 1ZXLA 1DC5A 3PP8A 5I8ZA 4FB5A 4LVUA 3HN2A 3CIFA 3UW3A 5BNFA 1LLQA 2GN8A 3H9JA 3BMCA 5ILGA 4GLLA 2Y1FA 3PJDA 3LT1A 2OXIA 1ZKMA 4BMNA 1WVGA 3EC7A 3VH1A 4NJMB 4DBVO 1YRLA 5IN5A 4D3FA 4WLFA 3KEQA 5DCYA 1GL3A 4BO4A 2G76A 1YB5A 3A28A 4LSWA 4L4XA 4RLSA 2ZKLA 4A10A 4I9HA 1CWUA 1ISHA 1TI7A 1YOVA 3I9KA 4HFMA 1AE1A 1PZFA 1NWCA 4W4TA 2DUWA 2HMVA 1HLDA 1UXKA 4OHUA 3BMQB 5JC1A 2BFMA 4TMFA 4DA9A 4RF5A 1IYZA 4CMIB 2J5QA 5KVQA 1NPYA 1SB9A 1P74A 1DLIA 3NEPX 4IJKA 3FBTA 4N5MA 1PS0A 3PHLA 4BMVA 1VL8A 3FWNA 3R6DA 2VZ0A 3Q0EA 5IDQA 2VNSA 1OC4A 1C0PA 4HP8A 3PYLA 5EL0A 5BSFA 2DUUA 4M49A 3KVOA 3ZHZA 1FDSA 4J9VA 3DFUA 4OH1A 4BB5A 3NDRA 1VJ1A 5HM8A 4WCFB 1PJTA 4D41A 1YH3A 4EEZA 1MX3A 1KVRA 2ZCUA 1U3WA 1NP3A 4YAKA 1KEWA 2X58A 1XLTA 4MKXA 4XQEA 2ZB8A 3ZWMA 3C7AA 4XEHA 3N74A 4L76A 4GX5A 2X0JA 2G1UA 1U4SA 2WJPA 4FQ8A 4IUYA 1E6WA 1ZW1A 4JJGA 5TF4A 3T7EA 1NFFA 4YT4A 4YXFA 4WKGA 1MUUA 1ONOA 1IHYA 1ONPA 1UR5A 2P4QA 3PHIA 4XQCA 3BMNA 4GX2A 3S2IA 4P22A 3QW2A 3ZH2A 1E5QA 3TSCA 4CQMB 4EEXA 3ETDA 3Q9UA 4PIVA 1NX6A 2PD3A 2E82A 3GVPA 1WAMA 2UVDA 4R1NA 2PTGA 1I2CA 1P1IA 4E2WA 1RPNA 2PK3A 1J4AA 3NX4A 2VTEA 4IGEA 1K5HA 5KKCA 3DEYX 4RVFA 2P9CA 4QUKA 4WE3A 2Q1TA 2D2IA 3L6DA 3MJEA 3ST7A 3SX2A 3VHRA 5CPFA 3GZNB 3GGOA 4OM8A 3GG9A 4IM7A 1R4MA 3PQEA 4J1SA 4NZ9A 2VUUA 4IQGA 1CYDA 4NNJA 4R41A 2QRJA 1XQ6A 2GN9A 4DIOA 2DTXA 3QIVA 1G0OA 3RQSA 3GUYA 4FJ0A 1Y5MA 5THKA 3ROMA 4Z9YA 2AW5A 2DFVA 2HK7A 2JCVA 5EN4A 1GPJA 2Y1OA 3RC7A 3WGTA 1A4IA 2NLOA 1LX6A 2JD0A 2V6MA 4QECA 5HS4A 3D64A 5JAQA 3ICPA 2HLPA 2VTDA 2OL4A 1ADBA 1DIBA 3RJ9A 3WWYA 4BO2A 4HNHA 5U4QA 4EGFA 4NMHA 3OIGA 4MVJG 1YONA 1CETA 1PIWA 1K89A 3CINA 4E5MA 2CVOA 4OXYA 4XIYA 2DBVO 4XJTA 2AEJA 1JA9A 1B8VA 4PLTA 2Y1GA 3AWDA 3AM5A 3H65A 2PGJA 1HWYA 2X9NA 2BFAA 4A73A 1S6YA 4YRBA 2GPTA 3KUXA 3K9QO 4DLBA 1M66A 4JNKA 4ESOA 1RM3A 3AFNA 2BHLA 4WLOA 1PQUA 1ZNQO 2PWZA 3ETGA 1R4NA 4RORA 3TFOA 1J5PA 3Q2KA 4RQTA 4XDZA 4I5FA 2GZ1A 4BKPA 3WFJA 4AJOA 1ZJZA 3GNSA 1LRJA 2BLLA 1R0SA 4LVCA 4FDAA 4TWRA 5AYVA 4ITUA 5ITVA 3HN7A 1H9BA 1QSGA 1U8XX 1YE3A 4XQ9A 3H5NA 1MP0A 2NTJA 2FR0A 1EEHA 5EINA 4CUKA 4MVJF 1ENZA 1A7KA 3HSKA 5B37A 4FOOA 4EI2A 4IXWA 1FDVA 2VUSA 5TRTA 1DBVO 2NM0A 4JK3A 1PJQA 4W9NA 2YDYA 4HXYA 4B8WA 4GQAA 4YQYA 2HMWA 1MA0A 1FDWA 2Q2WA 3B20A 3G79A 3IKVA 1DFIA 2QRLA 4AJJA 4HFNA 3AUAA 3L6EA 1HRDA 5GZ1A 1JVBA 2NSDA 3INTA 4PG4A 2XPCA 3CKYA 1J0XO 1Y8QB 4MP3A 5IJZA 1IB6A 4NU5A 3ZV6A 1EE2A 1EUCA 1Q0QA 3GFGA 1GD1O 4CMBA 2YQ5A 2YDXA 5I8WA 3AUSA 4J6FA 4NHEA 3U3XA 1DSSG 1H94A 4IDDA 3UKOA 4UVIA 4D43A 3INGA 3SLKA 4RZIA 4ZD6A 5FYDA 1V3TA 3W6UA 1LEHA 2ZCVA 4Y8VA 4BNNA 1NYTA 5TSDA 1DFGA 3NRCA 1Q2XA 1YQXA 2VWGA 3ZI0A 5TC4A 3MJVA 1E7MA 1NVTA 5TNXA 4GLOA 4WOKA 2EGGA 1PZHA 3IMFA 1QG6A 3QHAA 4NJMA 3BA1A 4YRAA 1CQIA 1DOHA 1C1XA 1GUZA 3JQGB 5A06A 3FR8A 2QG4A 2D0IA 1U7TA 2IODA 5T8KA 4BGIA 4OQZA 4XWYA 1PR3A 5T6BA 5COBA 3DL2A 2JCXA 1VSUA 1Y81A 3KV3O 4WJZA 1I3MA 1E6UA 3PYXA 3PWKA 2RCYA 1SZJG 3BMQA 1VJ0A 1ZK4A 3V2HA 4CMIA 2DBQA 2FRDA 4YAIA 1Q7CA 1IZ0A 4DYVA 2LDXA 4MKRA 1H5QA 1WWKA 2G17A 4BNYA 4TZKA 3VVBA 3NGLA 2VZ8A 1P44A 4FGSA 1BMDA 3CEAA 1YL5A 3IS3A 4CQMD 1ZK1A 2QX7A 1O94A 1U5AA 3ENKA 2B69A 2NU6A 2RAFA 1VJTA 4B4UA 1UH5A 1L1FA 4WCFA 3JQAB 4PLCA 2E6UX 3WLFA 4BQPA 4RLHA 3W6ZA 2HJSA 1KERA 4UUNA 1CF2O 4JJFA 2CY0A 5T67A 4DLLA 3ITDA 4PZDA 1G1AA 1M2WA 2IZ0A 2PKQO 2ZB3A 3DOCA 5IZCC 4FW8A 3DMTA 3WIEA 1SOWA 3V8BA 2P4HX 4D3DA 3LSYA 4OXKA 4AFNA 3PTZA 1AXEA 3KLPX 2VZ9A 3PRJA 1IHXA 1U4OA 1U5CA 2QYSA 2WM3A 1R15A 3UCEA 3W4JA 1VKNA 2X9GA 4CQMA 2NVWA 2X8LA 2GZ3A 3DAFA 3MOIA 1UXGA 4R16A 3C1AA 1R66A 1ZBQA 5KJ1A 3L07A 4U0KA 5LCXA 3TQHA 3VPGA 3PQFA 5HTOA 4IJWA 3O03A 5DBGA 3Q1LA 2C2XA 2C54A 2NV6A 3KYDB 4J49A 3GZNA 4IDEA 3T4XA 4Y9DA 3BHMA 3C1TA 1PJ2A 1Y6JA 3E82A 4JCOA 3HJAA 3OA2A 1VPDA 3DQPA 3JQCA 1LSJA 4KDEA 4PG6A 3ZNOA 4RL6A 3L9XA 4FFPA 1F14A 1A71A 1S7CA 2FSSA 4CMEA 1U1IA 2QW8A 5JDCA 1DRWA 1KS9A 1ISGA 4L4RA 3IAHA 2QYTA 4B79A 2HSDA 3C3XA 1X1EA 3ZWOA 1DJNA 5L9AA 1B16A 1PGOA 3DOOA 1E3LA 4YJFB 4BO3A 3PK0A 2FPPA 2WYVA 4DMLA 2OUIA 2JFFA 2J3KA 4WPGA 1A72A 3MTJA 1H6DA 2RBEA 1V0JA 3FD8A 3K2BA 4BOYA 4CLDA 1U8FO 4XYBA 1Z45A 4I5GA 2EGHA 2D3TA 2EP5A 2O7QA 3LF1A 3K5PA 3QJ5A 4TZTA 4RPKA 5IDYA 2DT5A 5JFOA 4E5YA 2Y1DA 1Q7BA 4BNVA 3LT0A 3M6IA 4RGBA 2OFPA 1JAYA 1HE5A 3P19A 4NK5A 4Z6KA 4UVGA 1CIVA 3F3SA 1MG0A 2ZQZA 1M75A 4D44A 2J8ZA 3E18A 3QVWA 3W1VA 3TOXA 3JQEA 4ALJA 4TQGA 5HWSA 4RF4A 1GQQA 4MO2A 1XG5A 3MZ0A 2O2SA 1QYXA 1UAYA 1V3UA 3E5MA 2Y0CA 2PZJA 4WECA 1I2BA 5BQFA 4CMGA 4WASA 1WW8A 1JAXA 1A7AA 1KVTA 5L3ZA 1NTOA 2YV1A 3GT0A 1HDYA 4BO0A 4FN4A 2VHYA 3H7AA 1Z7BA 9LDBA 2A9FA 4HBGA 2Y1CA 5KVCA 5KCZA 3QA9A 3V2GA 4BNHA 3WGQA 3K92A 4AJNA 1DC3A 1DPGA 1GCUA 2Y1EA 4M1QA 2PGDA 3D1LA 1ISIA 5K6AC 1ADCA 3WQRA 2HKIA 4G5HA 4OKNA 5JLAA 3GAZA 5BSGA 3GVHA 4L9RA 3PFFA 5BR7A 3PZRA 5FEUA 3FN4A 4O5OA 3V1TC 4GAEA 3RWBA 1N1EA 4RDIA 4GSKA 3DZBA 2A94A 5L4SA 3RU9A 5B4UA 3STHA 2RHCA 1ZH8A 1PGPA 2VWHA 3TNLA 4ALLA 1DIRA 3BMNB 4GL4A 3V1UA 1Y8QA 1A27A 3D3WA 3U4HA 3RBZA 3QVOA 1XHLA 1R6DA 1BXGB 1R0KA 2C5AA 1YBAA 3JD3A 2AG8A 3G0OA 3AOGA 4QO8A 4Z3KA 3AY7A 4YA6A 4P4NA 1PR9A 2OORA 4DPKA 3ASUA 4DRYA 1ZEJA 2H9IA 3LZ6A 4M89A 5TS3A 5IFLA 4PG5A 4FJ1A 1MC5A 1EBFA 5JMWA 4D0SA 3LT2A 3PYMA 4NFSA 1IZ9A 1UXJA 1KYQA 3LLVA 1ZSYA 4U8GA 1K6IA 2BMAA 2VT3A 3JQGA 3JQAD 1PL8A 4NBTA 3S2FA 4H7PA 4A26A 1HE2A 1UJMA 5A05A 3E03A 3B1FA 2FP4A 3IP3A 5DNAA 4ZJUA 3NV9A 3I3OA 3X2FA 3DZFA 4DGSA 3H4VA 1V6AA 4DVJA 3N58A 3SJ7A 1ZMTA 2DAPA 2HCTA 4F6CA 1NR1A 4GKVA 3KYCA 2BRUA 1SC6A 3E1KA 3JQBA 1I8TA 1BVRA 4J2HA 3AOEC 1P1KA 2FPGA 2HK9A 3K31A 3PGXA 1B8PA 5CFZA 2PR2A 3H2ZA 3JYLA 4ILKA 2D8AA 1P77A 2X7HA 1YO6A 1FMCA 2PFGA 3IOYA 3QWHA 4Q3AA 4CL8A 1GEEA 1T2DA 1VRWA 3JQAA 2XXBA 2WDZA 1KBZA 4P8RA 1DIGA 2CDCA 4CM5A 3WYCA 2E37A 1UXHA 2FN7A 2HU2A 3O4RA 4S1VA 1WZEA 3FHLA 1HEUA 5L53A 2NACA 2WYWA 4OSPA 3OSUA 3AI2A 2Y68A 1BW9A 3WNVA 1CEQA 4AJPA 1H6CA 4FPXA 4BO5A 4CV1A 5C3MA 5A02A 3GN2A 1KEPA 4E12A 2ZQYA 2PH5A 3NTOA 2EHDA 5JCXA 3OETA 3JYPA 3AI1A 2P68A 4CMKA 1VM6A 2NTNA 4OKIA 4QQRA 3JYNA 1Y9EA 1Z73A 3DZKA 4Z0TA 4C4OA 4YTEA 5FFFA 3X2EA 3GNTA 1E6EA 3JYQA 4BS9A 1QP8A 1NNUA 4H16A 3ZHBA 1SMKA 1N7HA 5AXDA 1KY5A 4BUCA 3ZWVA 1P3DA 2EG9A 2O48X 1LLUA 3H9QA 3PGJA 8ADHA 4G65A 4IMPA 1PS9A 1E7RA 2ZB4A 5JXWA 3PWSA 4DQXA 4XRRA 2PKRA 4AVYA 2ZIZA 5EIOA 3KYDA 3HE3A 3ZV5A 2IZ1A 2OGUA 1I3KA 2UV8A 1ZK3A 3ULKA 3OMLA 1ZEMA 4F6LA 4MPDA 1T1SA 3FWZA 3KSDO 4LN1A 3TWOA 1KEUA 1F06A 2NQTA 2VQ3A 1X7HA 2Q99A 1OOEA 5G0SA 1JQBA 2ZTUA 1EQUA 2O4UX 3WNQA 4D79A 5EMHA 1SOVA 4INAA 1ULSA 4ALNA 1D1SA 2EW2A 2GNAA 1LUAA 1NHGA 1DHRA 1TB4A 1LSOA 3FTNA 5JO9A 4YJFA 3KM0A 3JQ7B 5TIIA 1P0CA 4KOAA 4MVJD 5COAA 4HY3A 4CR6A 1E7QA 1E0DA 1X13A 3COSA 4BV8A 1U28A 3GVCA 4MIEA 2FSVA 4PCVA 4NBVA 2IE0A 4HADA 4EDFA 2JFHA 4MKZA 3I9MA 3RJ5A 1C1XB 1GQ2A 5CHEA 3UCXA 1X0XA 4EJ6A 4Q39A 1FJHA 3IL2A 4R1TA 4R9SA 1DRVA 3ZWPA 1LA2A 1Q1NA 3I9OA 4PLVA 1ZK2A 3W8EA 1ENYA 5T5QA 3IUPA 2YJZA 5IAAA 1X1TA 1HDGO 4L0QA 3HDHA 1B8UA 3PFWO 3UFXA 3BTOA 5KWEA 3RUFA 1TT7A 3T4EA 4I8XA 2O3RA 4Y98A 3VTFA 4QO7A 5DF1A 2Y05A 5EPOA 3DBHB 3SEFA 3AY3A 4MVJA 4KUEA 2BKAA 4ZU3A 3E9NA 2EIHA 4QT0A 4B3JA 4GX1A 3JQ9C 4L74A 4N7RA 3I4FA 1GYRA 4FFOA 1PJBA 1ZUD1 4TRNA 4BO1A 1E3JA 5L7TA 1T25A 4PLYA 4PG8A 5A1TA 3VC7A 2X5JO 4RPLA 1T4DA 1YBMA 1R12A 4E5KA 5LC1A 1U9JA 3AFMA 4DPLA 5A9SB 1K6XA 3KO8A 1DEHA 3OA0A 2D59A 4BO8A 4GSLA 1N5DA 4CM3A 1LC0A 4L8VA 3WQQA 1LDBA 3SJUA 1GEGA 1JVSA 4BGUA 1H6BA 2RH4A 1FK8A 4PZEA 1XGKA 2GCGA 3ZNNA 3K6JA 1KC3A 1EVYA 3ZDFA 3OM9A 4J43A 4JGBA 1UP6A 3IJPA 2JAHA 4ALIA 1ML3A 3JQFC 4O63O 5K0ZA 4IIVA 1DO8A 1RYDA 1F12A 4CR8A 4EJMA 4WUVA 4AICA 3HHPA 4BKOA 1P1HA 4OOEA 5H81A 2JHFA 3A1NA 3GN1A 1EFKA 3TPCA 4CMHA 3S2GA 1BXGA 1V35A 1B26A 1P45A 4DXHA 2DC1A 3IUSA 2OMEA 5JE8A 4J16A 3DOJA 1O6ZA 3RSHA 4J1QA 1PGQA 2FMUA 5JC8A
chains in the Genus database with same CATH superfamily
2R6CA 3GMSA 4HEQA 3SQDA 2B0JA 2I33A 3GCDA 1OIWA 1E9CA 3RVKA 1ICEA 4JU9A 4L6IA 3UJ8A 5A3QA 1QP7A 4MVJE 4D4LA 2RK6A 3Q3CA 3QVTA 1CUYA 4RFVA 1L7VC 2QK4A 4RK5A 1HLFA 5J5CA 4YT2A 1NVDA 4NCXA 3KZMA 2D4HA 2UUPA 4FIZA 4ROSA 1GP2A 3KBOA 4JMPA 5BW5A 4MAMA 5EJAA 4FK8A 4DLVA 1VCHA 2B2NA 1J7KA 1BG6A 2MSCB 1EK1A 1X15A 4G2NA 3CNHA 4OOFA 5AW2A 4N8EA 5H8WA 4N7JA 1X42A 3H3XA 3PHBE 1N3IA 1GPKA 1P8AA 4E4RA 1HT2E 3VR5A 1H8HA 2LNDA 4KO3S 3RASA 1T8WA 1GIAA 4BKMA 4AIRA 6Q21A 2GCIA 1IUNA 1MC4A 3S44A 1Y9AA 3WL5A 3R7BA 1WPQA 3NH9A 2L2QA 5BSKA 2JHAA 3ZWNA 1KIFA 4CM6A 2BKXA 1OTXA 3FOWA 1EEXB 2AGVA 1HYEA 2ODPA 4UDXX 1NY6A 3UVEA 5DOZA 2F48A 5ER9A 2GM4A 1F8UA 5E1OA 2X0NA 2SHKA 2PKEA 3GRPA 4YPFA 1PUJA 3TLEA 3UHPA 13PKA 3LOPA 3MWEA 5CYPA 2VHXA 1Q3TA 1WMBA 2ZXUA 3EUEA 2EXXA 1SC4A 2NO9A 4G1FA 3KEOA 4MIYA 3ZNPA 1ONBA 2HBRA 4EPVA 1XMIA 3UANA 1SOUA 3MRXA 3OUZA 1N2SA 1MLDA 4GBMA 3I6IA 4JCCA 4TRMA 2JVKA 4MGHA 1N6RA 1OXTA 4BFLA 5B64A 4A6PA 3NBAA 4HB3A 4R9RA 3P9RA 5KJ6A 4X1KA 1YC2A 2EDCA 3EF0A 3F0TA 4S1PA 4MWTA 4HNGA 4MYSA 3TLAA 4KXVA 4ZODA 4H60A 3K7EA 3AF4A 3NUGA 4PXYA 3EQ2A 2OYRA 1M10A 4O1MA 4P4GA 3DBLB 5F35A 4INZA 3ILVA 1EE9A 4IY1A 1UT8A 4QUJA 4FINA 3HEAA 3RVBA 1TU3A 2BM9A 3EWIA 3HSYA 4RHYA 3HKBB 1GRCA 3RUIA 5ICSA 4AZSA 1G8JA 3WL6A 3T1YB 4MPTA 3DMYA 2QNRA 3CH7A 1K7XB 2H1IA 3A6KA 4YRCA 1K97A 3NKVA 2KSQA 3EF3A 2NU8A 1V45E 2VYQA 1G9SA 3ET5A 1DFHA 5HX7A 3MOSA 2XNKA 3JVDA 4E2ZA 2A9KA 1G9TA 4KLCA 4AJHA 5B3LA 3WHLA 3TUZC 1T9GS 3EZLA 1FFYA 3WLNA 1YZVA 1GPDG 1EAYA 1LBIA 3OBBA 2CBXA 3M3DA 4JLNA 3MLEA 4EFKA 2OP1A 3ONFA 5LPNA 5ALQA 5LQMA 1TRKA 5ECYA 4II3A 1Q50A 1ABEA 2YHAA 3I5YA 1VG8A 2P6PA 4E21A 2XQGA 2AKAB 2BP7A 3KT8A 5TF0A 3IBFA 2R97A 1AQUA 3KXKA 3Q0IA 4F6RB 2WTEA 5BPFA 1JYFA 2PL9A 4LCBA 1C9YA 2RGCA 2JCBA 1C0KA 3K8YA 4HAIA 1O4WA 1AURA 1SHZA 2ACEA 3WK5A 5JCJD 3NMUF 3AO0B 1E77A 3FHCB 3PU6A 1P1RA 2A0FA 4CMEC 1P9LA 2LIVA 1Q7TA 5IBCA 4CTOA 3WIOA 4RHFA 1NN1A 1T13A 2HWKA 3S2SA 1RCFA 4OJMX 5JADA 2XB2A 3NPAA 4NE7A 1RKUA 2YYSA 3LM8A 3RCBA 3ZNQA 1WXFA 2W98A 1N8TA 3L02A 2WAMA 1J23A 4C2AA 3PRHA 4BNGA 1ORHA 4NAVA 1Y9JA 4K8RB 3R7NA 1AS0A 2FA9A 1BA3A 2EBWA 1CZKA 1LZKA 3TEFA 2HLHA 2P2SA 2HHLA 4PPGA 3EDCA 4Y6OA 4C6TB 1UKBA 2DETA 4CMCA 5ERXA 4CCSA 4BO6A 3GHHA 3ILXA 5HRCA 5KHOC 2DKFA 5H9VA 3WQHA 5B1EA 2R8OA 3O8CA 2GK3A 3G6KA 3WGYA 1WUHS 4NCHA 5E2AA 3CFYA 3ZY3A 4CJXA 2IU6A 1IXSB 5JH7A 1ZRMA 3OE4A 1AKEA 4ONEA 2O3JA 4ESVA 3ABQB 2FSFA 1GUYA 2YW2A 3JX9A 4TKMA 2Z5FA 2CKMA 4IVPA 5JCJA 5JAMA 1FIUA 2AVDA 3H2IA 1XTKA 3NNSA 3BIJA 4MQ5A 4NE2A 4Z9XA 4EUFA 3MWJA 3IUMA 2O2YA 5EJ9A 3KYCB 3H1PA 3KAPA 2AXPA 4PG7A 5E6SB 1HL3A 1XQXA 3PUKA 4XVQA 3TK1A 3SYNA 3GLRA 3AR5A 4J8PA 4RYDA 3ZU3A 1DEOA 4ZI7B 3WX0A 1A8IA 5FO0A 1SEVA 4ZQBA 3A37A 3LVFO 2D06A 4BVAA 1Z34A 4EARA 1MQ8B 1JEDA 1I10A 3EQ6A 4R4JA 2PD6A 3JCZA 1TO1E 5H3LA 4HNAA 1TCUA 1VL0A 4GKAA 4CTNA 4YJ3B 5TQVA 4R51A 2JH9A 4YMWA 3OJFA 1KE1A 4YRNA 1YS7A 1TTTA 3N70A 1V8FA 1USGA 4ZAFA 3G8AA 5I9NA 3I01A 2O5EA 3H4MA 3SVZA 4OUDA 2AOUB 2C2YA 3RU2A 3PIRA 4CRWB 3DE6X 4I8IA 4BAUA 3MD9A 3VC1A 3SHFA 3ITEA 3QI7A 5LNK1 1TMOA 1NG9A 3RLFA 3JR3A 4UU7A 4HLDA 4RGVA 3SOPA 1ES9A 4G4JA 1ZVVA 5LQUA 2C57A 4X0EA 4ZZ2A 4DDTA 1UKZA 3EF1A 3WV5A 5LP1A 2JH3A 3G2PA 1K86A 1DKUA 2IQIA 2FEWB 3WLRA 3R3JA 1K6MA 1HYQA 2VSYA 2WU8A 3FNHA 2QTZA 1UM9A 2J3EA 3OU7A 5KNLA 1V1RB 1RIFA 4A8JC 3QF7A 3LGAA 4UM5A 2BJWA 1Z12A 3HWRA 3TEJA 5K0NA 3D3JA 5IMBA 4GXRA 1MJGA 1J42A 1BMTA 2BBOA 3MSCA 2QQ5A 4WI1A 5DM0A 1FQJA 4C0SA 4YMHA 2C04A 1F2TA 2WTNA 2YY5A 4LJ6A 4RZQA 4EHFA 4V1CB 3FFAA 4FWIB 1B14A 2DGDA 5E0OA 4DLAA 1A1SA 1Q83A 1GFIA 4BZWA 2X2FA 4P08A 4LMBA 2ZETA 1KJZA 4MR8B 3JSAA 2BGIA 2GHQA 1QHNA 4KYIB 3I23A 1Q7EA 4N3BA 3SBXA 4UOZA 1XCBA 1NJ5A 3FJOA 3EEFA 3IQEA 3OHMA 2PGNA 4BIMA 5H16A 2QL6A 4D96A 2B20A 2R5WA 2WPDD 1YRBA 1ETUA 2H17A 3WNCA 4ZCIA 5KHLB 1DAHA 3ZQKA 1SVLA 3GEDA 2YOFA 1N0UA 2NIPA 2PZMA 5CVJA 2QU8A 3C48A 1TMGE 2QB5A 3PR1A 4J29A 2DWOA 3H8VA 1QIMA 1B8OA 1NR7A 3EVDA 4NI5A 5AR1A 4RO0A 3ADOA 3RLIA 1YB2A 3BSYA 3JAKB 3AG5A 4OGLA 5TMDA 3UA3A 2XCRB 1SCBA 1OYOA 3G2QA 2PWYA 2PBZA 1MVNA 6AT1A 1PF7E 3PWZA 2C92A 3EXIB 2WD8A 3DPUA 4TSFD 1IL0A 2H5LA 2QNBA 4C5CA 1G19A 2VNJA 3LTNC 1RWOA 1OPRA 1VDZA 5KC9A 2V9PA 3A9VA 1H2WA 3KJNA 3V1KA 4O0LA 5DH9A 1T3LA 5IPFA 4IDFA 1GNRA 3RKUA 4LJLA 6ADHA 1BGXT 1V9CA 5HEKA 2XRMA 5TQ0B 1HETA 4NPCA 4N76A 3H6HA 4YLEA 3WLAA 2XT0A 4HT3B 5IG2A 3C1OA 2QAGC 5AXAA 5AI0A 4UE3S 2WY2D 2C3UA 2OPHA 3HRIA 1GU7A 3QP9A 3G8DA 1CJUC 1R0LA 1HNWB 1ZC4A 1VZ2A 3HNRA 2R87A 5SZJA 4YIHA 4DHWA 4E3ZA 2G9ZA 3B6MA 3HCPA 2OHXA 2WPDA 3NHKA 2WJIA 1J2JA 4QWWA 5J2UF 2ZBEA 1KF0A 4D4GA 1P75A 2FMIA 3PDJA 4R68A 4HPWA 4C87A 4CN8A 1YU6A 4JR1A 2XCSB 3DNFA 5F9HA 2BD0A 4U8HA 5AJWA 4CQLB 3TPZA 3HCEA 3NIDB 4BZZA 3A2LA 3CGWA 1CS4C 2HU8A 4M0KA 3AIIA 1PQWA 4FD2A 5BW4A 3UFXB 4CF7A 4ZXFA 2RB5A 3VC2A 4E30A 1SUIA 2XEDA 4KO1S 4L8WB 3FFWA 2G88A 4HDSA 4MHSA 4BNMA 6ABPA 5JS7A 4TSFA 3PQ3A 2HDHA 5CDYA 3DFZA 3TOVA 5IH7A 2OHGA 1GUAA 3LCMA 3PXDA 4DR5B 4UMEA 1EX1A 2UVPB 5JNUA 1C7ZA 3C3YA 3ZIUA 5BV8A 3C6YA 4P2BA 1NVWQ 4B8ZA 3CMCO 4ENTA 5IVHA 4Y9TA 3TPFA 2CJYA 4C4TA 4KO4S 1U0LA 3DB2A 4W1SA 4WCDA 2UAGA 1G5IA 2ZI6A 5ALHA 5AW9A 4NICA 1SUEA 1Z5ZA 4QOHA 1NXPA 1JFVA 1GCIA 3FR7A 4RL4A 5EWMB 1AXGA 3N0WA 4BQQA 1IXKA 1DEXA 1I3OA 1Z2DA 1JMYA 4R83A 2Y99A 1LJUA 1KDYA 4AYWA 2ZB7A 1Y1RA 3OQBA 4FHFA 4Q4CA 3NHYA 4Z4CA 4NECA 5KWJA 2WZQA 1B7GO 2YXDA 3H2BA 3PNBA 1Q74A 2UZ0A 3P94A 4KQGA 4TQ9A 4JI1B 4MMXB 2GF9A 1G66A 1UQUA 2X4GA 4D9FA 3T7RA 5EIXA 3L1IA 4TN5A 2AMFA 4RQUA 5ALYA 5IDVA 3EVBA 3ZU2A 4YRMA 2UUOA 4OGGA 3AEYA 4FNMA 1NVKA 1NGSA 2AQKA 4OSOA 4QLAA 3H99A 4QBFA 1PG2A 2HNAA 2UYGA 5FTWA 2HH9A 1WUTA 1T6BY 2ZRIA 4KFTA 3KETA 1NLZA 3NORA 2RE8A 2CDNA 3PD0A 4EECA 5BVGB 3DONA 3K6KA 2I9KA 4WN9A 3SJCA 3MJFA 1KQGA 1NOJA 1PFVA 5LIPA 1MT3A 2Q9AA 1YF3A 1PUIA 2EJWA 4E0BA 2VL7A 2BFFB 2DG2A 4EZIA 1N78A 2OBNA 3GQVA 3ZDEA 3IAM6 5KNDD 2AVNA 3RT9A 1LLCA 2F8SA 5G0VA 1RLOA 1G2OA 3D4OA 3G2JA 1KY3A 1QB7A 2LKDA 3I64A 3IIMA 4IV8A 4Q3CA 2ZSBA 3P27A 3R7AA 3VZPA 2CF5A 4EFMA 4ZEVA 2ANCA 3I45A 1GG8A 3LUDA 1LSSA 3OWHA 1FZTA 4ZV4A 1Z4OA 2GA8A 1VJRA 4A4DA 3A4MA 4MOWA 3VXKA 2XMCA 3GGPA 5EJ7A 1GM5A 1YQTA 2A4MA 1TM5E 3GIDA 3WE7A 3WL8A 4GLFA 3BMXA 2NNLD 7ABPA 3T1TA 1A3CA 3L1JA 1DX6A 2YV4A 1AG9A 1Z38A 4BNDA 2QL9A 2BELA 1OD6A 3B3JA 3GEHA 2YV3A 4KC0A 4L73A 5HCIA 5K3FA 5JZSA 2JKVA 1Z18A 4P5EA 2KPOA 2X6RA 1O87A 5JZMA 2ZJZA 1Z4JA 2IEBA 3B6IA 4UULA 1Z33A 1NT4A 2QUAA 5B4TA 4X66B 2Q6LA 2F1KA 2VHTA 2VTVA 1D4ZA 3QWBA 4RFSA 2H4ZA 4PYQA 3TB6A 2WWWA 3WYNA 3UJ9A 1WDMA 5KNDA 2B83A 1U63A 2X8BA 1G8AA 3DAYA 1N4DA 4AULA 2B4KA 4A2WA 4DV2B 3LLMA 2C97A 3TBFA 5HA5A 4H31A 1R8SA 2RB4A 3BHNA 3CEPB 3UV7A 4H9GA 4AXXA 4OJYA 4EYOA 4JSTA 3TGLA 1YAJA 2YFYA 4RIHA 2FW6A 3PFIA 4QRDA 4W6ZA 3EW7A 5AM1A 4D6XA 2Q46A 2W2XA 2E4VA 1DBPA 3ZI4A 3K5IA 2IP1A 4GWLA 4KR3A 1BDIA 3L7YA 4X60A 1YQWA 2GUWA 2AZTA 2PWAA 4N5DA 4CKBB 5HOQA 1JQEA 2EARA 1NOIA 4G67A 3OJ0A 5LVAA 3GFFA 2XWQA 4D8YA 4ZOQI 2EEZA 3L7AA 3RH0A 3U9SA 1DIHA 3ASZA 1FRQA 2P5YA 5BXYA 1F4LA 1NONA 1SOMA 3QWAA 1FQKA 4KXMA 4RK0A 2KHZA 1XYGA 2AEFA 3FOZA 5CDSA 1P4SA 3KLNA 5AM3A 1XTSA 5ESRA 4PPFA 1TYEB 5TS2A 2C95A 1DDOA 1QORA 2VQFB 4NDZA 2AHOA 2ZYGA 4RVDA 1G8MA 2CUZA 3DV9A 5G4KA 2EFGA 1JZQA 1A1VA 2J31A 4RAQA 3WLJA 2PLRA 1WABA 3A4VA 3LCCA 3RKRA 4HLQB 2R6FA 3CF6R 3LG2A 3A6PC 3A04A 1EVJA 2ZI5A 2RK3A 2TMKA 3WGGA 3E8XA 3WYFA 1F2VA 1M3SA 3DT6A 4RDHA 5BV0A 4WOPA 2O8DB 3A7EA 1E2KA 2AE2A 4ALKA 4KI7A 4Z53A 4KBGA 4MAFA 3ZG6A 3X0DA 2R60A 2XGOA 4K2HA 3SDZA 1G8PA 4HN2A 2I6TA 2DQ4A 4M6WB 5KYXA 4PSVA 1TT5A 2FN4A 4MVJI 3BCRA 3VDNB 3ZS8A 2NNWB 3TW8B 3WLHA 2JLXA 1M7HA 3HDYA 4BB6A 3QYAA 4DF3A 4YEDA 3O9VA 3DAPA 3WS7A 5HKAA 4FMPA 5EE0A 1Y7PA 2HDWA 1XTQA 2W7TA 4Q01A 5CG2A 3KR2A 4JWKA 4IJQA 4O6VA 4OHXA 5D3QA 5IAJA 4E6PA 1Q15A 4J7XA 4Y2UA 1EFCA 3ZHYA 2XXJA 1XL1A 4WCVA 4HAUA 3DKKA 4LV5B 1VB3A 5A4DA 5CAEA 3BJRA 3E2IA 1EUQA 3DLAA 2ACVA 3RWMB 4Y3UA 5JW6A 3E05A 1SCKA 1SPXA 2XCQA 2VS1A 4E2YA 3TJZA 5JAIA 1JKJB 5BR1A 2F00A 3JATB 1VE1A 1O6BA 5IFKA 2GN0A 1NRJB 3TRKA 3A6ZA 1NULA 3QEMB 4X8OA 3S2YA 1E0SA 2Q6VA 1X7ZA 2CXNA 4CEHA 1RPJA 3MSXA 1JR2A 1SELA 2QTNA 2A0XA 3A6DA 2XEXA 5LZ7A 5GVRA 1A8PA 3CLTD 3TDKA 4M55A 2YCBA 3B1JA 1RKXA 1PR1A 1JYEA 4WGGA 1KFKB 1USVA 1X1QA 2XUKA 5DYIA 5GPBA 5ITSA 1CJBA 4GICA 2Z56A 4GE3A 2QJTA 4M9XA 3WYEA 3AI3A 5KNCH 1N8SA 3GLGA 3JQPA 3B2EA 3FIJA 4GM4A 4DARA 5J2UB 1ABBA 4B9EA 1DU4A 2X5KO 2FPKA 3AU9A 1SRQA 1AKWA 3DZJA 3QUAA 4UBLA 3ICVA 2VFAA 3T54A 3VNBA 1OIVA 3ZJYA 5EP2A 5F21A 5A4MS 4G4SP 1OFUA 2IPXA 1DEKA 3GPBA 4AUNA 4PF1A 1KK0A 1T0UA 2X76A 2G9NA 3BGWA 1CZHA 1RYNA 2O54A 2HYIC 3Q3EA 121PA 1D8AA 3ILHA 521PA 3BG5A 5SZIA 3AYZB 5TPWB 3ZD6A 3IE1A 1VYTA 4DKJA 3MEQA 1I1NA 5FEMA 3IA2A 2F64A 3RDPA 2D5AA 3TXAA 3CUUA 5C37A 4U6NA 3QVJA 4GHWA 2N3ZA 5BT9A 1D4OA 3OCXA 1PGJA 1ZUIA 4RIEA 1QGUA 2WHQA 5CM2Z 1P2TA 2CXTA 1T3HA 4RAOA 1W36D 2O8EB 1TJYA 1J49A 5KTTA 2IYTA 4R2KA 3THYA 1L4MA 1Z0UA 4PRZA 1SUAA 4TUYF 3S1LA 4U7HA 2Z08A 5FA8A 2QVCA 4QDOA 4BJ6A 2Q5QA 2A78A 3DE0X 1OAOC 4ZA2A 4AROA 5CYFA 2Q1WA 4RU1A 4L8GA 2DPMA 1H2AS 4IPTA 4JLVA 1CJCA 2VWPA 1JG7A 5IH3A 3ESBA 1N6PA 1YZKA 2W71A 2PH3A 3WWZA 3B9BA 3RYCA 1XJCA 2R65A 2IJGX 2UZIR 1FLNA 1UZLA 3M2TA 4QEDA 1KK1A 3C3JA 4PHHA 3GZJA 1EP2B 1YL6A 2XD9A 4J0KA 1GGMA 2WWRA 3ANXA 2O2CA 4DM3A 2GZMA 4PEVA 2J9XB 3U4MA 1DBQA 2ZBDA 3AL3A 1E92A 3LWZA 3RYHA 3R8FA 1E5DA 3OJCA 3VNUA 3HFGA 3T7IA 1I9GA 4PO1A 4CF3A 3N28A 3SKXA 1NQ5A 1SU6A 1F1JA 2H1OA 4TXHA 3M89A 1C0IA 5IANA 1Q1BA 2DFDA 2ZVDA 4NCJA 2IV2X 2ASEA 2DY0A 3F5QA 5FI3A 4AN0A 1AUVA 4PN3A 5BYBA 4F9TA 2P9EA 1NNSA 1NXWA 4O4LF 4QJIA 2NO4A 3P0IA 1Q6YA 2DFTA 3F5SA 3LHFA 3Q87B 3R5SA 4KBFA 4KMOA 1GZ3A 5E6UB 3TQQA 1PP4A 1J8FA 4WVLA 3ZWDA 3A14A 3AERA 3DSRA 3OT1B 4BLOA 1KYZA 4QQNA 5IYZA 3UBTA 1FF9A 1XN1A 1FTYA 2HLDD 4GPD1 1RI3A 4L5JA 2EV9A 3UYKA 3FY4A 3LUCA 1VLVA 3M9WA 3PLRA 5LOVA 3ANTA 3DS8A 1Y7TA 3HI6A 3Q9LA 4FZ5A 4KE8A 4WD3A 3TZ6A 2FMTA 3WZMA 4FDVA 1YCGA 1J22A 3EHEA 3HZZA 4R0MA 1KZ9A 2CC2A 4NR0A 1SKUA 3PF8A 1JIJA 1Q19A 3ZEAA 2PS9A 1NL3A 4LW8A 4X7BA 4GWKA 4F45A 4POOA 4AJKA 3A9RA 1HDZA 4RVNA 4E31A 2ZS7A 4S2EA 4XYMA 4HB0A 4QIHA 1L7MA 1FNSA 1XD2B 1P5HA 2DWQA 3NBXX 4CM9D 3BSSA 4QDZA 1OLUB 3TQFA 3JVVA 1DC4A 2QZZA 4U6SA 1ZHOA 1AGXA 1UOQA 3GRCA 4QODA 3DDOA 1BU5A 4XKJA 5HQJA 2AWOA 2Z3VA 4NBRA 2FYTA 2O8CB 2HHAA 1P4AA 4M2LA 5JY6A 4O59O 5EUMA 1FC0A 1UFVA 4ZHQF 3DBIA 2EKQA 4DMCA 2A5DA 4JZKA 1A76A 4GO1A 3ROGA 3HJNA 1AQYA 4AJLA 2HWUA 2ZTVA 2HLDA 4PGFA 5B6IA 2B8EA 3CMMA 5DNAA 1QE0A 1XMSA 2IPOA 3GPCA 4AN1A 2PL3A 4EG0A 2XDAA 4E5PA 2HL6A 2B2CA 4EFNA 2W8ZA 4EYGA 2AHRA 1W4BA 4AJ1A 5C1BA 1HFWA 2HMTA 3P4XA 3JVUA 5CEEA 5L6LB 5CGZA 1HLPA 1SZPA 2WF5A 4B31A 2V5UA 3OM1A 1WIWA 5JPDA 3AR2A 1URPA 1ZD1A 1GGJA 1O77A 3RNOA 1XA4A 4OU5A 4QAJA 5E6RA 3M70A 1QWOA 1QG4A 2ZE5A 5DTIA 4CM9A 5CBKA 4BX3A 1LLDA 1MABB 1P2FA 4I4IA 2W6QA 3NAGA 2JHPA 5EJ6A 2JF0A 1I5RA 1YI1A 2PU7A 3ZLUA 2H6EA 3THXB 1JS1X 1WPXA 1J5EB 1DTEA 3PDUA 4IQ4A 2XYVA 1NP7A 3DMTC 3ZWBA 1P1JA 4LK2A 2XODA 1QS0B 3NAZA 4JJAA 1KZ1A 3LSTA 2OCGA 1TMYA 1ULUA 3WQSB 2HA7A 4IUBS 2OAGA 2Q5FA 2SCUA 3T0FA 4KBYA 3GLHA 2EFCB 3OMXA 3ZZMA 3AJ9A 3JQ8B 3RFUA 1KGSA 4I08A 3G8YA 1FMFA 1JPJA 3PC3A 4L7VA 5B36A 2XRYA 3LYLA 4FE3A 5G0WA 4TWZA 3WK8A 2C29D 3MG9A 1OJ7A 2CKDA 1EA5A 3U9LA 4J0IA 4ZAWA 1FFCA 2ABWA 1IIRA 1ODIA 4TQAA 1TJPB 3DCJA 4WEOA 4D3XA 1JDJA 1FLAA 1H9AA 4LX8A 4IVRA 3E9QA 3VU3A 2WKPA 3JQ9A 3OESA 2NO7A 5IVKA 4TL9A 1PJ3A 1NBAA 2WPNA 4RA6B 3FBGA 3O84A 2C20A 4Y0AA 4XSHA 1IFXA 2C1EA 1CD5A 1K5GA 4TKLA 4XA8A 4Y9SA 3UMJA 1XLVA 1E1LA 4YRJA 1I01A 2H63A 1JIVA 5FNVA 1YHYA 1PJLA 4A2CA 4LXQA 2G8NA 3IELA 1CUEA 3X3HA 3A27A 1F5SA 2PLAA 4U2CA 3TFWA 3I6BA 4LDZA 5CA0F 4KGZA 1FU8A 3KWMA 1LVGA 2CL5A 1SB8A 3GQBB 2HRZA 2ZAOA 1WM1A 5ES3A 3RT7A 3RUCA 4CM8B 1IE3A 5KEIA 5DP2A 1J99A 4GF5A 1GZHB 2AMLA 1O97D 2GLUA 1I3LA 3DE1X 3FNBA 3L0ZA 5LQSA 3NUQA 3UG6A 4E5DA 3KJZA 3OAAD 2X15A 1TVMA 3GJ0A 3MRTA 2JGDA 2FEAA 2GEDA 2F7SA 1VYHA 3C6QA 2HOQA 2NU9A 4FGKA 2X1HA 4FUQA 4C5BA 3SVTA 3FNEA 2PO5A 5JNTA 3E35A 4X41A 4ZDKA 2YVAA 1QKIA 3AI7A 3U19A 1HURA 4XE5A 2D0PB 5BVHA 3IVMA 1NLYA 1NXQA 1YQ9A 1W1WA 2QJRA 3C24A 3CF4G 2AFHB 4JJ4A 3F3MA 4QUDA 3S1SA 1XRLA 1R0RE 3G8CA 2YWFA 4MUXA 5K3AA 2GD0A 4X7PA 3WLEA 5CYOA 1XT6A 3CVOA 4WK2B 4XPIA 3AW9A 1KO5A 2RGNC 3DC2A 1KI6B 1KDVA 1D1TA 1WCYA 3BILA 1D2CA 3WBKA 1WR8A 4MO9A 3VVMA 4BMZA 2CNBA 3MT9A 5HYVA 3OF3A 5MGBA 3RARA 2C7VA 1WLYA 4YAGA 5B5SA 1J2EA 1S8OA 3GWZA 2FV8A 5AVXA 3U7JA 3SG0A 2OAP1 2XBUA 2CZCA 3IT0A 4GC5A 2AR7A 1X1BA 4R3WA 2QMOA 3ECAA 2W0SA 2QJOA 3S1AA 5HKOA 1HR0B 2VXYA 3L0DA 3OQIA 1JU3A 3IR6A 3NBZC 1Q0HA 3QV1A 4XVHA 4JI5B 1T15A 1Y4DE 2I6QA 4TUYB 1U04A 2J0EA 3U6KA 3OAAA 3AESA 5LP6B 4MWOA 3JYOA 2DJ5A 2GLXA 4UEKA 3TRJA 3VDXA 4CLRA 1QHXA 5JT1A 1L1RA 4IRXA 1EAMA 2RHJA 2MINA 3MC1A 4EKNB 1KO8A 1W59A 2WFMA 1OLSA 1QRDA 3BXPA 2I8AA 3Q7SA 4J3FA 3JZMA 3G1UA 5FPQA 4O2AA 4V0NA 3PF9A 5FAKA 1LS6A 3M6WA 5BQ5A 3H19A 2P2DA 3JD1A 1O5OA 3O91A 1GTMA 1YZTA 4QHTA 3U31A 1EGVB 4QFCA 2HF7A 5JXIA 2O7NA 2HK6A 4KQEA 4EOGA 3HCDA 3K70D 4JYZA 4D82A 3U4QA 1J39A 4CIXA 4AXBA 3W5IA 1WULS 3HJBA 2C4MA 3KOMA 2PGXA 3CEHA 2Y1KA 4URZR 5CT5A 3SYLA 3ANMA 2IYZA 4V39A 2ZIFA 5DNWA 1T1RA 5AW1A 3QEBZ 4KQ1A 1QQ6A 1AUPA 4DCVA 2M6SA 1W581 4AU1A 5ENZA 4BWFB 1YZGA 4NCBA 2CVFA 4JX8A 4J4TA 3CVXA 5IJ9B 5BUSA 1TYAE 3LXMA 4O4LB 5GJCA 2GCPA 5CFOA 4RTPA 1XTZA 1ZM3A 1ZR2A 4UREA 5B1IA 1JPNA 2CE2X 5CNJA 4EKEA 2GPBA 2ZW9A 4I1VA 4OBWA 4A0GA 3HH8A 4MWZA 3HNPA 5BP7A 3OQHA 3A0RB 2GPWA 2V7QD 3FF4A 1P2VA 3JZAA 1Y3DE 3K0HA 3M6XA 4PBTA 3TQCA 1Q22A 5B3JC 4D8TA 2JAOA 4NJOA 1E4YA 1ESNA 1IC6A 3QE3A 3DYBA 4D46A 4DSNA 3MCUA 4PHGA 3D54D 5BV7A 2X5XA 2W4QA 5I7WA 2EERA 1JA1A 3H1EA 3PUIA 4OUKX 1QYVA 1Y5RA 1BCRA 3L4JA 1XNGA 1TGYA 3ELDA 2TMGA 4U9UA 2NVUB 3ZQJA 2V9CA 3GAFA 3U44A 3W5JA 2NVOA 3I2HA 2Y76A 3HDJA 4OEHA 5PNTA 1GU1A 3D6UA 3L0IB 4JODA 4TX1A 1JJFA 4X8LA 5DGHA 3FYUC 3HCWA 4GPTA 1VTKA 4M9SA 3D8HA 2W6ID 3KAQA 4A23A 2YHIB 3PCXA 1T1GA 4NF2A 1DNPA 2Q45A 2R0QC 1ZJYA 1Z4LA 2OBXA 4FW9A 3UTCA 3PKJA 2GI4A 3QKWA 2WA1A 1Q0ZA 4JEIA 4NH4A 5ALPA 4ZT4A 3T52A 4OLHA 1HDEA 1HE4A 2XOKD 2YXNA 4G0PA 1GVHA 3CWQA 1U4NA 3I9LA 5DSTA 5E95A 5E4YA 1G8SA 1ZGJA 3GG2A 4BL5A 3LO5A 9ATCA 1LWNA 2GHTA 4ZHQB 4JROA 4RY8A 3LBHA 4JVLA 4M1WA 1JIQA 2UKDA 3ZWCA 2PY6A 1OWOA 3GBSA 5F98A 1XJ5A 2PNFA 4LISA 3T5CA 5AKHA 2I6GA 4MP8A 5GWXA 1JHAA 4EQZA 1XXHB 2LZ0A 3RRJA 3RSLA 2VDRB 4GYWA 1Z4NA 4ZK6A 1DMSA 4XD2A 4X1YA 4MUKA 3L6CA 1QC5B 4QOEA 5ADHA 1ZCJA 4XWAA 3L77A 2O3UA 1GUFA 1SC3A 1XU7A 4LVNA 5K9ZA 1J8YF 3I5XA 3IXQA 1W5TA 4Q4AA 3RK1A 2W6NA 1AN0A 3I9FA 1KP9A 3JQBC 4RZXA 2P0YA 1JE0A 1P4GA 1PR4A 3NYIA 5C53B 5HE8A 2QTFA 1MO2A 2K2WA 3OJXA 3PGKA 4YQEA 4B3HA 1QNLA 1GQFA 2W6IA 2HUNA 1PW5A 1SBIA 3WY9A 3S27A 4OMFG 4EG7A 1MHPA 3EDMA 5LUAA 2EJCA 4IG9A 1KO1A 2GZDA 5TVGA 1D9ZA 4GPZA 4JC5A 2PAAA 5THXA 2XOKA 3GXOA 3BMOA 2VQ6A 5KNCA 3K05A 1MDFA 3PNKA 1ITZA 2LDBA 2XDQA 1NBWB 4HEJA 3W9SA 1WTCA 5KKAA 1UBFA 2E21A 4KMSA 2D62A 4U39A 5KYNA 1M8PA 2WU4A 4ZZIA 1I30A 2AR0A 3MRSA 1SQ5A 4OXNA 1HNZB 2IRWA 3W8DA 3VNVA 2QTGA 1ID1A 4ZVOA 2AOTB 5ALUA 3OFND 4ZCSA 4F2HA 1AA9A 4LI0A 5FWYA 1QHEA 1TC2A 4P4LA 4RHTA 3I39X 4C0WA 4BHTA 1N77A 5P8WA 3EUWA 1RP1A 1T9HA 2F1OA 3ER6A 3VH2A 1YOVB 3N0RA 2WWFA 2QYOA 2AA3A 4CODB 4V3CA 3TOZA 3IB3A 4B17A 4B4OA 1MVLA 2IW1A 3KKQA 5A0FA 2A35A 4XYGA 4V0RA 1T2EA 3DAOA 4I1IA 2W00A 3N6XA 3TTXA 4D4IA 1GADO 2CDAA 2EX1A 4B82A 1B15A 4OHYA 4NFLA 4RNDB 2WT8A 2WKRA 1EPUA 2E55A 3ABOB 1UDBA 1VPLA 2ECKA 5CLQA 2BFOA 2EF1A 5B53A 2J0QA 1ZLYA 3O3CA 1N5RA 3Q5DA 4MJLA 2GBIA 3ZR4B 1X1RA 3T5PA 1OVGA 2BTOA 2HWXA 3PNPA 4L27A 2Q21A 4RV9A 3VPBA 1NUAA 4C7KA 4DSTA 4XUEA 4E09A 1YC5A 2WLTA 1L5MA 1QR6A 3MJCA 1H69A 5H7XA 3PXUA 1OJLA 5CA0B 1EUDA 3LYHA 3ORRA 1M2HA 5CD1A 4TTPA 1M5UA 3OFNA 1GVNB 1MN6A 2GSWA 4BO9A 1U0EA 3LF2A 2ZRPA 2DPLA 3EVNA 4J91A 3HCFA 2QGZA 4LHSA 3T7CA 3V4LA 5IX8A 1Q1ZA 3B60A 3UHAA 3RS8A 2QUBA 2VSNA 2Y4OA 5GIPE 2JLUA 3C3BA 2VDNB 1YJXA 2ATCA 4E6EA 4KIGA 4JQCA 1IDN1 2ZYTX 1KMHB 5CDUA 4JXZA 4W5NA 2ORED 5EAIA 2XBMA 1EBBA 1O0SA 2WTBA 3RYFB 4ISBA 4LOJA 5AM2A 4EJ2A 3LLCA 4I36A 1SXJC 1D7OA 1L4BA 3I58A 5CVVA 5DTMA 2XZPA 1KU6A 2GVNA 3IIJA 4RANA 3SHVA 2B25A 1Z47A 3GRRA 4IIFA 4NNOA 4OI1A 3MMPA 4HV4A 3AB8A 1Z36A 4FGWA 3L8CA 4IRMA 4Y1EA 4IXDA 4O2BF 3W5HA 4EJSA 4XOIA 3CSSA 4KQ9A 4V0ME 3R0IA 3EPLA 1LV7A 4BNFA 3JPWA 4ESEA 1BX3A 1MJFA 4NV0A 3NYRA 2IVFA 1P7CA 1VLHA 3WMGA 1E89A 2CXPA 3CG0A 4XFJA 1EH5A 2AEMA 3I92A 4HUTA 1KK3A 2OHJA 1M7GA 2SECE 4J0EA 3SBEA 1Z5UA 2EX4A 4MUBA 1V1MA 4RZSA 4C4XA 3ZCPA 3QX3A 4LDRA 3KQLA 4DCTA 2ZDHA 2R8ZA 4G24A 4IFTA 3RB8A 4EZBA 3H11A 4ZV9A 3NO4A 2JIOA 5A4KA 4OXIA 3VAZA 2Y6VA 1EXDA 1J70A 1K3TA 3CRQA 3OFVA 4AF6A 3ZGYA 2ZTSA 1CR0A 3MNFA 4GBJA 4AKEA 2V45A 4IMRA 4UCWA 4YCAA 5F52A 2B35A 2WB2A 4KTTE 5FA6A 1RQXA 3IERA 3L8DA 1K6JA 4ITRC 5IABA 4XB1A 1YQGA 3HZHA 2E5FA 4P3OA 2WEKA 2XQFA 1W46A 2EWMA 2IE8A 3GLIB 1U2GA 1D5CA 5K3EA 2CUKA 4DTCA 4ER3A 3NTUA 1NVMB 2AYZA 3VH4A 4MJ7A 4NENA 3IPCA 3ND8A 4EYQA 4RPGA 2NTVA 4I4LA 4QSMA 4P81A 2AX3A 2JJ2D 4X97A 3OJLA 5F1OA 1HZZA 4KYVA 4YMUA 1ESDA 4DDVA 4WFIA 1MFPA 4WLUA 3WMXA 3I2JA 1Z3CA 1RWNA 1KVQA 2NT4A 4UASA 2WJHA 1IOVA 2VOEA 4DEYA 3DHVA 1P2UA 3AR8A 5FRDA 3T3PB 5ICGA 1U8TA 1L4LA 3IH5A 3D4PA 1LNZA 1ZD4A 2IGBA 2JJYA 3QVLA 1YKFA 4K6FA 4UUQA 1FFDA 3SC4A 4EHAA 5ES4B 3RYIB 2WYOA 4DAEA 1JAHA 5A7FA 4XDYA 3L79A 5KYYB 4XJSA 4H0CA 3LT5A 4KXFB 1GGFA 1FFXB 4YS6A 3SYTA 8ABPA 1NAHA 2PZFA 1NJFA 2ZBVA 2EU8A 2VCEA 1EHYA 1M5TA 5JDIA 1C14A 3KG2A 3OKFA 5H70A 1H0HA 1NRIA 1R4NB 1IN7A 4XSGA 4UHEA 3LPDA 4FFVA 4F1KA 5CDTA 4CKWA 1EK2A 4UOQA 2C2ZA 3KLMX 1CY4A 3SJAA 5LMNB 3ND7A 4QYIA 1JHVA 5LBTA 3SYRA 5K8VA 4LZNA 2BZ0A 2W6JD 2ZJOA 4UTXA 5HS6A 2VLIA 2B2XA 3C97A 2I76A 1EGQA 1OSNA 2IVZA 4YJGB 2OHHA 3T5GA 5EVCA 3TTYA 1MPTA 1XPRA 3MCVA 3QFRA 5TDHA 2AC7A 2D3WA 4N18A 5KAPA 3RTCA 5BYKA 5KWVA 3TSOA 1P0IA 2FSUA 4B2PA 5CB0A 2W2VA 5H82A 3ZQ4A 2KJQA 3FPBA 2FZ5A 2GAFA 4TXNA 2PE5A 4GOXA 1AF7A 4ARAA 3FBWA 2CLOB 1YZ3A 2JANA 4GZ6A 4K03A 2ZB2A 5AVOA 5EGNA 1KA9H 3K20A 2XHEA 5IJXA 1TF5A 2PGIA 3PTAA 2ST1A 3DB1A 1WP9A 2CF6A 1WZNA 7ADHA 3QV2A 1T5TA 2DKNA 3EZGA 4IXMA 2F3TA 1QP4A 2XUDA 2ZAGA 2VA8A 1QCZA 2V65A 3W5UA 3L82B 2Z5GA 4DC0A 2R68A 2GDZA 4NMLA 3W2IA 1C0LA 3CZMA 2IPLA 3FOCA 3MM4A 3PXEA 2QL7A 4J4HA 1Z2EA 4X6YA 4B3BA 1EUCB 2OHVA 3ZXXA 1XMXA 3WTCA 5NULA 4S1WA 5AQEA 1TCBA 4P31A 4JDPA 4JYPA 4YRFA 5L3SA 3R40A 4FKBA 3LUJA 2W6JA 1SNYA 3UWSA 1SCJA 3KIPA 5FLEX 3PPWA 4W82A 3VZQA 4DR2B 1N5IA 1PL7A 4R5HA 4ZOLF 1PJAA 3IC5A 3DMGA 3I0ZA 3KDAA 3AM4A 1LXCA 1U0HC 2BEWB 3E27A 2H1LA 3V6LA 3DEFA 1A2KC 2MYPA 3STTA 1O58A 2ODWA 3PP8A 5DO9A 4BX0A 5IJ0B 3X1DA 3B2QA 3H2GA 3MD0A 4YRTA 3UW3A 4AO8A 6PFKA 4OLAA 2JFYA 2WV9A 4PX9A 4U3JB 5K3CA 3TIXB 4YP9A 2LW7A 2RHDA 1MIHA 3L0SA 4J94A 1WVGA 3O5AA 4KRXA 1J00A 3OM8A 1U90A 3LHSA 3OG9A 4NJMB 1RVDA 4WHMA 4D3FA 5DCYA 2V3WA 4C4SA 4BO4A 2G76A 4RKQA 2CNWD 4KSBA 2ZYUX 3ADCA 2WQ6A 1TF7A 5IBRA 3HHEA 1P5FA 1C8LA 1UPAA 2CLLB 1XTVA 5E0KB 1UBEA 4J0GA 1CNMA 4NX2A 3UM9A 2WUGA 2V0CA 3EA4A 3K2IA 3LKVA 4QSHA 1U8AA 2DWUA 1HLDA 5DHPA 2C78A 2WVGA 4OHUA 1DJLA 3DEJA 2BFMA 5JC1A 4X65B 5K45A 2FUCA 1NPYA 3UMSA 4C89A 1U02A 1G5HA 2CXXA 5JHGB 1FP6A 1QRAA 2G06A 4Z4EA 1XXHE 2KLHA 4N1AA 1CLUA 1IWOA 3BICA 5EMJA 2AZXA 2OCKA 1Z0AA 2H5EA 1G17A 2W0MA 1PS0A 2YHBA 2AFVA 1M2OB 2GTHA 3R20A 4NU0A 4MRPA 5EJ5A 4HDCA 3K6SB 2VZ0A