3O26A

The structure of salutaridine reductase from papaver somniferum.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
294
structure length
294
Chain Sequence
RRCAVVTGGNKGIGFEICKQLSSNGIMVVLTCRDVTKGHEAVEKLKNSNHENVVFHQLDVTDPIATMSSLADFIKTHFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEELVKIYEKPEAQELMSETYELAEECLKINYNGVKSVTEVLIPLLQLSDSPRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVVNMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLANKIPKFQVNCVCPGLVKTEMNYGIGNYTAEEGAEHVVRIALFPDDGPSGFFYDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The atomic structure of salutaridine reductase from the opium poppy Papaver somniferum.
pubmed doi rcsb
source organism Papaver somniferum
molecule tags Oxidoreductase
molecule keywords Salutaridine reductase
total genus 114
structure length 294
sequence length 294
ec nomenclature ec 1.1.1.248: Salutaridine reductase (NADPH).
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3o26A00
1XYGA 3TL2A 1NASA 4HFNA 1EUDA 1IPEA 3OIDA 1WWKA 4Z9FA 3I6IA 3IUSA 3O8QA 4B8WA 4PVCA 4YA6A 1RWBA 2PR2A 4HP8A 4BNKA 4FOOA 4FC7A 3DFZA 4PG4A 1YXMA 5T64A 1JU9A 4YRDA 2FY8A 3L9XA 3JQGB 4BO6A 1YQGA 4J7XA 4S3MA 5CG1A 2EGHA 4H16A 4XIJA 2EKQA 1UZMA 1Y9EA 5L9AA 2AEJA 3AUUA 2NU9A 2GGSA 1NQTA 3NJ8A 3GHYA 1LC0A 1WVGA 5A5FA 5KKAA 4AJ1A 5IZ4A 3AUTA 2H63A 1YOVB 1E7SA 1NAHA 1MLDA 2CDCA 4D0SA 2BFPA 3K92A 3NV9A 4M1QA 3WQSB 2H9IA 1I01A 3ZV5A 1E1LA 1D4FA 1NQAO 4IM7A 5GMOA 5T57A 4BMNA 5EIOA 5JMWA 1J6UA 1XGKA 4D3FA 3KV3O 1M6HA 8LDHA 3INTA 3UICA 2ZTLA 3WDSA 2B4RO 1C14A 1ZK2A 1YWGO 2C29D 2YY7A 4TRRA 4BNJA 3G17A 3RU7A 3NTQA 3M2PA 4DBVO 1X14A 2EP5A 3KRTA 4ZN6A 4WNIA 1UP4A 1QORA 4M8SA 4BQPA 3RC7A 1EE2A 2HK8A 3IP3A 4R9RA 2X0IA 1LUAA 3FNHA 3PZRA 3KBOA 2ZB7A 4M49A 4RLHA 4CV3A 5A3JA 1ZSNA 1JAYA 4BNVA 2P5UA 1PL6A 1LLQA 1LBEA 2NADA 1C0PA 1YDEA 2VQ3A 1CF2O 1E3WA 1KVQA 1W8DA 1ZK1A 4NBRA 5EESA 3DC2A 1HETA 2P9CA 4E6PA 4E5YA 5H81A 4IQ8A 2CDAA 1G6KA 1K5HA 4GX2A 3INGA 2DBQA 4PZEA 2FZEA 4I5EA 3D3WB 1CJCA 3RUEA 5I8WA 2E82A 4LISA 3KTDA 1C0LA 1KERA 1I0ZA 1N7HA 1QP8A 2AE1A 3HFGA 3ZNPA 4DLAA 3B1KA 3U4DA 4WNCA 3PWKA 4GQAA 1GR0A 2C54A 4CM8A 4IS2A 1QKIA 5AXBA 4CMHA 4ZD6A 5A3VA 1UDCA 3SC6A 1X0XA 2Q99A 3CXRA 1Q0QA 3JQ9A 1FXSA 3PYMA 3WFJA 5CEJA 4IJVA 2CY0A 2GNAA 4N5NA 5A5EA 4YT2A 4NR0A 1Q0HA 1YQXA 3GN1A 4BO8A 2E49A 3NT2A 5CDSA 1X1TA 3Q2KA 3VH3A 5J23A 3LF1A 1R0LA 3GEMA 4GX1A 4JCOA 3GC6A 3FSRA 3I9OA 4FFLA 1NXQA 1W73A 4I5GA 4CM4B 2NTJA 4BO0A 1DRUA 1HL3A 1J0XO 1PL7A 1U2DA 1NPYA 3K31A 3PJGA 5A9TA 2NSDA 3DB2A 1YBMA 5G4KB 1YL5A 5IN4A 5JYDA 1EUCA 4PLPA 2AEFA 1OC2A 1LC3A 2HRZA 1PZEA 2J3JA 3WGOA 5IF3A 3TOXA 2O7QA 1ISMA 4ALIA 2GZ1A 2JCVA 3C7AA 4GH5A 3AM5A 3GAFA 2E37A 2Z1MA 4CLOB 1SOWA 3FRJA 3BMOA 1U7HA 4ZRNA 2UAGA 3C85A 4R41A 2GD1O 5A02A 1R6DA 4L76A 1KETA 1C1XB 1Y9AA 3U62A 4E2YA 1KC3A 3U09A 2HMWA 4L4RA 1PGOA 2J5QA 2PZJA 4CQLB 5ER9A 2JFHA 2OUIA 3F4BA 1UDBA 5TGDA 3C8MA 2V6FA 2B37A 3DO5A 4CMAA 4CUKA 4RGBA 5BQFA 3BMOB 2JCXA 2GPTA 1MXHA 1RYEA 2EP7A 1ISGA 3PDUA 4HFJA 4RDIA 1P1FA 3CSDA 4ALNA 5LDGA 1D3AA 3DAPA 4E31A 4AJKA 4URFA 4RO0A 3IJPA 3MTGA 3VTFA 4BO4A 4TZTA 3IKTA 1GAEO 1K6JA 4IXWA 3AUAA 1LSOA 3I9JA 3KYDB 4MVJF 4N5LA 4NHEA 4Z9YA 1ZSYA 4ILKA 1JN0A 2ZATA 5DOVA 3H3FA 4XYMA 5G0SA 1SMKA 3UFXA 4BNWA 4OHUA 3L4BC 5JYEA 2ILTA 2WE8A 1DIBA 1KY4A 1YE3A 3UVEA 1A9YA 4JJIA 1C3VA 2EXXA 4NJMA 4J7UA 4OO3A 2O2SA 3WIEA 5L45A 4HUJA 3EVTA 4CLRA 2GO1A 3ROMA 4YAJA 4DGSA 1VSUA 4Y8VA 3DAGA 3ZNOA 4R51A 3UXYA 1XIVA 1HDZA 4BO1A 4FR5A 4R1UA 4I9UA 5L3ZA 1E3EA 4BO7A 3RBZA 2NU8A 1D7OA 4MVJI 1UAYA 1NVMB 4P8RA 4BNMA 5LCXA 5ENVA 1U9JA 2PZLA 2IZ0A 3OEYA 2B36A 4CM3A 1F12A 3DZBA 3AI1A 4OJNA 5ENDA 1EUZA 4J49A 4CLRB 3OICA 4WGGA 4Y6RA 2GLXA 1QR6A 1A27A 2G0TA 2NU7A 3RJ5A 3G1UA 4NBUA 4AG3A 2O2YA 3H9GA 4FD3A 2I9PA 3I6QA 4XCVA 5ER6A 1M2WA 4R69A 2DTXA 4XJTA 1K2WA 4JK3A 3ZW9A 4QUKA 2Y66A 5JY1A 4JBGA 4N54A 3RCBA 1WXDA 1PQUA 4UEOA 1P3DA 5DN9A 2EW8A 4NH4A 3JQCA 4GKVA 2GDZA 3RASA 4YYZA 3AI3A 1RYDA 1WAMA 4I1IA 5B12A 1U7TA 2PD4A 2CVZA 1X7DA 4BKRA 1ZSVA 2GUGA 4YVFA 1GYPA 1PZHA 2OO5A 5JBIA 4L4XA 1XSEA 2NTVA 1P1HA 2NUAA 2VHWA 5IDYA 1H6CA 4MVJD 4RV9A 2HSDA 5JLAA 1NM5A 3WGTA 2BFOA 1BW9B 1QG6A 1GZ3A 1ZW1A 1OZAA 2UUPA 2FPGA 2W2KB 3KYBA 4MVJH 2ZCVA 4I5FA 3OJEA 2NACA 4CR7A 5TF4A 4Q3BA 3I1JA 2HRBA 4ZQHA 5T8KC 3HDHA 1DJNA 3KLPX 1PGNA 5DF1A 2Y99A 1DLJA 2V6MA 3H9UA 2Y1FA 3G0OA 4ALLA 1N2SA 4L0QA 4QSMA 1Z74A 3NX4A 3NRCA 2QRKA 2DUWA 2W2KA 3PGXA 3IAHA 3F5SA 1ZO8A 2PGLA 5HS6A 2O23A 4HV4A 5K9ZA 2YFQA 2PD3A 1NX6A 5GZ3A 2OMEA 1NNUA 5JNLA 3GEGA 1SB8A 2XXBA 4XB1A 2RHRA 3DBRA 4HNHA 4E0BA 3EDMA 1NVGA 3NEPX 3PJFA 2I65A 3HDJA 3VPSA 5IDXA 1R4MA 5DCWA 1C0KA 1DEHA 2FWMX 1PZFA 2VOJA 4OQYA 4NNJA 4TRJA 4U8GA 2B35A 4R1SA 5TT1A 5I7FA 4D42A 5CDUA 5DP2A 3RC9A 3LSYA 5FI3A 3O9ZA 1EK5A 3BTOA 3P5SA 3QWIA 1AN9A 2ZQYA 3QHAA 3VDRA 3WNVA 3Q9NA 4CODB 3PYXA 4ZQGA 3H8VA 3WGIA 2X86A 4QFDA 4W7IA 3JD1A 4DWVA 2AXQA 1YL6A 4LK3A 2D0IA 4NPCA 1LSJA 4NIMA 4C7KA 1P9LA 2Y0CA 3JQAB 1KEWA 4YJGA 4F45A 5KVVA 3HUDA 2C20A 2GZ2A 3SLGA 3PRJA 4YJFB 4AJ4A 1VKNA 2I6TA 2XOXA 3W4JA 1D8AA 1LDEA 2O3TA 2AHRA 3MJTA 2Q1WA 1D1SA 4O63O 1R4NA 5AOVA 4FBGA 1U5AA 2BFAA 1CERA 1ZJZA 4BKPA 3VVCA 1ZJYA 4QX6A 2YZ7A 4OL9A 4MIYA 2VRCD 2VYVD 1MG5A 4AVYA 4FFPA 4Z3DA 3PQFA 2FR8A 4U7WA 1E7RA 1U2GA 2YQ5A 3B6ZA 1HDGO 1DC5A 2Y1EA 3DBVO 3QVOA 3U4IA 3VZRA 4IUYA 3W8DA 5BR7A 1DFHA 1VL0A 3PVZA 3ULKA 3UGKA 4A7PA 1GEGA 1U3WA 2HLPA 4Q9NA 2VWQA 1L7EA 1DIGA 1O94A 2QYTA 1OBFO 2R00C 3IS3A 3DQPA 4MINA 3GGOA 3RUCA 1KVSA 4JROA 3H65A 3U4CA 5A03A 3ONEA 3BHJA 4XB2A 2P5YA 3A1NA 5DT9A 3FF4A 4OYRA 3WG9A 1ZUD1 4A03A 1F8GA 3LT4A 1E3JA 1WNTA 4CMKA 4YRBA 3SEFA 2Y68A 3OIFA 3MJVA 4K28A 4L8VA 2EKLA 3NTRA 5GZ6A 4I08A 1WW8A 2BD0A 3V2GA 3E1KA 5I7VA 1LDMA 4BNIA 5A06A 5L40A 1WDKA 3DZFA 5B4UA 4FGWA 4XDZA 1Y8RA 2ZB3A 3GAZA 4DQVA 4ALMA 1N1EA 4Q3EA 1VLLA 3K73O 3GGPA 3CIFA 1JKFA 3ZW8A 4QEDA 1ADFA 1Y5MA 2QHXA 1NFRA 4GWKA 4M87A 2O3QA 4NMHA 3GPDG 2Q4BA 5MDHA 1QV7A 3Q2IA 3DL2A 3ZU5A 6LDHA 2FPPA 4YJHA 4ZGWA 3LK7A 3WLEA 4B3HA 4PLCA 4GL4A 1H9AA 5CPBA 2FN7A 3ZWVA 1Y8QA 2I76A 3NGLA 4PZDA 1C1DA 2DBZA 3K2BA 4E5NA 4IDAA 4HY3A 2HMUA 2B5WA 1VJTA 4TVOA 1I5RA 2WD7B 3PHJA 1FDVA 1XELA 1PGQA 2YJZA 2O3JA 4CM1A 2FR0A 3FNEA 5C7LO 4IJKA 4IIVA 2BHLA 2R2GA 3VVBA 2OP0A 3MWDB 5TS3A 3I9NA 4G81A 4GX0A 2NVWA 4KQXA 2EF1A 1PL8A 1GY8A 2JAPA 3E6AA 1EVIA 3JYLA 2VRCA 5A1TA 3PZBA 1X0VA 2QW8A 3ZV6A 3JD3A 5JPIA 1A4UA 1VJ0A 3LT0A 5JY6A 2OHXA 3WQRA 1J49A 3JQGA 5TRTA 2BGKA 4RF5A 1NWCA 1LLUA 1IUKA 1KIFA 1SNYA 4L9RA 1JAXA 4OQZA 3H4VA 2GN4A 5KJ1A 5HBRA 1R66A 2PV7A 1H6BA 4M54A 5KKCA 5CDYA 3RROA 5GZ1A 1O9BA 3DAFA 5I7SA 3OETA 2E4AA 2BFMA 1DDOA 5KVQA 3UCEA 3JQ6A 3MJ4A 3TN7A 3AK4A 1E6WA 1E5QA 2J5KA 5C37A 1DB3A 5TJ9A 2VTDA 1Z45A 1YJQA 2X0RA 3JD2A 3RUDA 4BO2A 2EV9A 1H5QA 3JQEA 3MJCA 4PIVA 3V1UA 3WTBA 4E2WA 1RPNA 3DDNA 4EEZA 3D3EA 4R5MA 1QYVA 1QXSA 4ND4A 2GSDA 1LNQA 1VC2A 1HLPA 3E5MA 1FDUA 4Y6PA 1K3TA 4WLOA 4BMVA 3D7LA 1U28A 1ADCA 3GA0A 1IY8A 2D2IA 3E82A 3BMCA 5A9SB 2I5PO 3AY7A 3LF2A 1NPDA 3RKRA 4RVFA 4WKGA 1PJLA 5COQA 1GZ4A 5F21A 1O0SA 3KB6A 3R3JA 3DFUA 1LX6A 1T2EA 3IJRA 4GPD1 4IGEA 3EAGA 4IDBA 4KP7A 4WCFA 3VAZA 3PPIA 5BNTA 5HA5A 2X6TA 4AICA 4IJUA 4DIOA 4J1NA 4FDAA 3GMSA 1E7QA 2Y93A 2YV1A 2CVQA 2PZKA 1GPDG 3GEDA 4MKRA 1U1IA 4GSLA 1PTJA 1RM3A 5F1OA 1I24A 4OXNA 5EMHA 1PSDA 3LDHA 2B4TO 3VKUA 1EDOA 3JQFA 3EGOA 3GRKA 2OGUA 4PVDA 4NU6A 3ZWXA 1NR7A 2LDBA 3V2UA 3DHEA 3VPFA 3ZHXA 3ZDFA 2D1YA 4PLZA 1ZK3A 4P22A 2PKQP 4FC6A 3WR5A 2HMTA 2RBEA 3MOGA 3JTMA 3AUSA 3PQEA 4H15A 3UH1A 3DZIA 5B4TA 3RUIA 3S2IA 3GG2A 2NQ8A 3GZNB 3IC5A 3QIVA 2Y1DA 4PRKA 3PIIA 4E13A 2DFDA 2BI8A 2Z95A 2CDBA 4NU5A 2GYYA 3LVFO 1UR5A 2CSUA 1NHWA 1A72A 3QSGA 4P4NA 5CFZA 3RC2A 2CMDA 3ONDA 4TVBA 3HDQA 4N5MA 2GN6A 5EPOA 3OQBA 1EMDA 3ICPA 4JBIA 4ND2A 4J91A 2YHIB 4FW8A 3EZYA 1PR9A 2Q45A 4PFJA 2HMVA 1GEEA 2X0NA 4KUEA 4JIGA 2QZZA 4BNHA 4A27A 2Q1SA 1EZ4A 3MJEA 1XG5A 5B37A 3VPXA 2IYPA 4XA8A 1NHGA 5A9RA 3GOHA 3PHHA 4ZICA 2BKAA 5G4KA 2YHIA 1P45A 1MP0A 3C3XA 3PIDA 4NG5A 3VC7A 2YV3A 1JTVA 1LQUA 4J1TA 4RQUA 2OL4A 1EVYA 4AJHA 8ADHA 4BO3A 4D79A 3AU8A 2VHZA 1GQYA 3CTMA 3ZWYA 3GUCA 1U5CA 3JQBA 4OGWA 4CM6A 4UULA 3I5MA 3H2SA 2B4QA 2EHDA 3EY4A 1Z7BA 2JCYA 3SXPA 2RIRA 4BKOA 3VPGA 5A05A 1SZJG 3WSVA 4CLOA 4Z9XA 4BOYA 4CM9A 2AQHA 2IEBA 3RIHA 3IL2A 3ADPA 1L1FA 1Q2XA 4EYEA 1ONNA 5BSEA 4WLEA 1H93A 2WMDA 5AVOA 1DC4A 3GVPA 3QQPA 4CV0A 1FF9A 5ADHA 3CMMA 4YTEA 1EVJA 5KNLA 4EJMA 3ZWMA 2YW9A 4GWGA 3O4RA 4E33A 4IDGA 5KTKA 4CV1A 3ANMA 4B3IA 4R16A 3VDQA 1IE3A 4YEDA 3RAJA 4B4OA 1R37A 3I52A 3DTYA 3Q9UA 2DPHA 3K96A 1GUZA 1Y7TA 4LMRA 1KBZA 1TT7A 3WGZA 4HKTA 2IODA 2J8ZA 1QYXA 3ETDA 5TSDA 5ICSA 5BNIA 3NJ4A 4FCCA 3L77A 4XIYA 5G0TA 3NDIA 4DMMA 1ID1A 2VYNA 4EDFA 2B0JA 3NAQA 2ZYDA 3S2GA 1B26A 1Z75A 4J4BA 1TLTA 5L4NA 3VTZA 3OBBA 2BGLA 3VH1A 3ANNA 2EJWA 4BV8A 1GPJA 4YT5A 1YKFA 4QXMA 3V5NA 4KTTE 4KUGA 4IDDA 4NJMB 1LDNA 3ZWBA 1GQQA 1P31A 3P7MA 2X5KO 3Q0EA 3WOHA 1T4BA 2IXBA 2B5VA 3HJAA 4BV9A 1V35A 2WYVA 3UUWA 4WCFC 5K0ZA 3HN7A 1I30A 2X58A 3PEFA 1GADO 1GUFA 4J9VA 1R0SA 4CM9D 4D41A 1BXZA 2DAPA 3E18A 3KSDO 5G2OA 5I9LA 2GN9A 1IHXA 1PWXA 3PLNA 4Y98A 2HAEA 4CQMA 4QO8A 4OM8A 3L0DA 2X23A 3E9QA 1P1IA 4YAKA 2HUNA 2NWQA 1LTHR 2NVBA 3GF4A 4O5OA 4C4OA 4J0EA 1GD1O 3RFVA 1JVBA 1U4SA 1A5ZA 1WP4A 2VNSA 2WD8A 5KVSA 4B4VA 3A4VA 4L74A 5KWEA 3DHYA 2NVUB 4BNZA 4CQMB 2BF7A 2Q1TA 3QWBA 3QVSA 3WB9A 3ZI0A 4LGVA 4RL6A 4R01A 5IXSA 1WMAA 1B8PA 2I66A 4MOWA 3H9QA 4WECA 4IIUA 1I2ZA 1PJ4A 4E5PA 4CL3A 2JHGA 2P68A 4FFRA 1NVTA 4PGFA 3K6JA 3UN1A 3MZ0A 2NVUA 3TZQA 1CYDA 3ICCA 1E0DA 4CR6A 2J3KA 5A4DA 3UCFA 3QP9A 4E5MA 2VCYA 5FI5A 4AJJA 3WTCA 3AFMA 3DZHA 2VHVA 4I8XA 3IUPA 3Q3CA 2QX7A 3FTNA 4Q3NA 3OFSA 4A0SA 2HCTA 4DPMA 1BVUA 1HT0A 1B3BA 1MXFA 2DTEA 3ZWCA 1I8TA 3RC1A 4DQXA 3TFQA 5AQ1A 3W6UA 1ZBQA 3HNPA 2PH5A 3TPCA 3L07A 4OOEA 1LJ8A 2RHCA 3A14A 3KVOA 2VUTA 4AFNA 2UUOA 4ZA2A 1KVRA 3RSHA 3B20A 4CMEA 7MDHA 1I2BA 1I3LA 1B16A 2CD9A 1VI2A 3A9WA 5CP8A 5KJFA 3HWRA 2O3SA 2P9GA 4R1TA 1T2AA 3TZCA 1DXYA 3W8EA 3AOGA 3U3XA 2WM3A 3BHMA 1Y81A 2VN8A 4GSKA 2IXAA 1B14A 3FWNA 2FMUA 5T8KA 4FOSA 4K26A 3N74A 4PLTA 2P4QA 3RWBA 3L6DA 2QRJA 4CQMD 1UXGA 3C1OA 3DBRB 5DZSA 4X54A 2HU2A 1KY5A 4E12A 2CF5A 2J6IA 4WPGA 1DHRA 1NP3A 1WDMA 4GX5A 3ZNNA 1CRWG 4PG5A 1OI7A 3F6YA 4U6QA 5HRUA 2LDXA 5JDIC 4KDFA 3GLQA 1RM0A 1N92A 4AJNA 3HHPA 2OORA 4TKLA 2PTGA 3BIOA 1MUUA 4KWIA 1OC4A 3SX2A 5I8ZA 2Q50A 1E3SA 5EQDA 3BHIA 3H9JA 1PJTA 5G4LA 1FK8A 4K6FA 2R00A 4MJLA 1HE5A 4XRRA 2VYVA 1KEUA 2QRLA 5ES3A 3P2YA 1ZZEA 4FFMA 3BTUA 1MA0A 5HTOA 3B1JA 2EJVA 4FS3A 2XAAA 2P2SA 3OA2A 3BAZA 5F1PA 3JQ7B 5H83A 2CFCA 3ROQA 1B8UA 5KJCA 2W8ZA 5HWSA 5TNXA 5F1KA 1SEPA 4XDYA 1BDMA 4ZQBA 4FB5A 4UUPA 3VH4A 1KYQA 3NUGA 4D45A 4B8ZA 4ZQFA 5T6BA 2P91A 3O26A 5K6AC 3JQ7A 3PHIA 4ONEA 2IEDA 1ZEMA 3W4KA 4YACA 2RH8A 1U8XX 4CLXA 4II2A 4QECA 1U3VA 4M89A 4U6SA 3KETA 4RVSA 3F9IA 3WYBA 2PNFA 4W4TA 3L9WA 1PR3A 3BMNB 5DULA 5TQVA 4MKZA 1YBAA 1E3WB 1WDLA 1HF3A 3DEYX 5B4VA 4YT8A 1K0UA 1U8FO 3PWSA 2F00A 4R1NA 3DZGA 3OJ0A 1ZKMA 2B83A 3U0BA 3LLVA 3WJAA 4N7RA 1I10A 5C7IO 4DA9A 2C82A 2O3RA 4A2CA 3BMNA 2BH9A 2X9NA 4Z0HO 3OIGA 3WIDA 1V3VA 4J1SA 3F1KA 3OSUA 5GY7A 3DR3A 3OQ1A 1V6AA 4M86A 5A04A 2Y1GA 3LC1O 1VSVA 1B3RA 5JCJD 3D64A 1QYCA 1I33A 4IZHA 3RKUA 1JLLA 4JP3A 4A73A 3C1AA 1CETA 1NWHA 3GFBA 2AG5A 3FNGA 2DBVO 2PWZA 1EFKA 1R4MB 2EW2A 2P9EA 2RCYA 4EJ6A 3O38A 4CLDA 1ISJA 1EQ2A 3OMLA 2X4GA 1LLDA 3RJ9A 1PS9A 2NQTA 5AXDA 4UEKA 2XXJA 2DUUA 4BQRA 4B4WA 4ID9A 2W4QA 1ULUA 3FHLA 4Z0PA 1B7GO 1DIRA 1PZGA 4UVDA 1QRRA 1HKUA 2VWHA 3AU9A 1H6AA 2Q3EA 4JJGA 4CMBA 5JCXA 1GUYA 3Q6IA 3D5QA 2ZB8A 4JX8A 1VL6A 1IPFA 4I9NA 1A7KA 5KOIA 3ON5A 3R0IA 4KUHA 4BNXA 3FD8A 2V65A 3NTOA 4F46A 1QYWA 1RM5A 4JJFA 4XRGA 9LDBA 4IDEA 4J90A 3QRWA 4NK4A 3MCVA 1T2FA 4D43A 4E4YA 2HJRA 2CZCA 3U4HA 1ZH8A 4MP3A 5CG2A 3KO8A 1T1SA 4JLWA 2ZTVA 4WLFA 4R3NA 5IAAA 1CQIA 3FBTA 1M75A 2I3GA 4IDCA 4RVDA 2J5RA 4R54A 1XKQA 1N9GB 4FJ2A 4HBGA 1BWSA 5L7WA 1YDWA 3JD4A 4OIMA 3S1LA 4NK5A 2FOIA 4RPKA 1DBVO 4YAGA 2ZIZA 4YB8A 2A4KA 1E6UA 3GR6A 2A9FA 1SCUA 3M1AA 4XKJA 3DOCA 3C7CB 1EQUA 1XDWA 2YFHA 4YR9A 1E6EA 4ESOA 2A94A 1EFLA 5BSGA 1JWAB 3JCZA 4P4LA 1MX3A 1MV8A 1EEHA 1U4OA 1X7GA 2Z5LA 4PLHA 3VH2A 4R3WA 4CMIB 4DRYA 4R9SA 2Q2VA 1OMOA 3KYDA 5JAIA 1OOEA 2HQ1A 4MKXA 2OXIA 1M6WA 3H5RA 3KUXA 4BB6A 5IZCA 1ONPA 1T4DA 2GASA 2IDZA 4L75A 3WWZA 1HLDA 1EBFA 5K6AA 3BXXA 3GDGA 4RVHA 3SJ7A 3ZWWA 1HE3A 4DUPA 4L4SA 2DTDA 4BL5A 1XA0A 3EC7A 2ET6A 4JBHA 1Y8RB 3LC2O 4IY1A 3GHHA 4TQGA 5IJZA 4HNGA 5CHEA 4XQ9A 1P0CA 1UXHA 5JS6A 3HQ4O 2I3AA 2O4UX 5HM8A 1HYGA 1GFSA 5JCJA 3LLSA 4NI5A 1TEHA 1YB1A 2Y1OA 3GNSA 5H82A 5DBGA 4YCAA 3D4PA 3MWEB 4A10A 2AQKA 1XCBA 2PLAA 5U4QA 3ZGYA 1ZFNA 4ZHSA 4UVIA 2VUUA 2DPGA 4RQTA 5L7TA 4BNTA 2I99A 3LT1A 2YUTA 5COAA 4DQUA 3ENNA 2J3IA 2X1HA 2A92A 3E9MA 1FJHA 1E3LA 3O8QB 2WD7A 4AJEA 3D0OA 1AHHA 3BYZA 5DCYA 2JFFA 4HFMA 4XX0A 3PDJA 5EJ2A 3ZZNA 4XYLA 3GUYA 4MP8A 4TRNA 3VOSA 4LRSB 2ZYGA 3DWFA 4G2NA 1LRJA 1HXHA 2C5EA 2JD0A 1F8FA 4OXYA 3VZPA 1WZEA 4E5KA 1T25A 1VE9A 4ZJUA 4WUVA 4JNKA 4TWRA 3GZNA 4CMJA 4WOKA 1T24A 2PK3A 4F6CA 1PJBA 2G17A 3ETEA 3WGHA 2Y67A 4UREA 4DBZA 3I4CA 4Z6KA 1YB5A 1R0KA 4MO2A 3RBXA 3QE3A 3RFTA 1J4AA 4WASA 3G79A 3CZMA 3QWHA 3AJRA 2ZTMA 3ROKA 3QW2A 1OAAA 3ITDA 1H9BA 5C7OO 1BXKA 4RCVA 4H7PA 4RPJA 1UXKA 5IDQA 2F1KA 1PJCA 5IFLA 1FDTA 1PJ3A 2WTBA 4E30A 3AOEC 1H2BA 3WGQA 1F0YA 1WLYA 4YPOA 5F3RA 3TRIA 2O48X 1P0FA 4B3JA 1LSUA 5T5QA 3VHRA 1DC6A 1TVEA 3CZRA 1YGYA 2WYWA 3WS7A 3LC7O 3E48A 4CM7A 3GK3A 1S7CA 4PLWA 4BGUA 4XGNA 3TNLA 4J4TA 1GQ2A 1X7HA 4BB5A 1SBYA 3UKOA 2X9GA 3WICA 2ZJ0A 4JP2A 1ZXLA 5L7YA 1W6UA 3L6EA 5KJ6A 1BRMA 3UHAA 3ZHBA 1N1GA 4OMUA 3WWYA 1NR1A 2CF6A 4IGFA 3QVTA 3ZWOA 3W6ZA 2IRWA 4NFYA 4Q3DA 2UVDA 3KXDA 3PTZA 4QT0A 4S1VA 3K30A 2RH4A 3F1LA 4CV2A 1SAYA 2C2XA 4CMCA 3JQBC 1DPGA 1LRLA 3UW3A 2VOEA 3ZWAA 1ZVMA 4MPDA 2AA3A 3PLRA 4D3DA 3FTPA 2DVMA 3COSA 2AW5A 4FFOA 2Y0EA 2DFVA 1LDGA 4DC0A 4BNNA 5JE8A 1EK6A 1F14A 2HJSA 4NFSA 1GU7A 5G0WA 1PIWA 3S8MA 3QJ5A 4EZBA 1ORRA 3EMKA 3P19A 2DLDA 4INAA 3I4FA 3DMYA 3TWOA 4WEQA 2VUSA 3U5TA 1BXGB 2GRAA 4CM8B 3R3SA 3WMWA 3ORFA 1P44A 1KS9A 4KQWA 4GVXA 4BS9A 2QG4A 3OF2A 2Q2WA 2Q46A 3KSUA 4CLHA 2TMDA 3DOJA 1TT5B 1UZLA 3ETGA 4HADA 1G0NA 1MC4A 1E1MA 1R4NB 2WEKA 1O89A 3IP1A 4YQZA 4XQEA 1IULA 5JAQA 3WFIA 4B7CA 2NNLD 4II3A 2DKNA 3I3OA 4ZU3A 2FSVA 2AMFA 1ZIDA 4J3FA 4J7CA 4D46A 1CWUA 1V3TA 1ZEJA 2VHYA 1P1RA 4OSOA 3JQ9C 4RJTA 1SO8A 2BRUA 5HS4A 2NV6A 3BTVA 1HYEA 3GDOA 4Z3KA 3GG9A 2DU8A 3DBHA 4W6ZA 4EGFA 2HDHA 3V1YA 3K8ZA 1AGNA 4MVJA 2EKPA 2VNAA 1YL7A 2BMAA 2YDYA 3KEOA 3O03A 5TLSA 4U0JA 1UXJA 1JA9A 1Y1PA 3TF5A 2H1SA 4BNUA 1ZXBA 5G0VA 3G49A 2FP4A 4RVGA 4J2OA 1YRLA 2GF2A 1AE1A 1HSOA 3IKVA 2W98A 2VWPA 1B0AA 1E7YA 1C1XA 3GN2A 3JSAA 2WYUA 3ZU3A 1YS4A 2VRBA 4AJOA 3R1IA 4IJWA 3RVDA 3RUHA 3EHEA 1X1EA 4DPKA 2VZ9A 2HO5A 5JDCC 2ZB4A 2Q1UA 1FDWA 4PLYA 1Z73A 4TRMA 1BTOA 1DFGA 1Q7BA 4K6CA 3L6OO 4BMSA 1Q7GA 3WYCA 2Y05A 3OQ6A 3IMFA 4BVAA 1V9LA 1BHSA 3KYCA 4FPXA 4W82A 3E03A 5DBFA 9LDTA 1Z82A 1UAGA 4KMSA 3CH6A 3P2OA 4M55A 4AJPA 5CDGA 4TMFA 4BKUA 4ALJA 1JVSA 1M66A 4E2XA 1KVUA 1R16A 1WZIA 5DBIA 5COBA 3FR8A 3N7UA 2NLOA 1UJMA 4KDEA 4J9UE 2VZ0A 3UOGA 1XQ6A 3IQDB 1EBUA 2Q4EA 5CEEA 1BVRA 4G5HA 2PH3A 4UVHA 1B2LA 1NBOA 3OM9A 3ENKA 4J1QA 4CMGA 3GVCA 2D8AA 3KYCB 3QA9A 3D4OA 4Y9DA 2WSBA 3TL3A 3C1TA 3KLMX 3PHLA 2ZKLA 3K5PA 1RKXA 5ICMA 4YXFA 3WLFA 4NBWA 4LSWA 3ZU2A 4F6LA 4DYVA 4BUCA 1I3KA 1LI4A 1KC1A 3RBVA 1PGPA 3WGYA 4GLLA 3TQHA 4CMEC 1VKOA 1YQDA 2IZZA 4BNYA 2D5AA 2BGMA 4P38A 2PKRA 2ZTUA 1Q1NA 4G65A 1EVZA 3L4BA 4MIOA 2WDZA 4AJ2A 2CNBA 4QFCA 2BELA 3AFNA 2Z1NA 4KZPA 1YONA 4AL4A 4CR8A 4HWKA 3B1FA 1DFIA 2B69A 4BNGA 4J43A 2G1UA 3N58A 2HMSA 4E32A 3CEAA 4GKBA 1K89A 1F17A 5B1YA 1EDZA 1V0JA 2E48A 1E7WA 4Q3AA 1PS8A 5DDIP 5EINA 5LDHA 1TI7A 2WE7A 4DC1A 1NYTA 4RPLA 4A5OA 4BGIA 2D4AA 4Q39A 3G1TA 5AYVA 3ROPA 5IDWA 5IXYA 1UP7A 3OP4A 2BLLA 2Q49A 6ADHA 4E21A 3LU1A 1IB6A 2JJYA 3PK0A 3I83A 2Q2QA 3C7DB 4RVUA 1KOLA 2NM0A 3TZKA 2O50A 4LN1A 4RPHA 3GGGA 3S2EA 3WNQA 1DIAA 2H6EA 4IINA 1G1AA 3QLJA 3LZ6A 4LW8A 3BTSA 2DM6A 3GDFA 3RFXA 4BO5A 1FMCA 3Q11A 3OJFA 4PG6A 3SLKA 2IYOA 1Z7EA 5DNAA 2PGJA 3ZV4A 4BIIA 3JQDA 1IZ9A 3I9KA 3LYLA 4E3ZA 4AJLA 1Q7CA 2EGGA 3UF0A 3X2EA 4YBZA 1HYHA 1HZZA 3H5AA 4DYDA 1BW9A 1SOVA 3BMCB 3GVHA 3PJDA 4XZ3A 4FGSA 4MP6A 5DOZA 3H5NA 3NT4A 1LEHA 3PFWO 3OECA 3JQFC 4U5QA 2X9VA 3DMTC 2C7VA 4NJOA 1N8KA 3JV7A 1R12A 1O95A 4Y6SA 4EI2A 3GNTA 4PCVA 5JFOA 2VZ8A 2Y0DA 3ITKA 2XF8A 2TMGA 1UP6A 3D3WA 1T2CA 1HDOA 4FFNA 1QV6A 3KM0A 4CJXA 1SPXA 3G3EA 3V8BA 7ADHA 4D3SA 1HDXA 3CPSA 4UEJA 1DAOA 1V8BA 4WLUA 3DONA 1Q0LA 2DC1A 2D5CA 3V1TC 3PFFA 4ALKA 3OH8A 1VM6A 1HSZA 1A9ZA 4P4GA 3CMCO 4EJ0A 1RM4A 3B70A 4LSMA 3KZVA 1PWZA 3F3SA 4DLBA 1LLCA 1A4IA 3R6DA 4B7XA 3AM3A 4FSHA 1SC6A 1JKJA 3QV1A 1GV0A 1M67A 4DXHA 1T2DA 2UDPA 4B79A 1GV1A 1SB9A 1GDHA 3HN2A 3OEWA 2OOSA 4RF4A 4BKQA 3STHA 4XJSA 4Y67A 5T67A 2I67A 4E2ZA 4ND1A 4XEHA 3EVNA 3FBGA 1YOVA 1LSSA 3OJLA 5IN5A 4HXYA 3NDRA 2JL1A 1MFZA 1ADGA 3OA0A 2FPIA 1ENOA 2X5OA 3WXBA 4ND5A 3OHSX 1QYDA 2JKVA 4TSKA 1O5IA 4D7AA 5EN4A 4YJFA 4W9NA 5BNFA 1DO8A 2V6BA 2POQX 3JYPA 5TJHA 1HDCA 2AQIA 4RZIA 4RLSA 5ILOA 3W8FA 2AE2A 4CL8A 4PLFA 3BMQB 4DLLA 4EW6A 1NQOA 5JC1A 4HFRA 5L53A 1NFFA 4AJIA 1VJ1A 4CM5A 3CINA 4IMRA 5DCUA 3ZNQA 3MTJA 4FQ8A 2FRDA 3SJUA 4ZRMA 3TOZA 1BMDA 1ZMOA 4GMGA 4RZHA 4ROSA 2O4CA 3VZSA 4UVEA 4GBJA 5JO0A 2WWRA 3BMQA 3WQQA 4PG7A 1GZ6A 4LVUA 4IQ0A 2QZ9A 5JO9A 4CQLA 4YAIA 5JXWA 1AXEA 2CVOA 2GZ3A 1PEDA 4A26A 1E1NA 3JQAD 1QLJA 5TC4A 3AW9A 3AM4A 3F4LA 4YDRA 4O0LA 1ONOA 2UYYA 4MVJM 1Y5RA 1X15A 1E1KA 5FF9A 5C3MA 1N5DA 2PGDA 3K2EA 3ST7A 4OKNA 3ZV3A 5CEFA 3HDYA 1IYZA 1S6YA 1P33A 3CE6A 2AEMA 2YHUA 4NFHA 1XWFA 1B15A 1UZNA 1CQJA 1I36A 2GR9A 1GYRA 2YV2A 1JQBA 3CUKA 4XYBA 4IMPA 5KCZA 4JGBA 5TIIA 3DBLA 4J6FA 4DL9A 3U9LA 4R5HA 3CKYA 5U1PA 4U0KA 1LA2A 1ISFA 1HRDA 4KOAA 1M76A 3JYQA 1O8CA 2QQ5A 4NDNE 5THQA 1ADBA 5FWNA 1ENYA 1P1JA 3UCXA 2IZ1A 3M2TA 1JKIA 3DBLB 3DZJA 4WLNA 2W90A 3DMTA 1W4ZA 3LQFA 3TZ6A 4OKIA 5TX7A 3D1LA 2Y1CA 4GAEA 1ISHA 1PQWA 1DC3A 1HZJA 1C1DB 3AWDA 1QSGA 2R6JA 3F5QA 2GERA 3FI9A 4CM4A 4I9HA 4KTVE 3PHGA 4XQGA 1JWBB 2JFGA 1UH5A 1N7GA 3HB5X 3HSKA 4C7JA 2OFPA 2YQ4A 4NZ9A 2DQ4A 2X8LA 1PJ2A 5ILGA 3ZCXA 3DXFA 1TB4A 4BGVA 2PD6A 4RF2A 1Y6JA 1CEQA 4CLEA 3RUAA 2ZQZA 1DLIA 3AOEA 3GH3A 3RU9A 1IHYA 1YO6A 1XQ1A 3EZLA 1C0IA 1PX0A 3F46A 3UAGA 3WX0A 1XU9A 2FZWA 3I9LA 1ISIA 3GQVA 1HE2A 5I7EA 1I32A 1B8VA 1SEVA 4JN6B 4K9DA 1PJSA 2OP1A 5F5NA 3HADA 1YVEI 3EUWA 3GT0A 4DTIA 4H3VA 1DOHA 1LRKA 4IPTA 5JW6A 1ENZA 4LRTB 5EERA 3I23A 1T1RA 1CIVA 1LU9A 1G0OA 1QLHA 5L4SA 1P1KA 5FFFA 2AQ8A 3U49A 3RUFA 4RDHA 1LDYA 2W2LA 5F5LA 4TZKA 2E6UX 4W9NC 3X2FA 4YRAA 4XYEA 3JYOA 1N9GA 1H2HA 4W99A 1GTMA 4O6VA 1NQ5A 4MDHA 2G5CA 3KHUA 4FN4A 2P4HX 3OJOA 4EBFA 1DRWA 1P74A 3V2HA 1Z6ZA 3MOIA 4CPDA 1LXCA 4XWYA 1PQPA 4OXKA 3NT5A 1ZK0A 4RORA 4BNFA 1A71A 4NBTA 4QTZA 3T4XA 3LT2A 3MEQA 4XR4A 1L7DA 5KVCA 3SC4A 1UDAA 1E5LA 4YJDA 4EUHA 4PN3A 1GCOA 3PJEA 4DIBA 4JXKA 1LDBA 4YAEA 3KOUA 3QY9A 4O1MA 1DJQA 3SBOA 5I9NA 5L95A 2D3TA 4F3YA 5U9CA 1WPQA 3MJSA 4IBOA 5A9SA 1PGJA 2OBNA 4RF3A 3TFOA 5EL0A 3QWFA 3I9MA 5JDIA 1ZNQO 3K9QO 2O3UA 4YT4A 1MC5A 3NKLA 4EITA 3IDSA 1U3TA 3HE3A 1HWYA 2NTNA 3KEQA 3TJRA 3DZKA 4GGPA 1IL0A 1BSVA 1VL8A 5IG2A 3T7CA 1GYQA 3PYLA 3WMXA 3HZZA 4QO7A 5FYDA 1AXGA 2GCGA 4ZVVA 1T26A 2PKQO 2VT2A 3BZUA 2VWGA 1LQTA 1WMBA 2FHSA 2PZMA 3T4EA 3HFSA 4FJ1A 4LCJA 1R15A 4TROA 4GLOA 2YYYA 4EEXA 1KEVA 4WOJA 1E3IA 1GCUA 3GVXA 4BO9A 5JC8A 2ZYAA 1AHIA 1HDRA 4GGOA 3PP8A 1PJQA 3S2FA 3GRPA 1D1TA 2PA3A 3M6IA 3FNFA 5BT9A 3H2ZA 3FN4A 3GZ4A 3WSWA 3TSCA 4UAGA 1E92A 2FSSA 3ZHZA 4XGIA 3H3JA 4DIFA 1HDYA 3W1VA 1IOLA 2NU6A 4IXTA 2EWMA 2A35A 4XD2A 3VPHA 1ZCJA 1NFQA 2DT5A 2JD2A 2W2LD 5LC1A 4MVJP 3H7AA 2RAFA 2C5AA 4MVJE 3HG7A 2X5JO 4J4HA 1BGVA 3ANLA 5I9MA 2ZCUA 4L73A 3ASVA 2C07A 2EIHA 2GN8A 1BDBA 4WLVA 5JDCA 2C0CA 4FJ0A 4PZCA 1EE9A 3JYNA 2EG9A 4PLGA 3GVIA 4DREA 2CUKA 4UUOA 3EYWA 3NGXA 5C5IA 2X0JA 3T7EA 1NPTO 3DBHB 3A28A 2X7HA 2WJPA 2JD1A 1NAIA 3QVWA 2X22A 4DVJA 4K1LA 2EERA 4UVGA 1TA4A 3ZWNA 3FPLA 5KIAA 3A06A 4O59O 3NYWA 2H5LA 4XQCA 4BHTA 2O7SA 1CDOA 1NTOA 3ZHYA 1K6XA 2C59A 1MFPA 2OZPA 1MG0A 2V7PA 3H6KA 3JD0A 1U3UA 3INRA 1VRWA 3M1LA 4OOFA 3E5RA 1F06A 3EK2A 4OAQA 1HTBA 4IDFA 5BSFA 2OBYA 3H9EO 4YWJA 3ZU4A 4R68A 3C24A 1JW9B 3PI7A 5JSFA 4CUZA 1DSSG 4YQYA 5BSHA 1PU2A 4TKMA 2SCUA 2C2YA 5AXAA 4EUEA 1IZ0A 4PRLA 3F47A 1ENPA 1J5PA 5JAMA 1FDSA 1BG6A 4XGKA 1E7MA 5EQFA 4I5DA 1GL3A 2QYSA 2YDXA 1A7AA 1PS0A 3JQAA 4YJGB 1KEPA 3TDKA 3SVTA 1DAPA 1YB4A 4ZQEA 4BGEA 5AXCA 5ITWA 1ARZA 1P77A 4PLVA 5CAEA 2PY6A 2FR1A 3GPIA 2HK9A 2HKIA 2QIOA 1XU7A 2UV8A 4IS3A 2AG8A 4J0FA 4LCEA 1DIHA 4OH1A 5FEUA 1W0CA 3PGJA 4JQCA 3VKVA 3WBFA 4UUNA 1BXGA 2JAHA 4QQRA 5MGBA 2C7GA 3EW7A 1H94A 5CDTA 2BI7A 4J16A 5KJEA 1TT5A 3JQ8A 3ZWPA 2DBRA 1YBVA 4UUMA 4B4UA 1MGOA 3PWZA 4HX5A 1VPDA 3GNQA 5ITVA 3WBBA 2IE0A 1ML3A 3AI2A 3WJ7A 3VZQA 2HK7A 1YJ8A 4XR9A 4Z0TA 1ULSA 4GVLA 1O6ZA 1UXIA 3Q1LA 1KVTA 4MVJG 4DMLA 1H0KA 1MB4A 1TXGA 4W7HA 1I2CA 3D4NA 3JQ8B 2G76A 3RD5A 3DHNA 1I3NA 5G0UA 2ZK7A 1HE4A 1K6IA 1I3MA 1UUFA 3ADOA 5JAZA 3IOYA 3FCOA 3RI3A 2G82A 3S55A 4R4JA 3W4IA 4BNLA 4IQGA 1H6DA 3IIEA 5IZCC 2VHXA 4WE3A 3FR7A 1V3UA 4IZIA 5TT0A 3KSZO 3PXXA 3FWZA 3GMDA 3ABIA 4GI2A 4NBVA 1YH3A 3RQSA 3D5TA 3DOOA 1XHLA 4WJZA 2VYND 1ZK4A 3QWAA 4WCDA 3GFGA 3ASUA 1OFGA 4N18A 2JHFA 4B7UA 1XLTA 4CMIA 4D44A 1XEAA 1DRVA 5JMPA 2VTEA 4J2HA 4CUJA 3BA1A 5DP1A 4LMPA 4PG8A 1AUPA 3NDJA 5CPFA 3GY0A 2J3HA 1HEUA 4YJHB 3FPCA 5L4LA 4RPGA 4WCFB 4ND3A 4NQZA 2VT3A 1JDJA 1Y8QB 2V6GA 4FIZA 3QVXA 2XPCA 5L51A 4Q3CA 2PFGA 1X13A 4LVCA 2EEZA 3ZN2A 3TZHA 4DPLA 1QMGA 4XYGA 3WYEA 1E77A 3E8XA 3ZH2A 2D59A 3AY6A 3WGGA 3DTTA 1ZMTA 3E9NA 3ONFA 4WK6A 4D0RA 4WEOA 1RJWA 3HB4X 1DHTA 2ZJ1A 3PQDA 4GMFA 3L4SO 4MIEA 4OSPA 1XR3A 4EUFA 5THKA 4KWHA 3AY3A 4ITUA
chains in the Genus database with same CATH superfamily
4FYKA 5CVCA 3V8VA 4HFNA 4R3UC 3E27A 4KKXB 1EUDA 2VQFB 1IXZA 1DOZA 1MX9A 3OIDA 2ZS8A 3AHHA 5LOVB 3ILXA 4PVCA 1ZI8A 2FVYA 2PR2A 4HP8A 5F1YA 5FQOA 2XZTA 3IEUA 1EQAA 1IXYA 1UM8A 2FMHA 5DGXA 5ADUS 2BYTA 3K20A 3M3HA 3SOPA 3TTYA 5T64A 3WDKA 4JT9A 3X3HA 4F1JA 1V8OA 3L9XA 3JQGB 1A69A 3RC3A 1KI6B 3LQYA 4QDJA 1K7SN 2G1JA 4J7XA 4QJBA 4BO6A 4BU1A 5FPSA 2EGHA 3IAS1 2VLIA 1Z2EA 4QJ4A 2AJLI 4AY6A 3AUUA 1G17A 4V0NA 3N7AA 3OD5A 4MV4A 2R7LA 2XE8A 2I34A 3FPBA 5ALZA 4UTNA 1VIDA 3NJ8A 3T1YB 2I03A 1MN6A 3CH5A 1LBIA 1SCDA 2AVNA 4CKBA 5K45A 1JG4A 2JFVA 4ZOLF 1F6DA 2H63A 1DZIA 2HA5A 4F2PA 1VMAA 5HYVA 4PYKA 1XWIA 4LX8A 2ZI4A 3K92A 4M1QA 2H9IA 3RT7A 5E4YA 3WK8A 1D4FA 3F5FA 4TLEA 1LPOA 2QORA 3L0YA 1XGKA 4GMDA 1XD8A 4OUDB 5EWJB 4D3FA 3IP6A 5KTYA 8LDHA 5KQGA 1DCTA 1N2BA 2B4RO 4LDQA 3SC3A 2HPHA 5AUOB 2D4HA 4MLCA 2JGNA 3AL2A 2GI4A 4D97A 1UQUA 2ZSEA 1YR8A 1X14A 4H7IA 4ENSA 3KRTA 4OPMA 4D8TA 4WA8A 4QTYA 4KQ2A 1UP4A 1QORA 2ARKA 2HT6A 4M8SA 5EWJA 5FR1A 3RVMA 5FUQA 5LIPA 3EEOA 1MO4A 4LJRA 3A1DA 2QJTA 1EE2A 2HK8A 1AGRA 4TL9A 4QKQA 1OVGA 3O2QB 3O8RA 2QT0A 3KBOA 3KQPA 3OFNA 4M49A 2F3TA 1QVRA 4DADA 2CXRA 3LPAA 4FOLA 4PYLA 2JIZA 4LXXA 1M5RA 4LYYA 1P4RA 4W1QA 1LLQA 1K5DA 1Y1LA 2E5FA 3NHPA 3P1JA 4KC0A 1C0PA 1IY2A 1EH5A 2Q6TA 1YDEA 2FFJA 1QZXA 2XMRA 1CF2O 1PFGA 2HB6A 4BWFB 2OVFA 1AKWA 1T6ZA 4EYOA 3FWHA 4RHXA 3KJEA 5C81A 1KDOA 4QDZA 5E0OA 3SSNA 2IZ7A 3HB9A 4HB2A 4TLBA 3QMVA 5B58C 2G7ZA 1JIIA 2CDAA 5FBZA 1SXPA 1R3DA 3D3WB 1CJCA 4PO1A 3MGGA 5JISA 4KPGA 3VNBA 1U0JA 1ZWKA 1KR5A 1DVRA 2EWWA 3FUWA 3HB1A 1IVYA 3V80A 2M9MA 2WNSA 5IM4A 4PIPA 2PHZA 4Q9DA 4DB2A 1KERA 2Q6KA 1N7HA 1QP8A 3C3WA 3HFGA 4GKAA 5LA6A 5TPZA 3STXA 1P9WA 1ZGZA 2C42A 3VNQA 1CDZA 3QVVA 3U4DA 4B73A 5JNWA 3GCGA 5J2TA 3ZY6A 4Q7KA 3PWKA 1R27A 2Y71A 4HEQA 4J0KA 1JLLB 1J2YA 1M1ZA 2XODA 3EXAA 5C8ZA 4IDHA 4OYHA 1QKIA 2LV8A 4LXQA 4CMHA 4CNQA 4G5YA 2IS1A 1UDCA 2QL7A 4K1XA 3DMFA 5ALRA 4ILEA 1HURA 3CXRA 3TLGA 1P80A 4HWGA 2PLWA 3PYMA 4TVKA 4ZCLA 1N0HA 4CU5A 1J97A 2M6SA 2MYNA 1XNJA 2GNAA 2I3ZA 2XTMA 3SSOA 1TYDE 4YT2A 5A5EA 2D7DA 4WBSA 3I34X 4KK3A 1PAUA 4ZT5A 1NE7A 3FMGA 3LVQE 4GMKA 5L3RA 4N82A 5A3QA 3GN1A 2M2IA 4JGGA 5KYWA 1QPZA 2IK8A 3AQIA 3NT2A 2P75A 2XA2A 1OV6A 5CDSA 1R4ZA 2HWWA 1NG1A 3VH3A 2V5AA 1XXLA 3TLYA 3TLGB 2Q7XA 3V8NA 4BMXA 2OO5C 1RSZA 2V7QA 4LHZA 5AKGA 1AMUA 1GM5A 2F59A 3WI7A 2WAOA 4XQ0A 3AR8A 3T9BA 4FFLA 3OZAA 1U2ZA 4I5GA 1YMVA 3CGWA 5LZ7A 1PL7A 1U2DA 5DNWA 1KEEA 1UMDA 1RD4A 2DR3A 1W5FA 2Y3IA 1YL5A 2XXAA 5TEVA 3N0TA 4JJ8A 2CXOA 1EUCA 4FIDA 2AK2A 4KSBA 4YRPA 3UAWA 4BZWA 4EENA 5M5BA 2AEFA 3O73A 1KHTA 4FGKA 2HW8A 3BXZA 1TF5A 3D4LA 3KUKA 3KJQA 2FZCA 2XTJA 4GWLA 4MCIA 4QEZA 3H9CA 1E2GA 1R6VA 1SKYB 1WEKA 2VP2A 4L51A 4ZVUA 5M29A 1KEEB 1UMDB 4L5CA 5K8JB 3AM5A 3GAFA 4O4LF 4CLOB 3E23A 3BMOA 1U7HA 2JHCA 1MV5A 5FR2A 1L8QA 2V6JA 1FFXB 3C85A 1XFAA 1R6DA 3S8YA 1O8BA 1KETA 1C1XB 1MDFA 2P0YA 4OREX 2QSJA 3UA4A 3W8RA 1IZYA 4G56A 4ZT7A 2PZJA 2XY4A 1I5EA 2JFYA 4BJHB 4IFIA 2J7KA 2YIJA 2R6DA 2XUFA 5TGDA 5ELLA 1DEOA 2I7XA 1R0WA 1G2QA 2AGVA 3BICA 3HO6A 4TKUA 3H6HA 1GJRA 4Y2XA 4CMAA 2GK4A 4CUKA 4AQ7A 4E11A 2GPTA 3KKQA 4LZJA 1RYEA 3ZGXA 4BCBA 3PSHA 5FX2A 3EODA 5LD2B 1P1FA 5H3CA 1XZHA 3DAPA 4E31A 4Z4QA 1JMVA 2O9JA 2YZNA 4LF8B 5LP6C 1NDUA 2CKDA 3FCYA 4AAYA 2BN4A 1JDVA 4V0QA 4L0MA 1H2AS 3GT4A 5EE1A 3R4CA 3IKTA 1E64A 2F3PA 4ZOBA 1VE5A 5AM3A 3WNDA 3HSYA 5AFSA 3HJCA 3WV4A 4B44A 4G8JA 5DHPA 4G67A 5AO9A 4N0DA 2KI5A 4MHSA 3TG2A 4MR9B 2ZATA 3P26A 4HOYA 5DOVA 2D1TA 3HZRA 4KACA 1SKMA 1A8SA 3ZJUA 1VI5A 2AH5A 3HVUA 2R86A 3BB3A 2PRKA 1A2QA 3QNUA 4JJIA 3ROXA 4CIXA 4J7UA 2GPSA 2O2SA 2IY9A 4OO3A 3KLNA 3ELDA 3EVTA 2R3SA 5F2OA 1Q77A 4YAJA 1VSUA 2OECA 4Y8VA 2YFYA 3K09A 3ZIDA 2Z6AA 2OCLA 1DNPA 5KREA 3VGPA 1JALA 4R51A 1TZKA 1XRPA 3UXYA 2BGWA 4R1UA 3RIXA 7AT1A 5K20A 1D7OA 3IUYA 3W5IA 1UAYA 4KQKA 4Q0MA 2WIJA 4Z9BA 4GRIA 3AERB 3BZWA 3A11A 2PZLA 1QCCA 2IZ0A 2WYOA 2B36A 2VP0A 2DXIA 1L2TA 2WF7A 1Y3FE 1F12A 2RHLA 2WZBA 3AFGA 4O2BB 2B8WA 4AG5A 3C74A 1DS6A 2FR8C 1NVKA 3IT3A 1A9RA 1N1DA 4KXMA 4G5XA 4F2HA 4WGGA 1YHNA 1QR6A 4P93A 4DA4A 1T5DX 2NU7A 3CPHA 1XVIA 4ENWA 3G1UA 3MTAA 2BSQA 4AG3A 3ND7A 5CM9C 1G8JA 4FD3A 2CLIB 3HKDB 3EDOA 3DKPA 5ER6A 3WY9A 2P1RA 4AX8A 3OJXA 2C3PA 4XJTA 5KPDA 5SICE 3QPCA 1ZJWA 2X4LA 5SY4A 2XIJA 4B3MB 2ZSKA 2OILA 4Y9SA 2OD7A 4QWWA 2IHVA 3AIMA 1ST3A 1TECE 4ACAA 1RNLA 3D2LA 4FKMA 4UEOA 4BCCA 3QZUA 4JVLA 4N03A 3OMXA 2EW8A 2ZDHA 4Z53A 1Y8AA 2ABWA 3M9LA 3U81A 2VXOA 2QB5A 3A8TA 1CUWA 1OYYA 3DMDA 4JJZA 1A9OA 1U7TA 2FJUA 4ZEWA 1USKA 4DDWA 1C3OA 1RLMA 2ISQA 1JS1X 3EIWA 4IOMA 3R0QA 1GFZA 2O0HA 2PFKA 3WOVA 4DLYA 2ZJYA 4DWOA 1Q95A 1MT0A 1GYPA 1QIJA 2OO5A 4LC9A 2I1LA 1IQRA 2XHEA 3F7NA 3HKBA 2J4CA 1BGWA 3A6FA 2WWVD 2NUAA 3UJ8A 2VHWA 3KQNA 4TV8B 4ZC8A 2O8BA 2B1GA 4MS1B 3ENZA 4RV9A 2ONJA 1AQ6A 4FB4A 1NM5A 4HH4A 2G1AA 5EHIA 2FPMA 2BFOA 4I55F 1Z4NA 1BW9B 2UUPA 3M6FA 3IOBA 1W30A 4W9MC 3G2KA 3OUUA 2YMLA 2YS6A 5EGNA 4LDNA 1LK5A 1GITA 4N7JA 2OA0A 3UW3A 4Y9TA 3ZV7A 1RJGA 4JQYA 4GR4A 1SQ0A 2MJLA 4M98A 4FYIA 5T8KC 3FY4A 1GGFA 4JL5A 3V00A 4EATA 5EZYB 1WD7A 1VKRA 1PGNA 2QR3A 4K9RA 4X41A 4JI5B 1D9XA 3Q5DA 4ZOLA 4A8PA 2JLBA 1N2SA 2CVPA 3LGAA 4L0QA 4MRVA 5KU1A 1NRXA 5JALA 2R6R1 1FMLA 3A2KA 2QRKA 2Z6VA 2QT1A 3C6QA 1IWPB 3OZGA 3RYHB 2DUWA 4HGOA 2YZMA 3U3JA 4EHKA 2VHCA 5DE3A 1AM4D 2WIAA 4C0KA 4HT3B 4X65B 1E3TA 1RQPA 2GO7A 2EJTA 1YCGA 2PGLA 3PU6A 4HSGA 4TXLA 5EJIA 1NBIA 4HV4A 5K9ZA 1J8FA 5CURA 4PQEA 2VO1A 3DLAA 3PT5A 4BECA 2XVXA 2C61A 3QXJA 1SB8A 1V1JA 4XB1A 4E0BA 4PZ9A 3EDMA 3PRYA 1JHPA 1IOWA 1YZLA 3C43A 5IDXA 5KOJA 2ZR8A 1P5HA 1UADA 2IITA 1DEHA 2JDIA 2XQJA 3Q4GA 5AI8A 4ZV7A 4TV9F 3S1AA 3HYCA 2XQVA 1RKUA 1ZJJA 3I76A 4NNJA 5H59A 5EJ4A 4CDGA 2XGJA 1JKMA 3T3OA 1IHDA 4M8NE 4P7JA 3U7QA 4D42A 2PR7A 1RQ7A 3LSYA 1WXHA 1WVIA 2IHKA 2VJAA 2WUFA 3AJEA 4LIPD 3KFXA 3VR4H 1IN4A 3W1EA 1Z0AA 1P2TA 2Q21A 2ZQYA 4NDZA 2AHOA 3CWZA 3PYXA 1S3FA 4ZQGA 5EPUA 4D9CA 5KSYA 3WGIA 1D4OA 1DXOA 1SELA 2WHEA 3DDZX 3IA2A 4DWVA 2AXQA 4EVQA 3MMSA 1OI2A 1ZHFA 2FE4A 5BSWA 3NBZC 3Q8WA 2HJVA 4PPFA 3JQAB 1KEWA 1S1CA 2GMWA 3ESYA 3K0CA 4JB0A 2GZ2A 4DZRA 2C9BA 3T5TA 2PRSA 3EGXA 5MFPA 1NN3A 3ESDA 5GOZA 2I6TA 4E2FA 3D8SA 3LFHA 3IPYA 4V1CI 2Q1WA 1JG6A 5AOVA 5BMVF 2Q6VA 4C14A 4LZNA 4FBGA 2UYGA 4FYWA 2BFAA 4MKFA 2RSLA 5AKEA 5FBVB 3BDIA 1FS5A 3EEBA 2D0OB 4LDRA 4YCJA 5BT8A 4X00A 1N0WA 3CSSA 1P5ZB 2ZUSA 1C8BA 2V3VA 2VRCD 3TK1A 4AVYA 3EGIA 3LTEA 4LMAA 5JXIA 5AJVB 3DV0A 4RTNA 1QFZA 1BQ3A 4LV8B 5FULA 4YQFA 4U7WA 2WFMA 1WCXA 1YVPA 2Y1EA 3HRIA 2P2NA 3U4IA 3RHSA 1E6LA 3ZUPA 5HXAA 5BR7A 1NMXA 5CNMA 3HXMA 2GJKA 2PEZA 3EG9A 1I7QB 2C3YA 3ZIAD 3ULKA 2MMCA 3AB8A 3IYLW 3FKSD 1C1HA 1GEGA 4A9AA 2LTAA 4Q9NA 4PGHA 3HO1A 3ICEA 1RQ2A 4C04A 4MINA 3RUCA 1Z0KA 2VBFA 4B76A 3Q6MA 4JROA 2R97A 2OPHA 2AD5A 3FRIA 2FSPA 4QTUB 3U4CA 3BHJA 5D2CA 2P5YA 1NY5A 3A1NA 4M9UA 5DT9A 3ZZ0A 1I4OA 4A8JA 4JYZA 1AX9A 4A03A 2V74B 1EJ2A 2F90A 4YRBA 3TGPA 4X92A 3WRWA 3WWDA 1RHRA 4OB8A 2B2CA 5ALWA 1Z5WA 4BVJA 1H1DA 3NTRA 1GKKA 4V0SA 2X40A 4DJDC 3E1KA 4KPUB 2MDTA 3DV9A 3EXFA 4BNIA 5A06A 3T7KA 1E3MA 4MA0A 3RYFA 4R7TA 4EA8A 4HLUA 3SNHA 4IGIA 5B4UA 4C30A 4WADA 3REOA 1NOKA 2K4MA 1Y8RA 2NZWA 3VR5D 4MRMA 5F4ZA 3FZYA 3CW8X 2PT5A 1RS0A 3G8AA 3V4VB 5FLXA 1IJBA 4Q3EA 4B85A 1VLLA 4MYUA 2YUIA 1OHHD 4OI1A 2A9KA 4MCJA 1A0OA 2J5XA 4Q9AA 3SFZA 1WUKS 3U7GA 2FSGA 1Y5MA 1BDJA 1NFRA 4HYYA 4L4UA 4LBVA 4NMHA 4YRCA 1G8AA 2HA6A 2YWJA 3EMDA 3SN6A 5MDHA 2QPAA 3L1UA 3Q2IA 3DL2A 3ZXUB 2V7GA 2X2PA 5KYXA 6LDHA 3K2IA 2XDQB 3PE4A 3AHJA 4ZGWA 2EZ8A 4B3FX 4PLCA 5DYYA 2XSZA 4ZVNA 2EZUA 1OGIA 4ZYWA 5I3CA 4ARCA 2I76A 4TSFD 2JIRA 2VPTA 2DBZA 3EZGA 3FWYA 4HRYA 1I6LA 1GU0A 1BQ4A 1CUIA 4M0EA 4C21A 2I0FA 1K7XB 5CLFA 4FD2A 5C52B 1I5RA 2WD7B 1MPXA 3P0EA 1PGQA 1NLFA 3AR9A 4XFDA 2CNDA 1Y3AA 4DS3A 2CD7A 5LQRA 4WZAA 2UZ3A 3FKQA 4RK6A 4WY8A 4ETWA 3F3YA 3B5IA 4IJKA 4G4SP 3KD3A 5B6PA 1P6QA 5JCPA 3IDQA 3HCOA 4I2NA 4OHFA 4DMGA 3THRA 1ZWLA 2D74A 2EF1A 2PKCA 3JASA 3IP5A 5C32A 1HRKA 1BCRB 2QW8A 4BASA 3PUIA 1EXDA 1A4UA 4D3ZA 1JYSA 1J0CA 1GN9A 2IL1A 1WZNA 4UHEA 1J49A 1YS1X 4KO3S 2B9VA 4JLMA 2G3YA 4WNAB 4DIUA 4J0JA 1KIFA 4L9RA 3FPAA 1UBEA 3CYFA 1JAXA 1RP7A 3FVRA 3CB2A 3JVEA 4KR9A 2GN4A 1SVIA 3BA6A 5JS1A 1R66A 3FDZB 1N6RA 5AM4A 5KKCA 4M54A 3OTWA 5CDYA 4QOFA 2HWUA 5DHTA 3U2QA 1O9BA 2PUDA 1U81A 2YWCA 3FSGA 3G9ZA 2JZCA 4FWBA 4V0LA 1KMMA 1W34A 2ZJAA 3JU3A 4FP9A 4K9OA 4LYEA 1H1TA 2BHSA 4WTOA 3T9FA 4EG0A 5UKDA 5AW0A 1DAGA 4HWSA 5BXYA 4AY5A 5AVZA 1XCJA 3W5DA 1WBJB 3GGCA 4ML3A 2WWTA 3AK4A 4HNAB 1E5QA 2J5KA 5HIAA 5LDDC 4MA5A 2JIZD 2VTDA 1XRLA 3RUDA 4CF5A 5JZMA 1CR2A 3NBYC 3U4QB 2BUAA 1OH5A 4DR7B 3V1UA 2QD5A 3DSRA 3PFHA 1XQYA 2BEVA 4WXPA 4RUKA 2ZSUA 1K7YA 3DDNA 3O47A 1DTWA 2WPNA 3D3EA 2HA3A 4R9NA 1XAHA 1QYVA 1QXSA 4IEEA 3WLSA 5BY2A 1P0IA 2QRPA 1VSTA 4L95C 5J5VA 2ENWA 1U9ZA 3E5MA 1V95A 2P41A 3GLIB 2OZKA 1GZ5A 1OIXA 3D8TA 5ALSA 3SXUA 3GLUA 4BMVA 4N76A 1QF6A 3D7LA 4OBEA 1PFYA 4B0OA 3H11A 3G0BA 3MILA 5GGXA 3E3NA 3CEHA 1NPDA 4RZSA 2PRZA 1QHNA 4X20A 5IBRA 5LIRA 1I2AA 1OFUX 1GZ4A 1O0SA 1WB4A 3ZKWA 4NOKA 1X94A 2HLNA 1KFBB 1T2EA 4Z0NA 3TQFA 4GPD1 4IGEA 2OCBA 3EAGA 4UE2A 1P19A 5E4JA 5BNTA 3PPIA 1SVWA 4AICA 4DVGA 3FIUA 5JASA 4DBLE 4BQNA 4ZTBA 3D7RA 1MOQA 1W6RA 2X0KA 2ZTSA 1NYQA 1Y6ZA 2CVQA 2PZKA 3GEDA 3HCBA 3IXMA 4IHJF 5KNCD 2FZLA 3GEBA 1RM3A 1SWWA 2Q3HA 2DJ5A 3LOPA 3LUGA 4LA4A 3NP9A 3HDTA 4ZYVA 1DG3A 2ZRQA 3VKUA 3ZXXA 2PBLA 3EGOA 3L1KA 3GRKA 5E6SB 4YIHA 1X1SA 3X1ZA 3N05A 4NU6A 3HDGA 3MINB 1S8FA 3A4IA 3N8DA 3F3MA 4HH3C 2QN9A 3EFBA 3VPFA 1D6MA 2D1YA 3KPJA 2HDNB 2O5RA 2G9NA 3G5TA 2IT1A 2ZYRA 2RBEA 2Z57A 5FI0B 3PQEA 1OJLA 4G5GA 3KKPA 4EHFA 3SBDA 4JENA 3S2IA 4Z51A 3GZNB 3DEHA 4UE6A 4PRKA 1CZHA 1QGZA 2ODPA 4GOND 4U2CA 1GGMA 2BI8A 2Q9CA 3EIOA 3IPCA 2CK3D 2Z95A 2P30A 4I36A 1N57A 2CDBA 2SKEA 3H0CA 3WLJA 2GYYA 5TQ2B 2CSUA 4QVGA 4DJJA 2XNDA 4MA4A 1XTQA 4RABA 5CXSA 1RXSA 4LTDA 4Q1FA 4TVBA 3Q7EA 3U40A 3HDQA 5ECDA 4B3GA 3PVSA 2UU9B 1I0LA 3FCEA 2GN6A 1KKLA 2H1IA 2NU9B 1C3LA 3MBKA 3SS8A 1E2BA 2D8MA 3ZE6A 1Q44A 1Y8CA 3IAS6 4J91A 5FPPA 1OZGA 1Z5UA 2QD4A 2B8JA 4LGYA 4Z5XA 1GPKA 1J1ZA 5GJVC 3SIRA 4TS4A 2DSNA 1ODJA 2PS0A 4E08A 4BAGA 2Q1SA 3GEPA 4JJ7A 5K1ZA 4XWGA 2OE2A 2H4XA 5EMMA 1VXOA 1XG5A 3EQ9A 3GJZA 4LKRA 4UBIA 4A92A 3DUFB 5EJ5A 5AVRA 1NHGA 5KYNA 1XK7A 2N47A 3Q3VA 5G4KA 1UOPA 1MP0A 2FF7A 3KKLA 1M34A 1OROA 2XMDA 3VC7A 3PBKA 1LQUA 3DTVD 3HCDA 4LGCA 1N5KA 4OAOA 4YAWA 8ADHA 3SC2B 3KE9A 1E60A 3O9MA 3UJ7A 4BO3A 4G0VA 1VL5A 2QTFA 2ZIEA 3WADA 1WSWA 1XVUA 3CTMA 3SP1A 1B4DA 5J9FA 4CM6A 1GGJA 1U2QA 3EAQA 1VSQA 3PNKA 3H97A 4JLJA 5F33A 5IHPA 5KTOA 1OH8A 2RIRA 1ZAYA 3VPGA 4FOPA 5JD3A 5AM0A 2EBHX 2OV3A 1FYFA 5EIWA 5JVDB 3B36A 4EYGA 3PEWA 1HT1E 2ZT7A 3GUHA 3K32A 4BOYA 1VMEA 3AYZB 1Q0ZA 1MQAA 4OV6B 3T0GA 1ZICA 3B51X 2C97A 3ADPA 2QMQA 1Q2XA 2VYQA 3W9UA 3UK6A 3TSYA 3P0FA 1J9GA 1U2RA 4WLEA 2FSHA 4LYAA 4ZODA 1EHYA 5CXXA 3UMVA 3W5AA 3QQPA 5EP4A 5C1DA 4EJSB 3CMMA 3ZWMA 2YW9A 3QKSA 4FYPA 4MYTA 3W5HA 4A15A 4E33A 5IF9A 4CV1A 3ANMA 1E1CA 4RMHA 3K9WA 2GZHA 2V59A 3RAJA 2Q3DA 3DTYA 3Q9UA 4FWIB 4GF5A 4ZO7A 3U39A 2XAUA 4H1WA 3K96A 1GUZA 5HX7A 5DBEX 3WGZA 1A7UA 2R87A 4IJQA 4PSCA 2IODA 3LD9A 2J8ZA 2FUKA 1GWNA 4EKEA 1QYXA 3ETDA 2B4AA 1KZ7B 3NJ4A 5BNIA 4XIYA 3TQTA 4Q24A 1F4VA 3QKSB 4HEA6 3IE2A 3NDIA 4JC0A 1CP2A 2QS9A 1ID1A 2UVQA 4HAVA 4BRSA 5K0TA 3EOBI 4CF3A 5KX5B 3UZUA 4QVKA 3O2JA 4MPPA 4Y2VA 1RC8A 2HSWA 1V47A 3NAQA 4Y0AA 1F8YA 3B82A 1K8YB 1NVUQ 3ODGA 5ADWA 3N70A 4GE0A 3I28A 3ID6C 1GPJA 1M73E 4HNSA 4YT5A 2H9YA 1RRVA 5F3WB 4TGLA 3T7RA 2Y1XA 5EXTA 4NJMB 1L4EA 2PS9A 1G21E 3ZWBA 5KEIA 2UZ4A 3Q0EA 1IIRA 3H8SA 3P9NA 3DEAA 1P4SA 2B5VA 2P9FA 3OO1A 5BQ5A 2WYVA 2W70A 4I50A 2W6IA 4K9MA 5K0ZA 4IZOA 1M83A 5M2QA 3PEFA 1JR6A 4Y6OA 4D41A 4UFOA 3T4PA 5G3YA 1E9RA 2I2AA 5G2OA 2NU8B 5I9LA 4U1RA 2BUCA 3QTTA 4L85A 5SZKB 1GAWA 3PGKA 4HN9A 4X1KA 4YALA 3UK1A 5F7XA 2OAP1 2FX5A 2IHYA 2LIPA 2HA4A 2NO1A 4EP1A 1JEEA 3E9QA 3R5JA 4FVTA 5EMKA 2NWQA 4MVXA 3GYGA 1GG8A 1PYOA 1G7CA 4F60A 2G9RA 4Q03A 1GD1O 3T99A 2ZDGA 3TR0A 2LNDA 3A58B 1DDGA 1WP4A 2VNSA 2WD8A 3T94A 2OCAA 2QAGC 5KVSA 1IWOA 2H5JA 3A4VA 5ALLA 3DHYA 2NVUB 1OLOA 2GARA 2IYWA 2Q1TA 4AF6A 2OXTA 3ZI0A 4JQSA 1DARA 4X7PA 4MNTA 5BN4B 3DE5X 4R01A 1Z68A 3ZEIA 1JEAA 1OIWA 1NJ2A 1SBHA 1JPJA 1WMAA 4MOWA 4B74A 4YO7A 4WECA 3B48A 2NXEA 2HV9A 3F6BX 1PJ4A 2P2YA 1Z7GA 1EFRD 4MUEA 4EO7A 2JHGA 4BQSA 1R8SA 4LBWA 4DIKA 1NVTA 1YACA 4O02B 1KQNA 2XZPA 3UJHA 4C0HA 5CCXA 1MRSA 2A1TS 3EIUA 3ICCA 2WJ6A 4RMIA 3F78A 5A4DA 2Q3BA 3DXXA 5ED4A 1GGKA 1ATZA 4BNGA 5BN4A 1OAOC 2EFGA 1AKMA 3EMVA 3FMIA 1A77A 3DZHA 2VHVA 3I30X 1VHLA 1LWNA 4ZOEA 3KUDA 3IBYA 2IYQA 1CFJA 4N8DA 2O2ZA 1TU3A 4B6OA 5CYOA 5DIFA 3HNRA 1SG6A 2HCTA 4YJ2F 2ZUBA 1MABA 2PM8A 3GJ4A 2C5GA 2YWFA 4NZYA 2HXYA 3RC1A 4WBNA 1N6OA 1ORHA 3EEQA 5IKXA 4UU1A 3W6UA 4PYOA 1XNQB 5KWVA 4GKKB 2JW5A 3L07A 1LJ8A 4HS9A 4JB3A 1J90A 3KOMA 3RAEC 2HPZA 2IOFK 2VJPA 3NPMA 9ATCA 3B20A 1JIJA 3U0VA 1S7GA 2GAOA 2RGNC 4CMEA 7MDHA 4MGIR 5CP8A 2RARA 3CEPB 3M4XA 4ZCRA 4BV2A 2A2ZA 1U0EA 5JHHB 1XQXA 1T2AA 1M1YA 1DXYA 2JFXA 1JJIA 4A0QA 1EPUA 3ZY2A 3VYWA 5FIUA 1WPGA 3MCTA 5JRJA 3FLMA 3QKIA 3TSOA 4GSKA 2IXAA 3FWNA 4LFCB 3R8CA 1V3QE 2A5LA 2O6LA 3OZVA 4FOSA 5LMZA 5AJWA 1T9KA 3WLPA 1UODA 4ZI7F 4PLTA 5H0IA 5IBCA 4I19A 1IN8A 1GUAA 2H85A 3CF4A 4GIBA 4NAVA 4CQMD 1UXGA 1GG5A 4ZO6A 4EIWA 3C5HA 1D9ZA 1XZEA 3K9FC 4PNHA 4WPGA 4P0QB 1W5SA 3R09A 4FTWA 5BV0A 2N9UA 3QU9A 5EKUA 1GPNA 1P18A 1OI7A 3F6YA 4B6SA 1Y34E 4G6ZA 4OBBA 1NMYA 1YZUA 3GLQA 1BXRB 2DWUA 4UJ3A 2PTGA 4YDHB 1MUUA 4KWIA 3SX2A 2FLKA 4YRLA 1L7RA 4GNKA 1PJTA 1S3IA 5G4LA 1DBWA 1AHNA 1FK8A 2ZR9A 1BU8A 1ELOA 1RLOA 2BEJA 3JAWB 1WM1A 4L0DA 5FWXA 2JLSA 2RH9B 5LLSA 3ZXIA 4BQFA 4XRRA 1KEUA 4CZ2A 1E18A 1PEAA 5KQLA 4I3FA 2PSEA 4FINA 3DDWA 4ECAA 1FP4B 1NF2A 1P9NA 3IELA 3NH6A 3VYTB 5HTOA 2BTQA 1EFDN 3QHQA 1AKVA 4FS3A 1WBBA 2P2SA 3ZLTA 1PG0A 3ZQKA 5DM4A 621PA 2NP6A 5F1PA 2AR7A 2O14A 4X9XA 2PUBA 1DIOB 2EGUA 3DVAA 2RGCA 3P0RA 4OLBA 5KYGA 5KJCA 3U44B 5AOBA 1US8B 1HZZC 1AH2A 2AN4A 1W93A 2D54A 4JX9A 4FB5A 4RTPA 1KK3A 2OKGA 4UUPA 2A67A 1PBTA 3IQIX 5FOXA 3MM4A 5TQ0B 3T1VA 2VATA 4R71A 2B8NA 1O96A 2ECOA 1VPTA 1U94A 1G5QA 4G1FA 5AT1A 4DA6A 1QP4A 2DFLA 4CEHA 2X19A 1JDBB 5JG7A 3T5DA 1SA0A 3M6VA 4ZQFA 1RXYA 2I2XB 3PD7A 3JQ7A 3PHIA 1OH7A 3UQZA 5CFRA 5EXEA 5GP1A 1GNPA 1TDJA 5CU7A 4II2A 1C7IA 1J8YF 2A58A 2J07A 3C7TA 4U6SA 1A97A 1Z8DA 4KIFA 4ZYXA 5BP7A 1DKRA 2R8OA 2AWNA 4AG6A 2Q0SA 1TUBB 1N0VC 5CLQA 1IVSA 3FDIA 3L9WA 3N8HA 1PR3A 4S12A 3BMNB 5DULA 3F6SA 4MKZA 3O8DA 3WYGA 4ZGBA 4F8EA 1SBCA 1KOFA 1K0UA 2OK8A 3ZLUA 3S0JA 3ENWA 2HYDA 5JT1A 2OT3B 4RXTA 1KO5A 3VC1A 3VRHA 1CJMA 1RLJA 4N7RA 3WJAA 1X80A 2Y77A 1Z2PX 2C82A 4B3BA 3IR7A 1KMCA 2QU8A 4ISCA 1DJMA 2FLWA 1YVRA 2I54A 2X9NA 4DCOA 1BFKA 1V71A 3MCZA 4KPEC 1Z8HA 3CRMA 1BEEA 1WCV1 1IG3A 3OSUA 2XE4A 1C7FA 1GPAA 4YV1A 3COJA 4M86A 4XPIA 1Z4IA 5A04A 5ESWA 4WT7A 1MENA 1H0HA 5KO2A 1MZPA 3EB9A 1B3RA 1G8KA 3RRJA 2PBZA 5JCJD 3D64A 1QYCA 1I33A 2IOQA 2GEDA 4OHVA 1FUEA 2BAGA 3C1AA 3QF4B 4ZAVA 3RTDA 3NVAA 3GFBA 4JS0A 2AG5A 4OQNA 2EATA 1SZPA 3BSYA 4P1ZA 4QUAA 2EW2A 2B3DA 2BMEA 4J3NA 1SVLA 2ONYA 1K9VF 1V1RB 3K9GA 3TXAA 3UMJA 2NQTA 5IKOA 4D8UA 5FXMA 2HCJB 5K3BA 2TYSB 2OWDA 4B48A 1T4CA 1RAIA 4Q7JB 1T1EA 4Z0PA 1OXMA 4EG6A 2ZVJA 3TE6A 5CGQB 3VO9A 5TB5A 4UVDA 1REQA 1ZN9A 2CYCA 1IEQA 2RGNA 2VAWA 4P92A 1W2HA 3DE4X 2IKSA 3OTHA 4YLGA 2Z56A 1H6AA 2Q5IA 5JQWA 1E9AA 1GUYA 1KI7A 1OXVA 1CQWA 2E4XA 1ABFA 3UAVA 4ZDIA 1UBLS 4RKWA 3C3JA 4QICA 1T34A 2AC7A 3TCKA 2BY4A 4V2IA 3JWIA 2MSDB 3KHTA 4I9NA 1A7KA 1SUAA 5CK4A 3ON5A 3R0IA 2HX1A 2IBTA 5AJXA 3BULA 1Z8FA 1ZD1A 1JV2B 3DMGA 1RM5A 2VNKA 3IX7A 3LRPA 4JJFA 3Q5GA 2GF9A 2Q5QA 4GM4A 3ZY4A 9LDBA 2IWHA 2AUNA 3DOUA 1M6VB 1NBME 2PO7A 2R4UA 3N2KA 1L1EA 1O58A 4UQOA 4CEJA 3KLOA 3L0IB 5BV2P 4Q00A 5LBTA 1Z6PA 4PC1A 1GRQA 1K5PA 3NM6B 3OJWA 1O7JA 1ZD9A 4GPTA 3RTAA 1NZJA 4UHCA 4C7BA 3U4HA 2WM9B 1SC3A 1Y98A 1ZH8A 4JLOA 3ZZTA 2W8BB 3KO8A 5F23A 2E89A 3KXKA 2IC5A 2VDUE 1DT3A 1Z29A 3D9QX 4PSVA 2ZKIA 4PPQA 5IVKA 5DHUA 3A1CA 4A36A 2CBXA 5GJCA 4RIGA 3WL3A 4IDCA 2OO7A 2MT9A 2J5RA 5T4FA 4S1NA 3LUKA 1IN6A 2QGZA 5JCZA 4QGBA 3I92A 4C2AA 4FJ2A 4NOJA 2WZDA 1ODIA 3EEFA 5CLLA 2FHPA 1J2RA 3LFTA 1JDPA 2QDKA 2QD2A 4HC4A 3AF0A 3RK1A 4RPKA 5GADl 3T8YA 3ETNA 5HTKA 2PX3A 5HKKA 5F3DA 1B0ZA 4MSUA 2C3OA 2FPRA 3T3NA 3M1AA 3ZDAA 4FCWA 3J81A 4ZTZB 3I42A 5C1BA 2ZYWX 4BP1A 3KR2A 4ZVLA 1JSXA 2UZ1A 3RODA 2BFBA 1U0OC 5C2JB 3JS5A 1L4NA 2F8TA 1JWAB 3QOWA 2A88A 3JCZA 2NOAA 2LKCA 1MX3A 4A2QA 4LZOA 4ASUA 4NE7A 2AXPA 2Z5LA 4RANA 2RE8A 5D5PA 4X5OA 4PLHA 2NUBA 3KHKA 2IX9A 4M9XA 4UDOA 4CMIB 1V7QA 4WIAA 2H65A 3JX9A 4RKQA 3COWA 1OOEA 2HQ1A 1NSTA 1LPPA 4FBMA 1ONPA 1T4DA 4L75A 2OV1A 1TK9A 2Z1DA 2I8AA 2NPOA 1UXOA 1EWTA 4HZGA 3W5JA 1NG9A 3NBMA 4L4SA 3LYHA 4WKNA 3ZCVA 3IKMB 3EC7A 3O74A 2O19A 2WG2A 4IY1A 4EI8A 2I62A 5CHEA 2VPQA 2YHAA 1UXHA 1QK3A 2O4UX 3HQ4O 3ADCA 1RWVA 1L5QA 1L8AA 1TMKA 1XX6A 2JJ1A 3I0MA 3LLSA 3NHSA 4NRDA 1FJXA 3AHCA 4QVIA 1ZESA 4Y2HA 1EHCA 2DY1A 1V7PC 3D6VA 3COPA 1TEHA 2JLCA 2Y1OA 4MPJA 5H82A 1S96A 1P2BA 5E2AA 3EOAI 4YCAA 2VSQA 3D4PA 4M1MA 1B6SA 1GAQA 2JIDA 2PS1A 3AKDA 3GUZA 2AQKA 1XCBA 2C5LA 2YY5A 3R9KA 2G0NA 4EAQA 1OE0A 3AR4A 3FUXA 3O8BA 4MYRA 4DUGA 2HA0A 3LOQA 1E62A 2VUUA 5YASA 1M1NA 4RQTA 1KS2A 3EUAA 3OBIA 5G1OA 1HGXA 3IALA 3T7TA 3X1KA 1CZKA 2QSUA 5FADA 4OF4A 4C0LA 5EMJA 3E9MA 1TEVA 1D6NA 2R6CA 3D0OA 4A6XA 3BYZA 2A0KA 4XJXA 4DBLC 4XX0A 3CVXA 4UNIA 4Q34A 3DCYA 3QBJA 2EG5A 2Z5VA 3ND9A 4XYLA 1FU4A 4CF4A 3GUYA 4IUBS 4Q4HB 4C4YA 3U37A 5FA5A 3FNRA 3DWFA 4LY6A 4PWZA 4Y7CA 2CLMB 2HBRA 2JRLA 3DF7A 3QYFA 2X41A 2XLCA 1SCJA 2PDAA 2EVWX 1T25A 1FB5A 1DV1A 3WISA 2RJ3A 2WVGA 4JNKA 1JFFB 4MQFA 1YDHA 2UYCA 3L06A 1ZQ9A 2BSXA 1YS6A 3N0XA 5M7EA 2GBCA 1F9EA 1R9NA 3LXUX 3OJCA 4UREA 4DBZA 3I4CA 4LJ6A 1YB5A 4MO2A 3RFTA 2I4MA 2C2MA 3A0RB 3CY6A 1SVSA 4RZ3A 1T29A 3MAAC 4PSKA 2ZTMA 2I8CA 3HI4A 2LCFA 4RPJA 4H7PA 2R1VB 3IIMA 3QVGA 1LPMA 1HORA 2F1KA 4GMXA 2IYUA 1FDTA 2YCLA 3P96A 1KZHA 2P0AA 3IPLA 3AOEC 2OAEA 3EVAA 1I4LD 1WLYA 1II9A 2A5FA 3CR7A 1E99A 1MPTA 3CX3A 5F3RA 4DUGD 3TPZA 3O4FA 3EWNA 3NRJA 5AR1A 1W85B 5T5QA 3CX8A 4JYCA 1K3FA 1DC6A 5FEMA 4DV7B 3LUPA 4WY2A 3AEUB 5IVHA 1G16A 1NTRA 1KFEB 1QYRA 4RTSA 1EFCA 1HI9A 3B3AA 4H0FA 3WS7A 3PX2A 4Q9HA 3LC7O 3E48A 4CM7A 4BWYA 1U0LA 1XOIA 2CFIA 4BGUA 3TNLA 3AR2A 1GQ2A 2ZAOA 4FUTA 1HFWA 1X7HA 4BB5A 3UKOA 2VJLA 2X9GA 2GAJA 4R6WA 3VR3D 1UPBA 2OTCA 4XDGA 3VISA 4A16A 4JP2A 4H17A 3TQIA 5L7YA 1ZLXA 3T52A 1W6UA 3QU2A 5TE9A 3LBAA 1BRMA 1G5RA 2JJQA 1C8VB 2O2GA 2IH2A 3IBTA 4LHXA 4AC9A 1WABA 3QVTA 3ZWOA 1ECJA 3SM3A 3IAUA 3NWEA 4RTOA 1EFUA 3PTZA 2QOEA 2VVTA 4LJYA 3DD5A 3K30A 2RH4A 4WVLA 4EMSA 2J9GA 3F4KA 4X97A 1N3IA 1W36B 2QW1A 1W19A 4AS1A 4KR7A 5A7HA 3TW4A 4MPDA 2ZI3A 3DOIA 3UAOA 4D3DA 4EUSA 1C4WA 2XTAA 1M2OA 1SBIA 1GGEA 2PUHA 2OMKA 3MSXA 4AYXA 2CHQA 5FL7A 2RK4A 4C4AA 4DC0A 5T3UA 3DVSX 3P45A 1IONA 3RADC 4JP8A 1V16B 1P0MA 3H8JA 4Z4IA 4PZAA 3R0JA 4JH0A 3S8MA 4KGZA 4I7EA 2F3RA 1Y6QA 1H66A 2JJ8A 3ZHSA 4ZYTA 1KWKA 5T6MA 1NQUA 2DLDA 2BEKA 5G02A 2J4FA 2PMFA 4CG1A 5BQXA 2HTFA 3P0HA 5T4EA 1DI0A 2K6GA 3R3SA 3SMQA 4QUBA 3WMWA 3E53A 3LH5A 2Y2UA 3BH0A 3NTVA 4XFJA 2QQGA 3NHYA 3O4JA 5DYWA 5CA0B 4GVXA 4RPCA 2NV2B 2GZMA 4MGEA 1N5JA 3THOA 4BS9A 2L82A 4IH4A 2UYHA 3KSUA 2TMDA 8ATCA 2P9HA 2R1ZA 3IA7A 4GLJA 3TJMA 2CV0A 3KSMA 1TT5B 3ETGA 3WK5A 1MC4A