3W9SA

Crystal structure analysis of the n-terminal receiver domain of response regulator pmra
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
116
structure length
116
Chain Sequence
KILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGLHFLSRMRREKMTQPVLILTARDTLEDRISGLDTGADDYLVKPFALEELNARIRALLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of a Physical Blockage Mechanism for the Interaction of Response Regulator PmrA with Connector Protein PmrD from Klebsiella Pneumoniae
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae ntuh-k2044
molecule tags Signaling protein/antimicrobial protein
molecule keywords OmpR family response regulator in two-component regulatory s
total genus 42
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3w9sA00
1EHCA 3TX6A 1SRRA 2GX6A 2VUHB 1QP7A 4ZPJA 3QK7A 5TQ0B 2N9UA 4KFCA 4YP9A 1KRWA 4F3TA 2FMFA 3HVRA 4KRFA 4MS1A 3OLYA 3P9YA 4JB2A 1JDNA 2FEKA 3JY6A 3KLNA 4WUTA 1PNTA 4MR8A 3Q7RA 4TMYA 2PUDA 4OATA 3EQ2A 4MR9A 4O5AA 4RK4A 3O1JC 1PUXA 1EWVA 3VNBA 3N0RA 1P2FA 2JK1A 4N0QA 3F7NA 4IMJB 2ZAYA 4W5TA 1Z16A 2OQRA 2E4WA 3F73A 3LUGA 5FBHA 4RY8A 3BREA 4ETMA 2IPNA 4JOQA 1YIOA 2MSWA 5TPZA 2HQOA 3C3MA 3QEKA 1DP4A 2GKGA 3HZHA 3LUCA 4IGAA 2V0NA 5D2CA 1OXBB 3HV2A 3DLBA 3HK2A 5C5EA 4LZLA 1EFAA 2A9QA 1ZGGA 7ABPA 1U2PA 5TPWB 4ZMSA 5KWSA 1QPZA 3MYYA 2IPMA 2QSJA 3IPCA 5CHYA 4LRQA 1PNRA 1SXHA 3MM4A 2VYCA 3RH0A 4RXUA 2GWRA 5IBQA 1NXWA 3KJXA 1U8TA 3O2QB 3QELA 1Z26A 1UDRA 4PEVA 4DQDA 4YWHA 2WJWA 3T8YA 4G0QA 1E6MA 1JDPA 3JTEA 1ZY2A 2E4UA 3GWGA 2YHAA 4L4UA 4G0YA 3R0JA 1MIHA 1YMUA 1L5ZA 1USGA 2A9OA 1EAYA 3CU5A 3IP7A 1YS7A 4Q6WA 1YMVA 1JHZA 1NXVA 1ZDMA 4YRZA 4LX8A 4W5RA 2QXYA 5BRJA 2RJNA 3HO1A 3QELB 2DRIA 5JNRA 3LUFA 3E3MA 4EVRA 5HSGA 4G97A 3IP6A 5I4CA 1ZAYA 4ETIA 4Q7EA 3HSYA 4RK1A 4KPYA 1JL3A 3CZCA 2R48A 5CNJA 1QQBA 1VPWA 2BGGA 2PJUA 1Z17A 4Q6BA 4TN5A 2O20A 3DBIA 4RZSA 5B3JA 4QPJC 4XFKA 4RDCA 4MLDA 1ZVVA 1CEYA 3UUGA 1DBQA 4L85A 4O1IA 3RVSA 3H5LA 1JFTA 3C6QA 1LK0A 3T6KA 3SNKA 8ABPA 3GRCA 5IUNC 3OO0A 1M2FA 1NY5A 1D5WA 2MSLA 4MQFB 3FFWA 2FW0A 4MS4B 1PEAA 1ZHHA 4MR9B 1U0SY 2AYXA 9ABPA 3C3WA 2MYNA 5HM6A 1F51E 3ILHA 4LE2A 5DLEA 2X7XA 2QW1A 4ZYLA 2E4YA 1M2EA 3O2JA 1VKRA 4QYMA 4MGEA 3DGFC 5TQ0A 3OQNA 3HXMA 5EWMB 4EVQA 4FE4A 3QLUC 4Z4GA 5CNMA 3NNDA 5TPZD 1RZRD 4KVFA 1DBPA 1KGSA 4DN6A 4S04A 3N0WA 4MS3B 3O1HB 1E6LA 1QNLA 1FFGA 4OLAA 2R47A 3I42A 1P6QA 5EWLA 4N76A 5T7BA 1ZH2A 1KRXA 4HNRA 2A9RA 4MRMA 1DRKA 2L19A 4QYWA 1LJLA 1PEYA 2WY2D 3SY8A 4E7PA 3N8IA 3NHMA 1CYEA 1JLKA 5EWMA 4MQEB 1GCAA 3N75A 5FWYB 1DCMA 4H3KB 4W5OA 3H5OA 4YS6A 2P4UA 1Z13A 4W5NA 4N03A 2LBPA 1TLFA 5GQSA 3RVPA 2WB4A 4G0PA 4TLMB 3OO1A 2B1JA 2IPLA 3HUUA 1D1QA 2QVGA 3O75A 4EYKA 5EWJB 1A04A 3FGZA 3MF4A 4H60A 4MRMB 3O2SB 1T34A 5TPWA 3MQ4A 2Q5CA 3H75A 4FE7A 3EGCA 2R25B 3OM1A 2PUAA 3HM9A 4OTZA 1GCGA 2JVKA 4ETNA 5CNKA 5PNTA 3HDVA 4YGXB 3QLVC 1FFSA 3K9CA 4XXHA 4KQCA 2IKSA 5KQGA 1DCKA 1E6KA 3CRNA 6ABPA 3D02A 1SXGA 1FQWA 2FMHA 4G0XA 3CG0A 2RGYA 2M98A 1YK0A 3QX9A 5JNTA 1JFSA 1BDIA 3RVNA 4MR7B 5EWJA 3NNSA 2FLKA 4RKQA 1JF8A 1QO0D 1ABFA 2HPHA 3CTPA 3QLVA 4WWHA 2IPAB 1LBIA 4LE1A 3RVQA 4KK4A 4XARA 1TVMA 3O1IC 3I09A 3QEMB 5JNSA 4RV5A 1JH9A 3OMWA 1MVOA 2HSGA 3TO5A 4KMRA 3ILYA 3CS3A 3KCNA 4IF4A 4RK7A 1YTUA 1B00A 4YLEA 2E4VA 2IOYA 4G0MA 3CHYA 3N6VA 3A0RB 1U04A 1Z2DA 3D8UA 3OLZA 4HNQA 4ML3A 3LKBA 1GUBA 2B4AA 5C5CA 4JAVC 2FQYA 1M5TA 2P9HA 4UHKA 3QX8A 4CBVA 5BR1A 2WJAA 1H9CA 3H5VA 5KQLA 5DCLA 3OM0A 1DC7A 1W25A 5DKFA 3FMVA 3OLVA 2NT3A 3KKEA 5T3YA 4O1HA 2CHEA 3GV0A 3G1WA 3FFTA 4WXEA 4NCAA 2MSKA 3VNAA 2PUEA 4Z4FA 4NV3A 3H5TA 5KQMA 4F8JA 1YK1A 1FSPA 3A0UA 4RK0A 2MYPA 2F8SA 1DJMA 1RNLA 5JS1A 1RPJA 3K4HA 2QU7A 5TQ2A 3E61A 3H1EA 4N0PA 3SM9A 1RZRA 1QP4A 2FEWB 1MB3A 2TMYA 1EWTA 4RY0A 5IULC 1BDJA 2JB9A 4W5QA 4RS3A 2JBAB 3DGEC 4JASB 2HQBA 4WXMA 3TB6A 4G0OA 3IP9A 4MQFA 2QVCA 2LIVA 4KV7A 1ISSA 4M88A 4PE5B 4Z99A 1FFWA 1NXXA 2IYNA 3EAFA 5B3JC 5IEJA 3CG4A 1IIBA 3LUKA 3RQIA 3RVKA 5KC8A 1S8NA 1VLZA 3Q7TA 1RXEA 5EWLB 3H6GA 2ID9A 3BRQA 3HJFA 4MAAA 2LPMA 3JPYA 4MLCA 4QICA 3N53A 4G86A 3IPAA 2FMIA 4WZZA 2VK2A 5BQ3A 1NXSA 5IUJC 4EUKA 1YS6A 4MS3A 4XLTA 4LE0A 3Q41A 2PKXA 3RVOA 4MR8B 5IUKC 4P98A 1ZN2A 4YCSA 3H1FA 3A10A 1BAPA 4XASA 2PMCA 4XAQA 3CKMA 1Z15A 3M9XA 4MR7A 1U2QA 4NICA 4EVSA 5JNVA 3IDOA 5FWXB 1Z25A 3BBLA 3QLUA 2A9PA 4JP1A 2PAFA 1NXOA 1JX6A 1ZITA 5TE9A 3UKJA 3UK0A 3DLHA 4IRXA 1OXKB 2JVIA 4YV7A 1K66A 3SQNA 1QQAA 4KZKA 1D1PA 5ED4A 2L2QA 4RXTA 2VUIB 1L5YA 3TD9A 1W9HA 4EGSA 3C97A 4Z4IA 2CHFA 2GBPA 1USIA 3KTOA 1R8JA 2JCGA 1RXIA 1DZ3A 3GBVA 3F6CA 1C0EA 4P1ZA 1BVHA 4RXMA 1GUDA 3LUDA 3A3KA 3LUAA 4EYOA 5ABPA 3KYJB 4RU1A 1XHEA 3GA5A 3CNBA 1JWLA 2YHBA 2PLNA 2FN9A 1MAVA 2PUCA 5TQJA 2ID7A 4GNRA 4Z9BA 1TM2A 2WRZA 2W42A 5F64A 1NXTA 2CWDA 1CHNA 2FXIA 3GYBA 1URPA 1JYFA 4H3HB 2FVYA 5KQPA 3KS9A 3Q7SA 2I6FA 2MYTA 4ZMRA 1ZESA 1JBEA 4LDAA 4F12A 3GBPA 2JBAA 3I5AA 1Z18A 4YO7A 3LUJA 2PUBA 1SXIA 1QO0A 3NNNA 1I3CA 2R4QA 4RY9A 1XWWA 4D6XA 1HEYA 1Y1LA 2WWVD 1DRJA 3OLWA 3EDCA 1E2BA 3Q9SA 3HS3A 6CHYA 5GOTA 3RVLA 2E4XA 2LP4Y 3KG2A 1J56A 1JFVA 1P8AA 5TQ2B 4WT7A 4ZJPA 3EODA 3T38A 1ZH4A 3HEBA 1YVUA 2RJOA 1Z12A 3MA0A 4KREA 3ROTA 3LTEA 3Q15C 3RVRA 2ZWMA 4EY3A 4Y9TA 1Z2EA 2L18A 5IC5A 5FWYA 1NATA 3OMXA 3FDFA 2H0AA 2QR3A 4RKRA 3G85A 4OLBA 2KYRA 4UHJA 1KMIY 2FSPA 4YR7A 2PUGA 3DZDA 4JB0A 4Z9AA 3OLXA 3SAJA 2FQXA 2H3HA 4NCBA 3H5IA 5KI6A 4N41A 2NUBA 2F8TA 3B2NA 4G0ZA 3CFYA 3M6MD 3NBMA 3W9SA 3MMNA 4HNSA 1EWKA 3H1GA 4RWEA 4B09A 4IILA 3BILA 1NTRA 4MQEA 2JRLA 2OENG 1QMPA 2QZJA 1ISRA 2FEPA 2PL1A 3H5WA 3KHTA 3NHZA 3T95A 2HQRA 4KK3A 2QV0A 2NT4A 4TLLB 3FFXA 2RDMA 4MS1B 2JVJA 5E3JA 2PE5A 2FMKA 4KNYA 5JS2A 2E4ZA 3I45A 4OBBA 4EYQA 5FBKA 3OQMA 4Z0NA 3IP5A 3MIZA 4MPTA 3S99A 1C4WA 4IMIB 1DBWA 1BDHA 3O74A 4KQ9A 5FWXA 1ABEA 1TMYA 3KLOA 2FLWA 3LKVA 3CLKA 3LFTA 4LDZA 4FB4A 3RVMA 5IX8A 3L49A 2WMYA 5IEBA 4Z4EA 3CZ5A 3TMYA 3GT7A 3QLTA 5KC9A 3O21A 1NXPA 3F6PA 4Z4HA 3URMA 2PUFA 4GPAA 4MYRA 1DG9A 5JNUA 3H6HA 2FTKE 1D4ZA 3JPWA 2LUOA 4E7OA 2GI4A 2FN8A 1AB5A 1DCFA 1MB0A 3LOPA 4PZ0A 5HKOA 1A2OA 5JNWA 3SG0A 2IDMA 1VRVA 2CD7A 4PICA 1PHRA 1XHFA 4PYRA 1AB6A 5HQJA 3M9WA 3ROFA 1GLGA 3BRSA 3GL9A 2NZUG 4NQRA 1BA2A 4RSMA 3HCWA 4JA2A 3KSMA 3RVJA 4DADA 1ZGZA 1LBHA 1QKKA 4S05A 3JVDA 1DC8A 2J48A 3N0XA 2NZVG 3KYIB 2AYZA 2FQWA 5DTEA 4D74A 1F4VA 4D6YA 1SD5A 2L17A 1APBA 1LJUA 2HJ9A 5BRAA 4Z4CA 3OQOA 1M5UA 1D2AA 3QEMA 1USKA 4HYEA 3C3KA 2PL9A 1TJYA 3HDGA 5DGCA 3LUHA 2MYUA 1QP0A 3EJWA 4OG2A 1K68A 2XDYA 1JYEA 5CNIA 3EQZA 3LMKA 4F06A 1P6UA 1WETA 4MS4A 1A0OA 3EULA 3JS5A 3L6UA 2M1ZA 2FKAA 4RK6A 4RK5A 4EYGA 3JVIA 4F11A 3HUTA 4N47A
chains in the Genus database with same CATH superfamily
3N9IA 4QASA 2F6RA 4Z3KA 2D7CA 2H2WA 9GPBA 1NQVA 3IAAA 2NUTA 1XVTA 3MERA 4FK8A 1T5LA 3WZMA 3MB8A 2AFRA 1E5TA 1WNTA 3PE6A 3MOGA 4H35A 4YA6A 3E9YA 3X44A 1U3GA 1RLIA 1U7XA 3VVBA 1G1MA 5DH9A 4L8LA 2Q6KA 3DZGA 1N9GB 5DYGA 4A36A 4TMYA 4GMXA 3K0CC 1W85B 4ZCQA 1CJMA 2Q1WA 3U1TA 3X43A 2VQSA 5H16A 1CQWA 1ZCZA 1NX9A 1UWCA 4CM4A 1L5KA 4EW6A 1QVZA 4CM4B 1D9ZA 5KYYB 1QC5A 2F1OA 3M4XA 4JLPA 1M7GA 5LQJA 4HDQB 3DXYA 2IOHA 2EYUA 1LJ8A 3JQ8A 3BDVA 3K1TA 2QG9A 4LYDA 2NO0A 4TKUA 1GG9A 3P26A 2F2TA 2PKQP 4NNJA 1W5EA 1FPQA 4UDNA 1Z2PX 3Q3IA 1EE2A 3NWJA 2GK4A 3JARB 1H2YA 1T0HB 2HQOA 2V7EA 2CLMB 1YOVA 3HZHA 3PR1A 2B4RO 1ZBQA 2ZSIA 3RBVA 3HA3A 4B33A 3NHLA 4JLOA 3NT4A 3JZMA 3Q3HA 3A6EA 4I99A 4B71A 4GI2A 3DC2A 5A06A 5M34A 3G8YA 2DFKB 1PTKA 3RUIA 3RUPA 1EZ4A 5CX1A 4GOLD 1KIAA 1OVGA 4AW9A 3KQWA 3PZRA 1HDXA 5G40A 3TNJA 3EDQA 1RRCA 5EP1A 1G8AA 1UDRA 3D7RA 3KPJA 4NAUA 3A36A 1MDFA 4TL7A 5CD9A 2XUJA 2NO1A 2BGMA 2JCSA 1BXKA 4GM4A 4H4DA 1ZY2A 1MC8A 1H5QA 2VPWA 3CF4G 2ECOA 2IYXA 5BN1A 1QONA 4ZOLF 2BI7A 3V2HA 2O1SA 4IJWA 1OHHD 3IP7A 3HYCA 4CIAA 4WGFA 4PAMA 1QGOA 3GRKA 1REQB 5IDXA 3W6UA 5JSZB 5C8DA 1ISPA 1EK5A 1U1GA 1ADCA 1REQA 4JSYA 1G98A 4PQGA 2QXYA 3F0TA 1YCFA 3GG9A 1THMA 3OM9A 3FPJA 2RJNA 4UNNA 3DFZA 1VRCA 3IAUA 3ZEAA 4Z2YA 2R0QC 2J7PD 2H2AA 5EHIA 5F1PA 1UAGA 2YDYA 3TX2A 2P68A 3BMCB 3RO7A 4C2AA 3HC7A 4RK1A 1E2NA 1SUFA 1QQBA 4B43A 2BFFB 2YHSA 3RS2A 3HYNA 4BTEA 4LZNA 1MVNA 2C58A 4N9WA 4CLDA 1DADA 3RE1A 5K5EA 3PHJA 1M73E 5DNDA 4HAWA 4CPDA 1LW7A 4AUNA 4C7JA 4PFSA 1LC0A 1V11B 2QW0X 4ZYUA 3AFGA 4X1OA 1ZG3A 4GOXA 4YRPA 3MLBA 5IUNC 1RWPA 3HDTA 4ND8B 3SX0A 5C1OA 1I6MA 3JR3A 5GVRA 2XYQA 5DI3A 4Y2VA 1T2FA 3FDZA 3CZMA 4XDZA 5EIFA 1SG9A 1XD2B 2BW0A 3K35A 2EFDB 3L7YA 3PRJA 1WZNA 4MR9B 4B3GA 4Q5IA 5JDCA 3MT8A 1IBKB 4B4VA 1PS0A 2MYNA 2J3LA 5BP7A 2QW1A 2YXPX 2ZJ5A 3C1TA 3LVBA 2JAUA 4OAQA 3V3TA 4RVGA 4QLBA 4Q9JA 3MCUA 3O7WA 5J40A 4RLFA 2AC7A 5EGNA 1J22A 2V4ZA 3WP1B 1UK8A 4M1EA 2QVYX 4E07A 2G3YA 3BOSA 1E6CA 1UUFA 1XD9A 5B3KA 2GF0A 1YQEA 3GGPA 4TWZA 5HG0A 1V48A 3E2IA 2TECE 1M6WA 3W5JA 1UBNA 3NAZA 4X6YA 5I7SA 1TU0A 2CMKA 2EP5A 4J0HA 1WHSB 2GM9A 4YUVA 3WFJA 5SY4A 1G4UR 4W63A 2J0QA 3PD7A 1QWSA 2CC2A 4QJ4A 3NHMA 4H6WA 4CMEC 1TM1E 4YJKA 4P35A 2ZU0C 3G8CA 5T8KC 1OIXA 5FWYB 4HT3B 3KJGA 3EVFA 2Q29A 1TCBA 3SLRA 3WTCA 3DT8A 5BWCA 2BGLA 3H5OA 3CR7A 1E1DA 1QIKA 1OE0A 4Q47A 1DKQA 2NU6A 2NSYA 3BKWA 1K97A 2N1BA 2WHYA 4MUMA 3VU1A 3QV2A 4WLVA 3GLRA 2P2SA 2P7HA 3F71A 2DPGA 4EB8A 1AQYA 1V8DA 5EY5B 5JO0A 2UYQA 3M6WA 1UKBA 3AUFA 4HRXA 1XRMA 5C46F 2DBYA 5K0JA 1N8SA 2GHIA 2J33A 3CF0A 4MQ4A 2XKJE 4PAQA 5A2QA 3R9WA 1XTPA 3FMOB 1GAXA 1AC5A 1U5AA 2FPXA 4E31A 3PFHA 5BN4B 2GFIA 3CX6A 5AI5A 3M2PA 1YQUA 2C1EA 5K3DA 3VHRA 3AKCA 4FB5A 3TM4A 5DHTA 3K32A 3V8VA 1FFSA 4J07A 1WOYA 3WL3A 4U0KA 1E6KA 1Z73A 3PFKA 1PL7A 4Y6GB 2RHOA 1SXGA 1FFHA 3JAWB 4K46A 1JFSA 3DR3A 3QA9A 1LS1A 1JVBA 5KOIA 1KZ1A 2BJVA 4LE1A 3ETEA 2Q3CA 2ORIA 2IU0A 2V9ZA 3V7UA 3MHTA 1SBZA 4KPGA 2G77B 3G5MA 4PC7A 4YRMA 4YV2A 4XPZA 3CS3A 3ESQA 1FQKA 1G0NA 2IGTA 2JLAA 4YCMA 2E4VA 5I9NA 4RIFA 4AMZA 5BSGA 2PKQO 5EP4A 4AY4A 3SQXA 2ETXA 3TS1A 2AEJA 1PJ8A 1X7XA 1CZUA 1GYRA 1U0NA 3T7KA 5DM4A 1VSQA 5BR1A 1YR9A 4AJIA 4DXDA 1T3TA 1QX3A 3MTJA 3N5CA 3NHBA 3R3JA 4MV0A 4BVBA 4CIWA 1S4QA 1E1YA 1ZMTA 1RM3A 2POCA 2IZ7A 2ZQYA 3V32A 4XSGA 4YROA 1ZHOA 1IBSA 2VUTA 5INTA 1NG1A 4BO3A 2V1UA 4WJKB 3PJRA 3PDHA 3CLSD 3PQEA 4NEQA 1GFIA 3P97A 5KQMA 2E5LB 3IAM6 1BS2A 3M4ZA 4PZCA 1FRZA 1U94A 4WOKA 2QRVA 1TQDA 4RD2A 2YWXA 4A2WA 3ETNA 2JCVA 4R5MA 4F3YA 1E1CB 1L5HB 4P3KA 1HT1E 3H65A 1MZPA 1D6JA 1E8DA 5HF8A 5JPCA 4GVPA 5B58C 2BELA 1DWOA 4R71A 2P9JA 5B3LA 4TTJA 1GKLA 2YWEA 5JS6A 2P5TB 2XEXA 4WXMA 4OH1A 5L8VA 4ME6A 4LJRA 2GR9A 3FSJX 1N2SA 5AW6A 2PT6A 4WEQA 3VSCA 3LBIA 3TLZA 4QRDA 2Q4RA 2JIZA 3TCKA 2JI4A 4HB3A 3IGFA 1TVKB 3C6ZA 3A70A 4GOOD 5CDUA 5DNYB 4DUGD 3P8ZA 4EJ0A 1QFZA 5IW8A 4R01A 3ASUA 4NENA 1VLZA 3N3BC 4ZO7A 2BTQB 1JHAA 1HM5A 2C8LA 3IJEB 3H6GA 5K3BA 3ZU5A 1OV4A 2RHRA 3LXUX 3NIBA 2FHSA 1T4CA 2J9ZB 3NR2A 3OPMA 1PWEA 4HJRA 1Q91A 4YT2A 1T15A 1NVBA 5HZHA 2CJYA 4QDXA 3H42B 3ZTYA 2D0OB 5DASA 2RH4A 4ECAA 3MILA 5K3FA 2ZPUA 2DWQA 3Q8MA 2IY8A 1WPXA 4JOSA 3FB4A 5KO2A 2BHLA 4WBNF 2VNAA 4NH0A 1UFKA 2XHZA 2BN4A 2FWRA 3AU9A 4WK2B 1FIUA 1Y4ZA 3ADKA 2MR6A 3RGWS 3RSCA 2PRSA 4CIBA 2PAFA 4F9GA 3BHIA 5CVUA 2CN1A 2E89A 5IJAA 1ZEJA 1E8MA 1Y7HA 4OHKA 4AG6A 5BSTA 4E51A 4YX9A 2WM2A 5IPFA 3M6IA 4RTKA 3QM1A 3FYUA 4KBFA 1TECE 5BV2P 2WYIA 1NHGA 3RROA 5LCXA 2GRUA 5ICMA 2O8DB 3GLGB 3O95A 4U8HA 2PZEA 3FDIA 5JXIA 1NJ8A 4FLFA 1UKYA 3VVLA 1FVXA 2O6LA 3D54D 4BMCA 8MHTA 1NJGA 2GN9A 3FNHA 3LYUA 4TKVA 1XNQB 1YI0A 3P2IA 1BVHA 3WRVA 3GLIB 1XLTC 1N5JA 1FK8A 1W34A 2FMUA 1YR2A 1VKZA 5DTRA 1CDZA 4OLHA 1VHDA 4A6XA 2ENUA 2IA5A 3EXEA 5EXXA 3FWYA 3RSSA 4PS1A 3RWBA 1U2EA 3BGSA 2Z3VA 3FGPA 1L4KA 5KHLB 4F5YA 1XD8A 4UEQA 1KPHA 5F3DA 3RSGA 1A5SB 3KBOA 4MVYA 5TF4A 3ZI7A 2RB5A 4G5OA 1ESNA 1XKTA 5DP1A 1OXSC 4AY2A 1MHPA 1VCIA 1SG0A 3G68A 4EF5A 1CUBA 4MQLA 1DHRA 2VHVA 1B6SA 3DJYA 3I9KA 3IA2A 5BVHA 4BNFA 2MYTA 1C1DA 2ZU6A 3G1TA 2XEDA 4LHYA 3P2YA 5AESA 2FR0A 4RTOA 3QZUA 4WZBA 1F6WA 1TJ3A 2AUMA 3LX5A 4JJKA 2XBUA 3WY9A 3GJYA 5KPDA 3AZQA 4R8SA 3FDJA 4CEIB 1NN1A 1PQPA 5FNZA 2GSWA 2D54A 4C0JA 2NZYA 1NI3A 5KDDA 1YBAA 4JYMA 1XALA 3CUKA 3HS3A 4IZ6A 5HS6A 4C3UA 1YMQA 1TYBE 1XTBA 5DBGA 2QRHA 4IQ4A 5FADA 5KJFA 1NF2A 5TQ2B 2WAAA 4E32A 1IHYA 5IZCA 3PS9A 5EZ5A 3Q5GA 5D5HA 3EODA 1LPPA 4EFMA 2YYZA 4HAYA 4A0SA 1MC4A 1K7CA 4HS9A 3RRBA 2IZ5A 3L7MA 1KE1A 2WHXA 2YIJA 2V8OA 3T3PB 2J31A 4I46A 2CCGA 1T10A 3MRVA 3M8KA 3GLFB 1L1RA 2O0LA 3EH1A 4J91A 3ZCUA 4UHJA 2IYOA 3GHHA 1Y42X 5KVQA 2G36A 4YR7A 1HK7A 1Y9JA 2DWUA 2HT6A 3NBXX 4C5AA 2NUBA 1QGDA 3CVOA 4TTAA 4MI6A 3S1SA 2Q2OA 2ZJAA 2IHVA 2OYRA 1UXOA 3WGZA 4TTSA 1FDRA 3BQNB 4KIGA 1QYVA 1JEQA 1R4MA 4P34A 3RC3A 2YHIB 3V4OA 2OCAA 2PU7A 1NTRA 3VOSA 4ZIRB 2WG0A 4LJ8A 4DUPA 1Q12A 1B74A 3KOWA 2WVJA 2Y1XA 4Z51A 3E3NA 3IUJA 4N4AA 2GCPA 2PEYA 3E4CA 3IQIX 3OJEA 4GL2A 4KNYA 3VR5H 4WCFB 2QX9A 1Z5PA 4I8XA 3E22A 1SHZA 1TT5A 3L3BA 1N75A 4HJXA 2NLOA 3IP5A 1MOQA 1XNJA 4XUEA 5DOVA 4YXWA 1UP6A 5HHTA 2TMKA 3I53A 1NUSA 3EE6A 1KDPA 5LP6B 2QRPA 2CY0A 4UZEA 4HQLA 4GXNA 4MICA 2OXRA 2AZ4A 4B7XA 2RBEA 3GLSA 4CI9A 1QK5A 8AT1A 1OA0A 3F7OA 2XGJA 3QOYA 4M9RA 3FZGA 3H1BA 4LZPA 1IXRC 5FDFA 4AY6A 1Y89A 2BGIA 5CFNA 3BGDA 4B3IA 2HO4A 5JJKA 1RQRA 2O23A 1J33A 2WZQA 2ZYIA 4RPLA 5G1OA 2ZSDA 1F2VA 3I9NA 3VOTA 4UFNA 3OVMA 4ITRC 2WMOB 1SG6A 2QTHA 2VJPA 4LY6A 1C7EA 3DZCA 2OECA 4D0RA 1NVGA 2AUNA 5HIJA 1WMFA 2RB4A 1T0BA 1U9JA 1OROA 1R27A 3CVVA 4A15A 3ESAA 3NOOA 3ZWAA 1KQOA 4D8XA 3PIIA 1WZUA 1W0JA 3LCRA 2CD7A 3VR5A 3NORA 4LYAA 4EBBA 2FPUA 2LDBA 4MIEA 5BR4A 2ZSEA 1FC0A 4YCLA 3LDGA 3JQFC 3PNKA 2HXYA 4OXKA 4A8JA 1HKHA 3HCWA 3UMRA 1NW5A 4JLVA 4DMMA 4TMVA 3B1XA 4ZAYA 3TTXA 1GUFA 2O59A 1A1SA 1XCGB 4JJ6A 3I8SA 4IKOA 3ZJ4A 5IH7A 5JAMA 3L77A 4S05A 5G0WA 3ERCA 4LSZA 5D3KA 5ALGA 4B6JA 3IAS1 3M83A 1Z8HA 3R2JA 1EUCB 4BNTA 1MX1A 1MD9A 1M6VA 1SD5A 5K4GA 1RBQA 1HX7A 4KXMA 1JXAA 1ULBA 4D97A 4IHQA 3RYFB 2BM9A 4QUJA 2JD0A 4DLVA 5JCJD 1ABBA 2DHQA 2BFPA 1E1RD 3HDGA 2F8MA 4R41A 1PR3A 2LXNA 4YMVA 4OG2A 1JQBA 1K68A 1N57A 3CEJA 2XDYA 3E3LA 1UKEA 1IQRA 3EWSA 4Y8VA 2YWGA 3MT0A 1SELA 3O3NB 3Q9NA 3QVLA 3UB4A 3VKUA 8OHMA 2GOYA 5CVVA 3ZDCA 2CSXA 4PBTA 4WESB 2Z6UA 5DLDA 3HUTA 2Q7DA 4CM7A 3C1OA 2QTBA 2GZRA 3IAEA 4DWVA 3LBFA 4RQTA 4YTEA 3W2GA 3OZ7A 4QGSA 2V03A 3Q1KA 4JLBA 1XRRA 2HNKA 1DBSA 3JAKA 4FMCF 2P4HX 5KJCA 4LBVA 3O5AA 1JDSA 2Y05A 1S1CA 4LHSA 3U48A 5EJ6A 4JUAA 1WQ4A 3EEYA 2H1LA 2X5NA 1KIFA 4RA6B 4OUDB 1VP9A 3DLPX 1X94A 1ZKMA 3DLCA 3GUYA 5GTDA 4HEA1 4N3AA 4EEXA 5B55A 4M7OA 2A3NA 2OQRA 4DPKA 2E49A 1XDDA 1NIJA 5DHSA 2FKNA 2OQIA 2C07A 2IPNA 3TSWA 1NMQA 5CA1A 2AEFA 3UMGA 5LN1A 4JOQA 1NAHA 1YACA 3AFMA 2WJ4A 2H8KA 3VX3A 4F60A 1NI4B 2QU8A 2XNKA 3GNLA 1AU9A 2XI4A 2RG7A 3DV0A 1JFFA 3OTGA 2OCXA 3NBYC 4S2UA 4M0MA 1CT9A 2JFHA 4E88A 4LZLA 3M3HA 1H65A 4AYXA 1L5OA 3NVKI 5K51A 5EYPB 2Y1WA 1C3OA 3IV9A 3K9LA 2F7SA 4WKBA 3MQ2A 2WWHA 1SQ0A 1YKSA 1ECLA 1W73A 4D44A 4BLOA 4R8MA 2R751 1SUIA 1U8AA 3HZZA 4DT1B 2YXDA 5HILA 2J4DA 2V7TA 1R5BA 1H94A 3ME5A 5G3ZA 4BX9A 3PPYA 3OESA 1XMVA 3AV3A 3QQ5A 4W5WA 3JCZA 4LRWA 3SZ3A 5IAOA 3C3CA 5K0CA 4RA9B 1RWNA 2Z2XA 1XWIA 2A9OA 2CFSA 1JQDA 1WB4A 3N0TA 4I1IA 4RE6A 4EVIA 3E6AA 4JQZA 5KNCA 3UWMA 2YN4A 3G0GA 4QIHA 2BFAA 2WFMA 4KE8A 3IEPA 4MZXA 4KR9A 3ZIAA 1Q44A 2VCEA 3E2PA 4BX2A 4YUWA 2C1XA 4Q19A 1W6UA 2GVDC 1RWXA 3GFOA 2IDKA 4X7BA 3MD0A 4EVRA 1SCKA 1T5SA 2AD1A 2W6PA 1BGWA 3DXXA 3T3GA 3K6JA 1UEJA 2GZDA 3PYXA 3QIVA 4HWPA 3BMQA 5I4CA 2PS3A 4WZBE 1KFJB 5FBLB 4MUJA 1JL3A 1H9BA 1L4LA 1UXKA 4KAJA 3NBAA 4BVLA 1M8JA 1Q1ZA 1Z0IA 5BMVA 1VPWA 5AUNB 3H9CA 1N6RA 1VSUA 3HY6A 3VYVA 1E9RA 3IMCA 1C7QA 2Z9CA 5AUPB 3S8YA 1YDFA 2HF9A 3CIOA 4K6KA 4HXGA 4QELA 5DHQA 4ENVA 1KH2A 5I01A 3COSA 3AVUA 1AMUA 1RQPA 3RVSA 1OXXK 4GKBA 1P77A 3IHWA 2C2HA 3TH5A 1H1LB 3ZE6A 3TGPA 2O8VA 5IH3A 5IS2A 2MSLA 2FWBA 3EZ2A 4FKBA 1V6SA 4ID3A 3U3OA 3ZUGA 2Q8PA 4PHGA 1PGNA 3K9GA 1N0WA 2D5AA 1O77A 2PPLA 5JSQA 1JZTA 3BCHA 2JI9A 2GZSA 3N70A 4M9UA 1VBKA 3AQ4A 3S6JA 3UMBA 4MK4A 4B8YA 2PRKA 3JAMA 1X7ZA 2E4YA 2FPIB 2YMPA 1JNYA 2WFLB 4AJEA 2HK7A 4LN1A 4NLLA 4KH1A 3TAUA 2DR2A 3QX3A 1FJXA 3GN1A 4Q9HA 1I32A 5CPBA 3WLNA 4K6GA 2XCUA 3GGGA 1GRVA 4RZQA 4D4KA 1E3SA 3OEHD 1QOPB 4OA5A 5BV8A 1NUQA 2JLSA 3M6AA 3N8NA 4DN6A 5JS8A 1HE4A 1ZM3A 3M82A 4RC9A 4TXNA 5AVKA 3RIXA 4ZFNA 3Q6IA 2YFYA 3DZIA 2HBRA 2PPVA 4D42A 1E66A 1A9QA 3PWKA 2TMDA 2YYYA 1Y0BA 5EWLA 1CS4C 2GRJA 1Q7CA 2COKA 4KFTA 1QIJA 1N2HA 4OJNA 4BRSA 1ZRMA 1M1XB 4CNBA 4WA8A 1IY0A 1KEPA 2WVAA 1TYEB 1O9GA 1HE3A 2H1FA 5LLTA 3NHJA 2H59A 3REOA 4ZQFA 4H3KB 3DBRB 3BCUA 4MDEA 5KJ6A 3DBRA 3UGKA 1R10A 1SC6A 2X1LA 2Z9BA 1T8UA 4L16A 1EVLA 5HIIA 4EG5A 4EG4A 3HBMA 2WMNB 2I66A 3CV3A 1E1QD 4NHOA 3DZJA 2DTXA 4U1RA 2DPHA 5AP9A 4ZAWA 4JJFA 4BQQA 5G0VA 4NZMA 2P9YA 3HKEB 4RLHA 2CHGA 1DAFA 1XQ1A 3PEUA 1CJUC 2Q0HA 4MWOA 4QFCA 3E9ZA 4IEEA 4MIKA 4P9NA 3GVPA 5AKEA 3C2QA 1ZNZA 1SNYA 2M2IA 1BKYA 1XLUA 2ZXEA 3GRFA 1XEWX 3I52A 2FSFA 4ETNA 4TZ6A 2QN8A 3UT6A 4Y6SA 2KB0A 2J3HA 4WXPA 4NDZA 2YCBA 2QRNA 1WX1A 2O7VA 2JG3A 2BE7A 3DUWA 2XDQA 4AN1A 1SIOA 1EB8A 1QIMA 1FQWA 3QWIA 1I7PA 4PZEA 3SQLA 4BRWA 6YASA 3QX9A 5BMVF 1J8YF 2VTDA 1BHJA 1RXYA 4G2TA 3H2YA 3SS9X 4D45A 5J2TF 1VE6A 4A27A 3NNSA 3BSSA 2HSEA 3C3DA 3CTPA 5CDFA 1S2MA 2EW1A 2GAOA 1WSBA 3CSUA 1NP7A 3QKRB 4IDNA 3L43A 2GBLA 3P9PA 3QEMB 5EIEA 3CBQA 2G9ZA 1QE3A 3VZCA 2DY1A 5J4VA 4CQNA 3MTGA 3NUQA 3OMWA 4OHYA 1WULS 3ZGOA 1AK9A 1EJBA 3IDSA 4NC9A 1P2TA 3I6ZA 5EERA 1ZBDA 2IYLD 1K7XB 3SBEA 4TX1A 5BSUA 1E5LA 2XUGA 4OQLA 3ZNOA 2BKEA 5BQ5A 1ESZA 1AQ6A 2B4AA 4YNBA 4HKTA 2PL5A 3MINA 5HXAA 5L6MB 4V3CA 1V1MA 5ALXA 4AFNA 1KOJA 3RKSA 3F3SA 3RT7A 2Y2VA 3UG7A 4PCAA 3TZKA 3ZQJA 4A2PA 1PI3A 1TM7E 4FGWA 3N8GA 3HCRA 5JAOA 9MHTA 2ORVA 3UYLA 4ZAGA 2ZB7A 1DIHA 4HOYA 3IESA 3KHKA 1SOWA 4QXRA 4NCAA 3KO8A 2VDUE 1WZCA 2Y9PB 4OKIA 1YL6A 4Z4FA 3PEYA 5DNVA 4PFQA 5AJUA 1SZCA 1G8GA 3HY3A 2WI8A 3A0UA 1E2EA 1NJSA 2YWCA 4IXTA 5H4HA 2OMEA 4JI2B 1YDEA 3E61A 3B1KA 3L40A 3GF4A 4A0RA 2QX6A 2GBCA 2XZTA 2JI8A 1C8VB 1ORWA 3LC2O 4YRCA 5J23A 4MP6A 1CUCA 3SC6A 2WPDA 2B4TO 3I05A 3WIOA 1NVVR 3DO6A 4PANA 4U9HS 3STHA 3ZHSA 5C4IA 1TC2A 1YWGO 2CLFB 2ZUTA 4MKZA 3K9FC 2UYCA 3KAPA 1O6BA 4BX0A 5J4YA 1YULA 5KOYA 4FU0A 4L0QA 3HVIA 4HZUB 2OB2A 2ZIZA 3ICOA 4NARA 2QSYA 2ZUSA 1RLTA 1ISSA 5SZIA 3T1NA 3P27A 4BEBA 5C8ZA 3ET5A 1XRPA 4Z99A 2QORA 3A1CA 3GUCA 1K6JA 3JYPA 4KWCA 4ZYXA 5HPYB 1U1IA 3OP1A 4HF7A 3WIDA 1L4HA 4FDTA 5K2MA 2CF5A 2ONZA 1M2NA 3ZBQA 2OCLA 4Y6QA 2ID9A 2H92A 2YJ3A 5EVCA 1JN0A 3OCZA 4BQSA 1RC8A 2VZ0A 1XTSA 2F4VB 2DSNA 3UMSA 3TQIA 2XE6A 4KUGA 1IHPA 4PF1A 2IIQA 1UPFA 2AEMA 4LRUA 2FMIA 5TEWA 2VC2B 1YC2A 5CAEB 3GLFA 1E60A 4XGNA 1N92A 1RM0A 3C1UA 5JDCC 4ES6A 5F9FA 4IP0A 4I14A 4OM7A 4DV1B 4FIDA 4EA6A 1JLRA 1PV2A 2LCIA 4OYRA 2DUJA 4GPIB 3MGAA 1T5IA 1DAGA 3BBLA 3I32A 3Q7PA 4CQMA 1FY2A 1TGYA 4BO0A 2A9PA 2Y1EA 2IELA 2QY9A 4YV0A 4IKEA 4WHMA 2HCRA 5KEIA 3NBUA 3F6EX 1ST2A 2ETVA 1L4MA 4CI0B 4DIEA 5EKSA 5FOQA 3TD9A 3EUEA 2HFKA 1GTJ1 4Q7LA 2Z43A 4HI0E 1L4EA 1NNUA 1THZA 4PS0A 3NDRA 5ETJA 3KZNA 1G5FA 4QATA 4F21A 3MJDA 5M3BA 4NU5A 4AUKA 3C4QA 1HUQA 2V7VA 3IRUA 2ECPA 5AVJA 2NPFA 4CMEA 3Q8LA 5DGDA 4Q1DA 1K3FA 1EPUA 3QUBA 4AY3A 5FUXA 3FUWA 1Y3IA 2H4ZA 1JDZA 3D8BA 3GA5A 3PL5A 4G5YA 3CNBA 3FAZA 4FFLA 4CM5A 2JLVA 5IJ0A 3L93A 4XTCS 1AQLA 1NMZA 1NV8A 1Q22A 3OZXA 4K3VA 1KMHA 4KFUA 4CFYA 4IPTA 1E62A 5AM2A 1YDGA 3DHVA 1OX4B 5MFPA 1DIBA 4R3WA 4PNEA 1O5TA 1NWCA 2WRZA 1P9WA 3W5CA 3IEVA 1VI5A 4HG2A 3TLGB 4E6PA 4K9LA 2VS1A 3TL6A 5A4FS 4ZVRA 2AL7A 2B4QA 4R3UC 3SBDA 1GG2A 2QTTA 5I7RA 5EUQB 1BMTA 3TFQA 4PX2A 3NJ8A 1KAGA 2EWMA 5A5DA 2B83A 4I5IA 3HR7A 4DJAA 4JLJA 5DM2A 1TOAA 1U7OA 3EXHB 1A7UA 3CNLA 3IQGX 3LK6A 3PHGA 2ZTVA 3IQWA 4KIJA 1D2MA 4BKQA 5IKXA 2OXFA 2CUZA 5H70A 3CTMA 3LVFO 4ENUA 4YRIA 1ID1A 4ZQIA 1M7HA 1PF7E 1VPTA 2XA1A 1H22A 1JQ3A 4L73A 2E4XA 4IIEA 4KQWA 5KYUB 3NFYA 5DULA 1QHNA 3RPEA 3SPXA 2IITA 3VNUA 1G4HA 2CJPA 2Q4EA 4M9XA 5AKXA 1YA8A 3HB7A 3W34A 7AT1A 1NUAA 2A1UA 2I6XA 1FDVA 1UBCA 2ZFUA 4DMRA 1Y7PA 3H2BA 5IC5A 2WHEA 2FRVA 2DM6A 4TYQA 4PZDA 1P0QA 3RASA 4RSRA 1MABA 3T7TA 1SUAA 3T1VA 3EQ7A 2RHCA 1MH1A 5LDGA 2P2CA 3T7EA 3GPIA 4Q4HA 3OBBA 4FHEA 4NCBA 3CC8A 2F8TA 1VJTA 2IHBA 1T4DA 3EEFA 3KT0A 4GX2A 1CUHA 3AL2A 4YMHA 2HDOA 5HK9A 1R0ZA 5JANA 1GDTA 1V8FA 1N6NA 2WT4A 5AI6A 4D46A 4P33A 1IATA 4IWXA 1ML3A 2VHTA 4ZREA 4ZCSA 2Q9CA 1PNQA 3E7PA 3KSDO 4M86A 3IIMA 4HB0A 2VTKA 3DVQX 4J7AA 4MQEA 4PIPA 3VAAA 4KQ1A 1ORRA 2FEPA 3NHZA 2P1DA 1UJBA 5FTLA 2WIAA 2OESA 3D2CA 2PE5A 1I7SB 3L5OA 2OYCA 2AXNA 2YS6A 3BG5A 3W5IA 5AHOA 1YBVA 1CY0A 2F59A 2W2OA 3BH6A 4Z0NA 1Q0HA 4B84A 2HV9A 1JA9A 4D26A 4FFSA 3GH1A 4BJ1A 1DBWA 2BEWA 1CJVC 1YB4A 4UBJA 1IONA 4RTPA 1K8ZB 1W93A 2HIHA 1Z8FA 5FWDA 3ZTTA 1MB9A 3QWBA 3SD7A 1XPRA 1GKYA 2FEAA 2FLWA 3FKSD 4UJ5A 4FB4A 4ENPA 5C18A 3NXSA 4Q4AB 2OK7A 5CT8A 3SC4A 1M1ZA 1IPHA 4Q4AA 5FCDA 1S3IA 2VP0A 2P2LA 2R1TA 3H86A 1H4SA 3ORSA 3ZY6A 4Z4HA 3URMA 2HU2A 4BO7A 2LKCA 3LSTA 5AUQA 1KZ4A 2R65A 2XH8A 3PC4A 1D4ZA 3FE2A 1C50A 4BBAA 1M83A 5KYGA 1N78A 1HH4A 4R84A 1PVVA 4O63O 1SKQA 1R1DA 1O6FA 4XGQA 2FPMA 3FTPA 1P7PA 2NUAB 5DM70 2ZS7A 5H59A 3E2MA 1SCBA 1J90A 1Y6ZA 3QYJA 4ANFA 1A2OA 5H4GA 1DPGA 5A2GA 1C0KA 5B37A 3BSFA 2EF0A 4G24A 4B45A 3K2EA 4WLEA 4TVOA 3ZQUA 5JEEA 3IB3A 4PZ9A 1GLGA 1XZAA 3QYAA 3VU0A 1BA2A 2F3UA 5JRDS 1WWKA 4C3VA 2CJFA 1AOXA 1PLKA 4NAVA 4C4ZA 3HJHA 4ZU3A 1GPBA 1SVMA 2PMWB 2XGMA 3JVDA 1TKRA 2NZJA 4ZJYA 2W2LA 2IUUA 1F9EA 1QB7A 4L6IA 2ZETA 1T2DA 3VGJA 5FTNA 2WV7A 3IFSA 4J75A 3K92A 1ODJA 3R7FA 3IVRA 3NBFA 1ECGA 5IAAA 2XW6A 2PWAA 4MDYA 3ROEA 5AM4A 1C7IA 5DLYA 4L4RA 3GUUA 1LB1B 1FB5A 1NQOA 1PYGA 1I4OA 4M60A 1OPXA 2X77A 5IDYA 2OBLA 2QUJA 2FMTA 1YHYA 2BBSA 3W4JA 5A1TA 4EF4A 3HXOA 1N8TA 2JKYA 1YS1X 4HNGA 3KBBA 3F9RA 3JYQA 4O33A 2IYUA 3OPVA 4RK5A 4ZCPA 3WBJA 1YAJA 3B78A 4O2AB 2C2GA 5CDSA 3MGGA 2XZOA 3DOUA 4Z0HO 1SVSA 3FPEA 3LS2A 3JQGA 4FNMA 4G23A 3G5TA 5A05A 4ZPJA 1LF0A 4EFDA 1U9CA 2D2XA 2HLHA 2CFOA 4J0FA 1KRWA 2XKAA 2GPTA 4DYVA 2J87A 1P2SA 3DOJA 4PXYA 4C6HA 3SIWA 5HTOA 3G5AA 4UCXA 2GNAA 5K01A 1ZVMA 2B20A 4WUTA 1BEUB 1HFKA 2FMXA 2Q9AA 4ZAZA 1PZNA 2W93A 4AF6A 5LQUA 3Q7RA 1OH8A 4WXRA 3H1TA 4AC9A 1T0UA 2QRQA 3MUOA 1UMBA 3QXCA 4D81A 2GN4A 2PTGA 2QJFA 3VJKA 4AZTA 1ZEMA 3MLEA 3BTVA 3VC2A 1CUFA 1KY5A 5CDFE 1GEGA 2H17A 4FJ1A 2D06A 3G1UA 3OKPA 3ZGXA 4OM8A 1JIIA 1GPWB 1T4CB 1FEZA 2B61A 5FBHA 1K7EB 4WBXC 1NRJB 3HEMA 1RAHA 2KI5A 2IYAA 3D5EA 4WERA 1OKKA 2NYRA 2FZLA 2PZGA 4O4HF 1XZ8A 3A25A 3KU4A 2OV6A 5FPHA 4QDTA 5J5AA 5D2CA 2DEUA 1R0RE 1WEHA 2OCBA 3DEKA 3HV2A 4JFAA 2F64A 2IY7A 1U4NA 1EFAA 4DY6A 2A78A 1RPAA 4J16C 3U17A 4AQ7A 4ZMSA 4GP9A 1N32B 3A2MA 1SU7A 5C8YB 4Z9YA 4EKYA 3WLRA 3LX8A 1QF9A 1PRYA 2BMEA 4DCNA 2ZR0A 5CHYA 5FAKA 1AD2A 5KTMA 1CDDA 3NEYA 4KCGA 1MJGA 4G67A 2X8AA 3S2GA 5JI2E 4JYZA 1MH9A 1U8TA 4AO6A 1VE3A 3C8ZA 1RPNA 4JP8A 2AOWA 2DT8A 5E9WA 4K9SA 4KQ6A 6REQB 4F93B 5KYTA 1CUSA 4HEJA 3A8TA 1G9TA 4BC0A 1O57A 2R7NA 3ILXA 3BIXA 1OFVA 1SB9A 5JTTA 1E98A 1DKOA 1UIMA 2Y0CA 3ZW7A 1RIIA 2WJIA 4C78A 1OR8A 3L0YA 2HA0A 1XPOA 3FX2A 4PNZA 4M7PA 3ITEA 2DKFA 4OHUA 1C8KA 4YC7A 1TMOA 4IINA 4E1BA 2ASEA 3C48A 4FMCB 1Q83A 3DNMA 3HKCA 4ZVTA 2CJWA 5KDLA 4QAJA 3TRJA 2PSDA 1YI1A 5A5VA 5FUVA 3VR6A 2P9QA 2O8DA 3U4HA 1W59A 1ZLXA 1GN8A 2EG5A 5HFJA 2O7NA 2O0HA 2VQ3A 2VYVD 3HO8A 4KWHA 3ZVNA 3V8QA 3D3WB 1K6EA 4LEIA 3GLVA 1CS0A 1IHDA 1OV6A 2GEUA 5B3JA 1ZU5A 3EG9B 3IILA 1RHMA 2DERA 2FLVA 4DR6B 3S44A 1PIWA 3QW2A 2Y8EA 3N7UA 4KQFA 1R8QA 2CF6A 2WKSA 3ITKA 3OQBA 5AVTA 2WA1A 4G89A 5ER9A 2G1JA 1C4KA 2XDAA 1IZ9A 2RIPA 3PDIB 2Q1SA 1IJEA 1W1WA 1WAMA 4FP9A 4TM8A 5ALTA 3A3NA 4BQRA 5J59A 1NSTA 4BE4A 2C96A 4NG5A 4YUXA 3CPEA 1QF6A 4YCDA 3J81A 4KRYA 3GARA 5AJYA 1W35A 4YV1A 3HL4A 4PM4A 3H17A 4GZ5A 5AD1A 2AYXA 2CK3A 2XTNA 3DOFA 2IL1A 4Y2RA 4FDMA 5DNEA 3SM3A 3UT0A 4XJVA 5D5QA 3A05A 3SX2A 3V42A 4RM2A 1ULTA 1B26A 1HLDA 4QNNA 4AJ9A 1NR5A 3GAZA 3LQ4A 5A3RA 1UMDB 3JQ9C 2NMVA 4LXXA 2QM0A 4BLWA 2ZUCA 4URZR 5CFLA 1DJQA 2Z30A 1LDGA 4Q3EA 4ZT5A 4ZDKA 1G291 3B51X 1O08A 1JVNA 1P61B 1UBKS 5D5PA 1SURA 1Z4LA 1E2DA 3L82B 2TMGA 5C32A 1K06A 1NQXA 1Q50A 3WNZA 4FGLA 4PO8A 5DHPA 4PN7A 3PHLA 4QTTB 4RZHA 3W5AA 5EZSA 4PONA 2AH5A 4WACA 1NMEA 5CYFA 5K0SA 4ZA2A 2BFBA 1PG2A 3R3UA 3LCVB 5FOTA 1C9EA 3BZWA 2HF8A 2NXCA 5LA6A 1XU7A 3HJUA 1DXYA 1VG9B 5AKJA 1ZI8A 4BPRA 1UWKA 2QTFA 1Z0FA 3F5SA 1QH0A 4XWYA 4RELA 5EHXA 4HZUA 2FG5A 4M9QA 2HFJA 3O38A 4CF4A 2IYSA 2QV7A 3DDWA 4TYNA 5DNCA 2QD3A 1PJCA 3NBQA 4QPDA 1Y9DA 3V1TC 3TBHA 1RW4A 4CL0A 1EZ1A 3E0XA 4MI1A 4BNNA 3AX6A 1FLNA 2X8JB 3AC0A 1SHUX 4Y2SA 2QYSA 3QE0A 4UQPA 2PUAA 2H18A 1S2IA 2NO5A 3GJSA 3Q11A 1Q7EA 1TZBA 3LWDA 3ITDA 4FNGA 5SZJA 3AI2A 1YT5A 3TSYA 1QUEA 1M0EA 2JFWA 5D85A 1AZSC 2B2NA 2QZZA 4A1OA 1Q5PA 1K75A 4KKXB 5CPFA 3KL2A 5F78A 3FJOA 1VFPA 5KYNA 1X8XA 1XXHE 3EW7A 1T26A 4KNVA 4F3CA 4MUFA 3HWWA 3H18A 3LW7A 3NC0C 2OWDA 3LQYA 4JFRA 4TWJA 1E2HA 3KHUA 4DLZA 2QE7A 2XB9A 1LV8A 3DE4X 2LRHA 1TVMA 5JECA 2PXAA 1IL0A 4EI9A 1WPQA 4GXRA 4JLMA 1SIUA 4AN0A 1CUUA 1MVOA 3IVGA 2ZP1A 4W8HA 4UNIA 4B74A 3WAGA 2HU8A 5B3AA 2XUFA 2CHQA 3QVOA 1RMQA 1GP2A 1YA6A 2ZOSA 1DEXA 3B48A 4JI6B 3ZV4A 3KVRA 1U0FA 1HQCA 2ORYA 4MGZR 4O4JA 4J3NA 2N75A 2ZT7A 4HX9A 5DDIP 3NHKA 1PJTA 3AB8A 2NU9B 4RUKA 1GARA 2VJQA 4JLWA 4DR7B 4IG9A 1H5UA 5DCLA 5KKAA 1RBZA 1CUZA 5DKFA 5HTKA 1M2HA 1NW4A 1DIOB 1ZX1A 4G37A 1JMKC 3FR7A 1J0BA 1ZMOA 4GRAA 1QHIA 3IEXA 4K9PA 2IHKA 1F8XA 4IV8A 4RMIA 3I37X 4TL8A 2P40A 1PT5A 3S2SA 1NN0A 3SJ7A 4TS1A 5BUQA 1SKYB 2B1QA 4XWWA 4YRRA 5EZQA 2Y1OA 4EJFA 2O8EA 3P0FA 5AT1A 5KAMA 3GUVA 1QYDA 5JISA 2MYPA 3IPLA 1G7SA 1HE5A 4WJZA 2QLFA 3PB3A 3UQYS 3UTCA 1VKOA 2NYUA 3VNQA 3CWQA 4N0PA 4EL5A 3H7AA 2NGRA 4MW2A 3TBFA 1GRNA 2I87A 1P1KA 1Z4JA 2AMJA 4JZKA 4O59O 5H5JA 5K0NA 2YVKA 3SKXA 2OEPA 3ZY4A 2AT1A 2IS2A 5E0OA 2R5WA 1FYFA 3WRYA 4MTCA 3FDXA 4QZVA 3UJ7A 1K1EA 1P1FA 3CKYA 4PSVA 4GW3A 1HNNA 2EU8A 2WF9A 4PZUA 5A7GA 2AG1A 3UT5A 4L02A 1MLDA 1E3IA 3RRZA 3B5EA 3DAFA 3D8RA 1FSFA 3HH8A 1WKCA 4QHYA 2PZBA 4L8WB 5AJHA 4EHAA 4KO1S 5JBIA 3BE4A 1W4BA 1XQ6A 1IIBA 2OFOA 3RVKA 1NVDA 4ZYYA 3LPAA 5LP6F 4K8OA 1GSAA 1VHQA 1C9NA 1U28C 4Q7KA 3CUTA 1A76A 2A86A 4M9ZA 1WL8A 2C61A 2RGCA 1JE0A 2O2EA 4QA9A 1CR1A 1YFZA 2E4AA 4DSUA 3SE0A 2VNKA 1U1CA 5CFRA 4I1RA 1Y1KE 2C4WA 4WZZA 1RC0A 4BZZA 2PXCA 3EXFB 4OCZA 2P3OA 2PUTA 4U2CA 3DCJA 3VC7A 5ERYA 3F5QA 1T3SA 2Q5QA 3RGGA 2E5WA 2IOFK 1M6EX 2XF2A 2Y67A 1Z15A 1Z5NA 2R8PA 4NICA 4WMLA 1I3OA 5KCMA 3UWKA 4B6RA 4MXDA 4DY4A 2BZ1A 1TMGE 4E1VA 5I9SA 2QT0A 1NXOA 1E5DA 3Q9UA 4FLMA 2A14A 5LBUA 1K66A 1ZD2P 2A35A 2GGSA 3ETJA 2ZUVA 3IYLW 4KZKA 3QPCA 4DT1A 3CF4A 3O9ZA 4QGHA 1KVQA 2G83A 3LRXA 4C03A 4F3NA 5JY6A 2FHPA 1N36B 2KS6A 2QI9F 3PJDA 3KSAC 2GBPA 3AFNA 2HNBA 3P9SA 1ZD8A 2WIJA 4X3PA 3TF5A 4JBYA 3U26A 1VLJA 1T2AA 2DWOA 2NUAA 2RAVA 3JQCA 5JSZA 3ZI4A 1W9MA 4F7WA 2VF7A 1Z3CA 2NYAA 2YOHA 4PX3A 3DXZA 3Q1LA 3JR7A 4UVEA 5AK0A 2H4WA 2CV1A 3NDBB 1U3TA 2O1WA 5CHEA 3EZYA 2ZIEA 4EHHA 2JCBA 2G5PA 1XQVA 1K7YA 1VKJA 1SFRA 5KTRA 3OY7A 2PHZA 3URKA 3KT3A 4FEYA 5IUKC 1ZZEA 3CZ9A 1O94D 1Y3AA 3GYBA 3W77A 3OZFA 3WNCA 3IQHX 2ZIXA 3DONA 1LZLA 2XUQA 3MYRA 1ND6A 1CRZA 1THGA 2H1WA 5IARA 5KAPA 4PSKA 4UUBA 4C3ZA 1M5RA 3U1BA 3OECA 2QAGB 1JBEA 1E2UA 2IU3A 2XAUA 2Y77A 4JLSA 5G41A 3SNHA 3BHNA 1GYPA 2ET6A 3WRXC 3GQBB 3I5AA 4XM0A 2QQEA 3WHPA 7ADHA 4FS8A 4W6QA 1QO0A 2WFAA 2DB3A 2GTPA 2K7ZA 4CG2A 4AJ2A 3IIIA 1QIFA 3NVAA 3CE6A 3V1NA 2UVPB 3DYBA 4RLSA 4UM5A 5ITSA 1JR6A 1BMQA 1RQ2A 2ZULA 2P9ZA 3ZV3A 5ECYA 4C4SA 2O05A 3KQVA 1JFVA 3A4NA 3O4IA 3CLHA 1M7BA 3GD7A 2PWZA 3R75A 4LMRA 5BMVB 5GZ6A 2Z1DA 5C9ZA 2PT5A 1MBZA 3CIFA 1ZGAA 3WGIA 1L5MA 1R64A 5FQOA 3U61B 2CMDA 2CXNA 3MA0A 1Y81A 3JD2A 4MKIA 4MRVA 3V2IA 1C1YA 4PLPA 1FU4A 4BNMA 5FWYA 3AHDA 4RNCA 4WH0A 2WU8A 3I8XA 2YZNA 3E84A 1YJBA 4HRVA 4S3MA 5E8RA 4DMUB 2ODAA 1P7YA 2XB6A 1K2WA 3LBHA 5FPYA 4OAPA 1MX9A 1LDYA 1CRWG 4RZ2A 1VBFA 1GUYA 2BM0A 5K8UA 5G2OA 1GGNA 1EP9A 1F12A 6AT1A 4BLPA 1N2JA 3QMVA 4UVGA 4XYGA 1RWOA 4ARCA 1IN4A 3GMIA 3Q5EA 3UHJA 3VO8A 1TDJA 2Y27A 4LY9A 3RU7A 2P6OA 2IYWA 5AW2A 2WSSD 4GD3Q 4IZOA 4E3ZA 1Y9AA 2NVOA 3AJRA 1TEVA 2WAOA 3OT1A 1GO2A 4C2TA 4C1BA 3I73A 2GM3A 3ZHQA 3K8OE 3OLCX 4G01B 3JAWA 3LQKA 4YQZA 5E1OA 3QEBZ 5C7YA 2C2OA 1UMBB 4BWYA 3G0HA 3KB2A 2HADA 5TGZA 4A6DA 1IOLA 3FHCB 4LK2A 1G41A 4HDSB 1ZONA 4NBWA 2JFYA 1EFTA 4J03A 4C07A 5LQSA 4RTSA 3BEDA 4YBRA 5ALLA 4BDTA 5KTNA 5KUTA 1IWOA 4BMPB 2NZXA 3CUUA 2OV1A 2XWQA 3GEBA 4J6EA 1IUPA 2IUTA 4M0DA 1H5NA 1PE0A 1Y5RA 4UMEA 4AULA 1QSGA 2ZYVX 1PV1A 3OWHA 2PUWA 4X5OA 2H4JA 2C88A 3GFQA 1AUVA 4ZTUB 1F4LA 4RGYA 1JFLA 2R97A 1ZD1A 3STUA 5LDDC 2PRIA 4G4SP 1U3FA 3O9VA 4V1CI 5TR9A 3S2ZA 3DO8A 4DCSA 2FN8A 3PIDA 4HDNA 1QDUA 2B99A 2D5LA 5JNWA 2VPYA 2BBWA 2V3VA 1ODSA 1GNTA 1V5GA 5LZ5A 3GB9A 5CXQA 4W1QA 2AA3A 2X8LA 4JJGA 5COQA 1J2YA 3GJ4A 1N2OA 3LQQA 1HZZA 3V7YA 4NQRA 1NW3A 3BGOS 1JGTA 3DKIA 2C7OA 3V8EA 3L6OO 3R3HA 4GYKA 5I6DA 3D7KA 1CS0B 3WGGA 4JVSB 2J48A 1J00A 3I2KA 5FBZA 4ZV9A 4EDFA 1RM4A 1ATZA 1RABA 2V6JA 1NNSA 2E18A 2Z5GA 3DZHA 3S0JA 1FTNA 2Z4RA 2FN4A 1BCSA 1QV7A 1TO6A 4F8YA 4O0MA 2AI2A 5EMJA 2C20A 4G0NA 3QEMA 2EGUA 2X6QA 1A82A 1TJYA 2C82A 1Y5IA 3FCSB 3MXOA 2Z2YA 1I6KA 3L8HA 4G63A 1XZQA 4P7JA 3SEZA 1NUPA 3C1AA 1GZ3A 1T4GA 2ATVA 1LVHA 2F90A 3KOMA 3SJCA 1Q92A 3LMKA 1AKNA 1XCOA 2VBCA 3GIWA 4YI3A 3B9PA 3GAFA 1HSOA 2Q0SA 1KYYA 1K5HA 3MBKA 4LQCA 2FKAA 4DSNA 3Q7IA 1L4NA 2V7WA 1VYUA 3CZAA 4D0LB 1DIRA 2GYUA 2C84A 3A11A 4V3BA 2X4GA 1X9GA 5AQ1A 4JBNA 3QK7A 4B46A 4HZIA 3HP1A 5LBIA 2Y76A 3LRPA 3NUZA 3OPNA 1HWYA 1QH9A 3SYMA 1FUYB 1UK7A 2FA9A 4F3TA 2V7QD 2Q8NA 1D2HA 2WILA 2ZBUA 1XELA 3GR6A 4WN9B 3PT9A 2X1HA 3QH4A 4PINA 5IJ9A 1Z6PA 3AF1A 1T6XA 2W6QA 2X8BA 3I01M 4L08A 3H11A 8ATCA 3PLAE 4DTIA 1SCQA 2AG6A 2FV8A 4RK4A 1DC3A 1PUXA 4JJAA 4XQCA 1SN7A 3OIDA 2YRWA 1LFDB 1WQ1R 4JD5A 4O4JF 4WD3A 4DA6A 2QTWB 3QVJA 3TXXA 1A27A 4LF6B 4ZT7A 1XDSA 3LUGA 1PWXA 1PS8A 3M1IA 4I1SA 4JOBA 4FFPA 1MNAA 3VPBA 3WMXA 3WVNA 4EKDA 3KHSA 3TE6A 5BNIA 4RD6A 5EJ7A 5ALPA 3CE9A 5FPPA 3RANA 5FL7A 5CAEA 3HA2A 4K8RB 1K4YA 2W4IA 5BPFA 5E1DA 5JYEA 1E3WA 2WF7A 4R9SA 5JD3A 4BDSA 5AW7A 2W4MA 5DBFA 1C9KA 1XMIA 3E0QA 1Z0ZA 2WG2A 1J9GA 1MQ9A 2WIFA 3F78A 2OUIA 4QUHA 5SYAA 2D2IA 4D79A 3L18A 5TPWB 1VGVA 2HIMA 2BDEA 2BMFA 3U62A 3B52X 4U39A 1JPUA 4XB1A 3IPCA 3FETA 1UDWA 1W48A 1LPSA 2Z2ZA 1DGQA 2R62A 4DDKA 4B75A 3I0NA 4ND3A 1OBFO 4HZGA 4KXQA 4C4OA 4AY5A 1NC1A 4XIYA 4POAA 1Q7RA 1CR6A 2C5GA 1K88A 2FYTA 2G5CA 3HACA 5CTAA 3OEEA 1E1MA 1WPRA 2VZLA 2E4UA 3NDIA 1TJNA 4JSTA 3H9GA 3G3EA 3T61A 1P1RA 1W88B 2VNHA 2HU7A 3OWXA 4G0YA 3WKAA 2VP6A 2Z6QA 5BQXA 4Q7QA 5HEKA 1E4YA 1T36A 2ZJ8A 1JIUA 4RF3A 3TIIA 1VKNA 2FPRA 4EB6A 1X1CA 1NXVA 4HAOA 4K26A 2PL3A 1XX6A 3OURA 1NI5A 1UK6A 2P6UA 3CH6A 2HEIA 1KQ3A 3C43A 1YS4A 5B1IA 1J6UA 1NOKA 4EW2A 3KOXA 2XVYA 1Z29A 4HDRA 3NT2A 3ZDEA 3GFTA 3W2HA 5B12A 1ZNQO 2DE0X 3PT5A 3W2TA 3A4IA 2P0YA 2FR1A 5C7OO 5DYTA 4J0QA 1TIKA 2WT9A 3EZ9A 5GV7A 2MMCA 4GWGA 1KDOA 3T3HA 1QX4A 2IEAA 2R44A 4Z7OB 3KX2A 1RAFA 1YR7A 3DBIA 1KVTA 1RAAA 4Q6BA 4PTLA 2Q50A 1RRMA 3WB1A 1JXMA 3VHXB 1SXJC 4OI0A 3ESCA 2AVNA 5CDGA 3TL2A 1B8UA 4P83A 4TXMA 2HK6A 4AB1A 3M49A 1D07A 4OGKA 4UAGA 1VYVA 3T6KA 1NQTA 4S1WA 4ZOLA 3UXYA 5IYZB 1RLMA 3RBZA 5H9WA 2PMKA 2Q9UA 1UPBA 2Z2JA 5SY9A 3BPSA 3JQ9A 4GEGA 5F5LA 2I8AA 3PHBE 3EIQA 4NFYA 2AI3A 3F6RA 4QQRA 2FDXA 1N3YA 1R4NA 2IW1A 1EK6A 4F6RB 4F5DA 4BGIA 3L9WA 4PGGA 3AERB 5UKDA 4URUR 3F9CA 4CNQA 1QQTA 3GK3A 4G5XA 4B32A 4KI7A 4ZYLA 4QDJA 3ZE8A 1P7WA 1CUIA 2EARA 2FFQA 2NU9A 1Y1QA 2VPQA 3KOZA 4QYMA 4YLGA 2WE7A 1R4MB 3L8FA 3G5UA 4YDQA 1AH2A 2Q8QA 4FE4A 4XA8A 2XMZA 1Z88A 4FJ0A 4Z2AA 3AIKA 4BIMA 2VH1A 4MGKR 4HVLA 3N7AA 3KTDA 2VBGA 2I3GA 1ONSA 3INGA 1F38A 1HURA 5AXAA 4RTNA 1FFGA 2GJKA 3HGTA 1W5AA 3BXEA 1CUJA 4N7RA 4OLFA 4CFZA 5H3HA 2I7TA 2IP4A 1G2QA 3GEGA 4U63A 5IMBA 3NKLA 5CURA 5AYVA 2WSBA 4FHGA 4HNRA 4MRMA 3TUZC 4MEJA 2JJMA 1A9PA 3ICWA 3FPBA 2YFKA 1J8MF 1ISMA 1DXQA 3H2HA 5EWMA 2BH2A 6ADHA 1JDBB 3L6RA 2O48X 4DKXA 1K6XA 1X7WB 3LC1O 4I6JA 2OBBA 4I1UA 1XYGA 2ZI9A 2C9OA 5E4TA 4N03A 3EGXA 2PO7A 3AYZB 3SJUA 3LLSA 3FF1A 3WADA 4EIWA 4OU4A 2PUHA 3OETA 3P0EA 3ISTA 2VSNA 2VTVA 5FA6A 2CZGA 3LLUA 2XV1A 4W9NC 1OA1A 4C7BA 1V9SA 2BKXA 2O7RA 3BS4A 4H60A 5AH0A 2ENWA 3ZD8A 3GCDA 3FW1A 1DEAA 1MU0A 4LC1A 1U0BB 2JVKA 2B25A 2QRMA 3GPLA 1HL7A 3LHFA 3AF4A 4BNLA 1XNHA 3IDQA 1DOZA 5LYJF 4MUXA 1LPOA 3I6IA 2PCJA 2Q62A 4UBLA 3AF0A 3V8NA 1UFRA 3N2GB 1BDIA 1PS9A 2OD2A 3U81A 5JC1A 2ACWA 1L4BA 3BRWA 3WB2A 1E9EA 4RKQA 2AHOA 1OFTA 3MNFA 1YQXA 3TZHA 5IJWA 2QM8A 1S2GA 5JNRA 2ZRDA 2IYVA 5EFZA 2W6IA 2X40A 3GPDG 1FLAA 3GVCA 4OUKX 3G2JA 4Y1RA 4G8DA 5D6NA 1GZ6A 5J5VA 5ENVA 5E6SB 3SP1A 4KXFB 4ARVA 3MAJA 4IIVA 4RK7A 2JZOA 1HT2E 2JA2A 4LQLA 4FEEA 2AE2A 1VL0A 3D1JA 4MYSA 2HSJA 1E64A 1N6KA 5CCDA 5MF6A 4JAVC 3OCVA 2CUTA 2WJAA 2VP5A 2XRYA 3M70A 4BGUA 4Z54A 1LNSA 1NL3A 3GYGA 4A0FA 4D99A 3A6DA 3V4RA 3M6FA 1TU4A 2FNAA 2PK3A 2GBIA 3A04A 3BDAA 5KOHB 4MDHA 4QGAA 4Z1MA 2WSMA 3EC1A 1E96A 1AE1A 3HUDA 3LCJA 2ISSD 2Q45A 3VNAA 4AF8A 4ALJA 4C14A 1KEZA 4TROA 1LSUA 3QG1A 3TNYA 2UYOA 3H5TA 2B69A 2NTEA 1P4SA 2WWTA 5EHZA 5D1HA 3FVVA 5C4MA 4G5HA 4R1SA 1KO1A 1MJHA 4L9RA 4RNDB 5EEGA 2F8SA 2DCMA 4PSCA 4LOAA 5E95A 4YAUA 3SX4A 3G0DA 3MMZA 5EZ6B 4H6XA 1KYVA 1G2IA 1YCHA 1IIRA 2GUWA 1ZU4A 1DO2A 1DTWA 1U7TA 3U4IA 1XZJA 4WBSA 1T0PA 1S02A 2JBAB 5FOSA 3HB1A 4XDYA 3MWEA 1XQ9A 3RFFA 3JYHA 3TKAA 2OB1A 2VHUA 3PV0A 4H9GA 5FFFA 4DLAA 1FXWA 1NVTA 4KACA 1S0UA 2CNLA 2H6EA 4Q03A 5C1IA 1OZAA 1WPGA 2B30A 3DUFA 2HAEA 1E94E 2CVQA 3ABRB 5L45A 1FYVA 1R8YA 1T1SA 2VRBA 3CG4A 1HA3A 1I3LA 3IAM1 4CGYA 2GNOA 2YC4C 4CW7A 3PPIA 1IHUA 4EFNA 4RVDA 2I6QA 2QL7A 4TOIA 2QQGA 4TS4A 5F7JA 2JFXA 1Z63A 1O97C 2XNHA 4UUNA 1V7ZA 3FCOA 3HJFA 5J2UA 1JIJA 3FRJA 4RTJA 4CTNA 4NI5A 1Q17A 1YVDA 4F1WA 2GEDA 2QQ5A 5AVZA 3EWNA 4RFSB 2J5RA 3U7QA 4A8JC 2ZRCA 1JU4A 4P98A 3TOCA 3DG9A 2VYFA 3A10A 3H9EO 5EYPA 2JD2A 1Q57A 2DVMA 1VE9A 3K2BA 1SUSA 3HCEA 4R9VA 3ZE7A 4LXYA 1P4RA 5P21A 1W36B 1CEXA 4NZZA 4O4LF 1RXCA 3ZW9A 1SUDA 4C21A 1T9ZA 3O8QB 4GICA 4MITA 3VUFA 3LAWA 4FN5A 4KQ2A 3DLHA 2J4FA 4UBOA 3B6IA 4CCYB 3AGQA 1FDWA 3CNEA 1BRMA 3MFQA 3GT0A 2VSOA 3OJ0A 2AZTA 3EC7A 4FFWA 5J58A 3R6TA 2QZ9A 4GAEA 5IM4A 2IW3A 3NZEA 4B6SA 1JSXA 2VDVE 3FSEA 1R8JA 2I4RA 2XY4A 2Q0QA 3DKKA 4OO3A 2JCGA 5KSPA 5E6RB 3F6CA 2C0PA 1JPJA 3O4VA 4HDNB 1U8UA 3KYJB 4QYIA 4LECA 4BLTA 4RU1A 4QARA 4TYWA 2CXPA 3NRCA 5IJZA 3HMKA 3KYDB 3SIRA 3L8DA 1GL3A 3W2FA 4W82A 5DWVA 4L4XA 5FA8A 1MAVA 4AX4A 2G07A 3FAKA 1W5BA 4NBKA 1SBQA 1FX0B 1P4AA 4WOPA 3TW4A 3R0XA 2G0NA 1U80A 3V4ZA 2ZRIA 4J0IA 4B0PA 4C4RA 4QPCA 2EL7A 1CZKA 4ZOQI 2OT3B 2CL6X 4CHTA 1UT8A 2E21A 2GWHA 4QSHA 2ACKA 3MWLA 4GL4A 3GELA 1M1YA 1X7ZB 2J9RA 3EIOA 1G8PA 3HXPA 3L4SO 4P4SA 2HLNA 2N47A 4X1YB 2QTNA 2HJHA 4M1TA 1QE0A 1EGAA 1VG8A 1TAHA 1VBMA 3DM5A 4HL6A 4J2OA 2MSDB 3U7FB 1X1SA 4KMSA 4M6WA 1KXJA 3L1VA 4N5NA 3UM9A 4BTVA 2EBHX 3KB8A 4RY9A 3WWYA 2AJ8A 4H0FA 4E13A 5EG5A 1X92A 4JI8B 5LLDA 3L0IB 3T1TA 1E2BA 3RC2A 2JZNA 5L3SA 3Q8KA 1FZTA 3EGOA 3KG2A 1CKEA 3C3JA 2ZROA 5DT2A 1I2DA 1YE3A 2IX9A 3B6ZA 3FKQA 3AW9A 3NIFB 5B1YA 4IIFA 3EJ6A 3COWA 2D5BA 4V0ME 5FBRB 1J8QA 4A03A 4BKUA 3FPLA 3FYDA 5I7VA 5AI9A 3W1EA 4CF7A 1NASA 2RAFA 2L18A 3MOSA 3MTAA 3H04A 2GB4A 3QXJA 4OKNA 5I7HA 4GFDA 2I3ZA 3IBFA 1CY1A 1TIPA 1E58A 5CMLA 1JLLB 2ZWPA 1K9VF 1U0TA 2J6HA 5JCXA 4JYBA 3PEFA 4PZYA 3WWDA 1O58A 2A67A 3CJTA 4R83A 4DIDA 2Z1NA 2AZMA 1UBJS 3RC1A 2Q3DA 3MGCA 2ZCUA 1OXVA 1T9GS 1CEQA 1E2GA 1J0CA 4KX3A 5LDHA 1IPEA 1GYQA 3EZGA 1EP3B 1AZLA 2IHJA 2VT2A 3OCJA 4XEHA 4FCTA 1R5NA 3SLGA 4C08A 2OAQ1 4MO9A 3H5WA 3TD6A 3VVCA 1N2CB 2HMAA 4UBKA 1RHJA 2NT4A 5I9LA 3FFXA 5DSXA 3BD8A 3W0LB 3PUVA 3I8OA 1IEQA 3E9MA 3Q87B 4CIYA 3Q3JB 2NNLD 2B7BA 4X6UA 4EHFA 4ZCMA 2BEUB 1AIPA 4ZAXA 1S3GA 3KM0A 4K05A 4ND7A 4RZUA 3UAVA 1QHGA 3WDSA 3G82C 5L6LB 4MQ5A 3N2LA 2X5JO 2DH5A 1ABEA 1CDOA 1C30B 4LJKA 3WRYC 4IDEA 4KE9A 3LFTA 3FTFA 3BX1A 4PR3A 2B5OA 4M7WA 3I04M 3AEQA 3HYTA 2VDLB 3HJCA 1AUXA 1G8JA 3A4MA 3Q12A 3QHPA 4NE2A 5COAA 2I67A 3AH8A 2Q2VA 4AQDA 4LAFA 1UL1X 4O2BB 2GXAA 4QG7A 5JQGF 1JIKA 3RAEC 4KDEA 4IJVA 1PTJA 4KGXA 4RDHA 4WKPA 5CCBA 2CLCX 4NJMB 3SZLA 2FTKE 1Q0ZA 1U28A 1GG8A 2D2EA 4AZSA 4MH0R 4DQKA 4NMHA 2NO6A 1CX9B 2XB8A 3WLQA 1EFCA 4JQYA 3OC6A 4E5NA 5F9HA 2GK6A 2ZJYA 1H8ED 1SQ5A 1Y4UA 3LOPA 4MHSA 4UTXA 3H1AA 1F4PA 3U4AA 3ZWQA 1MF7A 2D1YA 3OF5A 4MGYR 4PG5A 4H59A 3SG0A 3COZA 3PNMA 5CG2A 3CZRA 5E7MA 1Z4PX 1B4DA 2JNWA 1GNLA 2P4EA 4BGEA 1LDMA 4RSMA 4ER6A 1I4LD 3IQDB 1ZKDA 2EEPA 1C8BA 1J2JA 4FFOA 4F96A 3JQDA 5MGNA 1EMDA 4L9SA 4CKWB 3GI1A 4C7XA 3GLTA 3ZCXA 1YRHA 2AOUB 3AHCA 5L53A 1IN1A 2I80A 3MCAA 2ZYRA 1CJKC 3PPXA 3R4VA 2HI0A 4B4DA 1MEEA 4FQ7A 2FF7A 3TQTA 1US8B 1VZ3A 2PQ6A 2SKCA 4QULA 1JBKA 1M8FA 2PKCA 4NVRA 2QL5A 2J0VA 3WJ7A 2WM3A 3C3KA 1KMHB 2AVDA 4UM9B 2EQBA 1NVVQ 1SOAA 1V4NA 3QF4B 2IGBA 2X0KA 2IEGA 1EX1A 5HZGA 3A6LA 2BFCB 1TKCA 3VPSA 2Y3IA 1SOVA 1FUIA 1XTZA 5ALNA 3QVTA 1U6KA 4K9NA 2F3SA 1D8AA 4DDMA 4EI7A 4V1CB 4R1NA 1BKDR 1P1HA 2RBKA 2VJAA 4M54A 3RVBA 1T1EA 3AT1A 1IRXA 1JIVA 3HU3A 3JVIA 4RIEA 4XI9A 4EG6A 5GPBA 4DQVA 4OH7A 5EOVA 4NNPA 4Q15A 2HJWA 3K9WA 1PJ3A 3MB5A 4X7RA 4UTVA 4JYCA 4WL0A 2XQGA 4WSOA 2DETA 3G6WA 4HAZA 4ZC8A 2FZCA 1R9JA 1Y33E 4Q3LA 5JI3E 2C9MA 3DXFA 2ZE6A 3WICA 1ISIA 1UQTA 5HM8A 4BB5A 621PA 4JIMA 1HFEL 2V9CA 1Z6QA 2XVMA 4LTMA 4MVJF 3VYRB 4PPGA 1N9GA 5IJ9B 3Q85A 1ZK4A 3ELDA 1BRTA 2DFTA 3U40A 3VKFA 5LP6A 3GUZA 5JCJA 3V4VB 2X4LA 3VFDA 1P2GA 3WRXA 5CIQA 5IHXA 1IUKA 2GZHA 5JXGA 3MW8A 3VZDA 2ZAYA 4FUTA 4B3RB 1GWNA 4OVKA 2E4WA 4HQFA 2FQQA 4FN4A 2F3RA 3M6UA 1XVUA 2J3JA 1BA3A 1FFAA 2RC5A 3FNQA 3SMQA 1XKXA 3EK2A 1ZUHA 1Q21A 1FUKA 4FZ3A 4NV0A 4TUYA 2ZT6A 2Q6OA 1B3BA 1WF3A 1GGHA 3WE7A 1YNSA 3MSCA 1M75A 4RA6A 1NSYA 4YHHB 3INRA 4MLZA 1MO3A 4KQHA 6LDHA 3MYYA 1EE1A 2WPNA 3SDBA 5DNWA 4GT1A 3I62A 2HLDA 4JR0A 4UZFA 1LS6A 3KJXA 4K2HA 3PCRB 1KI8A 2QRZA 4JI4B 3RK0A 4CDGA 1XSEA 3G7NA 1I1OA 1VIYA 1OREA 3L8MA 4GZ3A 5AVYA 3ZZUA 3OZIA 1ZM7A 2NN3C 2WYOA 1E6MA 3NIDB 1D6MA 1H66A 2XQVA 3NYIA 3TLCA 1ULAA 3DV0B 2X9NA 3TIXB 3HGMA 5F7XA 2MIIA 5DZSA 3DP9A 2R8EA 5TJ9A 3FYHA 3BICA 5BSWA 2ZRQA 4Y3UA 2PA0A 5GINE 2QTMA 1YS7A 4F9EA 2PFGA 3IV6A 4B5KA 4WNIA 1ZDMA 1N5LA 2I4OA 3LDFA 3CMCO 1P81A 3PITA 4RVUA 3GMTA 1CRLA 4WGGA 2Y4OA 3FF4A 3F2IA 4C4YA 3HR4A 4LJLA 5L3QB 2NP6A 4LMBA 4OHFA 4M1MA 1SXJA 2HO5A 3LF2A 3LUFA 3OH8A 2CMHA 3EGVA 5DTJA 3TR6A 4M8NE 3BMCA 4JKYA 4ODIA 4CEHB 2X0FA 2WUGA 1SKYE 4K81B 5EMHA 3VA7A 4RJ2A 4KDRA 2KLHA 1T1JA 5FP0A 2QI9C 1BQEA 1LQTA 1AHIA 1QOZA 5FA5A 4JGIA 2EWVA 2GDZA 1RR6A 2QMQA 2KJQA 2NZ8A 1VSVA 3ND8A 5JVDF 4UM8B 5EMNA 4ZO6A 1E6UA 3R24A 4X71A 1BHSA 5HF6A 2NW6A 4EX7A 1U98A 2R1VB 2HLPA 3HKDA 3RYFA 3L79A 2XMPA 1SVKA 2VG8A 5ENDA 3S2UA 3L4KA 2X4DA 4MAFA 1W75A 2Z4SA 2V3CC 4G09A 5COBA 2FR8A 2EEZA 4DABA 5TVGA 3IUEA 4F3KA 1GXSB 2ZBDA 2WW8A 2MWMA 2G71A 4AICA 1ZOIA 1XFDA 5HRUA 3QFRA 3I9LA 2X7XA 1N4DA 3TDMA 2EBUA 4F5EA 2P2ZA 3DGFC 1O9HA 4QX6A 4R2MA 2CD9A 4B3JA 3BXHA 2V9PA 2CVPA 3L6EA 4V2IA 5EWMB 4BZPA 1T9DA 3I23A 3WYEA 4Z4GA 1SUPA 4BMVA 1UMCA 1XAJA 1YKGA 4DG9A 1V2HE 5E1BA 1JDBC 4YJFB 2PH7A 4L8VA 2WD8A 4FKZA 2QD4A 3U39A 4M0FA 5C52B 4LMAA 1GD1O 3MJTA 2IFTA 1V47A 2H1CA 3QRWA 4G1BA 1PFVA 4MUYA 4Y2QA 4CN9A 5ALHA 3U7GA 3ADBA 1W29A 2AK3A 3WK4A 4DWJA 4WK4B 4JI7B 1XXHB 4QXMA 1TKAA 3VQTA 1PEYA 2CL7X 2JAOA 3N8IA 3ZE0B 2DBRA 4JXZA 2UZ0A 1NJ6A 4HBGA 4BO8A 4CG1A 4UVHA 1G17A 4B34A 4RCVA 3WDKA 5J63A 1FNDA 1KE2A 1FP6A 4EPVA 4LC0A 1DKLA 1E79D 3B89A 3ET4A 5I8PA 2EKBA 2NXNA 3TUJC 1XEXB 3UAOA 3LC0A 2O5CA 1N2BA 1RC1A 1NDHA 5I7EA 3WJAA 1AT1A 3K0BA 4MB0A 1CB0A 1E7QA 1PFUA 2GCEA 3L4BA 4L5IA 3BT7A 2HHJA 5A04A 4OA8A 1HRKA 5K4AA 5C4GB 4FZVA 2E48A 3S40A 5CW1A 3IPYA 1OX6A 2DQYA 3WJ2A 4UASA 3G9UA 1OJ7A 2Q5CA 2EW8A 1KMCA 1R6UA 4X20A 1UBGA 2AJBA 2JCYA 4IDGA 1E9AA 4CWAA 1CUWA 1CZHA 2Y66A 2AE1A 3ICVA 3ONDA 3NEJA 2FUG1 4QAQA 3D2BA 3TTYA 5CNKA 1IJBA 1PX0A 3VO9A 3ZHVA 1Y8CA 3QLVC 4D5GA 5JPDA 4GYYA 2EX4A 1NMYA 2JKVA 3OI7A 4XXHA 5BOVA 3OE7A 4BMSA 4QBTA 3Q9LA 1KJIA 1SIWA 1ZS9A 3GZTB 1C9YA 3QKIA 4LY0A 4HYQA 4O6VA 5A6VA 2FFHA 4DQUA 3D3KA 4B79A 1OC4A 1LLCA 1WJGA 2A9FA 3SF8B 5KNDD 1VCHA 2OL4A 5KU7A 1EBFA 1JHVA 4ESEA 1L7RA 2Z09A 3N8DA 2XCSB 1JF8A 2QUHA 2VYNA 2OXTA 1K8XB 5FXMA 5HYVA 1EWYA 2FX5A 1BH6A 3ICCA 1Z75A 2B4YA 4D9BA 2J9YB 4RV5A 4X3CA 3AF6A 2HL6A 1OCEA 1B8PA 1P60A 5H82A 4GP6A 3B1ZA 2NQ8A 3R20A 1E2IA 1U2RA 2G9QA 3DFFA 5A0FA 1S8AA 1GAQA 1KI3A 3LCCA 2IOYA 4TWBA 3N6VA 4A73A 4D02A 2HCBA 4AL4A 3BK1A 3OPYB 2XNJA 1L7NA 1OYOA 1TXGA 3T1QA 4DCUA 5CFZA 4CDMA 3IR5A 3L8EA 4RV9A 4EENA 2XGOA 5G02A 5JSHA 1V6AA 1NURA 5FR2A 3BB4A 3PGVA 4B81A 3ZWDA 2ECQA 2Q27A 3B70A 3QFTA 4F72A 1RYBA 1M2OA 5AVXA 5CK4A 2O5EA 4J9VA 3MVEA 4LBYA 4M55A 3IPXA 3NMUF 1DJLA 1PWZA 1FFCA 2AQIA 2GPNA 2VLBA 2PGIA 2IS6A 3IDAA 5AOVA 1JG1A 1I3KA 1YRBA 1YRYE 2F1RA 3UBMA 2YMQA 3F5DA 3VPDA 3UGJA 3EXG1 4LF4B 4WTOA 1JJFA 2CL5A 1I10A 5C8YF 1OF1A 4JZYA 4R1LA 3I92A 3EFOB 2C8KA 4M1WA 1GR1A 1MB3A 1SZPA 2QG4A 4TS9A 4AP5A 1ZR4A 1RHUA 1TD9A 4AG5A 4W5QA 4X6LA 3SQMA 1Z45A 4KFRA 1KPIA 4EMSA 2A58A 1KR2A 4NYMQ 3DPUA 4G9BA 3A1DA 4R98A 3ZJVA 3DZKA 3CLTD 3LWNA 4LWQA 4X63A 1AK1A 5DE3A 2JFUA 1BEZA 1XAHA 3M5WA 5HNKA 3FUXA 1EUZA 1AS0A 3QOXA 1ZIYA 3TAXA 1XHLA 5ADHA 2P7IA 3HV0A 1T3LA 4CETA 4Y2YA 5EXPA 5B1DA 1N3BA 4YP7A 1CZOA 1AV7A 2IYNA 4WFJA 4QQFA 4BO5A 2PRZA 2XWBF 2YJ5A 5C8XA 2G1UA 5CG1A 2JGDB 4KI0A 3TQHA 3X2FA 2A0YA