3W9SA

Crystal structure analysis of the n-terminal receiver domain of response regulator pmra
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
116
structure length
116
Chain Sequence
KILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGLHFLSRMRREKMTQPVLILTARDTLEDRISGLDTGADDYLVKPFALEELNARIRALLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OmpR family response regulator in two-component regulatory s
publication title Structural Basis of a Physical Blockage Mechanism for the Interaction of Response Regulator PmrA with Connector Protein PmrD from Klebsiella Pneumoniae
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae ntuh-k2044
molecule tags Signaling protein/antimicrobial protein
total genus 42
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3w9sA00
2CHFA 1QP7A 2JBAB 1U2QA 3H1GA 3HUTA 1PUXA 2I6FA 3A3KA 4XFKA 4MS3A 4Y9TA 1W25A 1RZRA 1EWVA 2MYUA 1QP4A 4Z99A 1CEYA 3T38A 1TLFA 4G0MA 3OLXA 3R0JA 5CNJA 2XDYA 3RVJA 3MYYA 2GWRA 3H5VA 3C3MA 5IX8A 2JVKA 2L2QA 2FN9A 1NXSA 3LUAA 1GCGA 2PKXA 4DQDA 5JNRA 4Z4IA 2HJ9A 3O2QB 5TQ0A 1JLKA 1U0SY 3EJWA 3Q41A 3IP6A 4MYRA 2E4VA 3O75A 3MF4A 2HQBA 4MR8B 4JAVC 2PUCA 1PHRA 3F6CA 3LUCA 4XLTA 2ID7A 2VUIB 3MQ4A 4NCAA 2FTKE 2O20A 3QLUC 1J56A 3OLVA 4RWEA 2JB9A 5TE9A 4N76A 3RVKA 5TQ2B 1USKA 2QVCA 2PL9A 3QX8A 3FMVA 2WRZA 5GQSA 2M1ZA 3O74A 1MVOA 1QMPA 2LP4Y 4MQEA 1APBA 2NT4A 4XXHA 1Z18A 4RY9A 1C4WA 2FLWA 3SY8A 4ETIA 4Z4GA 4KPYA 3H6HA 2L17A 2NZUG 6CHYA 2IKSA 2FEPA 4RK0A 2RJNA 4Z9AA 4Z9BA 5KC8A 2FQYA 4Z0NA 4MS1A 2QU7A 2AYXA 2ZAYA 2JK1A 2VK2A 3HEBA 1XWWA 1ZN2A 3JVIA 2F8TA 1ABFA 1D2AA 3HCWA 3K4HA 1HEYA 3OMWA 1JF8A 1FQWA 4O5AA 3FDFA 3UK0A 4FE7A 3EGCA 2PAFA 1DBQA 4EY3A 4HNRA 1LBIA 3GBPA 3O21A 4YS6A 4N41A 4EGSA 5B3JC 1Z16A 4NQRA 2N9UA 2B4AA 3CTPA 1E6LA 2F8SA 1Z15A 5ED4A 3HV2A 1B00A 4S04A 2WJWA 3Q15C 2CHEA 3KYJB 3B2NA 3ROFA 3BILA 2LBPA 2R47A 3QLVC 2HPHA 5BRAA 2FXIA 2P4UA 4RK1A 1ZITA 3HJFA 2LUOA 1DBWA 3GA5A 4RKRA 5FWXB 4QYMA 4KNYA 4HYEA 3HM9A 5IBQA 4B09A 1MAVA 1U8TA 3M9XA 4TN5A 5TPZA 1LJLA 4OBBA 3SAJA 3CKMA 3NHZA 5E3JA 1ISSA 2IPNA 1LJUA 2FMHA 3LKVA 1AB6A 4RY0A 1QKKA 4XARA 4EYKA 1E6MA 4G0XA 3C3WA 4OLBA 1D1PA 3OQNA 4G97A 2OENG 5HM6A 2M98A 3T6KA 2FKAA 3CFYA 2PE5A 5T3YA 1RPJA 5JNWA 2NUBA 4RK4A 5DGCA 3IPAA 4RXMA 4OG2A 2HSGA 1Z2EA 3C6QA 2VYCA 4MR7A 4WT7A 4W5OA 4H3KB 4G0YA 3HXMA 3I5AA 4Q6BA 4W5RA 1JX6A 4EVSA 5DKFA 2BGGA 3G85A 3OO0A 4ETNA 1YMVA 3KKEA 3HS3A 3N0WA 2W42A 1GUDA 5EWJB 1JFVA 4RK5A 1D1QA 3GV0A 4YGXB 1YS7A 4KZKA 3I42A 4KQCA 3MMNA 2E4WA 4NV3A 3LTEA 4RS3A 3RQIA 1SXGA 3HZHA 1FFWA 2IPMA 2GX6A 4L85A 4YP9A 4RKQA 4LE0A 5KQGA 3QEMB 2ZWMA 3NNNA 5EWLA 3Q7RA 1BDHA 1TM2A 3FFTA 5KWSA 3G1WA 4MGEA 3C97A 4G0QA 5HQJA 4F06A 2MSKA 3S99A 1YMUA 4WXMA 3RVMA 5DTEA 3N75A 4YRZA 1ZDMA 2RJOA 8ABPA 3BRSA 3GT7A 3A10A 3IP9A 3OLWA 3JY6A 4YLEA 1BAPA 4Q6WA 1D4ZA 4F3TA 4ML3A 1ISRA 1PNRA 5DCLA 4KREA 3L49A 3O1IC 3KSMA 3D02A 5EWMA 4F12A 1MIHA 4EVQA 1T34A 1GUBA 2L18A 1YVUA 2PUGA 2PL1A 5BQ3A 3K9CA 3NNSA 4O1HA 4MS4A 1EAYA 5IEBA 4RK7A 2AYZA 3NBMA 2FEWB 1NXXA 2A9QA 3FFWA 3LMKA 4RXTA 3RVNA 5KQPA 3BREA 2CD7A 2JCGA 4IF4A 1CHNA 2X7XA 2QZJA 4N0QA 3I09A 3TD9A 3EQZA 4GNRA 3M6MD 2RGYA 4MR9B 2R4QA 3N6VA 1YS6A 4MQFA 3QX9A 1NTRA 1QO0A 1M5TA 3NHMA 3O2SB 4FE4A 4N03A 4RDCA 4XAQA 3N0XA 4JB2A 2WY2D 5ABPA 3LUKA 2WMYA 4QPJC 4W5QA 4PZ0A 3ILYA 1KMIY 4L4UA 5CNIA 4ZPJA 3UUGA 4MRMB 4IGAA 1RXIA 5D2CA 4Z4HA 2PUAA 3JS5A 9ABPA 3KG2A 1C0EA 4JA2A 4H60A 1XHFA 5FWYA 5KC9A 5T7BA 3RVRA 1BDIA 4MS3B 4RU1A 4YCSA 3QELA 2FEKA 5IULC 1NXOA 1QQBA 1RZRD 2FN8A 4RZSA 1EWTA 1ZVVA 1P6UA 1K68A 1F51E 3F7NA 1ZGZA 4IRXA 3CZCA 3TMYA 3DGFC 4Z4FA 3N53A 2YHBA 3DLHA 3H6GA 5KQLA 3ROTA 5TQ0B 4D74A 4M88A 3H1EA 4QICA 1DZ3A 3OQMA 3F73A 3T8YA 4LZLA 5TPWA 3GWGA 1NXWA 1DP4A 6ABPA 4YO7A 1MB3A 4JB0A 5IUKC 3QK7A 1A0OA 1VPWA 1H9CA 3OO1A 1KRWA 1K66A 1SD5A 2HQOA 2WB4A 3LUFA 5C5EA 5FBKA 1KGSA 2PJUA 4G0ZA 4MPTA 3C3KA 3KJXA 5IUNC 5KI6A 2FSPA 2JVIA 3FGZA 1ZH2A 5I4CA 2FLKA 3NNDA 1WETA 4OLAA 4MQEB 3H1FA 1YIOA 1I3CA 1Z26A 2FMFA 2QSJA 4ZJPA 5IEJA 4E7OA 3P9YA 1JWLA 2JBAA 3RVOA 2QVGA 2YHAA 3HUUA 4ZMRA 1NXTA 2FQXA 2FW0A 3LUGA 4GPAA 4F8JA 4MS1B 1NY5A 1JBEA 1TJYA 2L19A 4CBVA 1DCFA 1Z17A 1PNTA 2H0AA 1RNLA 1ZGGA 4N47A 4DADA 1JHZA 3CG0A 4KFCA 3H5OA 4KRFA 4EVRA 2QW1A 5JNTA 3DLBA 1XHEA 3JTEA 2J48A 2FMKA 1DJMA 1QP0A 2VUHB 5JNSA 4KQ9A 2PUBA 1FSPA 2E4YA 3RH0A 4MLDA 2MYTA 5CNMA 4KK4A 4F11A 4Z4EA 1JDPA 4MR8A 3T95A 2FMIA 4QYWA 1U04A 4E7PA 2IPLA 1DC8A 3JPWA 4TMYA 3OQOA 2E4XA 3I45A 3MIZA 4LDZA 3GRCA 3OM1A 1A2OA 3SQNA 3CU5A 1PEYA 3DBIA 2MSLA 3LUJA 3LKBA 2A9RA 3HO1A 4YWHA 3H5TA 2PUDA 5TQ2A 3H75A 1NXVA 1YK0A 4TLLB 3RVLA 2R48A 3DGEC 2MYPA 4DN6A 3UKJA 1BA2A 2IYNA 4W5NA 1L5ZA 4P1ZA 4EYOA 1M2EA 2TMYA 2QV0A 4RV5A 3Q9SA 4D6YA 5C5CA 2PUEA 1D5WA 3H5LA 3TB6A 5TPZD 3TX6A 1USGA 1EFAA 2ID9A 4MAAA 5JNVA 3H5WA 4TLMB 1E2BA 1DCMA 1URPA 1Y1LA 3MM4A 4Z4CA 5CNKA 1ZY2A 3OMXA 3HK2A 4PYRA 4MR7B 5F64A 2IOYA 3GYBA 4P98A 3SM9A 4EUKA 4LRQA 2Q5CA 1JYEA 3F6PA 1IIBA 4KMRA 3O2JA 1DRKA 4LX8A 1SXHA 1GLGA 3CNBA 4UHJA 3CLKA 2MSWA 3HSYA 3A0UA 4EYGA 3N8IA 2LPMA 4W5TA 4PEVA 3CG4A 4S05A 2E4UA 2IPAB 3N0RA 1JL3A 5PNTA 3DZDA 5JS2A 4LDAA 3LFTA 5BRJA 3HDVA 3QLTA 2QXYA 3JPYA 3BBLA 3KHTA 3O1JC 2B1JA 3H5IA 3ILHA 3KYIB 3QEKA 3CRNA 1UDRA 3L6UA 5EWLB 4FB4A 2FVYA 4G0OA 5FBHA 5FWXA 1YTUA 3GL9A 1KRXA 2DRIA 4RXUA 1R8JA 1VRVA 3Q7TA 1NATA 4IMJB 5DLEA 1JFTA 1QPZA 5TQJA 2PUFA 5HKOA 3QLUA 5CHYA 4OTZA 4WUTA 2QR3A 2E4ZA 2JVJA 1FFGA 1VLZA 1JYFA 2PLNA 1ZAYA 4PE5B 1F4VA 5EWMB 5IC5A 2GI4A 1NXPA 3M9WA 4PICA 2JRLA 3CZ5A 4KVFA 3CHYA 2H3HA 4O1IA 4UHKA 4WWHA 3VNBA 1ZESA 4MS4B 3SG0A 3RVQA 3IP7A 4HNQA 4D6XA 5BR1A 4XASA 3BRQA 1LK0A 4LE2A 5EWJA 1DRJA 4HNSA 4G0PA 4JOQA 3JVDA 1TVMA 2R25B 4NCBA 4NICA 5JS1A 1ZH4A 4MLCA 7ABPA 3KLNA 1MB0A 3E3MA 3KCNA 1USIA 1YK1A 3IP5A 2HQRA 2WJAA 2IDMA 1M2FA 4ETMA 1SXIA 3IPCA 1M5UA 3E61A 3O1HB 1CYEA 1QNLA 3URMA 3LUHA 2PMCA 3MA0A 4MQFB 4OATA 4IILA 1OXKB 3QEMA 4ZMSA 4YV7A 1ZHHA 3HVRA 3KS9A 1GCAA 5GOTA 1QO0D 1Z25A 4H3HB 1PEAA 4RK6A 2A9PA 3VNAA 2FQWA 3D8UA 4KK3A 4KV7A 5B3JA 1DCKA 1Z12A 2GBPA 1QQAA 3LUDA 1DBPA 1RXEA 3FFXA 1P6QA 3SNKA 5FWYB 4ZYLA 4Q7EA 1P2FA 1Z13A 1VKRA 5IUJC 1SRRA 4JP1A 2MYNA 3EAFA 3QELB 4IMIB 1L5YA 4LE1A 4WXEA 2A9OA 3GBVA 3OM0A 1BVHA 2GKGA 3RVSA 1U2PA 2WWVD 3QLVA 1LBHA 5KQMA 4WZZA 3A0RB 1A04A 1JDNA 4RY8A 3EDCA 3OLYA 1OXBB 1TMYA 1S8NA 5JNUA 1BDJA 3Q7SA 1AB5A 1E6KA 3EULA 3HDGA 5TPWB 2CWDA 3LOPA 4RSMA 2NT3A 3OLZA 1DG9A 1DC7A 3CS3A 4EYQA 4JASB 4MR9A 2RDMA 3TO5A 2NZVG 2P9HA 1JFSA 1EWKA 4N0PA 1P8AA 4YR7A 2LIVA 1FFSA 3EQ2A 1Z2DA 3KTOA 1JH9A 3RVPA 2OQRA 3IDOA 2KYRA 1ABEA 1W9HA 5HSGA 1EHCA 3W9SA 3EODA 3KLOA 4MRMA 2V0NA 4G86A
chains in the Genus database with same CATH superfamily
2P4SA 3ZNQA 2BELA 1KFBB 2CGEA 3ND9A 2QUKA 4WOJA 1N5LA 5CVEA 1QP7A 4NZOA 3SLKA 4RS4A 2NYVA 3D3KA 1TW3A 2I6FA 2NLOA 3H6KA 4KIWA 4KOAA 5I48A 2OG1A 1EWVA 4XVHA 2NWQA 1TLFA 1OX4A 2VHYA 2X22A 2GYVA 2WUDA 3V33A 3OETA 5CNJA 2II6A 2OB2A 2R5WA 3INYA 3JD3A 4NFYA 1E0DA 4AL4A 1LI7A 4X3PA 4DHEA 3OX3A 1P77A 4QU5A 1SCNE 2YQZA 1R0YA 1C9MA 4FWBA 1SN7A 4L5BA 4PSDA 1DU4A 3B12A 4AQDA 3PJDA 3B36A 4EPYA 4B2PA 1EA5A 1YGYA 3KD2A 3VSAA 2NO4A 3IP6A 1CJTC 4MYRA 3O75A 2JGRA 4ZAYA 5TB5A 2QR2A 3GD7A 3LI2A 3VYVA 3DZBA 1TECE 3O4GA 2B20A 2R6ZA 2OVBA 4MA4A 4NMLA 5I6DA 4XR4A 1ORHA 1ZRSA 4RCYA 4N5MA 3DHYA 3RJ9A 3LBYA 3ROKA 1JB9A 1ZM9A 5KYWA 3CT6A 1DFHA 4Z53A 1Z6TA 3K0CC 3RVKA 1CG6A 4LSGA 5CJPA 1GG2A 2G8LA 3VYWA 3RC8A 3LT4A 2F3QA 3LVQE 1JDTA 4A8JC 1TIKA 1VLLA 4OREX 1R6XA 2ZYUX 1P17A 5LKRA 1FTYA 1UPFA 4B71A 4D0GA 1XZPA 4MB2A 3DR5A 1ZIYA 1SCIA 3LWNA 1ZIOA 3K1AA 4M83A 4BQNA 5ES4B 3QNWA 4DB2A 2RHBA 3OUZA 1PZXA 4NMXB 3W1EA 3PV0A 1SZCA 1WPQA 2Q9CA 4NJEB 3PX2A 1NN3A 4DWOA 3M34A 4RK0A 4B9EA 2JLRA 2OP0A 3QWIA 2XUPA 4H7KA 2OZPA 2BFAA 2YASA 3EQ8A 4RM3A 3RRZA 4C04A 4E5KA 3GRZA 1U4OA 1OMOA 4C06A 4C0AC 2QRPA 4OK5A 1OC2A 4EZBA 4WA8A 2XJ4A 3WSVA 1G98A 1BH6A 1GL3A 1HEYA 4NBRA 5TV2A 3DZIA 4UU8A 2C9OA 1GAEO 1V71A 3A7DA 5FPYA 3V80A 1YRQA 1Q17A 3NAMA 2G07A 1C9DB 1E77A 1KJJA 3OJLA 4J0GA 4GBED 4FEGA 3Q3EA 2H51A 2X0NA 2YTZA 4EHLA 3L04A 1KSFX 2F8LA 3P9ZA 5BWBA 4S12A 4IXNA 1MIOA 1B4DA 4ZVTA 1U81A 1K97A 3IELA 4NJMB 2JLWA 1HNNA 3I05A 4Y9DA 1E6LA 2JK0A 1L4MA 2XEXA 1FS5A 3B7GA 4LDJA 4RCZA 1IXKA 1E64A 1PU2A 2CHEA 3L7KA 4PG8A 2I67A 1H2EA 1JMYA 4HAXA 2IHTA 3I4FA 4QYIA 3VC1A 3ZUPA 5CB4B 1XTSA 2C4WA 3PQ6A 3WK5A 2WVGA 5FNVF 3P52A 5G0TA 4HRYA 1FXUA 5AVKA 1OJLA 5JTUA 2YQ5A 2KMLA 4QDTA 3WQBA 2BF4A 4YP7A 2G80A 1QANA 1LRJA 3DNMA 3GLUA 1TU4A 1Q16A 4HYEA 4EW2A 2OBBA 2OZLA 2Z08A 4FK8A 1GG8A 1UWCA 3RUHA 2QAGA 1N1MA 3UV3A 3ZHXA 1EXWA 1NNI1 4D7AA 1TQ6A 5TT0A 1RVV1 3FGPA 5AVYA 5IU6A 3PQ4A 2Z2YA 3KR0A 2DJ5A 3DOJA 1IBLB 1NBIA 1SBHA 3BTVA 4D8XA 2WIBA 4WCDA 2O8EB 2C4VA 4BCBA 1LDYA 3NPAA 4TMFA 4G97A 4R2WA 2VJNA 1QS0B 4RH1A 5JNWA 2NUBA 3ZCRA 1SNYA 4RXMA 3N8HA 3HXTA 3TOVA 2P5UA 3MTQA 1DO2A 2PT9A 4ENRA 2O5EA 3WICA 4CLRB 2QT0A 3FMIA 1NC1A 2BMEA 4QVKA 3UGJA 1JEEA 1PT5A 3RSQA 3EHDA 4YDHB 2O59A 3IBCA 3EMKA 2QT1A 3N0WA 4F0JA 4URYR 3F8WA 4RVOA 1MJGA 1PKEA 2VNJA 3GRYA 3ICCA 4IIVA 1R4MA 4YJKA 4LHVA 4XZ3A 5U4QA 1NUUA 3U62A 1LB1B 1T2EA 2I6GA 5HMLA 2Q62A 2OGUA 4ZVSA 5KNBD 4QBTA 4ZXPA 1B0AA 1JVNA 1PS9A 3PNKA 5DWDA 3FYSA 1VLQA 3OSZA 1UXKA 3FVRA 4TYMA 2DMRA 4ZVOA 3C7KA 4KE7A 3VNUA 1PQYA 5IJ0A 2GVZC 1WXFA 3Q12A 4GC9A 4QG3A 4NOJA 1AZWA 2ZYDA 3EZ6A 3R6GA 3WL6A 2HIGA 3B6ZA 4RA6A 1KFEB 3H65A 4PFSA 2ZKIA 3SQWA 3GJSA 3FDJA 4X45A 2MSKA 2X8BA 2YV1A 3BSSA 3H18A 5ICEA 4O8ZA 5GPBA 3T7JA 2J85A 4F04A 2VJMA 2XHEA 3NHYA 4K87A 5TS3A 4QKQA 1FZTA 3IE1A 1NU6A 3AIMA 2FF7A 4PFQA 4RH0A 1U1IA 5IARA 2QIPA 4MIKA 3PX3A 2HAEA 2JCSA 5FUBA 4RELA 4ZJYA 5EHXA 3WXBA 4EHKA 1UR5A 1CY4A 1P0FA 1KTVA 1C8LA 1HLDA 1O6GA 1XKLA 3D7SA 4GLFA 4C0WA 3KSMA 1MUUA 1Z5ZA 3EXG2 2O9JA 2V6IA 1IHXA 4Q24A 2VQDA 3PBKA 4G24A 3TTVA 5FUQA 4JCCA 1Z7YA 5JZOA 4O1HA 2LW7A 4W7SA 2GH1A 5FPKA 3ZDAA 5AHRA 4HN9A 5A1JA 3KETA 2K2QB 1GZ7A 3T54A 1NXXA 2A9QA 3PDWA 1NUQA 4J4TA 5FH9A 2KWIA 1V35A 5KQPA 2FQQA 5A5FA 4PSCA 1ISMA 2UVQA 1U9JA 1YFKA 2HTFA 2P2DA 1EU1A 4MNTA 1OGIA 3T1VA 1P4RA 1WXIA 2R6DA 2TMGA 1RSZA 3IVXA 5G40A 1P7WA 4MZXA 1S2DA 3CMCO 1QO0A 2W00A 1M5TA 4RDCA 1CZUA 1GP2A 4KBFA 1NVUQ 4JB2A 1A5SB 1AUPA 1VKOA 4BLPA 3LUKA 4QPJC 4TS3A 5IRCD 3QGMA 5JSZA 4L4UA 1NDHA 4NECA 1UADA 1ZEMA 3VZCA 2AK2A 4EUEA 4F9TA 2ARKA 1GPH1 1OB2A 4PHFA 2CV1A 1HYHA 3O3MB 2GM4A 3L05A 4BO5A 3WLSA 3AR3A 1TL7C 3E35A 3OC0A 4RKFA 2D0DA 4BO1A 1MDFA 3OFVA 4OHBA 1GL7A 4YACA 4BLVA 1MOQA 1TF7A 2Y93A 2Z4RA 4OJKA 3SVTA 4YJ2F 2OV4A 1NXOA 3VAYA 3W05A 5L4SA 3M5PA 4L8YA 4ZFNA 1KORA 1Q11A 5M5BA 3KP1A 1ZVVA 3ZHQA 3KLBA 3LO5A 1V7CA 4MPPA 1FEZA 2YWRA 3T9AA 2X9NA 4KWTA 3DO5A 1DG3A 4BU0A 4Y1EA 3LC2O 1MC8A 4JGBA 4BASA 4OUDB 2WA1A 1V96A 2QAGC 3CZRA 3RAJA 4A4DA 2HC9A 3BICA 4YUWA 1C9JA 4M21A 1T24A 3RANA 3IUYA 1N2GA 1IN7A 2Z2KA 3OUUA 2YHIA 4TGLA 2HU5A 1E3LA 1L8LA 4HDQB 1T6BY 3BD9A 4U7FA 4AWBA 2HSEA 3F97A 3K31A 3NORA 2UUAB 1YB2A 4MX8A 3U3ZA 4OQFA 4GH5A 1QF9A 2FJPA 2IYFA 2YMQA 1FCJA 1QLHA 2R8ZA 2YUIA 1ZKDA 1MPXA 3E3NA 4J49A 3X2SA 1EWQA 4GLLA 5SZKB 3UY4A 1J0AA 3DHEA 3KSBC 2QT9A 5HUQA 1TAHA 2BFOA 1B2RA 2COUA 1RMQA 1MO5A 4PZUA 4UEWA 3RDPA 1J70A 4MQEB 1XQ1A 3H1FA 1LQ2A 2ZZNA 3DKVA 3RR2A 4REQB 3Q9LA 1K5DA 2XNDA 1ZUNB 2IIVA 2JGDA 3OAAA 4L1KA 4WKCA 2XJ9A 5CK5A 1UJ2A 1YQWA 2CXUA 3HN6A 1RPZA 1Y1SA 1QO9A 3VKVA 3T52A 4AXBA 4KFRA 4RZIA 4LYHA 4LZOA 3JQEA 2FJ0A 3OFNA 4UUPA 4AG5A 3ENKA 2MU1A 2VTDA 3CZQA 2JI9A 4CLOA 2D5LA 2I4TA 4DV0B 1SXPA 1EHYA 4O2BB 1XMPA 3V7FA 4BO3A 1CJUC 2D8MA 2Q1WA 2OTCA 4OP1A 4P08A 2AR0A 2BGLA 3BD7A 4PQEA 4YJHA 3TLXA 2PS0A 1XHEA 2XX3A 1WHSB 4FIZA 1OPXA 2QW0X 4N0EA 3Q7PA 5JJKA 2IUEA 2YIDA 1GADO 3EFHA 5AJYA 4TMVA 5CNMA 4ZU3A 3TIGA 5AM2A 4DV4B 2WG1A 1RI3A 2YN0A 4QOIA 1RQXA 4IYRA 5F7ZA 1U04A 2W71A 2BGRA 3DF7A 1HQDA 1LVUA 4TKZA 2E4XA 2FWJA 4HTFA 4RJIA 4ZJUA 5JH7B 5LR6A 3W3AD 3ONDA 1K8XB 3QKWA 4HDRA 1YJCA 3T5BA 2NIPA 3AKYA 1P60A 1LEHA 2P0YA 2X0IA 3L6DA 4JBNA 1B15A 2VP6A 3OPYB 4RJJA 4RPHA 1Z6YA 4XI9A 5FLEX 3SJ7A 2I80A 3ZJYA 3IKMB 3NI2A 1QU3A 4GT1A 2H9AA 1XHLA 4R40A 1FXWF 3AT1A 1II8B 3ZHZA 3R6DA 1PV4A 4EYOA 4CTMA 5EN4A 1YRBA 3GDWA 3I76A 2TMYA 4H15A 3Q9SA 1GN8A 4FQ5A 1QIMA 1H3NA 4L8WB 3NASA 1M10A 1KMNA 4EGJA 1JEQA 3PD7A 1W4LA 4OM8A 1BWSA 2HMAA 3GEBA 4LOAA 1I9CA 1Q22A 2H59A 4KJXA 1OAOA 4G07A 3UAZA 1JHAA 5BVGA 5IF3A 2AUNA 4NU6A 2EIHA 2EF0A 3T5PA 3U44A 1H85A 3DMDA 1A4XA 4IOLA 4ALNA 2EGHA 4BRSA 5ALFA 3HUDA 3TGPA 2G4CA 2FJUA 5AK0A 3T1QA 3AW9A 1Y7LA 2ZBQA 4WI1A 5FHQA 3HSYA 4R5HA 3GEHA 1CZRA 3FPCA 3HRKA 3ZNOA 5I47A 1FNCA 3IEIA 3NXSA 4FCTA 3M83A 1ISPA 3IOEA 5A3JA 1T13A 2PSHA 1FRFS 3B89A 4JGGA 3KXKA 3PYMA 1Z0ZA 4XVRA 3WO0A 4AN4A 5LU9A 1BYUA 3ZE1B 1HPLA 2OCYC 2YZ2A 2B6NA 2OCKA 4FOPA 1BROA 5AKZA 3H5IA 1WDMA 4BZQA 5BORA 4LJRA 2XUGA 3T4EA 2VZLA 1JV2B 3MLAA 4QPCA 5SZHB 4FE3A 1PFVA 1FNNA 4HEA1 2EKQA 4Y0VA 3NTRA 4ZI5A 4C4ZA 5HUJA 1VPDA 5FX2A 1LVHA 4DLTA 2I4IA 3R3JA 2X4IA 4MV3A 2E0IA 3DDCA 2ZJOA 1WMAA 2OHXA 3EIUA 3GVIA 3KTAA 4UATA 3S5JA 3WQQA 3B53X 2ZJYA 4KACA 4LN1A 1ZL0A 1PR4A 2ZFUA 3S1AA 3SHFA 3PHHA 3OOHA 1ACJA 1I7QB 1QOQB 2NO0A 3DDNA 1RHRA 2ADOA 4XYGA 4FHZA 4F84A 2ZQZA 2V45A 2D00A 5K3BA 3Q8WA 2OOSA 2JD2A 3FRHA 1S2MA 3ABIA 3MJDA 4Q9KA 1JI0A 2DPLA 2WVAA 3IOCA 2HRQA 3VMFA 4CG0A 2CFIA 1TQ2A 1V8DA 4PAWA 4BMCA 1FNBA 2V6FA 2W22A 3UJAA 1E3SA 3L7YA 2JLVA 3WNQA 1YIAA 2IODA 4MLZA 5B53A 4EJSA 5JBQA 1J2YA 1ZU4A 2WT9A 1T5LA 2G5TA 5JECA 5AVVA 2D2EA 2PVSA 4NRDA 4EA6A 3DMFA 4F71A 1A95A 3WMWA 5BQXA 3KLNA 3U81A 3I2GA 4EHDA 4B3RB 4G2TA 3CH6A 2Q4EA 4BN4A 3WJ2A 2XW6A 2AN3A 1OWOA 1G59A 3LUHA 4PRYA 1T3HA 4CMHA 4OATA 1KDOA 3DBOB 3NOOA 1Z6AA 2HK8A 4CF3A 3JATA 1FSSA 3C5WP 4JYBA 1FS6A 3HN7A 3H11A 4YECA 5LA6B 3VX4A 1SQGA 4KK3A 3EEYA 4Y2XA 3CPJB 1W35A 3J81A 1JJIA 1DCKA 2GBPA 3LUDA 4PGFA 2OO7A 3DFZA 3SNKA 1TX4B 4HQ6A 4KPEC 4JVLA 4D4LA 2P11A 2W90A 3P2IA 1UPUA 4IGEA 4ZI7F 5BUSA 3UWPA 3B38A 2YH2A 5BUZA 4FYWA 2SNIE 2WJIA 1XALA 2XMSA 4K9OA 3RK4A 3A2KA 4GL4A 5K3SA 1KZHA 2WM3A 3DL0A 1J8VA 3BIXA 5IDXA 3HMQA 5HPYB 3QPBA 1GRQA 2COKA 3GIWA 4AURA 5TGTA 1CP2A 4BKPA 2XYHA 2EBWA 3ZY3A 1MB4A 1W46A 1YHNA 5L8VA 2HEGA 5KPJA 4XSVA 2PX0A 3KAPA 1ZN7A 1VIMA 4BNDB 3HTXA 1PWZA 2XCIA 1AB5A 4ARZB 1RHMA 1V7PC 3TMAA 8ATCA 5HBGA 4V38A 4WK6A 3K6RA 3VFDA 1N6OA 3FFAA 4X3OA 5TRTA 5AUOB 3SBEA 1P44A 3DMYA 4HP8A 1V16B 2QLJA 3N2KA 4UUMA 4MW0A 5LWHA 2RGGA 3DE6X 3U3JA 2JHPA 3AETB 3EOAI 1OAOC 4N0PA 5KIAA 3AFMA 4D9KA 3BA6A 3GJZA 1GFWA 1A5TA 3KJFA 1FUUA 5LB2A 1DUVG 1XGKA 5K1ZA 3AESA 4YXWA 1BEZA 2ZVJA 1HYBA 1Q0PA 4JT2A 1U0FA 2WFLA 1PUIA 3VR5A 2G1UA 2E9SA 1PR2A 1QCCA 3HYNA 4RH3A 4JQYA 3QFTA 3OM8A 3EE6A 1IATA 3FVWA 1L4UA 2I8CA 4JLMA 1UDWA 2V58A 4ER3A 3HCAA 1CQZA 4UAJA 2PGIA 2H3EA 2MSEB 2WZDA 1EDZA 2Q6IA 3BK1A 1GA1A 1ODIA 1KP9A 2O52A 3GQVA 4GC5A 1V5FA 5ERYA 3WL5A 1T6NA 5C8YB 1EG7A 4U00A 1JKIA 1GZSA 2GILA 1NVDA 3HMKA 5AVSA 2ZPUA 1BQ4A 3CPEA 4ZYWA 3G1TA 3LP8A 4TSFA 1RBYA 2QRQA 1JLKA 4L5JA 5IKXA 3HR8A 1BFDA 3NT5A 3A1DA 3VI3B 5AXDA 3JQDA 3OE1A 2IEAA 1Z4PX 1IPFA 2WU4A 1Q1EA 2YYAA 3Q41A 4N5IX 4YR9A 1X9IA 5B5SA 5AHOA 2BONA 2ILVA 4R41A 2PUCA 2AI2A 5JISA 2QBYA 2BISA 2Z1NA 4G8JA 3MQ4A 1BCSB 2XRYA 2C4NA 4A2PA 3GJ0A 1TKAA 2ECOA 3SGLA 1V5EA 2Q41A 2J5XA 3HVUA 1G3MA 4L4ZA 4ISBA 4F21A 4LKOA 1AKQA 2QVCA 4J94A 3AYXB 3DS8A 1JG3A 3WJAA 2PZEA 4Y6GB 5GQSA 1R4NB 5FL3A 5JD3A 4Y1RA 1VKJA 5GWXA 4JEMA 3G2PA 4EMUA 1Z9BA 1QHXA 1YCHA 1JHMA 3CZ9A 4EJSC 5A0VA 1T91A 2GPYA 3C87A 2VJOA 3QVGB 3T9DA 4MW7A 4C2UA 2NZUG 1NWCA 3V8RA 1YQXA 2QGNA 1UCFA 3JQ7B 5HA5A 1ECGA 3C70A 4L3VA 3UJDA 1BE0A 3TVYA 2ZAIA 2A1TS 1X15A 1CLUA 1THZA 3QZUA 4M6WA 1FJXA 4YJFB 2F8TA 1ABFA 4BWGA 3A06A 4UE3S 3I2KA 2YXBA 2BFBA 4E07A 4CM5A 1M1NB 1OTYA 2YN2A 5JNLA 4EY3A 5TLSA 1EQUA 1LBIA 3L6CA 1S01A 2A94A 1F2UA 4NBLA 1BC5A 3RIHA 3C7AA 1VZ3A 1R6VA 3FBWA 2QMHA 3WFJA 3JQPA 1VDMA 3MXTA 4U6SA 3S3TA 4NFLA 5BQ5A 3ABQB 1NVWQ 3VYSB 1Z07A 4DZZA 5AUPB 1EDBA 4N3NA 2B9VA 2W0SA 1JEJA 1OPRA 3FMFA 3PX7A 2ZKLA 4PZYA 5A7FA 3X43A 3G17A 4YRDA 1QHHB 3IMCA 4LY3A 3MN1A 1G4UR 2W0MA 2YS7A 1G6OA 2YCLA 4CMKA 4HSEA 1Z22A 5JWRA 2XGOA 3SSNA 5C81A 4UZFA 4KDFA 1SXJB 2Y67A 4YAEA 1NQOA 5I7FA 2NU9B 2XNSA 3HM9A 4G09A 2JHAA 1HI9A 4M1TA 4LWOA 5IBQA 5B30A 4TV8A 5EIBC 5CTJA 1YCFA 4W8GA 1U8UA 3V1UA 3VU1A 1EFPB 2I6SA 2C7VA 3O2NA 1EEHA 3LKVA 4XTRA 3RSZA 1OREA 4IIEA 3CX4A 3WP1B 4ZOQI 5A5GA 1EUQA 1VMIA 1GL9B 5GINE 1U2GA 1NJFA 2X5KO 3MJCA 1QCDA 4ENPA 3S81A 2ORIA 1A8SA 1ZOOA 3H9EO 1QQ6A 3BMNA 3AI2A 5K05A 3QM1A 3D6UA 1VPTA 3V97A 1Z39A 2H5JA 3PUXA 1TO1E 3PUJA 3PFKA 1T1GA 4FNGA 4NNOA 3WKAA 5J3JA 3WLFA 3SNHA 4OXNA 3FPHA 3G0GA 1F1JA 1XRMA 4UHDA 1HTBA 2MR6A 3I6YA 3H8JA 4E0BA 5TDHA 5L45A 2RK3A 3TN7A 3VI4B 4F2GA 1H9BA 1ZD3A 5CMLA 3S68A 2Q3MA 1G9SA 4NEGA 3ZCTA 4RD1A 1F0PA 1XA4A 4WACA 4ENUA 4L5CA 2Q7OE 4P7KA 4PIMA 2TMKA 1Y89A 1KL7A 3FSGA 2HN9A 1XU9A 4U6QA 4LJYA 5CW1A 4IIUA 4YP9A 4HWRA 4FOSA 2NXNA 3GO4A 3CY6A 3FIJA 2QL9A 3HA7A 1XRSB 1ZD1A 3LP5A 3ZBUA 2NYAA 3D9QX 1GN9A 3IQIX 5DE3A 5HQJA 3VAZA 1K5PA 1TK2A 2RIPA 4HCJA 2XOKD 4HUJA 1TA9A 3KRTA 2YXNA 5DYNA 4MIOA 4YPFA 2EKPA 3BRSA 3M3PA 3ZTWA 4A5SA 3AVUA 1ISJA 3H2KA 3R3VA 4AJ4A 3BBPA 4D5GA 4RD4A 4L4XA 1IHDA 4FQ8A 4LY0A 4A82A 1K0UA 3WAKA 1WPRA 2JZNA 1JDBC 2GO7A 1WXXA 2ZIVB 3VRHA 3FTEA 2DHCA 4CM6A 2E21A 4L72A 1NL3A 1EZZA 3UPTA 1MZPA 5JRDS 1JZQA 4RY2A 3F2IA 3DULA 3TK1A 1XC7A 4B6FA 2PUGA 2XR1A 5EZYB 4BLOA 2XVXA 2X5OA 3JV7A 2Z9BA 2QUHA 5KKCA 2I5PO 2RHGB 3A11A 4FUQA 5DX8A 1DRVA 1ETUA 3U0VA 3IBGA 3WL4A 1Y98A 4TUYB 4K6KA 1Z3CA 4PS0A 3OP4A 1EM8A 2PZMA 3N5KA 3EVZA 2OESA 4YC7A 4N3BA 1KVRA 2QMYA 2QE6A 2EBFX 2QZ9A 1E1RA 2GJKA 3NRBA 3N0XA 4QO8A 4TLDA 4BRZA 1P0QA 5LXTA 4KSCA 3ITDA 1CZKA 1L1RA 3IUQA 3AY7A 1Q92A 3DPSA 3UUGA 3LOQA 1OLUA 5D2CA 3O3OB 4EF6A 4YJ3A 4FSXA 2XNHA 4K46A 1JN0A 2FUG6 3C3JA 3CNQS 3ICQB 2PD4A 2HCFA 2C96A 4UBKA 4RD0A 2GCOA 3TNLA 4MS3B 3W0LB 3AZQA 1OGJA 3TD6A 2CVQA 4GX2A 3E9ZA 3LKDA 3EFOB 3MWKA 3OHMA 4UD2A 5K0LA 1UBJS 4F2WA 4JI3B 3RS8A 5BWCA 4ESVA 3PNPA 4PZZA 1QYCA 5IN5A 2I7DA 4W1RA 3C5EA 2FG7C 4Q1FA 4HB2A 3FTDA 3TLYA 4ZV9A 3TH5A 2JLZA 2CJYA 2HV8A 1O96B 2O2IA 2YHBA 1W0KD 3ID6C 2SICE 3T9EA 2EZTA 3RODA 3WMFA 4D74A 2WU3A 4O2RA 5KQLA 1HQYE 2YICA 4L28A 4M9QA 5C46F 4HEHA 4KV9A 4IPTA 1YOBA 1B1CA 4J7UA 4L22A 2XQIA 2JIZA 2I55A 2QXUA 3DWEX 3GFGA 1DP4A 2PTGA 1V5GA 2HGSA 4OYRA 1Z7EA 3QK7A 1A82A 1RI2A 2HW8A 1E1YA 3LM8A 5FTNA 2BGJA 3JQBA 2V9CA 5AJTA 3IUPA 4H1VA 1U2GC 3TAUA 3KDSE 2V03A 2NNWB 3QXHA 4D8UA 4DIDA 2BHTA 3S44A 4YT8A 2CCGA 2F3TA 4QREA 3FYUC 2FSPA 2Z56A 3UJBA 1XDUA 4C08A 3R2JA 1ZH2A 4JX9A 4XE5A 3OUTA 2W43A 3R7BA 2I22A 1A98A 2R66A 4TXLA 5E1BA 5DK4A 5CFQA 1LSSA 1DAEA 2YINC 3RVOA 2O8CA 3FETA 1T0HB 2I3ZA 5C4IA 3THSA 4MXDA 1G55A 2YMPA 5EGNA 5FPQA 1FYFA 3UK6A 2CXPA 1GDDA 2BR4A 2FW0A 2JAWA 2P3LA 2PS9A 3NHUA 4GOXA 4R8LA 1XNRB 1KOGA 3C8DA 1SCQA 3LC0A 3BFVA 4FD2A 1WTAA 3A1CA 4RL6A 3MC1A 4RIEA 1QVRA 4TS9A 2IHNA 4HQNA 4J7AA 4AW9A 3OQBA 1GU0A 1M2VB 3JYQA 3VOTA 3JAWB 1YASA 1ZNYA 1QDEA 2GXQA 3F67A 1YDHA 4JB8A 4N82A 2PX3A 3P7MA 4JJIA 4JP3A 3P4XA 4MW9A 3PKJA 4CDNA 2WM8A 2H4YA 2W8BA 3AILA 4PWYA 1JDPA 5AXBA 2EFYA 4MR8A 4TV8F 3ZQ4A 2JCVA 3GAFA 1JHYA 3IQWA 5DDIP 5FPTA 3SX0A 5D3MA 2YZMA 5CA1A 4YEDA 4R1SA 1KDZA 1UPCA 2C8VA 4BMSA 1RBQA 2MSLA 4Q66C 5HRAA 4YCDA 3FNBA 4M0UA 5LB4A 3PHBE 3AV3A 1P72A 3G2NA 4M1KA 5L4LA 1F38A 4YVFA 1EK2A 2Z98A 1V9LA 2R84A 5EHIA 2KHZA 4N18A 2EQAA 2MYPA 3F74A 4MW6A 3IEKA 5DT9A 4NZ9A 3ZZ1A 3NOXA 3RO7A 4HWOA 3G88A 5FWAA 3U49A 3IBFA 1UBLS 1IFXA 3JVVA 1CJMA 3DOOA 3STYA 4FFRA 4WA7A 3RYCB 1F2VA 3I5MA 1A77A 3Q8MA 3STHA 4X9XA 2HBYA 2HY7A 1QH1B 1ZGBA 2PWYA 2VAMA 1SUPA 1SGWA 3O4JA 3HXPA 3UCXA 4ZKEA 3ZYZA 5EJ7A 1URPA 2GPWA 4J8PA 5EKTA 2YWGA 2QGFA 5LVAA 4D4KA 2PG3A 5DTRA 4HXFB 1UXIA 4Q15A 3D31A 5F1OA 2Y68A 3PGXA 1CUWA 3Q88A 1A1SA 4K0RA 3VVMA 2N1MA 2PX5A 4N48A 6NULA 5FNVB 2WF9A 2JLAA 5ENZA 3UT0A 1SU7A 1KR5A 2QNBA 2C2WA 4R05A 3U3OA 3NBXX 3CLKA 1J1ZA 1ZXXA 3QUBA 1JYSA 4AP9A 3BHIA 3AJ9A 3RPEA 1UEIA 3I23A 3K2EA 3ULKA 4ZT3A 1DWPA 1TLLA 3MGKA 1ZGHA 4DW8A 4LSWA 2H2GA 4Q4LA 1A9PA 2EGUA 3A3OA 4KPUA 1L7XA 1GJRA 5JS2A 2RHOA 1CY6A 1G0NA 1P0IA 2GHRA 1FC0A 2X8WA 1JZTA 3CVOA 1EE9A 2FPSA 3M6IA 4JGIA 3AYZB 2AE2A 3PE4A 1Z0AA 3ILHA 3QJYA 1AVTA 5FOXA 4YUXA 3TZHA 3BFPA 1YRLA 1XNHA 3V1LA 3AHDA 3HCRA 4DWJA 2HB6A 1V1JA 3ZVRA 4QUEA 4Z7JA 4M9ZA 2XB9A 3USES 3VZBA 4CQMB 4NHOA 4UUQA 1R8JA 1G3QA 4JC5A 4EHBA 1E9RA 1EVLA 4MKFA 2B61A 4ZVMA 5DXFA 3IT0A 4HKTA 3TZCA 4KMOA 3SXUB 1GNVA 2JGLA 2C9CA 3GFOA 3KWMA 4KE9A 4DLPA 1XI2A 1TMGE 4U2EA 3WGLA 4QOJA 3JQBC 1SZDA 1FFGA 3CRRA 4EF5A 2CEAA 3GNQA 1A96A 1BS1A 1NI4A 2ZJAA 4LF6B 2QMEA 4MW1A 4Q4HB 1BW9A 4DIKA 2RAPA 3NWEA 3RFUA 1H5QA 1VRCA 3C74A 1MV8A 4OBXA 2ZDQA 1HO3A 3DMPA 4JJEA 5LXTF 3SJBA 3MTIA 5GVSA 1JKMA 3PP8A 4HNQA 2H2WA 3L7AA 1RLIA 4ZO8A 5AQ1A 5JD6A 3UO8B 2DFPA 3IQEA 3ZU3A 3DVLA 3JVDA 3K9LA 4BLSA 3TVDA 2CJWA 2ETXA 1W34A 3SQDA 1F7VA 1MB0A 2YN4A 3IGFA 2D1YA 2HYDA 4MWSA 3ZZNA 1BCRA 1CUFA 1N0WA 4INJA 1BKDR 5J4VA 2WDPA 1B8PA 3PNMA 4MQBA 3BMQA 2VRBA 4A73A 1J00A 4DDVA 1U8ZA 1WDLA 2O3JA 1YONA 4MV9A 1V0JA 2ZTHA 3KS9A 3A2LA 1Y6FA 2YZGA 3RVBA 1PEAA 5HS4A 3D8UA 3PLNA 3R8FA 4QD3A 1HURA 1Q0QA 1OBFO 1VP3A 1TM1E 2AI3A 2P41A 2X23A 4KV7A 4R1LA 3IUJA 5CM2Z 2VP0A 4CMCA 4LOHA 4FLFA 2AI1A 3T3NA 1SQ6A 1VKRA 1FJHA 4QTZA 4QG7A 3GY0A 1JJBA 3VYTB 4Q7LA 2JPDA 3QELB 4A0RA 3B6KA 1I24A 1WCIA 2KI5A 2NTEA 2CLIB 2VYQA 5DASA 3ROGA 3ZHOA 4DUGA 3U7HB 3SJZA 1UFKA 2W6OA 4BVGA 5IYZA 3TSZA 4MA5A 5J4KA 5KNCH 4KGVA 1JDNA 1P4AA 3NC0C 1W36D 4LVOA 5KTOA 2PANA 3E53A 2FSVA 2QX9A 2GD2A 3EA0A 4AMVA 5C4MA 5F1KA 4RFSB 4M76B 4TL9A 4X5OA 5C37A 4W8OA 3W8RA 3T9BA 4HSGA 3KQYA 1T25A 1TRHA 1T2AA 3L41A 4OYLA 5LMUB 3VO1A 2WAYA 2XGJA 1UBGA 4XIGS 1EYZA 4EUNA 2Z95A 2W6ZA 4AQYB 1YZ3A 3RC7A 4E46A 2IS4A 4HGPA 1LDGA 1QFSA 2QJFA 5CLGA 3RLIA 4BWFB 1OVMA 1T29A 1JH9A 1SJ9A 4WBXC 5CTAA 3ZZUA 2Y2UA 2VA8A 1W9HA 2JA1A 4B6GA 1RMTA 4C3UA 4DCTA 1IQUA 1HDEA 4JJZA 3Q7IA 2IGTA 5M34A 3EZ7A 3BXGA 1VMKA 1WUYA 2DBQA 4HF7A 3D6MA 5BMOA 6PFKA 2MJLA 3LOUA 1PBNA 5BNZA 3E8XA 4OOEA 3LHIA 4OHRA 4Y9TA 3NQ41 3BGDA 4XH9B 2OD7A 4RJLA 2GMWA 1KKUA 4XLLA 1R0BA 3M2TA 3TSOA 3V4ZA 2H65A 4BJ3A 4Z99A 4B4KA 1ZISA 4LXIA 2CYBA 5I01A 4G5OA 4CXMA 2ZS9A 3ADBA 2PS1A 2X6RA 3DLCA 3OC6A 4JLDA 5LZ5A 1P9LA 3OKFA 5FFFA 5MHTA 3PXDA 3N2EA 4CV2A 2Z2JA 1KI7A 1XPUA 2DUUA 1P61B 1REQA 5TQ0A 3WWOA 4MYSA 3NOQA 3P2EA 2ZEJA 1LBSA 1Z0DA 1V6AA 1O95D 2CLCX 2HUNA 4RAQA 3LBHA 3RS7A 4TVKA 1NMEA 1VCOA 5JCPA 5K8IA 4BEWA 2AE1A 1K4MA 4UNQA 2ID7A 2ONZA 3EARA 4U2FA 5KYXB 2OILA 3DT9A 3DEJA 3RG8A 1ND6A 2GGSA 2XBLA 1GT6A 2C0PA 3CGWA 5TNXA 4JLOA 4M9UA 1QG2A 3TQRA 4ZQEA 3KQVA 2PL9A 3NR2A 1R0KA 3GWZA 2RH9B 2WILA 4DVJA 1EK1A 1RYNA 4G9BA 4YQZA 5C7OO 3MTDA 4FUTA 4R81A 3UT6A 2R2AA 2XUFA 3UQYS 2IOHA 4B6EA 1T3TA 2BM8A 1T2FA 3EVNA 2E5LB 2Z43A 1WQ3A 4ETIA 4YCLA 2W4IA 4LG1A 2AWNA 3H9GA 1UQTA 2ZYWX 4BNYA 4YONB 3EEBA 4BFLA 6CHYA 4O1MA 2Q29A 3DL7A 3DC7A 4ZEOA 3NDBB 3CZPA 4JMPA 4QFCA 3SU8A 4TYPA 2BDUA 3GFRA 1YB5A 3R9IA 621PA 3HEBA 5EXPA 3E7WA 3GEMA 3HWRA 5H83A 2AN5A 1PT9A 4O0MA 1QMGA 3VDRA 4LYEA 4O5AA 4KYIB 1V8OA 4IDEA 3W78A 1P7ZA 1NW7A 2GTHA 3HI6A 5ELLA 1M9NA 3TUZC 1QQ7A 1KDPA 1PJCA 2PS3A 3HXKA 1G0OA 4X7PA 2H92A 3CRMA 3EF1A 4R31A 4B87A 1LVGA 4RHYA 1CUBA 5I5GA 1VJ1A 5CNIA 2ONJA 3ZCPA 3KKOA 1FFBA 1IZZA 1NZDA 3F9RA 2CT8A 3I4CA 1X1AA 2PXAA 2ABWA 2J0QA 1QV9A 4RLSA 1Z8DA 5KYTA 2PWZA 1CV2A 2J08A 1KJIA 1P7PA 3ZW9A 5HZGA 5HBRA 2PRSA 1QVWA 5LOVF 1S3SA 4MV4A 4J90A 5DBFA 5IZCC 2GO1A 5M3BA 3QFRA 3FI9A 3JQGA 3R4CA 2O4UX 3BJZA 4PYNA 5BSEA 1N5DA 2FSVC 1T9GS 3BEOA 4GYJA 4F6CA 1ZSVA 2I2XB 3BTOA 3RT1A 2BKXA 2P9FA 2GCNA 4TKLA 4C7BA 1T3SA 3P45A 3DONA 2HSDA 5EMHA 3R23A 4UUNA 3QXJA 3QW4B 1ZRMA 3QFHA 2L42A 4CKEB 1JQ3A 2AHRA 2CB0A 3I2HA 2V9PA 2J4FA 3EG9A 2OENG 4B81A 4WKNA 3BGIA 3QUQA 2JH9A 1EX1A 1ATIA 1DX4A 1KAQA 3H2GA 3U19A 2FP4B 1VA5A 1DC3A 1L8QA 2PR2A 2XDQB 4G0YA 2EF1A 1FTGA 1G8SA 4A8JB 1VJGA 3B1KA 1AF7A 1AGXA 3KXPA 3EW7A 2QVXX 2QYHA 4B8WA 3ZJVA 5BW4A 1CF9A 2R1VB 2Q1YA 3T0FA 1AOXA 2OHGA 3KKEA 2ZIWB 4L3WA 3QVOA 1J99A 5D51S 3V4LA 3OCZA 4P54A 4QXAA 4OFXA 1G5PA 4O08A 4XIFA 2J32A 1D1QA 1T9HA 2QRVA 3A9UA 3ZGXA 1Y1RA 4I2NA 1AV6A 3D3NA 3HUEA 5TY0A 4LTDA 4P4NA 1VB5A 1YL7A 3T7EA 1SCKA 2IZ6A 4B6SA 3PHCA 4O4JF 4RS3A 3CVWA 2FDXA 4PXAA 4AJLA 3A70A 2MMCA 4KLNA 3V4VB 1L7NA 2TS1A 1RJGA 5THKA 1CJBA 4K28A 1RLTA 2PUVA 2Q3EA 4UCXA 3FDIA 5CVTA 4Q3CA 1E2HA 1CIVA 2JIQA 2OK7A 4C4OA 3ICEA 3LNTA 4ZCIA 1P4GA 4CM7A 3QA9A 3N76A 5IYZF 3T9CA 5K3AA 3PQFA 3OCJA 4GOLD 1X9GA 1ZP6A 4XA8A 4XB2A 3RGWS 5G4KB 1BX3A 1PJZA 3OLQA 3PENA 3B5IA 4UBJA 1H2AS 1WB9A 1W19A 2BSXA 3IC5A 1SKAA 2E1RA 5EERA 3ICWA 4PAQA 4F4DA 2C8JA 4Q6WA 4ND5A 1HLPA 1UBFA 1C1YA 2ROQA 3JQ9C 4I1VA 4F3TA 2ZWIA 5LCXA 2W2LA 2DWCA 1UJNA 3W6PA 4F2HA 3MT8A 1XVVA 4F12A 4H1TA 4YV0A 3DOCA 1YVUA 4L8LA 3G2JA 1C3LA 1CIPA 1CUHA 4KO8A 4L0DA 2YC4C 1G7CA 3DHNA 2FKNA 1ZUIA 2B2XA 1RQ2A 3IULA 2AYZA 4FFBB 4FCCA 3SYLA 5BUQA 3RREA 2KBFA 4BX2A 2G36A 3L84A 5KTKA 3QVLA 1BEEA 1I7NA 3WO1A 3WWPA 1GVNB 4R2XA 2QG4A 3WGJA 3WHIA 5M7EA 4KWHA 1KAEA 3OU2A 4JP5A 3ZGYA 1I4DD 5AM4A 3M3DA 1LRKA 5AJXA 4IVQA 5SZIA 1R5NA 3WK8A 1BQEA 3K0EA 3RRBA 2J9FA 5BR7A 4QDJA 3QWAA 4L8GA 3NEJA 3EYWA 2JNWA 1PF7E 3E2PA 3HY4A 1R2QA 2Y0CA 3EVDA 1XE3A 2C58A 2L0XA 1BE1A 4KNWA 5JCJA 4L74A 4YMTA 5B4TA 1FDOA 1IQ0A 5DHAA 3S2FA 2PUAA 1MHTA 3BDIA 4JA2A 4X20A 3ETDA 1UBMS 5T7BA 3SD7A 1VE7A 4UKDA 1BDIA 1UXGA 2IELA 1XTVA 1P80A 3QIAA 4GI7A 3AR9A 3ZHVA 5IKEA 3IAS6 4O4IA 5KSZA 1MN6A 3HXLA 1EHIA 3LT0A 4JA0A 5IULC 3AV0B 1OX4B 4B3BA 1DAKA 2AOTA 1W30A 2CNWA 4KYUA 1SMKA 2YWJA 4CTOA 1NVAA 1TYCA 2FGKA 2WG2A 2VCEA 2YNMD 3N05A 1OA0A 4L4SA 1OLOA 1PQPA 1EA7A 5EVCA 3H6GA 5DNWA 2PRYA 4ENTA 1FLNA 1WXWA 1KO8A 1NYQA 1OD6A 2J8ZA 1J2TA 2O5VA 3KM0A 1DZ3A 2CYCA 2EFGA 4QUHA 3U9SA 1HETA 3ZNNA 4XVUA 3OQMA 2OOKA 3F4LA 4BVLA 4CT0A 1XRQA 3HKEA 4QUDA 1O3YA 5DSXA 2A1UA 1S96A 4N5NA 4JC8A 2VHEA 4QDUA 5DBIA 3W5CA 1I4TD 2Y2VA 3LXRA 4GX1A 4RFLA 1UAGA 4E2ZA 3HPQA 4EYSA 2R8YA 1KAGA 1WPXA 5KYWB 3LBAA 1GSAA 1F4PA 2VWGA 2Z0MA 2AZMA 1KGSA 1Z2NX 2O0LA 3C3YA 2PXHA 3QLEA 1O97D 4MPTA 3LX6A 4B0PA 3LDHA 3FGZA 3WKEA 4ZVNA 3JQAA 4EARA 3TR5A 2OKCA 4DMUB 1KK2A 1JP7A 4RQUA 1KK3A 2B99A 3K1AB 2PXCA 4II7A 3VPHA 1HQCA 1M72A 3VHXA 2BGIA 1EGHA 3KPWA 3L8HA 4HYTA 1HL3A 1HK7A 1HRDA 1CNFA 1TQDA 1CUGA 2FFHA 3BDAA 1HGXA 4F8JA 4XSHA 1RHQA 1FFCA 1D6MA 1JBQA 1TJYA 3GRRA 3GZTB 2ZRKA 4CCAA 1I4LD 4R4JA 3TKYA 4RQAA 3VH1A 5JXGA 2J5BA 5SICE 2N42A 4LOLA 5P21A 2QTLA 5KEIA 4MKRA 1H66A 1NZFA 5JJIA 2J7KA 3ADKA 4MVJH 4I5IA 1TUBA 2VSYA 4WBNF 3DVQX 4X63A 1E7YA 1Y48E 4Y2YA 1YZKA 4ISCA 2GK3A 1H6AA 1AK1A 1WAMA 2J4DA 1PE0A 2IA5A 2I3AA 3FSRA 3GXBA 1C3EA 1HV8A 1MIOB 2ZUDA 2B1GA 3B8HA 4X61A 4ZOCA 3LUPA 4F4JA 4YCMA 8AT1A 1Y9DA 3O1LA 2Q3JA 1LW6E 2X2OA 5JUWA 1LSUA 4HQFA 3A4MA 5CYOA 1YULA 4KYVA 4G63A 4C4XA 2C0CA 4KXUA 1SOVA 4QYIB 4RHTA 4V0RA 3UBMA 3EZGA 2GZSA 1AN9A 4FGKA 3RRMA 4FEAA 1NXVA 2EWVA 1B0PA 4LHZA 4MJ7A 4LX0A 1YWGO 2IW1A 2XCQA 3PNOA 1QNFA 4HQKA 1WVIA 4M3NA 1BA2A 5LBIA 3TCKA 1ZI6A 3BXPA 2OZLB 3I6ZA 1JFLA 1I5EA 3I1FA 3NWPA 2QAGB 1R3UA 2VHZA 3DLAA 4XRGA 3WGKA 1SY7A 1KNQA 1N5KA 2ZJ4A 2ZLBA 3DT6A 5ESWA 3PD0A 3SIXA 2B0CA 3DE1X 4CF4A 3OZBA 2ID9A 1S3GA 2VDKB 3AEYA 3Q4GA 3TS1A 3FG9A 4TLMB 4LF8B 1VGQA 1DCMA 3H9CA 3MM4A 3QVWA 1IN8A 1EBFA 3I0MA 3A9RA 5E3HA 5DGDA 4OHCA 1WW3A 3FPKA 5EJEA 1QIGA 2X15A 2IOYA 5F64A 4UOZA 1JYEA 2FYTA 2ZJ2A 1IIBA 2O3UA 4HXEB 5IPFA 4HX2A 4DZRA 1RJWA 1T8PA 1UC9A 2ZYTX 4DBVO 2AMVA 4GKJB 4HRAA 1NIPA 2IYRA 1R4MB 2GLTA 4YMVA 3FPGA 1KPGA 1EXVA 4BFZA 3MILA 3INNA 1UM9A 4B2IA 4AUEA 4YPVA 5ADVA 2NTNA 2ZGVA 2W6JA 3DM5A 4QM6A 1OH6A 4Y1GA 5AHXA 4C0JA 2OHIA 3GMSA 4S35A 2P9JA 5IJ0B 5BP7A 3HB1A 4FB4A 1P4SA 5AI9A 1GWNA 2Q4DA 4J7CA 4PZAA 1ZA2A 4RA6B 3UK2A 4KJZA 4BMZA 4CEJA 1XDGA 4H59A 4J4HA 1TUGA 1E7QA 3B60A 5B4UA 4PSVA 3LQFA 3K8ZA 4ZAWA 4HNVA 2ZBRA 2B35A 2VJMB 2BBSA 5JAPA 1ABBA 4CEIA 2ZSDA 5CH5A 4V39A 4NIMA 1NPYA 2GN0A 2VT6A 4BPRA 3KVVA 3EH2A 3GPCA 5ALQA 4Q9LA 2F62A 3RUEA 2HA4A 2JVJA 1WZCA 5EXXA 1PJTA 4X0EA 5IKOA 2XUHA 3K9WA 5J63A 4N01A 5DBEX 4ZQFA 4OB6A 1MKYA 1HDCA 1UK6A 1PL8A 2C9MA 3DFKA 1ANKA 2QTFA 3D6NB 3FUTA 3EA5A 3IIIA 3CZ5A 3CRQA 4JVMA 4HGZA 4LV5B 5G2OA 1J09A 3MRTA 3VU9A 1VPVA 2C29D 4B35A 5EHQA 3UHOA 4INAA 4R2MA 2ZI3A 4WSOA 4TQ9A 2R8BA 3OCXA 5JO9A 3LFUA 3IB3A 4CMIA 5DH9A 1HE8B 3O8NA 2A5DA 1U8FO 1I0ZA 2D7JA 3CH4B 4YCAA 4G5QA 3ZI7A 5KVVA 3BHJA 2C2KA 3KAKA 4FP9A 3OPXA 4QTYA 2P1RA 3GF4A 5EXEA 5CDYA 2WAMA 4OK3A 2FF5A 5DX1A 4FM9A 3K5HA 1DB3A 2NV2B 2OQVA 2WJAA 1T8RA 1GUFA 1T8WA 4KWIA 1QO7A 4KR2A 2PUJA 1C7FA 3K1YA 3KBOA 4M86A 3OCYA 4W1PA 2VHXA 3WL8A 1C7JA 1EXMA 1RE0A 2O2YA 1K89A 4JNCA 3W79A 5I4BA 2DLDA 5JSZB 4NX2A 1K9SA 2I78A 4IYJA 4ND3A 2CUTA 3V3KA 2C00A 5A5VA 2VEOA 1AKVA 5K0GA 3P2OA 3VH4A 5JI3E 2GJ9A 3C6ZA 1BGWA 5G0WA 3WMRA 4DFDA 3MJRA 4U7PB 1HDOA 1A1VA 2ZB8A 1Y4UA 4NKRA 4B76A 3AP3A 3TE6A 5K8LA 1GHTA 3GBVA 2CXXA 3IVMA 4E88A 1NVBA 1MF7A 1VE1A 3JQRA 3M4ZA 3HNRA 3U31A 1OWLA 2ALJA 5H70A 5AK4A 3TTWA 5LQRA 2XQJA 1TYAE 4LCJA 4QATA 4NBKA 4OHWA 5DXAA 4R98A 3MT0A 3MOGA 1W8DA 3CX8A 1TMYA 2CF6A 4BTEA 2OGTA 2IWRA 4P31A 2PFGA 4FGLA 2G1KA 3HDGA 3DTVA 3P4YA 4TT3D 2CWDA 1UMDA 5HIAA 2YHIB 2D54A 3OIGA 4PZPA 4JLBA 4RMNA 2FOXA 4DLKA 5DM0A 5D1HA 5JQWA 4LHXA 1FFDA 1EZ1A 1M1XB 4BJ1A 2ERCA 4YR7A 3MW8A 2D62A 1EX6A 1VCNA 2G83A 3REFA 2ZS7A 3JVUA 1QZXA 3HPRA 1K4YA 5ALVA 3PQ2A 3DCJA 3UK7A 3BULA 3CIFA 3P0IA 5A05A 2ZRAA 1BOFA 2IITA 2JIDA 2JGDB 1ZIDA 3QI2A 5A3RA 2W5UA 3M89A 1N25A 2P40A 2VF4X 3CR3C 3TW0A 3WL7A 3WWZA 2P3QA 2CJFA 2EDAA 3F0TA 3TQIA 1XVIA 3DZKA 3TRHA 1W25A 1J0BA 1RZRA 4G9EA 1QP4A 2LE0A 4CLOB 4PF1A 2WIGA 3KEQA 2PMEA 1XNJA 4D9FA 3DD5A 4LGMA 4B3SB 5DM1A 4BX0A 2X4DA 1JIQA 1ESDA 3MWDA 3O8QA 3UWKA 1TGVA 2B4TO 3AEKA 3FYHA 4YJHB 1HKHA 1LJ8A 3W2HA 4EMBA 3PXXA 3NT4A 1I2MA 3U48A 5HZMA 3NAQA 5BYKA 1FX0A 4FIDA 5JI2E 2C3YA 4GZ3A 1U9ZA 2Q0QA 3H3FA 2XSZD 1OYOA 5DW3A 3SBDA 4EEKA 3E5MA 1G9XA 2UYYA 4I9FA 5DGXA 3SJAA 5KYGA 2XZLA 3D6JA 1QR6A 3DZ8A 3ZWYA 4LI0A 2WWXA 1L5FA 1TM4E 2FTKE 4HTFB 1U3FA 4XIIA 2D1TA 2QM3A 4HDRB 1SPBS 1ULHA 3H4TA 1JEYB 1RRVA 3HLYA 1AQUA 1JU4A 5EMNA 1X1EA 4ABTA 2DXIA 1T9DA 3X1ZA 3QX8A 3I37X 4RPLA 4U4AA 1R5OA 1VJ0A 2FB9A 3IQDB 3DYIA 3OD5A 3BXFA 4FPXA 2NT4A 3GN2A 2VHUA 4RY9A 3QW2A 4IRMA 5C5IA 3WLAA 2WD9A 2XLCA 4LRSB 4A8HA 1H4QA 4GL2A 5GMOA 3UMGA 1PGQA 5G02A 4PYKA 4C1BA 3C43A 2GZAA 2HF2A 1JEQB 4BQOA 5DNYB 4CRWB 4ASUD 3PVZA 2CXQA 4Z0NA 4B7UA 3FOAA 1W2HA 2XE6A 1TVEA 2YY5A 5BVGB 4DJTA 1B23P 2IZ1A 3ZHCA 2GPSA 3CIOA 5FA8A 3ZYCA 2ZYRA 1J39A 1WR8A 1KR2A 3U44B 1JF8A 2WUWE 2YZKA 2JEOA 2RCNA 3WFIA 1H65A 2B34A 4UTOA 3SHWA 4RZ3A 3V8PA 5JATA 2Q2OA 2BH2A 4XYLA 3L92A 1DELA 2DKFA 4TV9F 1LF5A 3HHPA 2QDXA 3ZY4A 1X13A 3P9NA 1M33A 3C3CA 3ANMA 1NOJA 3B6MA 1X7GA 2AFRA 2RH5A 3L40A 4D8YA 1CE8A 2DJIA 3HGTA 3RYHA 3UMJA 1M6NA 1VHDA 1A88A 1YXMA 2BL4A 3EAGA 4MUAA 4AIIA 1WB5A 2C5BA 2IWHA 3OJWA 1DXYA 2C2OA 4KUEA 5GJVC 5GZ6A 1TU3A 2BSQA 1JIVA 2J0VA 3IDZA 3CVXA 3BN3A 5D3ZA 1GRVA 1NR7A 2BHRA 4H0NA 2DT5A 4ATNA 4KNYA 3HDQA 3LCCA 1HSOA 3CLSC 3I9MA 3QPAA 8GPBA 2AFIE 3OT1B 4I9UA 4UU1A 1I8TA 2WFMA 3L0DA 3CKMA 3G2OA 3KTAB 3EEOA 2YCBA 3OTIA 3TLKA 1AB6A 1NVXQ 3A3YA 4RY0A 3S1AB 4BBJA 4PPGA 3PLAE 2X1VA 1FP2A 1XWFA 1K98A 3W3ZB 4BNMA 4CR7A 2X8LA 3AGPA 1R0RE 3OX2A 5T3YA 4D3SA 2EHJA 5JQGA 1C8KA 4R3NA 1VIAA 1JR3A 1RVDA 1W6RA 2HSGA 4FOLA 4Y6RA 1EGMB 1E3MA 2HRBA 2PPVA 3C6MA 4M2LA 2C4MA 2GEUA 4GX5A 2XKAA 4KQEA 4W5RA 3GA7A 3CKKA 2PGOA 3N8KA 4RIGA 1FK8A 4EVSA 1N2JA 2X13A 5ALWA 1ZCFA 1YMVA 2W42A 1KEUA 3BHNA 4IIDA 1GUDA 1VSTA 2AFHE 4EJSB 9MHTA 3SHVA 3VO9A 3GV0A 2BGWA 3LHSA 2RAUA 1W2GA 3ND8A 3BJRA 1QHIA 2NYRA 4MVJF 3DH0A 4LMPA 4WDQA 4K6CA 4DVGA 4OA5A 5D5HA 2FETA 3CONA 4WNAA 2JATA 4Q1BA 4L85A 3Q85A 1QGED 4ZQCB 3UWSA 3FW1A 4I14A 3M81A 4M99A 4NC9A 3ZNPA 1N9KA 3WZLA 3JATB 3PWKA 4O29A 5F7JA 1BEUB 4X7BA 3C97A 3H11B 1XAGA 1JSCA 5FIUA 2OXIA 2HR1A 1NQTA 1DO0A 3L6EA 4B84A 2CL7X 4NESA 5D87A 4DLZA 4UUAA 4BC0A 2PNJA 1ZDMA 4JQCA 3ZX4A 4XB1A 3MYRA 5DNAA 1GQQA 1L7RA 2HREA 2JDID 4A8PA 2ZTLA 3KUDA 3OTQA 1K1EA 6Q21A 1J42A 1K6JA 3C24A 4UNPA 2X7JA 3X1KA 1H4SA 1KEPA 1TA0A 3VR0A 2VXOA 1WMSA 4PCLA 3AF1A 4QELA 1RAHA 1OTHA 1THMA 2P5TB 1V3TA 3F8TA 2IP2A 2AFVA 2BGNA 3L49A 5JVDA 3RC2A 3KKQA 4EHAA 4HXYA 2WYIA 4GG1A 3RK0A 3V4FA 3R5XA 1GUBA 1O6FA 2PGLA 5EHNA 4I46A 1L4GA 3TQOA 3QXCA 3ON5A 4BGDA 1L5MA 3G7SA 4G6ZA 1LI5A 2P2GA 1EXNA 1ZG3A 3NTLA 4FKBA 4RXTA 3O95A 1K7EB 3BIWA 3IHLA 1IN5A 5F5LA 5IJWA 4I4LA 1DBVO 2OCIA 3W6UA 2JLQA 2PBFA 3N2KB 3C16C 1XWIA 3K6JA 3QYJA 3E2MA 5TF4A 3VR1A 1N7HA 1HE3A 3VPXA 3B78A 4ZVQA 1XUOA 1FE8A 4NJOA 3GLQA 2P5SA 2ZRJA 4ARCA 2C97A 1G20E 1KEWA 3OPQA 3IQZA 1Z5WA 4XPIA 4MULA 3AESB 3HXQA 3IR7A 4WZAE 1KMIY 5JCZA 4QUGA 1I4OA 2WFLB 4QGAA 4IGAA 1TYDE 4M0KA 1PR0A 5AUNB 4DXAA 1J8FA 1P29A 2W6ID 3DCNA 3THRA 2WYOA 1DWOA 5LP1A 2YJNA 2F3RA 4GUDA 3RVRA 4UVIA 1D2GA 3VPGA 1RJFA 3QXSA 3ZWVA 3TLZA 2W2KA 1LPMA 1MW8X 3RJMA 3GC6A 4OIMA 3RHFA 1UBEA 1UBUS 2ZIEA 1K9VF 3G6KA 3G0BA 4PLWA 4Q34A 5CT9A 2MR5A 3BQ9A 3GUYA 4TQGA 1KSGA 4OHMA 5BR4A 2C2GA 4J16A 3TAHA 2WV7A 4D79A 4B8ZA 3PC8C 3R9WA 1WTCA 3RS5A 1T9AA 1I51A 2F17A 5DHQA 1PGPA 4IBOA 1AHPA 3WHKA 2RI6A 4QICA 4ZOEA 3C4QA 1OIWA 2A4MA 2DQ4A 5A0FA 3NUZA 4YA6A 2QROA 3OCWA 4L4RA 5ALGA 2QBYB 1UJBA 1MPTA 2JGMA 4GW3A 2O1SA 1YIDA 2DAPA 2Q45A 5T64A 2ZPTX 1JDBB 3IP3A 1VHWA 3VGJA 3EW9A 4OKIA 4CUZA 1EB9A 2WB4A 2FCRA 3LUFA 1A9SA 4NYJR 4F9FA 1DAOA 1ZLXA 4B40A 1N77A 2XEDA 4QQ8A 1P33A 4EO9A 2IUTA 4XCVA 2ZG6A 2IEZA 3H84A 3NIGB 4JBIA 3TNFA 1MVNA 3MCZA 1WNTA 4Y1RB 3C8MA 4BMDA 2BEJA 2C5SA 3ZEIA 4QU9A 4KE6A 4L0MA 5AJWA 2QVGA 2HL6A 4JKYA 5A4MS 1AKRA 3ST7A 5ALEA 2FQXA 4KUHA 3BIFA 4G0VA 1QRSA 2X0RA 3M4XA 1JAIA 1N5OX 3R7NA 3MRVA 3L1IA 4C4PA 3E5RA 1ONOA 3QVUA 1K8ZB 2E1PA 3CJTA 3O26A 4FONA 2FPRA 2O3RA 4M6WB 4YHHB 1P1FA 5D85A 2JAXA 3ZGOA 4I9NA 5IVHA 5A9TA 3GBSA 1PS0A 2IE8A 2OECA 4MWCA 2FPMA 3O8DA 1DTSA 1E2MA 1WLSA 4EGCB 1CRPA 2VSXA 1F2UB 2IY8A 2V7PA 5C1OA 2IUFA 4NU0A 3UATA 5C7IO 4TWBA 4KOEC 1P5RA 5KYVA 4CEHA 4Q02A 4E7PA 3I2IA 5I9IA 3VR4A 2CCJA 3GELA 5KS2A 3VU0A 1R0LA 3PTZA 3ZH9B 3OF2A 4B6RA 1NSFA 3DBIA 3LPCA 1UKVY 1OZ0A 4M9SA 1A3CA 3GGJA 4K7JA 4A3SA 4K2AA 2J7PD 3AR8A 3D3QA 4X1OA 3W4JA 3EDYA 3RVLA 4MO9A 4Q3KA 2IS2A 4IM7A 1SBQA 1A7KA 1L5ZA 3PC4A 5FUWA 5LQCA 1O7JA 4TV8B 1PT7A 1O5OA 1YJBA 1XP5A 5CB0A 2GPTA 1GGHA 2ZRIA 4PLPA 5EKSA 2B1IA 3OA2A 4L5YA 2AKAB 1H0HA 2I9PA 4HZIA 2WTAA 1IM8A 2IYAA 1G7RA 3MPOA 1E3DA 2H0RA 3ORYA 4MUYA 1NX9A 5CNKA 5F51A 2ZUCA 4PNEA 2ZAMA 4IV8A 3FYUB 2MWMA 3IAHA 2CNDA 3BMNB 5REQA 2XQVA 3RC1A 2UZ4A 1FP1D 3SZGA 2D0PB 4IJKA 2QOEA 4PHTA 4B3DA 4CMAA 1PD0A 3EZXA 1MX1A 4LCBA 2R6FA 1QTQA 1KVTA 2CHQA 2OVFA 4PEVA 3UHJA 5LZ2A 1IJFA 4S05A 1PLLA 1WHTA 2ZT5A 3R7WA 2AOVA 1V6CA 4K9DA 1C3VA 3G0CA 1EK5A 2WVHA 4I1YA 3VSDA 2ETVA 2R751 3JVEA 3UA4A 3E9RA 1M2KA 1XCMA 2AN9A 4F6RA 1X7ZA 2C5HA 4X7MA 3KPJA 1FDWA 5G1PA 4FYYA 2AEEA 2XOEA 4G81A 4FX5A 4J16C 1BSVA 3CRNA 3B7PA 4TTIA 2CZQA 3ND7A 5MFPA 2PWAA 1P3Y1 5FBHA 4A92A 4Z6KA 1KEEA 2GPBA 4DQVA 1O5IA 3FGNA 2DRIA 4B4WA 1ORDA 3X2EA 5DLEA 1DQPA 2KLHA 1YE5A 3VHLB 1TKRA 1YU9A 2AK3A 2JC3A 1PQWA 2VUUA 3LIPA 5TMBA 3TIVA 4K2HA 4WOCA 5DPMA 4RGBA 1DJQA 5DULA 4FJ2A 3FMOB 3KSRA 3AUYA 4MAMA 2NZ8A 3MMXA 3KQLA 1NSTA 1WUHS 4MVYA 4ROTA 3TOCA 4RMGA 3KVNA 3V8NA 2XUDA 2VFAA 3WYNA 3TF5A 1IZ0A 4XGQA 2WSSD 1TTTA 4GRAA 1GPJA 1K92A 1DQNA 1YZUA 3Q3CA 3HDHA 5D6OA 5J2TA 1T2DA 4DM7A 2WHRA 3BRWD 2VHCA 3UHFA 4GP7A 4LA4A 5IMBA 3RT7A 4LEIA 1DOAA 1NBEA 2V8BA 3L0CA 1L5VA 2IL1A 2EL7A 1EM8B 3SDBA 3KVOA 1ECBA 1USIA 2IEYA 3IP5A 3TQSA 1RAIA 3OWXA 3ZQJA 1Y4DE 3CX3A 3O1HB 3H4MA 3OZWA 5H3HA 2PX4A 4G5XA 3ER6A 4HG2A 1XAJA 1B6GA 1MP0A 5FBLB 3DMHA 2IS1A 2NN3C 3I53A 3GRPA 3KSZO 2XLBA 4LMBA 3KTFA 1HZZA 3MTGA 1Q44A 2ECPA 5LXTB 1GPKA 1TLTA 3FHTA 4TZ0A 4MWBA 1IJKA 1IMJA 5EKDA 5GJCA 5F33A 4QPDA 4BEVA 1WV0A 4QVGA 3ZE6A 1OLUB 1TZ2A 3U56A 4YJ3B 3TGLA 1WUJS 2R4TA 4LQLA 5JHHB 1ZICA 1SD1A 2CMHA 1RXSA 3RIYA 2G4VA 1N4AA 1FDUA 2Z3VA 4ZYLA 2GCOB 3CN7A 2GRUA 5E7JA 1CUEA 1ZMOA 1ZO8A 2J3EA 4M1SA 5E9JA 1CUIA 3FPAA 4GM1A 1WQ1R 1SC4A 1NZJA 1CRWG 3NHJA 3GG2A 4V03A 2A9OA 4WXEA 4DLRA 3FPJA 4HNHA 5HE9A 5LN1A 1I2DA 2HLDD 3O31A 2GKGA 3P9QA 5CFNA 2LIPA 3QPCA 4B33A 5M04A 1RKBA 3R0QA 3A0RB 4HS4A 4EGQA 1MABA 3BB3A 4D98A 4POAA 3QG1A 3OTHA 3OLYA 3CUVA 4DS3A 4QLBA 4ZK6A 3CLUC 2AX4A 1WXEA 3RG2A 4MJLA 4AULA 5HX7A 2AMFA 1JXOA 3QUSA 4KR6A 4LXQA 3G9UA 2P6OA 4A6PA 1LDBA 4UHFA 1IQPA 2N46A 3DA8A 2PKCA 3K8QA 2XB4A 3E9QA 5AXCA 3TTTA 3VO8A 1O58A 1SHLA 3COWA 4AZ0A 4B8YA 1ECLA 2YJ5A 4R9NA 1NLFA 2HM7A 1MJHA 4DMCA 5JXHA 1I3KA 2A1IA 3FWNA 1W1WA 3EQ2A 4CV1A 1SOMA 4YFVA 2ZRCA 3G8AA 1V8BA 2ZBDA 4N8DA 3CUEF 3R77A 1RTKA 5HSGA 4Z49A 1A4UA 4E6EA 1FFYA 2RB4A 2KQUA 3DXFA 4GRDA 3HE3A 4NH4A 2DX7A 4J0FA 2HXGA 3AHJA 3WYDA 3V2IA 1E8NA 2O8CB 2VBFA 3GCWA 3GEDA 3PCXA 2B7BA 3NFRA 3A3KA 1H2ZA 1NLZA 2NV0A 3ONVA 3CLRC 4ZDJA 1QHSA 2IZ0A 2VUTA 2WWWA 2WYHA 3BD8A 2HF8A 3DBRA 4BPBA 3QBTA 4I1PA 4MHOA 3BK2A 3G6WA 4YT2A 1TU0A 1E5DA 1R9JA 2EERA 5JZVA 4KXFB 3ECAA 3EPLA 2CE2X 2BMDA 3JARA 1O6ZA 4WXPA 1QU2A 1XZ8A 5JW6A 2IXBA 4LK3A 4JR1A 4KRYA 4IS3A 4DLSA 1VCMA 1XK7A 4BO9A 2NU7A 1R27A 1U0SY 4PXYA 4J07A 1YNSA 4GKBA 4PBSA 4XOIA 3KOMA 4IUYA 3MT7A 1KIAA 3AF3A 3AG5A 3KJEA 4RIHA 3SM3A 2W8BB 3MBKA 1IZYA 3MF4A 4ZDKA 1FW6A 4MR8B 1E5QA 3K0FA 3ZWCA 2J33A 5D3MB 4JOBA 1YUMA 4A16A 5CA1B 2UXDB 2YJGA 1DT3A 2ZTUA 2JB9A 4OHPA 4E2WA 1CUCA 1VJCA 3ENVA 4U6NA 3ORRA 3QEOA 4PZEA 3WAGA 3KYCA 5BPHA 2OV1A 1E6CA 5B3LA 2HHAA 3OBIA 2DM6A 3FMVA 2WRZA 4X3CA 3EIHA 3OZFA 2QRNA 3E1KA 2XOXA 1GU1A 3NUQA 4GBGA 4O3MA 2GASA 2OBMA 5AW9A 4Y6OA 5GIPE 4II3A 1F3LA 1C4KA 1V8PA 2Y9MB 3CW9A 3FZYA 5HP4A 3NATA 1GEEA 5DLYA 3E58A 4GPD1 1QZ3A 2J3DA 2Q5LA 5LBTA 2QU7A 4KN6A 4PINA 2J6IA 1QGAA 3NG1A 1Q50A 4GX0A 4QUAA 4EJ0A 1V4VA 2C2HA 3DO6A 1FQWA 2QYOA 4WCFA 3ZY2A 2NVOA 1HZZC 1T4CA 1EUCA 1C30A 2GK4A 3CINA 4JT8A 3GLHA 2IYLD 1JDVA 1YL6A 2FFBA 1LTKA 2X5JO 1CTQA 3GU3A 4IEFB 3JQFA 4EGSA 3VVCA 1TE2A 5B7NA 4MDHA 2DKNA 4RTSA 1BHQ1 2X1LA 2XUKA 4W1SA 1XEWX 2H52A 2PMFA 2PTHA 3LXMA 1OAAA 2HUPA 2OEPA 3EC7A 3PL1A 4KPUB 3NM5A 4CJXA 1IN6A 4LY6A 1CJSA 2BEWA 4UFOA 4YFYA 5CGZA 2BFCA 3I6QA 2PKQO 3HN2A 3IJRA 5BQPA 3LHDA 3UUWA 4ED9A 1X0XA 3X44A 2YVUA 1CYDA 2LWIA 4HYYA 1DBWA 1M83A 3F4BA 3PHIA 3RIXA 3JRXA 1CWUA 2WPDA 3L3BA 5E7IA 2EKBA 4QASA 2WTNA 5J2TF 3RFFA 3WYCA 5IM5A 4D45A 4V0QA 1QKKA 1NLYA 3EGIA 2GN2A 4CL8A 3KR1A 3AJAA 4X95A 3PDUA 4MH0R 1YKSA 4UMEA 3CFYA 5J40A 4KQXA 4EY5A 3EB9A 1AJEA 3ISVA 2VWQA 5GVRA 1NI4B 1VDZA 1XVLA 1W4RA 2WSLA 3IL2A 1CR6A 2I91A 1BW9B 2ZIXA 4M8LA 4KR7A 3TI9A 3MGAA 5KSYA 4ETNA 2WG0A 3Q2KA 3FNIA 3I9NA 3LQQA 5AMXA 2QDKA 1JFVA 1W5SA 4YGXB 1WBBA 2ODBA 2VI5A 2G0AA 1Y7PA 1M2WA 2BFPA 2CJWB 2YKGA 2Q6KA 2EG9A 4JDPA 2P30A 3E03A 2P4QA 2PGAA 4MDFA 1BCRB 2HDWA 4NEHB 4G5GA 2J46A 2ZYIA 3RWMB 3GUHA 3K70C 3HZHA 3FVVA 3P5SA 1FFWA 3BMQB 1KDYA 1OC4A 3D4LA 3IRUA 1X94A 1GPNA 2RFLA 3D43A 3ESRA 4I4TA 4O5OA 2QD4A 5CAEA 1YR8A 1ZRHA 4GI3A 3KT0A 4H77A 3R7DA 3V4OA 4F06A 1S8AA 3A9SA 2J0EA 3DHWC 3OIWA 1BHO1 3D4PA 3RAPR 3SE7A 2AFIA 2BDTA 4C4SA 5I7EA 1E9FA 2Q1XA 3ACDA 5FKJA 4FW8A 1KXJA 1NRIA 2F2TA 2KW5A 1P1KA 1SUDA 4TXHA 5BNWA 1B43A 2CKDA 2ZUSA 4JBWA 4N49A 3ZU6A 4CV3A 5HKKD 4LYFA 3SZLA 1EKXA 3AVVA 4LYAA 1WCIB 2JFBA 5DCLA 4GNKA 1M1YE 1XKQA 3O1IC 3ZV7A 1R6AA 4B6QA 4DXHA 3FNFA 5BT9A 2R5NA 4HPXB 1BMFD 3ZGVA 4AO8A 3BQNB 5IYZB 2WQZA 1BU5A 4B46A 2CFSA 5KSWB 3PVCA 1Z5GA 2O7RA 2QTNA 4W6QA 1KI4A 3ECSA 3VAAA 3NBMA 2PIAA 4WDRA 3RW9A 1GPBA 3CUWA 4YXFA 5FWDA 1T9BA 4GPEA 3SR3A 5B7GA 4OUKX 1F8UA 4H4DA 1RPAA 1BWRA 1CHNA 4XD2A 1Z5VA 2VS1A 1RLMA 4N0QA 3U3DA 2QJOA 4IEEA 3TD9A 2B6HA 4FGWA 3FROA 4TTSA 3K92A 2FW8A 1KQ3A 4FE4A 3SHQA 2WUEA 1E62A 2CZGA 3HBAA 4KIJA 4EHJA 3AP1A 1PYOA 2IJGX 2RHLA 4WCFC 3SMVA 4HOYA 1PG5A 4HY3A 2A33A 4CUKA 4ZMBA 4RD6A 1HSZA 3LP6A 4E1VA 2VYND 1ML4A 1FTQA 3H0CA 2Y66A 1FPMA 3KAJA 3H2JA 2UZ1A 1LPSA 4RETA 1XZDA 3JQFC 4B3IA 1KZYC 3GGOA 3OZAA 5KC9A 2DH5A 1D07A 1PR5A 3ISJA 2PT5A 1G6Q1 1MORA 4RVUA 5FV7A 3VNQA 4D56A 4DT1A 3VOSA 2P90A 4L51A 4C4TA 4JUCA 3F1KA 4Z0TA 4RYDA 1NNEA 2FEKA 5B6PA 5BMVF 1H5NA 4JODA 2RHTA 1T1JA 2YUTA 4XDZA 5B1YA 1P6UA 2WE7A 3FY4A 3GLIA 1PI3A 2CB9A 1K4KA 3F7NA 1DC4A 1BD3A 1QYDA 4KLCA 5ESRA 5JXIA 2PKRA 4G1UC 4QOGA 4W63A 2ZSEA 4Z4FA 1REQB 5TQ0B 5EMMA 4XJVA 3V8VA 1Z8FA 2QV7A 4DPKA 1H05A 1RPTA 2F9FA 2FY8A 3QE9Y 1SZPA 1N0VC 3A9VA 5BXYA 2BTEA 2ZW9A 5CD9A 3Q10A 3W34A 4YRMA 1J1IA 5HIMA 2PCLA 3M1IA 4NQZA 4EAAA 1QRUA 2HRCA 4DILA 3NKVA 2HSJA 1H9CA 2CE7A 3SS8A 1KRWA 3UF0A 3TLBA 3F3KA 1NQXA 2H1HA 2QW8A 2PJUA 1B1AA 3ZXYA 3EVBA 5G0SA 1I6MA 4HPJB 1H2XA 3IVAA 3BCRA 1YR1A 1D2CA 3U16A 4GDMA 5EMLA 3SJCA 4Q4CA 3ERCA 3DCYA 2CCKA 2NQ8A 1OBHA 1H94A 2ZRMA 5C80A 1ATZA 3WGIA 1FRQA 2WMNB 4FOOA 1I80A 4IZHA 1TAQA 1Z26A 4RF5A 4D9MA 1W36C 2AW3A 4E7OA 3E7DA 4TS4A 5CLJA 3M6XA 3RUIA 4X93A 4EEZA 4QM7A 5IP5A 4XD7A 4E4RA 1VBFA 2PZBA 3KQTA 3S2IA 5KX5A 3OESA 3UENA 2V0GA 1T9ZA 1CUUA 1TIPA 1PJ4A 1KXZA 3CRW1 2EGGA 1OLXA 1QTRA 2XQFA 3KXIA 1DADA 1RZ3A 3ESZA 4KH1A 1NQWA 3K1JA 3JWEA 4KAXA 4YV1A 4ZZ0A 1XZFA 2WM2A 3BRCA 4J75A 4NH0A 4KFCA 5IAEA 1AS0A 2RH4A 4KRFA 2ERYA 2FWBA 3B13B 4ZVUA 1FP4A 3KOYA 4F8YA 2CMGA 3GGCA 2H4JA 2PH1A 4PM4A 1NE7A 5F3RA 5IZ4A 2CUNA 4OGWA 3OZSA 4N3AA 1DL5A 2JFWA 3AY0A 5DP2A 4D9IA 5A2GA 1FNSA 2B36A 4YRIA 4H18A 1U2RA 4TMYA 2VJPA 2AEFA 1JIUA 5LQNA