3W9SA

Crystal structure analysis of the n-terminal receiver domain of response regulator pmra
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
116
structure length
116
Chain Sequence
KILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGLHFLSRMRREKMTQPVLILTARDTLEDRISGLDTGADDYLVKPFALEELNARIRALLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/antimicrobial protein
molecule keywords OmpR family response regulator in two-component regulatory s
publication title Structural Basis of a Physical Blockage Mechanism for the Interaction of Response Regulator PmrA with Connector Protein PmrD from Klebsiella Pneumoniae
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae ntuh-k2044
total genus 42
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3w9sA00
3O2QB 4ETNA 1USKA 1A0OA 4QYMA 2GWRA 1DJMA 4RZSA 3NHMA 1P6UA 1YMVA 5JS1A 3KG2A 3EQ2A 2R25B 4JOQA 5EWJB 2H3HA 1RZRD 2OQRA 3CKMA 1SRRA 1JH9A 1T34A 3KJXA 4MRMA 2MYTA 4KFCA 3T95A 4FE7A 4IMJB 3O74A 5EWLB 4N0PA 3GBVA 3SM9A 1XHFA 1H9CA 1WETA 3LUGA 1LBIA 2PUBA 4MQEA 2JCGA 2WJWA 3FMVA 2L18A 3F7NA 4MQFB 3H1GA 5DTEA 1BDHA 4TN5A 2RJNA 4WZZA 3VNAA 2LIVA 4MR8B 4PEVA 1Z13A 5JS2A 1DC7A 2FQYA 1JDPA 1E2BA 2FEKA 3DLBA 4KPYA 1KMIY 1U04A 1USGA 3Q7TA 4YGXB 1E6LA 3CU5A 5FWYA 4F11A 4Z9AA 1JFSA 1AB5A 4GPAA 2IOYA 3RVLA 4RS3A 1M5UA 5TQ0A 2VYCA 2MYPA 5HSGA 2E4WA 3N0WA 4WXEA 3LTEA 1MIHA 4JB0A 5DCLA 1K66A 2Q5CA 3H5IA 4DQDA 1JWLA 2I6FA 1RZRA 4MR7A 1OXBB 4IILA 4KQ9A 1Z2DA 4YRZA 5HM6A 4PYRA 3B2NA 3KYIB 4MS3B 4TMYA 4W5OA 5JNVA 2E4UA 4WWHA 1ISSA 2FEPA 2PL1A 3GWGA 3HUUA 1DBWA 4F12A 4MS4B 3H6HA 2PJUA 3NNNA 2WWVD 1NXOA 1VRVA 3RH0A 2LUOA 3A0RB 1LBHA 2B1JA 1APBA 1EWTA 4Z4HA 3QELA 1PNRA 1QP0A 3T8YA 3CG0A 3QX8A 2A9RA 3OO1A 4N41A 2P4UA 3I45A 1JLKA 1RNLA 3EGCA 1DRJA 1IIBA 5DGCA 4CBVA 1NXSA 2LPMA 1ZESA 3O1IC 2H0AA 4LDAA 4EUKA 3MIZA 4ETMA 4ZMRA 2MSWA 3CZCA 3LKBA 3EQZA 2KYRA 5TE9A 4F8JA 2IPLA 2QW1A 1S8NA 3LMKA 1YVUA 2R47A 5E3JA 3CS3A 3QX9A 5KC8A 3BRQA 1P6QA 4MAAA 3O21A 4QYWA 3H75A 4RKQA 3SQNA 4G0MA 2NUBA 5T3YA 2PL9A 1L5ZA 3LUHA 3N0XA 4ETIA 3RVMA 1Z16A 3QLVC 4RY0A 1JDNA 1RPJA 2B4AA 3GRCA 4JB2A 4LRQA 4JAVC 3CLKA 5JNWA 3KSMA 4LX8A 4TLMB 4N0QA 3UKJA 3A0UA 4EVQA 4XXHA 2HQRA 3I09A 1I3CA 3C3WA 3LFTA 5TQ2A 4Z4FA 4G0QA 4YLEA 4ZYLA 3SNKA 1QNLA 1UDRA 3DBIA 3OLVA 1EHCA 3O1HB 5ED4A 2MYNA 2FMFA 1ZAYA 2JVIA 1DBPA 4MYRA 3G85A 2CHEA 6CHYA 5IULC 3N53A 4W5NA 3KCNA 1YK1A 4DN6A 2HJ9A 2P9HA 2FSPA 1Z12A 8ABPA 1HEYA 4MS1B 3HDVA 4OLAA 1VLZA 2FTKE 3LUAA 3CG4A 1CYEA 1Y1LA 4N76A 3H5TA 3ILHA 3JPYA 3LUDA 3CHYA 2MYUA 4RXMA 5IUNC 3Q9SA 3JTEA 4Q6WA 4LDZA 2JBAA 2LBPA 2FXIA 3Q7SA 4RY8A 4RK7A 1L5YA 5EWMB 3OMXA 3QLVA 3OLXA 3HO1A 1MB3A 3IP7A 4Z4IA 4O5AA 4ML3A 4LE1A 3HXMA 1NXVA 1VPWA 2R4QA 3G1WA 3HM9A 4RXUA 4QPJC 4IGAA 3N6VA 1YTUA 3HSYA 2IPAB 3RVJA 4FE4A 1QP7A 3KKEA 5EWLA 3OM0A 1CHNA 1C4WA 2IPMA 1GCAA 2NT4A 3H5LA 3KHTA 4OATA 4KQCA 2PUAA 2ID9A 1A04A 2R48A 4UHJA 3H5OA 4MQFA 1ZDMA 3E3MA 1GCGA 2QVGA 1OXKB 1NXWA 1PEYA 2GKGA 2HQOA 3EAFA 4MR8A 5PNTA 4W5QA 3RVPA 1B00A 3LUCA 1KRWA 3I5AA 1FFGA 3Q15C 2N9UA 4XLTA 3QEMB 3GV0A 1NXTA 4Q7EA 3OQNA 3TMYA 3HZHA 5KWSA 2O20A 3OO0A 4RSMA 1FSPA 2FW0A 3H5WA 3TX6A 1C0EA 1BA2A 1DG9A 1M5TA 4KZKA 4KK4A 1LJUA 4XAQA 3CZ5A 3L49A 3A10A 4NCBA 3C3MA 4KRFA 3MA0A 3C6QA 3EODA 4MS4A 1LJLA 3RVNA 1YS7A 5KQMA 3M6MD 2F8SA 3S99A 1QKKA 4ZJPA 4OLBA 4P98A 3IP6A 1AB6A 3GYBA 5CHYA 2E4ZA 4G0PA 4Q6BA 1SXIA 2FVYA 4LE2A 3BBLA 4EYOA 2FN8A 2RDMA 3CRNA 2FQXA 3SG0A 4MRMB 2JB9A 3HUTA 1D5WA 1GUDA 3C97A 1JL3A 4G0XA 1JF8A 3RQIA 5FWXB 2IYNA 1DCFA 1P8AA 4MQEB 1JYFA 4JP1A 4HNRA 1KRXA 1D1QA 4P1ZA 3DZDA 3LOPA 3MYYA 2NZUG 4YR7A 3MM4A 3NNDA 4YS6A 1Z15A 3HEBA 2PAFA 3K9CA 2E4VA 1EWKA 1DC8A 5FWYB 1USIA 2FMHA 4MGEA 4O1HA 2FKAA 3D8UA 3QLUC 5KC9A 1BDIA 2IKSA 2MSKA 2M1ZA 3N75A 5BQ3A 5TQ0B 4OG2A 2YHAA 4TLLB 4S05A 4RK5A 1YK0A 1QMPA 3JVDA 4N03A 4RU1A 1ZH2A 3RVQA 3M9XA 4MR7B 3DGFC 3OLWA 4H3KB 1K68A 3GT7A 3M9WA 1RXEA 1ABFA 3JPWA 4HNSA 1KGSA 3RVRA 3A3KA 3RVOA 4RK1A 5IC5A 1Z2EA 1DCKA 4E7PA 2BGGA 4EY3A 1DZ3A 3H5VA 5CNIA 3H6GA 5TPWB 3QK7A 1W25A 3QELB 3CNBA 4RDCA 1NATA 4Z0NA 5KQLA 1E6KA 2QZJA 3VNBA 1TLFA 4RXTA 5C5EA 5I4CA 5EWMA 1GUBA 5KQPA 3QLUA 3URMA 4Z4EA 1PHRA 1ZITA 2VUIB 3BRSA 4G97A 2L2QA 2PKXA 3N0RA 2QU7A 1MB0A 2QV0A 3Q7RA 4RK4A 4YCSA 2OENG 5HKOA 1JHZA 2YHBA 2JVKA 1ABEA 2A9QA 3IP9A 3LUJA 2FMIA 5T7BA 2MSLA 3OLYA 4RK6A 2HPHA 5DKFA 4XASA 3OQMA 3FFXA 1BAPA 1F4VA 1JYEA 5EWJA 1ISRA 3TB6A 4MR9B 2ZWMA 2A9PA 2XDYA 1EFAA 5F64A 1DCMA 1Z18A 3E61A 3JS5A 1CEYA 1LK0A 1GLGA 1R8JA 2NT3A 5DLEA 5IEJA 1Z26A 5TQ2B 2WB4A 1PUXA 2IPNA 3CFYA 1XHEA 4RK0A 4EGSA 5HQJA 1FQWA 5IUJC 4W5RA 2J48A 3JY6A 2FLWA 1TM2A 2QSJA 4Z4GA 4HNQA 5FBHA 2FQWA 1NTRA 3HCWA 1QQBA 2W42A 5ABPA 3F73A 1DRKA 3N8IA 1NXPA 3HVRA 1FFSA 2PE5A 4DADA 1U2QA 2CD7A 1ZN2A 2QVCA 1JX6A 4OTZA 4Z4CA 5JNUA 4WUTA 2V0NA 2FMKA 3BREA 1YIOA 4MLCA 1JFVA 4RY9A 1MVOA 3MQ4A 3IPAA 3HS3A 2JBAB 4KVFA 1ZY2A 2DRIA 3IDOA 4FB4A 4D6YA 1EAYA 3KLNA 3KLOA 4XFKA 3FDFA 5JNTA 3T6KA 3FFTA 4Z99A 3ILYA 1U0SY 4E7OA 4EYKA 3NBMA 3KS9A 1FFWA 4G0OA 4MS3A 3D02A 5BR1A 1ZH4A 4RKRA 1J56A 1D2AA 2WMYA 4XARA 5FWXA 5IEBA 5IUKC 1U8TA 3RVSA 3IP5A 3OQOA 1NXXA 3LUFA 3DLHA 3CTPA 2PUGA 2PMCA 5KQGA 4MPTA 2LP4Y 1JFTA 4B09A 3FFWA 3UK0A 3P9YA 4KNYA 4LE0A 1MAVA 3L6UA 2AYXA 4G0YA 2RJOA 4GNRA 3RVKA 3ROTA 1QP4A 1TJYA 3OM1A 3HDGA 4QICA 6ABPA 2L19A 4IF4A 3TD9A 2FLKA 2RGYA 2WJAA 4G0ZA 2WY2D 5CNKA 4EYGA 4D6XA 2PUFA 3EJWA 4F06A 4HYEA 3EDCA 3LKVA 1W9HA 2ID7A 4WT7A 9ABPA 3TO5A 1F51E 1JBEA 3F6CA 5JNRA 5CNMA 2M98A 5D2CA 4ZPJA 3NNSA 3O1JC 3W9SA 2PUCA 1E6MA 1QPZA 5TPWA 5KI6A 3IPCA 4OBBA 1VKRA 1A2OA 3GBPA 4IMIB 1EWVA 3F6PA 3EULA 4EYQA 1QQAA 4L85A 2TMYA 3GL9A 3O2SB 3C3KA 3I42A 5BRAA 4MS1A 2VK2A 3DGEC 3H1EA 3HV2A 4YO7A 5GOTA 5IBQA 2AYZA 2A9OA 3O2JA 2PUDA 4NICA 5TPZD 3UUGA 2NZVG 2PLNA 2WRZA 5B3JC 1QO0D 3QEKA 4NV3A 1ZGGA 4H3HB 4MLDA 2CWDA 5CNJA 2VUHB 4YWHA 3LUKA 1M2EA 1SXHA 1Z17A 3OLZA 4RV5A 2JRLA 4EVRA 3K4HA 5JNSA 1URPA 4F3TA 5TQJA 4PE5B 4MR9A 1BVHA 3BILA 4KMRA 4N47A 4D74A 4KK3A 1YMUA 2PUEA 1NY5A 1TVMA 4H60A 2FN9A 3MMNA 5GQSA 1BDJA 1TMYA 3HK2A 4Y9TA 2IDMA 4G86A 3ROFA 5BRJA 3SAJA 2GBPA 2X7XA 1M2FA 4NCAA 3OMWA 4PICA 3MF4A 4PZ0A 5FBKA 2E4YA 4YP9A 3QLTA 2GI4A 4L4UA 4LZLA 1PNTA 3Q41A 3SY8A 3KYJB 2F8TA 4ZMSA 2QR3A 1SD5A 3H1FA 2JVJA 4JA2A 3NHZA 4JASB 7ABPA 2HQBA 2FEWB 5TPZA 2L17A 3O75A 1ZGZA 5IX8A 3QEMA 2JK1A 2QXYA 1PEAA 3GA5A 3JVIA 5B3JA 1D4ZA 1QO0A 1SXGA 4EVSA 4W5TA 1ZHHA 2ZAYA 2E4XA 4KREA 1U2PA 4RWEA 4S04A 1YS6A 1XWWA 4Z9BA 4IRXA 3HJFA 3KTOA 4M88A 4YV7A 4WXMA 3T38A 2HSGA 4O1IA 1D1PA 4UHKA 1ZVVA 2GX6A 1DP4A 4KV7A 1DBQA 1P2FA 1Z25A 3R0JA 2CHFA 5C5CA 1RXIA 3FGZA 4NQRA
chains in the Genus database with same CATH superfamily
5A3QA 2PPLA 5E8JA 3QKWA 4ESOA 1DFHA 3GT3A 1QDLB 1G20B 3ZWNA 3VYTB 3UT0A 2SCUB 3TKYA 3WSWA 2C2GA 3OTQA 1LB1B 5AKKA 3TLXA 1RXSA 2CBGA 1T34A 2XVAA 1Q3KA 4MRMA 2E89A 3TVTA 3UHAA 4TVBA 2FCAA 3WSVA 2B8EA 1ESZA 2BC9A 3W1VA 4BKMA 2AUMA 4B9EA 3PGMA 4UM9B 2JIBA 2NU7B 1N34B 3AEUA 1NMZA 1DEHA 1PNOA 1XEWY 2ZRCA 4Q24A 1AHPA 1H9CA 2QRMA 1FYEA 3E9DA 6REQB 3IA7A 4MQFB 3SHWA 1OW3B 3H1GA 4UCFA 5DTEA 3S2UA 4CG0A 5C3MA 3W3ZB 4KR2A 4F8YA 3KKNA 3VNAA 3PENA 1IY9A 3FKSA 2VYNA 5JS2A 1Z13A 5JH7B 3NRBA 2RAPA 1QV7A 2P9TA 1TAUA 1CUFA 4X61A 1USGA 1YQXA 4YGXB 3WFIA 3QF4A 2PNJA 4JUFA 1Z6PA 1CJMA 1XOIA 5PGMA 1QGZA 3AFOA 4KPUA 1YCHA 3EPLA 2IOYA 4WESA 5HP4A 1E2FA 1T4CB 4ANFA 4EO4A 2YVLA 2HIMA 4BVGA 2CNLA 2P9CA 5A6SA 4AKHA 3OFKA 4UFPA 4RY2A 3AUJB 3MELA 1VKHA 2O3QA 4LBVA 5JCOC 3VR1A 2AKAB 1E4EA 4BASA 3T3NA 3KSDO 2GM5A 3IPLA 5DNDA 1YZUA 5DBOA 1OLXB 2IT1A 4WLVA 3RV3A 2XQIA 3AY6A 3KYIB 4QAJA 5DYYA 4CM6A 4EZIA 4YUYA 4WI1A 1MA0A 2NVOA 1U8YA 3DYIA 3RGGA 3O8OA 4MS4B 5B4VA 2WHXA 1K0UA 2PKQP 2ZIEA 2WABA 3L04A 3SJZA 3LZDA 5CFPA 4YLYA 4KQWA 4BXOA 1E1DA 2H06A 2UXCB 5HIMA 1UKYA 3PPWA 3ABIA 4ZICA 2OFWA 2JLCA 1T2VA 2E1RA 3OO1A 3ZY6A 4E11A 1CT9A 3I61A 4HB3A 4L3OA 5AM1A 3O4RA 3UT5A 1AGXA 3LQQA 3NOOA 5I8PA 4YRMA 1E5LA 2B2NA 2NPOA 3MJFA 4EVIA 3LNCA 3GLUA 4RMHA 4DJEC 2BOVA 2QENA 4J2OA 1E7MA 3B70A 1LLFA 1QFSA 2BBTA 2YQZA 1PG2A 3OPXA 1AKUA 1RYYA 3GEPA 4IV8A 1AUVA 2B8WA 3D6VA 4JWTA 1EG2A 1MNAA 3DCJA 2JAOA 4RZIA 4DLPA 2XITA 4CV3A 2J08A 4WIAA 5E1DA 1C8KA 3HQ4O 4WEOA 4HQRA 3VGPA 4D41A 4ZV4A 3FPJA 2IHBA 3JYOA 3QKRA 1XWFA 1OLOA 1I1OA 2DPGA 3I0ZA 3KQPA 3N0XA 3AF1A 1CQJB 2VZ9A 4M7WA 3RVMA 1ZPDA 2WYHA 3WGNA 3T94A 2FR8C 1QCCA 3AJEA 2EKQA 3FOAA 3LOQA 5JZ9A 2WM9B 4NBUA 4QPCA 1QDEA 3TFOA 5GIOE 1KQPA 3K8QA 4V0LA 3JZAA 2PXAA 4NJEA 3UFBA 4BX2A 4G0QA 4XVHA 5CXSA 4L0CA 3SNKA 2GAIA 2N42A 1BVUA 5ED4A 4PYMA 4S1PA 5K0LA 1AUQA 7GPBA 4Y9SA 4BLRA 2P5YA 3I01A 3WGJA 4TRMA 1QH8B 1I1HA 2FMUA 1QQ7A 1ZXBA 2VK4A 2H7YA 4GLLA 1AKMA 1U0TA 4GLOA 3NBQA 4TV8F 4ARZB 1ORDA 1T1IA 1U9JA 3HFSA 3IA2A 3N0TA 4JBWA 2Z6UA 4DNFA 5HJ7A 1RJDA 3O3CA 1L5GB 1H2AS 4KG7A 5H7XA 4IDQA 2ZQ5A 1SUPA 3GVCA 1Z37A 3JWGA 3LUDA 3OG9A 3T5BA 1J9ZA 4IJQA 4ID9A 1JPUA 1AGPA 4W7IA 2WQ6A 1NWHA 4LDZA 4EHHA 3Q7SA 1KC3A 1G55A 3F6EX 4ZI2A 2XOEA 1P73A 1N32B 3I32A 1KDOA 3HCNA 4O5AA 5EJIA 2EJTA 1NLYA 3HXMA 3BD9A 3I8XA 1X70A 2EKDA 3NORA 3HB1A 4IDCA 1ZX1A 1Z0SA 2CVZA 3EVDA 1LSSA 2ORVA 3G2OA 2DWOA 2EDAA 3WJ1A 1TT7A 5F3WB 2ZREA 1ZK2A 2H1VA 2O1XA 3M1LA 4IDPA 4OYRA 4R3WA 4YV0A 2O2EA 5AW6A 3VNSA 1A2QA 4RL4A 2QROA 2MIIA 3P9QA 3ZE0B 1H1DA 4DA8A 1U5AA 1UODA 5E8RA 3VOTA 1FFBA 3JQAB 3HNPA 1RXCA 3CMMA 3EF3A 4IIXA 2WUGA 5B7NA 2XA1A 4KRYA 1HKUA 1E66A 2HQOA 3NJ8A 2RSLA 3ES9A 4DDHA 1KRWA 3NUGA 3OCWA 1E92A 1THGA 4XX0A 2QUHA 2IELA 4BDTA 4CF3A 2CK3D 2X5OA 4DMLA 2VDWB 4CYMA 5FL3A 3VM6A 4DEYA 2X0NA 1LC0A 3GJ8A 3LPLA 4W1SA 1GXSA 3EGOA 2XCTB 1T2CA 3L8YA 3HVKA 3ZU5A 2HT1A 3AVVA 3PUXA 4B3BA 1PV2A 1XZEA 2ECKA 2F48A 1TVEA 1G60A 3L6BA 1YQ9A 2I1VB 3P9RA 2EV9A 2B3DA 2RGCA 1X7ZA 2Q4OA 4A1FA 3PQ2A 3WDLA 3PNSA 4D46A 1X8XA 4DLNA 3M3HA 2SICE 4FMCB 3UOGA 1DWOA 1WXHA 3GEMA 4MJLA 4QTXA 4DUYB 3CVXA 3U3DA 4U4AA 1CUZA 4Y18A 3IIJA 4U5XA 1P7ZA 4UUPA 3AL3A 3WHKA 2HW8A 3N8NA 5FTWA 3STXA 1T3GA 1KQGA 1AB6A 1GPAA 2HRCA 3FMFA 4K46A 4LPKA 1MRSA 1FW8A 3TJRA 1IOWA 1OD6A 1MH9A 2ZT8A 4B3MB 3ZJUA 4PPFA 4BNDA 4YMLA 2O14A 3ZD6A 4ZQFA 2CK3A 1WBDA 4G2NA 4ITUA 4WY5A 2ZRJA 1Y9JA 1IBMB 3VKGA 1V3TA 1AH2A 2IYRA 3PDIA 1XTUA 2DT5A 2SHKA 3SZLA 1L4NA 1WD5A 3PD0A 2FZWA 2ORYA 4HX9A 4JS0A 4DIOA 2GCPA 1PJCA 4LHVA 5GVRA 3DHVA 3RS0A 3G49A 1Z15A 3HEBA 1J5XA 3JX9A 1CJKC 4WZAA 4TKVA 2YJGA 4P7KA 3DFZA 4XDHA 4L3VA 2O0HA 3WB9A 1XCBA 3HE3A 5IJAA 4O1HA 3GJZA 3NT2A 5KKCA 2P3SA 2MSKA 1FJHA 3NVAA 5E38A 2IXEA 2NACA 1Q2XA 4C6TA 4Z0TA 1AA9A 4S24A 3IYLW 4UUOA 4LOKA 4EHBA 1XX6A 3DDNA 3DKKA 3O7MA 2Q8PA 5AHXA 1DELA 3WTCA 2ZIGA 1KH2A 1YCFA 3KBOA 4UUAA 3PNQA 1GGEA 2OAQ1 2E0IA 2GESA 3GT7A 3I2YX 1BOFA 3LW7A 4DY6A 3SMQA 5CLHA 1TT5A 4ZO7A 1U0LA 3AWIA 1D6NA 5IW8A 3DZCA 2YUTA 4G9GA 2F3TA 3H18A 2YWRA 4P38A 2JFHA 2I33A 3FROA 3I9V1 4LXQA 4OYYA 4BU1A 5CDFE 2VR1A 2NZXA 4OHMA 3I34X 4N5DA 3KSBC 2ZRBA 4LTDA 3PNKA 3E7PA 4BX9A 5CFMA 2YXBA 1XQXA 2IZ1A 2Y4OA 5KYUA 1TMOA 2GA8A 4KO4S 4D82A 3KV3O 1KPGA 3VSEA 3QU9A 1ESEA 1H6BA 3BCSA 2P6MA 1HE5A 5IJXA 5HKOA 3HJNA 2C1XA 4R1MA 4CTMA 1L5NA 1FP4B 4BN5A 3RIYA 1SIWA 2VEDA 1ATZA 2ZAIA 4K88A 4JJ4A 3KOOA 3IVXA 3UPTA 3ZKWA 1QMGA 4KI0A 1JIKA 1UH5A 3TLCA 2JLRA 1OU0A 1TF2A 2ZBUA 4MGYR 5AJTA 1Z2NX 2WM3A 2Y1LA 3M7IA 5FPTA 1WB6A 2WIKA 1ISRA 4ZAFA 1PFYA 1W2HA 3V9AA 4ZJYA 4DCSA 5K4GA 5IT9A 1OF1A 2O06A 3C2QA 3LWNA 3Q3VA 4CG3A 4ZAVA 2P62A 4DNQA 2HUPA 3GLGA 2QMYA 4PVDA 1T3HA 5JI2E 2PCLA 4IP0A 1C41A 5EPOA 2IPNA 1XK7A 2HA0A 1FQWA 2HDOA 3LP5A 2H5LA 4PWZA 4U0KA 5BORA 4M1QA 1ISFA 1J8FA 4WN3A 4N3BA 1NRJB 2C2MA 5LR6A 1P44A 4TUYF 2B99A 2WIFA 3V9PA 4A03A 4CKBA 3KB2A 3GPCA 3N8IA 2AQ8A 4B8YA 4WXHA 2Q2WA 4MA0A 3A06A 2PL5A 1JQEA 1FU7A 2ZJ1A 3A1UA 3I9MA 2E7ZA 2CHUA 2FMKA 3UICA 1YE8A 1DKQA 5MHTA 3HJTA 1C4KA 1Q0HA 2QYSA 4KCGA 1G8PA 1YRYE 4QJ5A 5LXTB 3DDWA 3E9YA 2C58A 3T7KA 4UVGA 1OE0A 3DBLB 5BQ5A 3S1SA 1RRGA 1TUBB 2ZJOA 4XEHA 3S40A 1P91A 1XZGA 3HYLA 3CLSD 5I6DA 2C99A 1G5IA 1XMPA 2HU2A 4PCVA 1PJAA 4E7OA 1T1RA 3GVPA 4LKOA 3H2SA 3D02A 4A0SA 3NAZA 3F1LA 4A23A 2R6GA 5SY6A 3UNXA 4Z8XA 3JQFC 1X19A 4NU0A 2C2WA 2LW7A 2VSYA 1SVUA 2Q6KA 2WMYA 3NGXA 3TZHA 3ZKAA 5GONA 2G1PA 1WWKA 1IQPA 4GI2A 4OGFA 1CQZA 2ICAA 2PLRA 4RGBA 4AKGA 3RSHA 4CT0A 4INPA 4QHTA 1ARZA 4YJ3B 3I5MA 1XXHB 1DAEA 2EQAA 1TLLA 2B4YA 2XSZD 1XCLA 3RKUA 2DJIA 3EEQA 4NTZA 3QUSA 3TTSA 3QSYA 3E15A 4M9CA 1MBZA 4H7FA 4FEAA 3T06B 3S5UA 3UXYA 4C6SA 3ZHXA 3ZVKA 4KNYA 1P1RA 3ZC3A 1DAFA 3B1FA 1HOTA 1KPIA 1D4FA 3LXMA 3IVMA 1CP3A 1HDZA 1V41E 2VDKB 4YRNA 2XJ9A 1AQJA 1XPOA 1HDYA 1UJBA 1U3VA 2OT3B 4N6OA 1DEOA 1HYQA 2C0CA 3L18A 4K3UA 1JS1X 1XNHA 2EF0A 4NZ9A 2YFYA 1N7JA 3J81k 1HUQA 3ZTTA 1PQYA 4K9DA 4L07A 1T6ZA 4OL9A 4KGXA 4RZ2A 4WT7A 2HWUA 4CE6A 3DOJA 3ND6A 4AG3A 1HQCA 1RPAA 2YS6A 2HO4A 5D2CA 1HT2E 4ZPJA 4YN3A 2IU0A 4F2WA 3NNSA 4OXKA 2QRJA 3VU8A 3DFFA 4IOMA 5JXIA 3W5BA 1R6XA 1XT6A 3A14A 2RHCA 4FI3C 1LGYA 1JVSA 5LL6P 1H85A 2OESA 2WWTA 3IPCA 1KAOA 4MV5A 1PWZA 5I5GA 2ZRMA 4BNLA 1BE8A 3W5IA 1F12A 3EWNA 4YEDA 1GCOA 2XSZA 3JQ6A 1L5WA 2Y0CA 5K3SA 4DCUA 1EKXA 4HO1X 3AM1A 1POXA 3CLHA 4CGZA 1ZIDA 4HZUB 1MPTA 5JR3A 3QFCA 1A97A 2H5EA 1V1RB 2FR0A 2H2GA 4OL0A 1ADJA 2Y3IA 3AR2A 4JT9A 1DG3A 1IOVA 1U28C 1ULUA 1FLVA 2B82A 3AFGA 4NV3A 5ER6A 1GFSA 5LQKA 2YW9A 1G6HA 3UKOA 1Z17A 4MV8A 1HNXB 3UBMA 4PE5B 4NJOA 1HYEA 4K1LA 3BILA 1R12A 5JS6A 4N47A 5L95A 1BVHA 3ED1A 1QYRA 5JSQA 1KJ8A 3FWKA 2AEEA 3G89A 3NHUA 3EZ6A 4H60A 4OQXA 4ARSA 5ALVA 3KWLA 3A6KA 3KUCA 4LXUA 3JVEA 4F5YA 1JEYA 3DV2A 1C3VA 1ID8A 1FFHA 4CLOA 1G64A 2IDMA 4US0R 1NKTA 3SKVA 4ZCMA 4DLLA 3KL4A 3ZBPA 1CY7A 4EFNA 1CYDA 1IBKB 4OHYA 2CCJA 1U3UA 2R79A 4HQFA 2CNDA 3GFPA 2J9FA 3KELA 1Z4NA 1UUFA 2LKCA 2XCLA 4K9PA 1GUFA 1PX2A 1WUIS 3NXKA 1RJ9B 4QBIA 4Q4CA 3EGIA 1T1SA 3L8MA 5DSXA 1YQWA 1P60A 2CF5A 4JASB 5F35A 2FEWB 3X2FA 1O1YA 3OE5A 5EHXA 1W1UA 3FMIA 3G17A 1Z0AA 3TQFA 4A5SA 2CJWB 3VNRA 3B8HA 3E5RA 4FB4A 3DVQX 1RADA 4KEAA 1BYIA 3JQ7B 4RFVA 1CZUA 4KAFA 4BTLA 4BHTA 4BQNA 5DMHA 5HRCA 1BKYA 2Q45A 4MW4A 3FHOA 4O1IA 1LBTA 5HFAA 4Z7OB 4JJAA 4PX5A 4XQ9A 2D5AA 3GCWA 1M67A 3MLBA 4FCWA 3Q0TA 4D9IA 1ZJ5A 4ZDJA 2VF7A 1G98A 1U63A 1VCHA 2FEOA 3FGZA 4OXIA 5C5CA 1FU8A 1VXOA 4ETNA 4WN9A 2NO7A 5AJVB 1F0NA 2ASEA 1D1TA 3EXHC 1FFAA 1XMIA 5L4LA 2GWRA 4JB3A 2RKWA 5HKKD 1P17A 2ES4A 3NHMA 1POWA 3K09A 2C3OA 3CRW1 2J3LA 1HE1C 3DOOA 3JAKA 3NC0C 4B81A 5B3KA 1RBZA 5IKPA 2GEDA 3OX1A 3CW2A 1CD5A 1GN9A 1W4BA 3HB5X 4FBGA 4J03A 4KYTA 3GMDA 1XMVA 1Z5UA 4PTYA 1H6DA 3I1IA 3NW9A 4DSAA 2YMLA 4M8KA 2ZCJA 1J0CA 3EXFA 3GBVA 4M0CA 4GE3A 1CP2A 5HQTA 3O82A 1IUPA 3E22A 4EIWA 4QBKA 3TD2A 3CE6A 3QHQA 2O1EA 3LSYA 4FGUA 1PTJA 1NURA 5FRDA 4RCZA 3BMQB 1HEIA 5HCNA 3VSDA 2BKVA 1BX0A 1DC7A 2HBZA 2HLNA 3OEHD 2XTZA 2FYTA 2KI5A 2NWQA 2V4MA 3CVOA 4PCAA 3EEBA 1W49A 4YROA 2XOXA 3LPDA 5FI1B 5BQOA 3V1YA 1KSFX 3ZOKA 4F11A 4ZYVA 5C35A 1S3SA 3IPXA 4GPAA 1PJ8A 3R3WA 3PCTA 1V71A 1PJBA 4H6WA 4NH0A 4IH1A 3BS4A 3HNOA 2P35A 4PWYA 1QJCA 2XADA 5DOZA 1BROA 3ZJ5A 5HKKA 2X23A 1P18A 3X44A 5AI9A 4UXJA 3K2IA 3T3PB 1ZM2A 3PQ3A 1V11A 1FFCA 3UMGA 1ONBA 1V5GA 1Q84A 4IZIA 4KI7A 4RBNA 1SB9A 7ADHA 4FLEA 1DAMA 1OXBB 1X8JA 3FKJA 2QQ0A 4HWKA 5BSTA 2HNAA 3UAVA 1Z2DA 3UMJA 3NTUA 5AW3A 5LSAA 2JJ8A 3HYSA 4MPRA 2PGNA 4W5OA 5EUBA 3LL4A 2C5BA 2CCGA 3LT4A 1P2VA 2XHZA 4BUCA 1Z56C 3ETDA 5C32A 2ZJZA 4LXTA 2WWVD 3GGJA 4AAYA 3G0GA 4WSOA 3RSGA 4YJFA 2PH1A 4E2YA 3BAFA 2PX3A 2O2XA 3TOVA 3VO9A 4YY3B 3SICE 1YZ3A 1KRHA 4K2HA 4JXKA 3OEHA 1N9ZA 3OCYA 5JAHA 4WCFA 2OLJA 1V95A 1HT3A 3EGCA 3IDSA 1PGQA 4JL5A 1REQA 1UEJA 2FGKA 2JFNA 4LDAA 2YZGA 2GEBA 4NFSA 4Q18A 1G18A 4MA5A 2ZI4A 4DRXB 5KTNA 4MEAA 1ZGHA 2VDRB 2OL4A 3MJSA 4JSYA 1S4MA 1YVUA 5GONF 2V8BA 4XI9A 3DE4X 1TU3A 2L42A 3I1YA 4EA7A 2ZSFA 3LUHA 4RQBA 5C7OO 1XRPA 5A4JA 1JPVA 4UZFA 5M2QA 4JB2A 1UDXA 2K2WA 2YV1A 3GRCA 3I4LA 3LC2O 3PDWA 4NMWA 5KYXA 1O0CA 1FP6A 2A1UA 2F1OA 3FJ1A 3L6RA 2QA5A 3FR8A 4I55B 3DXFA 3RSFA 2OBNA 3IPYA 5EMJA 2F1IA 2HDNB 4XB1A 3AXSA 4J8PA 2Q0QA 1KDZA 1OI4A 1OU4A 3MCAA 4MYRA 4A2CA 2Z8YM 2C4KA 4I1YA 2AN4A 3CNEA 4K9LA 5JWRA 2B2CA 3IEXA 2PGXA 4ILKA 5HDQA 3UY4A 3WWYA 1P4GA 3RSCA 4AZ0A 2VP0A 2O05A 4XVQA 2DQSA 1RI4A 1DIGA 1JN0A 1WW3A 4FCCA 4G09A 1SVOA 5IMBA 5DHAA 2XAAA 3EEYA 4TTIA 4M46A 1K6JA 3L0YA 2WYVA 2IOHA 2IH4A 4O4IB 1S3IA 2ILVA 2GSDA 4WNYA 1XFAA 4F9FA 3JARB 1SUIA 3OMXA 4Z51A 3UAZA 2HSDA 4FXOA 4TVKA 1CQIB 3MRVA 7MHTA 1N3YA 3VZSA 2JG3A 1JHPA 2NLOA 4BGEA 1JIVA 4F4FA 1KY3A 2BEJA 4JP5A 3BQMB 2FLVA 1U4SA 3TSYA 3DHNA 1T8TA 5CA0B 3CH4B 3KX2A 3KDPA 2WMDA 3H5LA 1ZCJA 3H5AA 1ZSVA 2C4HA 1JEDA 5FWAA 3VXKA 2R48A 3OT1A 3R77A 4OI1A 3HB9A 3IV6A 4BVFA 5KX5B 3QUQA 4BQQA 2GXUA 3M4XA 1OXKB 1QRUA 1QYCA 2NADA 5EP4A 4BWYA 4RLQA 2P2LA 4RD3A 3HZOA 3E2IA 4J0CA 4PC3A 4ER5A 2NZ8A 2YJNA 5BVHB 1KJNA 3PEWA 4PF1A 4YX9A 1W87A 4C4ZA 1TA4A 2WJ4A 3HVHA 5THXA 1IJKA 3P71T 1OFIA 3NIFB 4XWKA 1QHNA 3WNBA 4ROSA 1H1LB 3RS9A 1GNPA 1U3TA 3SSMA 2ZJ3A 3H84A 2UZ1B 4KE9A 1JAIA 4V0KA 4AJJA 4D02A 1XCOA 4Z8YA 2PSJA 1OBOA 2C98A 1V7CA 1ZJ6A 2CN1A 2NUAA 421PA 4JOCA 4A8PA 3SCZA 3AEZA 3DLTA 2V6GA 4GI1A 1K8YB 5D5PA 4XVCA 3CZ5A 3IIKA 1XRSB 2AN5A 4UEWA 1E1NA 4FXPA 4RAQA 5ELXA 4EENA 4CU2A 1TADA 3AW8A 3MWDB 1B93A 3OZCA 2H51A 1HLDA 2ID8A 2JH9A 2W6MA 3FNFA 3H9UA 2BFFA 3FYHA 4Y2JA 2Q5EA 4H18A 1NZFA 4LMRA 5G4LA 4YT8A 5HJEA 4Q6BA 3DDSA 2QL5A 4IIDA 2FVYA 4CDMA 4GLJA 3FDJA 1X0XA 3FTNA 4O4LB 3FYUA 3B7PA 1LDBA 2YY5A 3ESAA 3DO8A 3GQBA 3PR1A 4GBED 4KIJA 4W8OA 5K9ZA 1G6KA 1KL7A 3DYBA 3EVCA 4V0ME 3K73O 5JMOA 3EVEA 3IC5A 4HB2A 2FE4A 4IO0A 4YDHB 1FUYB 3AM3A 3FJYA 1UKVY 1P62B 2WQZA 3IERA 2YS7A 1O6FA 4M1ZA 4EUEA 1GZ7A 5FNZA 1M1UA 1YMQA 2RK3A 4DM7A 2LDBA 1N2JA 1WUJS 2R1VA 2ZUDA 1D1QA 3GP5A 5FJIA 5DBGA 4DWVA 3R5JA 1JU9A 4HHEA 4JMLA 1CUXA 2DYKA 2R7MA 1JV2B 4YR7A 1P9NA 2ZRKA 3A4LA 4L15A 1VJGA 1RRVA 2QRNA 2QN7A 4JD5A 4C06A 2QJWA 4AY4A 2PGAA 3CZAA 3O8DA 1XZPA 4R8VA 4DLSA 4DIFA 3Q7QA 1U1CA 3Q6IA 2QY6A 5A9SB 3GGOA 4KSBA 4JJ6A 5KDDA 1JJVA 5A06A 2XCOA 1BQ3A 1HXHA 1C0PA 3HKEB 2A9KA 3AFMA 1MIOB 2DWCA 3OZFA 4QDTA 4PNEA 5ALKA 1QTQA 3AVOA 2OM2A 5GZ6A 4QDXA 5L4SA 4XWWA 5GINE 2GXAA 5JQGA 4OMDA 2D1QA 2FFJA 1ZH2A 4FS3A 2Y1FA 2QNRA 3ZHZA 2V9ZA 4LKRA 4BJ6A 4KKXB 4REMA 1RXEA 3DOCA 2I2XB 3NKLA 4YYEA 2PUWA 1SKUA 1TF5A 3NEAA 3I92A 3OLQA 1XLVA 4Q4JB 1ZUHA 3RUHA 3ZCQA 4B82A 5JXGA 4YFYA 3VKWA 3UUFA 4JV5B 2JGEA 1NR1A 4IW3B 3RE1A 4PSKA 5DRTA 1KI6B 4M9ZA 1GZHB 1NATA 4ZO4A 4CV0A 3DSRA 2PIDA 4B47A 5K0EA 2FPLA 3OTIA 4WNAB 3LQ2A 1TLFA 1IIRA 4RSGA 5EWMA 3ZQ6A 5CFOA 4L0DA 5IYZB 1PHRA 3EIWA 2PKXA 3CX7A 4TMZA 1XK6A 4RK4A 1XRLA 2QU8A 2ZYVX 3OQIB 4N5NA 5I7VA 4IDOA 2J41A 2YN2A 4G0NA 1XAJA 5EEGA 2IE0A 4MMYB 2QP4A 4OGKA 3KR9A 3M9LA 3IMFA 3WGGA 2B7CA 2YHIB 2HT6A 1XEXA 2VUTA 3JQ8B 1DRUA 4HKTA 4NATA 1ELOA 1EFCA 3OLYA 5JLAA 2HPHA 3HB7A 1XROA 2GK3A 3TB6A 4IZHA 5I3ZA 1VDMA 2V9PA 5C37A 1K08A 3PQ4A 2G71A 3Q2IA 2ZVQX 4M0MA 2A9PA 2GAJA 5HKLA 4C9BA 5JPCA 2NXCA 5HF5A 3ENNA 3B3FA 2VTVA 3CGGA 1R8JA 4B44A 5AI8A 2Y66A 3QQ5A 2D7DA 2VSOA 5IEJA 1Z26A 1CVRA 1N0UA 2OECA 2XI4A 4KYIB 3AUAA 2CMKA 1NW8A 1RWWA 4OA5A 1P77A 4NMMA 1VC2A 4B3RB 1U0OC 5F9MA 2BV3A 4IOJA 4ILEA 1YUMA 4EQ6B 1TM2A 2HA6A 4IRUB 4QNMA 1L4EA 2B6NA 3O83A 4CWAA 4DT1A 1W5AA 4CM5A 3AVQA 2ZJ6A 1VBNA 4MA4A 1W88A 3TQRA 2CJPA 2Q4DA 3F9IA 3OZSA 4J94A 4ZRDA 2XUQA 4Q3LA 1EINA 1DE0A 3CEPB 2JEZA 4HAUA 1F2TA 3PGLA 1PW5A 4BMDA 2EJUA 4D6PA 8LDHA 2GEJA 1JEAA 2Z6QA 2VUUA 3V4VB 3MOIA 1MV8A 3Q11A 2QT9A 4YRBA 4W7HA 1BE1A 3WQHA 3VDNB 2HLDD 3DULA 4BVAA 2G5TA 1EAYA 2H4FA 5LMNB 1CX9B 2EL7A 4B3TB 1GDTA 3Q88A 5HCIA 1W85A 1PVDA 2PK3A 1EFVA 1YFKA 4OOEA 4XB2A 4II2A 3SBEA 2BGNA 5DWQA 3EEOA 3EIFA 4NH4A 3PGXA 3KS9A 1GNQA 4DCPA 1K5GA 2IUEA 3CJRA 4EG6A 3NIBA 4QM7A 4HWPA 4HPWA 4RLFA 2XQJA 2RB4A 1BS2A 3A9UA 4RKRA 5H4HA 3AKYA 5EE0A 1NF2A 3B1VA 4OGGA 1FNDA 4FMDB 1HLGA 1NXXA 1UL1X 3UYLA 2HBQA 1IJFA 1BFDA 2PMFA 3TQSA 3TZLA 2GS9A 2HDWA 2OO3A 2PA0A 2O2YA 3QYJA 4RX1A 2ZB2A 1SWVA 2JHFA 4RD6A 5T5QA 3SK0A 3IE0A 1FXWA 4K6KA 3E81A 4GF5A 2C2KA 4M87A 3AK4A 5F7XA 6YASA 3Q7EA 4Q93A 1LLDA 4GGPA 2CYCA 4NLLA 3FFWA 3I2GA 3GJ0A 3K9GA 2QVXX 4YMSA 2IP1A 2RJ3A 3AEUB 4D9JA 1M66A 1Q92A 2W6OA 5ALRA 3TTTA 3T5AA 3OM1A 2P11A 4QICA 3UHPA 4D8VA 3U7FB 1PR5A 3KJIA 4IF4A 2HLDA 4Y2HA 1FK8A 2ZAOA 1GNVA 4MK4A 1LVGA 1XEAA 4J90A 4NYIR 5EGNA 3TL6A 3TSCA 4G0ZA 4HDKA 3A58B 1TF7A 3IHTA 4ADSG 2WU3A 3O38A 2HIAA 1V6SA 4MV7A 4XD2A 5BWMA 1GAWA 4D6XA 2GPTA 1QH1B 3FUWA 3CCCA 2GWHA 4E2ZA 2IZ7A 2NN3C 3HDQA 2REQA 4KPUB 2H54A 4XX1A 4GOND 3C5WP 3F6CA 4ZOCA 3L7AA 3MPOA 3WLMA 5JAIA 4K0KB 2GILA 2C83A 2QZ4A 3I76A 2AS0A 2C7BA 1RYFA 3RDPA 2GN0A 1VKNA 2XODA 3CZ9A 1EVKA 3K6KA 1XQYA 3ESQA 4FGKA 1H8HD 1CJUC 3MOGA 4R1TA 4HWOA 1FYVA 1RE1A 1XP8A 3S2ZA 4XRRA 3AR4A 3IURA 1WABA 1A2OA 4LZAA 4EY7A 4MCHA 4MKXA 1U9IC 4P9NA 3H2GA 5ICCA 2WSSD 2PZMA 1HDCA 3T4EA 4G9BA 3GL9A 2QB5A 3GJXC 4HDSA 1KKMA 2JLSA 4FNGA 4YJHB 3HV2A 1EE1A 4C7BA 5BRAA 5CFRA 1UP6A 4DUGD 2ZIAA 4X1YB 4R2LA 3BSYA 1ISJA 1NQUA 2Q9BA 1GG8A 1IZ0A 1G8SA 1HFEL 1K9VF 2GMWA 3N5CA 5IDVA 2TRSB 2B4RO 1QO0D 3IS3A 5B37A 3RRMA 2O8EB 3NIGB 2ZRLA 2EGUA 3O3NB 4AQYB 2W2TA 3BMOA 4RV4A 3UT5B 1ZI9A 1A8UA 3M33A 1MJGM 4AQ7A 1AU9A 4BRUA 5J4KA 1KEEA 4JQOA 1N2CB 1QX4A 3IT1A 3PF8A 1T13A 3RI3A 1MW8X 2ANCA 2BFDA 4JQCA 2DF8A 3BDAA 1G0NA 1USWA 1C3JA 3A1EA 2WYWA 1Z0DA 5J9FA 1J1ZA 1XZLA 3T5TA 1VMDA 2FN9A 4X9XA 3VDMA 4EJ2A 4MUMA 1IXSB 4WY8A 1H8HA 4LSGA 3F97A 3CH5A 3PHJA 3HKDA 5BRJA 1U2EA 2HHCA 2IYEA 2GPJA 1PD0A 2YL2A 3H13A 4KN9S 3ZBTA 2IOQA 3C1TA 3KZVA 1BGVA 3K9FC 1OMOA 1AS2A 1T9BA 2WSSA 4R83A 1G5QA 1RFLA 3I0MA 3V8MA 2A0XA 4JEUA 1UZLA 2P5UA 1VJRA 2BEKA 5HK9A 1XDDA 4DUGA 1QGOA 3PXXA 3PRJA 3G0OA 5AVJA 1OH7A 4LECA 2P0AA 2ZRQA 3QEMA 4NJEB 4OGWA 1RQ7A 4U8HA 3UUEA 4DLBA 1IUKA 1QO0A 1SXGA 4F4JA 1ZHHA 2CVHA 3MWYW 4HRXA 4KE7A 4DMRA 2O0KA 1V3QE 3EZ9A 5DHQA 4Z9BA 1WEKA 5JQGF 4D7AA 1UBTS 1JA1A 3P32A 2CZCA 3ND7A 1U7WA 5EIBC 4QSMA 1Z8DA 4K9SA 1E7WA 1GTRA 4UHHA 2AFIB 3IAFA 4QEDA 2WE8A 5C8YA 3ORYA 5HDBB 3V7NA 3DE7X 3ENVA 3L7LA 1ZUIA 2HWXA 2Y1DA 3P4XA 5DGTA 2XR1A 1TTHA 1BW9B 2BFNA 3K1JA 3LX6A 4HSEA 3ROXA 3AHDA 2CDBA 1SC4A 3O2QB 2BAGA 2R6DA 2VYVD 1XELA 2E18A 3L05A 1TO1E 4E32A 3BRWD 4HDAA 1VBKA 4M7RA 2FDRA 2JI8A 4A6DA 1N6RA 2CJXA 4HBZA 3GZTB 2O5VA 3D1JA 3LSTA 1Y9ZA 2CXHA 2XTAA 3K2EA 4KODA 4M9SA 3OIFA 4IMJB 5EXTA 2RD2A 3CVVA 2ST1A 5DX1A 3CRQA 3T4UA 2AC2A 2FX3A 4J2HA 4H6XA 4QQKA 4B3SB 3K6SA 2XECA 3TVDA 1W4CA 1VPDA 4QUHA 1O5TA 1PN3A 1I2CA 1X87A 2BSAA 3D6AA 3R0VA 4NU6A 1JAYA 2DMRA 1XDWA 5LXTF 1RQGA 4ZOAA 4DLAA 3SPXA 2JW5A 1TE2A 3DQQA 3NDRA 4JQYA 3KZNA 4PYKA 4Q4DA 5K51A 5C31A 1Z75A 1ECJA 1ST3A 1WNFA 2C5EA 2GTIA 2QTFA 4TV9F 4ZALA 3RODA 1QAMA 3E9RA 4HN4B 4NONA 3ZWOA 4B6QA 5IWAB 3TNYA 3IAS6 4X64B 5DX0A 3GUUA 1ZA1A 5E6RA 2AW5A 2VYVA 5FL7D 5K4AA 2VDVE 3PNYA 4XJXA 4B5KA 3FFBA 4CQMD 3W7VA 3L77A 2TS1A 4DNXA 2X9NA 1Z9BA 2Z6VA 1ZUNA 2PYIA 3BB1A 3BRWA 1BH6A 2P8SA 3NAGA 4MWDA 3U3KA 2O52A 1Q11A 2M6RA 1Q17A 3B1WA 2Y1CA 4ER7A 4O3MA 2YY6A 4KQFA 2GVNA 1CQPA 2GD2A 1N0VC 1DTEA 5EAIA 3RJTA 5HRAA 4ZVMA 2JZCA 4C0LA 4WASA 5DO9A 4D9GA 1CRQA 1PBNA 2HKIA 4GYJA 2WE7A 3IUMA 1NXOA 2EFCB 2WKQA 3LQ1A 2CMGA 3PVSA 3HY4A 5DNVA 2G28A 2ZT7A 1YZTA 4Z4HA 1TZKA 4C21A 3ZCPA 3QELA 1UPCA 5C80A 5JRJA 5E4TA 4BNDB 2Q2OA 4EYSA 1UXOA 3GU3A 4DBLE 4YTEA 4CKWA 3BZUA 1ODJA 3DMRA 3FM9A 4JBNA 4QVKA 1M76A 4TLCA 4WKNA 3RNLA 3WLOA 4U63A 5FL7A 3WWEA 4DV7B 3PHIA 3PDIB 4CQMA 2GN6A 2OPHA 2ONZA 1CSEE 3A1DA 3INTA 4TM7A 4YRCA 4WK0B 3S55A 2XZOA 1UWKA 1S8NA 3HVJA 3PGA1 2PLAA 2X2FA 4ZPXA 1NBME 4N6NA 1DDGA 2WP8J 2PG3A 4B4WA 2PFSA 5DW3A 1ZWKA 4YCJA 5SICE 4L76A 1T6YA 3ECAA 1UADA 1Z35A 4FZVA 1JW9B 1U2RA 2KLHA 2WILA 3H5NA 4JLJA 5TEVA 4D25A 4AUNA 5EJAA 5C81A 2YRXA 5B3AA 1KO1A 2ASVA 2V6IA 5DM2A 3X2SA 3KSMA 2ZTVA 4TLMB 1D8AA 3L4SO 4C6TB 1E59A 3G7NA 4CMJA 1I3CA 2FPGB 1AZTA 4PNZA 4ZYLA 1NJ8A 2BE7A 2HHJA 3BTVA 2GGSA 1M6HA 3KD2A 3KVRA 4Q47A 2JVIA 3ITNA 1DPGA 1H65A 1UOPA 1VOTA 3DMYA 3G85A 3UWPA 4MW1A 1TFRA 5J40A 5EXEA 4DLZA 2V7QD 5J2TA 5AIBA 1HEYA 3R4CA 4PR3A 4Q19A 4Y6PA 3NDBB 3O9MA 1GCIA 1MB2A 4O8ZA 2MYUA 3ASYA 5JYCA 4QARA 4BCDA 4KVGA 3QFSA 3EPPA 5K3EA 2NSHA 4HH0A 2FXIA 5CT8A 4WJKB 1PL7A 3NM6B 2PWYA 1N3IA 2DBZA 3LA8A 4DRZA 4JZYA 3GLTA 1V9LA 2V7XA 1GDDA 5EERA 1EDOA 1BKSB 4HH4A 3PC2A 1MD9A 3GEDA 1PVOA 4B79A 4FSDA 3MJHA 3RRXA 3WNQA 1C2TA 1C4WA 2IPMA 2NT4A 2XT6A 1SQ5A 3A9TA 2VDPB 1HNNA 1N3BA 3KHTA 1WXIA 5CLFA 1X7YA 1GJRA 1A96A 1JMVA 3IL2A 4I1VA 4UTPA 1GFWA 3PQ6A 4IKOA 4NHOA 2B9EA 1QE0A 4R05A 4EKDA 3F1KA 5DN6D 1HTWA 2V7QA 3BORA 1B00A 4Y7CA 4HVAA 4DLRA 2JFXA 1BKDR 4ZHQA 1FFYA 4OYHA 4LFAB 2VDJA 2MMCA 2BGJA 1O2DA 1TJNA 1QPGA 1GM5A 2QYOA 4X45A 3ND5A 3DKVA 5H9WA 4O33A 1SU8A 2HJVA 3H7IA 1A98A 4X1IB 3COSA 3PCXA 4NE9A 5AW7A 5TJHA 4YXFA 5K6TA 4Z1MD 1JAXA 2AZ4A 2CJFA 4K9QA 3A9SA 4N9QA 3FFAA 1S2DA 4QDZA 3SZGA 1B76A 1FX1A 1UJ6A 2JH3A 2ZBGA 3AWDA 3PX7A 4KK4A 1WE2A 1NV8A 1U90A 2CXNA 2PRSA 3BCRA 3P1JA 1VL1A 2X4LA 4GDFA 1BD4A 2JGRA 1AMNA 3C3MA 5LP6A 4UW9A 1KC1A 5A3RA 2WWHA 3PNBA 2XWPA 2HQSA 2FI1A 4PXSA 6GPBA 1ISHA 5K2OA 2DETA 5KOHA 4XE5A 1OZHA 3HTXA 3K6RA 1JR2A 1FDUA 3ZCUA 1I3NA 2VF5X 2PV0A 5KB3A 1Y34E 2OCIA 1SBNE 3CUSA 3WB2A 3HZRA 4XZ3A 2OK7A 3TLZA 1ETHA 2OA0A 1K75A 2XCIA 1VI2A 1KZ6A 1KPHA 3E2MA 4OD0A 3WKEA 2G6TA 3MW8A 1NQWA 2PH7A 3QXSA 3T1TA 2HMTA 2BHRA 2NXJA 3NHYA 4I50A 4BLQA 5CB0A 1MV5A 1T9DA 4Q3NA 2WTEA 1YHNA 4V38A 3J81A 4XDGA 3T9BA 3U60B 5AOBA 3BHIA 4ZIRB 3HP4A 4KKVA 4Z1MA 4CLRB 4JP1A 3VU3A 5AD1A 1KY2A 2IEZA 4R41A 1NRXA 2NZUG 4CLHA 4XQGA 5E1BA 1B43A 1UPUA 4MW2A 5TS2A 4C07A 3FOZA 4MWGA 1RC0A 1NYRA 2C9ZA 3EIOA 4IWYA 2QTRA 4MUJA 1O6GA 2JC3A 4MRVA 2AZXA 4R8SA 4FHCA 2W9XA 4BKPA 1GU7A 1NVFA 1E4YA 4A8TA 3KJNA 1PG5A 2Q5HA 5KC9A 1EDDA 1C5KA 3ZW9A 1BDIA 3OJXA 1KEPA 3U80A 4WBNA 1A77A 1AJEA 2NSDA 2FOLA 4LCEA 4M0DA 4TLLB 1WS6A 2I3AA 4TSKA 2B20A 4WOCA 4M3NA 4CIDA 1JBKA 4DCGA 3CRZA 1XU4A 3LDHA 3OOSA 4YACA 2C7PA 1XQ1A 1CFJA 3AP3A 4JCCA 4LV5B 3DV9A 4KDCA 5AJYA 2P9BA 4YJ2A 4K6MA 5K0FA 1NLMA 2MR6A 3KT3A 5J2UF 4PG8A 1S2GA 1VE7A 1UXJA 2WSBA 3QEJA 1LFDB 5DRYA 3W6OA 4BO5A 2AG6A 2VATA 3JAWA 3GLFB 4UXIA 1CDDA 1DZ3A 1ULTA 2RBKA 3RD5A 4RNDB 2C92A 4DIEA 1VKZA 1FXUA 1G8MA 3UWDA 2BGIA 1EBBA 3W5CA 2WD9A 1Z4IA 2C5FA 3CNBA 2CYBA 2H7VA 4FOTA 2QZJA 1B8PA 3FVQA 1XMXA 3LJKA 5J63A 3X1DA 2QN9A 2PWZA 5C5EA 1BMFD 2ALJA 4L5IA 1MHPA 4D4KA 1ZGCA 2WWXA 4GKAA 1DIHA 4BV3A 3HU1A 3DZFA 2XB4A 4RGVA 4KRGA 5CG1A 2AC4A 1Y8RB 3HXLA 1EMDA 4NIMA 1MMFB 1NR7A 1WTCA 2HMVA 1S3FA 3R7BA 5HXAA 2Q9UA 5DASA 5AOCA 2AOVA 1I4OA 3DOFA 1N25A 1X7HA 1XQVA 1H5NA 4MUAA 1CU1A 3RJMA 3F47A 1PR1A 2BHTA 3G5UA 5JAUA 1TA9A 4GLFA 1XVIA 2DFDA 1O95D 2B1GA 2I6UA 4EEXA 3C8MA 3Q3IA 2VHVA 4LNAA 1CJBA 1GL6A 5B1YA 3SIXA 2GA9A 3OIWA 3QM1A 2ZZKA 4W1QA 1E64A 5KVCA 3RCBA 1OJLA 4MRRA 2OBBA 3WNZA 4K2AA 1JEYB 3VTFA 1N1GA 1ZVKA 1MQ9A 3CM0A 3SYRA 1Q1QA 2R6AA 3PFHA 3F4LA 3KWFA 3DEHA 3ZZMA 3LW8A 4DTIA 1HNZB 1Y6RA 5HQJA 2BEVA 3D8BA 1FIUA 1KZ4A 2J09A 4UKDA 1BMFA 3FMOB 4HS4A 5E2AA 3V7WA 5BOVA 2PSDA 4DBVO 2ENUA 1LRJA 2E55A 5F5XA 3ZS9A 2I2FA 4TM8A 3D4BA 3VPFA 1V6CA 1Z5OA 3LG2A 1IHDA 1JZQA 1G21A 3GJ4A 4XM2A 3DOHA 2CNOA 3TGWA 4I4TA 4TYPA 5HNKA 3GEIA 4BATA 1XVLA 3WJAA 4UMVA 1L4BA 2ZDQA 4V2UA 5H83A 2X1MA 3R40A 3WRVA 2CFRA 2GEVA 4NE7A 4ZV7A 2OV6A 5C5IA 1O95A 5LBTA 2R65A 2VWGA 3HS3A 5TXGA 4EGAA 5IFKA 1Z3IX 3J7TA 4UBOA 3KJEA 2O23A 1Q19A 1N9GB 3TR6A 4DFDA 3T6KA 5JADA 1XAGA 1OUMA 2J67A 3AFNA 3MJTA 4N1AA 3CLSC 1WHTB 1UQRA 1MABB 1IXKA 2J46A 3B6ZA 3C41J 4X92A 4S2EA 5T8KC 2W70A 5A3SA 3RFVA 3VX3A 3OEED 4Y9DA 1HSOA 1X1EA 1LFAA 2NSJA 5CB4B 1LZKA 4BWGA 1T36A 3TJZA 4EHJA 2Y1GA 1VRWA 3OAAD 4GHWA 4RVOA 2WWWA 3IP5A 3RVSA 1M0TA 3LUFA 4XIJA 1CUHA 5FOXA 3TOCA 1M2VA 3ET4A 1A7KA 4V0OA 4QYSA 4D96A 4DG8A 4ODIA 4ZKDA 4G0UA 1OT5A 2G25A 4MI6A 4LTNA 3JAKB 2XUAA 1K1EA 4OQZA 5M3BA 2IOFA 3RU3A 1B0PA 2BZGA 1UK7A 3B20A 3HMQA 4MJ7A 4OHXA 4YJKA 5JEDA 2HSWA 4IIYA 5CX1B 2XBMA 1E94E 4H2DA 1BWSA 4Y98A 1FRVA 3P9YA 4OM7A 3OLCX 1AQUA 8OHMA 1QP4A 2DTXA 3NMUF 2P9FA 4YHHB 2C8KA 1SG6A 2PQMA 2QX4A 3KJFA 3UIEA 5JCZA 4L3WA 1Y3IA 4YP1A 5FB3A 3GCGA 3U1TA 3HL4A 2F4VB 3GOQA 2FZ4A 5DYNA 3P26A 3BE4A 3E3OA 3YASA 5CNKA 4BUZA 2DHRA 3TD6A 2R751 3QY0A 2PUFA 2P4SA 3GVIA 5BYJA 1TPZA 3OEEA 2MINA 1X7DA 1W9HA 1X0VA 4P3KA 4DR5B 1PTKA 1VFPA 3QKSA 1JBEA 1NM5A 2XWQA 3OAAA 2YQ5A 4H7IA 1U31A 3E8SA 4URXR 4XW2A 4NCHA 1AQIA 4OM8A 4D9MA 3N70A 3W9SA 2NUTB 3OHMA 4G1CA 3D3QA 2XDQB 1EP9A 1V11B 3C4QA 4HMOA 4COOA 5TPWA 5A05A 3SYNA 2IPOA 2WWYA 3SX2A 3V4RA 2ZR7A 5K3AA 4CCYA 1O54A 1TQ4A 2I22A 3ZCTA 2BD0A 3UJPA 1XZAA 2WC1A 4QDJA 1QG2A 1GPDG 4EYQA 1WDMA 2HF2A 1BWRA 2HK9A 4EEKA 4KXMA 3ZQ4A 4DMFA 5C7LO 1OX6A 4YH1A 2YN4A 4MS1A 2VK2A 3NHKA 4YO7A 1HDGO 2FZGA 4DGSA 1N6KA 4IDBA 3B8EA 4QRIA 2B1IA 1SQSA 2QAIA 3W5DA 1U8EA 5FUQA 3JATA 4NICA 4C43A 4QDKA 1Q1NA 1Q95A 3G2IA 1ODFA 1E6CA 3QH4A 3LWBA 1U94A 3T5CA 2DHQA 2QGZA 1N5KA 4WCFB 4WMLA 4H27A 4J7AA 1JXQA 4CDGA 4EY4A 1I2BA 2YJ5A 2JRLA 2VNHA 4A26A 1EFPA 1I1QB 4KBYA 4UREA 1JHOA 1REQB 4GEKA 1M6YA 1VBMA 3ILVA 1G3RA 3OX3A 4I50F 4DA6A 3C1UA 1NBEA 1U2GC 2XMZA 1ZK4A 3VVLA 2I8AA 2J32A 5GQSA 5KO2A 1F8YA 4U7JA 1TMYA 4UNIA 2OGWA 1M33A 4CI9A 5M04A 3HK2A 4RIGA 1W48A 2WWRA 4MW7A 4EWLA 3II6X 4M22A 4QOHA 4AZSA 4ZZ3A 1AKQA 2IBSA 4P35A 3K20A 2OZLA 3FOFC 2XXAB 1C81A 3U4AA 3GFFA 5H3CA 1ISGA 1CS4C 2GI4A 1A95A 3K09C 3NC4A 5AM0A 1PQUA 2Y8EA 1CDEA 1CUCA 3MMZA 4MQUA 4BKOA 5IYZF 1WUHS 3EJ6A 5JI3E 3JVVA 3F6YA 1ZOLA 3ROMA 3EA5A 4KLZA 3OTGA 3K0SA 1FFXA 1OY1A 3TEFA 2P3LA 3OOEA 2GUWA 2RH5A 4OF4A 3A4TA 2JIQA 5FWDA 1ZNXA 5B1IA 2BMFA 2OEPA 1ORRA 2NXNA 2PR2A 3R74A 1XWWA 3H2BA 4JLWA 4LC9A 4UNPA 3KE9A 5DMXA 2SBTA 1PTJC 4V1CB 1R0YA 2HSGA 2IXBA 2OD9A 3EN0A 1EQAA 1DC5A 5JU6A 3ZHRA 4AZ0B 3C7CB 2BM9A 3B1ZA 4DXDA 1PYGA 1X1AA 3KJHA 4JLKA 5CDHA 4RULA 3RU2A 2C95A 4DARA 3WNDA 3IAEA 1H0HA 3R0QA 2Q3MA 2AW3A 5CD1A 1R10A 2RI0A 1LI5A 5FLXA 1N0WA 1PGOA 5GGYA 3OD1A 2DUNA 5GOZA 1CZKA 3UK6A 2Z2ZA 5GZ3A 1WPQA 1PWXA 5JDCA 1IDOA 5DHUA 1RYBA 1NMQA 2H0RA 5IKOA 3SNHA 3W77A 2WOOA 4C29A 5L40A 4AECA 3GFBA 4OAPA 3TLMA 3PFCA 1P5HA 1ZM9A 2EX1A 4TWRA 4XUEA 2G5GX 5D1NA 1TTPB 2P2SA 3M3DA 3U4HA 4QTTB 5D6OA 3MXTA 3SDSA 2J9XB 3SS8A 4EJSB 5BSHA 2OY0A 4G63A 5JC1A 2HXSA 3MRTA 2JCGA 2WJWA 3ONFA 1TEXA 1U1DA 1X1RA 5HE9A 5AKZA 3C3EA 3OPQA 3OOJA 2QLNA 1KKUA 1SFRA 4IY1A 4NJMB 4B87A 2CE2X 5DU2A 1VHJA 3PA6A 4Y6GB 1JDPA 4P4SA 2QG4A 3THWB 1AF4A 5JJIA 1KMIY 2VPPA 3BL5A 1FC0A 3FTCA 4ZU1X 5EOVA 4AROA 2WVAA 3PR3A 4Z9AA 4ZGWA 4EL5A 1XLTA 1H2RS 1B0ZA 1Q20A 4P31A 4R8RA 4RIFA 1D6SA 3SF8B 4C0BA 4INAA 3UMRA 5KNBH 4G07A 1P7PA 3M6AA 4HYTA 1KAHA 1XQ9A 3WMFA 4QPNA 3AR5A 1W76A 3CUKA 4PZPA 1YBHA 1FTYA 1NPDA 3P5SA 2FW8A 3QJGA 2CKMA 5G1OA 2IHKA 3C7KA 4IYJA 2NUAB 4PRZA 4IDGA 2GZ3A 4M1TA 3WIVA 1WMBA 4U2GA 1YBMA 2Z95A 5GM1A 3H3XA 5GIPE 3RTAA 3P96A 1U0JA 1ISSA 4OMFG 4TS1A 4LPSA 4YRDA 3KKLA 2QZZA 3N2GA 1RPTA 1NYTA 1T5BA 4R8LA 3CJQA 4G4JA 4I4TF 5BN4A 1KZ1A 3IMCA 2BFFB 2RGXA 3ZDAA 1EWTA 1F60A 2DJ5A 3KYDB 5HEKA 3ZZ1A 2JZNA 1E2LA 3HXPA 5JD6A 1W36B 2HCTA 2YINC 3CSDA 2PQ0A 3KQKA 3WGQA 4HL6A 3U5ZB 3TE7A 3E9EA 1H2BA 2ZYWX 3FYUB 1UPXA 3GQBB 3L0SA 4MHOA 2DLCX 3RVBA 4WK2B 1RLOA 2EAUA 2X22A 3R76A 4KR3A 1HFWA 1G9TA 1SC1A 2VF8A 3BXXA 1E3DA 1AE1A 3JQ9A 4ACBA 4NZPA 2XMSA 1JSLA 1ZESA 4IXWA 4PCLA 1VZ2A 3U3OA 3CH7A 5BNWA 3DOIA 4M37A 1JDTA 1L5LA 1J07A 2R1VB 2QTBA 4MX8A 4NHEA 4G24A 2JFZA 2PZFA 4Y1RA 1PFGA 2HWYA 2I9PA 1MP0A 3K2BA 3ODPA 1VJCA 4KX3A 4WOKA 4GIBA 4KGZA 1JLLA 2H9YA 1R6BX 2Q4RA 3T7JA 2W2LD 2ILTA 3GLVA 4NG4A 3RWOA 1V5FA 2XT9A 4FILA 1NF8A 1DV2A 1QO9A 3ZIUA 3HBAA 4D44A 3I8OA 1E9DA 4LI3X 2I5PO 4GX1A 1UMBA 1EHYA 4BQSA 1KFJB 4MCJA 1G1AA 4YPVA 4GMGA 4R2WA 3K9LA 1LDMA 1YU6A 1ODSA 3DD5A 4ARUA 3ZV4A 5G0TA 1LVHA 1DS6A 1KVUA 1UR5A 2VXBA 1G19A 2MYNA 3LT1A 4JB8A 3E1SA 1RM0A 2CHEA 1YIAA 6CHYA 1AC5A 3F8WA 4GUDA 7REQA 2WTBA 2QY9A 1WZEA 5H68A 1ZJYA 3KJQA 4D0RA 1I94B 2P0EA 3B3JA 1LLUA 2WJVA 3IAHA 4H7PA 2FTKE 3CG4A 1IUOA 2XQVA 3QOFA 1B6TA 4LY3A 2F3RA 2XYQA 1O4VA 1E3SA 2Q1YA 1CJSA 3ANXA 3EFHA 3ILHA 4R7ZA 4Y2RA 2QRUA 1FZTA 1QONA 2J85A 5LQAA 2C3UA 5JE8A 3A31A 4CV1A 2QG9A 3HLTA 4D4MA 1MEJA 2LBPA 5EWMB 1NX6A 2W2LA 3H99A 3VGJA 1U6KA 2M1XA 3AFHA 4RH0A 5DT2A 1GYPA 2JAUA 2TMGA 4HK4A 1XPJA 3OQBA 3L6OO 4R9VA 5ERGB 2ZJFA 1ESCA 1IRXA 4C7JA 1A72A 4FLMA 3CZ4A 4RTKA 2ZBFA 3OM0A 3R20A 4U7DA 4BZZA 5HX7A 4OQDA 4A0FA 3RO7A 1Q44A 4CEJA 1MEOA 4J2TA 2B7BA 3FY4A 1JIIA 3H4TA 4ZO9A 3R7WB 2LZ0A 3EW9A 4MP3A 4BAUA 4DIUA 3HN7A 2QD2A 1WTAA 3OC6A 2GKGA 1RAEA 4TRNA 5F52A 4U00A 1BH2A 5AW1A 4DHEA 2BH2A 3ZGVA 3G5LA 4LN1A 5E4YA 3IQDB 3WB0A 5FV7A 3ZWAA 3GOHA 2D6FA 5BMVA 4I6GA 3BKXA 3I83A 2IW1A 2DCMA 3A1WA 3CN9A 3RRNA 3L4EA 2JIZD 1A88A 1CC1S 2C4TA 5CYPA 4ENUA 4BX8A 3PFIA 4D42A 3OQNA 1XXLA 2HHAA 1YUBA 3DE6X 3DT6A 4TYMA 1TKRA 5KWSA 2O20A 3GLFE 1CZNA 3B6EA 2P9YA 3GGGA 2QQ5A 1KQ3A 4L8FA 5E1OA 1I6KA 5JAMA 2HAEA 2OCLA 4I99A 3VYUB 1DGQA 1W88B 3BGWA 1I33A 1DAKA 3NWPA 3AINA 4ND5A 1YSCA 3LTNC 4J0KA 1U8AA 2ZJBA 3KOZA 2FXVA 3RV4A 2Y27A 4COKA 2PXCA 4R7TA 3OD5A 4EHNA 4JU8A 2DHCA 2IPXA 3ZNOA 4DPKA 1JALA 3CR8A 3C7AA 5SZKB 5JZBA 4RTPA 3BWVA 4ZP1A 2PLWA 3L7OA 3ON5A 3S2IA 2J31A 3V7FA 4DWJA 3CRNA 3SG0A 3AG5A 4O4HF 2NU9A 3ZZTA 4BKUA 2JLQA 3ZYZA 2VA8A 4RA6A 1D9XA 2E9SA 4NBVA 1P4HA 3HBNA 1TI7A 2XUIA 2JIZA 4LFBB 2WTNA 4J1QA 3KOXA 1ZOOA 2IYNA 2KBFA 3GJ3A 2ZTMA 4ZOBA 4BNJA 3KC2A 4Z7NB 1MH1A 3CLUD 2WU0A 1KHHA 1M54A 3EPRA 4JROA 4ZTZB 1X92A 1JU3A 2QUZA 3MJVA 5IKXA 1G5TA 3DUWA 4G0VA 1Y5MA 3EZ7A 1PKEA 2Q3FA 1VM6A 4YUXA 3W9UA 2H8GA 2F9FA 3T9DA 3IT3A 2P6RA 5FO0A 3F9CA 2E4VA 4D9KA 1QCDA 2PX5A 4YCLA 2GK4A 2XE7A 3D5QA 1GT6A 4GQAA 1ZD2P 1BHJA 1VSBA 1Q7EA 2PZAA 4C04A 4NRDA 4IICA 2VPWA 1GZ6A 3NDIA 5BSRA 1SG0A 2EP7A 4ACAA 2O8CA 4G9EA 1Z2CA 4G5FA 3N8DA 4J07A 1GN8A 5EE1A 2ZYDA 2QP3A 2CLDX 3LVRE 5IKEA 3RAJA 4UE6A 1PWEA 3I62A 5JCPA 4MICA 2EG9A 5HHTA 3AERA 2BKUA 3MWEA 1N6OA 5FLKA 4MRSA 1AKWA 2QAGB 1E3WB 5HMLA 5L3SA 1ZN8A 2XLBA 1X3SA 4AJLA 4ONEA 2ZXFA 5DM1A 4D3XA 2Q07A 4JVNA 3IUQA 4ZREA 3OWHA 2QN8A 4GL4A 1YR2A 3WYAA 5LOVB 1I13A 2ZYGA 2WPDD 1Z4MA 2O7VA 2N3ZA 1WVGA 2QGFA 5AK6A 3VC3A 2AF4C 5ESXA 2OCPA 3LY5A 1Q12A 3E7WA 4RH1A 5B64A 1E2UA 1M2JA 1KYWA 3P2IA 4Q05A 2XUHA 5ALLA 4Z0NA 5KQLA 4GKBA 3UMYA 4WA7A 1ZN9A 2XWJI 4AF6A 5HJ2A 2GF9A 2CB9A 2R4UA 2WW8A 3DAYA 3WG9A 3SQOA 2L2QA 5ICGA 2V96A 1SXPA 2CUZA 3SX4A 4CMGA 1LS6A 3Q2KA 3JSAA 1W30A 3ROKA 3UH1A 3K0FB 1IZ7A 2NGRA 2JARA 4Y2UA 1SVLA 3QYPA 1A5ZA 1G4AE 2B5VA 4NBNA 3RQSA 4JYAB 1ZGJA 2OAEA 1N0HA 2FUKA 2Q3HA 2XA2A 3D6MA 4WLEA 4EEZA 1C80A 4AMVA 3OQ1A 5CXQA 4IHQA 2YXPX 1ESMA 2XUZA 2O0MA 2ZUWA 3IOBA 2XRFA 3WLEA 3D3NA 1ZUD1 4FFBA 3HY3A 2BFDB 2D59A 1GQYA 1D2GA 2WF9A 2WPDA 1DCMA 2ISCA 2VKQA 3JS5A 5C0OE 5G4KA 2H18A 3L7KA 3VPDA 5IAAA 3H4IA 4G5YA 5KTPA 1BE6A 1C7IA 1FBTA 4PQYA 1XHEA 2WJ6A 4B48A 4FOSA 3O0TA 3BAZA 4KQ2A 4ZOLA 3R7SA 4AS2A 3TZCA 3FB1A 4UUBA 2FF5A 1Q1GA 2QSZA 3UWSA 1NPTO 3ZE6A 5AVSA 1NTRA 2J30A 2YC2C 3BWCA 1PK7A 3F3SA 2XVMA 3A4IA 3VHXA 4CKEA 4DIBA 2AMYA 1YA8A 3L0ZA 3PNPA 2VDOB 3R7LA 3I9FA 1IZ9A 2R1ZA 4H6PA 4OTZA 4LSMA 2R8OA 3SFZA 5CR9A 2BE9A 4LV6A 3R41A 1T5HX 1ORHA 2G1UA 2C1ZA 1MAAA 2UVDA 3O4IA 3U4IA 4RMJA 3IPAA 4YCMA 3I73A 1BHO1 1B7GO 3OJEA 5IBRA 1JEQA 4RPLA 1WQ3A 2PWBA 4AW9A 5JDIA 3SQDA 2VHEA 4NARA 1AURA 3PK0A 1PJQA 1DQZA 4B0PA 4M83A 1RHJA 3K96A 4KOEC 3B5EA 5HZKA 2QVLA 5KHAA 1WXGA 1CHDA 5T6MA 4OYLA 1D5CA 1QQ6A 3HJRA 1BMQA 1GV1A 1HWYA 1C1XB 1KXJA 3SEAA 5AM2A 3E8XA 2ODBA 3AKEA 4MQLA 1IVNA 1KYVA 2DFKB 4F5ZA 3RLFA 5K2MA 4YIHA 5DXAA 1PWHA 5E2BA 4Q4HA 4N9WA 2Q7OE 4O2AF 3IAAA 2DXIA 4DNOA 1WLYA 4F93B 3BN3A 3UMSA 3R75A 4OXQA 1OTHA 2J3MA 3FUUA 4MARA 5K8TA 2HIHA 2ZITA 2FN4A 3CUVA 3BE5A 4OHOA 1RMTA 5KNBD 1XA0A 1FX0A 1F06A 5J43A 3R3JA 2FPRA 5HM8A 1Z4KA 2X3UA 1RI1A 1TQ8A 3PV0A 1WOYA 1YE3A 4I1IA 5HILA 1Y8ZA 2WWFA 1P1KA 1QIIA 1KDYA 1DL5A 3EZYA 4HNTA 5LIPA 4FFVA 4D3YA 1XKTA 1A4RA 1OB5A 1OTXA 5JO9A 5C7YA 2G77B 4NAHA 5TR9A 4AJEA 5GVSA 1BE0A 3F6BX 3RFUA 2JBHA 3SBXA 1SBQA 4E5DA 4BVJA 4CZ2A 5DIZA 3VPHA 4HUTA 2H92A 4RH3A 5E6RB 1AT1A 1MRZA 1NONA 3LQFA 4NYJR 1BD3A 1HH4A 3CX6A 3X1MA 4UPEA 2DEUA 4N8EA 4OXRA 3BT7A 1P2UA 1RKUA 3QXJA 7AT1A 2JNWA 4IJWA 1D4AA 5KTKA 1UZUA 2NTEA 2X5KO 1PGNA 2LV8A 2IODA 1DKPA 2FUCA 2JIPA 3BFXA 3IT2A 5EHQA 4E1BA 5KNDH 2C4MA 3GARA 3KCQA 4PGFA 5IG2A 2D2IA 1EWVA 1I2ZA 1PL6A 3FYTA 4DIMA 5KZMB 3ZWPA 3KEGA 4YJGA 1YF3A 1QQAA 4FBLA 1VE1A 5ECYA 1LSOA 1R0SA 2QRVA 3KXPA 2AG5A 1E8DA 4RQTA 3SJ7A 1I4WA 5KNBA 3AF0A 3NIDB 1J20A 2FK7A 2QM8A 2Q2VA 3UCXA 4BKRA 3P94A 3O2JA 4JUAA 3E70C 2OXRA 4LYEA 4ZEMA 3ZY3A 4D5EA 4UNQA 4DANA 3ZW7A 1SELA 4RM2A 5CNJA 1KARA 2MDTA 4UQPA 3PRKE 1OXXK 2QW0X 2IHZA 4MKRA 2CLLB 1TZ2A 4OSOA 3OLZA 2XT0A 4YLGA 1K27A 2AXNA 5AICA 3VR3D 5H02A 4ENWA 3LCMA 2Z5VA 5DEIA 4L8YA 4Z7QB 1EUCA 4KMRA 1E8NA 1KO8A 2VTKA 3TZQA 1O9BA 4D74A 4YRGA 2GJAA 2P30A 4CQMB 5TV2A 4B71A 4D5GA 3WX0A 2W2XA 4EW1A 4B4VA 2WHPA 5HF9A 4N39A 1FQJA 3S2YA 3ACDA 1RWMA 4C3OB 1DVRA 1V5IA 4IH4A 1C0IA 5F5LA 4ZVOA 1Y1KE 2BMJA 5FPPA 4PSDA 3ETLA 1SR8A 3IQXA 3MCVA 3LP8A 3KB1A 1MAHA 5KHLB 2G76A 3KYJB 3U7JA 4BO3A 2C9BA 1OYYA 2HJHA 2QR3A 1YC2A 5FYQA 3G0BA 1QF6A 2C2OA 4GOKA 2GCIA 1J0AA 1XZ8A 4AP6A 2A35A 2QXYA 3JVIA 4LHYA 5JAOA 1U7DA 2Q5LA 3NH6A 4LMAA 5IJ9A 3A2KA 1EXVA 3P9CA 2Q62A 3ICWA 3NPAA 2R8BA 3IRUA 3OQ6A 1GTJ1 4ZEOA 2AD1A 4D4GA 5BOSA 1C3OA 3VR3A 4BN0A 4G1EB 5ENDA 2YR0A 3DMNA 1NZJA 5J2TB 1H5UA 4N0DA 3QPUA 2BHSA 3LUBA 4NZMA 2P41A 2G67A 2F43A 1BDBA 5BURA 1HMPA 3EDYA 5JVDB 1EJ6A 1WXXA 4FT2A 4GP6A 1DBQA 1KE1A 3IE1A 4CIXA 1ZK0A 3A1CA 4CIWA 1YJAA 2A9JA 2JGJA 4B4OA 1CKEA 2MCFA 1ZC3A 5AUOB 3H11A 3B38A 4I36A 4MITA 1RR6A 2AF3C 3BJEA 4OREX 4P86A 4WGGA 3G3EA 1T3TA 4RPCA 4Y3UA 4RMGA 2JI4A 5EWJB 2R25B 1DXYA 4HRVA 4YMIA 3VDXA 3AR6A 2ZWVA 2WA2A 2GBLC 2IYTA 3BWXA 1GQRA 1GQOA 1YZVA 2I65A 3MTGA 4N12A 3TRDA 4UD2A 1Z6TA 3OFND 1NW6A 3EFOB 1TYAE 3LUGA 4JWKA 2PUBA 1X7YB 2QTVA 4I1RA 1QHHA 3GJ5A 4L1KA 5DVZA 4GYYA 2GNAA 2PV7A 3LIPA 3G2KA 4I5DA 4YBRA 4DMKA 2DH6A 2RGDA 5A2QA 4NOKA 2WYOA 3KAJA 2I3BA 5AW2A 2V65A 1IMOA 4ZHQB 3SFTA 1FDOA 1EWQA 1S8AA 1XZNA 4AJNA 5HMMA 2VL7A 5AW0A 4UVHA 1ZK3A 4O2BB 4DEXA 3MHTA 3I12A 4LX0A 4TS4A 4UHFA 7MDHA 1VMAA 1DX4A 5CB4F 3ZQJA 1K86A 5F5NA 1OC2A 1CY2A 3RARA 2JGKA 3H0KA 3GMSA 4JKYA 1IQ0A 4B76A 3K70D 1JWLA 1ZCAA 3JASB 1T0IA 3KXKA 3NT5A 4J6EA 1YZGA 2UYCA 4KIGA 3LKZA 3ST7A 3JVUA 5C4GB 4MR7A 3ICQB 2A5JA 2COUA 4G5OA 1GSAA 3QKIA 1V2HE 3PIIA 5AKIA 1EX9A 3TW0A 3VJLA 4UBLA 4C89A 2FK8A 5FTMA 1FPQA 3MUNA 2DX7A 2VJDA 4FP9A 1OIVA 5LP6B 2PL1A 2R8YA 3HVUA 4BNXA 2ZQYA 5AI4A 3OFNA 2D2VA 2PJUA 6Q21A 5KOHB 1NFFA 2IZ0A 1PG0A 1NQOA 3HFJA 1GTL1 1JEOA 1FDWA 4R5HA 5DHTA 1V25A 3A0RB 5EFOA 4GMKA 4J0EA 1TM3E 2HPVA 4PYQA 4RTJA 2NW6A 4ENVA 3CVUA 1E1CA 3G0CA 4CM4B 2OAGA 4DBLC 3B60A 1P1BA 2AMJA 3KO8A 1QVRA 4BGVA 2FJ0A 3OJ0A 1SUDA 3VJKA 2H1SA 4MPPA 1SCIA 1KOJA 2P91A 2CXOA 5DGCA 3D0RA 2BVNA 4HDNB 4RVSA 5FHRA 3REQB 4E15A 1S02A 1GARA 2WKPA 2Q9CA 3SD7A 4CKCA 1HA3A 1ZNYA 5DLYA 2VI5A 2XCUA 4U6QA 5LQCA 2HADA 5C5DA 3USES 2JHAA 2I9KA 4YQYA 5JMPA 1ZVQA 1QHEA 3K1AA 3SZUA 3HWWA 4BFVA 1RTKA 1G291 1L0BA 3TTXA 3H75A 5I7AA 3RWBA 1ZD5A 1L5SA 1VA5A 5ES4B 1L5ZA 4K9KA 3C6XA 3MNFA 2CLFB 3DP7A 2I7VA 1CJTC 2WNSA 4JYZA 4J43A 1MO4A 3DWIA 4HLUA 3MLEA 2J9ZB 3CLKA 4RQUA 1TIPA 3VFDA 4WBNB 3WNVA 2FPIB 1LNQA 4H6VA 2X2EA 2V6FA 1LDGA 1ENOA 2Z8ZA 4MW5A 5B58T 3UB2A 4IIJA 1TGVA 2FWJA 1QNLA 3DBIA 4ZCSA 1KIFA 2G1AA 3O1HB 1W581 1M8KA 1N77A 2VNJA 3LHFA 4K05A 5IULC 5DBFA 1YK1A 3D6NB 1X1DA 4DN6A 4GSLA 1O87A 1QLWA 3LPMA 2Z8XA 1E9EA 4N7RA 5LZ5A 5FPYA 4Q3DA 2A7XA 3PPVA 3TDNA 3X1YA 3NHJA 3TTWA 2XUOA 3WWOA 3QKTA 2O4UX 5KWVA 1GSIA 2Q27A 3K6JA 4CUZA 3EPHA 5BN1A 5J4HA 2VLIA 3CR3C 3KQQA 3IDAA 1RQPA 4WBSA 1GPNA 1F2VA 2GN9A 2QN6A 3DL0A 3OLXA 2JJYA 2CLCX 1XZMA 3KFVA 1WOMA 2X58A 3FWHA 5F7ZA 5EMKA 5BWCA 5BO5A 1WD7A 2R8EA 3RWMB 5K0BA 4TX1A 3AU9A 4GLBA 4EHDA 4CEHA 3DV0B 1BEEA 1Z5WA 3NHLA 1NJ1A 2Q4TA 3NVKI 3BH0A 4IKEA 3E03A 2P2GA 3EHDA 3WGKA 4P84A 1VI5A 4LNHA 3WAGA 3ANNA 3F5QA 1QRSA 1WDKA 4C7OA 2JFBA 1F38A 1D2MA 1LQTA 5CCXA 3S1AA 2ZI5A 4IDEA 2X0EA 3VH4A 5DM60 4MDEA 1OYOA 2JI6A 4PXYA 5ARCA 2FFBA 2YFQA 9LDTA 2ZKLA 1RLJA 3WIDA 1JG1A 2FF7A 3G02A 3RRJA 3WL7A 1H42A 4IEIA 2R60A 1V7ZA 3TH5A 1AXEA 4E46A 4XGKA 2BEVB 1LF0A 2F6RA 2Z56A 1TZCA 2I8LA 2NZ2A 1UBRS 3FVVA 5MN4A 1XRRA 1NW7A 4LFCB 3FPAA 3K0CC 3K5HA 1G21B 3G59A 3MJRA 4EA6A 4CU5A 1P1FA 1IY2A 1BQEA 3D7LA 1I30A 3EXG2 4XAQA 1T4DA 3UC5A 4EG5A 2J0SA 3A10A 3CYFA 5FXMA 4J29A 2Q5OA 1IN5A 3RW9A 3IBYA 3KJZA 1T4GA 5KUTA 5JIBA 1L4UA 3BC1A 1PT5A 5D3KA 3WTBA 4AO6A 1V26A 5E3HA 2HF8A 4G0PA 1SXIA 2QRZA 2M2IA 3NHSA 2JGDA 4LE2A 1QFXA 4JI0B 3QFRA 1YAJA 3CY6A 1F3LA 1S0UA 1ZD3A 2LXNA 4YXWD 4QUDA 4RV9A 1YS9A 2BGRA 2BGMA 4JDUA 3FCEA 3IQZA 1KAGA 1QZZA 1T36B 4GVLA 3RQIA 4G67A 4RSRA 1I7QB 3EWSA 4KQ1A 1DO2A 1WDTA 1VLVA 3AKZA 2F9LA 4MQEB 1HM5A 1M2VB 1X3LA 2EW8A 2Z2IA 3P2OA 1RAIA 3LOPA 1RWBA 1LQ2A 2BLNA 4ND8A 5EKXA 3VMFA 2PX6A 4TPKA 3A1FA 4LEIA 4P2GA 3O95A 2G9VA 5CTJA 5DLDA 3K2QA 4RPJA 3RFTA 3VSBA 1QX3A 2WDPA 4BP3A 3K9WA 1ZC4A 4KDRA 1TM5E 1Y7LA 2P65A 4YMHA 2IKSA 4J4TA 3W2FA 3H05A 5DHFA 3PTLA 2V98A 5ANRB 2XDWA 1RYHA 2FVXA 1GV0A 5K09A 1JJIA 5JLJA 5KNDD 2CL6X 2P69A 1M7BA 4NABA 3U1BA 3HPRA 3ABZA 3KT0A 4HNHA 4YXWA 4LXIA 1F2UB 2HMSA 2Q3EA 2MINB 3NP9A 5DXFA 3O8QA 1L5KA 1ABFA 1HV8A 1KGSA 3ID6C 3OQVA 2YCBA 4TL8A 4P0PB 1AVTA 3NM4A 1Z6XA 1QBGA 4HQOA 2X4DA 5HF8A 5FX2A 1S2NA 2OFXA 4I1OA 521PA 2J0QA 1J