1F3LA

Crystal structure of the conserved core of protein arginine methyltransferase prmt3
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
321
structure length
321
Chain Sequence
b'DLQEDEDGVYFSSYGHYGIHEEMLKDKVRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVIAVDQSEILYQAMDIIRLNKLEDTIVLIKGKIEEVSLPVEKVDVIISEWMGYFLLFESMLDSVLYAKSKYLAKGGSVYPDICTISLVAVSDVSKHADRIAFWDDVYGFNMSCMKKAVIPEAVVEVVDHKTLISDPCDIKHIDCHTTSISDLEFSSDFTLRTTKTAMCTAVAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTIFLLEKPFPVKAGEALKGKITVHKNKKDPRSLIVTLTLNSSTQTYSLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN ARGININE METHYLTRANSFERASE PRMT3
publication title Crystal structure of the conserved core of protein arginine methyltransferase PRMT3.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 99
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 2000-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 1f3lA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1f3lA01
2BH2A 2CMGA 1VE3A 2WA2A 3C6KA 2HNKA 3GIWA 5EIFA 4ER7A 3R0QA 1QANA 2PY6A 3PS9A 1VPTA 4QVGA 2GB4A 2FYTA 3C3PA 2P3LA 2OYRA 3RODA 5HIKA 2FK8A 3T0IA 1R00A 1NW5A 3Q7EA 1AF7A 3NWEA 2BR5A 5MHTA 3AXSA 5HILA 1FBNA 5JUWA 2UZ4A 3EEOA 2P41A 4RTMA 5DM1A 3P71T 1HMYA 2ZBQA 3H2BA 5HIIA 5GINE 3NMUF 2PT6A 1KYZA 5D1HA 4MIKA 1JG2A 3MCZA 4HRAA 4P7JA 5KQSA 2XYVA 3KKZA 4L7VA 4P7FA 2JG3A 3MERA 2YUIA 2H00A 5CVVA 1L9KA 2IP2A 3G2MA 3O7WA 4M38A 1D2HA 3X0DA 5LQCA 2IBTA 3M6UA 3A25A 5EIWA 3I9FA 2YQZA 3KQSA 2AOWA 5K09A 4ER6A 3P9KA 4GC9A 5GP1A 1L3CA 3I53A 3IV6A 1EJ0A 3KQTA 3EPPA 3LECA 4PGHA 4JXJA 3TFWA 5CM2Z 2ZZMA 5E2AA 2K4MA 4DA4A 3MB5A 2I62A 2G71A 3LDFA 7MHTA 3EEYA 4KWCA 4XCXA 3V8VA 3HA7A 4UOEA 1PJZA 4QDKA 3G5LA 5EC8A 2PXAA 2NXEA 3GDHA 3EGVA 2OBFA 5DRYA 4RVFA 3DMHA 4E33A 5LR6A 1I9GA 3AXTA 3LKDA 4EQZA 4YMHA 1KR5A 3FRIA 3P9IA 2QYOA 3BWCA 3FPHA 1TW2A 5HFJA 1BOOA 2E5WA 3BWBA 3CGGA 3LGAA 4V0QA 2YXLA 4POOA 4X41A 4YV0A 2HR1A 5EMMA 3RIEA 3SX0A 1WS6A 1ZQ9A 2IFTA 3CVOA 4CXMA 3FTEA 3DXXA 1TW3A 2QM3A 4KIGA 1PRYA 2DPMA 5FQNA 1UFKA 2QE6A 3TM4A 4ER3A 2XVAA 1RJDA 2ESRA 3FRHA 3KR2A 4PWYA 4F86A 1R6AA 2NYUA 2UYQA 3OFKA 5F2OA 4C03A 3QOXA 3V97A 1SKMA 2AOVA 4CKCA 5DSTA 3KQOA 2Y1XA 3I64A 3KR9A 3B7PA 2YR0A 1F38A 3EVBA 5E1OA 1NT2A 3T7SA 2N47A 2AOUB 3EVGA 1JQEA 4FZVA 4FR0A 3KU1A 2NNWB 4GOND 5E8JA 3UBTA 3VYWA 5E9WA 2P3QA 1BKYA 3FPJA 1EIZA 2OY0A 4YV2A 5LQUA 3IEIA 3MGGA 1D2GA 3G8BA 2NXCA 1JQDA 3KQVA 3CCFA 2ONZA 4YUZA 2XYQA 3ELDA 4RX1A 2HTEA 9MHTA 5EHGA 1VIDA 3FTFA 2IH2A 4Y2HA 1L1EA 1QAMA 2I7CA 3FZGA 3P2EA 3MCTA 2ZW9A 4PYOA 4PNEA 1BHJA 3HVHA 3GGDA 4C08A 1JR4A 1VL5A 3CKKA 2H11A 2B78A 2XBMA 2FK7A 4IV0A 1X1CA 3TOSA 2JHPA 4QQNA 2EJUA 3OCJA 3UJCA 3B5IA 4PGGA 8MHTA 1BC5A 2C7PA 5IH3A 3JWJA 4MWZA 2G8NA 3BZBA 2NP6A 1R8XA 2ZWVA 3ELYA 3EGIA 2AOTB 2PT9A 4KIFA 1R18A 2OZVA 4KDCA 4LWPA 4PYMA 2PSSA 3R6TA 3OU7A 4KDRA 4LG1A 1INLA 2JH9A 3DUWA 3TLJA 1MHTA 5HIMA 5ICFA 3UA4A 4EKGA 1EAMA 1V39A 3ANXA 1UWVA 3HCAA 3LL7A 5CVJA 3G2PA 5E9JA 5CCXA 3KQPA 5F2NA 4Y30A 3LDGA 3LHDA 4EKIA 2VP3A 5EQJB 1NKVA 3AWIA 2HWKA 3GRZA 3PX3A 4HH4A 3P9CA 2ZZKA 3MAGA 4KRGA 1EG2A 4OBWA 5M5BA 2V7EA 1NV9A 1N7IA 5FCDA 3T7RA 5K01A 4Z2YA 3UA3A 2FHPA 1KPGA 5EPEA 2G1PA 4GOOD 3PFGA 5GOZA 4DKJA 2H1RA 3C3YA 3GNLA 2P3OA 4E2WA 1TPYA 4RVHA 3TQSA 1O9GA 3BWMA 3BGIA 5EMLA 5DX1A 1JTEA 1NW6A 4FSXA 5DT2A 3VC2A 1Q0SA 1G38A 1T43A 1WY7A 1QAOA 1XTPA 3NDJA 3R3HA 4PYQA 2JHCA 2GH1A 4R8SA 4OX9Y 2AN5A 4A6DA 1ORIA 4O29A 5DM2A 4HTFB 3OU2A 4X60A 2C7OA 4GC5A 3E7PA 2ZIGA 1WZNA 1KPIA 3DXZA 3REOA 5K03A 1IY9A 2O0LA 4E31A 5LQRA 2PX4A 3NJRA 5LQNA 2ZVJA 2C7QA 3EMBA 4AZSA 5EOVA 1XCJA 3PTAA 1YFJA 1P91A 1SQFA 4M36A 2LD4A 3E05A 4FS8A 2A14A 5EKUA 3DTNA 2UYCA 3OZTA 2GAFA 5ERGB 5DXAA 2OB2A 2Y1WA 1AQIA 2OKCA 5FA8A 2O07A 3CBGA 3B3JA 1SVUA 2R3SA 3M4XA 1VLMA 1O54A 2ZWAA 2I6GA 3DR5A 4CKBA 4RTNA 2ERCA 1P1BA 3BWYA 1F3LA 5K8VA 3HVJA 4E32A 5FULA 4XUDA 5FHRA 2VZ9A 1DL5A 3DULA 4RTPA 1ZGAA 2CL5A 3GWZA 3M6VA 1B42A 1NBHA 2P35A 3ELWA 5FUBA 3ORHA 3DXYA 1EJ6A 3HM2A 3UJ7A 4YUYA 4OQEA 1P1CA 1YZHA 2G70A 3EVAA 3FUVA 4ER5A 5K0EA 5FWDA 2HMYB 3CJQA 3GXOA 3FUUA 3DLIA 5DX8A 4V0RA 1G55A 2P1DA 3E23A 1RI1A 3DOUA 1RJFA 4HC4A 2AN3A 5GM1A 3ER9A 3I5UA 1SUSA 2ONYA 3A7EA 5DM0A 4HGYA 3OZRA 3KPYA 2PV0A 3G5TA 2DULA 3OE4A 3B3GA 2XVMA 3TRKA 2YXEA 1RI4A 5DWQA 3M70A 2AOXA 4RTLA 2NP7A 3HVKA 1AQJA 4GF5A 5C9ZA 2ADMA 4P7KA 1NW7A 2PBFA 1MJFA 1RI3A 3GO4A 5E1MA 2IGTA 3SXJA 2AVDA 4YUVA 4MQ4A 3VSEA 5BW4A 4ISCA 1VP9A 3NVMB 2BM9A 4C04A 4CKEA 1D2CA 2B25A 2HV9A 3C6MA 5KYGA 3P97A 4EVIA 3OFJA 4X61A 3BKXA 3T7TA 4FP9A 1JTFA 4PINA 3KPJA 4PYKA 2JH8A 2PX2A 1G60A 5P8WA 4P58A 4QDJA 4R05A 2ZTHA 3KHKA 2KW5A 5DTQA 3LPMA 4M37A 2QRVA 4QPNA 4AUKA 4YUXA 4IKPA 5DM4A 1YF3A 3KPWA 1KP9A 2Z6QA 4K6MA 4RTQA 1FJXA 3ERCA 1U2ZA 2PX5A 5DXJA 3SMQA 2F8LA 2ZBPA 2VDVE 2BR3A 3FTDA 3SR4A 3NTVA 5CVEA 1WXWA 5C1IA 2FRXA 5G02A 3HCFA 3GRUA 4OA5A 2AVNA 5C0OE 1DUSA 3LKZA 4BLVA 3P9NA 3ELUA 3FUXA 1XXLA 4R6WA 5FADA 4ATNA 2NXJA 4BLWA 3UJBA 2ZZNA 1RI5A 3DMGA 2AS0A 3LDUA 1Y8CA 3R24A 4PCLA 4DM3A 3UJ9A 1X1AA 3G88A 3BUSA 3THSA 3O31A 3LX6A 1JG3A 1JSZA 2IDKA 1KXZA 3A7DA 3DH0A 2EJTA 3DMFA 3QOWA 4HG2A 5DLYA 2O06A 2Q41A 5B1SA 3SGLA 1DCTA 4F85A 1RI2A 3PX2A 2OXTA 4RTJA 5GIOE 1XVAA 3LSTA 5FA5A 5EGSA 4U7TB 4H0NA 1G8SA 1X1BA 2GS9A 3FTCA 3KQQA 4E2XA 4P7GA 4KW7A 3TR6A 1QAQA 4E70A 4GQBA 1Z3CA 4PONA 1M0EA 2IPXA 2ZFUA 2PX8A 1YFLA 4QTTB 2B2CA 2PGXA 2OO3A 4B17A 3LBYA 4QQKA 3A4TA 1YUBA 4RWZA 1KPHA 1KYWA 3OPNA 4FT2A 1OR8A 1UIRA 3SVZA 4ER0A 1IXKA 5K0JA 4R6XA 5EMKA 4MHTA 3PLAE 3G89A 2O57A 3M33A 1Q0TA 5E2BA 4QPPA 3HA5A 2ZSUA 3M6XA 2BM8A 3KR0A 3LBFA 4RVGA 1VQ1A 3WSTA 3E8SA 2B3TA 3CJTA 1ZG3A 4GEKA 5HEKA 5T64A 5ICEA 2I9KA 3QV2A 1IM8A 3LCCA 1JG4A 3HCEA 4C07A 4DQ0A 4HSGA 1NV8A 2ZLBA 2OPBA 3UJAA 4PYJA 2AR0A 4R8RA 5JR3A 4IWNA 3SSOA 1ZGJA 4AX8A 2VS1A 3C0KA 3F4KA 2PLWA 4FGZA 1VP3A 5F2KA 2GPYA 4RTRA 2ZBRA 4BP1A 5FQOA 5T67A 1KIAA 5LQKA 2R6ZA 1HNNA 3UZUA 3BKWA 4RSRA 1X19A 4AZVA 2VDWA 3SSNA 4ZTBA 4BY9E 5CVUA 5DSXA 3BXOA 1SUIA 2WA1A 3D2LA 5DRTA 5LQJA 2NXNA 3HCCA 5EKXA 4XUCA 3FYCA 5T6BA 2ZCJA 3OZSA 3HEMA 5EZSA 5BW5A 5K0NA 4RYLA 3JWGA 3GCZA 2AOUA 3DLCA 1H1DA 4CTKA 2ZULA 3GRYA 3OU6A 3NVKI 4DCMA 1FP1D 3PVCA 4OQDA 1ORHA 4PYNA 3TKAA 1WXXA 3FYDA 3U81A 2IBSA 3BGVA 5E8RA 4BLUA 2Z6AA 4X63A 3L8DA 5EHIA 3I58A 1XJ5A 3GRRA 3HP7A 3ME5A 2P7IA 5K05A 2UYHA 2PXCA 1G6Q1 5IKMA 3BGDA 1SG9A 3KQWA 5CCBA 3MTIA 4PIMA 3EVDA 3HTXA 5K0LA 3FPFA 4RTSA 1X1DA 4GOMD 3B3FA 4DMGA 4E2ZA 4AZTA 2B9EA 5EZQA 4CTJA 5CUQA 3P8ZA 2YXDA 4G56A 5U4XA 1ZHFA 1RJEA 2IDJA 2YVLA 4GUAA 5FTWA 3HCBA 3FPEA 3NDIA 1NW8A 5HZMA 1M6YA 1NW3A 4QVKA 3A27A 5EMJA 2XYRA 5DPMA 3ID6C 1O9HA 5FHQA 2VDUE 4WXHA 4BP3A 5HOQA 5K0BA 2AOTA 3M6WA 3TKYA 3P2KA 5H02A 1N2XA 3AY0A 1XDSA 2FCAA 5FWAA 2WK1A 3CC8A 5CD1A 1R8YA 3KQYA 3BT7A 3EVFA 4PCAA 4U7PB 4C06A 1JQ3A 3K0BA 1M6EX 3IHTA 3UWPA 1N7JA 5KVAA 4PIPA 4FSDA 4C4AA 1SQGA 2PXXA 2P8JA 3EVCA 4AZWA 3ER8A 3TM5A 2YTZA 3FPGA 2FPOA 3KQMA 4IV8A 5EVJA 3THRA 2JHAA 3JWHA 3R9XB 2OB1A 3NWBA 4DZRA 3KR1A 10MHA 4YUWA 4CWAA 3VC1A 1NE2A 5BP7A 2ZIEA 4C05A 4DCGA 3G2OA 5KS2A 2IH4A 2EX4A 2V74B 3B89A 5E1DA 3HCDA 4NECA 2GA9A 3PT9A 1XCLA 3CJRA 4E2YA 3G2QA 1XDZA 5LQAA 2QY6A 5CVDA 1P39A 3EVZA 4GBED 1QYRA 2PJDA 3G7UA 3UFBA 5ICCA 4KVZA 3EVEA 5KQRA 3O4FA 1KHHA 2P7HA 1YZ3A 2PWYA 4FT4A 3DP7A 5GIPE 4HTFA 4M7RA 3UJ6A 4E30A 1EQAA 1L3BA 3FUTA 4RTOA 3KPVA 3P2IA 3HNRA 4HGZA 5GM2A 4F84A 4RVDA 1NBIA 2Z6UA 2CMHA 1XDUA 3K6RA 3KPUA 1JSXA 3PFHA 4GOLD 3AJDA 4PYLA 3A26A 5K0CA 1L3IA 3FUWA 5E1BA 2AZTA 1I4WA 1VBFA 1WG8A 3LCUA 4OA8A 4PYIA 3HA3A 5K0GA 4MTLA 3OE5A 2ORED 1ZKDA 2CKDA 3EMDA 2JJQA 2IH5A 3SSMA 1JG1A 3LCVB 5E9QA 5D1NA 3RW9A 3MQ2A 3GRVA 5EEHA 4DF3A 5BXYA 3GU3A 5LSAA 5DX0A 3S68A 2O05A 2UYOA 4WVLA 2IIPA 5HIJA 2BZGA 2P40A 2G72A 3TPZA 5K0FA 2YX1A 2PWPA 5DTMA 2C7RA 3EGEA 1AV6A 3MHTA 3JWIA 5CIYA 2AN4A 4XUEA 1YB2A 4RV9A 5ICGA 2GLUA 4EK9A 2EG5A 2PVCA 3HVIA 3IYLW 4X1OA 2QRVB 4QTUB 3UJDA 3PB3A 4A6EA 4RTKA 3TMAA 2EFJA 5EEGA 4LWOA 2ZIFA 3G8AA 4EMSA 1QZZA 1FPQA 4LECA 2BR4A 5GWXA 5DTRA 1G8AA 3SM3A 3UJ8A 3NW9A 2CWWA 4YMGA 1R74A 4OBXA 1I1NA 2PKWA 4YV1A 3GJYA 1RJGA 1FP2A 5EG5A 3MTEA 3Q87B
chains in the Genus database with same CATH superfamily
1SHKA 5CLHA 1TMOA 3IURA 4AB1A 1UAAA 3NFYA 2MYPA 3EQ8A 4TSFD 4FUTA 1VHQA 3GK3A 4JUFA 3QBDA 1VKOA 3ZQ4A 2OGSA 4BMCA 4EMUA 5K8IA 1ABBA 1FFEA 1KGSA 1Z13A 3NWEA 4PO1A 1WUIS 4BFWA 2YZ2A 5HILA 1E66A 1Y3IA 2VSNA 3QI2A 4GR5A 1V5WA 1MFZA 2ACEA 1SVIA 2Q9UA 4YUAA 5HGJA 3NC0C 2W48A 1BMFA 4FOSA 3MNFA 3RYCB 1D7OA 4EYEA 3D5QA 3E0QA 2V3WA 2I8LA 3I01M 3LPCA 4BFLA 2GZ2A 3A05A 5FPKA 3IULA 1BIFA 2RGAA 2ERYA 3B1WA 4B6EA 4EJMA 2TMYA 2ZSKA 5CLLA 1PZMA 2X86A 4INJA 4IS2A 3PWKA 3JQFC 1D2HA 2CY0A 3X0DA 1LTHR 2CYAA 3M6UA 3QW4B 4XVUA 2PR7A 1CWUA 1EHCA 1THGA 3AR7A 1BMDA 1XZQA 2C5AA 3QE2A 4U8GA 3ZU3A 1JR3E 2V9CA 1V8ZA 1Z5PA 3DKKA 1OTXA 2BCEA 2D7CA 2O1EA 1A72A 1X0XA 2M6SA 2VK2A 5CNJA 1C29B 1M0SA 5DP2A 5ALYA 3TFWA 3T34A 3IT1A 4M0PA 5CAEA 1U2RA 2WIDA 1PGJA 1RRPA 3MLEA 2Y27A 3V8VA 2PKQP 5CA0A 4ZVTA 4E0BA 2WJVA 4EW3A 4ENVA 2OZLB 3BFJA 4FZ5A 3SEZA 2CFOA 3EGVA 2PKCA 3ABSB 4F2WA 1HF3A 3UCEA 2B5WA 3BG5A 1JT9A 5AMXA 1LLCA 2O8BA 1AGRA 2ODAA 2R5FA 3NHSA 3RB8A 2OL4A 1AK1A 5IJ9B 4LF8B 4MW5A 1OLSB 3HLTA 4GAEA 4TYPA 1HLPA 2BYTA 3FPSA 3GA5A 4UDNA 5LKAA 4UW9A 2HA5A 2C1XA 3I6QA 1N1GA 1C9DB 3SX4A 2XCQA 3LZ6A 2IYOA 1N5KA 3NHLA 3V97A 4V2UA 1X7HA 2JS7A 1X1QA 2QLLA 3B82A 4IJKA 2EF1A 2HDNB 4GGOA 1FXWA 2ZRHA 3MWFA 2ZJFA 4N76A 3IAFA 4FMCB 1EWTA 1TK2A 1N2CA 2PA0A 1X38A 2GPJA 1JGTA 5E9WA 3VYWA 3BRCA 3QUQA 5TGZA 2LV8A 4YCAA 4KO3S 4PQYA 2BMVA 2XTAA 5B1HA 4ZKEA 4KGVA 5CB4F 1P2VA 4QARA 5LQUA 4C0KA 1JQDA 1U3TA 1NF9A 4ERNA 2W2TA 4BEBA 3W5HA 2IC5A 4QOJA 1XLVA 3DF9A 3GT0A 2VT7A 3MUEA 4MNTA 1Y4ZA 3JALA 2JCGA 3ELDA 2WJZB 3WS7A 3IDAA 4CFYA 2G4CA 3ILSA 3EA4A 4NBSA 4TQAA 1EUQA 3OPMA 1X8JA 1FXSA 2XE4A 5JYEA 1ZOSA 1ZRNA 4HNAB 3H75A 4NMHA 3OTIA 3GQBA 1U28C 1N3BA 1NLFA 2GETA 4JJFA 4YP6A 3UMBA 2A86A 1M2EA 4BO3A 1R0BA 3CG0A 3LKBA 4KQ1A 1KI4A 1ZR4A 2VZLA 2XR1A 2YJ6A 3IE0A 2JJ2D 1OA1A 4XSGA 4MWZA 4B3TB 4OQNA 4Z4HA 2FOIA 3KVRA 4FHZA 7REQA 3EGIA 5B4UA 1K8QA 3K9BA 1W46A 2ZBFA 1TQ6A 1F0KA 1QIHA 1INLA 3FJ1A 1L5QA 4NBTA 2O7VA 4MUGA 3SXUB 2XITA 2NSHA 2IHYA 5I4IA 1V39A 3ANXA 2D1SA 1BCRA 3G2PA 3HS3A 1CZLA 3UNXA 4N5HX 4BE4A 5F78A 2FUEA 3CZPA 3M9LA 3D7RA 1OQAA 2A78A 4F3KA 3LHDA 5TE9A 5AJXA 3W8DA 3JS5A 4MP6A 3ZJ5A 1NMEA 3O4RA 4ZALA 3JTMA 1NKVA 2BDTA 1A7AA 3EIUA 4XB6B 1XRSB 5KTKA 1O4VA 3R3XA 3UFXA 9LDTA 5CTAA 3MOSA 1B43A 5KNCD 2P67A 4CQMA 4RSHA 2FPWA 5KBYA 5JAQA 5EAIA 1I30A 1ZD1A 3SQMA 3W06A 2EX0A 4QDZA 3RU3A 4OK3A 4RSGA 4ZJYA 2FPRA 3ON5A 2ZQ5A 4YRDA 3W5UA 2X0KA 3HBFA 3E7FA 4LHVA 3USZA 1JDVA 5HE9A 3RHZA 4XDGA 3R3HA 5DCWA 3PE4A 5LDGA 2AF4C 2JHCA 3ZOKA 4E03A 1KAHA 4RK7A 1U02A 5KAPA 1FNSA 1UBMS 3HY3A 1OZ0A 2D59A 4E6PA 3HB7A 4V1CB 1EFLA 1S3SA 3LQQA 4HPXB 3HQ4O 4R2XA 3EIWA 2EBUA 1UDCA 1ST3A 2NO5A 4P4LA 2VUTA 1FRFS 4IIGA 2GESA 5LZ5A 2Q6LA 3OEED 3L1IA 3UTDA 2R7NA 3LIIA 4OUDA 1C7IA 1VE1A 2E5FA 5LYJF 3PJFA 4FONA 3PTAA 1P91A 2P9JA 4PSKA 1RKBA 2HY7A 3KXPA 4ARAA 1WXIA 5L40A 1AG9A 3KU4A 3A4YA 4CYMA 3AI7A 3GVHA 1N4AA 1GTRA 5DNYB 3H0KA 1NNI1 2RAUA 4HVCA 2J9RA 4UPEA 4MS3A 3HBMA 4UBJA 2X6RA 1ISMA 3NIBA 5TT1A 3IXQA 2QROA 4YIKA 3W4IA 3ZDBA 4BKOA 1K6EA 4DG8A 2Q27A 5K99A 4DLUA 2D0PB 1CUCA 5DN9A 3M1LA 2CL5A 4YJGB 5G53C 4IO0A 5C2JB 3L4SO 5DNUA 2PAAA 1V47A 2A1UB 4K7JA 1ISHA 1Z28A 1LZLA 5HK8A 1GILA 1LQTA 1WNTA 1UUFA 1C2TA 1HYQA 4M9XA 4NYMR 1R1DA 3GLFE 1P7YA 3GEGA 4MR9A 3DLIA 1TLTA 3KZMA 2X1LA 1M76A 2H2AA 1DTSA 4Q9JA 1FFBA 3OPYB 4C22A 2AN3A 2FW8A 3B78A 3PXAA 3BD7A 3HRKA 4IO1A 4QDUA 3G82C 4X0EA 3K35A 2DULA 2Y0CA 3BZUA 2ECPA 3TFQA 1U9IC 3UPTA 1T1RA 8OHMA 2NV6A 3KEFA 4QAJA 3U0BA 3ZJYA 3I3SR 1THMA 1TEHA 5EL0A 5FTMA 3SXJA 5IBCA 1L7NA 4KAXA 1E4YA 8GPBA 2BEUA 1YSCA 2B25A 1SCUB 4IEEA 2WWTA 3BULA 4FR5A 3F3MA 3OFJA 1RQ2A 4J1SA 4AJLA 5I7EA 1N34B 2IXBA 2F1IA 2PSJA 3EJ6A 3W3AH 3QUBA 1UBEA 3HKEA 5EE0A 4EUHA 4FYWA 1YRBA 4EA9A 1VPEA 1JB9A 2EL9A 5KKNB 2JLXA 3CSUA 4EJSA 1O6GA 1YF3A 2LDBA 5HFNA 2FF7A 1PD1A 1TOAA 2R4UA 4BUZA 3JWPA 1U2ZA 1GAJA 4ZT5A 1CT9A 3JQ8B 5L6MB 4H2DA 3E9DA 1MABA 4D3SA 1D2EA 2FN9A 4M0DA 4DIEA 5C0OE 3WDSA 3U1BA 2JRLA 4EIWA 1ZVQA 1TJYA 4BFSA 3OTWA 4EVQA 4FC7A 1XXLA 3EEQA 4MRRA 3ST7A 2ZZNA 3KSZO 1G66A 3UJBA 2KBFA 1RI5A 1P2UA 3R24A 1E1QA 1X1AA 2YWJA 2Q5HA 3L41A 3EFOB 4LVUA 5AM5A 1ODLA 2X41A 3PJGA 5DKFA 4ZRNA 2CVZA 3VHRA 4XIFA 1CTQA 2YINC 3HP1A 4A2PA 5KTSA 3G0GA 4JQSA 3QPWA 1XTRA 3PX2A 4BDSA 5AK3A 1N6RA 5B2ZA 3QSYA 2VZ0A 5GIOE 2EGGA 3LSTA 4Q3BA 2ZBEA 2BCJQ 3RAJA 1ZSYA 3L7AA 4IF6A 1G5RA 4G63A 3LY8A 2OFOA 1ZC4A 1SKYB 2REBA 4I4LA 4BLOA 5IFKA 2YWCA 3FXAA 3IDQA 2GBGA 3TXXA 1FB5A 2DKFA 4D79A 1VLLA 3GJ7A 1W36C 2VA8A 2WYOA 4I36A 4BNVA 3KZNA 4ALKA 1YBVA 4PN3A 2X13A 4YRBA 4W5RA 2BP7A 2WD9A 1WO8A 3AF3A 1PDVA 5EMKA 1GKUB 2DKOA 4KNVA 5DCUA 3TJMA 3A11A 3KKKA 2R6JA 3HI4A 4QPPA 2BN4A 1RU3A 1JI3A 3N8IA 1JEJA 5E2BA 1BSVA 3JX9A 4IJ6A 2C94A 3CF4A 5FA6A 1B2RA 1YOBA 1ZHOA 3MMNA 1F4LA 3MJCA 2ETVA 3ETNA 4RD3A 4S2EA 2ATXA 3KEMA 4U7WA 1NUUA 2DPXA 3HYSA 4OJQA 3U4MA 1IAQA 2NZVG 4HX5A 3EG9B 4TLCA 3PC8A 5I9BA 4DQ0A 621PA 4H1WA 4ON9A 2OXCA 2YFKA 3ZU2A 2GM9A 5E4FA 1RABA 2G1AA 2OT3B 4DLZA 3CX6A 2YWRA 4RLFA 2V98A 4GRIA 2WOJA 4CV2A 1KBZA 3HJHA 1HQKA 2GPSA 1C1DA 2KMLA 2GKOA 1GPJA 2QG9A 2IV7A 2P4UA 1CUYA 4B3MB 4R2JA 1IC6A 1SOMA 3LYLA 3R3ZA 3IDFA 4XGQA 5DRTA 1KVUA 2C8KA 2FPPB 3UKJA 2QORA 4XUCA 4XPIB 4R2LA 3TNJA 4EHKA 5LP6B 1I4LD 4OBEA 2OVBA 3ACDA 3BHMA 1J09A 1DEKA 2FFQA 5FTNA 3ZU4A 4XYLA 5AW3A 1AB6A 1SG6A 5EWJA 1S8AA 4BKQA 1UJ6A 4F9GA 4L6IA 4V38A 3T5MA 1ZRMA 4BFYA 1RADA 4LSWA 1K63A 4FGUA 3R41A 1Z22A 3PVCA 4C78A 4PYNA 2CUKA 2J4CA 4MW4A 1NUSA 3FYDA 3TKAA 1OFIA 4AMYA 3NHRA 1RYMA 1XALA 4L85A 1PGNA 4OLBA 3HP7A 3K09C 1Q44A 4D4HA 4E6EA 2WFAA 3BFPA 1XCMA 2I9PA 2R47A 4NK4A 1A82A 3FAZA 4YRCA 1M2OB 2P6NA 4IHAA 3PC3A 2ZTUA 3AI2A 3K9WA 3TMKA 3ILYA 3DV0B 1NF2A 3A9TA 3ISJA 5KX5F 2IODA 4QQRA 1BXGA 5EXPA 4KO2S 3DBHA 4BO0A 3LV8A 4RGBA 5DK6A 3P8ZA 3ZDEA 1QYDA 2YXDA 1Q84A 5FD8A 1C7RA 4Y9RA 4TL9A 5FTWA 2IPNA 3G2JA 2GO7A 3W7BA 4QYIA 2IV3A 1K97A 4Q05A 2P1ZA 1V96A 2I6QA 2I2WA 3IAM1 3ID6C 3NO4A 2HX1A 2FE1A 3Q98A 3E84A 2OG2A 2R8YA 3USES 3WTCA 3DDOA 5FOUA 1LA2A 3STHA 3CX4A 1TO6A 3LVQE 1ZD3A 1D04A 4U7PB 2WY2D 2RBKA 1KKUA 2RKWA 4C06A 1BWRA 1H0KA 3ZZ0A 2IYNA 2Q2QA 4ZYZA 1XK7A 1EFTA 1P2TA 4J1TA 4MR7A 2BF4A 4QOHA 3AVXA 1E2FA 3TRDA 1EUZA 5ECDA 2C2XA 2FPOA 1L4GA 1C3OB 2P2DA 1JLRA 3PQ4A 4I4CA 4OKNA 5EVJA 1FU7A 5FOXA 4EHNA 1GTVA 3DUFB 1GCGA 2IZ6A 3NWBA 4LDQA 4L0CA 4KUEA 4EVSA 4MUYA 1FNDA 1NQWA 1ZVKA 4K6HA 4C1NA 1ZVVA 3D8NA 1PU2A 5MDHA 2O0HA 5JANA 4KXXA 5LUAA 1G59A 4S1NA 5C1BA 3OOJA 3WWPA 3HB1A 4IZOA 4NECA 4IV5A 1DZIA 1JJVA 1GN9A 3CXUA 1CHNA 1JEDA 1A50B 1GA4A 1P4HA 2Q6IA 1UBUS 2PL5A 5GJCA 3EVZA 1HUQA 2Z0MA 2ST1A 3IJRA 4KPUB 5REQB 2DBZA 2GERA 3DG9A 3H65A 7ADHA 1VIAA 1XXHB 1HLDA 2HREA 1Q3TA 1J70A 3LUPA 3BQNB 2WYIA 4P36A 1NAIA 3FFTA 5JSYA 3UJ6A 5GZ1A 4C6SA 4H7JA 2BGKA 2PFSA 3OC6A 3NTOA 4FZJA 4MPPA 3UK6A 2NUBA 4IHJF 4UUQA 4TLAA 2QG4A 3LIPA 1XWFA 2Z6UA 4TUYF 3PFHA 4Q4AA 1JSXA 3O1IC 3LVFO 2V3VA 4GOLD 1QHNA 4M9UA 5ALOA 4R4JA 3RC9A 4O2BB 1PQYA 4PYIA 4PBTA 5FUXA 1XTKA 4MS4A 1LB1B 5IDYA 2QTNA 4MTLA 1P5FA 3REQB 3V1MA 3ZCVA 4PIVA 1JDJA 1JMVA 3WDLA 2Z4SA 3EGWA 3LOUA 3A1NA 3HYNA 1SZCA 3PPYA 1RRMA 4I6EA 4NAVA 3V4ZA 3R09A 3VPFA 4LMPA 5BXYA 2AZXA 1YZNA 2YY6A 2XTNA 3WBFA 2V0NA 4Q9DA 1X0VA 5EHZA 5DTMA 1SK8A 3SF0A 5HHTA 4EI8A 3IFSA 3EGXA 2H7VA 1DAGA 4TVBA 4EKDA 4JR2A 5AJHA 1TUGA 1USGA 3GMIA 4RXMA 4RPHA 4D3DA 3ZN2A 1VBNA 1SIBE 2CC2A 1O8CA 2PJZA 1P61B 2H1HA 4LYJA 3VJLA 4A6EA 4RQUA 5FJIA 5DCLA 4CLXA 1UPUA 1BX3A 3MCVA 1JJBA 5EEGA 3GEHA 4FX5A 3PDJA 4F4FA 1EAYA 1AMOA 1BCSB 5C8YA 5AJZA 1HV8A 1AGXA 3NHYA 2YWFA 3NW9A 3CUVA 4Y98A 5FOSA 1RZRA 2FVXA 3T7DA 4C5AA 2QPAA 1P6UA 2NU6B 2N1BA 3HXLA 3Q87B 3AHGA 2MSNA 5KSZA 2BH2A 1QRDA 3NBUA 2O2SA 5DGIA 4ER7A 5BXQC 1CC1S 2E4VA 4JOCA 4PSUA 3IJ5A 3V1YA 1YTLA 2FK8A 5C8XA 1I10A 1GZDA 3BGWA 2NO9A 3IMEA 5DNAA 4A9AA 3OQIA 4HO1X 4CT4B 4Z54A 2CUZA 4WA7A 1NR1A 1E18A 1U1DA 4M9SA 2DFTA 4ESEA 1NY5A 2Z58A 3KTFA 3L46A 1YRQA 3E2IA 5THXA 2YDYA 1F7VA 2WYVA 3MCZA 4HGRA 3M6IA 4HRAA 3IQDB 3VR6D 3M9WA 3SS7X 5GADl 3NGMA 3FVQA 3FCXA 1WUJS 5DE3A 1XEAA 2E1PA 2PLRA 3AF2A 1CKEA 1TX4B 1T4DA 2B1RA 2I1VB 4IMRA 5JS1A 4HYTA 2A5YB 3G2MA 4K3UA 3UYKA 1GOTA 3BWEA 1II9A 3KJQA 1JA0A 1MRNA 1H2YA 4BNLA 4JEMA 3OJWA 1OFTA 3T5DA 2QB5A 2YQZA 3ZHBA 3B51X 5KYYA 1ZRSA 5A6SB 3HH8A 3GHYA 1Z5UA 5IBPA 3OX4A 1OLUA 4D44A 1E3MA 4EQ6A 5ITWA 4L6CA 5JVDF 3EWAA 2D8MA 1O8BA 3V3KA 3T95A 4Z3DA 3EPPA 1A27A 1YNSA 3JTEA 2PSFA 5H16A 5CM2Z 5K3FB 4EHJA 4A8HA 3CNNA 2ZXUA 2ROQA 1QGZA 1RPJA 1GXSB 4K6OA 4DUGD 3SEAA 3H04A 4FNGA 4X5OA 4E88A 4PZEA 1SBZA 1ZEJA 2F3PA 3G5LA 3NBKA 1Z74A 1NN0A 4LX0A 2IP4A 2W2KB 1M6NA 2W6OA 4Q34A 4WZAB 1DKLA 3OOSA 2XNCA 3ETCA 1JA9A 4B85A 1RXCA 3K0FB 1HDXA 2CDNA 2QYOA 1KJ9A 4MI6A 2HMVA 4ETWA 1ZH0A 2FZKA 4UHKA 3W78A 4BVBA 1TA4A 1WS6A 3FFAA 2R48A 3RYIA 3X1XA 4ESOA 1APBA 1A5ZA 4MRNA 2QBYB 4KIGA 1IULA 1Q7BA 2J31A 4PS0A 1QG4A 3S7ZA 3WP0A 4NFYA 4PQEA 3WMFA 2Q6TA 3SU8A 4C03A 4FHDA 4JFAA 2JARA 5DLEA 2H4XA 4WK2B 5DXFA 1Z36A 3I6IA 3I64A 1IUNA 2QGZA 2YW9A 3U16A 1MIHA 3OFVA 3DCIA 2W2NA 2XEDA 4YDSA 1E6LA 1G5QA 1HC7A 1PK9A 3HKCB 4DSOA 1HM5A 1ZH8A 4G8JA 1OE0A 1I7PA 3I9JA 3GDGA 3R4VA 4MIOA 4D4LA 2PL3A 3SJZA 1EFHA 3SNHA 4E13A 1F8GA 1CUDA 3CLHA 4IEFB 2XYQA 3OHPA 4JBIA 4PO3X 1ZOPA 1GSOA 3G1TA 5JYDA 4LHEA 2IH2A 3SYMA 2R84A 1P1IA 2E7ZA 3P2EA 4P93A 3OA2A 2AK3A 2Y1CA 3HVHA 1FRZA 1OGIA 4UMDA 1CUSA 2FWJA 3D0RA 3KB6A 2PTGA 4B35A 4IV0A 2G0NA 3L7JA 4JJ8A 1J0DA 4Y67A 4ND2A 3N2KA 5AUOB 3B5IA 5K7SA 1Z8NA 3FDXA 1SC6A 5KJCA 2ZB7A 3RF6A 1ZH2A 1IWBB 1E32A 2HHCA 4DIDA 1MB0A 5BR8B 2F3RA 1DZ3A 2PUHA 1JAHA 3RVMA 4A2QA 2D2VA 4EPTA 1EE9A 1R18A 3HACA 1H8EA 1YRAA 2EKBA 2QUHA 4L8FA 1AC5A 3NHAA 3LQ4A 4EBBA 5DBFA 3HCPA 2A8YA 3UA4A 3LDAA 1OILA 3MT0A 3Q5DA 4B6OA 1U31A 1BYIA 3LO5A 2YYAA 5CURA 5T41A 1KIFA 3AVTA 3X1DA 3KQPA 4TRNA 4OJTA 4UC0A 3BMCB 1M7GA 1XEWY 1V4VA 2VP3A 2YQ4A 3F2IA 2ZR8A 5EWMB 1NVAA 3A9SA 3IB6A 3K53A 3BTOA 3ROFA 3QBVA 1KI7A 2NT3A 3L5OA 4HDKA 1VFNA 3DHWC 3GEEA 4QC2A 4KITB 2DGDA 4DVGA 1GYRA 3NEAA 4OQMA 2Z08A 4QATA 1U0EA 4UD6A 3VO1A 3NJ8A 3EVNA 3IUPA 1R9NA 4Q37A 3T7RA 2G82A 3TX6A 3W5IA 3LHSA 4K6KA 2VJNA 4MGYR 4H3KB 4OMUA 2N42A 4Z2YA 5AQEA 2OV8A 3ZY4A 4W8OA 3VNQA 1R64A 3HWX1 1I33A 2DVMA 3K94A 3O5AA 2EVWX 3QUTA 5KJFA 1NRIA 4BKMA 1WBJB 4IIHA 1NW6A 1NUQA 2VJQA 2VNIA 4AO6A 1UXHA 3NDJA 4OX9Y 1MW8X 1CPYA 2H17A 1SCAA 4EGQA 1DU4A 2HPZA 4I3FA 3BJZA 3TVYA 4UM9B 2PQMA 3BGOS 4L4ZA 3U26A 5ALPA 4YLEA 2OFXA 1W44A 2ZWPA 1JNYA 2IOFA 3IDSA 3BF8A 3QVKA 4G5RA 4J07A 4OXKA 4YMUA 1S4MA 3DKIA 3REOA 1Z0IA 1QZXA 2V7BA 3IIKA 4KCGA 5EXDA 4PC1A 4BFUA 5IVIA 1E8MA 1QYIA 3HLKA 2GZSA 5EIXA 4PM4A 4BZZA 1YRHA 2P75A 4B82A 2WINI 5FUMA 3HJGA 4XLTA 1V3QE 1YVUA 4PNPA 3W6ZA 2BOVA 1IU9A 2Z1NA 4ZDJA 1K8ZB 3HVRA 2J46A 3N8NA 2YY5A 2JAXA 4OLFA 3INYA 4YLYA 2A9KA 1K6IA 3LXXA 5EKUA 4H17A 2RHDA 2GAFA 4WFIA 1VLMA 2RHTA 4ZZ1A 2BM0A 4FXOA 4INOA 1MHPA 4L75A 1BH6A 3PI6A 4M46A 4Y2UA 3T3PB 5FHRA 5BVGA 1OH6A 1MVNA 1HURA 3IERA 5CLQA 4P3NA 4R1OA 3PEVA 1B42A 2HA0A 3LS2A 3P1JA 3LYHA 4BEJA 3IP5A 4NH0A 2CSUA 4II3A 3I9V6 2Y2UA 2ZXEA 3I6YA 1P1CA 3HFGA 3IXMA 4GI2A 1AKQA 3NBXX 4CF5A 2PBZA 3W04A 5FOQA 4LF4B 4I9FA 4NEQA 4D6YA 3OWHA 4LZJA 2P1DA 3CV3A 1KZ6A 5GM1A 1XVIA 4ABYA 1VJ1A 4H35A 3BJIC 2Q3LA 3ABRB 1FEZA 3PFKA 3Q7QA 1RR6A 4Q4HB 3KPYA 2NWQA 3B3GA 1CR2A 1Y3FE 3PKJA 2ORVA 4KXNA 5HUHA 5JROA 5LZ2A 1N2SA 1YZVA 4IX9A 4KOAA 3TWOA 3VMFA 2FXVA 3IOMA 3KTAA 3NT5A 1TAHA 3IP6A 4OJNA 2IIQA 2L2QA 3FZNA 4NDZA 2WIFA 1MJFA 4XGIA 3WMXA 1QPBA 2JZNA 4MQ4A 3G68A 4UE3S 4PZPA 2W58A 2HXGA 1F2UA 3DTTA 2VYND 4JBLA 4KQ6A 2QM0A 4LBZA 3WMWA 1TIBA 3HJBA 3PC7A 5CDFA 4OLAA 3IMFA 3LLCA 3KAKA 2VRWA 2HLDA 2Z1DA 2BKLA 1CS4C 2JH8A 2FJ0A 4OGLA 1FOEB 4P9NA 1ND5A 1TYDE 2RH4A 3LYAA 1R0XA 3IQHX 3LWNA 4M22A 1VJGA 1VGQA 4MAFA 2ZRFA 4QDJA 1NYLA 1W5BA 1RZ3A 3NONA 4ZFNA 5THKA 1XZAA 2AFHE 4P4GA 1OIXA 4TROA 3OM9A 4Y2VA 5B3AA 4CIWA 2H1WA 1JSLA 2J3KA 4CEJB 1JIUA 1Z06A 3TH5A 1DIRA 1O6ZA 3U4HA 2AZ4A 4LX8A 1SN7A 4U7JA 4F3TA 3MF4A 1KZ7B 3V9PA 2FRXA 1E3SA 4OGFA 4M1KA 5JMPA 4KH0A 3ISTA 3O2QB 3PPWA 2XUPA 3L05A 4UUMA 5FADA 3DAFA 2A1TR 3DMGA 4IUDS 1CLUA 3H4TA 4PCLA 3UV6A 5JDIC 5A1JA 3DCNA 1X80B 2Z5VA 1ZR2A 1ESEA 1Z25A 1X8KA 4RMGA 3THSA 5JSZB 4MCAA 2C54A 5TQ0B 4G1UC 3D6NB 1MRSA 1ACJA 3HO6A 3SGLA 2ZB3A 1FRVA 4KQJA 1KH1A 1THTA 2CB9A 4A03A 2XOKD 3NIFB 4C7KA 4ZYWA 2O14A 4CKZA 3UF0A 1RLTA 2IV2X 4D43A 3M2PA 1KK2A 4Z86A 3ZCPA 3HJAA 1Y4UA 2FETA 5ALDA 2JCSA 1P7WA 1DBQA 2HCJB 3HRHA 3QMVA 2EG9A 4P7GA 2BJWA 1MW9X 2I55A 3KJZA 5DEOA 1T4CB 1P4GA 2O3QA 4B6GA 4BTVA 5L53A 1EIWA 3PUYA 4BVKA 3N8DA 1D4ZA 1T5TA 3KZVA 2CW5A 3ET4A 3OPNA 5AOVA 5K0JA 1QIJA 1VI5A 2EARA 2BMEA 2OO7A 1O6CA 1ZI6A 4LDNA 4PHFA 1RHKA 4Q1AA 5FLEX 4MDYA 4YRKA 3PUVA 1V1RA 2XBLA 2QRGA 1JZSA 2BM8A 2IXGA 2ODTX 3WMGA 4PHGA 2QAGA 5HRUA 4F5YA 2R5WA 2FR8A 4RXUA 2NU8A 4HAOA 2BMAA 1QFXA 3JR3A 2QLNA 4B6FA 1X8XA 3JQ9C 3QLVA 4IY1A 1ZS9A 2GCOA 3P94A 4QFBA 2WABA 1GYPA 2OXEA 3LCCA 1CUAA 3W3AA 5AHXA 5EY5B 4EKEA 4LF9B 3NATA 3UC9A 2V6IA 2BV3A 3VU9A 2G1JA 3ZZMA 2JRCA 3KQLA 3U4IA 4Z0TA 1V16A 3ZIAA 1YJQA 3TPCA 5KTNA 2EKQA 1NRWA 1P4SA 1VSVA 2YFQA 3STUA 5GAJA 4LC0A 3GPDG 2P5TB 3GIDA 3AKDA 4HPWA 3ORSA 4L8YA 3W2GA 4D80A 4CKWA 5JEDA 3WAJA 1XRQA 1OZGA 2H4WA 5CDYA 1R8SA 4MV1A 3SSNA 3O3MB 2FWMX 1JWLA 4L9SA 4F4IA 3X1ZA 2MINA 4XGRA 3WGNA 3T5PA 4UUPA 1XA0A 3B9QA 5EKXA 1CF4A 2ZR7A 3SHVA 1XEXA 1ZM4A 3DT6A 3ICPA 1RAGA 4IFBA 2ZP1A 1SKQA 3QKTA 2CJWA 4FDUA 4CMEA 2J8ZA 4RF5A 5BW5A 2FSSA 4PV7A 3TW4A 3EY4A 5HF5A 1PYOA 3ZWOA 4AJKA 1AA6A 1K06A 1Z0KA 4P5DA 4IDAA 1FP1D 3GZNB 1NY6A 3Q1KA 3R5KA 2QTHA 5EWLA 4LK3A 5M3BA 1ZY2A 3NV9A 3IE1A 5ERYA 1HDCA 4F3CA 4M9ZA 4FFDA 1PG2A 3IALA 5D85A 5KEIA 5IMSA 1JHPA 1Y5RA 1MAHA 2BHRA 2MSWA 3UAOA 3TUZC 2O6HA 1J1IA 5D87A 1XD8A 4YXWD 4CBVA 3WBBA 2D1FA 2F17A 2HV8A 2X2FA 1WHTA 1OLXB 3IVCA 4XAQA 5JS6A 3K1AA 2W7TA 3R6LA 4KHPB 1DAKA 3CVWA 4IDCA 3KEQA 5TT0A 4W82A 4WOKA 1Z4OA 1C7JA 1ULUA 2QRHA 3JARB 4H7EA 4KJXA 3WB1A 4F2GA 1QX3A 2DP4E 2PS1A 4FFBB 3DZHA 4MUFA 5IAJA 1KE1A 5DPMA 4GLJA 3V4LA 5I9MA 3W6UA 3G8DA 3ZC3A 1U7WA 2Q07A 3E48A 2VDUE 3ETEA 1Y82A 1E3EA 5D5HA 3SOZA 3BVPA 5FPQA 3OTHA 1IWOA 2WU0A 1QX4A 4TRJA 1T3HA 1XNQB 4MMZB 5A5EA 3U60B 2VF5X 4R01A 2G9NA 2B94A 5F3RA 3PQ3A 2Q3BA 5AVTA 1O57A 4ED9A 4O2AB 2BEWA 2X9QA 4MV8A 2PXXA 3LTEA 3IV9A 2B2XA 1NP7A 3JQ7A 3NBYC 5CEEA 3TOCA 1R0CA 3Q7SA 4WIAA 3UXMA 4ZKDA 3LLMA 5BYKA 1ABFA 1IG0A 3ZUPA 4CFZA 5CT5A 2WM8A 2UVQA 5K4AA 1GT91 3HBAA 2BGLA 3QLJA 5K6AC 3UO8B 1L8OA 3M6LA 5JPDA 2W6NA 4E15A 4YUWA 3BWXA 2WUFA 4ZOCA 2M98A 3E6AA 5JSKA 2JKYA 4JT9A 3CMMA 3YASA 4OHUA 3FGPA 5ECWA 3SLGA 2AW5A 4H77A 4X8LA 5D51S 3SEQA 3GCXA 3FWNA 5C35A 4X1YB 5DLQC 1RWNA 2FG6C 1RZVA 5F64A 4BNGA 5JNVA 3VU3A 3MJHA 2NM0A 4L51A 1MPTA 4CMJA 3A4LA 2GCIA 4D42A 7MDHA 4QOGA 1M34B 1YZ3A 1WTCA 3NHZA 1J1ZA 1WEHA 1AKTA 1LS6A 4IDGA 3IMGA 4C4TA 2FHSA 2XECA 1L3BA 1WR8A 2SBTA 4LWQA 1KA9H 2JAHA 4RANA 2R96A 4V39A 5GM2A 5JZOA 4FSHA 1NBIA 3IEPA 1GKLA 4N18A 3K6RA 1HL7A 4HGQA 5HFAA 1BX1A 1MF7A 1VYVA 1WF6A 1N9GB 2A5FA 2H5LA 3TW8B 1X42A 2AZMA 3HA3A 3RHTA 2OM2A 2CNNA 3WYDA 3ICEA 1A1SA 2QU8A 4LW8A 4UVEA 1Y9EA 3VNBA 4CUKA 3I39X 5D1NA 2Z9DA 1WW3A 3CB4A 1K4YA 3BPSA 4J49A 3RBAA 4NY1A 3V46A 2EKDA 5ITZB 1KOFA 2BDUA 3GB9A 4WVLA 3CXRA 3NALA 1CJUC 1E2JA 1FMCA 1EUDA 1JSCA 1ZWLA 2SICE 3TPZA 1VXRA 3S8EA 5ENDA 3TFOA 4X6YA 2ZYSA 4D8WA 2RHBA 4TTAA 2D0IA 5KJ6A 1KDOA 2VQSA 3RU9A 1B16A 1GEEA 2EBFX 2GHRA 2H5IA 2Q0HA 3EZ7A 3K1TA 1DINA 3A6LA 1KETA 3QW2A 1THZA 3R7NA 3H5AA 2VWGA 3TMAA 3ZOZA 1A8QA 1F9EA 4LYEA 3IQWA 4A27A 4MKZA 3DE2X 1WBDA 2G9ZA 1LLQA 5BQPA 5GWXA 4B43A 4DMKA 1SXJB 3QKRB 1VKZA 5KSPA 5SV2A 3ZQ6A 5FLKA 5BQ3A 3QLUC 2DQ4A 1H23A 3C1OA 3D4IA 2BFFA 2C5GA 2WG1A 4C4XA 1L7BA 3HJTA 4Y7DA 2FTKE 4V24A 3NXSA 2DQSA 2CL7X 3R0QA 1E1CB 1TUIA 1WCIB 3GH1A 4KO4S 2GXSA 2COUA 2YC4C 4PX3A 1XU7A 4JYBA 1TYAE 4KG7A 3EQZA 5ECYA 5JBIA 2ZM6B 5FL3A 3K0AB 2FMHA 5CGZA 2AHOA 521PA 3Q3CA 2BTEA 5BNTA 2OEPA 1WPGA 1GRNA 2O50A 3F1KA 1KDYA 4NYIR 2DM6A 4Q1CA 4C3VA 4EZEA 1K88A 3HY4A 2X22A 4LXHA 1NUHA 5DM1A 2HCBA 1NNLA 1PKXA 3ONWA 5DTIA 1KYZA 3TN7A 4A8JA 5BN1A 4RPIA 2QRKA 3IA2A 4MICA 1OGJA 1M6VA 2VHYA 3WYEA 1KFJB 2R8RA 1USKA 5LFAA 3MERA 2K2WA 1RXUA 1SD1A 5THQA 1UAGA 2I87A 1ZFNA 2H00A 2SECE 1EXNA 4BHTA 3ABQB 4A8PA 1DHTA 5BWLA 1CY1A 1ZH4A 5C4GB 4L3VA 5LQCA 3ZK9A 3KWLA 5CBKA 1Y7IA 1IPFA 1DC3A 2C1ZA 1IN6A 2BFCA 4DR5B 4DNQA 1TQ2A 2GCGA 2QHXA 3F4LA 1R9MA 4D46A 1XQXA 2WMNB 5TLSA 3ZE1B 1FW6A 4N3NA 3RLFA 2ZXFA 1U3VA 4YQZA 3HDVA 5G1OA 3K70C 2Q7XA 3D8BA 4J03A 5AK4A 3EPJA 2RB5A 4NENB 4L15A 1KS9A 4Q03A 2A3NA 1PJZA 1QR2A 1YK1A 1P9WA 3GDHA 5AKEA 3R75A 1XPOA 4C7OB 3DMHA 4RKQA 3GLRA 2O7QA 4DPMA 4K88A 2ENUA 1HK7A 1ZA1A 3E82A 3ICWA 4RF4A 4RHUA 3TO5A 5KNBH 4HUJA 1KDPA 2G67A 3T4XA 1JTVA 1SULA 4KWHA 4AJEA 2JLVA 1F0PA 4TTVA 2Z8YM 4POOA 1FVXA 3GJRA 1ZQ9A 2Q9AA 4U7DA 1IZ9A 2A92A 2IZ0A 5DTJA 1PRYA 2DPMA 3L6BA 3VBEA 3PP8A 1COWD 1DTWB 5MN4A 4Z1MD 2I22A 4WK6A 1B3BA 3JAWB 3CA8A 2FPUA 3CG4A 4KREA 3ZQKA 2HEGA 1C9JA 3OO1A 1C0KA 4IH1A 2OGTA 1XP5A 4CKCA 1I2DA 1KARA 1MGPA 2FFRA 1F38A 2F1RA 2JIQA 3KR9A 4X3CA 3F5SA 1C5KA 3OIWA 3HU5A 4BFZA 3BA1A 4FR0A 2NNWB 4E7PA 2FDXA 3C3DA 3H1GA 2NZXA 1N3IA 3IP8A 4OOFA 1Q50A 2JHFA 1MB3A 3I45A 1KF0A 2FPMA 3CNEA 3FPJA 4JUCA 1FZQA 1EDZA 2XXBA 1XZKA 3BFKA 3IEIA 3MGGA 4RHEA 5LLSA 3D8RA 2P0YA 1WZEA 2O8FB 3VZDA 3P19A 1UDAA 4TX1A 4RA6B 4G0OA 3AIIA 2RK4A 1JUDA 1FNMA 1U2SA 2R6DA 1G64A 4LY0A 3CIOA 2OP1A 4MV3A 5F7ZA 3PU6A 5BWCA 4WGGA 4F3RA 2D0OB 3GGDA 2BLNA 4J3JA 5CVCA 4EY5A 3C7AA 2HO4A 3CKKA 2PIAA 3MRXA 4WNCA 4YRFA 3WNBA 2OCPA 1ZINA 4DLNA 1WB9A 2LKDA 4CIAA 1XYVA 2C3OA 1JU4A 4WACA 1ENPA 4PHHA 3KQHA 3COJA 3AL0C 1VJ5A 121PA 1BKDR 3EF0A 3F4BA 4MV5A 3ZKWA 4TVSA 2G76A 4GZ5A 3PITA 1J8YF 4Y6PA 1Z47A 3MG9A 5LZ8A 3JWEA 3F5QA 4MKHA 3UH0A 4J0FA 4NULA 4BO1A 4BNWA 4F8YA 3BQ9A 4WK0B 1Q0PA 3AV0B 3DUWA 3GQVA 4QFMA 4YJDA 1WX1A 3C98A 1SOUA 3EZ2A 1LW7A 3HBLA 4PLPA 3COWA 3LRXA 3EEIA 2ZRNA 1T8PA 2I5PO 3OECA 1QSGA 3RVJA 2VHZA 3HK2A 3T61A 2ISSD 4H31A 2F1KA 4LZWA 5AVKA 2G0AA 3RU2A 5KWVA 2XDYA 4ZI7B 5HJ2A 3ZTYA 2D5IA 4HB4A 2ZUTA 3GLGE 4AJIA 1EWQA 2FSVA 1CRPA 5EIHA 3VISA 5KINB 1DFIA 1L4MA 3VR1A 2DPHA 2BTQA 3VDMA 1VHDA 3ILHA 3P9ZA 2XLCA 4ND5A 4MI3A 2C07A 3FJOA 5LB4A 1BFUA 1UC5B 1G9SA 2O1XA 5G2OA 3SR3A 4DA8A 2PV7A 2OYSA 4MINA 5AESA 4GUDA 4DFDA 2WMYA 2YXNA 1GYQA 1RAAA 1V7QA 1XZJA 2XHZA 5I5EA 1XSEA 2XODA 3AILA 1G8KA 5EJ9A 1OMOA 3R77A 1XRLA 3QU7A 1UMBA 2MIIA 4BMZA 2IYTA 2UZ0A 3N2GA 4I50F 3VC2A 1G38A 1T43A 3GT4A 3IUNA 1QCYA 3TKYA 2BRUC 1O95C 1ORIA 1G8GA 2HFKA 1UKEA 2WIKA 2V45A 1J21A 1Y48E 2GEUA 1OWMA 4LAFA 3V4SA 3CLSC 3OT4A 5I51A 3CB2A 1W8IA 3RYFA 3PHBE 2IEBA 2ISQA 4KGXA 5JRZA 2CXHA 4LSZA 2P9QA 4IIJB 4F0JA 4U5QA 1LSUA 2OUKA 1U8EA 1XCJA 1N92A 2LXNA 1E62A 3M4JA 4DMHA 5LL6P 2CGEA 2XZOA 4WLEA 3OM1A 2BFAA 2J7KA 4TV9A 1Z0SA 1ORVA 3NU1A 1SM4A 3AJAA 1KY5A 2HB6A 2V59A 3S7TA 3VKVA 5TARA 4BFVA 3QTLA 4RHFA 1P2BA 4X95A 1WDKA 2W6PA 1NW9B 2ZG6A 3Q5EA 4IVNA 3T5BA 3AHFA 4RTPA 2B30A 1R4NB 4OTZA 3GGPA 1VGVA 1PV4A 4OQQA 4YGXB 3SI7A 5CPBA 3UJ7A 1GJRA 1KC3A 2NACA 5G3YA 2G70A 3X2FA 5AXCA 3CR8A 1DAMA 3RSSA 4I1PA 5BMVF 1DRKA 2GWHA 4O4JF 1CLEA 5BR1A 2HJ9A 1E5DA 2PZFA 1KQOA 3E0XA 3PXBA 5AJTA 3WP1B 2QV0A 2W6QA 3BAFA 4MQ5A 4NLLA 4BMVA 4JJAA 1B23P 3PLNA 5F76A 1DKPA 3WLNA 3MB8A 4OMCA 4BAZA 3A2LA 3UPUA 1PV2A 1QH1B 2RKBA 1CUGA 2JZOA 1B6RA 3D6TB 3DBOB 3R6WA 2GF0A 4GMDA 3D3WB 4JJ6A 3OY2A 3WNDA 1AHNA 4JC0A 1RFLA 4UXIA 3M49A 4QRDA 2BELA 1M1NB 3IV7A 1MO3A 3JQDA 4UVHA 4MWEA 3FB4A 1VP9A 4KXWA 4D9EA 4U2GA 4IXTA 3RVSA 3O8CA 3VJRA 2SCUB 2PMEA 3RFVA 4ALIA 1D6MA 2RIRA 2XQFA 2ZBGA 3G2IA 2O8EB 1O94D 1KJZA 4D45A 1E2EA 5JCOA 3NR2A 4XFKA 1FTYA 2HRRA 1JTFA 5DJ5A 1UKZA 5HTKA 3KQUA 2UYGA 4RJJA 2Z56A 1T36B 2F7SA 4HNHA 2VUIB 3H5TA 3WHKA 4L4SA 5DTQA 3LCRA 1GL6A 4C4OA 1M83A 3TSOA 4MHSA 4PZ9A 1V1MB 1DB3A 2YV4A 4HDSA 4LY9A 3WNVA 2XYPA 1R8JA 3KVOA 2X0EA 4XASA 2Z3ZA 4FVTA 3PNVA 1KY3A 3KEOA 4DM4A 4X94A 1W30A 1T8SA 3T7AA 3LRPA 4GT1A 1CULC 1MPXA 5A7GA 4N7RA 4BBPA 1BA3A 3GBPA 3OLCX 3W6OA 4AYXA 1FJ2A 2VBFA 4MGKR 4MPRA 4R51A 2BBSA 4RDHA 3F2VA 1GUZA 3IVGA 2IF0A 1JHDA 3EXFA 2FWIA 3A3NA 4HDRB 4RH1A 5LXTF 4A0HA 4XSVA 2GTPA 2IVZA 2IDKA 1P77A 1NSFA 3DH0A 4HG2A 2QRPA 5SZIA 4CL8A 2CXRA 1MU0A 3RVPA 3O93A 4G0QA 2EW2A 3KKNA 2JFXA 3PTLA 3DOFA 3INTA 4LY3A 4EZBA 4ZGGA 5JAPA 4G1BA 4G85A 4R69A 4NBWA 5DF1A 5JCJA 3N2LA 3AR2A 1T1EA 2VUHB 4E70A 2V4ZA 1E60A 1NZJA 2VQ6A 1XLUA 3FBGA 5DGTA 5AM1A 1A8UA 3WGVA 1W5TA 1G8FA 2DKNA 4CF6A 4Q48A 4HXGA 3O2NA 1XGKA 4LYYA 1P33A 4XJXA 3IPXA 5IM4F 4HLCA 1FBTA 3L18A 3ABIA 1FRNA 3GROA 3PGMA 2ZIAA 1U0OC 3EMKA 4GE3A 4L73A 2FP4A 4UAUA 3QVJA 3KR0A 5GV8A 1Q77A 2VCHA 2WICA 1T29A 4C89A 1BRMA 1MV5A 2OHGA 1GG5A 3QVMA 3T7IA 4RA9B 3LY7A 3VVLA 2JGJA 2HYDA 3EZLA 3LL4A 1EH5A 2XUAA 5EA2A 5B58T 2JFPA 3BIFA 1E4EA 3OI7A 4YJ3A 5IAGA 2OXIA 1E2UA 1LH0A 4DDUA 5JXHA 1WMAA 2X0IA 4BO8A 1UFOA 3OHMA 3PHHA 1V11A 2QMEA 3H1AA 4RETA 3WTBA 4OO3A 1OC4A 1A4IA 2ZBRA 3IR6A 4H3HB 4NRDA 3WKEA 3RS2A 4D4GA 3C4VA 3SFTA 1JDUA 3TIXB 4AMVA 2XOEA 1O0CA 4PFKA 5DI3A 1T15A 1Z4NA 5CHYA 2HA4A 3W4KA 3KXDA 4XQ9A 3DUFA 3WWEA 4NZPA 3BL8A 3B5EA 1KJWA 2DXIA 1T0IA 1TQ4A 1I3NA 3ENKA 3FA2A 3T52A 3P0IA 4EJ0A 3P4YA 2QT0A 4HCJA 3DEZA 3ODGA 5EMNA 1K5DA 2W6ZA 1QQAA 3W2IA 3H0CA 1TT5B 1TU3A 1GZ4A 1WULS 2P2GA 3UAVA 3E3OA 5IWAB 3GRYA 4TRMA 2FFHA 2HT6A 4EITA 1YR9A 3R7DA 3AGPA 1TKRA 1TTHA 2IYPA 2MSLA 3ZI0A 4BB6A 3MSXA 2MDTA 3AH8A 4KC0A 4P08A 3TG2A 2WWFA 1XJ5A 1OI3A 3P4XA 3ESAA 2W0MA 4QBTA 2PIDA 4DY4A 1SVOA 2QRLA 3C8DA 2JFQA 5G3ZA 4JU8A 2FPGA 1DKUA 1NI5A 1XCBA 4QLAA 2FJPA 3EXIA 2OAP1 1XMPA 3O3NB 4EPVA 2WFLB 4FQ8A 4RACA 4AZTA 2UZ1A 1U7PA 5EZQA 1YS9A 2JLAA 4P5EA 4B4UA 1LK5A 1N36B 5U4XA 4G65A 4L16A 4S0XA 4YJHA 3A9RA 5G4KB 4F45A 3NDIA 4JVMA 1IXYA 1ETUA 1Z45A 5HZMA 4D8TA 4D9BA 1U0FA 3VZSA 2VDOB 4I55A 3ZY3A 1EFAA 2OO5C 3B48A 4FW9A 3SY8A 3ZX4A 1QGED 2B0JA 2AW3A 2LGJA 4GYKA 4P3OA 1JKJA 1ZGGA 4XOIA 5HOQA 1B1CA 1QRAA 3A9VA 4UU7A 4CCYB 4MB0A 5C3UA 3PTZA 2XUDA 4ZQEA 2EAUA 4BN0A 3SBXA 5KOHB 2O1WA 4J0KA 4BGEA 1SB8A 5HQJA 3PG5A 3BFXA 2Z4TA 1K6XA 1AQUA 1NBOA 3ER8A 5EJIA 2QN9A 1C0LA 1PJQA 3FPGA 2V1XA 4P84A 3KQMA 2FWPA 3CR7A 4HQKA 5C5CA 4KXMA 1NXSA 4N9WA 3FI0A 1X7WB 1RHUA 2AJDA 2C78A 3AHIA 3QPAA 4HWRA 3OQVA 4JX9A 2PZ8A 3E8XA 1DAEA 4RUKA 1FMLA 3U56A 1ISPA 4C05A 1T1IA 3G2OA 1JEQA 2V74B 4FN5A 3GT7A 4Q4JB 4V0ME 4DQKA 1U1CA 3VPCA 5JJKA 2NU6A 1UKYA 3PT9A 1OFVA 1XCLA 2BFNA 3CN9A 3CRNA 4FDVA 4KFSA 4W1RA 1CS0A 1O1YA 3PQDA 5IVDA 3Q6MA 1B6SA 4RLQA 4PTZA 1JB1A 4UAJA 2JLYA 3HN6A 2VRCA 2PWYA 3ONNA 4MMYB 2YZMA 3DP7A 3MUFA 3BXHA 2OG1A 4MQEB 3CSDA 1XFAA 1EWRA 2VJKA 4RNCA 1IPHA 1RRFA 2PFGA 4WOJA 5CH8A 5KOIA 3KPVA 3P2IA 1Z2OX 1ZCFA 3C24A 1E9EA 4HGZA 3WWZA 3D6MA 4HP8A 4Q3AA 1ZMRA 2CMHA 1EZ4A 4PPGA 3B8EA 1ST2A 3AY3A 4QXOA 4WASA 5K2OA 4BZPA 4CF4A 4B46A 1NKSA 3OEYA 2POCA 4WZBA 1ZRHA 1P7ZA 2ECOA 1F60A 1RS0A 1WAMA 2R8XA 4IQ4A 1LVHA 4PRYA 4K9NA 2ORED 2MCFA 2W9XA 4Y6SA 4B3JA 5I4KA 2JJQA 4B3BA 3ZY2A 1SHUX 3SSMA 3H3XA 4L8LA 5AI6A 2Q2NA 3INNA 1CB0A 2C9CA 3EIOA 4P80A 2ZJ6A 4FGWA 4D4IA 4C0QC 1PX2A 5E0KB 5G4LA 1SBNE 2ZIVB 2P40A 3SQLA 2I54A 1NW4A 1UK8A 5ALRA 5EYPA 5K3FA 3EGEA 4E3WA 4J3FA 4K9KA 1DJPA 1VGRA 3QY9A 5KHAA 5BR7A 2D6FA 3P5BA 3FYUA 3Q9SA 3VOBA 1FQJA 1QMPA 4LGYA 1X9GA 3RF7A 4XEHA 4X65B 1HORA 5AW9A 1A9OA 4KSCA 2JW5A 2VPXA 2OV1A 4QTUB 2IA5A 3NPAA 2W2KA 3HB4X 4QU9A 4U2BA 4YS6A 4G1FA 2Q3JA 3CINA 4QNMA 3W4JA 4D0RA 3QKSB 1QDUA 1Z6AA 2H1IA 3L1KA 3B2QA 3LBHA 2BDEA 2JGEA 3IPAA 4JS0A 1Z8DA 1ZISA 3MJ4A 5EG5A 1UINA 1WWKA 2ZJ3A 2ODEA 3O8OA 1FNCA 1NQXA 4GEGA 5LBIA 1JDNA 1DBIA 4BQOA 2Y99A 4LZLA 3VR5H 1BW9B 4RD0A 1XB2A 3AYZB 3JAMA 2J9YB 2HH9A 2Q5OA 5LZ7A 4Y0NA 4M0FA 3K32A 1T26A 3B60A 2DWOA 1M10A 2EFYA 4FOPA 4W7IA 3ZNOA 2UXDB 5EJEA 1R7RA 3IODA 2O8VA 1CZOA 1PFQA 13PKA 1AKMA 4TWIA 3K6JA 4FEAA 1TMGE 4K1LA 1J0CA 4DWJA 2COEA 3N6VA 3UATA 2IUFA 3MJSA 4M1WA 3E9ZA 1K7FB 3H2SA 1JFVA 1YOVA 2Z57A 2QTGA 2ZJ5A 4BNXA 1YAJA 1F0NA 2X0RA 1R4ZA 2OVFA 2Q4DA 1AN9A 2VCEA 2XYVA 4EL0A 3P9XA 3MS7A 4CQMD 2WIGA 2HSJA 3AL3A 3HR8A 4QRIA 2AMFA 2FPKA 4QXAA 3ZVLA 5JNSA 2BWJA 3NHMA 4GXTA 3A3PA 3WZ2A 2XCIA 3PFBA 3OT1A 3PUWA 1PLJA 3A04A 4B1FA 2E0IA 1HDEA 4EEZA 2OCBA 1WD7A 3B2EA 3DO8A 4MUAA 1XZEA 2EJBA 5A05A 2E89A 3U37A 4JXJA 4XGNA 4AS3A 1KFEB 5H83A 3ZWNA 1DJQA 4X1KB 1KI9A 1QBKC 1TD9A 3CO5A 1KI6B 2JGKA 3QMWA 4MV7A 4O08A 4NNJA 3WSWA 2PU5A 3S28A 2F43B 5EC8A 3F9IA 2ZAMA 4Y7CA 4EX7A 2DSTA 1PWZA 3TZQA 1W85B 4R98A 3ACCA 3MGKA 2WI8A 4KPFC 1JLLA 4QYWA 1NKTA 3LKDA 4NJMB 3VGJA 3P9IA 3BWCA 5IEJA 8ADHA 4RY9A 3IQGX 1D0IA 4HS9A 3LGAA 1PF7E 4HX2A 2XGMA 4IQFA 4FYXA 3RIEA 1CUWA 3GOQA 4GGMX 1TW3A 3CX7A 3GEIA 3LQRA 4FFVA 4BP9A 1Z29A 1YO6A 3L3BA 4JOSA 1JEYA 2WFMA 3OQJA 1QIMA 4U4AA 2J5KA 1IIRA 3DBRA 4MI1A 2GJKA 1SB9A 1BFKA 1D1TA 1BWSA 4B47A 2GFIA 2QX9A 2UVPB 3QELA 4KGDA 5AVJA 2FZWA 2Q1TA 2ZTSA 3S1AB 3BD6A 4B6JA 4DYHA 2G6BA 1ZJWA 3C39A 2AOUB 2FVYA 3HSKA 4DQUA 5HGXA 5JFTA 1DIHA 4R9SA 2HHAA 1H85A 1NPDA 1XQVA 2EBWA 2BLLA 3W3ZB 2E4WA 1JLKA 2Q5IA 1DG1G 1EM8A 5CITA 3MWEA 5CB4A 2GYUA 3ETJA 5J40A 5KNDH 4FILA 4D9CA 3QX8A 3F9RA 3CCFA 3I2HA 4RLSA 2DMRA 5AJVB 5DLPA 4XWOA 3SAJA 4MKRA 3OTOB 1ZAYA 3KE9A 5H3LA 3HGTA 1XX6A 4WY5A 5FB3A 1K7YA 3AM4A 3UK1A 4C4YA 1UEXC 5ILQA 1EK2A 2LIVA 4NNOA 5IVPA 5DHTA 1LLDA 5F2EA 2L69A 4XOUA 2ZSBA 4EY7A 3VVBA 4NV1A 5AKXA 3V1UA 1XJCA 4O0MA 2PH1A 4ARBA 5CTJA 3GLIA 2ZI9A 3ZV7A 2PR2A 1E2BA 4KRXA 1IEQA 3AR3A 2PD4A 3NM6B 2GRUA 4I4IA 3VTAA 4D3XA 2ZWVA 3L7LA 4GR4A 3LG2A 3BIWA 5F35A 1HFJA 3GHHA 4Q1DA 1U9YA 3V8NA 3WL5A 4D5EA 2G9UA 5B7PA 2C59A 1XQ6A 2CXSA 2WF6A 3CKLA 1RLJA 3CLTD 4KDRA 2JLQA 3HV0A 3LK7A 1KWKA 4XM2A 4JK3A 2ONCA 1Z9BA 3WIEA 3Q3JB 1EVLA 1P29A 2C4WA 2H18A 2EFEB 3MBOA 3ONVA 1FSPA 4TWBA 5KNBA 4CEIB 2WV9A 5F2NA 2HJRA 4XH9B 3GI1A 2VTDA 1Z56C 2GBLC 4NEGA 1M74A 1RQLA 3GLHE 5JSUA 1MTZA 1W9MA 2O0KA 2ZZKA 1E5XA 4ZANA 2P5YA 4Z6KA 1QHEA 1T9CA 4L7QA 4MLCA 2FPSA 3RKRA 4C3OB 3GXBA 2RHHA 4R1TA 1N7IA 5JD5A 2G5GX 4GQIA 3OCXA 2ZT7A 3KL4A 1E1QD 3PFGA 4KQXA 3L9WA 3BN3A 3KE8A 4RSMA 4K87A 4QUJA 3TL3A 3C3YA 5A3QA 1JHRA 4P7BA 1L2TA 2O5VA 1QG6A 2P3OA 3NGXA 2ZITA 3HCOA 1DC4A 3K3PA 3PRHA 4MHOA 1Z0JA 4JL5A 3JQBA 5GVSA 4JXKA 3DGFC 2PT5A 1WY7A 3L93A 4IEIA 4P22A 4M86A 1KMQA 3ZV4A 2FW9A 4V0SA 3SHWA 2O6LA 1PP4A 2Q1XA 3E1GA 4CIVA 3KSMA 1Q5PA 1HRDA 4I4TF 1BE0A 1RRVA 1KEUA 1EP9A 1C1XB 3BXXA 1BMQA 4ZVPA 1N78A 1XN4A 2A1TS 3QKWA 4J4TA 1KEEB 2A5DA 1T3SA 1LC3A 2W70A 3TNDA 1PNRA 1R6BX 3OZFA 2CFRA 4IOKA 2MR6A 1G41A 4ZOLA 1KMHA 3RU7A 3VSCA 1G6KA 5A06A 3DC2A 5JH7F 1TADA 5FT9A 2HYIC 4MUJA 3RSCA 4DPKA 2WAYA 2WJGA 2QL9A 4KLRA 3C87A 5LYJA 2QYHA 3C5EA 4WXYB 3VZPA 1ZJ6A 1N25A 3DTNA 3EIHA 2C0QA 1GSHA 2IVFA 4OH7A 3ZV6A 2CDBA 2CVFA 3WZLA 2EATA 3FZQA 1RPNA 1US8B 1F48A 3FE2A 1O0SA 1AUPA 4LXIA 3UHPA 1XU4A 4BLSA 2XKKA 4MQFA 3U6KA 4GZ6A 1L8AA 4BQEA 1ZGAA 2FW7A 4NYMQ 5LUBA 5LNK6 3TLBA 2A57A 1G2OA 3E9YA 3NLLA 3ORHA 3HM2A 4IDHA 4MIEA 4UMFA 1Z18A 3UEOA 1LSJA 4YRLA 2HJVA 4ER5A 4NXMB 3R8FA 4DLSA 1ONNA 3IJEB 2O7RA 4FHEA 5DX8A 3KVNA 1GPWB 1ZJ4A 1PJRA 2JGNA 3JATB 2ZJ4A 3SKXA 2TMDA 1RI1A 1IQPA 1MXFA 4R83A 4WXRA 3NNDA 5J2UB 1QH8A 1NOIA 5IUJC 4KQWA 3WISA 1WVGA 1TLLA 1VCOA 4MVJH 2GK7A 2GTHA 1ZMXA 3PD7A 2XT9A 3OICA 3U7JA 5DWQA 2DSNA 2WIJA 1MEJA 4D56A 1VMEA 4HWTA 3WLFA 2SKCA 4R9RA 3T3OA 1NVVR 1L4EA 2PRYA 4BYGA 5C9ZA 2VP0A 1G0NA 2AMLA 5CPFA 2DFNA 4LVNA 3IBSA 4ISCA 5B55A 3QYAA 1PJ2A 1R6XA 5IBRA 2QPLA 3NVMB 1NOJA 1DXQA 2VDPB 4WUVA 3S2GA 3HFRA 3LO8A 5IDVA 4DCJA 4GMKA 4MJ3A 5CX1A 1XT6A 3VNRA 3D81A 4RS4A 4B0PA 5KI6A 3JD0A 4JIGA 4DE5A 3O8QA 4COOA 5CEFA 3ZJTA 1MZPA 5IT4A 1BJTA 2PL1A 3RQSA 5FWNA 4Z4EA 2O8NA 3RT7A 3MPUA 1L5LA 2P5SA 1KDZA 3DGEC 4ZV4A 3HU1A 1E1KA 5IUNC 1VPWA 4EG4A 4M37A 1OZFA 2R1TB 5AHOA 2BH9A 4L07A 3UJ3X 4ZO7A 1HYBA 1W4AA 2ZSHA 3FCEA 4LE2A 3VV3A 2O8DB 1QK5A 2AUNA 4QAQA 3OP4A 4AQDA 2R6HA 3EXHC 5HR5A 5CB6A 1D4OA 5EHXA 4D5GA 1NQTA 1AKRA 1FTNA 4Z51A 4TKVA 4YRSA 1FNBA 2HN9A 3PDCA 3LKZA 2PZBA 1AY0A 3WLJA 2C92A 2Q5CA 2VTEA 2VSYA 2WHYA 3PGXA 2ZUBA 5JNTA 1HE3A 2CLCX 3GD5A 4HX9A 2IUYA 2J3QA 5A4IS 3UAGA 1B00A 1WETA 1CVRA 3KWJA 5DBEX 2JKVA 1OH7A 4IS3A 5AW8A 4FKZA 5CU7A 1I1OA 1OPRA 2P1RA 3WDKA 1IB6A 2C8JA 2W22A 2AEJA 2WM9B 3IEKA 3NCHA 1NJSA 3WC4A 3D3KA 3ND6A 5E0OA 4F46A 1Z08A 1W7AA 2D0DA 1XA4A 4OSOA 5GJWC 3DQPA 1KEPA 3NTUA 3UV7A 3W9UA 4AXBA 5EGSA 5CGQB 1PFVA 4IBOA 1E9CA 1LX7A 1JHOA 2WU1A 1ONSA 3NWPA 2QRZA 4RF2A 4UREA 5LLTA 3G6KA 3FTQA 4XB2A 2DQKA 3WIOA 1M0EA 3D7SA 1SU6A 4MPDA 3FDIA 3U7QB 1G2IA 1QIIA 2F9MA 3ZE9A 4F5DA 1GQFA 1UBCA 5B6IA 1EUYA 4R1SA 1ZZEA 3P9SA 1UJ5A 5COBA 3VYUB 5HQ3A 1I32A 3TEJA 4KBYA 4C30A 4LQ4A 3SOPA 2VKQA 1U2EA 3E22B 4BO6A 1RAFA 5SY9A 4GRAA 3ZPXA 4PC7A 5JRDS 1TU4A 1VIMA 2HEIA 1SHJA 2ZOSA 1QUEA 3MINB 3OIDA 4HWSA 3RRBA 4HLDA 1EK1A 1VDMA 1EZZA 1I6LA 2YWHA 3ZHYA 5AVXA 4LEIA 2Q4RA 1XBTA 3GUUA 1RM3A 4MZXA 3D6UA 5BSRA 3WJ7A 2JCXA 4TZKA 2G08A 4UZFA 1Q91A 1XRNA 2VPWA 2ZSJA 3V7UA 4D9KA 2ZLBA 2JBWA 5IVHA 4AROA 3CKYA 4ZVSA 4BFCA 1MVLA 1ZGJA 1AUOA 3T9CA 2P30A 2QDKA 3KAPA 1Q19A 4KODA 1VA4A 4FGZA 5F2KA 3T54A 3QXGA 2GPYA 2V4MA 4YI3A 1P2FA 1UMCA 1Z5OA 5FI0B 4NL4H 4AMGA 2F9FA 1ZM2A 4LZNA 5KVQA 5KYUB 5DH9A 4CW7A 6AT1A 3IAXA 3WGJA 3ADDA 2REQB 3T94A 2VP2A 3EASA 3F6YA 3AR8A 1TA9A 1OTYA 1J56A 1DQSA 2OK7A 4P3YA 1BDIA 3D8HA 2QN7A 4GKJB 2I8AA 1UM8A 1PS0A 4KWIA 1HL3A 3V8EA 1XTIA 3D4LA 4MPJA 3EXEB 1KMMA 2XY4A 4KVFA 3UWKA 1MNQA 4KI7A 4GZ3A 3IVXA 4PLWA 2VP6A 3PWZA 3U81A 3O73A 2P91A 1L5RA 2ZSIA 4YI5A 2GZMA 1UMKA 3N0VA 5F5XA 4UHHA 2ABWA 1PL0A 3UPDA 1RCUA 4ZK6A 1YACA 4QO7A 1NQ5A 2VHCA 5K51A 1A2KC 1RZRD 1FK8A 1FFWA 1Y98A 2WBLC 4LV5B 3WNZA 1HTBA 3K9GA 2AQ8A 1KJJA 1X1DA 2FU5C 2PCLA 4K9LA 4YA6A 2IHVA 5KX5A 1Z2NX 1ZHFA 4LNUB 4YDRA 1SRQA 3HCBA 5ILOA 3ES9A 2H92A 2ZDQA 4QO8A 1F4VA 1CNFA 1Z0FA 2XQIA 1WSBA 4Q1BA 3A8TA 4RE6A 1JHXA 1R10A 4JUDX 1PN3A 1AURA 3FHLA 4JJIA 3O7MA 4IP0A 5CA0F 4XQ0A 4BP3A 4F6RA 1M66A 5JJCA 3N6XA 1MR3F 4MV6A 3VPHA 4E5KA 1Y1SA 1TYBE 4KAJA 5CFRA 4ND8A 5C8DA 1EDBA 1JPNA 2ECKA 1EGVB 3T3GA 2JGLA 1GU1A 3UGJA 1H0HA 3MWDB 1JFFB 1RXYA 1E7MA 3FMVA 4RPGA 3L7MA 4ERXA 1UBKS 4TWJA 4YVFA 3I6MA 4M0EA 3O47A 4C4AA 1W4ZA 2O4CA 1G4UR 2R751 5HF9A 4CG1A 1PL7A 4LHSA 2YTZA 3WADA 2DT5A 1J06A 1JJFA 1QGUA 3V8QA 4QLBA 3THRA 5HKLA 5IH7A 1C8LA 2JHAA 2VP5A 3R9XB 1UZNA 3IB3A 4QEDA 4NOMA 2CLIB 4ZO4A 3U62A 4NJEA 4HQ0A 3D64A 2J85A 3HL4A 4M87A 1NTRA 2GKGA 3KG2A 3UT6A 2XCTB 4IFTA 4LCBA 3VI4B 1X7XB 1WXQA 3SZMA 3OTGA 4WNAA 2Z5FA 1FQKA 3QVUA 3CJRA 3VQTA 4P3PA 1OTHA 2GA8A 4MAAA 1VC2A 3LT4A 5CD9A 3OIGA 4BBZA 2GKSA 1EYZA 1RBZA 2VHQA 1EGHA 4X6UA 4W63A 5EE9A 4A10A 3D6JA 3I8SA 5K3EA 3IAHA 3OUZA 1U9CA 3GVCA 4U6QA 2LWIA 2QY9A 3B9PA 1E1RD 5TGDA 3U39A 1W36B 1G291 2C9OA 2WWIA 4A73A 1UP4A 3LY9A 4IHJA 2CUNA 4AY4A 5J3JA 3KPUA 4PZLA 2ZYAA 1SOAA 4XVHA 4TUYA 1SUDA 1LPNA 4DDMA 4BQFA 3FUWA 4U6SA 2KI5A 3M1IA 4R0VA 2OV2A 3IQEA 1VBFA 3L0YA 2IIVA 3LCUA 4EZIA 4DR1B 2AJTA 3KSUA 5I7WA 3DBLA 2PQ2A 2YVQA 1S9HA 3AO0B 3JQAB 1M6HA 2J4DA 4KDFA 1ZI9A 4CI0B 3VO8A 1V4BA 1H2AS 3WL7A 1RYYA 3LD9A 2Q4BA 3X1MA 3WYCA 3TZHA 4BNDB 3GZJA 3NDRA 3S68A 4U3JA 4IX1A 3OQOA 3GX1A 1P75A 1Z4IA 5EESA 1EE2A 2AEMA 4XW2A 3VH1A 5BOSB 6PFKA 4LDJA 2BISA 4TS4A 3KS9A 3DMNA 4MYCA 2OGZA 1K5HA 4HQOA 1GPAA 4RV9A 4DC9A 5TC4A 1B0UA 1NBWB 4GR9A 1QYXA 4UFPA 3AM3A 3ZVRA 4DJJA 3H5NA 4IXWA 4EW2A 3UAYA 4L0QA 1P17A 1QNLA 3DAHA 3MWYW 5LVAA 1Z26A 1SCIA 3VR3A 4KQFA 1FX0A 4EFLA 1H9BA 3G2NA 1L4FA 1VCHA 3IBFA 3IUMA 1UXJA 3LOPA 1ID1A 1SKYE 3H9UA 1LVUA 5BT9A 3UKDA 1BFDA 1ENZA 1WJGA 4EATA 5JTTA 3DQZA 4RMIA 1IHPA 4DREA 4DQVA 1DDIA 1S1MA 5JD3A 4DIBA 3HDYA 1H8ED 3GIWA 4F86A 5E4TA 3PS9A 1N2HA 2GB4A 4PF1A 4AS2A 5A5FA 3R7WB 4JI0B 1VKRA 3HEBA 3PXCX 4WVFA 1NMYA 2GYYA 5LP1A 1G5TA 3KBOA 2BEKA 4ZICA 4DR2B 1R8QA 1IJKA 3EBOA 2APJA 1BTOA 1T9ZA 3CX8A 5TNXA 3LP8A 2D1YA 2P41A 2OFPA 4IJMA 3TRFA 2PJUA 3KVYA 1XOIA 4FGJA 1Y5MA 1T6BY 1ZOLA 3D43A 2WKSA 1JG2A 4Z3OA 3HXMA 2E4AA 4L7VA 4LHWA 5F3DA 4F7WA 5IKPA 2ID4A 3UYLA 4IUBS 1EXMA 1KL7A 2EX1A 1AKYA 1I2AA 1PG0A 2Z1MA 1JWAB 1F6BA 1RXSA 4RCYA 4RQTA 4R0MA 2HGZA 1B4DA 2P2ZA 4F92B 3G7NA 2BHNA 5EIWA 3ETDA 3KQSA 3HHPA 4JBHA 2XWPA 2W2MA 3L0PA 4JI7B 3NZEA 4JSTA 5I45A 3LUDA 4FD3A 2VTBB 1Q3KA 2QN3A 3Q72A 4O02B 5DVZA 1SIWA 5JVDA 3KJNA 3KLPX 2VA9A 2K4MA 1XIVA 5JWHA 4D41A 4BRWA 3LDFA 4LQLA 4JAVC 3GPLA 4BV9A 4MWSA 5AVQA 1IUKA 1NMSA 2BFEA 1UT6A 2VNHA 2WB4A 1G21A 3WYFA 4DG5A 4LDPA 2PXAA 1BOFA 3KYCA 2WTAA 4AFNA 4EWLA 4YCCA 3ZLUA 1P80A 3SKVA 3VI3B 4MP3A 4M88A 5I8ZA 1WMFA 5A9RA 3WAKA 2A84A 1YCFA 5HMLA 2JI7A 5J23A 2W2QA 4RMJA 4WXMA 3MWJA 2Y1FA 3F5DA 5EMMA 1Z82A 3IIJA 3LT5A 1VI6A 3UAWA 3CNOA 3RUHA 2C98A 4LZOA 1ZD4A 1S9DA 4R8KA 4KR0A 1PV1A 1RJDA 1OF1A 2XVAA 4JOBA 4TKZA 3MUNA 4O3MA 4QOSA 3VR5A 4RZXA 4XQGA 5AVUA 3IEMA 3DL2A 3U44A 2AK2A 4BEWA 5AKJA 1LJ8A 2Y1XA 4NP6A 5AO9A 3U5ZB 4ZI2A 3CH5A 4D98A 1ZL0A 3EVGA 4XYEA 4I1VA 4UHCA 4DILA 2J5RA 4ESVA 2JEOA 2NPOA 4O4LB 4PXYA 1WVMA 2QP4A 3A6ZA 5AI4A 1EP1B 2OY0A 2QRJA 3COVA 1H2XA 4EG1A 2EEZA 2Q3EA 5A5VA 5HRCA 1LNSA 2EWVA 3M5PA 1TTQB 4B3HA 4XVQA 4TSKA 5FRDA 1QOZA 2YIMA 4ENQA 1BEUB 3WKCA 3ESYA 1E1NA 1DRVA 4BU0A 2JVJA 3CCBA 2ZW9A 4ZODA 3AFGA 2Y1KA 1F2TA 2EW1A 3NTRA 3KB1A 2J7PA 1WUTA 2H11A 3P2JA 4TV8F 5LOVF 2CNOA 1CR4A 1DKRA 2JHPA 4RF3A 4CMKA 4YYZA 3UJCA 3A0UA 3V55A 3ZLVA 4ZYTA