1F3LA

Crystal structure of the conserved core of protein arginine methyltransferase prmt3
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
321
structure length
321
Chain Sequence
DLQEDEDGVYFSSYGHYGIHEEMLKDKVRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVIAVDQSEILYQAMDIIRLNKLEDTIVLIKGKIEEVSLPVEKVDVIISEWMGYFLLFESMLDSVLYAKSKYLAKGGSVYPDICTISLVAVSDVSKHADRIAFWDDVYGFNMSCMKKAVIPEAVVEVVDHKTLISDPCDIKHIDCHTTSISDLEFSSDFTLRTTKTAMCTAVAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTIFLLEKPFPVKAGEALKGKITVHKNKKDPRSLIVTLTLNSSTQTYSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the conserved core of protein arginine methyltransferase PRMT3.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords PROTEIN ARGININE METHYLTRANSFERASE PRMT3
total genus 99
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 2000-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 1f3lA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1f3lA01
4HG2A 2WA2A 4RVHA 1WZNA 5FADA 4BLUA 4RTJA 4RTNA 4R05A 2IH4A 2I9KA 4OX9Y 3CCFA 3MGGA 3HVKA 2C7OA 2PVCA 4RVGA 2B2CA 5DXAA 2FPOA 3SSMA 4PNEA 4YMGA 2YVLA 4QPPA 1YB2A 2PGXA 1PJZA 2ONYA 3DMHA 2JG3A 1FPQA 2AOVA 3I58A 5HIJA 1IY9A 3U81A 4H0NA 4C07A 3CKKA 3GIWA 5DTMA 1ZGAA 5EPEA 3JWJA 3VSEA 3DUWA 1QAMA 4QTUB 5KQSA 3TRKA 5EC8A 1G38A 5E1DA 3I5UA 2Q41A 5DXJA 3C3PA 3CJQA 4RV9A 5E1OA 4CKCA 5LQCA 5M5BA 4E32A 1SQGA 2VZ9A 1TW2A 4PIMA 5E9JA 5FA8A 5C0OE 5CCBA 4YMHA 3DP7A 7MHTA 1NV8A 2HTEA 2HV9A 3C0KA 4PYNA 3R3HA 4GOLD 4YUXA 1SUIA 3GRVA 1JSZA 2JHAA 3M6XA 4DQ0A 1SKMA 1R8YA 5ICCA 2F8LA 1AQIA 2ZIGA 3BWMA 1WG8A 1B42A 3HA7A 5KVAA 3EEOA 1H1DA 2PBFA 1YUBA 3DTNA 1VE3A 2OZVA 4WXHA 1ORIA 2ESRA 3SXJA 3UJ7A 4FT2A 2XYQA 3KPYA 3OE4A 1EJ0A 3FPGA 3KQWA 3BUSA 3UFBA 1DCTA 4JXJA 1JQ3A 1KPGA 2AZTA 3MB5A 5GM1A 3VYWA 2O06A 5K0BA 4X60A 4YUZA 1JQEA 2PV0A 1XDUA 2PX5A 3TM5A 3HA5A 2OB2A 4BLVA 1NW5A 3IEIA 4YV0A 4F85A 2OXTA 1JG2A 2GS9A 1L1EA 3KQPA 3P71T 2Y1XA 1FBNA 2CL5A 2GA9A 4MIKA 1NKVA 2HWKA 5E1BA 3EVZA 3CC8A 3LX6A 2UYHA 5EKXA 3FPEA 4DCMA 3OZSA 5KQRA 3HVJA 3JWGA 1NW8A 4OQEA 2E5WA 5T67A 3BWCA 5E2AA 3G2OA 3KQYA 3MERA 3NVKI 3EVAA 3HCEA 2C7RA 2IGTA 4M38A 3L8DA 4OQDA 2P35A 2P8JA 3M33A 1DUSA 3MAGA 4GOND 3NDIA 4EK9A 5EIFA 3T7RA 4IV8A 4Y30A 3TLJA 3HCDA 1MJFA 4AZSA 1JG1A 1P1CA 3PS9A 1Q0SA 1JTFA 4OA8A 5K0JA 1R00A 4PYMA 4OA5A 3KR1A 4RVDA 5EMJA 1XCJA 4BLWA 5K0NA 2AOTB 3MCZA 1ZQ9A 2VDUE 3E8SA 2LD4A 2OBFA 2O57A 2IIPA 4E30A 3P2EA 3G5TA 2OB1A 5FCDA 3R6TA 4M7RA 4GOMD 3ELYA 4P58A 3TFWA 3QOXA 5EVJA 3UJAA 4C03A 1JG3A 5DTRA 3THRA 4A6EA 3PTAA 3DXYA 3PVCA 5LSAA 2UYCA 1RJGA 4KDRA 5K0GA 4RSRA 2Z6UA 4FSDA 2V7EA 4GEKA 5ICEA 3VC2A 2ZIFA 4AZVA 4R8SA 1BKYA 4POOA 3BT7A 4RVFA 2YXEA 3B3JA 1NBHA 5P8WA 3Q7EA 4F86A 3CGGA 3I53A 3G89A 1OR8A 2PSSA 3ANXA 2B9EA 3GXOA 4EVIA 3UJBA 4P7FA 1QANA 2O07A 1XDSA 3LDUA 3OE5A 4FZVA 4KW7A 4C04A 3T7TA 4QVKA 2NXCA 3O31A 1UWVA 4Y2HA 2YX1A 1X1DA 2NYUA 2ZLBA 3CVOA 4KIGA 3HCBA 3OFJA 3CJRA 3P2KA 3NTVA 3Q87B 1N2XA 2V74B 1IM8A 2AOWA 4PYKA 2HMYB 3TKYA 1XDZA 5FHQA 5CVVA 3A25A 2NXEA 4DZRA 3EPPA 1RI1A 4LECA 5LQAA 1YFLA 1BHJA 2P3OA 2PXCA 4ER5A 3HM2A 3SGLA 5EEGA 5IH3A 2FRXA 2IBTA 4E2YA 1JQDA 1VBFA 1QZZA 4PONA 4CTJA 4PYQA 5DX1A 2QY6A 4DM3A 2IBSA 2ZTHA 5E2BA 4YUWA 2XBMA 3B3FA 3A27A 3MHTA 4LWOA 2PLWA 3AXTA 5DX8A 5F2OA 4RTQA 2UZ4A 2AR0A 3EVEA 1INLA 2NP6A 4F84A 3GJYA 3QV2A 3E23A 2JJQA 3P9IA 4AX8A 3P2IA 5ICGA 3DLCA 1R6AA 3TOSA 5BXYA 4RTOA 3KQSA 5EMMA 1RJDA 2AVNA 2ZFUA 3EVFA 5GIOE 3BGIA 3ME5A 2G1PA 1KP9A 1L3BA 3OU2A 2NXNA 1XVAA 3LDFA 5K0EA 4GUAA 4ER3A 3G2QA 4E33A 1G6Q1 3FRHA 5HFJA 1D2HA 3DXXA 3G88A 1EJ6A 4RYLA 2BR3A 2A14A 3BGDA 4CXMA 5CVUA 1O9HA 2P7IA 3P9NA 4RTSA 2DPMA 2P3QA 4L7VA 3LECA 5GP1A 1SQFA 1NBIA 2WK1A 3GRUA 3KPVA 1O9GA 3F4KA 3EGEA 2JH9A 4RX1A 2C7PA 4OBXA 2G8NA 1KYZA 4EKGA 4ER7A 2Z6AA 3SM3A 5EOVA 1VQ1A 1EAMA 1L3IA 1NT2A 2PWPA 2QRVA 3FUXA 4HTFB 2OY0A 3DULA 1P39A 3KR0A 3KR9A 3M70A 5GWXA 5K8VA 3OU6A 2FYTA 3FZGA 1O54A 4A6DA 3OZRA 3EVGA 3AJDA 2CKDA 2XVMA 3G8BA 3NVMB 4ER0A 5CVEA 2QM3A 3FTEA 2ZIEA 3P8ZA 5EG5A 4P7GA 3B7PA 1I4WA 4E2XA 3SR4A 1WS6A 3LBFA 5C1IA 2BZGA 4P7JA 4DMGA 4M36A 3NW9A 1RI2A 3FTCA 3V97A 4Z2YA 4GF5A 3DR5A 3S68A 2EG5A 2H1RA 1NE2A 1ZGJA 3UA3A 3CJTA 4R6XA 3AXSA 3I64A 4G56A 3FTDA 3GCZA 3SSOA 1EG2A 3UJCA 2IDJA 5D1HA 5EMLA 2B3TA 1XCLA 1DL5A 1KR5A 1L9KA 2ZWAA 3EMBA 3FUWA 3G5LA 3JWHA 2AVDA 2ZCJA 3R9XB 1D2CA 5K05A 4E70A 3R0QA 3KQOA 3G7UA 4X41A 2PXXA 4PYLA 4MHTA 2BH2A 3NMUF 3LPMA 2O0LA 2AOXA 4KVZA 5DRYA 2G71A 5E9QA 2VDVE 5HIKA 3GWZA 3OPNA 3GGDA 5GINE 1I1NA 1QYRA 3MQ2A 3PT9A 4OBWA 3RW9A 4PYIA 3HTXA 3PLAE 3KPWA 2GH1A 4IWNA 3EVBA 2FK7A 3MCTA 3REOA 2OPBA 2QRVB 1AQJA 2VDWA 3G8AA 5DM1A 4X63A 2BM8A 5BW5A 1G55A 4E2WA 1WXXA 1HMYA 3M6UA 2ZVJA 5GOZA 5EIWA 4WVLA 3BKWA 3HCCA 5EZSA 1FP2A 3SX0A 5LR6A 3ELUA 3B89A 4X1OA 9MHTA 4FSXA 3ORHA 4KDCA 4AZWA 3LDGA 3MTEA 5EKUA 4XCXA 3HVHA 5DM2A 1F3LA 4FT4A 5ERGB 5BP7A 3KU1A 3BXOA 3KPUA 1KIAA 5F2KA 1VP9A 2G72A 4P7KA 2ZULA 2AOUB 4GOOD 4C4AA 5FQNA 1NW7A 4LG1A 5DM4A 3TKAA 5KYGA 5GIPE 3FYCA 2CWWA 1HNNA 2ZW9A 3T0IA 5HOQA 4XUEA 4QQKA 1M6EX 1NW6A 1SUSA 4GC9A 4QVGA 5BW4A 4RTMA 4GC5A 3SSNA 3BZBA 2YUIA 1FP1D 4BP3A 3KQMA 2YR0A 5FUBA 1I9GA 3ID6C 5CVJA 1Z3CA 1SG9A 5E1MA 4CTKA 4QPNA 4LWPA 3A7EA 4R6WA 3TM4A 3UWPA 4C08A 4YUYA 5E9WA 4ZTBA 4GQBA 4ER6A 5DRTA 4EMSA 5ICFA 3TMAA 2K4MA 3UJ6A 4CWAA 1YFJA 1BC5A 3GU3A 2N47A 4YUVA 2NXJA 1RI5A 3OFKA 5K0LA 3GO4A 4BY9E 2YQZA 3THSA 3JWIA 1NV9A 4C05A 1XTPA 3ELWA 5DX0A 3HCAA 2DULA 2UYOA 1MHTA 3K6RA 2IH5A 1X1AA 1R8XA 2B25A 3B5IA 3CBGA 3KKZA 5K01A 3IV6A 2ZZMA 3UZUA 5K09A 3TPZA 1L3CA 2PXAA 2VP3A 4PGHA 4EQZA 4RTPA 3LCVB 3C3YA 5EHIA 3VC1A 2B78A 2Y1WA 2PY6A 2HNKA 4HGZA 4YV1A 4FGZA 4PCLA 2WA1A 4RWZA 5K0FA 3PX3A 2H11A 1V39A 3RIEA 4QDKA 2BR5A 1N7JA 1AF7A 2R6ZA 3FRIA 3SMQA 4RTLA 1F38A 2XYRA 3FUVA 2G70A 2OO3A 1JG4A 5DT2A 2R3SA 4MWZA 2ERCA 1Q0TA 4UOEA 1G8SA 3HP7A 3M6WA 5IKMA 2AN4A 5CIYA 1KPIA 1KYWA 3EGVA 5FULA 1KPHA 3EEYA 3M6VA 2PX4A 2IH2A 3DMFA 5FWDA 5LQJA 3P9CA 3KQVA 3ER9A 3LL7A 3FYDA 2XYVA 3I9FA 5CCXA 1FJXA 2PKWA 1P1BA 2JH8A 3TQSA 4XUDA 1R74A 2AN5A 5HZMA 4KIFA 4KWCA 3G2PA 4YV2A 3HCFA 5K0CA 3G2MA 2PX2A 2H00A 2YTZA 3D2LA 3LCUA 2PX8A 3R24A 4PWYA 4V0RA 3UBTA 4PIPA 4DA4A 3P97A 2ZWVA 3KR2A 3OZTA 2NNWB 3EVCA 1QAOA 3V8VA 3SVZA 1X1CA 3IHTA 3PFHA 5DLYA 2ZZKA 2C7QA 1ZHFA 1AV6A 1RJFA 2IP2A 3EGIA 1KHHA 3GRZA 1EQAA 2PJDA 1YZHA 2YXDA 3B3GA 2O05A 3T7SA 5K03A 3OU7A 1ZKDA 1VIDA 4PCAA 1RI3A 5EHGA 2QE6A 3KHKA 2ORED 1G60A 3NWBA 2ZSUA 3O7WA 5CD1A 2CMGA 5G02A 2ADMA 1TW3A 4V0QA 3HA3A 3LKZA 3BGVA 2P40A 2OKCA 3DMGA 4EKIA 1RI4A 3NWEA 5EGSA 3HNRA 3ER8A 1ZG3A 4NECA 3MTIA 4K6MA 1ORHA 5JR3A 2GLUA 4HH4A 1KXZA 2P1DA 3NDJA 5FHRA 5KS2A 3DLIA 3UA4A 1SVUA 4M37A 5FWAA 1D2GA 1TPYA 4B17A 5LQKA 2GPYA 4QDJA 3AWIA 1YF3A 1X19A 1WXWA 1EIZA 2UYQA 3BWBA 3FPFA 3FTFA 2JHCA 2XVAA 1Y8CA 1QAQA 5HIIA 5U4XA 5HIMA 2JHPA 3AY0A 2FCAA 3O4FA 5CM2Z 10MHA 3KQTA 3BWYA 2GAFA 2BR4A 4QQNA 4PYOA 4QTTB 5EEHA 5GM2A 2Z6QA 3TR6A 3ERCA 4DF3A 5EZQA 1T43A 3X0DA 4HRAA 5B1SA 3LBYA 5HILA 2ZBPA 3ELDA 2AOTA 4PINA 2AN3A 3E05A 3GRYA 4GBED 5FTWA 4FR0A 3H2BA 2I62A 2AS0A 3DXZA 4U7PB 3LSTA 4O29A 3FUTA 4XUCA 5D1NA 1JTEA 2AOUA 5DSXA 3UJ9A 2QYOA 5LQRA 5MHTA 2EFJA 1WY7A 2VS1A 4HC4A 2ZBRA 4HGYA 1RJEA 4IV0A 4HSGA 1VL5A 1UIRA 2BM9A 2EX4A 2OYRA 5HEKA 1YZ3A 3FUUA 3EVDA 3KPJA 1BOOA 3PX2A 2YXLA 3QOWA 2CMHA 4DCGA 1M6YA 4HTFA 2IFTA 5CVDA 4DKJA 4X61A 5LQUA 3C6MA 5EMKA 1P91A 3K0BA 2I6GA 4ISCA 2EJUA 4MQ4A 1JSXA 2IDKA 4ATNA 4FS8A 8MHTA 3WSTA 5DSTA 3LKDA 1R18A 3UJ8A 5EQJB 4RTRA 4AZTA 5C9ZA 5JUWA 3UJDA 4FP9A 3LHDA 3FPJA 3M4XA 1M0EA 4IKPA 4PYJA 2ZBQA 3IYLW 5F2NA 4PGGA 1PRYA 1JR4A 2KW5A 3GDHA 4AUKA 4RTKA 2NP7A 5DWQA 5CUQA 5DPMA 3NJRA 4MTLA 2I7CA 4C06A 4E31A 3FPHA 3GNLA 3PFGA 3DH0A 2ONZA 4KRGA 1XXLA 5FA5A 2PT9A 5DTQA 3E7PA 3A4TA 4BP1A 2P41A 2P7HA 4CKEA 2EJTA 1VPTA 4E2ZA 5FQOA 1U2ZA 1XJ5A 2IPXA 3P9KA 1NW3A 5T64A 1IXKA 2P3LA 1VP3A 3BKXA 2HR1A 3HVIA 2FK8A 4CKBA 2GB4A 2ZZNA 3PB3A 1VLMA 3A26A 3EMDA 1UFKA 1G8AA 5E8RA 3RODA 1N7IA 5LQNA 1X1BA 3GRRA 3LCCA 2PT6A 3OCJA 3C6KA 4R8RA 3HEMA 5H02A 5T6BA 5DM0A 3KQQA 3DOUA 3LGAA 2PWYA 2FHPA 4U7TB 3A7DA 5E8JA
chains in the Genus database with same CATH superfamily
1IMJA 4YXWD 3OO1A 4HYEA 3EAGA 4ITVA 1CR6A 1S2OA 4R9UC 3TQOA 3C3EA 3RUPA 1MVNA 3B2EA 3E9EA 4E07A 1H5NA 2HFJA 2HA3A 2I9KA 5E4JA 1BG6A 1K3TA 1LRKA 1WEHA 1ZD1A 2PGXA 4UBJA 5BRJA 1HT0A 1PJZA 2MYUA 2P30A 2XE7A 1TU3A 3CUUA 3U81A 4H0NA 5U1PA 4RHTA 2B99A 5DTMA 3DKVA 1VHWA 3EY9A 1GGJA 5ECYA 3VSEA 5KQSA 3TRKA 2Z8ZA 5K6RA 5K1ZA 3MWKA 5DXJA 1YQEA 3N6XA 1A3CA 1DNPA 4G24A 4G63A 4R16A 5C80A 4Q82A 1UBJS 5KJEA 2QLBA 3WKCA 1Z56C 2VZ9A 1II0A 3VU8A 3RRFA 5KVSA 5TIIA 1JHZA 4P33A 1NTOA 5HMMA 5GZ6A 1E1DA 1NKTA 1V11A 2J4CA 2K2WA 4G23A 1DPGA 3KKNA 1LPOA 2TECE 3FM9A 3C43A 5ESXA 1LDYA 3M6XA 3OE7A 4R2XA 4EAQA 4OLHA 2WHXA 1QK5A 2QQEA 2WNHA 1JIIA 1AQIA 2J4FA 5KYWB 3O75A 1AHNA 3RAEC 4LZWA 5F2NA 3VDQA 4D97A 3GFSA 3A28A 1DPFA 3LG2A 3ZDEA 4CN9A 3BM5A 1SUBA 4NJMB 1EJ0A 3K1ZA 4FGLA 4II7A 4BBPA 3FVTA 4QJIA 4LHYA 2QJRA 3QFTA 2OCPA 1DDGA 2XMGA 3HYRA 3WWYA 4C0SA 1WB9A 4ITRC 1VI5A 4ZIRB 3V1NA 4NWIA 2JBWA 2QRMA 3RU7A 3L93A 1QG0A 3GLRA 5A04A 2I1QA 4MR9B 4MJLA 4I5EA 1JAIA 4MI9A 3GYBA 3KYCB 2Q1SA 4OLAA 3A70A 4W9RA 3K2EA 2BGTA 1FNBA 5AVRA 4DTIA 5FEUA 5EKXA 4Q4JA 4DB2A 2RHJA 2AJDA 1JXAA 5B7GA 3BWCA 3ESBA 2RMKA 1M8KA 2VCYA 3QFSA 4PFQA 1JT2A 5I7UA 1WB4A 3HLTA 3IQEA 3PXCX 2YJTD 1PHPA 4QRIA 3M33A 3OQNA 2HBRA 4UM9D 1RJ9B 1NP7A 4NG5A 5FBVB 3E5HA 5AJVB 4BOYA 3TPCA 3CF0A 4GR9A 4XX0A 3L7MA 1ULHA 2NZXA 2YZ2A 3K92A 5TSDA 3WYCA 1GGFA 1ZGCA 1FLDA 5TC4A 1CBUA 2HFKA 4JT9A 2DG2A 1HSOA 3AL2A 3ONWA 4B7XA 4BLWA 4OGFA 2GCPA 3F8WA 4J9UE 3LGXA 4X84A 3CN7A 3WGKA 4QJ5A 4HUQA 4PX3A 1TYBE 4YLYA 1F2VA 1T5BA 3OM1A 5EI5A 3GBSA 2Y0PA 1CDDA 1DP4A 4XWTA 5AP9A 4DKXA 4BFVA 3ELYA 3X1MA 1ELOA 5MN4A 3PUXA 3W7AA 2XE6A 2QZZA 4DLUA 4HX9A 3VO9A 2BEWA 3D3JA 5C8YF 2UYCA 4MA4A 1HBJA 4QQ8A 1R15A 2P9CA 2QXYA 2NQ2C 3WNDA 3ZZTA 2AYYA 1Y5LA 4P3OA 2X8LA 3IDZA 3MMPA 4G97A 2ZSJA 1GTRA 3ANXA 1N6RA 3NBKA 4UU1A 2WFLA 2CDBA 5JRZA 1CRQA 4TXMA 4Q02A 4RQTA 4B40A 3DA8A 3MUNA 5AW9A 1DAMA 3F98A 2R4UA 3A37A 1NDUA 1DV1A 1IZ7A 4Z0PA 4B84A 1QVWA 1X8KA 2OQ2A 3BMOA 4KIGA 3HCBA 1V1JA 4D25A 4EGFA 2HRQA 3ZW8A 4DLZA 1WCIB 4BFWA 3KIPA 2RGAA 4NMXB 2QTFA 5DBGA 4GBMA 3RASA 3U7EB 1JEQB 3PXEA 2WHEA 4TKVA 4RJ2A 1J2EA 2PXCA 4DLNA 1SPXA 1G2QA 3DKIA 3FUCA 1Q0QA 1F2UA 1T5IA 2B8NA 2C82A 5FNZA 4PONA 5JMWA 4XJXA 3KQUA 3UH0A 3R5HA 1OV6A 1POWA 2ZYUX 4OUKX 3QEMB 4LJRA 1AKUA 3NP7A 1JMVA 3AF4A 3G0DA 3QMPA 1OZ0A 3TGWA 1R0KA 4A4DA 1E3WB 4U5XA 4ENVA 1Z2AA 4WZAA 1FS5A 1LPAB 4B5KA 2ZRIA 3GJYA 3USES 2JJQA 3IP8A 1PUXA 2XA1A 3DLCA 5B6JA 1QH9A 2YQ5A 4KO3S 2WZCA 3UW1A 2OGUA 1CNEA 3ENZA 2QX8A 1CUHA 3O4IA 1CR2A 3F5MA 3P9QA 4DCNA 3CUVA 3PD7A 3CLRD 4EA6A 3NBXX 4Y6RA 5DEIA 4EUKA 2O8EB 4IIEA 3LDFA 4R7TA 3QVWA 5ED0A 1I3LA 2DT8A 5HFJA 1C7ZA 1SG6A 4KQ9A 4XAQA 1QDEA 1WMAA 3WZLA 3HL0A 2G36A 4AO7A 4W4TA 3IB6A 4GUDA 3DBRA 1LWOA 1NDQA 1CJSA 5CX4A 1W5AA 3B6JA 3GRUA 3IO3A 3RNLA 1KMHB 1O9GA 4UEOA 2O8BB 4FPXA 2ZBDA 4G2TA 3S2ZA 5KYYB 3T1VA 2C0CA 2QX7A 3OLVA 1DRWA 1ONOA 3H3FA 4N3GA 4R2KA 1OT3A 2J3QA 5C1PA 4LXUA 2I1WA 2X0DA 2GZ3A 5J4LA 5J2UF 5JDCA 4MVYA 4CQMB 3E35A 2YXPX 3AJDA 1RWXA 1ZRSA 3R3XA 2PUJA 2QVZX 5IDYA 1UPXA 2ZIEA 4W1QA 2CGEA 4X1IB 3CVJA 1LDNA 3DFMA 1M8GA 3IPAA 3PPVA 5CEFA 4CEJB 5C7LO 1U0TA 3AV3A 3NAGA 3RT9A 4P7JA 5LUBA 3VISA 4BRWA 1WHTA 1SK9A 2IZ6A 1LNSA 3RT7A 3WDKA 2ZRDA 3UQYS 4ZI2A 4MCIA 3KOZA 4BNZA 3FTDA 1C9KA 1DQNA 4Y2UA 3NUGA 2BTEA 5AW5A 4JXZA 1ILWA 1TEVA 2PLAA 2WDPA 1T5TA 1V2HE 3DJYA 4WBNA 1O0CA 3NBFA 1SXJC 4R3WA 2HJHA 3FZYA 1DL5A 3GDFA 2AVDA 5D6OA 2Q29A 3TAXA 5AJTA 1D2CA 3DEJA 3G9QA 3LHIA 1GPH1 1UKZA 2CBXA 1KDPA 2JHFA 2ZSHA 4P5DA 3H13A 3LQ2A 5DHTA 3D81A 1J0EA 4UKDA 2HK7A 2JF0A 2PXXA 1P2FA 4CUJA 3DE6X 4FCCA 1C4XA 4NZYA 4YCSA 4MHTA 3UG7A 2N75A 1V95A 4JDUA 2QTZA 1GFWA 1RP7A 4LY0A 4XTCS 2JGDB 5IKOA 4D0NA 2MSCB 3BQ9A 3C1AA 4P3XA 1K89A 3IT2A 1FRVA 3EVBA 4O4HA 4O4IA 5JADA 1T1IA 3REOA 1B74A 5MFZA 4LX8A 4I6JA 4M8LA 4C43A 1KYIA 2R96A 4IP0A 2F43B 1FFXB 2XXBA 1RFLA 4IINA 1KC3A 1Z0ZA 4I1OA 4EHJA 5EIWA 4NBWA 2EEPA 3PD1A 1E7QA 1BCRB 1GVNB 1EE1A 4V0KA 4L8GA 1ZW6A 3TQCA 1KEPA 5K3EA 3FMVA 3LDGA 4URVR 4MMXB 2H65A 1M2NA 2VHQA 3O93A 1FTYA 3G8CA 1OH7A 3IULA 3IHLA 4GT1A 3MLEA 4UMDA 2QR3A 2XMPA 4ZOBA 3RFFA 4ARAA 1XIVA 1NSTA 4DV3B 2VBCA 1KSHA 3P0HA 1WWKA 3LAWA 1NVAA 2O7SA 1S2GA 4QU9A 1WZCA 2XUAA 1RFGE 1WKCA 2IYWA 4OXIA 1ZL0A 5BMVB 2PIDA 2W0MA 4Y2SA 4ARUA 2JZOA 3SF8A 4ZC1A 1CUJA 1T13A 5KCMA 5ER9A 4G1MB 3V32A 1IC6A 3FWPA 1SG9A 4P5PA 1R12A 4EITA 3G49A 3OJLA 1K75A 4ZVKA 1F5NA 4NBNA 1R4ZA 1CZLA 1T3TA 4B6JA 4JYCA 1ENZA 4GPD1 4DLPA 1EUQA 3OF3A 4NSNA 4JLKA 4MS4A 4BVEA 1ZFNA 2P90A 4ACBA 2X13A 4ZZ0A 1JEYA 4UQLA 5BW8A 3EFEA 1R27A 2DULA 1MHTA 2WLSA 3LV8A 3ER6A 1LY1A 4N3BA 3WFZA 2XUFA 1G5FA 2YVUA 1XAJA 2VVTA 2IEYA 2BEKA 4G1UC 5LM3A 2SCUB 3QSGA 3GFRA 4LJ5A 3HUDA 3RRYA 2EKLA 4IDBA 4U39A 3VVLA 5KTMA 4B3TB 4LPSA 1ZIPA 4MICA 3SZUA 4BFSA 3C5HA 3CUSA 3C24A 4I1SA 4ZKEA 3PC4A 4E22A 2VH1A 1G8FA 2O4UX 2XCQA 2ZB8A 3DB2A 4FYJA 3CX8A 4UHKA 1M8PA 4BECA 1ECCA 1KI4A 2JVKA 4YAKA 2PNFA 2GZDA 2RHGB 2IWHA 1QIKA 4UEQA 1Y63A 3NDBB 3IHWA 3VV3A 1EVQA 1FZQA 1QFSA 2R3SA 4MWZA 3JD0A 3FF1A 4JQZA 4R40A 2JAWA 1C8LA 5IM4A 3SYRA 3FSEA 2H0AA 2W8BA 1KYWA 1DHRA 3REFA 2VBGA 3KAPA 3CB4A 2DJ5A 3M83A 3RHTA 5JXHA 4ISBA 4MARA 2YV4A 4KK3A 1E94E 2GILA 4R5HA 3SG0A 3WYBA 3O74A 4DJTA 3SN6A 2Q5EA 4REQB 3UY4A 1LD3A 1GEGA 4X1KA 4WL0A 3B38A 1DQYA 2JCXA 3F3SA 4JB8A 3T7KA 4BBZA 2P2YA 4ZYVA 5B4UA 3DYBA 4X6XA 1BFKA 1N2OA 1Z6ZA 1PL0A 5JH7A 1Z4QA 5E7IA 1YQWA 1NMEA 3N8HA 2L18A 4B8YA 1NG1A 4Q1VA 4ZK6A 4FGUA 5B1YA 2QSYA 4I5FA 4KXLA 5JS1A 1HUQA 3A3OA 1ULZA 4G0OA 2GXQA 1XAIA 2ZR7A 4DJDC 3G0BA 3ZOKA 4YQZA 4PAOA 3WGQA 2ERXA 4ZZ2A 1MTOA 3UMBA 1NUHA 3GUCA 3RR2A 2J0QA 4N5LA 1Z82A 4MULA 3B3GA 1HG0A 1IHYA 2YN2A 2GRUA 2JB9A 2OFWA 3JX9A 4FNOA 4OK3A 3JYHA 3RIGA 3U6BA 3O7WA 1EXVA 4XVQA 3U7FB 2JCYA 3W6PA 1RBYA 4LJ7A 5JMTA 1Y4SA 1GRCA 3N76A 5GV7A 4YCBA 3JPYA 4CDNA 2I6TA 3G6KA 2DKFA 3LYAA 3TSOA 1QUFA 1OLUA 5BV8A 4L9SA 1KA9H 4BO4A 4O4HB 4FUTA 1P7ZA 2V96A 4K7JA 1L1RA 2P1DA 2IOFK 1E2JA 2W6CX 3LUHA 5AKGA 3UA4A 3BFVA 1HORA 5HW0A 1G1MA 1RQPA 3E0XA 1DX6A 1V1MB 2H18A 2H92A 4M0EA 1XMIA 2X0KA 1P72A 1DVRA 1J20A 3B1JA 2YV2A 5GMOA 1QKKA 4TLLB 5IMSA 3PUYA 2GF2A 4NXMB 2EDCA 4QSMA 3NEPX 1N2BA 4QQNA 4KP7A 2VJMB 4PWZA 1Z2EA 3T3GA 3FN4A 3SS7X 4TS3A 5HCUA 3LE8A 3X0DA 1JU9A 5ALFA 5AOCA 5T4EA 1OFIA 2ZYIA 4K9NA 3KZNA 4Q1AA 3M5CA 4WESA 3VR6D 2NPIA 3F7MA 2NAPA 1HOXA 1L4HA 3GRYA 1EH5A 5DOVA 2JLRA 1XTVA 3HB1A 1P1JA 2B9VA 3D8RA 4MI1A 4O29A 1DBSA 1E1MA 1RE1A 4I4CA 3OZCA 2PMDA 4HNUA 4OO3A 4UULA 4MVXA 1J06A 4WN9A 3DTTA 2IHNA 3FCCA 3RJ9A 1C9EA 2JARA 1UFRA 2K87A 3Q7QA 3KZMA 3ZYCA 4GVXA 2IIQA 2HGSA 5T41A 4BJHB 4RHFA 4WLVA 1QP8A 2X19A 1SU8A 2J85A 3ADOA 3EVDA 2GYYA 2AYZA 3B1VA 3L49A 3OJXA 1CQIB 4B2PA 5KQLA 3OOJA 2X58A 5A3VA 4FFDA 1AKYA 1PZXA 1HT3A 1Q2XA 3K0BA 1B1CA 4RVNA 3D4OA 4QODA 2ZJBA 1JDPA 3KM0A 4DLRA 4Q6BA 4TS9A 5SY9A 4CF6A 4BGDA 5AHRA 2E85A 1KRXA 3EPJA 1QJ4A 2C9MA 3PI6A 3G2JA 3MTQA 4ZT5A 3KELA 2CMFA 2OORC 1BO6A 3SOPA 3KV1A 2W6PA 4AJ9A 2VYFA 2ABWA 3I05A 4YJHA 1C1XB 1V7QA 3M7IA 5FA6A 3KT6A 5FTNA 1M1ZA 4MROA 1NF3A 5ADUS 3KQHA 5JD4A 2WJYA 3T7JA 4E2FA 5KX5A 4Z3KA 3AKYA 4JB3A 3TLEA 4HZUA 2XOXA 1O0SA 4AWAA 3DDNA 1AQLA 1K1EA 3S2EA 4DYHA 3IQIX 3IQWA 5FQOA 1NW3A 2F3SA 4OHBA 3ITKA 5TMPA 1VP3A 1KI9A 4EI9A 2VJDA 2FK8A 5B6PA 1D1PA 2ZUWA 3PFKA 2DFKB 1GAXA 4BVHA 1N7IA 3LHSA 4R3NA 4XFKA 3ZZNA 5C5CA 5DV9A 3VSBA 5K2OA 3GJRA 2IU3A 3C5VA 3C6KA 1EE2A 3ONEA 5HDQA 5H02A 1EX9A 1UF9A 2CZQA 3OTIA 3EPRA 3QVGB 5FUWA 1PJ2A 4RH1A 3FCUB 5BR4A 4HN2A 1M2VA 2UZIR 2ZSIA 1UPBA 4QECA 1YRYE 4UQOA 4BC1A 4BE7B 3KVNA 3N2EA 2VATA 1KSFX 4R05A 3S2SA 4Y9RA 3CCFA 2RGWA 5LOVF 3HPQA 1LDBA 2FPOA 1XWIA 1ZJJA 2J9GA 4URUR 4NG4A 4UU7A 1KFJB 2OHVA 1E2BA 1AKVA 2VHZA 1E6CA 3JASB 1SEPA 5LIPA 1W30A 3C1UA 3CKKA 1HLFA 3ROPA 1XTKA 1E7WA 4AYTA 3SJ7A 4PAGA 3RVBA 4TYWA 2PRSA 3L1KA 1Q1QA 3N2GB 5AW8A 1KFKB 2YOHA 3GQVA 1BN7A 2Q3BA 2CXOA 3PHGA 3QG5A 4QHYA 4QXRA 4JOSA 5CLQA 4AMGA 5JY1A 2Z2XA 3HZRA 1Y8RB 1XPJA 2RCNA 2V0CA 1Z88A 4OQQA 8OHMA 1D9ZA 2R47A 2JHAA 2V7QA 1DAPA 5CLJA 5LKRA 1CFZA 4MIYA 4HUTA 1YQUA 3MOSA 3FOAA 3VSCA 4CIVA 1I6MA 4RCVA 5HXAA 3HCWA 4JC8A 2C57A 3QPVA 3SI7A 1VE3A 2GLTA 1NOJA 4G5HA 3PHLA 5HK9A 1KSGA 4D4GA 3JVVA 1KE1A 3N8NA 5JJ5A 1ZAYA 4EG5A 3AP1A 2IZ1A 3R4VA 4Z86A 3ET5A 4DC0A 3LYUA 1JT9A 4JLAA 3CVVA 4S05A 3T1TA 4WERA 3RHZA 2PBRA 1R0XA 1B8OA 3A6HA 1M33A 1DBWA 3SHTA 4TL9A 3V6LA 4D3DA 3PWSA 1EBBA 3Q88A 4R7ZA 4UHDA 4YV0A 2OXTA 2YWJA 3MQFA 4MWTA 1ECGA 1E8NA 3GCXA 4XX0B 3ZY5A 4TLAA 3ZCXA 2OCAA 4QTYA 3IT0A 2Y4OA 3K71B 3FJ1A 4TTPA 2LTAA 3WLTA 4YAGA 3O9ZA 1X1TA 1E5VA 1D7OA 1Q1BA 4PAMA 4BAUA 3LLCA 2J9RA 3UJ3X 5BYBA 1L5VA 4LI3X 2OD9A 1YULA 3WK5A 3AHFA 1ZS9A 1BEZA 4X45A 3NM4A 4OQDA 3SD7A 3DVAB 2J3MA 3RIXA 1JEEA 2OOKA 4NBTA 2VEOA 1F8FA 2V0NA 4N1AA 1J1ZA 1EX1A 1WXFA 2CEKA 3KUUA 4UVHA 3QKSA 2H4JA 5EIFA 4BGEA 1Y3AA 4E09A 1OH5A 5BN4B 1OAAA 4B31A 4K9SA 2R4TA 4D42A 3FROA 3K20A 4RM3A 4F06A 2QSZA 4JBNA 4PYMA 2XA2A 1OGJA 3A1VA 3AUYA 2BSXA 4KXWA 2C96A 2OCBA 2D62A 1TE2A 2E6KA 4ZODA 2JGLA 4B46A 2HAEA 3DGFC 3TZEA 1ZQ9A 2G1UA 2GVZC 2HDOA 2RHRA 3E8SA 1UOPA 4OVKA 4TV9A 3PITA 5HX7A 2JLQA 4U0JA 1H2WA 4WT7A 3R6TA 4K9DA 5MGBA 3GEIA 3R8FA 1OLOA 2P9QA 1YBAA 3JQ7B 4EZEA 3U7GA 2QNIA 4CTOA 1W36B 1RJGA 2IA5A 3NTOA 3QE0A 1MLDA 4K0RA 4MQFA 4JT8A 4CMIB 3SR3A 2V7EA 1M1YE 3WGLA 4EB0A 5H7XA 4MLCA 1JGTA 5KDLA 4BRSA 1KU0A 3K9CA 3RTDA 3I53A 1ANKA 3U19A 3CKLA 3L0DA 3EB9A 3IE2A 3O0TA 4PC6A 3T3MB 3UJBA 3LDUA 3BMQA 2AFHB 2JIPA 1O87A 4IDAA 1E9RA 1ZIYA 3DBHA 3ICOA 3GMTA 4DEXA 1WV0A 4CZ2A 4U2BA 2BF7A 3LUKA 3JQGB 2CD7A 3DLHA 1VPWA 1ZOIA 2HMTA 3AMVA 2I7DA 1JFLA 1T4GA 3BN3A 3NANA 3RFTA 2QMOA 3UANA 4HO1X 4BFZA 1MB4A 1XQ9A 1M3SA 1YQXA 4N39A 5D86A 3TEFA 5BWOA 4W5OA 2HU5A 1BIFA 1PS0A 1P8AA 1R8SA 1CUDA 3B1KA 3HWWA 2RHCA 5M3BA 2IS4A 3L40A 3NTRA 2DUJA 4LECA 2Q50A 1SRQA 3FX2A 1MQAA 4QFBA 4I6GA 1SUAA 2DF8A 2XR1A 4ND5A 3LYLA 4MSUA 2FRXA 2W4QA 3AI2A 3TI9A 1PUJA 3UEOA 7AT1A 5JAOA 3A31A 3L4JA 4IGEA 4DBLE 3QWFA 3G3EA 2AA3A 3DZIA 3O26A 4J2HA 3B3FA 2BM0A 3A27A 3R4CA 4WASA 3MHTA 1HQDA 1XLVA 2PLWA 2V8BA 3L5KA 3DZGA 4MZXA 1VKOA 2I8CA 1Z07A 1WA5A 2FSVA 5CTJA 2QQGA 2H2IA 2J3LA 3KXDA 1W88A 3LQRA 3HCOA 4NQZA 2HHJA 3KFXA 1T9CA 1LB1B 2FN7A 3EGXA 3HBMA 1V25A 2F1JA 3Q5DA 4PGMA 5D5HA 5J43A 1X9IA 3C3CA 4DW8A 1VYUA 3QZUA 4ZAGA 4YP1A 1FRNA 1PD0A 3GAMA 2DPHA 2OBYA 5AM4A 4N5IX 3RANA 3VI4B 2ZFUA 1N9GB 4FFNA 3NC4A 4LF7B 4XPIB 3OU2A 4X85A 3H05A 2B21A 4ER3A 1PVOA 4HQKA 4CV0A 3FVVA 1EJ6A 3LU1A 1IHPA 2A14A 3EQ8A 5CVCA 1F2TB 3U44A 2ZSFA 3RE1A 5LP6F 5F9FA 1RYBA 4OLJA 2QKYA 1WLSA 2V9PA 2WJIA 4LKOA 3R0IA 1WMFA 3CLUC 3F4KA 5HP4A 4HX2A 3OP4A 2OR3A 1GU7A 1ACJA 3EGEA 1TMGE 4FEYA 5FWYB 3IAUA 4D9IA 5IBRA 1XMQB 1FXWA 2VP4A 3I5XA 4F7DA 4FMCF 1RYEA 1DC5A 2EZUA 2BBOA 2X8JB 3FG9A 1VQ1A 3AF5A 4EGQA 4H1UA 3KR9A 2ZRKA 1KXJA 1H6AA 1OAKA 3FZGA 2WTNA 3WBFA 4IQ8A 1LVGA 1USGA 2OCDA 4I9FA 5CVEA 1DBQA 3G0OA 4ZI7A 4I5GA 1POXA 2YWRA 2DCMA 2VYVA 3NXKA 3QFRA 3DDOA 2VJQA 3H6HA 4FFMA 4LN1A 1TZCA 4MUIA 2JA2A 2IUTA 4WNCA 2EGGA 3EQZA 3GHHA 4YPOA 2GM3A 4R6XA 5INTA 3EDCA 5T4HA 1OFHA 3DBVO 4B3MB 3OEYA 2WSBA 2ZI4A 4CQLA 4N9QA 4AICA 2VRBA 2H9AA 2HADA 1FLNA 3V1YA 1IWOA 4KVAA 2R8EA 1G66A 5C31A 5TXGA 2VBIA 2XTZA 4C88A 1NX9A 1OHHA 4K28A 3U2QA 3ZXXA 5KQPA 2I78A 3QMWA 9ATCA 3OPYA 4CM4B 4PBTA 2AFIA 4NCNA 3RAJA 1X1EA 1ADGA 2GJSA 3G7UA 4O4LF 5G2OA 2GTIA 2QE7A 4OMDA 1E2MA 4CRWB 2VN8A 4TM7A 3GY0A 5DRYA 1NDHA 4J0GA 2HO4A 2WFAA 2FB9A 2ZEJA 4QBHA 1WCWA 2QBYB 4D4KA 4I7EA 4TTTS 4B34A 1TYZA 2GEFA 3HCPA 2Q3DA 2RI1A 4Y0VA 4PRYA 3B8EA 2C1EA 2D6FA 1EA7A 4YBZA 1NMZA 1PE0A 2AKEA 1FEZA 2FMKA 4LZJA 5I47A 4O3FA 1RLOA 4BTVA 4C2UA 5JSHA 4Z51A 2BKAA 3EIWA 2N46A 1XPRA 1CUGA 4EEXA 3PDHA 1HLDA 4J16A 4LUCA 5DM2A 3VNRA 5BP7A 2FU5C 3CZRA 5EHZA 2OTCA 1DS6A 2M6RA 3TNDA 4PLYA 1A72A 2P4UA 4WCFB 1VP9A 2BKVA 4GX0A 2AOUB 2I03A 2FEOA 3SXUA 2QD5A 3TKAA 2FEPA 3HFGA 4HGQA 1MC1A 3IIMA 4IX1A 4PZYA 4WFQA 4C6SA 3I2FA 1HNXB 1IWBB 1F8XA 1NLYA 1M34A 1TJYA 5TMBA 2DRIA 4XD7A 1YQTA 5DK6A 2V45A 4RTMA 3CR7A 2GSDA 1QSGA 1ZUNB 2IXBA 4IEEA 4QLBA 5M29A 5AVVA 1E32A 1FP1D 3KQMA 4YJDA 3WNCA 1I9GA 4BDSA 4BNXA 1F8UA 1LX6A 1XLTC 2ILVA 3O8DA 3TB4A 4N0PA 1N8NA 4R6WA 4NJEA 3W9YA 4CIBA 1XVVA 1APBA 1BA3A 1TA0A 2BP7A 2QPOA 4L8WB 4DLKA 2J6IA 4V1CI 3DOOA 4LWQA 2D2IA 2VC2B 4Q5IA 1U3CA 2C7BA 2WMNB 4CUZA 2P1ZA 3W4KA 1SGWA 4L07A 4OQPA 2VJPA 1R4MB 4TTAA 2FQXA 2OWDA 5ELXA 2MYTA 2XUDA 3VRHA 3WL4A 4C05A 1JHOA 3T3HA 4C7OA 1W96A 4JLUA 2BHLA 1T8TA 3AFGA 2QTHA 5PNTA 1FC0A 1EQUA 1TLFA 2LE0A 2QNBA 2EP8A 3KUCA 5F3DA 2C2MA 2DTXA 3G2LA 1XTIA 4PE5B 1I7DA 2ZJ2A 3D3WB 2ZUDA 2QTVA 4G37A 3QNWA 4WNAA 3NYQA 1DJNA 1O03A 1W93A 5KU7A 2I6FA 1NW9B 1JKXA 2MHCA 3HPRA 2GAOA 3K9LA 2Q7DA 1U0NA 4EF6A 4PF1A 2IITA 1N3BA 2I8AA 4N0QA 5JLJA 4JELA 3LDHA 2ICAA 1EDOA 5CNIA 2JFHA 4R71A 2FVXA 3E7WA 3EEIA 1LLUA 1I80A 4H3SA 1YJAA 1LK0A 2JLYA 4FYYA 3YASA 1KIFA 1NVBA 1TU4A 3FPLA 2JFBA 1V2GA 5FOTA 3IP9A 3JQAB 2I3BA 4C5BA 2ZJ7A 4RE5A 3R7NA 4ZCIA 4L3VA 4B4WA 5DISB 4DSUA 3U09A 3RCBA 3TRDA 3KZVA 1I32A 2PK3A 5EUBA 2PX0A 4C0LA 5IJZA 1W85B 2IZ5A 4TLBA 3FOEC 3CPJB 3SCZA 4NZZA 2RH4A 3KTAB 4EY3A 2HIAA 1UK9A 1VBMA 4CCYB 1AGXA 5A3QA 4OFWA 2DPGA 2PX8A 1T4BA 3W34A 4H77A 1JR3D 1N78A 2I2DA 3BMXA 2FN4A 2FNAA 4Q3EA 1PSDA 1P3JA 4A0QA 2HJWA 1QAOA 3JU3A 1L8AA 4JROA 3V8VA 2PH1A 2J9YB 1X1CA 1RWWA 3AJ8A 4QXOA 3VI3B 2G7MC 1X87A 1O6ZA 1ZZEA 4MRRA 3VAYA 4G5RA 4AIIA 1U3TA 1GA4A 2G04A 3VOAA 1ODTC 1KF0A 1P1KA 1QZTA 2D7CA 3HNOA 5EJGA 3UJHA 1UQRA 3QLJA 4BP8A 2QE6A 4HXYA 1JBKA 1NQ5A 2V7BA 3QUSA 1UDBA 4Q9IA 1TT5A 4HGNA 4UTZA 4WD3A 4WH0A 4EHIA 2OCGA 2XUZA 3KSUA 5BVHB 1LI4A 1GSIA 2NSJA 4YQEA 5IKPA 4I55B 4NCXA 2E0IA 3DPSA 2A84A 1O4WA 5FEMA 4ODIA 3HACA 3D3WA 1M7BA 2AFHE 3OEHA 3PDJA 4ND3A 3QYAA 4NYIR 4WDQA 3U4MA 4RC9A 1OXSC 3FFBA 3WYAA 1YXMA 4X3OA 3ZWKA 4DWOA 4M37A 3DDHA 3ZR4B 2SKEA 1Z5GA 3A1UA 1VGVA 4GVPA 2ZIVB 2YY6A 1OX4B 1YF3A 1BDIA 1LFDB 1G4AE 4RZXA 3GLHB 3FPFA 4OGGA 1Z3IX 2WB4A 4QKQA 4INOA 5KYXA 2HJGA 3T3IA 4TL8A 1G20E 2XMSA 3PYMA 3MMZA 3R23A 5ALMA 3I83A 3EH1A 4PR3A 2XQKA 4KU4A 5EQTA 1PGPA 2H2WA 4FHZA 4DMUB 3ADDA 3DV0A 4PINA 4B3BA 3DAFA 5HMLA 2ZPUA 2YINC 4QQRA 1IPFA 1GR1A 5BQOA 2G5TA 4FR0A 3IPRA 4NZ9A 3ZZUA 3UCEA 4LVCA 5CK4A 2EHJA 2E55A 3L01A 4RKFA 4HNQA 4O2BF 1UPUA 4YRRA 2PAAA 3UJ9A 4AJ1A 4BB5A 4WJKB 5B36A 2X4IA 2EFJA 1OH6A 3PE3A 1MT3A 2I67A 2Q4BA 2Z3ZA 3C3KA 3IP3A 3KT0A 2CNWD 5CYOA 1N6OA 4KO4S 5FI0B 2PKEA 5C4GB 3NKVA 1RC0A 1Z9BA 5CTAA 1B1AA 1P75A 3I9KA 1PNOA 2D2XA 4TKLA 3RYFB 3B13B 2FEXA 4BZQA 1B00A 2M32A 2O8DA 3U31A 2VL7A 3S99A 2VHUA 3U3RA 3HRIA 5DHQA 4FKZA 3DDZX 3C6MA 4EPXA 1MIOB 1N3IA 1Z17A 4I46A 1AA6A 4LBVA 4QDXA 3FDXA 4U8HA 5DZSA 2EL9A 5DSTA 5E9AA 3CCCA 4AJIA 2A9VA 1YUNA 1DC8A 1J0BA 2C58A 2HPZA 1IUNA 1YU9A 1Z2NX 5CT9A 5JZSA 3PC2A 4RLFA 1U2DC 3GNTA 4OJYA 4Y1EA 4DIMA 2OP0A 1U7OA 1EHCA 3GLGA 1CV2A 2PMWB 1G5IA 3FGZA 1BS1A 3ORQA 3W0LB 1E7YA 3GJ0A 2X2PA 4TMVA 4YXWA 1C7QA 2UUBB 1Q7CA 3CPEA 4CKBB 4QDZA 1XXLA 3WLNA 1M7HA 1C1HA 5BNWA 3TX6A 2ECOA 2DGDA 2HUNA 1HURA 3SDBA 3KLBA 3BTOA 4E2ZA 4DWJA 4KZKA 1FXUA 1LJUA 2QG9A 2BEUB 4JQOA 5B4TA 5KVVA 2ODWA 1E2KA 3LP5A 3P26A 3UT5B 1OREA 1Z4LA 1B6RA 4UTXA 3RSOA 1HK7A 3ECCA 1NI5A 5BN1A 3U1BA 1QR2A 3OTHA 4RBNA 4C78A 1RDFA 5KYXB 4OAOA 3OD5A 1L7DA 4LDZA 3KSMA 2AD1A 3OESA 1NVVR 4R2MA 2V5AA 4DILA 3LGAA 4D9MA 3A1CA 1O2DA 1R7RA 3J81A 1L4BA 1REQB 5HOEA 1FXWF 1RYYA 1XDWA 2WA2A 4IVPA 4JAVC 4OF4A 5FOWA 1MCZA 2IBMA 4UNPA 3NRBA 3SEAA 3SC2A 1GNSA 4I9HA 3ZGOA 5BMOA 4RCYA 3STHA 2FHSA 2ZI3A 2C5FA 3AOEC 4NV3A 2QN1A 1DLIA 3TVTA 3Q8LA 1M9NA 1TT5B 5F1YA 1P9RA 2KMLA 4ZVLA 4LYAA 3REGA 4Q9NA 5JCZA 1S0UA 4BVLA 2WABA 2P4QA 4E88A 3AETB 1W0JD 5E1DA 3I5UA 2NO0A 4EJFA 1OOEA 4BUJA 5CD9A 4RDXA 1OYOA 3GLFE 1XCGB 3HZOA 4PIMA 4NMMA 6ADHA 5AKEA 1AS0A 1HDXA 3D6VA 4XYGA 4ARSA 4RHCA 2Z30A 3X1JA 2ZJ0A 121PA 3IVAA 4GNKA 3UV6A 3KQNA 2D7DA 4HAXA 1N3LA 2DUMA 3MFYA 1PJAA 2XNDA 1YR2A 3GJ4A 3NVDA 2E21A 1UFVA 1NLZA 1BE0A 2IPAB 2ZIGA 1KZYC 4MRAA 4LYDA 4MRNA 4D57A 2AG5A 1A7JA 2TRSB 3NM5A 4E12A 1H1DA 2PBFA 1YUBA 2BONA 2ODPA 2OZVA 1SCKA 2HTFA 1AKMA 1Q21A 3AG5A 4WXHA 5JG7A 1QMGA 4KK4A 3KQWA 3ZQUA 1M54A 1PGOA 1SIOA 1B8NA 2PLRA 3DJFA 3GD5A 2I2CA 2R1VA 2WFMA 4I4NA 4MB0A 4Y9UA 5EE9A 4U7GA 2A9RA 3KKMA 1SOVA 1KPGA 3SHQA 2B6HA 3MB5A 1PDVA 4JB2A 3TUIC 4CKXA 1T3SA 2IDZA 3LPNA 3UFXA 1HM5A 2AUNA 3SS8A 2LXNA 2Q3LA 4H1WA 2O8CB 1D3AA 1UZNA 1MW9X 4C6RA 5J5VA 3N3AC 5JJKA 1FBNA 3MOIA 3RSQA 4HL6A 2ATIA 4HLNA 4MV7A 4R1OA 1CB0A 4D4IA 4G1BA 1D8TA 1DKPA 3JWGA 4OQEA 3TZKA 3N7TA 4RABA 4HKTA 2CXQA 3MERA 3TO5A 3NVKI 3OTGA 1MAAA 3D4BA 4KTTE 4YS6A 3PXXA 4MGKR 3DONA 1J97A 2VP5A 1RRKA 4RVOA 1T4CA 5DGCA 4GOND 5IDWA 3S2GA 4PTZA 4ZT4A 3WI7A 1D5WA 3EFOB 1X80B 3WTBA 5J47A 4PZ9A 1WPRA 5KINB 5KTRA 3G7NA 1Y1TA 2NT3A 3J7TA 1R88A 1NP6A 1S02A 3DGEC 3KKQA 3L8MA 3ZWDA 2VQ6A 1Q20A 4BWFB 1SHJA 4XQ9A 5KAMA 1URPA 1QFJA 4TLCA 4F7WA 5MDHA 1QM5A 1G8KA 4JLWA 5I9LA 3IBGA 4B44A 5K0NA 5KREA 2A2ZA 5P21A 3WL8A 4E21A 3DO6A 5KKAA 2VI5A 3DLBA 1GPAA 4JJAA 4QHTA 3G0CA 3KLNA 5EXPA 4HV4A 1V8ZA 2IHBA 2IX9A 3KVOA 3OPMA 4P4LA 3CLUD 4PX2A 3SY8A 1W2GA 2GD0A 3NDRA 4BQRA 4C0QC 4ZU3A 4E7OA 4X62B 3VNVA 3MJEA 1FRFS 2IOQA 3DXYA 1SKQA 3AW8A 2Q49A 1T8SA 2WJJA 4W8OA 2QAGC 2V3WA 2BGUA 3GLTA 4ZO6A 1M34B 1NA5A 3MPUA 2G06A 2Y9PB 4POOA 2RG1A 3B3JA 1A76A 2B1RA 2YXEA 2ZDHA 4IIBA 4PTLA 2O2GA 3THYA 1FSPA 1BN6A 1EUDB 1EJ2A 1SEVA 1XQWA 2B9EA 2I34A 3H1FA 1SKYE 1J24A 3Q41A 4PNZA 5EQDA 9LDTA 1QANA 1XDGA 1XDSA 3M1IA 1D6NA 3PEFA 4IJMA 4PO1A 2WWWA 4D9GA 1X39A 4Y2HA 1ODCA 2QD1A 2WYOA 5AOAA 3A11A 3ISTA 2JBHA 3QVKA 5LC1A 3LW7A 1LF0A 3HC7A 1N2XA 3LT1A 3PR2B 4UBMA 3KUKA 3PBKA 3TKYA 3EIHA 5CVVA 2AC4A 1SULA 4ZRNA 1C4OA 2ZE7A 2HMSA 1U2QA 5KTTA 1YFLA 2YL2A 1UM9A 4MQ5A 4X3CA 4AD8A 2QBYA 4EFMA 4FFVA 3F0TA 1JQDA 4N01A 1R66A 4CIXA 2IBSA 1OZHA 2UV8A 2JC3A 1THZA 3KCQA 4HDOB 1BWRA 1E2QA 1XB2A 1FE8A 3ODPA 4YI5A 4BNLA 3U4DA 1E63A 1QDUA 4KQJA 4MW5A 4YMIA 4Y3UA 4UJ3A 2AFIB 1DOZA 3AXTA 1XWWA 3EQ6A 3O94A 4ZVOA 3ZNNA 5JBQA 2GDZA 1A88A 1JQBA 3A6LA 3AU9A 3HXKA 5LBTA 3KBBA 1NXSA 1ZUHA 2PZLA 1Q3TA 4RPHA 1TO6A 2YNMC 1CHNA 5KVQA 3FSGA 4D3YA 1XNRB 1ADBA 4CG2A 4E5DA 1HI9A 3IT3A 2BZSA 3VYSB 4D3FA 3HR8A 3ZXSA 3TOSA 1Q3KA 5DVZA 4BFXA 2QW0X 1IIBA 3B3AA 3ME5A 4OQNA 4LXYA 4DNXA 1IUPA 5FOVA 3V3TA 3TIXB 1G21E 2G07A 3CH7A 5H0IA 1K6XA 3TSCA 1MRSA 1JVBA 1P3DA 3UKJA 1RAEA 3ZLBA 3HM9A 1XZJA 3PGA1 4ARIA 1X7YA 4G81A 4JL5A 3OHMA 3P9NA 4OIMA 2GTPA 4U6SA 4L7VA 3MJ4A 1L6IA 3L6UA 1CQJB 1HYBA 4LOIA 3VR5D 4L27A 4X8LA 3ZGNA 4ACAA 1RXWA 1PTJC 1QP0A 1E7RA 1IDN1 2Q5LA 3GUUA 3O8NA 3Q85A 2IXGA 4P98A 4XQCA 3BK1A 3JASA 2ZYVX 3BQNB 1HEYA 3L7KA 1JNYA 2FUEA 4IS3A 4F4DA 2E5LB 2NU7B 2Z58A 3IEXA 3TX2A 5FWNA 2QRVA 1YNSA 2GBIA 2I4OA 1YRAA 4JP8A 2C94A 3KKPA 4ZVUA 4KFTA 2EWVA 2AFRA 2Q1YA 3BEOA 4I2VA 2IQ5A 1OI4A 2A0KA 2BLLA 1F2TA 4QYWA 3UH1A 3U44B 2DB3A 4Y6OA 1WXDA 4HPJB 3AV0B 4MR8A 1MHPA 1JG7A 3VDXA 5KSOA 1WS6A 4NENA 2DLNA 1YTLA 1W5SA 3VPFA 1C9DB 1FFCA 3WJ7A 3N58A 4XWOA 1PFYA 3GGPA 3BRQA 4PG8A 4YDQA 1M2OB 3FSJX 4MK4A 5DNEA 3LX4A 4GMHA 2I3GA 4JC5A 1RRCA 4LIPD 3V7NA 1A95A 4EB3A 3ZXYA 3O8OA 5EMLA 1NBOA 2HHCA 2WM8A 4IDDA 5JNWA 3X2SA 5H8WA 3QPDA 3FJOA 2H07A 1U81A 5KQMA 1GQSA 2D2VA 5I45A 2J3DA 4P2BA 3V7YA 4D9HA 3BE4A 2OZPA 5CH3A 4RACA 3ZIDA 1AXEA 3ZHZA 4N5DA 3I2KA 5HFAA 4DY6A 1EDBA 3P20A 5JAZA 3JAWA 2ZIWB 4N8EA 2O0LA 3PFCA 1C1XA 721PA 2G71A 2GEDA 4K8RB 3RTGA 2XE4A 2ZYTX 1W5TA 4G0MA 3RBAA 3OCXA 2GFIA 5J23A 4YNBA 1F06A 1XHLA 5E4YA 4ID9A 4A82A 3FLMA 3ML1A 4URXR 5E2IA 5J4KA 2OPHA 5TR9A 1RWNA 2ZUUA 3BS4A 1Q92A 2HRDA 3NYRA 1Z15A 2I2AA 1WXXA 2WIJA 5A7FA 1RIIA 4P83A 3R5TA 1AQYA 3WSVA 3WNZA 4IHQA 4QWMA 3R7BA 1W35A 1RZ3A 2FPWA 2A92A 2HRBA 3D6HA 4LE1A 4WAUA 2C29D 1UZLA 2HSDA 3COPA 4M7WA 2K7FA 1RHKA 1SCUB 3MTEA 4GSLA 1TTTA 3GEMA 3IJRA 4IG4A 3TL2A 4WJLA 2HHHB 4OLBA 1GXSA 5DYTA 1JHXA 1Y1KE 1HFEL 2J6CA 1J4AA 1DDOA 2HK9A 2JD1A 3M1LA 3C4JA 3DOHA 5ALZA 3ZHTA 1U3GA 1ZCBA 4ROTA 3ETHA 3F5DA 1NI4A 2EQAA 4J1SA 1Z7YA 3BZBA 3IOYA 3ZPXA 4DANA 2YR0A 3ZV5A 2B4KA 1E1QA 2IIBA 4CU2A 4D8WA 1H2XA 2HIGA 1JDUA 5DM60 4PXAA 1Y1RA 2Q4DA 1XEFA 1F4VA 2Q0SA 4YPFA 5TQJA 2WTAA 4HYTA 2O7QA 3NBAA 2HSGA 3EVNA 3EXEB 3DAYA 2RAUA 2GN1A 4H6WA 4NCBA 2IXTA 2I4RA 1FDRA 4JEIA 4X7BA 4CKYA 3GVPA 4B87A 5AM2A 2RK6A 2IEDA 5ILGA 2YQZA 4P32A 3JWIA 5CFRA 1GRRA 1KFCB 3PR1A 3WK9A 2I1VB 4HJRA 4PR0A 4EHFA 4F4HA 4ZARA 1YIOA 4GRDA 4CMGA 1ZOLA 3LF2A 2AQIA 1PT8A 4ES6A 2OCKA 2F67A 2XTJA 1EP9A 4PGHA 1MXFA 3KJFA 3JD2A 4UUQA 4HQ6A 2ZM6B 2VZEA 4OSOA 1GUBA 1Z2OX 4R8LA 4B1FA 4CMBA 4CMKA 5BYKA 1EVJA 5KNCH 2QTBA 1C41A 4YV1A 2IPMA 3T4PA 3RC3A 4HT3B 1PFVA 1SAYA 2DFPA 3TD2A 2HLHA 3GH3A 1RQNA 1CVIA 2BDTA 5HTKA 3FRIA 2W93A 1RHRA 1F38A 2FGJA 2PKYX 1Q7GA 4RZHA 3RHSA 4TKZA 2YN0A 4BMXA 1Q0TA 3EQ9A 2ERCA 2ZAYA 3IXLA 4NZPA 4UTOA 3WMEA 1OB2A 1EUDA 1G8SA 1HXHA 2QLJA 1Q6ZA 2YIVX 5I9IA 2ZANA 4JC4A 4YCJA 4GOKA 3U39A 3B8HA 4D41A 2V4ZA 3IOBA 5E6UB 1W0CA 5HQJA 3SJZA 3LXUX 3SEZA 1XRNA 2PGJA 2LVBA 3EEYA 2GZRA 1KZ7B 1SG0A 3WLPA 1I3KA 1G8HA 1GGKA 1P3Y1 2EARA 1P2TA 2QU7A 3P9CA 4G26A 5D3KA 1ISSA 4D80A 3FWNA 4MKZA 1AVTA 1M34E 3UXHA 4F92B 3EBOA 2JH8A 3RYCB 2X0IA 1R74A 1SVOA 2R8BA 2X0EA 4JLPA 4MQMA 2FMFA 5DOZA 3OLXA 4U7WA 3GAAA 2C7VA 3OQBA 4L1KA 4M86A 1RXYA 3LCUA 3OAAA 1TDJA 1FYVA 2A35A 1JR6A 4J49A 4PS1A 1JHRA 5E38A 4WUTA 4DXHA 4EI2A 3BGOS 4Z7JA 1ZONA 2FLVA 5IVDA 3F49S 4KNWA 3EXIA 2W8BB 1YIDA 5M04A 4QUKA 4QO7A 5CYFA 2RC5A 4IKOA 3GEBA 3VUEA 5FPKA 5EE1A 2FW7A 3SQLA 2ZUSA 2XZTA 4UOQA 3RVNA 3GJTA 3DPIA 4Q12A 2WWVD 2Z5LA 1FU8A 2ORED 3NWBA 1N6NA 5T3YA 3CVUA 3P1JA 4ZYXA 3MJSA 3ZW7A 1MGOA 1XCBA 2YS6A 1IVSA 4RGQA 1R9JA 3OQIA 4O25A 2JASA 1IHOA 3ASZA 4JJZA 4F46A 9LDBA 2D5BA 3EAFA 1JALA 3H9UA 5TJ9A 4JR1A 2VBFA 1DU4A 5JR3A 3RSZA 4B6FA 1J1UA 2Z2IA 4JHXA 4JWTA 3DLIA 4DR4B 1PFGA 4PO3X 3A3PA 1GZ3A 3AWIA 2OV6A 3KEQA 1RYHA 4RANA 4ZT3A 2Y1KA 1EIZA 3BWBA 3HWRA 3SNHA 1Q83A 3DMYA 5HIIA 4RQAA 4MS4B 2IUUA 3T5MA 1W0JA 3UMYA 1PSZA 5KU1A 3GA0A 1HZZC 4GMKA 2VJYA 1CUXA 1RACA 1CUSA 4UXJA 2VTBA 4Z4FA 3E70C 5LA6B 2O3JA 3V4OA 4ZRDA 3PG5A 4LQ4A 2SNIE 1KQOA 3U4GA 3V9AA 3FVRA 1P7PA 1IIRA 4M83A 4L5CA 2A67A 3W1VA 3W6NA 2I62A 1G3RA 3RGGA 1I7PA 2ZBUA 4KFUA 3GJSA 4OXKA 3E81A 3ZI0A 1FNCA 2QN9A 1O89A 1BAPA 3WK7A 4WBNF 5BSKA 3K0FA 5I9SA 3COZA 3TZCA 4ZO7A 2EAUA 5B3KA 3PE6A 3I5YA 2QAJA 1R0SA 5HEKA 2AJLI 4ROSA 1RWBA 4EBFA 3PFWO 4AWBA 3GLFB 2A9FA 2VNJA 1FTWA 3C6BA 5EMKA 3JXEA 2HDHA 3IMCA 2X41A 2FOIA 3PGJA 2M6LA 2I6GA 1H0KA 3OQHA 2BFDA 5DM70 3NV9A 5FOXA 1JE0A 1R18A 5COBA 5BSRA 4HEA1 1I01A 3CRW1 1B7GO 5AQ1A 4Q34A 3OBBA 1QPGA 3CF4G 4EFLA 1RRGA 1FXSA 3FR7A 4V0LA 1A7KA 8AT1A 2HXSA 4KIUA 3SKYA 4TMZA 3WB9A 4GKKB 3T3OA 2WD7A 4MWOA 2XUQA 2EJBA 1J9ZA 3MAAC 2DAPA 4PGGA 4ETNA 4CM4A 2PUEA 2NUAB 5CBPB 1RCFA 4AL4A 3DE3X 5LMUB 2ISCA 2QXUA 3DH0A 2A5DA 1ISIA 2PT9A 1NNSA 2XJ9A 3E7PA 3NHFA 4OLFA 4W63A 3PP8A 1JEAA 2WAOA 3E27A 4JP2A 4HUJA 4WESB 5EP4A 3SYKA 2FR1A 1CG6A 2HA0A 3UF0A 4DV6B 2FZWA 3MWLA 2IPXA 3ZHRA 4XRGA 1LDEA 2ZK7A 4L16A 4V0OA 1IXKA 2VP6A 4JSYA 3EWIA 2VJMA 3UUGA 1RCUA 1IOLA 1T9KA 3JRNA 3A26A 3EMDA 3PUVA 4IPTA 4OH7A 4P4GA 2I99A 2FFAA 4R9NA 2X5XA 4ZJPA 3GRRA 4DEYA 1C2TA 2WD7B 3KHUA 1UT8A 1QK4A 3GG2A 4HRYA 2YCBA 1QC5B 3DOUA 1GD1O 1A8QA 1DKRA 3KB6A 4N12A 4YMSA 5BQ3A 4CEJA 1HSZA 3LTNC 2R66A 1K7FB 2Q4TA 2Q3EA 3RS2A 3OWHA 4B4VA 4R1MA 2DSTA 1RWPA 3ABQB 1C0LA 3OZUA 3JATA 4C0BA 1SU4A 1UKYA 2BGLA 3RK4A 4EJ0A 3QTLA 4ILEA 1DLJA 4J6EA 3OY7A 4PNEA 1A9QA 2PYIA 3E7XA 4CGYA 1XYVA 2DPYA 1GGMA 1Z5UA 2QYHA 3NEYA 4HH0A 1IY9A 3BK7A 5KYYA 4NEQA 3FF4A 3RYTC 1Y5IA 4WOPA 4PIVA 4AKSA 3USCS 2W83A 1A9XA 4OXXA 3EXG2 1H6BA 5AI4A 5E1OA 4H9GA 1I6LA 1TKRA 3THYB 1FRZA 3RAGA 4ZCTA 5C0OE 3TS1A 2ODTX 4F97A 4AKGA 3HJFA 4TROA 2CZGA 3I4CA 5EE3A 3CE9A 5FI1B 2Y9MB 2FPIA 1H66A 2WM3A 3DXFA 3HR7A 1U0BB 3BXEA 1JSZA 1U7WA 3ESZA 1PZHA 3A1DA 3CH4B 5LB4A 2QTWB 4QPDA 3RK1A 1DZIA 1RMTA 2XB8A 1E7SA 4J94A 3BDIA 4L95C 1KK1A 1NU6A 2PX3A 4X8MA 3T9CA 4KO8A 2FN8A 4N7BA 3AVXA 4G5YA 1FZTA 1FTGA 3DTNA 4DIOA 3B2NA 2ESRA 2WTXA 5DLDA 1JXOA 2Y1EA 3D4PA 1NUQA 4J0JA 1UKBA 4LCBA 1KKLA 1TZJA 1X0XA 2ZE6A 2F59A 4JXXA 4A36A 3L7BA 4ZMRA 4AS1A 3LVFO 1BXZA 4JGIA 4L0QA 3UG6A 1XDUA 5EWMB 4CM7A 2OB2A 5CXQA 4BL5A 1ZUD1 1CZNA 3GDGA 1SBQA 4X6LA 4FC7A 4BNFA 4QU5A 1KYYA 1EG7A 1ZJ6A 3BJEA 1R9MA 3CC8A 3HBFA 3TEMA 4QX6A 4QPJC 4EFKA 5JH7F 2OVFA 1DOHA 3OZSA 1G21B 2OCLA 4HDMB 4JLNA 3RUEA 3QVJA 5JCJD 3EEQA 2A86A 4KQCA 4LKRA 2JGJA 3MELA 4HSEA 4LDJA 3EVAA 3OURA 3N8GA 4X90A 3GGCA 3EE6A 5AMXA 2VHYA 5EYPB 3RKSA 1K27A 2KS6A 1IBCA 4MLDA 1U9JA 2B37A 2FPXA 2P8SA 5GJWC 2LPMA 5KYTA 3DBIA 5CB8A 4QT4A 4NYJQ 2HHLA 4EEKA 2XCRB 4C4TA 1LI5A 1WF6A 1N4AA 4PSVA 2JKZA 3JQFA 3LL4A 4BVBA 4GKVA 2C3MA 7ADHA 2A5FA 4M9UA 4ZVRA 4OA8A 2JIRA 5K0JA 1ZD8A 3ENKA 4Z9AA 4RM2A 1ZJZA 2ZT7A 3EF1A 3KR1A 3L1UA 1ZIOA 3IRUA 4JLOA 1YJ5A 1EGHA 3V8MA 2OQVA 1PN3A 4GD3Q 4BZZA 1T6NA 4H4CA 2R1VB 1PL7A 3FIJA 2LD4A 4CHGA 3ADPA 4LVOA 4P80A 3RYCA 3V55A 1WMSA 2O2CA 2XF8A 2GEKA 4NMHA 4IX9A 5IANA 1G5PA 4IDHA 1Z37A 1UQUA 3L7JA 1A82A 4J3JA 3EARA 1JG3A 3E1KA 4WCDA 3PTAA 3WMFA 1IFXA 1MQSA 2QUKA 1PZNA 4J0QA 2P0AA 1T5SA 3DLTA 3BE5A 1G8MA 1AE1A 4YJ3B 5IUKC 5CCDA 5EJ6A 3M49A 4KN5A 4TZKA 2C4KA 4K26A 2GO7A 4M21A 4MQBA 2AQ8A 2ACKA 1U5BB 3FNIA 1GPNA 5IVKA 5EHNA 2BI4A 1EUCA 2WUGA 3TJMA 4LF4B 4KAJA 4I2NA 4YHHB 2YHBA 3INGA 2WMDA 5M2QA 1KORA 2PCLA 5F5XA 4AY4A 1OYYA 7REQB 1PYGA 1Y33E 3PSHA 2ZETA 4BC0A 3WWEA 1UWVA 3UNXA 3TGPA 2BUBA 3DPUA 2XIJA 1RTKA 4MP6A 2I7TA 4PLFA 3CVOA 2PJUA 5EJFA 1F9AA 3QBVA 4J1TC 5J2TA 4G1EB 1DX4A 5ER6A 1A77A 1FFXA 3OCVA 4KMOA 4P86A 5FHQA 4Q4JB 3V1MA 3W06A 4B48A 4F91B 4DUGD 4I3FA 2BVNA 2PT7A 3FCYA 3LT2A 4PSDA 4O08A 5FNVB 2BZ0A 3HM2A 3ANTA 1Y8QA 4ER5A 1QORA 2JGRA 5IBPA 4DXDA 3D1JA 2EG9A 5IG2A 4EY5A 3BH6A 3RJMA 3D3NA 1FDWA 3N2NA 4FUQA 4NY1A 1ST2A 5CT4A 3GI1A 4IMRA 1YBFA 4C7OB 3HVRA 3KP1A 2PIAA 4IDEA 2IYPA 5DX8A 4D46A 2Q6IA 1R3UA 2DVMA 3ZE6A 2ZYWX 4YCCA 1QVZA 4GOXA 3F9CA 3N59A 3W7BA 4P3YA 3RWOA 2BJHA 4W5NA 4H7KA 1O97C 4PHHA 3HKDA 1NBMD 4PC7A 4POAA 4UUBA 3IAM6 4NEGA 3M0EA 4HDSA 4KVGA 3E58A 3VPXA 3WGGA 5FYDA 4BNNA 2QOEA 3W5UA 5T57A 3EIOA 3SZOA 3FWYA 1R0YA 1BTOA 4A26A 2YZ7A 1J8QA 2C9OA 2WTBA 2ZYDA 4ZVNA 1K3UB 1O0BA 4UREA 3T4UA 4CI0B 5C51B 1D2HA 3AQ4A 4QULA 4XOIA 3C74A 5ECWA 3SJAA 1SCUA 2RBEA 1O6BA 3AEUA 4Z4CA 3P96A 3G59A 3NAZA 4AMYA 4GM1A 1ZI8A 4H16A 3AIOA 1FSSA 2AT1A 5IAAA 1E3TA 1XAGA 3KB1A 2JH9A 1T2UA 5F73A 4M9CA 1HF3A 4K6HA 4UZSA 1W49A 1ZGHA 5FLKA 4DHEA 4YCAA 1JEOA 3O8CA 3FUXA 3DULA 2C3OA 1KU6A 3CZ5A 1UBNA 1O54A 1QLJA 3QUAA 1XZNA 1ZBQA 2JA1A 4RVCA 1M2HA 4BVFA 4EMTA 1ENYA 1JW9B 1YR3A 2ZROA 5CIQA 4R7GA 2ZAGA 4D9CA 2C4VA 4UD6A 4WFKA 4EG7A 4R68A 2N9UA 4UHFA 3DMNA 4IIUA 1UUFA 2ZXEA 2ZCUA 2XWBF 3NW9A 3WRXA 1MOSA 3CA8A 5H3LA 1GSHA 2H1RA 4URYR 1GU1A 2P4EA 2R6R1 3IQHX 3ABIA 1OTXA 3HB5X 4O33A 1JHYA 5B3JC 5FKJA 3C85A 3DV0B 4BDTA 1T6BY 4LHVA 2O2JA 1FYEA 2P68A 1G19A 4FFLA 1HEUA 4LK2A 4JQCA 3EMBA 1KR5A 3JWHA 3FUWA 1P7YA 3AHJA 4X64B 2HWXA 1I7QB 4BCBA 4YT8A 1RBQA 1UDRA 1WDWB 3OM8A 3R8CA 3KKLA 1E3SA 4DJ5X 2P2DA 2V8OA 5T7BA 1NM5A 1DEAA 3RADC 1UC4B 3CYFA 1JA1A 3GGDA 4EX6A 2W9XA 3RW9A 1NJ8A 2B7BA 2PVPA 1OCEA 1V1RB 3D54D 3TCNA 3BAZA 3TDNA 5DNUA 2WB2A 3MMNA 2QRVB 1KMIY 2EJCA 4NJOA 2BGMA 3CU5A 4PAQA 3F73A 4MV3A 2Q62A 4Q39A 4K3VA 5CYGA 3D2CA 4ENRA 1N5RA 4UVGA 1QR6A 3HB4X 1FP2A 1E89A 1SNYA 1EWVA 1D2NA 2O0KA 2ZYHA 3AB7A 3G9UA 2QQ5A 4N6OA 5ALHA 3TLMA 3UN1A 3AR6A 5K3BA 2G9QA 3VOTA 3UMGA 4XCXA 4QOSA 1MFZA 2ZRAA 5HM8A 1NWCA 1SELA 1BDHA 1EFLA 3SOZA 3KSBC 3EZGA 3KT3A 1THGA 3JY6A 4PG5A 2WFLB 5TF0A 4KOAA 3GOHA 4R2JA 3OUTA 3R3JA 3NZEA 1PK9A 4D6YA 1LGYA 4MEAA 1P6QA 3DC2A 3DS8A 4J0DA 5J5CA 3SDSA 3V5NA 2Y6UA 1RYFA 2CDNA 4GC9A 3UMFA 1NE7A 4DBZA 5L6MB 1VJCA 4EH1A 4MYRA 1BGXT 3FNHA 3DFKA 5I4KA 4LDQA 4JGBA 1U1CA 1Q1ZA 4WK2B 2JANA 1KDOA 1Z3CA 3CEJA 4XRRA 3WWDA 2VH2A 4CKWB 4OOFA 3A9SA 4C08A 3V7FA 3E5MA 4MCAA 2D5IA 3FHTA 1E9AA 4NU5A 2B8JA 3X44A 3TMAA 3H2GA 1XEWY 1XEWX 1MW8X 5CYPA 2WUFA 3PJDA 3IVMA 2DH5A 4NTZA 2ZRGA 3IV9A 3LY9A 2WMYA 5F2EA 1U2EA 4YJ2B 4Z4GA 3AKCA 2C4HA 4IY1A 4S0ZA 2RKOA 3TIFA 2P5UA 2WBLC 2VDNB 3ETNA 3NHWA 4L02A 1SH7A 3BL8A 1KYXA 3IVGA 3LVQE 3PNLA 1JAXA 1QQ7A 2I3AA 4RHYA 1G4UR 4Z0NA 4E5MA 5KYNA 2CL6X 3GT3A 3C3YA 3QBTA 3Q3GE 1B23P 1O6GA 3F8TA 4XIIA 3B7GA 2H7YA 2XCUA 2OFPA 4ZAFA 3WZ2A 2JVJA 2G6TA 2QN7A 3LUAA 4XCVA 3TNYA 4Y9SA 3E22B 3ZWVA 5BOSA 5JDIA 5JJBA 3DT8A 4EQ6B 2F4VB 1TRHA 1Z0DA 2BR5A 4GX5A 1X7GA 2H1FA 3FAKA 2ZTLA 3DCIA 3NWJA 2YY5A 5T6MA 1RLMA 4P0PB 5DT2A 3UTDA 4QU0A 4EG4A 4QM6A 3TQQA 4XGKA 3ORRA 3TMYA 1CLEA 3CX3A 1E0KA 3EGVA 2IRWA 2WIGA 3M6VA 2J67A 3ZI7A 4ER6A 3QW2A 2X7XA 3G02A 2YYAA 4CEIA 2VJNA 3IUEA 3LL7A 1T2VA 3WRXC 1HDOA 4GICA 4J16C 2VH5R 1E6EA 4Z0HO 1UOEA 3U1TA 3RLIA 2PGLA 1KEWA 2I4MA 3EIQA 4IDCA 1ZSYA 3W2IA 2ZE5A 4G89A 4WGFA 1XAHA 1DCFA 2D74A 5EE5B 1EM8A 2NV6A 4KYIB 3AUAA 4H7DA 4NL4H 3N75A 2UXDB 2ZDQA 1YZGA 2ZJ8A 1ECFA 1YSCA 1JU4A 1ZIDA 2AUMA 3OEHD 3UBTA 3R9KA 3KR2A 4DY4A 2W42A 1XWFA 4RNCA 3K0CC 3COJA 1PTKA 1E9SA 3MK31 1M66A 5K6TA 4ZQCB 4YFVA 4Q18A 2H9IA 5FFFA 1KHHA 2J7PA 4BQQA 3D6NB 5EWJA 4F04A 1S2DA 1GKUB 1GFIA 4M53A 5CH5A 2FTKE 3ZNPA 4GPZA 1LJLA 3PRJA 2CMGA 5G02A 5F51A 4DGQA 4BQIA 5DXFA 5BSGA 1GP2A 3KOXA 1NXOA 2HNBA 2R8YA 1J90A 1ZD3A 4Y18A 1FMFA 1BS2A 3F6RA 1B0AA 4B73A 3BB1A 4ND6A 2FSIA 3CLKA 1JR3A 4NECA 3RRJA 1EKXA 2OAEA 4IIJA 4RFSA 1ZRNA 2PUHA 2PD6A 3JVUA 4G8DA 5HIAA 2UVQA 2XT0A 5F4BA 3K1YA 4BEVA 2IPOA 3EY4A 4KRXA 5E95A 3A3NA 2XUOA 1DTWB 1HPLA 3OCWA 4Y6PA 5IT9A 4LRYA 3RBVA 1EWTA 4OHXA 2BR4A 2X77A 5EEHA 4TLDA 1J0DA 5J58A 2Z6QA 4BU1A 5C5EA 4EHHA 1COWA 1KO8A 4HRAA 2OP1A 1B26A 1TC1A 2O5CA 1Z6TA 4A0RA 4UQPA 2FPUA 4JEHA 4ZQEA 4DC1A 3GQBA 1ZLYA 3WDSA 4F11A 3GARA 3VO8A 5JAIA 2UZAA 3RFCA 2QSJA 2R6HA 5JE8A 5BMVA 1U7DA 5C18A 1Z25A 2Q8QA 3LLMA 5D3MB 3SZRA 5JHGB 2WQ6A 2EL7A 2X7HA 2J3EA 5FLEX 2X8BA 4PEVA 4D45A 2BMJA 3FLAA 3KALA 5JXGA 3TTXA 4HC4A 5COAA 1UBFA 3OLQA 4CCWA 1MT0A 2P4HX 1MH1A 3FPBA 2NU6A 3AG6A 2V5UA 3H5RA 3PX2A 1NUTA 4ZVMA 4BNWA 1VZ2A 2I4TA 2EFHB 3KLPX 2PBZA 2AEMA 3EXHA 3K8QA 2EJUA 2F43A 4OHUA 2QR5A 3VQTA 3OZBA 2LKCA 3KJXA 4PLHA 5DYYA 4DPLA 3T1HB 1F6WA 3T52A 1O5IA 1YRQA 1GPUA 1NVFA 3DYIA 3VSAA 1U3FA 4E46A 4HNRA 4RZSA 3CSSA 3EPHA 1L4YA 1PT7A 1TCAA 3OKAA 1X86B 2H5EA 4KOEC 3Q8KA 3HJHA 2R7KA 3L9XA 1HDZA 2ZBQA 3MHPA 4AUKA 4PHFA 2C20A 3QVGA 2CFSA 4GYJA 5AKJA 4LZPA 1GLNA 2VK1A 1IONA 3HUUA 1L7RA 1H4QA 4KRGA 3K6KA 1RYDA 1R6DA 3N05A 1I0LA 3PWKA 3HEBA 1U7TA 4UHJA 1OGYA 2H1IA 3DHVA 3W8EA 4O02B 4I50B 1IY1A 3CZ4A 3NATA 4QHSA 4YP0A 4HNSA 1IHUA 4BE4A 3I61A 2QENA 5JJLA 2P3LA 2VHTA 3E9ZA 1PEDA 4KQXA 4QT0A 5IDXA 4RH0A 4CKBA 3V4PB 5KTSA 2VYNA 1JQJC 3PPXA 4BV2A 3QIVA 3WLFA 2RI6A 1E5QA 1HY3A 4C4YA 4LHSA 3IODA 2IYXA 4FGWA 3PXDA 1TYDE 3FHJA 1NIJA 3U7QB 1Q5PA 4QGGA 3JTEA 1WUTA 2ZP1A 5K4HA 2ZDGA 2QD3A 2PNJA 3M1AA 4RTJA 2CZCA 2IH4A 4OX9Y 3PGMA 2I0FA 4Q7MB 5LXTF 4WKGA 5C1BA 3BSWA 3SKVA 4OFXA 1CJBA 4LJSA 2CLKB 1MOZA 4LHXA 1IATA 1NVVQ 2BSAA 1M1YA 1XLTA 3FY4A 3I3OA 1QBKC 3K0KA 4FYVA 4B82A 2QT0A 1JVSA 5K8CA 4AXBA 3BMQB 5EC8A 2ASEA 3NXSA 2GBLC 4EA8A 1CP2A 5DHPA 3A4VA 2QAGB 4GM4A 13PKA 4XM2A 3BJRA 2Z3WA 3NM6B 2OHJA 4GG1A 1LPMA 1RCTE 5KTPA 5B3AA 3NT4A 1J99A 2HV9A 4HVTA 3GFOA 2NSDA 4WV3A 4MQFB 2QTGA 5TMEA 4EO9A 2Y1LA 3IQDB 2CDAA 4OHZA 4I50A 2WF5A 1EXDA 2FR8C 3IA7A 1NZFA 3DCNA 4LQDA 4I8DA 1S7GA 1YHNA 4N41A 4J0HA 3GFQA 5K9ZA 1GZHB 4TV9B 3ZWMA 5JTUA 4IEIA 3K8OE 3PSAA 3D8UA 3F74A 1JQ3A 2WF7A 3HFRA 1GLGA 3WDLA 3JVDA 5HCIA 1W94A 3EZLA 1O5OA 3GP5A 1P33A 4L7QA 4KTVE 1P74A 3SFTA 3WDMA 4DA7A 1A9TA 3RU9A 2NSYA 5FNVA 4LYEA 5B64A 4FE3A 1N6IA 1GITA 4NRDA 1U7UA 2ACWA 3GAFA 3QFHA 4UDNA 5B1IA 5JXJA 4OMFG 4CM1A 1OLUB 2BFWA 4DCMA 5JOQA 3VKHA 1CJCA 1EZZA 1MF7A 1NW8A 2BGIA 1Z22A 3OZVA 3KQYA 4UC0A 4ZCQA 2PN1A 2V5VA 3LW8A 4G09A 4AZ3A 1UWKA 1TKAA 2R5NA 2YBEA 3WOVA 1U2TA 2C5BA 1RQRA 3AY3A 3N5KA 1JHVA 5EUQB 1H3EA 1QHYA 1N0WA 4NLLA 1ZCAA 1JF8A 4A0SA 4RLQA 1WB6A 1K2VN 1VL0A 1ZD4A 3NALA 2QUHA 1MJFA 3COVA 4OL0A 3TLJA 2QLMA 4JJEA 4BJ6A 1NNUA 4PLCA 1XKQA 4KO2S 3A3KA 4FDTA 1XCJA 4FX5A 4LVUA 4CCYA 2XADA 1I3OA 1CDZA 3GQBB 3HABA 2GUGA 3IERA 4PC3A 4G0UA 2O6LA 4M1QA 3M8KA 3PHJA 2FW0A 1JPUA 3LTEA 3ZTWA 1RZRA 2O8FA 2J3HA 4HUQB 1H5QA 4M0MA 4ZI7F 8GPBA 3U4HA 4QPZA 3IKTA 4BKRA 1YI8A 1TKCA 3N7AA 4X24A 2LDXA 4R1QA 2VDQB 5DTRA 3AF1A 2M6KA 5C7IO 2XQJA 4HB3A 4KE8A 3W9SA 3ZEAA 5A5FA 2FR8A 1YNOA 2RAFA 2ZU6A 3A4IA 4QLAA 2Z6UA 4G1VA 5ICEA 4PLPA 1P4RA 3KYBA 4ZEOA 3IIIA 2HF9A 4AKIA 1Q7TA 4OHKA 3BT7A 5I4BA 1YBVA 4RVFA 1NBHA 4Q1FA 5P8WA 1AZSC 3FMFA 3O92A 4MP3A 5K2MA 4AULA 2O3TA 1RJ9A 3CY6A 2PUGA 4ND8B 2C92A 3WXMA 1HDIA 3BTSA 1Y5MA 2F17A 4FZVA 1L5GB 4C04A 1YS4A 2HU7A 3S2UA 2NXCA 4L4XA 1OWLA 4D4LA 4B83A 3EULA 3T3EA 1QONA 1QYWA 4NNJA 3S8EA 4Z4IA 1KY3A 4AY2A 1PR0A 4WNAB 3K1AA 2C2XA 1UKEA 4K9QA 1RXUA 3P2KA 4WMLA 4RD3A 1RXIA 3GLHE 4U6QA 3ZE0B 3ZHBA 4PQRA 4A7PA 1UJBA 3HDTA 1IN1A 1XDZA 5HR5A 2OT3B 5KTNA 3T7AA 4DG8A 4TGLA 5HZHA 3LA6A 4JJ8A 1FUIA 1JQKA 3U3KA 4A8PA 1FFSA 5E4FA 2F1IA 1XL1A 1X9HA 4DQVA 3QEKA 3W3ZB 3Q4GA 4XUGB 2FV8A 1NJ2A 4BIIA 1OHHD 1W4RA 3P2MA 3QTTA 3UMVA 4AY6A 3H87A 3PPYA 2W6NA 4FN5A 4CM8B 3EF3A 4Y9TA 1ORVA 5ARCA 1AO3A 2V9ZA 2O3UA 3KB2A 4NJEB 5D84A 3ZTYA 3ZV7A 2WDZA 2HI0A 1MN6A 4ONEA 1I14A 3UB3A 1U9CA 1SXGA 2P9YA 4R2LA 4U63A <