1F3LA

Crystal structure of the conserved core of protein arginine methyltransferase prmt3
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
321
structure length
321
Chain Sequence
b'DLQEDEDGVYFSSYGHYGIHEEMLKDKVRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVIAVDQSEILYQAMDIIRLNKLEDTIVLIKGKIEEVSLPVEKVDVIISEWMGYFLLFESMLDSVLYAKSKYLAKGGSVYPDICTISLVAVSDVSKHADRIAFWDDVYGFNMSCMKKAVIPEAVVEVVDHKTLISDPCDIKHIDCHTTSISDLEFSSDFTLRTTKTAMCTAVAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTIFLLEKPFPVKAGEALKGKITVHKNKKDPRSLIVTLTLNSSTQTYSLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN ARGININE METHYLTRANSFERASE PRMT3
publication title Crystal structure of the conserved core of protein arginine methyltransferase PRMT3.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 99
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 2000-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 1f3lA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1f3lA01
5DTQA 2ZFUA 2B25A 1ZGAA 1NW8A 3K6RA 5EEHA 3R3HA 2B3TA 3KPVA 4PIPA 4BP3A 1FP1D 4C08A 1M6YA 3LCVB 4RVGA 3FTCA 2EG5A 4GUAA 5EIFA 5ICCA 3BKXA 4ER3A 4GOND 2ZBQA 4PYIA 5GM1A 1VIDA 3R0QA 2VP3A 3FPJA 3NW9A 3SR4A 3TPZA 3P71T 3TRKA 4F85A 3P9NA 1VL5A 3JWGA 2F8LA 4Z2YA 3TOSA 1F3LA 5JR3A 1BOOA 1L9KA 2CKDA 2AVDA 2GAFA 4C04A 3EMBA 3KPUA 3EVBA 5CIYA 3FTEA 3QOWA 1JG1A 3EGVA 4FP9A 1UIRA 3EGEA 1RI4A 3LECA 4V0RA 3LBFA 3ORHA 1N2XA 2KW5A 1AF7A 2AOTB 1D2CA 3BUSA 3TM4A 4DCGA 2XBMA 2HWKA 5HILA 1ZHFA 5K0FA 3G2MA 1M0EA 2AR0A 3GJYA 4IV8A 4R6WA 2PX4A 4U7TB 2C7RA 1KYWA 1NV8A 3DXYA 2G1PA 3IHTA 8MHTA 4U7PB 4C05A 1QAQA 1B42A 4GF5A 3A7DA 2O07A 3CVOA 4QVGA 7MHTA 3BWCA 5E8JA 2NP6A 2VDWA 3Q7EA 3WSTA 1KPHA 2R3SA 3OU6A 5FTWA 4H0NA 4AX8A 2CMGA 3A4TA 2JHAA 4HTFA 1G8AA 1BC5A 2IP2A 3ERCA 1AQIA 3BWMA 2IH5A 1RI1A 2V7EA 5EOVA 2R6ZA 4XUEA 1VP9A 4BLUA 2JH9A 1FPQA 2QE6A 1ZQ9A 4FT2A 4PINA 4XUCA 3CJQA 3FPHA 1DCTA 5DX0A 3TR6A 5DLYA 1RJEA 3GXOA 4QDJA 4YUZA 1N7IA 3CCFA 2I6GA 4ER5A 5DSTA 5E9QA 3OZRA 3KPJA 3E05A 4RTSA 2PKWA 2HV9A 4KWCA 3CBGA 3G2PA 5CVDA 5K0GA 5T64A 4QTTB 5FCDA 4E2XA 4IKPA 5FHQA 1KXZA 2HTEA 3GRZA 3M6XA 3OU7A 4YUXA 2BM9A 2VDVE 5E2BA 1G55A 3X0DA 2ONZA 5EKXA 1L3IA 1AV6A 1YFLA 4X41A 2JHCA 4MQ4A 2ZIEA 1TW2A 2OYRA 4HC4A 5DX1A 4RTPA 2QRVA 4UOEA 5K0EA 3VYWA 4PONA 5LR6A 5EIWA 4DM3A 2ZZNA 1H1DA 3GRYA 4E32A 5DX8A 3NVKI 3BWBA 4PWYA 2EJTA 3LSTA 4E33A 3KQYA 2HR1A 3P97A 5GIPE 2C7PA 2G72A 2Y1XA 1YB2A 2P41A 3FPFA 1SG9A 3MCTA 4HGYA 3SM3A 2AOVA 2PV0A 2VDUE 3KQSA 4C4AA 1RI2A 1ZKDA 3ELYA 3TKAA 2WK1A 2IH4A 5FWDA 1X19A 4FSDA 4RWZA 3UJAA 2FYTA 1NW6A 3DTNA 3HA3A 5EZSA 1SQFA 2IFTA 2YUIA 4DQ0A 3B89A 3MGGA 4RTOA 3OZTA 4RTJA 4QPNA 3DXZA 2ZZMA 2YXDA 4F84A 3ANXA 2UZ4A 2H00A 2ZBPA 2ZULA 4F86A 5FHRA 1G38A 5DM0A 1O9HA 1NW5A 5KVAA 4EMSA 2EFJA 1V39A 1L3CA 5CVUA 1SVUA 3FRHA 5K01A 5CCBA 1NT2A 3M33A 3DMGA 2FRXA 2HNKA 3MB5A 4YV0A 1R18A 1QAOA 3SSNA 3PVCA 2GA9A 2IGTA 3TQSA 3LKDA 4HSGA 3OFJA 4HH4A 1R6AA 3R24A 1X1CA 2AN4A 3KQMA 3P9IA 1ZGJA 3G5TA 3DP7A 3GO4A 2GLUA 2BR4A 3KR1A 4FGZA 1ORHA 1XJ5A 2XVMA 4O29A 2BR3A 3B5IA 2N47A 5DWQA 3SVZA 3C0KA 1RI5A 3EPPA 3HM2A 3KQVA 5BP7A 2YVLA 3BGIA 3H2BA 2AN5A 5EMMA 3C3YA 5HZMA 4M38A 2IIPA 4OBXA 3UJ8A 2O05A 3QV2A 1I1NA 4ATNA 3AY0A 4ER7A 5T6BA 5C9ZA 3FUTA 4RTMA 3P2KA 5E9WA 3M4XA 2B9EA 2ZSUA 3MAGA 5FADA 3TKYA 2C7QA 2NP7A 3IV6A 2VS1A 3NTVA 5KS2A 1XDZA 5E2AA 3C6KA 2IPXA 4PNEA 4ER6A 4X61A 3ER9A 1KIAA 5GIOE 5FUBA 2FK8A 3DLIA 1NV9A 5F2KA 5HOQA 3T7SA 3MQ2A 1NBHA 3CGGA 2IH2A 5F2OA 2GB4A 5U4XA 5LQKA 3GCZA 1PJZA 5CVVA 2G70A 3TFWA 2JH8A 5K0BA 3SXJA 3I64A 3LPMA 5LQJA 4A6DA 5DTRA 2O57A 2I7CA 4RVDA 3HA7A 3DMHA 3RODA 3ER8A 5E1OA 3O7WA 3A25A 1P1CA 2AOTA 2CWWA 3HCFA 2AOUA 3FZGA 3P9KA 4RTQA 2ZCJA 4PGHA 3EVDA 3HP7A 9MHTA 2PY6A 2JG3A 1YFJA 3BGDA 4AZVA 3UA4A 4BP1A 3RIEA 2XVAA 4E2ZA 2ERCA 3UJ6A 2OO3A 5BXYA 5CD1A 1XCLA 2PXCA 2I62A 5E1BA 3FTDA 4FSXA 4KDRA 3OCJA 3B3FA 3I53A 1UWVA 2O06A 1XTPA 2PLWA 3CJRA 3OE5A 2PJDA 1WS6A 3R9XB 5GM2A 4RVFA 3LCUA 1X1BA 4DZRA 1KYZA 4KDCA 3C6MA 3FYCA 3T7TA 3K0BA 5D1HA 3EEYA 1R8XA 1X1DA 4X60A 3FPGA 5C0OE 2FK7A 3TLJA 5EKUA 3E7PA 3KPWA 4PCAA 4GEKA 5HEKA 4CTKA 4M36A 4YUVA 5MHTA 4PYKA 5K05A 3NMUF 3TM5A 3GRVA 5GINE 3EVZA 5IKMA 2JHPA 3HVHA 3KR2A 4HTFB 1JTFA 3LKZA 4IV0A 4ISCA 2IBSA 2AOXA 1VPTA 2PX8A 3LDFA 5HIJA 3DUWA 1U2ZA 3LGAA 1G60A 2PX2A 3VC2A 4G56A 1WZNA 2DPMA 1L3BA 2Z6UA 2P8JA 3BZBA 5EMKA 4AZSA 1SUSA 1JSZA 1KHHA 5E9JA 5HFJA 4YMHA 4DMGA 3I58A 5FULA 2B2CA 2ZBRA 4DCMA 3C3PA 3FUXA 3S68A 1WG8A 4YUYA 3DOUA 4PYJA 4EKIA 4GOMD 3DR5A 3KQWA 3FUUA 2ORED 5ICGA 4B17A 1WY7A 1QAMA 2ZWAA 3GGDA 3SSMA 1NE2A 3KPYA 4R05A 1JG3A 1SUIA 1UFKA 3FUVA 3G89A 4ZTBA 5C1IA 1EJ6A 1JQDA 3M6WA 1Q0SA 5GWXA 5EC8A 3HCBA 5K0NA 1Q0TA 2YTZA 5E1MA 3L8DA 3SMQA 1VBFA 5DXAA 4GC9A 5HIIA 3MCZA 2P7IA 3QOXA 4AZWA 1P39A 2BZGA 1KR5A 2QRVB 3PLAE 3CKKA 1P1BA 2UYOA 4V0QA 5LQCA 3B7PA 1VP3A 3A7EA 2ZWVA 1DUSA 1O9GA 1VE3A 5LQAA 3LHDA 3JWJA 2ZTHA 3HTXA 1VLMA 3BKWA 3EVAA 3OPNA 1TPYA 1IM8A 4R8SA 3I5UA 2DULA 4M37A 3DH0A 3ELUA 5FA5A 5K0CA 5DT2A 3NJRA 1F38A 4R6XA 2H1RA 4LWPA 3LL7A 3HVIA 5LQNA 2OKCA 4CTJA 4A6EA 1QZZA 2UYCA 2JJQA 4PYLA 5CVJA 1XXLA 5DXJA 3REOA 2P3QA 2I9KA 2Y1WA 2QY6A 5M5BA 3MERA 4PIMA 4LWOA 5EMLA 1L1EA 1HNNA 3AJDA 4R8RA 3EVFA 4RSRA 5BW5A 5JUWA 4WVLA 3O4FA 4XUDA 2XYRA 3UJCA 3PTAA 1RJGA 1MHTA 4OA8A 2P40A 3G2OA 4QQKA 4OBWA 3UBTA 2NXCA 3HVJA 1YZ3A 2GPYA 2YXEA 3KKZA 3OE4A 3G2QA 4JXJA 4PGGA 4P7GA 2P7HA 2IBTA 1X1AA 3GWZA 3KR0A 3CJTA 1NW7A 2VZ9A 2LD4A 2YR0A 4LECA 3BXOA 3M6UA 2P3OA 4OX9Y 1IXKA 1D2HA 2Z6QA 2PT9A 1QYRA 4P7FA 5EMJA 3HCDA 3G5LA 1G8SA 3KHKA 4QDKA 3KQOA 4ER0A 3G88A 4MIKA 3UJDA 3D2LA 3UZUA 3V97A 1MJFA 5KYGA 5K0JA 2OPBA 1SQGA 1DL5A 1QANA 3E23A 5LSAA 3B3GA 5BW4A 4M7RA 4GOOD 5CUQA 3KQQA 2XYQA 4FS8A 3B3JA 4P7JA 4CXMA 2YX1A 2AN3A 3E8SA 4KRGA 3A26A 3ID6C 3VC1A 5EZQA 1NBIA 4GQBA 3NDIA 3SSOA 5FQOA 2PXAA 3DULA 3F4KA 3UJ7A 3FRIA 4MTLA 2UYHA 3UWPA 3VSEA 2Q41A 3EGIA 3LX6A 2WA2A 2BM8A 2ESRA 1XVAA 2UYQA 3GNLA 3KQTA 4YUWA 4Y2HA 2NXJA 2AVNA 2CL5A 2OY0A 3AWIA 3BT7A 3HCEA 5CM2Z 2ZLBA 5K03A 2P35A 3AXSA 4GC5A 5LQRA 5KQSA 1JQ3A 3OU2A 3PX3A 2NNWB 3G7UA 5EHGA 5GOZA 3FTFA 3DMFA 2K4MA 5T67A 5DRTA 3V8VA 1I9GA 4Y30A 1XCJA 3M6VA 2AOUB 2IDKA 3DXXA 3GDHA 4RTLA 1N7JA 4EQZA 3ELDA 3PT9A 1JTEA 3JWHA 1EIZA 3M70A 4PYNA 2GS9A 3MTEA 3Q87B 2PXXA 1WXXA 4EVIA 5K09A 1XDSA 2G71A 3BGVA 4MHTA 2V74B 3NWEA 2ZVJA 4RYLA 2PVCA 3BWYA 3P8ZA 3PFGA 4QQNA 2A14A 4PYQA 4QVKA 5F2NA 2ONYA 1KPGA 2FCAA 4C07A 2PGXA 1AQJA 4KW7A 1BKYA 1JQEA 2BR5A 3FUWA 3ELWA 1ZG3A 3EVGA 1FJXA 2FPOA 3THSA 2NYUA 2ZZKA 4RX1A 5DM1A 3JWIA 2O0LA 10MHA 2CMHA 3OZSA 4HRAA 5G02A 4MWZA 2Z6AA 5CCXA 4WXHA 5EHIA 2OB2A 3IYLW 1EG2A 2EX4A 3O31A 5DM4A 4RV9A 4DKJA 5DSXA 1SKMA 5FQNA 3HA5A 2YQZA 2OXTA 1P91A 1D2GA 5B1SA 3G8BA 1KP9A 2EJUA 5EGSA 5FWAA 2PT6A 2WA1A 3KR9A 3GIWA 3PB3A 4XCXA 5DTMA 5EQJB 5K0LA 4E2WA 3HCAA 4EKGA 1R74A 2PWYA 3UFBA 1JG2A 5HIMA 2ZIGA 4P58A 3CC8A 1FBNA 1JSXA 1Y8CA 2IDJA 4X63A 3LDUA 2OBFA 4EK9A 5KQRA 5GP1A 4AUKA 1JG4A 1XDUA 1EJ0A 4GBED 4YMGA 5H02A 2XYVA 3HNRA 3T7RA 4QPPA 3NVMB 4BY9E 3HEMA 5E8RA 4IWNA 5EPEA 3MHTA 3RW9A 4LG1A 5ERGB 3SX0A 3EMDA 1YZHA 3HCCA 5CVEA 1RJDA 4X1OA 3NDJA 4C03A 4E31A 2PSSA 1RI3A 5K8VA 4L7VA 1T43A 1VQ1A 3NWBA 4HGZA 1NKVA 1ORIA 4RTNA 1YUBA 2NXEA 3FYDA 3GRRA 3R6TA 3GU3A 3LDGA 1OR8A 2P3LA 2OB1A 2ZIFA 3KU1A 4FT4A 4OQDA 3UJ9A 4BLWA 2PX5A 4CKCA 3A27A 4FR0A 4KIGA 3P2EA 3HVKA 3P9CA 5D1NA 3TMAA 3LCCA 4OA5A 1YF3A 4PYMA 4PYOA 2PBFA 4OQEA 4BLVA 2AS0A 1NW3A 2C7OA 2QYOA 5FA8A 1O54A 4RTKA 2OZVA 2G8NA 2P1DA 3I9FA 2YXLA 2PWPA 1Z3CA 3PX2A 2QM3A 4HG2A 1BHJA 1R00A 4CKEA 5EEGA 3G8AA 5EVJA 2H11A 4QTUB 1M6EX 5ICFA 3T0IA 3U81A 4KIFA 2FHPA 4DF3A 3EVCA 4RTRA 3GRUA 1KPIA 4E2YA 2E5WA 1INLA 3IEIA 3P2IA 4AZTA 1R8YA 4C06A 5IH3A 1WXWA 1G6Q1 3EVEA 3MTIA 5P8WA 4RVHA 2AOWA 4K6MA 3FPEA 4GOLD 2BH2A 4NECA 4YV2A 1PRYA 4POOA 1EQAA 5HIKA 3THRA 5ICEA 2GH1A 2AZTA 4PCLA 3ME5A 5DRYA 1JR4A 2HMYB 5E1DA 2ZW9A 5EG5A 3AXTA 2ADMA 3KQPA 5LQUA 3DLCA 4FZVA 1I4WA 4E70A 3LBYA 5DPMA 3PS9A 3EEOA 1HMYA 4KVZA 4P7KA 1IY9A 3UA3A 1FP2A 1TW3A 2NXNA 3PFHA 3UJBA 4CWAA 4CKBA 5DM2A 2B78A 4E30A 4DA4A 1EAMA 1RJFA 3OFKA 4YV1A 3SGLA
chains in the Genus database with same CATH superfamily
4V3BA 4CEHA 1OJ7A 2VYVD 3KTOA 3AZQA 3FKJA 3OHMA 3WJAA 2CNKA 4C08A 2GYWA 4OSPA 4J91A 1YK0A 1KA9H 1WKBA 1ZOPA 2FWRA 2XTAA 2C2GA 3J81A 3VNSA 2R8YA 3HJGA 3GH3A 3TPZA 1H3EA 3WGJA 5JHGB 1IZ7A 1MV8A 2AE2A 3RREA 1SUFA 5E6SA 3WZ2A 1N0VC 4BFCA 3MJCA 2NVOA 1DDIA 4W7IA 1NJ8A 3ICEA 4FJ1A 4UE6A 4FILA 4XRRA 1TNDA 3GF4A 3CRZA 4ARZA 3LUBA 4LXXA 3O47A 1NNEA 3IXMA 1YDFA 5CPBA 1PL0A 1EHIA 2DHQA 4BO8A 2VBIA 3U61B 3X2EA 4FEGA 4MV6A 3SD7A 4H1TA 3UXEA 3FPLA 2B4RO 2PS0A 4QO8A 4J4BA 2R8OA 1EHYA 3BN3A 1JR2A 4JBYA 4BMSA 4B3IA 3COJA 2J07A 1UMCA 3NOXA 4O02B 5BSEA 1KNQA 1IC6A 4MHSA 1QCYA 1RIFA 1U8TA 2FPKA 2QLFA 3PQ8A 4D9IA 3A4VA 3BWCA 1CUGA 3DZ8A 5IUKC 4ZRDA 3REQB 5FTWA 2DPYA 1ETUA 3G0DA 2DR0A 1WDTA 2FFAA 1FTQA 3B53X 1B8PA 3R0VA 3EF3A 5CYFA 3TLBA 2EC5A 1HO3A 2C5SA 2KJQA 2W6QA 4OQLA 1Y0BA 4Q9KA 1KJQA 1RJWA 3WMWA 5CDUA 1MZPA 2I4RA 4B8ZA 3WA7A 3HXKA 2OV3A 4RA9A 5AKIA 2D1SA 2VTBA 2BGWA 2H0RA 3GOHA 2AJBA 4TL7A 1RKVA 3AV0B 3KTDA 3KG2A 3DYVA 5EZYF 5EZYA 5FDFA 3R7AA 4WOKA 1EWYA 1EFRD 3BE8A 3VPFA 1ZUD1 3ENKA 4YDQA 1BDJA 3KOUA 3IOEA 5FORA 4DUYB 3MW8A 1PNOA 1ZK2A 1EWVA 4XWOA 4E88A 4NMMA 4OXYA 2VPWA 3H65A 1MORA 2GFHA 4TLEA 4DM4A 2F1RA 5F7ZA 4M8NE 3BQNB 3GZTB 3L7MA 4YS6A 4ZEMA 1ZS9A 4J7AA 2ONZA 4GRAA 5FOUA 3GCXA 1NYRA 1H23A 2ZB2A 2VZ0A 8AT1A 2E4YA 2O2XA 1NW9B 3AG5A 3HB9A 1RM3A 2J5KA 1J07A 2JFZA 4TXHA 4NK4A 5B37A 3ND5A 3VI4B 4FEEA 1ESCA 3P9PA 2HSGA 3AT1A 4A8HA 3NVKI 1TVCA 4K87A 1JKMA 4DLBA 1B4DA 4FM9A 1E7YA 1RAGA 3O4IA 4KMSA 4B74A 2Y1XA 4GUDA 3SM3A 2VDUE 1N34B 1JHAA 2V96A 4W1SA 5JE8A 3TMYA 3CVVA 1U0BB 1LW6E 1X7ZA 4BWYA 3ZI7A 4EEZA 3KWLA 4FSDA 3TG2A 2FWMX 1NW6A 1C0KA 2G77B 3P5SA 5ELLA 2EFGA 1W4RA 2VNSA 4L9RA 4B6RA 5AJWA 1AURA 4N5LA 1BGVA 1E2QA 2BD0A 4B4DA 3DSRA 3TPCA 2AFHA 1DBWA 5LB2A 5TV2A 3TUIC 3UM9A 2FOXA 3U19A 1O03A 3PWSA 4P93A 1GZVA 4ESVA 3A11A 1VJGA 3PIDA 3FWNA 4YAGA 2HBQA 1WEKA 2FP3A 2JIQA 5ETJA 2DSNA 2FF7A 4TLBA 1I13A 3ZDAA 1V35A 3FW1A 3K7EA 3MJSA 1QLJA 1CUDA 1PZXA 5B4UA 2VF8A 3DOJA 2ENWA 3L0YA 4EELA 3ZVNA 3A1VA 1OI2A 3GHYA 4RGYA 1NXWA 3IMFA 3R75A 2JGAA 2O8DB 1VXRA 4IIGA 1ZOIA 4N4AA 3R24A 4US0R 1GG5A 821PA 1SUAA 2GWHA 4C87A 1I6WA 4R1QA 1JZQA 3KQMA 1I4LD 3L05A 3OY7A 2QRNA 2HIMA 1WKCA 3OIWA 4UARA 4RZ2A 4DA4A 5SZHB 1X14A 3OF5A 3EPPA 4YO8A 2WPNA 3RS0A 1VSBA 5G4LA 4EZIA 5HZMA 2YL2A 2X23A 1U5AA 3E03A 5LZ2A 2VK2A 5KPJA 3OJ0A 4J0DA 4LZLA 2O4UX 3QPBA 3JSXA 1PR3A 3AG6A 3ILVA 4RPGA 4TKUB 4WGGA 1U94A 3UG6A 5ED4A 1VYVA 3C16C 3AR6A 5FL7D 5KS2A 2C98A 1C0PA 1UP4A 5EIAA 4V0NA 2Y1KA 5KWSA 2WICA 1Y42X 3M2TA 3V8MA 2IPXA 1P7WA 2XE6A 1ZM7A 3IUPA 2V9ZA 5KC8A 4ENSA 3QJYA 4L8VA 4UHBA 4CU2A 2GZRA 1EZ4A 1U0TA 2RGNC 5LZ4A 3KVRA 4M1ZA 4NYMQ 4WDQA 4HB2A 5HOQA 4REQA 5BWMA 2B21A 4YP6A 2J5RA 2R1TB 3ZQKA 4CUKA 3EQZA 3I9V6 1RCTE 5D87A 5TDHA 3U4IA 2VDRB 2Q1SA 3TFWA 5B6PA 2C4VA 2RHJA 1HDYA 3LDAA 1F2TB 2OCYC 2KSQA 2PO5A 3K20A 1GQ2A 2YV3A 2QRQA 1JJFA 3AP2A 4MIOA 1XWIA 2IPOA 3Q3GE 3EGXB 5GVSA 4Y2XA 4XWWA 4KUGA 2WIJA 3A25A 3WLJA 4DA7A 1T0HB 4GS5A 1SUEA 1QFMA 1HQYE 4ETWA 1JDZA 4J7XA 4EUEA 1IONA 4WOBA 8ABPA 5A0TA 1OWPA 3FDXA 1CLEA 2NTJA 4EMBA 4F5ZA 3LUKA 2CXTA 4E1BA 1FFAA 2VSXA 3D8UA 1KJZA 1ZCBA 2FR8A 3BZWA 4QBGB 3RIEA 4CBVA 2NZYA 5MGBA 4WK6A 2PE5A 3EASA 5JS6A 2V0GA 4JK3A 1EVQA 2OFXA 4MS4B 4QOIA 4YAJA 1DJMA 2WYIA 2ZUFA 5J3JA 1KAEA 1XFAA 2V7QA 1E18A 2CHVA 3H84A 3H8VA 1T0PA 3A4NA 4JY7A 3TIFA 4CIVA 3C24A 4B33A 3PJRA 5A04A 3C6MA 3T7TA 4G8DA 4UBOA 4KPFC 1QHXA 4OQFA 3E7PA 1K3UB 1TK9A 1ZWLA 2BDEA 1XRQA 2CE2X 2VUUA 3MJVA 1JDUA 1VRCA 4UVGA 4HTFB 4G4IA 1B74A 2ZANA 5BYAA 2VF7A 2EATA 4R7GA 4QFCA 2DSTA 1D04A 4IWYA 4EQ6B 1RXWA 1LPNA 1G60A 4F3RA 4G56A 2QTZA 1BJRE 3HUDA 3PHCA 2LW7A 3DVAA 1PWZA 4JU9A 4C0AC 2GKGA 4XLLA 3AF6A 3K9LA 4URYR 1CEYA 3E9CA 1Z5VA 1KH1A 4UQPA 3IBGA 3S68A 1GGKA 4O0MA 1SR8A 2BMWA 2PFGA 1CR2A 5ALSA 3VR4D 5BN1A 4RE6A 4F8JA 4RPJA 3W6ZA 2J1LA 2P9EA 2ZJ7A 4GYJA 4QG7A 1V7ZA 3ZGYA 1YCFA 3B6KA 4MZXA 4P3YA 4X6LA 1SUIA 5JNRA 5JT1A 3CVYA 1CF2O 3Q7RA 1Q0SA 4OF4A 3ZLJA 3WGKA 4JT2A 1WCV1 2CDNA 1ZZGA 4B2LA 2XGSA 2W8BB 1EEXB 2HAEA 1RQNA 3FIUA 2P7IA 2P2LA 2VI5A 3QX9A 4GPTA 4EPWA 2NT4A 1ZN7A 1X1TA 3D0RA 1UEJA 4PX3A 3AUSA 1TQ2A 4RCVA 4TLAA 1HH4A 3H0KA 4EHNA 3JARA 5CXSA 1FW8A 4X1IB 3TLGB 3B7PA 1KJJA 1Y89A 2RGCA 4R01A 3CG4A 2Z4SA 3A7EA 3HJRA 4DPMA 1W5FA 2J41A 3GBPA 5B30A 4ZCQA 1WV0A 3E9MA 3K0KA 1Y3IA 4P92A 5SY4A 2RJNA 3WADA 2I8AA 2QR5A 4NZNA 2BFBA 4JYBA 4WFIA 3HR8A 3VHQA 3VSBA 1ZJJA 3SKVA 1E6WA 3EXHB 1NLMA 3PRKE 1T8SA 4KIWA 3ZV7A 4GMDA 2CNWD 4L27A 3QFFA 1BAPA 2H1RA 2ZSEA 3M49A 3QHQA 3T7KA 2ZUTA 3KDSE 3N8NA 4M21A 2BTOA 6ADHA 3JRNA 2QTNA 3ZS9A 1R0SA 2WG0A 4BLQA 5DBOA 2NUBA 3MERA 3CFYA 4PIMA 1VG9B 3IOMA 1XEXA 2M6LA 3AJDA 3PEFA 1PCXA 2WOJA 4N47A 1XRJA 2CLCX 8OHMA 3FD8A 4UHJA 1MHTA 3PTAA 1M0SA 1W5SA 1UJBA 4G85A 3DLBA 4QGSA 1TB4A 4RQUA 1VECA 3ZGVA 1KEVA 4MP6A 1W49A 2GZ3A 5A2GA 4A3SA 2IC5A 5CLIA 3UBTA 1WULS 2EF1A 1NN3A 2GPYA 2YXEA 3O1IC 1P19A 1OAOC 5KJCA 2BGMA 1E94E 1P4SA 1SVNA 2OWDA 3MELA 4MVJF 3V8QA 5IN4A 1FSSA 1R5OA 2QQEA 2GM5A 4GXRA 2HF8A 3IO5A 2R4QA 2YJ6A 4B8YA 2PUHA 1KZYC 2P3OA 3I3OA 1DTWB 3BS4A 3NHMA 4JSYA 4N7BA 2JLBA 4FD2A 4J94A 3AONB 1Q83A 1J8QA 2BFFA 5DNEA 4LC0A 4F0JA 3PR1A 3KQUA 1Q1GA 4R2MA 4LJLA 1O95A 2P9HA 2V3CC 3R0IA 3SJZA 3K70B 3GJ0A 1OPXA 2BMFA 3QVMA 5LSAA 5CUQA 1UXJA 2HK9A 3LX8A 2XYQA 4M46A 3GGSA 3JQRA 4MICA 5K3AA 5CPFA 5TMDA 1AE1A 2BFAA 3I45A 1ORTA 4ZQHA 1YO6A 3KOOA 4HGNA 4L51A 1PUJA 5CDFE 4M9XA 1NSFA 1W59A 3FRIA 4ARUA 1YAHA 4QGAA 3W5DA 1FSZA 1V8DA 3FPBA 5FOQA 1DIOB 3K2EA 4P0PB 5I7SA 4UZSA 4PXAA 2CL5A 3AUKA 4CUZA 5LNK1 3OFNA 3OQVA 1ND5A 1P3DA 1QVAA 2JJMA 3Q88A 4YAUA 4A2WA 2GBCA 1PFGA 5LDHA 1SAYA 3NT2A 4Y2TA 4OAOA 3IEUA 4Y6PA 5GZ1A 3D3EA 3ZBQA 1DQRA 1FTYA 2RKBA 3A2NA 3CR3C 2DTXA 5G0VA 4C3OB 5G4KA 2OVBA 4XD2A 2FRVA 4LGMA 2X6RA 4XM1A 3DXXA 3S4YA 4AJPA 4IIJB 1Q0ZA 2AMFA 2V58A 4QDZA 4QOSA 5AKJA 2GS9A 1CEQA 3TH5A 3FROA 4MR8B 5FO1A 3C48A 4X64B 4YQFA 4HVCA 3CF2A 3T3GA 1EVKA 3EPKA 4C5AA 3MZ0A 4ZALA 3SS8A 2HW8A 3O8QB 2BUAA 3K1ZA 3VDXA 3ELWA 1MQ8B 2B83A 2FQ1A 2QD4A 4G8CA 3KJFA 4DEXA 2NYUA 2EKZA 1W0JA 2JFFA 2P27A 3N0VA 4KTTE 3RVNA 1L8OA 2VXCA 2E18A 10MHA 3VX4A 3BIJA 4HRAA 1D1TA 1XLTC 4HQKA 3UEOA 5CCXA 3R5KA 4R8LA 4GYWA 4LXQA 4NBKA 4E03A 5C7IO 4DGSA 3BRQA 2EHJA 3OHSX 4GXTA 4K88A 4DKJA 5AK5A 3OWOA 4ZEXA 1LFDB 4LOLA 2Z8ZA 5KAPA 4EW6A 3UMSA 4LNUA 1YVDA 3G8YA 4QSMA 3EOAI 1WUKS 3PB3A 4XCXA 1JVBA 3WLTA 5AVUA 2QHXA 3NV7A 621PA 2UUOA 3CC8A 3HJHA 1EX1A 1MNAA 2DLDA 2PVSA 3JZIA 2OBFA 4ZVNA 2JHGA 2YOGA 3W04A 6YASA 3NC4A 1W6RA 3L06A 3JSAA 4X3CA 4L9AA 5TS3A 2FW7A 1IQPA 2JFYA 2ZS8A 1NL3A 2X9GA 3O4RA 3E3OA 1JL3A 4O4LB 2QP4A 1U11A 2VA8A 3BK7A 1XQXA 5ERXA 3L7YA 3QPVA 3GXBA 1SC6A 1V3QE 1EK0A 4GX0A 4QODA 2MINB 1J90A 1JHVA 3MJRA 3WA6A 1G1AA 1NT4A 1YU9A 1D6MA 4CM7A 4FWTA 1AK9A 1E0DA 1XD9A 4HGRA 4B6GA 1OR8A 1QONA 1JT9A 4RGVA 5HFNA 4KXNA 2QTGA 4UDNA 4Y6GB 3T5GA 5BVHA 1EIWA 3RTBA 3A27A 5COBA 1C9DB 4DMCA 1F17A 3BQ9A 3E22A 4V39A 1FNSA 4FZRA 2HHCA 4B6EA 3GUHA 3NH6A 4XWTA 1BFUA 1XSEA 2YUTA 3DF7A 4OHRA 4PYOA 2VRWA 5EYPA 3DFFA 4HFJA 3A4IA 3TUZC 1ZC3A 2CDBA 4ECAA 5FA8A 4ZVRA 3I9FA 4KRYA 2HUPA 3U3RA 5EPOA 1Z0JA 2BMDA 4IAOA 4EB0A 1WE2A 3SZUA 3DTTA 5EEGA 4NCBA 1KF0A 1M6EX 1IUOA 1MR3F 2ORIA 3C3DA 2I2FA 3EVCA 2GK4A 5CLLA 3NIDB 1GGJA 1M7BA 4LQDA 4TMWA 2ZDHA 1BWSA 2CJFA 3C6BA 2NPFA 1UJ5A 4BEJA 1X9GA 4MAFA 1YBVA 5P8WA 3P94A 2FB9A 3C8ZA 4NECA 3DV2A 3WLAA 4AW9A 3THRA 1EM8B 1EG7A 3WP1B 3LUCA 4HJRA 5DRYA 1U7HA 2GD2A 1X9HA 2ADMA 2WF9A 1EFDN 1T1EA 1ZP6A 2C61A 2Z57A 4RFSB 3ZK8A 3HUUA 1ESDA 4LXTA 4KVZA 3Q98A 1XTVA 2XB2A 4WZBB 1PVOA 1M8GA 4G1MB 1RPJA 1DEHA 4FDMA 2G9QA 2PPLA 3M6FA 4RA6B 5HX7A 3V1MA 1RKXA 1NW8A 4CIXA 2B3TA 4PIPA 3RUDA 3T9AA 1ESNA 2IELA 1N2JA 4JB8A 4I50B 1C4WA 3W1EA 3GP8A 3QPUA 2DFLA 3QXCA 2O7SA 1V45E 1ZRHA 3PDUA 4UJ3A 2VP3A 2PQ0A 5IM5A 1U0LA 3P71T 4PLHA 9LDTA 3JWGA 3MLAA 1QZXA 2ZJ8A 4NAHA 4PHGA 4TLMB 2L69A 1MABA 2C59A 2GAJA 2RB5A 5AH0A 4DIBA 2EU8A 3TS1A 1YOBA 2KBFA 2ST1A 3Q11A 4Q7LA 1JG1A 4JN6B 3DKVA 4MO9A 1QRSA 2B1IA 3ZXYA 4HRVA 1QFJA 5ENDA 4Y9RA 1AF7A 2QIOA 2GR9A 5IMSA 3PFKA 3MWDA 2XQVA 2I76A 1A2KC 5BN5B 4P6VF 4EY6A 3DC2A 4DXDA 3QY0A 1Q74A 1STOA 3KE9A 3SLKA 1XNRB 3EXG1 1Q44A 1ZRMA 2P9ZA 4IMIB 4RF4A 3ED1A 5LD2B 2REXB 3ABZA 2M2IA 4QREA 4TKLA 2R3SA 4DR2B 1A8QA 4H0NA 3D6MA 2IZ7A 3OT1B 3QSYA 3DC7A 1RYHA 2FR0A 4B3SB 1ZL2A 3FYUA 2NV6A 3PC2A 3I62A 4GU5A 1IN6A 2NSJA 1OYWA 4HWPA 4LJYA 3HYSA 4AJOA 5ISMA 2H7VA 5BSVA 4ZCPA 3UWMA 4QYIA 5IKXA 3CXUA 5JDCA 2FR1A 4YGXB 4B3MB 3FBTA 2EGGA 4A36A 2L42A 2P4SA 5I9BA 1JAXA 2YVUA 1G63A 1T6ZA 1TMGE 1QSGA 4ZD6A 5KVSA 1KIFA 2Z98A 3LO5A 1A77A 3Q6NA 5DBIA 3U0VA 1SCIA 2NXWA 2PKWA 4RTSA 4L4RA 3IP6A 2B8NA 4DNQA 2K6GA 2X8JB 2QJFA 1L4YA 1T26A 1UFVA 2YVAA 1TTTA 4EVQA 3OU7A 4JGBA 2H5LA 1DXYA 3DG9A 1W30A 3P9ZA 3X0DA 4WXRA 3ROTA 3KFLA 3P0HA 2IXFA 2O2EA 2OHXA 4Q3AA 3AFHA 4AN4A 2PA3A 4GI2A 3EG9B 5IHXA 3D8RA 5LWHA 3L6RA 3SZLA 1Z0DA 3I05A 1ZLXA 3MYYA 3RRFA 4MWOA 4GX5A 1HLGA 4PC6A 5JXIA 2X4GA 2D5BA 2NAFA 1H1DA 3PI6A 3OTGA 3PEWA 1XCBA 5FOSA 2W2MA 1ABEA 3RS7A 1Z2PX 2Q3MA 3RASA 1VE7A 3VYTB 2MIIA 2E3JA 2B8WA 3NKFA 3OIUA 4MYHA 4A8JB 1KFCB 1A50B 3FYSA 1VB3A 2HA2A 4NV1A 4B1FA 4ZI7F 4ZI7A 2W2PA 3KQNA 1ZA1A 3HYTA 2FGJA 3UENA 5TJHA 3B6JA 3STXA 3VHXA 3W2HA 2CFIA 1EE2A 2WU0A 1O6GA 1N2CE 2YYYA 1NIPA 1CQZA 1MDFA 3K15A 1GPDG 1T5SA 1NATA 2HMSA 1AT1A 3HABA 1NVTA 4V0SA 1P0IA 1Z2EA 4Y1EA 1SC4A 2IIBA 3R8FA 4RZXA 5CJ2A 5C5IA 3N53A 2J32A 2XECA 4B87A 2P8SA 2FZEA 3ZU5A 3NNNA 2D2FA 2H00A 2OK7A 1GAWA 2ZIVB 4LJ9A 2G0TA 1ZEJA 5HPYB 1BW9B 2H16A 3AUYA 3L07A 4GMXA 1AO0A 2RHWA 1RNLA 1U5BA 4P5DA 4F96A 3C7TA 1JVSA 2OHHA 1F8FA 4BQOA 3JX9A 5CCBA 1NT2A 2Y67A 3M33A 4L6CA 2P0YA 4B7XA 4KMOA 5DYTA 1KJIA 4FFWA 2IGTA 4G4SO 1TYEB 5JJKA 1IM2A 3CMMA 1PDWA 4DHEA 4J76A 3AEQB 3IMGA 3K4HA 4WBXC 3BXPA 4K9MA 3PHGA 4PE5B 3CF6R 1CPYA 1ZGJA 2GK3A 4MA4A 3JATB 3AU9A 3PNLA 3U39A 4B71A 2OXRA 2P9FA 2G7MC 1GNQA 5BP7A 3WJ2A 3V1NA 2MSDB 1L4UA 3JQ9C 3EPJA 4GVPA 4QOFA 2IK8A 5EMMA 1ZIYA 1HC7A 2DVMA 2ZI4A 4FR5A 4R98A 1LI7A 3NBZC 4XM0A 3HXMA 1BDHA 2WP0A 1N6HA 2A59A 1IBMB 1W29A 2O05A 3TDKA 3IBYA 3Q3EA 1QGUB 4X85A 4GKJB 4N0QA 4IDHA 2OAEA 3NCHA 5DYGA 4K40A 2VS1A 3CLRC 1V6SA 1G20A 1PFUA 5DCLA 1E6EA 3GQBB 1SQSA 2P78A 1LEHA 2ODPA 4OK3A 1SU7A 1ZNQO 3TGPA 2XWSA 2IP4A 1K7YA 4EGJA 1PUXA 4R69A 2CSXA 7REQA 4B32A 3TNLA 1A88A 1I24A 5AVXA 3EE6A 4F4UA 1O0CA 4D41A 4FHCA 1CD5A 3UH0A 2JEZA 5BR1A 4E08A 4EG4A 2CNLA 4Q3BA 4ZARA 1MFPA 5I51A 4UOZA 4C5BA 2A4KA 4JT4A 4M55A 3KP1A 4Z5XA 1GQRA 1BA2A 1P2SA 3L79A 5AUOB 3ER8A 1QHNA 5K9ZA 1ZX1A 5E7IA 3Q1KA 3VU3A 4B76A 2WFMA 2QMUA 3PGA1 3NLLA 1ZBQA 3LYLA 5DM70 5G3ZA 2XWQA 1UMDB 4AT1A 5DVZA 3H5IA 2ZCJA 3M6MD 9MHTA 1N5MA 4M9ZA 1UK9A 2W11A 4WA7A 1R66A 5FUYA 1E5LA 5JI2E 1V8PA 4E1VA 3QWIA 3UMYA 1K2WA 1WL8A 2GF2A 1DMRA 1XDGA 1Z74A 2RHHA 3AF3A 3L93A 4G23A 3OCJA 3OZCA 3D1JA 4IUDS 1NBME 4R9UC 1UXKA 1KAQA 4HWSA 2I33A 1UK8A 4P80A 3VYVA 1N2CB 3PRYA 3P26A 4Z7NB 3IE1A 2VZLA 3H1GA 1QTQA 2FZ4A 2CKMA 2VYFA 2FCRA 2MTBA 2O2GA 3OSZA 3Q3IA 1PLLA 1UBOS 2HF2A 1GNPA 1IJFA 2VT3A 5EKUA 1H6AA 5IT0A 4EJSA 4ETIA 2BY4A 4IIBA 4PQYA 2EKDA 3KBOA 5GINE 3GRVA 3EXIA 1DTSA 4MMYB 3COPA 3S2FA 4CTOA 4F1JA 1NZFA 2BDTA 2G1AA 3CG0A 2PX8A 2V7PA 3I04M 4W7HA 3DUWA 4WLVA 4NSNA 3M1YA 5DBFA 3SQXA 4GP7A 1SXJD 1A82A 1MEJA 2HZBA 3NBUA 1YS7A 4DZTA 3I58A 1VIAA 4P53A 2D1TA 1YRYE 1K7CA 2H51A 3FOFC 2L18A 1LX6A 2BKAA 1U0SY 2LXNA 2RGUA 4DCPA 2PUCA 1VFPA 3NGLA 3GJ3A 3UK1A 4PPQA 1SXJE 3IAM6 1GG8A 3TQHA 2A0YA 2J6IA 1B73A 1PJBA 1YQGA 2GN1A 3HR4A 3OLCX 3UUWA 1YC2A 2BTEA 2CHEA 3G6KA 2NVUB 1UFKA 1XNGA 3L01A 4JZYA 1JQDA 3I30X 1RS0A 5EC8A 1NSTA 1AZWA 1UBKS 4YO7A 1XALA 2PGNA 2Y1OA 2O5EA 1VKZA 3TFQA 1XQYA 2Y6VA 4FMPA 4GC9A 4DXAA 1TO6A 4NZ9A 5CDTA 4X93A 4JKOA 5JANA 4F4CA 2VAXA 4ZCMA 2XOKA 2VF4X 3EDCA 4R1LA 1XYGA 3VBEA 1H8HA 2JCXA 5F5NA 3TIIA 2Q6KA 4K46A 3DE5X 4DDTA 1PQUA 4IHAA 1YL7A 1MJGA 1A7KA 4WA8A 3MS2A 4IRUB 4DG9A 3R3JA 5JZSA 5LQAA 1D6SA 1VLMA 2D4AA 1JG7A 1Q1BA 3T54A 3HKBA 3M5CA 3UMGA 1VZ2A 3AHGA 1NSYA 1Q84A 1VHQA 3OIDA 4I99A 4INAA 3NB0A 4WXPA 1YS4A 1F38A 2OVFA 4XQ0A 4DQDA 1M6VB 1COWD 5DE3A 4WT7A 5IAGA 1HZZA 2OKCA 3OX4A 3AKZA 1UBNA 1AZTA 1PWEA 5KHAA 5EY5B 2B2XA 3AR5A 2VHUA 4PPFA 4UUOA 5ARDA 3REGA 1PGOA 5EGNA 3JXEA 3IA2A 3KEGA 1ZW6A 4ZV7A 4S3MA 3LX4A 3ENZA 3G9XA 1E20A 2Y99A 3LYHA 4QBKA 5THQA 3IT3A 1PZGA 1AKNA 1L7NA 1XYVA 1JA9A 1EAYA 2P40A 1SWVA 5H9VA 1RXYA 2HADA 1R6UA 4JL8A 4HUJA 4YMSA 2QTCA 6AT1A 4R81A 3DAYA 3WYGA 4IFEA 4YIHA 2A7QA 4DQLA 4A82A 1KI9A 1OX5A 4OI0A 2VDPB 2ZRFA 1YJCA 3IPYA 2P69A 1T91A 5C5EA 1ZH8A 1CQPA 2DZDA 3SQDA 2OFOA 2POCA 3G17A 3N05A 3EFEA 3L7LA 4DMUB 3C4VA 2QXUA 1QYRA 1BD4A 5T4EA 5IJWA 1NHWA 5EMJA 1KOFA 1OD6A 4KIUA 3R6DA 3TW0A 4ZHSA 4J0IA 2FQQA 4PPYA 1O4VA 4C4YA 4TLCA 5CCEA 5DOZA 5F3WB 3MM4A 1NDQA 3FN4A 4MA5A 4MPDA 4LF5B 1XPOA 4DY4A 1ZCFA 1P18A 2J3KA 3B3GA 1MA3A 4G0OA 4LDQA 2A9FA 3ST7A 4FS8A 4B6PA 2QTLA 2C3YA 3RBVA 1WNTA 4HV4A 3AIIA 2CWDA 4TQ9A 3UYLA 2Z1MA 4LN1A 1HBJA 1E2NA 4GE3A 2LDBA 4EABA 1Z0FA 4JFRA 2JIPA 1N5IA 4D6XA 2Q2WA 2KHZA 2WIGA 2WA2A 2ESRA 2MHCA 3A1FA 3GNLA 3UAGA 4AQYB 3LVQE 5F12A 4AY6A 1C41A 4LJRA 1D7OA 5FNZA 2ZLBA 1GZ5A 2KQUA 1RCFA 2CHUA 1YT5A 3FAKA 4F71A 4M0MA 5KTYA 3AVWA 1HK7A 2FSPA 2NNWB 2Z4RA 1R3DA 4XQEA 2X0NA 2Y1CA 3RF7A 4D3ZA 3UHJA 2HLPA 1N3IA 4WNYA 5AFSA 6REQA 1KYIA 5FWXB 4ZAVA 1P1RA 4G5RA 4NBNA 1LI4A 5P21A 2AF4C 1R5NA 3PFFA 4KQCA 2PAAA 4UE3S 1ECFA 4KXYA 5FBWB 2XXAB 1KZ4A 3QM1A 4C6HA 2VUSA 4KLZA 1ZUWA 2H2AA 2VDWB 4PYQA 2H1LA 2CL0X 3QLTA 4QICA 4YRFA 1M1YB 5B7NA 3NGMA 4KN5A 4NU8X 2WTBA 1SO8A 3PXCX 3CX7A 4QXRA 4WY5A 4AF6A 1QZUA 3B1VA 2D7JA 2EFEB 1K92A 3K30A 3PGKA 1GSAA 3O82A 2AFIA 4RX1A 5BN4B 3UJ3X 3TR0A 4FZ3A 4JYMA 2EJWA 2Q3LA 3AR3A 3EXG2 3OZSA 4HDNB 3PUYA 4MVJG 5C8DA 1V5GA 1L4KA 3K8ZA 1TYAE 1JKJA 3L02A 4IH1A 1TLLA 3ILHA 1DV1A 4QWWA 1SXPA 3ENVA 4N5HX 3ZDDA 1LK5A 3HU3A 1VJ1A 3CONA 5FQNA 3GLHA 3DE1X 3KKQA 1BX1A 4HWKA 4OP1A 4OOEA 2Z1DA 2WA1A 5FWAA 4P0TA 5EQJB 1EB8A 5LC1A 4F7WA 4OV6B 1DXHA 2EKBA 4BMVA 2R84A 2Q8NA 3RC8A 3FHLA 5K01A 1M8PA 3JD1A 2ZB3A 3OZFA 4X20B 5KQRA 1U0NA 1O96B 4RY8A 4EK9A 3KUXA 2ILVA 4MQFA 3DMTA 4WASA 5KYXA 3KO8A 2I7TA 2ZUVA 3QPCA 4S1TA 4Y6RA 1NMYA 3IAXA 4IUBS 4KKVA 4Y2QA 2N3ZA 4UFOA 5A7FA 2E5LB 4KLRA 4QPDA 3WIOA 5JPDA 2PZLA 2Z2KA 2BRUA 1QIIA 1RI3A 2PSSA 3IP3A 1J70A 3TTUA 4DCOA 4E5VA 2DKFA 2H7XA 4B75A 2Y76A 4AG5A 2JK0A 1Q20A 1YZLA 4PX5A 4D0SA 2CJYA 2WSIA 4YROA 4CU5A 3RSLA 1N8KA 1Y4ZA 4FT4A 3U7EB 4MP3A 5CB4A 2X9LA 5CB4F 5K99A 3OOYA 1CF4A 1U9IA 3BGOS 1KO8A 4ARCA 3EFBA 1CJMA 5D1NA 2Z8YA 4DCUA 9ABPA 1U2SA 2HV8A 4OGKA 4GZ3A 4RSHA 3SZMA 1TCUA 2NQ8A 3T5TA 1NUAA 2CVPA 2C20A 3VYSB 1ZGHA 2AS0A 3L7IA 4TUYA 2JCGA 1RZ3A 5CX1A 3ZW8A 3BA6A 1FP6A 1ZISA 2YW2A 4D4KA 1XZBA 1G5PA 1FQOA 3RT1A 1R4MB 5LOVF 2RE8A 5LOVA 3S2UA 2I2WA 5AXBA 5I5EA 1E9DA 4JX8A 3ZD9A 1D9ZA 1YQWA 2XY4A 3K2BA 4PZLA 1YKSA 3BFPA 1HEYA 4KIFA 2OBYA 3ANTA 1AA9A 1J49A 2QN3A 1X6VA 3I34X 3I8SA 5EJAA 5I7OA 2E6UX 1N2BA 3IEIA 4FXPA 3LLUA 4KDFA 3S2ZA 5JEDA 5FWYB 5L3SA 3R5FA 4KFUA 4ZJZA 4XVQA 1FCJA 2G36A 3E8MA 5J9FA 3LBNA 3O83A 5FPPA 2CBZA 4EY7A 4DDKA 4U6QA 5AI4A 5AM0A 1HFJA 2AMYA 3O74A 1U6KA 2QLJA 3UJPA 1VL0A 1EH5A 3LWDA 1JPUA 3AXTA 1WHSA 3P2JA 3EEOA 3GG9A 4KWTA 5IW8A 4IEEA 5H9WA 2NXNA 3LQQA 1QS0A 5JXHA 1PNRA 1G3UA 4JMLA 2IUTA 3WIUA 4MCJA 5EERA 5EEHA 4BNVA 2A0XA 1SRQA 3KPVA 2RONA 1XF9A 2B98A 2N1MA 4BVKA 1RLTA 1SCDA 4HN4B 3ZVMA 4BUCA 3CUKA 5BN3A 3C1OA 1J5EB 3HJFA 3H87A 2QTRA 1I2DA 2BEJA 2Z5FA 5AJYA 3TRKA 1NOIA 3C85A 4FYKA 1KVRA 5JRZA 1B6RA 1E6MA 4OMFG 3HKEA 3WSWA 1ID8A 1Y8AA 5J5VA 1WB4A 2QW0X 4DLAA 3M4JA 1C1HA 1Z38A 2ZJOA 4FP9A 4JEHA 2C1XA 4LI0A 4MYTA 1XL1A 1E9EA 1LLCA 2GJ8A 1N2XA 4PEVA 4WEOA 4ZOQI 2XRMA 2AC2A 1SIOA 2AC7A 3IC5A 1ECPA 2A86A 1NAHA 1A9ZA 3LGXA 2ZJZA 1A2BA 3V55A 1T4BA 5JJIA 1QUFA 4BJHB 1Q16A 4PZAA 3N0WA 3A7DA 4D79A 4I3HA 2PWBA 1F8YA 2NO1A 2O8VA 4ZAYA 4RS4A 2NP6A 3C3AA 2JI6A 2R65A 4CI0B 1M2JA 2V3VA 1QG0A 5A62A 1MTOA 2Q46A 2WSLA 3PLRA 2Y8EA 4BQQA 4MB2A 2IH5A 4GPIB 2JA1A 2CT8A 4XUEA 5IBPA 4BLUA 2H4JA 3D8HA 3VKFA 2QUZA 2CDAA 4GI7A 4CMJA 1EXNA 1Z0KA 2XTNA 4ILKA 5HK9A 3EIEA 3KAKA 1XV5A 4LBVA 4OL9A 2CXUA 4FYJA 4RPIA 4WN3A 1OGYA 3P52A 3PG5A 1NP6A 4LHWA 4GOKA 3WHKA 3WGLA 3VR2D 4D8VA 4BNIA 3Q72A 3KJGA 4BNMA 3SHVA 2QRZA 2HTEA 4JJ4A 1EZ1A 4ZYWA 3FR8A 4MUIA 5ESDA 4CKZA 3KHTA 5J4VA 4TSFD 2QZSA 5ADVA 5KWEA 3D54D 3NEJA 3IMKA 3UFXA 4CQMA 4BN0A 5B2EA 1TC2A 2QM7A 4KSBA 4TLDA 1Z25A 4NONA 2G0NA 3BD8A 4QDXA 4URUR 3WL8A 2F1HA 2DPLA 4BL5A 5LR6A 5EIWA 4IVNA 3T7CA 2P75A 2GPAA 2G4LA 2KLBA 2XWJI 3F78A 3KOWA 5DX8A 1X7DA 3EDOA 3QITA 3JQPA 4ZZ3A 3RVRA 4BB0A 1DO8A 1UC9A 1YK1A 3U37A 3V2UA 1SB9A 3PQ7A 3TW8B 1AKWA 5BW5A 3G0HA 2HHJA 3ANLA 2CFCA 4D96A 2O8FA 2R66A 3HPRA 3L6EA 1S2GA 1JI0A 2P6MA 2COKA 3CX8A 4X7MA 5AJZA 1PJAA 5DWVA 5KAMA 1UDCA 3TSYA 4HVTA 4YRKA 4DCTA 4W9NA 5E9AA 4JQZA 2Q45A 4ZAFA 3FHTA 1JJAA 4ALNA 1JIKA 3A3KA 1WM1A 1TZMA 3AOEA 5ANRB 5F76A 1PKXA 1XCMA 2F6RA 4XDYA 3V4ZA 4G67A 2OG2A 4MPRA 4MAAA 2YXDA 3W77A 4B5LA 4X92A 5A4DA 5G41A 1SIBE 3QTBA 3A6GA 4FFLA 1ADGA 5AI8A 5FV4A 3U4CA 3OQ6A 2N42A 1SVKA 3HZZA 2IOHA 5FTMA 1TU3A 3MPUA 3RT7A 3A28A 5LBUA 1W4ZA 4YV0A 5IDWA 1XCPA 3PVCA 1EGHA 1A4UA 1WVIA 5AP9A 2FW8A 3QWFA 1TEHA 3ZU4A 4HSGA 3OFJA 1O94A 1TU4A 2AN4A 1R37A 1JDJA 3F5FA 3ZWQA 5M29A 4B48A 2A5FA 3BD7A 2ZUSA 2VJQA 2DBZA 2XAAA 3G5TA 4YQYA 3GO4A 1IOWA 2C5AA 3A3PA 4GXQA 4JBLA 4KB5A 3RPEA 3GDOA 4B4WA 2BKLA 3ETCA 3B5JA 2EZ4A 4I1OA 2ZWMA 3LK6A 5KMGA 3ZQJA 4RD1A 3ECAA 4LC1A 5REQB 3D3WB 1UR5A 2IODA 5DLPA 4IS2A 3LXXA 4W82A 2G9UA 4A6PA 3AY0A 2ZEJA 4CT5A 3MAGA 1APBA 3KHSA 4UHDA 4L08A 2RHMA 5A5EA 5E2AA 4BJ3A 3O3OB 5H16A 2QX4A 3ENWA 3TW4A 5AW1A 5ERYA 4N0MA 4M3NA 4GKKB 1AA6A 1M54A 1MKYA 2QQ0A 3DYBA 1E2JA 5WRFA 4NY1A 1EFPB 3T99A 2EBWA 3ASUA 3ZZTA 4J3NA 2GHIA 3BSSA 1IBKB 1FDRA 2GFQA 4FMDB 4MYUA 3WRXA 3KZXA 1AZLA 1Y82A 2OCKA 3JAWA 3WBKA 5EUCA 3D2BA 5F7JA 4A23A 1KH3A 4YAKA 3FWZA 4ZT6A 4OHVA 1W73A 4JP2A 1NVWQ 2NLOA 3OX2A 1HGXA 5TS2A 1C7RA 2WRZA 4WK0B 5B36A 4Q18A 3A6FA 5JG7A 3E7XA 4NULA 1R2QA 2DQKA 2JGKA 2Y1EA 2CWWA 2HWXA 3ZZ0A 5K3EA 1GD1O 4XXHA 3DP9A 1Z39A 1M72A 2XSZD 4G1FA 4C6TA 4PGHA 3KSDO 2CF6A 4W4TA 4TYNA 4TMZA 4MV5A 1PJRA 1LZKA 2OO3A 2VJNA 1SUBA 1TEXA 5CD1A 4ZDKA 2QS9A 1XD8A 5LLDA 4KGDA 4REMA 5D01A 2X22A 2IS4A 4TMFA 3NNDA 4QM6A 1M7HA 1UWVA 3BIWA 2NTNA 4F6RA 2WZQA 3CKLA 5EPUA 1H93A 4G5XA 4XDGA 4ZFNA 4AD8A 3EIUA 1DB3A 5JU6A 2IZ6A 1LCIA 2EVWX 5IARA 3TO5A 1L5SA 1J4AA 3WKCA 1C80A 1DCFA 1YZUA 4NG5A 3ZVLA 4A4DA 5I9LA 2EXXA 3JQ8B 3IDOA 4QBTA 3EH2A 1NG9A 4IJMA 2UYYA 1MO2A 3FZEA 3K3PA 5GZ6A 3VR4H 2WUWE 3Q7PA 3VZSA 3LGAA 4PVDA 1SKYE 2PS1A 2QMYA 4GMGA 1W76A 4E09A 5K5EA 2Z6UA 1NMZA 4XQ9A 4YA6A 3F6CA 5KWJA 1VKHA 1WXDA 3P0EA 1T2AA 1Q19A 1BD3A 1TK2A 2R44A 2BDUA 4IS3A 4XE5A 2XZLA 1Z12A 2ZRMA 3GLQA 1ZICA 4M1OA 1X39A 3NXKA 5KYVA 2I2XB 3ZU2A 4B7ZA 4KCGA 4DQKA 1P4AA 2Z9CA 3SYKA 1XTUA 3MGBA 1JEDA 1V11B 1SQ5A 1IAQA 2Q3HA 4O5AA 1A97A 3CW8X 3MWJA 4R2JA 1H4VB 2YWGA 1UMBB 2ZWPA 4MJ7A 4XIFA 4GRDA 3D6NB 3K9GA 1K63A 3SMQA 1JEQB 1ZD2P 2EEZA 4R2IA 2G67A 2ZYSA 4NJEA 2O0KA 4L2IA 2SHKA 1V6AA 2HPHA 3MUOA 2H4WA 1TOAA 3TXYA 2IYVA 2NZUG 3H2IA 2CEAA 3KETA 4YNBA 4D4IA 3MN1A 4EFKA 4FKZA 1E2DA 1ZPDA 3BMOA 1DELA 2VQDA 1KK2A 1B6GA 5K3FB 5TGDA 4Z1MD 4A15A 1XZHA 4I1RA 4GAEA 4YXWA 4BVLA 1KH2A 2GF0A 2N1BA 4NAUA 4JZKA 4R2HA 5LIRA 2VYNA 1DKLA 4CN9A 1QIJA 3WYEA 3CIFA 4KR0A 4IRMA 1H2RS 5TC4A 3NM6B 1IMJA 3R0JA 1II9A 5TPWB 2XCRB 4RJLA 3QLJA 4EBBA 4N40A 1WUHS 2NZJA 4X9XA 1PN3A 4A5SA 5LDDC 5FA5A 2X2FA 3ANNA 2XT6A 4GT1A 4EF5A 3KYIB 4RHUA 4O2BB 3VR3D 3ZBTA 1KY2A 1OU0A 3CUSA 4L6AA 1Z6ZA 2V7XA 2C2MA 3AIOA 3Q0IA 1IEVA 2IYSA 4C2UA 1LK7A 5LA6B 5GJBA 4AAYA 3A05A 3SYNA 2QX8A 4QJIA 3QPWA 4FVTA 1ULSA 4ARVA 4EX7A 1T3SA 1U1EA 4FXOA 1CQIB 2VK1A 2XCLA 5KHLB 3O4HA 2E6KA 3CLSD 5JARA 1WA5A 3ZLUA 4C7KA 1P5RA 1GPKA 4K86A 1NI4A 3QRWA 2Y6UA 4C7MA 4Z4CA 5EINA 5HS4A 3KKZA 1XMXA 3HVJA 3OE4A 2R4TA 3FFAA 4JXJA 4IHQA 4BXOB 3FCCA 2XUGA 1T4CA 3CJTA 3RR2A 2Q5OA 4F3KA 4RJTA 2YRFA 2FI1A 5KB3A 2R1VB 5K3BA 2JPDA 3PNYA 1YJBA 3VO1A 1H9CA 3KHKA 2FFHA 1UZAA 4XDZA 5AOAA 4ZDWA 2A9VA 1DKMA 5KYGA 3GPCA 3LQRA 3FVQA 1Y34E 5IEJA 1JIIA 5B1YA 2I34A 1K27A 3V34A 2BV3A 2B5VA 4E5NA 4RADA 1S8NA 3NHYA 1GTG1 1QHHA 4KPEC 1DPGA 3ROZA 4B81A 1FUIA 1UPTA 5D7BA 1U7PA 1GTVA 1SOMA 3NDIA 4NBRA 4CQLB 5FQOA 1VKJA 4MDHA 3IKMB 1E7RA 5I7RA 1JF8A 1IWOA 2GM3A 3EXFA 1PT5A 3TOXA 4ABYA 2IHJA 3GJ5A 3MTGA 4C4PA 4AMYA 3LX6A 4QU5A 2FG7C 4YH1A 3HBMA 1CY7A 4E6PA 3V4RA 2VYQA 1XK7A 3RKRA 1EFTA 4MLPA 5EA2A 3RS3A 4OHXA 4RK7A 5FTLA 1GL9B 4QPJC 1YOVB 4K0KB 5ESRA 1SELA 2QX6A 1KJYA 5C8VA 2JGFA 1JTVA 4G5SA 4P4SB 3V8RA 3SJ7A 3AP3A 3HKDA 5I7AA 3UT6A 3NTUA 3ZCUA 3PYXA 1D4FA 4HBGA 3AX6A 1D0VA 3MTEA 5LMCA 1EHCA 1RT9A 2QVZX 4EHLA 5C31A 1JSLA 3BGVA 1CJTC 1C3VA 3S5JA 1E69A 1JR3E 3RFTA 2IYNA 3KV1A 4MUKA 1HUQA 1LW7A 5J4YA 3LT5A 4Q4AA 5IC6A 2QAGB 1IN1A 3Q9UA 3W6OA 1U0JA 2GQ0A 2NWQA 4R1UA 4XVUA 2XUAA 2HA6A 1YZTA 3SF8A 2GEVA 4MYCA 5TLSA 4ZZ0A 1Y63A 3NZEA 1AKYA 2P9BA 2ZG6A 4MARA 5BNIA 2QVXX 1PR2A 1VB5A 2OAGA 3OMLA 4YRMA 5EJ4A 1AGNA 1YGPA 2F9FA 1YMUA 3O1HB 1WTCA 4X6XA 1AZSC 1Z5GA 2C57A 3EGCA 4S04A 4YQZA 2JAHA 2FPSA 2ZI6A 4NIMA 3T1OA 1U7UA 4IXMA 1P91A 1D2GA 3FOAA 4LJ7A 5DTEA 1FSPA 3QG1A 5F35A 3R0ZA 4LE0A 4BU1A 3QU4A 3IDFA 5EUMA 3RC7A 2QQGA 2I1QA 5LNK6 4H59A 4IKEA 4MRRA 2H4FA 2IDJA 2CVZA 4QU8A 5CFQA 5JNUA 1CRPA 1GDHA 1MXHA 2C84A 3QXJA 4GECA 4PS0A 3RAEC 4YMGA 5LPNA 4PC3A 2XYVA 1JVNA 1UJMA 1W9HA 4MEAA 2XR1A 3FOBA 1Y5LA 2GPBA 1NXOA 4ND1A 4Z51A 2JGDA 4BUJA 2PMFA 4E31A 2GZ1A 2GZMA 2GJ4A 2VRBA 2ZQ5A 2QPAA 2R47A 1XQ1A 2Z3ZA 2PMEA 1UKBA 1LTQA 3LY9A 2VJMB 1CJVC 2BFPA 2E21A 3ASZA 3ZWAA 5IRCD 4NWIA 3IULA 1JA1A 3DHWC 3PGVA 3MOGA 4MUJA 4RZIA 5I48A 2O8CB 2GDJA 3C98A 3PL1A 2XEXA 3X1MA 5F33A 3ZJUA 3R6LA 2IU4A 2P65A 4NH0A 4WJKB 3LKVA 2TMYA 4BZPA 2CVQA 4R1TA 4I3FA 4PZ0A 3OVMA 4UKDA 3PEEA 5KNCA 1FP4A 2YY7A 2PWPA 3VNQA 1QGOA 3HYNA 4DUPA 5J47A 2FPLA 3T3NA 1U3FA 2WMNB 4M0LA 4J1TC 4YJ2F 4DSOA 4YJ2A 3A9VA 2H11A 3GLRA 4AZ0A 1NLZA 1W88A 4D02A 5KYYB 2Y2VA 1NQ5A 2V6JA 3K0FA 2FHPA 1T9ZA 3FVTA 4EYOA 1I5OA 2O5RA 3AEZA 4R16A 4LE2A 2C2OA 2YW9A 4MWGA 4YCLA 3NI2A 1QHFA 4FDTA 3ZY6A 2C2XA 2ZBGA 4MW5A 4KR2A 2JLSA 4OU4A 2YXBA 3FCSB 4RVHA 3DMDA 3HN7A 4H35A 2JGEA 3UT5A 2O48X 1MP0A 2Q5FA 5DF1A 3FSGD 4PVCA 3O3NB 1EUQA 3R2JA 2II6A 1EVZA 2JW5A 4BN5A 3IOBA 3EXHC 1EVEA 2RH4A 1JJVA 1HMYA 1M2VA 3F6SA 5DP2A 3YASA 1IY9A 4N3AA 3EPRA 4TOIA 3A4LA 5E7QA 4CWAA 2HT6A 3DZBA 4IDOA 3SU8A 4MKFA 1KZ7B 4H4DA 4U7JA 1QBKC 3FWPA 4MS1A 4Y6QA 3TXXA 4B35A 4DA8A 1J06A 1NQVA 5DMHA 2WJZB 3QF4B 2AW3A 2VBFA 4IJKA 5AQ1A 5E3IA 4EYKA 1MW8X 1FP1D 1XHLA 3J7AC 4LS3A 5ILQA 3BMNA 3USZA 4KMRA 2QTWB 4Q3NA 4F9FA 1OA1A 4JJZA 1OXTA 2YXPX 3NHFA 5HW0A 2IDMA 2PLNA 3OFSA 1MJ5A 2VTVA 4LHXA 3NW9A 4IZHA 4CDRA 3QX3A 4Q3LA 3KQHA 4U5QA 5EKDA 3OX3A 2CSUA 4TS9A 4Y2SA 2DQSA 4ZVKA 5I7WA 1Z0SA 3WG9A 4DL9A 1RRMA 4EM6A 2HBZA 5BT9A 2DJ5A 4UE2A 1X7WA 5BSWA 2CYBA 3EFHA 4GI1A 3FTEA 4Q3EA 1RWPA 3A6KA 3K71B 1E0JA 1I0ZA 4Y1FA 4D42A 4EG3A 2OGTA 3ORHA 2ZJ3A 3GUZA 4Q39A 1WLSA 2WNIA 1PFVA 1QTNA 2Z83A 4BNYA 1FZTA 1ZHFA 1FDVA 3G2MA 4FFBB 4M86A 4EW2A 4IV8A 4NRDA 4I9GA 5AW7A 1IK4A 4U7TB 5AK6A 1BVHA 1JLLB 4MOWA 3STWA 1U2RA 3IJ5A 4RJJA 4C05A 3CLKA 4NCAA 2PZAA 3GJQA 3VYRB 1K2VN 1WXIA 2WT8A 3BWDD 1E8NA 1SCJA 1RYNA 4TS1A 3GFRA 3WSTA 3MOIA 1DLIA 3KOYA 2ZJ0A 3MWLA 3BRSA 1YCGA 4JQOA 1HOTA 1ZA2A 3QV1A 1TZBA 2NZVG 3FNQA 3E58A 2P2SA 4Q7QA 2V8BA 3B9BA 1TAUA 4XGQA 1YHYA 1I6LA 4FFVA 3VKHA 1ZJ5A 4IFIA 1KTIA 3O8LA 5CT9A 4P2BA 3IQDB 4TRRA 3TAUA 4CPDA 2P68A 1YGYA 3MAJA 3QOYA 1QIGA 1T25A 2A8YA 2AQ8A 4L4SA 4QOJA 3R7WB 3RK0A 3UY4A 4DCCA 4BECA 2I6GA 3B3QA 3WVNA 2FFRA 5C3MA 4HNRA 1QUEA 5ARCA 1DINA 1KDTA 1YNSA 4H2DA 4BO6A 3DZHA 3SHWA 4EPXA 3DEAA 2JAWA 4KPGA 4MQEA 2W37A 1DAOA 1KJ8A 3LXUX 1HKHA 1MAAA 2A5DA 4OXRA 2NYRA 3A8TA 4H6WA 2ZUBA 3HDVA 5C8YA 4Z4FA 1K06A 1KJWA 3A2KA 1IHOA 2G3YA 4MB6A 3L84A 4GR5A 4D26A 1V1MB 5NULA 4N03A 4HC4A 5DX1A 4UM8B 4A9AA 1P33A 2BYTA 1N92A 2JZCA 5BWOA 3TTSA 5MFPA 2AKYA 4MQMA 4UBKA 2WG2A 1NXPA 2XF2A 3AI2A 2VIIA 3NASA 4I6GA 1RYZA 3USES 4MUGA 4DJDC 3DHEA 1J8VA 2OK8A 4F5DA 3R5XA 1KE2A 2P41A 2CN1A 2D2VA 2PSHA 2ZI5A 2H0QA 4RPHA 5FWDA 2CXHA 4F12A 5B58T 1TUBA 1RP7A 1E2KA 1OXKB 1T1SA 2BP7B 2EGHA 2I0FA 1SQFA 4TTJA 1CUYA 4I08A 2I2BA 4KX3A 1IY8A 3ZGNA 3H97A 5C8XA 3NBFA 5KYTA 3L8MA 2WINI 5A4IS 5BNZA 1QCCA 1Q50A 1LRLA 2R2AA 4MPJA 4UREA 3UMVA 1DQPA 4NBVA 1MO6A 3K31A 1CUXA 5I45A 5CLGA 1F2VA 1O9HA 3CF0A 1Z7WA 4Q3CA 3N0XA 1P6UA 3KYCA 5CVUA 4BNGA 4QT4A 3O73A 2OHVA 4GGOA 2F55A 4NOLA 5CH5A 3LE8A 3MMNA 4WBNB 2AL7A 1ZK3A 3GH1A 3S2IA 5L3QA 5CMLA 5CFOA 1EFKA 3ZDCA 1X15A 3BCHA 2Z5VA 5DO9A 1Y3CE 3LVBA 2OECA 1GNTA 3IPLA 4W5WA 4F91B 2XMBA 4ESOA 3JALB 1BXRB 2LRHA 4TV9B 1P3Y1 2BR3A 3GZNA 1J0AA 3L1VA 5H83A 1BXGA 5KQPA 2XMPA 5ECYA 1GKYA 1I4DD 4P8RA 4CT4B 3DV9A 2IX3A 3RRBA 1L8AA 5D5PA 4PANA 4OBXA 1O9BA 1XAHA 3AKCA 1A72A 1OTHA 3A9UA 1QU3A 1TA0A 1QFSA 3PLNA 1JFSA 5C9ZA 4YP1A 5E9WA 4D5EA 2FUG1 3HDTA 3OZBA 5HF6A 2W8ZA 3M5WA 4KR9A 3NTVA 1EJBA 5JNSA 5LFAA 1TJ5A 1XMJA 3H2HA 3RHTA 1Z6XA 2OHFA 3RCBA 4DA0A 3FNBA 3G5MA 1G4UR 3C3KA 4JJGA 5CT6A 4KGZA 1U2PA 1NR5A 4G81A 5ILOA 2D2EA 3L7NA 4IGKA 4H1HA 4LVCA 3DLIA 1YA8A 4YGYA 2IU6A 4D43A 4C3VA 2OBNA 3DCNA 1NBHA 2ZYIA 3WGIA 1LF0A 2C7BA 5F77A 2A0FA 3C41J 4L1KA 3N75A 5DV9A 4OUKX 4TT3A 4UPEA 4PSKA 4V03A 4HVLA 3BC1A 3IE2A 3LP8A 3PCTA 4MIYA 1JV2B 3INTA 3KWFA 1T9KA 5TEVA 3E82A 5JLAA 1YIDA 3RODA 2ATCA 2AFHE 3FLMA 3HI4A 4OJYA 3B85A 1EX9A 1VGQA 3O7WA 4KQ2A 4TTQA 3TQRA 5IPFA 1KQGA 1N6OA 1TXGA 3MA0A 5E6SB 2X13A 1GUAA 2QN1A 2AYXA 4FJ2A 2V7UA 4G0ZA 1SBQA 2H07A 1YS9A 1KZ1A 2VSFA 4FYXA 4ARZB 2B34A 3HGQA 1QJ4A 3SQLA 3O1LA 4DCNA 2WD7A 4JLVA 4Z8YA 2JCBA 1E2FA 4TM7A 1TF5A 2PLWA 5D6NA 3ZNQA 5JQWA 3WIVA 1A04A 1JHOA 1EFUA 2XGJA 3PGJA 1OCEA 1I3CA 3QYAA 1WU8A 3EXAA 1IY0A 1JAHA 1UMCB 4GIBA 4V24A 2O2SA 5CNJA 5ALFA 4TKVA 3U4MA 1H6DA 4L5CA 4J2HA 1HDIA 2GO7A 2QR2A 3KPWA 4B0PA 4GEKA 3PC6A 5JYEA 3RVOA 2GN6A 4EARA 3QBTA 2YCBA 3SLRA 1JHXA 3ONNA 4NMLA 4QRIA 1LA2A 1UDWA 1QK4A 3ZGXA 1VPTA 1R0XA 1K3TA 1RRGA 4RVUA 3C1AA 1E4EA 2PX2A 1XU9A 4RA9B 5EVCA 5LYYA 3BZBA 5EMKA 2WZBA 3BXXA 2VTBB 1RYMA 2C8KA 5EZYB 5ECWA 3D31A 8ATCA 2ZRIA 2H5EA 1PJQA 2O4CA 2ZQYA 4R7TA 5CLHA 3CNNA 1IDN1 3W5VA 1AHPA 2XWPA 5LD2C 3S40A 5JDIA 3SDSA 4ANFA 3OUTA 3IP7A 1HURA 3GGDA 1RQLA 2GGSA 2SKEA 3IKTA 3K0CA 4TKZA 3V8BA 5D85A 1GGEA 2OD2A 3BMQB 2V6BA 9GPBA 2HRZA 2Q9BA 1CY8A 3SOPA 4CETA 2WV9A 4Z9FA 3BF8A 3ZE8A 4KV9A 5EWLB 3ZHVA 1UL1X 2NMVA 3O9ZA 1DRUA 3IT2A 1ZOLA 5IFLA 1KAOA 1OWOA 1UBMS 4R3WA 3L9WA 3EHEA 1NBWB 5C4IA 1GLVA 1NVVR 2DQZA 2GBFA 1L4BA 2V7QD 4QQRA 3N2YA 1SZPA 4MGZR 1RWNA 5HDBB 3SJUA 3RUCA 2WUFA 2C31A 4CL0A 1EFVA 5KYWA 4FBMA 3ORFA 1TM7E 1QYWA 1TUEA 1X7ZB 2H18A 3GJ8A 3NBQA 1I2ZA 3NDPA 3QKRA 4L0QA 4YWJA 3U26A 3WO1A 3QI7A 1H5NA 4QVIA 4F06A 2ORVA 4KN8A 1F8XA 1KVSA 4K6GA 4IMRA 3TQIA 5LQNA 4LRTB 2WHEA 3HG7A 3GNSA 1U6IA 2XKAA 4FLMA 3TLAA 3JZDA 3I37X 2WMOB 3REOA 4LQLA 2Y1WA 4WI1A 3TOCA 4W5OA 3QE0A 1SQ6A 3L0IB 4XX0A 1U3GA 2ZREA 3KSMA 5LL6P 1L1EA 4FNOA 3NHBA 1TJNA 1DUIA 2ZE5A 2H1FA 3TQCA 3U9LA 3WLFA 1XA0A 5KNDD 1N6RA 2BEUA 1E1KA 1V37A 4GPZA 4I9UA 1WHTA 1OH7A 1EKXA 4H7JA 3NORA 5JSHA 4BGIA 5T3YA 3GZ4A 4F38A 3NEAA 4H3KB 5F7OA 2EQBA 1GM5A 1DKRA 3RFFA 4UQLA 1FA9A 1X1AA 1NMEA 5B2FA 4IOMA 1GSIA 2A7XA 2BKVA 3JR3A 5AOCA 3VQTA 4BBZA 3QEJA 2ID4A 4S05A 2HUNA 3ESQA 1ZAKA 1LI5A 2ZR0A 2ZCUA 1OX4A 1L7AA 2PT9A 3NOOA 1YKGA 4CG1A 4IY1A 4RENA 2W0MA 3T15A 4GPEA 4UEQA 3EUWA 3P27A 3UJDA 4HNUA 4FX2A 3SBXA 1P5ZB 4P34A 3UTCA 4RCYA 4Z1OA 1S3SA 5A03A 4JP3A 3X3HA 1WCIA 4BKPA 3TXAA 1SQGA 1BROA 2WIKA 4EEXA 3CN9A 5GV7A 1FFHA 2OGUA 2CJXA 3CSDA 4GICA 1PSZA 4JV5B 1JIQA 1XC7A 3EG5A 3KT8A 2HLHA 4LGCA 2QRMA 2YX1A 4AMBA 4ADSG 1NBIA 5DYWA 1QFYA 1T2DA 2PXAA 1C2YA 3QUCA 4YALA 5IF3A 1E99A 4MTLA 4CIWA 1VG0B 2WMYA 2ZYAA 3W5UA 3WK5A 3S8MA 4WE3A 3ZTWA 3URMA 4DIMA 3R7DA 4F92B 3H9BA 3PC3A 2KMLA 4G5OA 4WZ6A 3IV9A 3UUGA 4GVXA 4D8TA 4REQB 4PIVA 5FBZA 4PO8A 2CDRA 3AWIA 1PR0A 2WNSA 4P84A 1DAIA 3KFXA 3LUDA 2H8GA 3MCUA 4BFTA 4WN9A 5FD8A 5CBPB 5HCNA 3WYCA 5JAOA 1PBTA 2W2LA 2BFEB 5T67A 3ZH2A 2ANCA 1L5KA 1KDOA 5EIBD 4MS4A 2NV2B 4ZVTA 5JJLA 2NO6A 3N1UA 3G85A 3H0EA 5AJXA 1SD5A 1K5GA 2NUAA 2PVPA 3DTVB 1PV1A 4RZUA 4NQRA 2YOHA 3ADCA 2OLEA 3PXEA 1J0XO 3URKA 4MVJD 5FR2A 3TNFA 3GFSA 4AF7A 5LMUB 2NUTA 3T5PA 4TL6A 4FGWA 4OY3A 3A36A 2OKGA 1KPGA 2NV0A 4WJZA 3UAOA 1I1QB 1OHHD 3HO8A 5IBQA 4BYMA 3GMTA 4OQPA 1QTIA 2VCEA 3UAXA 4KWHA 3B1JA 4Q93A 3B1YA 2QN8A 4MVJE 5F3RA 3GN2A 5B7QA 4BYGA 3GFQA 1GUFA 3ZU3A 2GETA 1WMSA 1FTGA 3RJMA 1JXAA 3N74A 2IU0A 1PNTA 2ZSAA 4C0SA 3IYLW 3KB6A 4Z53A 2ZDQA 1QMPA 4BZZA 2H57A 2Z3WA 1C1XA 3GGPA 3QW2A 4BX0A 1KK3A 2GYVA 1YTUA 4DLZA 4DMRA 2H3HA 5B1SA 1PEKE 3G8BA 2GEFA 1KP9A 2LDXA 3N87A 5BNTA 1TTHA 3TNYA 2FTKE 1WZIA 3CX3A 2PX3A 1HMPA 3H17A 5K0LA 4YT2A 3FCYA 2J3JA 3GFBA 3OFND 3COYA 2CK3A 3DVAB 3EZ9A 3LDUA 4P58A 2PKQO 3B9RA 4S1PA 5IP5A 4B80A 4D3XA 1N32B 5EMHA 1O89A 3K6JA 3HNRA 1CNEA 4LHYA 4U39A 4BFXA 2W8BA 3QLUC 5CBKA 4B44A 5JY1A 1ZM9A 1Y33E 3K9QO 3LPNA 1UANA 3HU5A 1YZHA 2OAQ1 3RO7A 3N07A 3LK7A 2JIBA 2GNOA 2FJUA 5K8VA 2I7DA 3ZLTA 1J1IA 4X1IA 1M8FA 5FPYA 2ZRPA 3TLGA 1WXQA 2ZRJA 1EFLA 4TWIA 3WMEA 4E51A 4TZKA 4A2PA 3FDZA 3FYDA 3NAGA 4M0FA 3OC6A 3TI7A 1IIBA 1REQA 3EF1A 3TF5A 2VSYA 3DAPA 1KWGA 5CHYA 1FFYA 4W5TA 2HMTA 3ZCXA 5BQPA 1QHIA 4ZJYA 4NJMB 4ZZ2A 3S6JA 3H9QA 2FSIA 2ZTUA 1M74A 2A0KA 3K92A 1BMDA 4OYRA 5IHPA 2PZKA 1W0JD 3U3DA 1NW3A 2PD3A 1XF1A 2QYOA 1IEXA 2ZSHA 5KINB 4X3PA 2QM3A 3ZJYA 4BNHA 2QMQA 1Q6ZA 4OBEA 2BFBB 1FSFA 2CNOA 4BTVA 5KTKA 1YRWA 2X6QA 1RHQA 2XUIA 1FYFA 2WILA 3T3PB 3RUIA 4DA9A 1OB2A 3K0EA 4LKRA 4YAEA 2EV9A 2R11A 2FA9A 4QSHA 3KLBA 3SQWA 1L1RA 4B3FX 3EULA 2WV7A 1KERA 3EVEA 4ZOAA 1FDTA 3AR9A 3FR7A 4WUVA 1JFTA 2VJPA 4TV8F 1GNVA 4TV8A 2WYUA 2W90A 3HB5X 3L0SA 1XEXB 4NBWA 4B3RB 3CLTD 1OSNA 2AZTA 3PHJA 1I36A 2A5JA 2HMYB 3GD7A 2DU8A 16PKA 3GV0A 4WOJA 4LRXA 5I47A 5KTPA 2PMDA 2QDKA 2I65A 3JVVA 1N2EA 5JAQA 1JQ5A 4UMFA 2AJDA 4YHBA 5IZ4A 1P9OA 4Q66C 1WPGA 1GCOA 1BRMA 2YN0A 3R76A 4LHVA 1PT8A 4EG6A 2P2ZA 3DMPA 2Q4DA 1Y3FE 3N5KA 3T9EA 4D4MA 1PQ4A 1V41E 2D3TA 3MTBA 4LOHA 4F04A 5I7VA 2YV4A 3NFYA 3JQFC 2PTGA 5CNMA 2YWCA 2P9TA 1H2ZA 3CNQS 4HWRA 5EIFA 2LCQA 2YWDA 3UG7A 2WP8J 3UK6A 1XIVA 5I9MA 2EWWA 4CF5A 1DCTA 1QQBA 2D0IA 2BFFB 3IILA 1XTIA 2FEXA 5BSKA 1I4EB 3MCAA 3ZUGA 2C77A 2OESA 3WE7A 3OOHA 4RH0A 3BIFA 3Q7SA 4Y2GA 1TKRA 1ZN8A 3QFRA 2Q1TA 1BE1A 4TYPA 1ZIXA 1ENZA 1MX5A 2AVDA 4C04A 1NUQA 1XZIA 1TMYA 2NSLA 1CUCA 1RE0A 3MT9A 3GEPA 3OKAA 3I2YX 4D2IA 2WIFA 2J33A 3OX1A 3DWFA 2B6HA 4XZ3A 4ZYYA 1IOZA 1U2DA 2HJGA 2JGRA 2O3SA 2PG3A 1T9HA 1J0CA 3GA7A 3OIFA 2ZAGA 4O4HA 4O4HF 1VHDA 1O4WA 4D0NA 4HGOA 2V5VA 4LGYA 1BU8A 4PX2A 4OUDA 3QFSA 2DCMA 3NATA 4IIJF 1N2OA 3LBIA 4U7PB 2YY5A 2XB9A 3R9WA 1ES9A 3PCRB 5EXPA 1CZUA 1ZVKA 3GP5A 3I32A 3T4PA 2ISQA 5EQFA 1IRXA 3I0NA 3V6LA 1AMOA 1GY8A 3Q7EA 2Z9BA 3LRPA 3PI7A 3Q12A 4AX8A 4Z99A 4CVNA 3A4TA 5JD6A 3QP9A 3MQFA 1D07A 4X91A 5LYJF 1F0YA 1BC5A 4JA2A 1BVRA 5LYJA 5G4KB 4DUGA 1PJ2A 3CRRA 4I1VA 4AG3A 2O59A 4RF2A 4HNHA 2A35A 4QUBA 5I9IA 1RI1A 2OHGA 1P5FA 2C2BA 3DO6A 1SXJC 2Q3JA 2V5UA 4R6XA 4RSMA 3CR7A 2R6DA 4LUCA 1XNJA 1E1CA 4I2VA 5JC8A 1VI6A 2FZLA 3AYZB 2HCFA 3TR6A 4IBOA 3X1XA 4D3DA 3GMDA 2ZYUX 4ERXA 1RZVA 5DSTA 3AIKA 2VQ3A 3OZRA 4JI6B 4P4TA 3CWZA 4YPFA 2BAGA 2QE7D 2ZIUB 2Q2QA 3W06A 4D9CA 4XYBA 5I7HA 1XTQA 1I5EA 3MTDA 4XIYA 5JZBA 5K2MA 4YPOA 4QBFA 1XZKA 1QRUA 1KMQA 1LF5A 1L4HA 2HF9A 3B52X 1Q92A 1LVUA 3WBFA 4IDDA 1OH5A 4JI0B 1CLUA 4L07A 1L1FA 2QAJA 3QJ5A 3UK2A 3SYRA 3LA6A 5ALKA 4BTLA 2IXTA 2ODQA 3ZOKA 4O4LF 1LLDA 5TVGA 5T57A 2QTAA 4HAOA 1N2ZA 3VPXA 4KLAA 3X1JA 5JJBA 2J31A 2J6HA 2ZIXA 3KZKA 4BVBA 1TEVA 1Z6QA 1FTWA 2Z04A 1FS4A 1DX6A 2MMCA 2GT1A 3D2AA 3CEHA 4C4AA 3TLZA 3ELYA 3CH6A 2IUSA 5EQDA 4ZDJA 4QEKA 4J90A 5DCWA 3MT7A 3UJAA 5AM2A 2PZ8A 4GOXA 2Y9PB 2FMUA 2YUIA 4DQ0A 1I9CA 2VJOA 3H4VA 4IVPA 4DV7B 1T1GA 4O2RA 2X40A 4ZA2A 2W98A 5GV8A 3UKDA 4YXFA 4LSWA 1J0DA 2DH6A 4JBWA 4OIMA 5DIZA 4EY4A 3JQBA 3PJDA 2WJVA 2ZTLA 1JEOA 2RAFA 3BJIC 2EIHA 5BVHB 5J4LA 4H7FA 2CFRA 2GVDC 4HT3B 2R5WA 3E22B 3FRHA 1U3CA 4MZDA 1RZRA 1N1MA 3QUQA 5HKKD 2PUBA 5HUJA 4LYJA 2C2WA 5ES3A 3SSNA 2K7FA 3CPEA 3CRQA 3RSZA 4BCBA 2XCIA 3C8MA 4MGHA 2PMKA 3RUAA 4Q7MB 3WIDA 4JEIA 1THMA 3G0IA 1N0HA 2GLUA 1OXBB 2RDMA 2BH9A 2JJ2A 3SVZA 1LTHR 2MSKA 4M53A 5LKAA 5K7SA 3ZX4A 2NU8A 4B47A 3B3AA 1YR6A 3OA2A 3DLPX 3AILA 5A7GA 1CEEA 3H6HA 3PKIA 4YRIA 4E15A 1E2MA 3LG2A 3FG9A 4G01B 2DHCA 3QKTA 3KSUA 4RTMA 1C5KA 1BNCA 3S99A 2NTEA 1ZU4A 1CQWA 2J6CA 5JS8A 4UASA 1ZQ1A 3NTQA 5FBLB 4WERA 5I01A 2C4MA 2A1UA 2FWAA 4XOIA 3H11A 4I50F 4B6JA 5FO0A 1PR6A 2CXQA 4CR7A 4R9RA 2ZJ4A 3O8RA 3Q3JB 2NPIA 3QELA 1JLRA 4DV4B 3WIEA 1B7GO 1XLTA 1ILEA 3C7CB 4GGPA 4QX6A 3C6ZA 4JC4A 2GB4A 1E1YA 2REOA 1Z8FA 2ONJA 1PJZA 2WDPA 2G70A 2GERA 4INPA 4RD0A 1JDSA 1G8PA 1OYYA 4TTIA 3VTAA 2E82A 4AWBA 1G16A 1A1SA 4YFVA 1VOTA 2YS7A 4K9DA 3NKVA 1VCOA 2Q4BA 1WUIS 3EB9A 3KFVA 3NIWA 3W2TA 3WFJA 1CJKC 2YZNA 4XFKA 1P1CA 5HGJA 5JYCA 1PL6A 2H92A 1N78A 4U00A 4G2NA 3RV3A 2PA0A 2OV8A 1GV0A 1MGOA 1MABB 1GPJA 2K2WA 2WJHA 2VWHA 2YIMA 1WW2A 4ZO8A 3TFOA 5FT9A 1T0JB 3BBPA 5F3DA 5TF4A 3PQ4A 1FX1A 1PG2A 2QW1A