1TMYA

Chey from thermotoga maritima (apo-i)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
118
structure length
118
Chain Sequence
b'GKRVLIVDDAAFMRMMLKDIITKAGYEVAGEATNGREAVEKYKELKPDIVTMDITMPEMNGIDAIKEIMKIDPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVKPFQPSRVVEALNKVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHEY PROTEIN
publication title Crystal structures of CheY from Thermotoga maritima do not support conventional explanations for the structural basis of enhanced thermostability.
pubmed rcsb
source organism Thermotoga maritima
molecule tags Chemotaxis
total genus 42
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 1997-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tmyA00
2TMYA 4WXEA 3JPYA 4WUTA 3RVJA 3T38A 5I4CA 1W9HA 4LE0A 5KQLA 1ABFA 3GRCA 3GYBA 2JK1A 3OLXA 5FWXA 3RVLA 1FFWA 5TQ0B 1EFAA 1JL3A 3OMWA 5DCLA 3IPCA 4Q6BA 2P4UA 3QELA 5CNJA 2JBAB 4S05A 3OLVA 4OATA 4YRZA 5JNUA 2MYNA 2M98A 2HQRA 2E4VA 2WB4A 3I42A 1DBWA 3C6QA 1NXTA 3MF4A 3O21A 3MQ4A 4QICA 3TB6A 3QLUA 1DP4A 1A0OA 4E7OA 3ROTA 5CHYA 3CZ5A 1GLGA 2YHBA 3RVRA 3F7NA 3RVMA 3OLYA 2PE5A 2NUBA 3H5IA 3O1HB 4WT7A 8ABPA 3QEKA 2IPLA 4MGEA 1SXGA 3Q15C 4ZMSA 4G0PA 2OQRA 4JASB 3FMVA 3N8IA 3TO5A 4F8JA 2PUEA 1A04A 4Q6WA 1P6QA 1TM2A 5DGCA 3I09A 1PNRA 4G0QA 2ZAYA 3KHTA 4MQEB 2FQWA 3RVSA 3QX8A 2KYRA 4JAVC 3O74A 3DLBA 3RQIA 4EUKA 1QP4A 1ISRA 2FN9A 3HV2A 2RDMA 3RVPA 4F3TA 2XDYA 6CHYA 4MAAA 4F12A 3C3KA 4ETIA 1NXSA 2QVCA 1RZRD 5B3JA 2IYNA 3M9XA 1ZN2A 5EWMB 1SRRA 2H3HA 1BA2A 5GOTA 5JNVA 2CWDA 5HQJA 3H75A 2GKGA 2JVJA 4L85A 1ZH2A 2BGGA 2PUFA 1QP0A 4MRMA 3H5OA 2RJNA 4OTZA 1NXVA 2MSWA 2A9OA 1LBIA 4IMIB 1FSPA 1KGSA 1M5UA 2NZVG 5BR1A 3Q41A 1MB3A 4HNRA 4IGAA 2R4QA 3QLTA 2JVKA 2R25B 2YHAA 4RDCA 3GBVA 5TE9A 3UUGA 3EGCA 4OBBA 3C3MA 1ZGGA 2VUIB 3H1GA 3OM0A 4MPTA 2WRZA 1CEYA 3KSMA 3CLKA 4KK3A 1NATA 3LKBA 3A0RB 3I45A 3DGEC 3CRNA 2FXIA 4NICA 1E6KA 1OXBB 1VPWA 4MS4A 4XLTA 1DCKA 1DBPA 1QO0A 4WXMA 2X7XA 5FWXB 3EULA 2B4AA 1XWWA 4D6XA 2AYXA 2J48A 1USKA 2RJOA 2MSLA 3HM9A 3KKEA 4UHJA 4EGSA 1TMYA 1P2FA 1YMUA 2NT3A 1DRKA 2ZWMA 1QPZA 4RXUA 5T3YA 3ROFA 1UDRA 3T6KA 2I6FA 1DC8A 2LBPA 5CNMA 4XARA 3VNAA 4ZYLA 1ZITA 2QXYA 3OLWA 3BRSA 4MR7A 1ZAYA 5PNTA 4EYKA 4F11A 1LBHA 2HSGA 5IUKC 4S04A 4W5RA 2GBPA 2GWRA 4D74A 3FFXA 3ILHA 4Y9TA 3LOPA 3O1IC 4G86A 3HO1A 3BREA 1YVUA 4Z4CA 2FMHA 2PL1A 3NNSA 2QZJA 3NBMA 1IIBA 3CHYA 1Y1LA 1GUBA 1Z13A 2O20A 4IRXA 1Z12A 4QYMA 2A9PA 2H0AA 4W5QA 1JX6A 3HJFA 3H5TA 1JDPA 1Z2EA 3S99A 3GL9A 2M1ZA 1A2OA 2FEWB 1MB0A 4KK4A 1D1QA 1YIOA 3OQOA 3DBIA 4UHKA 2WMYA 4IILA 5KQGA 2QW1A 1HEYA 4RK4A 4TN5A 4HNSA 1XHFA 2PJUA 4KFCA 1APBA 1DCFA 2JVIA 5FBHA 4G0YA 4ETMA 4RWEA 4MR8A 4FB4A 3HXMA 4N41A 1JFTA 2QVGA 4MR9A 3TX6A 3NNNA 3C3WA 3MMNA 4LDAA 1PEAA 3BRQA 1USIA 1F4VA 1Z2DA 4RK7A 2FSPA 1DC7A 4MRMB 3O2QB 1VLZA 4QYWA 2B1JA 3BILA 3LKVA 4ML3A 5TPZA 2FLKA 2HPHA 4RY8A 3NHMA 4N76A 4RU1A 3OM1A 1D5WA 2FLWA 4G0XA 4G0OA 4MS3A 3MIZA 1ZGZA 1NTRA 2NZUG 1C0EA 4MS1B 1ZESA 5HSGA 3H1FA 4O5AA 3G1WA 3URMA 1F51E 1KRWA 4H3KB 3SQNA 4ZMRA 3RVQA 3CNBA 2VUHB 3LUGA 2PLNA 1FFGA 4MLCA 4YS6A 2CHEA 5TQ2B 4MS4B 4ZPJA 4O1IA 4TLLB 1TJYA 3QX9A 4M88A 1NXWA 1MIHA 1U8TA 1CHNA 5TPWB 4PYRA 1J56A 3TMYA 3GT7A 4ETNA 1JLKA 1KRXA 1RPJA 4KQCA 3E3MA 3RVKA 3QLUC 1PNTA 4Z99A 5IC5A 5IUNC 1URPA 4ZJPA 2E4WA 3JS5A 1GUDA 3F73A 1E6LA 1K68A 2E4UA 3IP5A 3OO0A 4MR7B 3RH0A 2IOYA 1QKKA 2QU7A 1JWLA 4YR7A 3H5LA 4XFKA 1E6MA 4YO7A 4IF4A 1Z16A 1EAYA 3HDVA 5D2CA 9ABPA 5FWYA 3M9WA 1JBEA 4GNRA 2FMIA 3HSYA 1SXIA 4P98A 3ILYA 1U2QA 2MYTA 5IBQA 1L5ZA 1JYEA 1D4ZA 3KS9A 2W42A 5IEJA 4RK5A 4Z9AA 3HK2A 5JNTA 2VK2A 1RNLA 1XHEA 4RK0A 2L19A 3KG2A 2RGYA 4RKRA 2JB9A 3H5WA 2FMKA 1ZDMA 1S8NA 4RK1A 2NT4A 1AB6A 5GQSA 2A9QA 3OQMA 1D2AA 3W9SA 1LJUA 3GBPA 4TMYA 2IDMA 2PMCA 5DLEA 4MR8B 4PZ0A 3T8YA 3SM9A 4G0MA 3DZDA 2FW0A 3I5AA 3LUHA 3Q7TA 3NHZA 4L4UA 3SG0A 4Q7EA 2E4XA 3QK7A 4KPYA 1PUXA 4OLBA 1SD5A 1DBQA 3QEMA 4IMJB 4RXMA 3O2SB 3QELB 4G0ZA 3M6MD 1P6UA 2FTKE 3IP9A 4Z4FA 5CNIA 2FMFA 2F8SA 1U04A 2IPMA 3TD9A 1BDJA 4FE4A 4MQEA 3MYYA 4QPJC 3GV0A 3EQ2A 1VRVA 3MA0A 1ZY2A 3OMXA 3EODA 2JRLA 3E61A 3O2JA 3Q9SA 4NV3A 4KZKA 5DKFA 3JVDA 3T95A 4EYGA 3LUAA 3N75A 4EY3A 3A3KA 1AB5A 2N9UA 2E4YA 4TLMB 2PUAA 3UKJA 1JYFA 3O75A 1QQBA 5ABPA 3LMKA 2WJWA 4RS3A 1BAPA 2E4ZA 4F06A 1YK1A 1FQWA 1YK0A 3KYJB 5EWMA 4YGXB 1Z25A 5EWJA 1I3CA 3P9YA 4Z4HA 1GCGA 5C5EA 4KREA 4RXTA 1EWKA 4LRQA 4YCSA 1Z17A 2A9RA 3RVOA 4RV5A 1QP7A 2AYZA 3CZCA 3H6HA 1RZRA 4EVRA 1SXHA 1Z18A 3N53A 4W5TA 1P8AA 1JF8A 5TQJA 3EQZA 3EDCA 1DCMA 5BRJA 4EYQA 4HNQA 3IP7A 4HYEA 3CS3A 1R8JA 3DGFC 4H3HB 3KYIB 4JP1A 4JB0A 4Z9BA 5F64A 3R0JA 4LDZA 3KJXA 5IX8A 4MQFA 2F8TA 2PUGA 4XXHA 5EWLA 1C4WA 2WWVD 3FFTA 5FWYB 4Z4IA 3QLVC 4MLDA 2MSKA 3H6GA 4KV7A 2FVYA 2DRIA 3N0XA 1EWTA 1JHZA 2IKSA 3N0WA 4JB2A 3D8UA 5E3JA 4XAQA 4FE7A 4LZLA 4RZSA 2MYUA 1H9CA 5HKOA 4OLAA 1WETA 1QO0D 3SY8A 1JFVA 4JA2A 4Z4GA 3RVNA 3HUTA 2WY2D 2JCGA 1E2BA 1T34A 3CKMA 1JDNA 3HZHA 4N47A 1RXEA 1BDIA 4B09A 1YTUA 1CYEA 3FGZA 1NXXA 4P1ZA 1NY5A 5T7BA 2LUOA 3HEBA 1Z15A 3VNBA 4MYRA 4H60A 3A10A 3EJWA 2ID7A 5KC9A 4RSMA 2PKXA 4YLEA 2L2QA 3LFTA 1B00A 3Q7RA 2IPAB 2WJAA 3HUUA 4GPAA 3K9CA 4RK6A 3H1EA 1YS6A 3L49A 1RXIA 3CG0A 3QEMB 4PE5B 1KMIY 1JH9A 1FFSA 5C5CA 4NCAA 1MVOA 4YWHA 1L5YA 2L17A 1QNLA 2LPMA 4N03A 4E7PA 1USGA 2PUDA 5FBKA 4Z0NA 5KQPA 4LX8A 4DADA 2PUCA 4KRFA 1DRJA 5KWSA 4KMRA 4NQRA 2HQBA 3HS3A 3LTEA 1TVMA 3LUCA 3CTPA 4O1HA 4EYOA 4YP9A 1LJLA 4WZZA 5CNKA 3CU5A 3K4HA 3UK0A 2Q5CA 5HM6A 2QSJA 5JNWA 1BVHA 2CHFA 4N0PA 2LIVA 2QV0A 3FFWA 4RY0A 1U0SY 3MM4A 3N0RA 5EWJB 3JPWA 4G97A 5B3JC 3O1JC 4KQ9A 3FDFA 3EAFA 1D1PA 1ZHHA 3KLNA 5TQ0A 1M2FA 2QR3A 3C97A 3HCWA 3CG4A 3OLZA 4LE1A 5IUJC 1K66A 1M2EA 2JBAA 4RY9A 1QMPA 2CD7A 3Q7SA 1M5TA 3A0UA 1ABEA 1QQAA 1ZVVA 5KI6A 5TPZD 3OO1A 4LE2A 1JFSA 4MR9B 5JS1A 1EHCA 1MAVA 3CFYA 1PEYA 4PICA 2FKAA 5IEBA 2V0NA 3LUJA 1YMVA 4MS1A 1YS7A 1GCAA 2MYPA 4DQDA 4W5OA 4MQFB 5DTEA 3F6PA 3SNKA 6ABPA 4WWHA 5EWLB 3JY6A 3GA5A 2R48A 4KNYA 1DG9A 1NXPA 2P9HA 2PUBA 1W25A 3H5VA 2FEKA 1LK0A 2GI4A 4MS3B 5TQ2A 4Z4EA 5JNSA 2FQYA 2LP4Y 1ISSA 3G85A 1DZ3A 5KQMA 5TPWA 3JVIA 3HDGA 5KC8A 2IPNA 2FQXA 3L6UA 3IP6A 1VKRA 2L18A 2VYCA 3GWGA 1ZH4A 1OXKB 3LUDA 4PEVA 2ID9A 2HQOA 1DJMA 2HJ9A 4YV7A 5IULC 2FN8A 4W5NA 3HVRA 2PL9A 4RKQA 4EVSA 3F6CA 3KTOA 3KLOA 3D02A 4KVFA 4D6YA 2GX6A 2PAFA 5ED4A 4EVQA 5BQ3A 1U2PA 4DN6A 1NXOA 3N6VA 3IPAA 4CBVA 1Z26A 2OENG 3BBLA 1PHRA 3IDOA 1TLFA 1BDHA 3DLHA 4XASA 3SAJA 3KCNA 3NNDA 4OG2A 5JS2A 5JNRA 2FEPA 3B2NA 3OQNA 4NCBA 4N0QA 7ABPA 5BRAA 3LUFA 3JTEA 3LUKA 3QLVA 4JOQA 2R47A 1EWVA
chains in the Genus database with same CATH superfamily
1XCJA 2JDID 3P2OA 2XRYA 5LCXA 3DC2A 3T38A 5LA6F 1IWOA 3B7WA 4M0CA 4HNGA 4XGNA 5KQLA 5EZ5A 3R7AA 3VR6H 1SUEA 3U6KA 1RM0A 1JWBB 3A1SA 5K2OA 1BJTA 4L8FA 5ES4B 2QTRA 4U00A 2D8MA 2GRUA 4DG8A 1SCDA 1RWMA 1GL6A 1YZVA 3HO6A 4MLPA 1XJCA 5LM3A 2C7GA 1YVRA 1QZ3A 2IXGA 2XYHA 4IZ6A 4U02A 4AJPA 3EK2A 3NTRA 1JL3A 2FJ0A 3UAOA 5DCLA 3UK6A 3BMQB 4C08A 2CYBA 4R3WA 2Q3CA 1U5BB 2NMVA 4L6CA 3G2LA 4FIZA 5JLAA 3AILA 1Q7CA 2CMFA 3NI2A 1W44A 4QBFA 2Q3MA 2M98A 2CJXA 1KJIA 2IGBA 4UEOA 4Y9TA 2Q8QA 4B3FX 2XUPA 3ZLTA 1CQJA 4ARVA 5FOSA 1TFRA 3RKSA 1N77A 1YB4A 1L7EA 4GI5A 3RAPR 4D9KA 2NUBA 2WHPA 1D8TA 1EVZA 2IY9A 2OORA 3FB4A 3KXPA 3LX6A 1AK2A 1QVVA 3D8RA 3AEKA 1DJPA 3BZBA 1T1IA 1TM2A 1O94A 1T35A 3V42A 5JYBA 3QI2A 4C0KA 1BYUA 2CL6X 1ZM4A 4BHTA 3AR5A 5C5IA 3RQIA 5B7NA 3F9RA 2C2GA 2Y92A 4TV9F 1N2CA 4KUGA 1NQAO 2ZYGA 4ARBA 1Y4DE 3OZRA 4X6YA 3HZRA 4TKZA 4U9IS 2ZRGA 4RHXA 4GXRA 5DMXA 1WVGA 3EMKA 4C2BA 3OTGA 1KDVA 2CDNA 4DNOA 2W2KA 1QLWA 3D31A 2OXTA 1JI0A 4ZP1A 2G67A 2OOKA 5CJ2A 3N2ZB 1W48A 4CWAA 4KQ1A 5JSQA 4LFBB 4I08A 2GH1A 2I3DA 1G5IA 1GL9B 4G0NA 3UJ9A 1RI5A 5GGYA 2Z2JA 3PUXA 3TPZA 3GRYA 4HRXA 4ARIA 3QKSA 5L3SA 2PX6A 1XL1A 3TSZA 4MRVA 2R6AA 2VHWA 3D4PA 2YUIA 2RJNA 4RVSA 1DG3A 3A9RA 3KK0A 3MXTA 4PS1A 1COWA 4KLCA 2Q4DA 2REBA 3FPKA 4KRXA 1NLYA 5JO0A 1PJ4A 1ZU5A 4AYWA 2EP7A 4CM4B 3OIYA 2QGNA 4FLMA 1L5VA 1KP3A 5B53A 1A7AA 2P4EA 4HNUA 3F4KA 2D2IA 4OBBA 1E7WA 4RGBA 2NG1A 2ZR8A 2WT8A 2VUIB 4HZIA 4TLDA 1E3LA 4ND8B 3G2HA 1UIMA 4NONA 3MJTA 5AHRA 3FKQA 3DGEC 4LX0A 2Q29A 1UEIA 1OXBB 2JH8A 1CUZA 2QRHA 2ZDHA 3OQJA 4FIDA 4HS4A 4LWZA 5KB3A 4TYWA 1Y1RA 2WDPA 3M6XA 1G8KA 3OTQA 4OQ4A 4EO4A 3JW8A 1WDWB 2VXBA 2E89A 4HPJB 4ZT4A 1BKYA 1UL1X 4S1PA 5FWXB 5IVHA 2DHQA 1ISHA 2AYXA 3I04A 4AYTA 1GIAA 2Q5FA 4DMLA 4IUBS 2VH2A 3DZ8A 5JSYA 3LBYA 3TX2A 4BUCA 2BDUA 4MHTA 1YMUA 2C3UA 3SQWA 1XLTA 1NMQA 1IVNA 3COPA 2DHRA 4G37A 1FQOA 2WZQA 4OY3A 4RV4A 5AOAA 4YO8A 2SKEA 2X0IA 2YV3A 4YJHB 1OGYA 3ZWQA 1RYHA 1QHYA 2GAIA 2NLOA 5FA6A 2AC4A 3SLRA 4EARA 4EZIA 5CPBA 4JZYA 3ZVMA 1LBHA 3K5WA 2JCVA 4OJQA 2X6TA 5AVVA 1AIPA 3TF5A 1H05A 4S04A 1I3LA 2WU0A 1KR2A 2BPOA 1JLLA 3PQDA 1FQJA 4HLUC 4NFHA 2NOAA 2HMVA 3SJBA 3C45A 2QLMA 4IZOA 1Y5NA 4TGLA 3R7DA 1FNSA 3MCAA 1PJLA 4UNRA 3U4CA 5KIAA 2ZAMA 4RGVA 4JYPA 3CHYA 2VSXA 3PHLA 3EVEA 4FM9A 1E0DA 4BFCA 2XF2A 4K46A 1OD6A 2W93A 4YDRA 4ENVA 4W5QA 2H0AA 4O33A 4D98A 1N9GB 3U3OA 4MPRA 1ISFA 3RV4A 4D6PA 3SXJA 2HGZA 4TKMA 2HJSA 3ROQA 3SDSA 1UZAA 1IJFA 1T4MA 4TMZA 3IE1A 1DX4A 1OXTA 3N2LA 1EUYA 5CD1A 1E5VA 3SX2A 3GEPA 1JG4A 3RT9A 1J33A 1BEZA 2D62A 1N6NA 5EHIA 2ORWA 2WQ6A 2BR3A 2O3TA 1AMOA 3UG7A 4MR9A 1BGVA 5FUWA 4EUEA 3RAGA 4G8CA 3QSGA 2D74A 3ORHA 4I3FA 3RJTA 1Z0AA 3ICOA 4CLXA 1F4VA 1VHQA 2JFVA 4KQ2A 1YVEI 1V45E 4BIIA 2ZTVA 1GA4A 2QAGB 3KM0A 4QNNA 4EHHA 4UVIA 3LHFA 4YUWA 4FNOA 1FS5A 1M2VB 2UDPA 3H16A 1A7UA 1E2IA 4KBGA 4O3FA 1U4SA 1OWOA 2WILA 3IILA 3T5TA 4MS3A 4R2LA 2WSLA 4RWZA 2XGMA 2A86A 3AHDA 2VP9A 5TV2A 5U4XA 4D8YA 2WM8A 4L78A 3KOYA 3CMMA 2OOSA 4XIGS 5FYDA 4JI5B 2HYDA 2YJTD 1KJ9A 3KVYA 2CUZA 3CW9A 4CV0A 4JC4A 3GNTA 3H2BA 1D2CA 3ZCXA 2PMFA 4P5EA 4E5DA 4CM5A 2BMDA 2BP7B 3T5AA 2LTAA 1A72A 1MIHA 2QN2A 4Z2AA 1AKWA 1E58A 1L5FA 3BDVA 2NWQA 1MV5A 1RHRA 2WV9A 1KQPA 3CEAA 4YPFA 3ON5A 3PDUA 4IZIA 1B42A 2IVFA 3LDHA 2LE0A 3OZCA 4AJJA 3RBVA 1K08A 1MX5A 1DOHA 1U8FO 1YCDA 3L4BC 4TZ6A 3U4QA 1UJ5A 4Y1FA 1JQBA 3RU2A 1GUDA 1U0HC 2JIOA 3LUBA 1XXLA 4EECA 5F23A 3BXPA 5GVRA 3RDPA 2F3SA 5F35A 5BQOA 1YZNA 4B6JA 3AFNA 4DVGA 3WLJA 1QKKA 3GGGA 3MWKA 2IU4A 4LJ6A 5K3AA 3CPJB 3WFZA 4JU9A 4AVYA 2J09A 5GM1A 2YMQA 3BWDD 3DZIA 4I9UA 2K5UA 4EAQA 3O8OA 4KR7A 3CE9A 4JI7B 3WYEA 1V1MB 4DV4B 3ICCA 1AKRA 5DIZA 1EDOA 1Z7WA 2J3JA 2AN4A 2XOKD 5FOXA 5AW5A 1SXIA 2C5BA 4EJMA 1YVPA 2DWCA 1AQYA 3DO8A 4FD3A 3ZTTA 3UGTA 1LPAB 2O0LA 4Z9AA 3G68A 4XKJA 1FMLA 4UXJA 2EU8A 5CH3A 5TX7A 3EY4A 5E6UB 3GCDA 3EMVA 3LT2A 4G0UA 1FRFS 1T0JB 1Z75A 2X9QA 2FMKA 3CF4G 3FYTA 3GRKA 2ZTLA 3K0CA 1IB0A 4O59O 3HBLA 4RD6A 1AB6A 4PGGA 4RDIA 4QXPA 3SP1A 4WJLA 3GCWA 2VDRB 3MWYW 4II2A 2Z30A 1J2EA 1GFSA 2WSBA 1EINA 5E1BA 3LW7A 2PV0A 2LKDA 1R27A 3JQ8B 5DWVA 5HXAA 4WLFA 4C4PA 4BB9A 1TZKA 4OXKA 1OFVA 3HLTA 4D41A 1VJ1A 5K0ZA 3TG2A 1OYWA 1D6NA 1HG0A 1P9RA 1WNTA 5T64A 2OHIA 1Z4IA 2HSWA 3DZDA 3A9WA 3I5AA 1LTKA 2ZR0A 1HDRA 5K6RA 1DCTA 4KPYA 5C1BA 4BQFA 2DC1A 1NP7A 3RTAA 2VBGA 3Q3GE 2O2EA 2PEYA 4RFSA 2IV3A 4H35A 3WGNA 4Z4FA 2G9ZA 2OVBA 1Q21A 4WLNA 1XTJA 4MIKA 4FE4A 4D4IA 1F14A 4D5EA 5C8XA 1UKCA 5IVPA 4B46A 1FJHA 2BFMA 2OPBA 4FFSA 1X15A 1PUJA 3UCFA 3GJ7A 4OOEA 3ESYA 5AM1A 2EFDB 5B37A 2X13A 4H7FA 1KAOA 4HSEA 1AUXA 4JLWA 4B5KA 3USCS 1EIWA 4DUZB 3SICE 3SVLA 5B1IA 2UYHA 2JKZA 2EJWA 4IX1A 3U0VA 1JEJA 3R6WA 4JV5B 4K2AA 4IIVA 4NU5A 1BAPA 3DAFA 4MW9A 2P1RA 3RNOA 3VR2D 2JLCA 1UMDB 2J6IA 1DUIA 1JU3A 3ZUPA 4EAAA 5KTMA 3N74A 4OIMA 5BVHB 5B12A 2BFCA 4WKCA 4ZAYA 5HK8A 3UNXA 2A9RA 2SCUA 1P2UA 1T8SA 2VG8A 2OTCA 3LVQE 1A9TA 4UBNA 1FP4A 5COQA 2UYCA 1NUHA 3RHSA 4HXGA 1IN8A 3LSYA 3OEEA 1P8AA 1RFGE 2Q2QA 3DZFA 3IXMA 1KSFX 4D3ZA 1RC8A 3V33A 3OECA 2VATA 3EDCA 1DCMA 2HWUA 1VHLA 1YR1A 3E8MA 3B5IA 4W6QA 5HCNA 1JJFA 2D1RA 3GX1A 3WL5A 4B2PA 4BQPA 4N3AA 4FHDA 2W2QA 3AR8A 4LNUA 4DLZA 3CRRA 4X63A 2IHJA 4BAGA 2ATVA 4KE7A 3H18A 4XVHA 3HR8A 2A2ZA 1VP9A 1NHGA 4PQGA 1KEUA 4C6HA 5PGMA 4P7GA 5F52A 5EWLA 3TMAA 2CDCA 4REMA 1I1NA 3VDRA 4XRRA 1HGXA 4DDUA 3U62A 7MHTA 2YV4A 3ENNA 2W11A 1GG8A 3EUWA 2BSQA 3MFQA 5KX5B 4H4DA 3N0TA 2EX0A 1ZD9A 4KWEA 4OOFA 4MO9A 2FU5C 2DFLA 4FCWA 1YA6A 4IO1A 5AKIA 1Y8AA 3AU9A 2O8CA 1C7IA 3EZ7A 1LKZA 2R5FA 3VJKA 1KO1A 1QQ5A 2Q41A 3OU7A 3UHPA 1UFOA 3PDIA 1J97A 1MJNA 3CGWA 3S8EA 1IEXA 3AY3A 3KJGA 4DKJA 2CFSA 2FMTA 1PQPA 3T7KA 3HY6A 3VI4B 1X38A 3PQ6A 4HTAA 2IV2X 1NWCA 3R9KA 2YNMA 2IL1A 1E18A 1E1NA 2J0EA 2WJ4A 3GGPA 4XWGA 5AKKA 3FHJA 4H60A 4XB2A 5KC9A 4OQZA 2ZRIA 3I9LA 1JAHA 5HS4A 1X7WA 1D3AA 2I34A 2BEWB 3IQDB 2QP3A 5FQOA 2N1BA 5FOWA 4F4CA 4NP6A 4ZZ1A 2PG3A 1IY9A 3CG0A 3I9OA 3UK7A 3VISA 4GX5A 1FFSA 3W2GA 1X86B 2ZR7A 1BE1A 5FLKA 3C39A 4DL9A 1U9YA 1X2BA 2BBSA 2EG9A 2MMCA 4MB0A 4G0VA 4JOCA 3T41A 2ZBUA 5CBKA 3BK1A 2IS4A 1XKLA 2FP4B 3A1WA 3UB2A 2ZEJA 5IKMA 1WPGA 4HNAA 3SNHA 4KB5A 3ZZ0A 5B6JA 3NP7A 1NMSA 3DJYA 1M34A 3GVHA 4ZZ0A 2HQBA 4XDGA 5I7RA 2FPMA 1WS6A 2FE1A 4GKVA 2E48A 4UEWA 1I8TA 2P68A 4IDHA 3LYHA 1TXGA 2H9YA 1W8DA 4BRSA 3BTUA 3WGOA 2GZHA 1MO5A 1RAGA 1TZBA 1YI1A 2OP1A 4EHJA 4DLYA 1P75A 5B3LA 4BO3A 1SZJG 1V35A 2DFDA 2HYIC 3JPWA 3GN1A 3HA5A 4CG1A 4D26A 2H8KA 4XR9A 4M46A 4X3PA 4NE9A 1NQWA 1QCYA 3OZWA 1DBIA 4BUZA 2QPLA 2IBTA 1K92A 1JQEA 1E9SA 2I2DA 3HWRA 2J85A 1U5BA 4ALLA 1EXNA 2JJ2A 4L3WA 3U1BA 1A9XB 2Y76A 2GT1A 1QHSA 5AJTA 2RGCA 3K7EA 5A4IS 1QQAA 3CRMA 2GEDA 2WIDA 3VZDA 4BJ3A 5HFJA 4L8GA 1FLVA 5M34A 1R0XA 2P78A 3DW3X 4C43A 2GNAA 1R15A 2RGEA 4FFVA 2VT7A 4EVIA 1AHPA 1POXA 2Y0PA 4KODA 4QSMA 1FFEA 2PZMA 5DTEA 4FBLA 3CX4A 1Z6QA 2HSJA 2YCBA 5F51A 4YTEA 2WWYA 3WIOA 1G8AA 2ET6A 4QASA 1RM5A 4MYCA 1VZ3A 4P7JA 3CISA 4PLYA 4IIGA 3UMGA 3AM1A 3ZJUA 1HDGO 3AIKA 1VI2A 2NU7B 5I8WA 3T3NA 4U1RA 4BGDA 3HCFA 2Q27A 1RRPA 3VH4A 4MCAA 2IEYA 4MRAA 1L5OA 4KUHA 2WMDA 3X2EA 3WVNA 1QIIA 3HMQA 4E1AA 2YJZA 3KP1A 1C1XB 1G6OA 2D0DA 2DECA 2J3EA 2P3LA 4FZRA 5I9SA 5HA5A 1ZBQA 3AUJB 2IS6A 1QIKA 2EP5A 1QTNA 1YL7A 4GX0A 1O96B 3N2EA 2X0DA 1TKCA 3D3EA 3Q4GA 3KT3A 3MYRA 3I83A 4Q1CA 2AA3A 2HPVA 2EL7A 2Q49A 1M3SA 3AY0A 4MUFA 3GIWA 3D02A 4L22A 2WVJA 2VHEA 4ZTUB 3W9YA 1SRQA 4YRNA 2IHUA 1ONNA 2DULA 1GDDA 5CCDA 1JXAA 3EXAA 3K9BA 4E46A 1TVKB 4C0AC 4GKKB 4KH0A 1IJKA 5ALRA 1PHRA 3AFMA 1OC4A 1H85A 1T9ZA 3U48A 5KJCA 4QUJA 4TWAA 2WK1A 1CZLA 2RKBA 3F5FA 2DFVA 4DLSA 4JLBA 3WJ1A 4GVLA 5H0IA 5AIBA 4C2UA 2H1LA 2XBUA 5COAA 3U6BA 2I66A 2CMGA 3AGQA 1NIJA 4P4SA 1YR2A 1DJQA 3QF4B 3E23A 3R0XA 3IFSA 2FPKA 2XQGA 5ANRB 3TNYA 5KSYA 4TXHA 1SCJA 2Z57A 3OPYI 5AOBA 2WMNB 2QAJA 4X41A 1U5AA 4P3YA 2OGWA 2OSBA 4YMSA 4NDNE 4JL8A 2BKVA 3I9FA 1RCFA 2QHXA 3LWZA 3O3MB 1T2AA 4DA0A 4R81A 5J4HA 1S3SA 5F78A 4DR5B 4PX3A 2ISSD 1T4CB 3DNPA 1WWKA 3DDWA 3KSUA 2ACWA 5D6OA 5FWXA 1DSSG 1NGSA 1QS0B 4BNYA 3THOA 1SXQA 1KNQA 1QDUA 2RGXA 4FNAA 1A8IA 1OFIA 1DWUA 1ZLXA 1JLRA 1RJ9B 2W6NA 2WEKA 3AEUB 1BOOA 3GCGA 4GOOD 1MQAA 5A0FA 4MH0R 3WG9A 3MJDA 4B75A 1TQ2A 3T3OA 1GFIA 2ZSDA 3NEPX 1RJDA 5FHRA 4M86A 3VGJA 3I42A 4YJHA 1VL6A 3O3CA 3ZWXA 3ANXA 3BXXA 4DFDA 1PN3A 1KYYA 1V2HE 1ECPA 3WLQA 2E85A 2ZSJA 2ZPAA 3QG5A 3NOQA 3RVMA 3VHQA 5LQKA 2R79A 4L4ZA 1SC4A 2WTMA 5IHXA 4FHZA 1X8JA 2IPLA 3QZUA 1SXGA 2B8EA 3G6KA 3PB3A 3N8IA 3U13A 1DJNA 2I7TA 2VSFA 3U5ZB 3QX7A 1C7RA 2D1QA 4G0QA 3PUKA 4FX2A 3TDNA 3VX4A 4MQEB 1HL7A 3HA3A 3K9HA 1NM5C 2ZROA 5EGNA 3FCSB 4PLHA 4C7OB 2VJAA 5JDIA 1VKOA 3ZHOA 4GQIA 2UYQA 1CQWA 2I80A 2A30A 4MAAA 5K0JA 1CYDA 1FRQA 4KXLA 3ZI4A 4F12A 4ETIA 1JIQA 5CX1B 3UH0A 4QUEA 4J4BA 4HGPA 3TFOA 1LBQA 4M8NE 3T4EA 5EUQB 3U31A 1C8BA 2P7HA 4XEUA 4PO3X 2FPUA 2GKOA 4R3UC 3HXQA 4JLKA 2XNDD 1Z45A 2DJIA 1DTEA 2R00C 3DVAB 4M1YA 3TL3A 1WBBA 5JNVA 2JIMA 1N6KA 1JXQA 3AR4A 4G84A 4IZHA 4KNVA 4B33A 3DEIA 1Q7GA 4J0KA 5ALSA 1B73A 2O05A 4L9RA 4P58A 2IU6A 3C74A 5L9AA 1VOTA 2YUTA 4TMFA 4PU0A 1K27A 3D2BA 1UBUS 1OLOA 3G2PA 2CNLA 3IAAA 4J3JA 4XQ0A 1M2VA 4LJSA 3MD9A 4RLQA 3F7MA 1E3JA 4QNRA 4RMHA 3T9CA 2P3OA 5D5HA 4ZAZA 1O89A 4Z3DA 4F6CA 2QL5A 3PNBA 3ND5A 1M5UA 2W0SA 2NZVG 3NUZA 4JLUA 4J3NA 4MKXA 5YASA 4P34A 5K9ZA 2R4QA 4L7VA 1C9KA 2R25B 3WOHA 5DT9A 2RBGA 1LSUA 2A4MA 1NLZA 2WPDA 1A2BA 4K9KA 1GNPA 1LWNA 3QJYA 3LQYA 5KQSA 1QIMA 5JY6A 2XDQB 1F7VA 4DLBA 5K0FA 3I01M 2HK7A 3TR0A 2DH6A 1PVDA 4Q93A 3C8MA 5BMVB 4M1WA 1P1BA 4S1NA 4MVXA 3WAJA 5AW8A 1NVKA 5HX7A 3W7VA 2FX3A 1XQVA 1M6VB 2X7XA 3H2YA 4MV5A 3KSZO 4KVZA 3MS7A 1T1GA 2O1WA 2HCTA 4FHGA 3B8HA 3LOQA 4M60A 5ITZB 4YV1A 4NOKA 1JILA 4BKOA 4BLTA 3ROFA 2QP9X 3O84A 1EP9A 2RHTA 1BW9B 1TRHA 2ZJ2A 1T3TA 4BWFB 3H1PA 1NN3A 1ZIYA 1NJFA 3IMGA 4HEA6 4PLGA 4LGVA 3QFSA 1LTHR 5PNTA 1TCAA 2FW7A 3OIFA 4B3MB 1D07A 2GVDC 3PUVA 4TWRA 1ECFA 3VPBA 1L4UA 1TT5B 1VL0A 1C0PA 4B48A 2C3MA 1V1MA 3E2PA 5F7ZA 4G86A 2QY6A 2UZIR 2ZSIA 1T6YA 1NW3A 2IU3A 2HMWA 1Y1KE 2I1LA 4Y6LA 2HWWA 4NBLA 1Y1LA 4AM8A 2J0UB 1NBHA 3DBLB 4CKEB 5J1SB 4Y30A 1HQCA 1ZOPA 1K7CA 2YJNA 4HQ0A 2H1RA 5E6UA 4ZZ2A 3QXGA 4OU4A 4O8CA 3U39A 4PQRA 4ARZA 1CUFA 4NCKA 3E81A 1ZQ1A 4EITA 2ZIGA 3PQFA 4ON9A 2PJUA 3TAHA 4CTOA 2E5WA 3C8ZA 1APBA 3F97A 4DLVA 5M3BA 1FDWA 1NT4A 2PZ8A 3IEPA 2RHMA 3JQ8A 4LJ7A 2QD5A 3P2KA 3KPJA 3NBXX 4IVRA 2P7IA 1YJ8A 4ZFNA 2JKYA 4AP6A 1COZA 1NLFA 1C4XA 1DIGA 2EXXA 4ZVNA 4NYIR 2XVYA 2QRLA 4OREX 2WTXA 5HQTA 4WKOA 2X0RA 1Z2DA 4TWIA 3UK1A 4B47A 3AUSA 5I7HA 1E8MA 3I2HA 3SFTA 3N2KA 5A4DA 5HP4A 2OK8A 3VHRA 3BILA 1XU7A 3VXKA 1FTGA 2FLKA 2J8ZA 3BVPA 3ZDDA 1B26A 3DVLA 3O3NB 2ZDQA 2VWQA 3CX6A 1VDMA 2OPHA 3UCEA 1YRYE 2NZUG 3BSFA 5HFAA 2X4GA 5IKOA 5C7IO 3W5HA 1OU4A 4FFLA 3SKXA 3A4VA 5CFLA 5KOIA 1GZ5A 3QQ5A 2PT5A 4I55B 4IQFA 2NTVA 5CPFA 4BJ5A 1AHHA 4Q4HB 3OX3A 1P4GA 2H1HA 1K86A 5AT1A 2H1OA 2CHEA 4WBSA 3ZDYB 5I5EA 5IWCA 4TLLB 3NKFA 2XDWA 1JN0A 1VG0B 2MR6A 1QHNA 1UMDA 2REQA 3OICA 1LDNA 3GT7A 4HWSA 3V9PA 3ZWKA 5ICSA 3AP2A 3E9DA 4XCQA 5MDHA 2Q46A 1J90A 3N2NA 5EE9A 2PZLA 1TJ5A 2KBFA 3ZXXA 4BTVA 3PIRA 1BJRE 3FWPA 4BMCA 3M5CA 3WLPA 3FHTA 1M2KA 1NJ5A 9ATCA 1BD3A 1WXIA 3O90A 1KYWA 5IF9A 2JJ8A 5KYXA 4GT1A 2J3MA 4K0RA 1RQXA 5CT9A 4PG8A 1A8QA 2QL7A 3KVOA 1NJ2A 1QPGA 2W00A 1B8NA 1NBAA 2X8BA 1CR1A 2A33A 3UYKA 1P0FA 3JQEA 3TEJA 4RCZA 3A6EA 4AMBA 2ZVQX 2KI5A 3K30A 2XRMA 3VYTB 1TAQA 1U0GA 2O7SA 2P0AA 1UK9A 2L19A 3E27A 3KG2A 2NSJA 1LLCA 2RGYA 4BNLA 5HIKA 2UZ4A 1C9MA 2VS1A 3K0AB 1YZ3A 2QMHA 4F3CA 5JEDA 4CN9A 1ODJA 4U2GA 3DP7A 3AINA 4F2HA 4N7JA 1D2AA 1KOGA 2BD0A 3PGA1 4F1JA 1N2HA 4B3HA 4CLRB 4MGYR 2PMCA 2PXHA 3KQOA 2QTVA 1N0UA 1RYFA 2YJ5A 2EF1A 3U3JA 5HMLA 2QORA 5KHAA 3H13A 4ZK2A 2CNWD 2R68A 1FFCA 4CF3A 4O2RA 2ZATA 5C3MA 1GGEA 3QK7A 1SHUX 3C3YA 3K16A 1AKUA 3C7TA 4OB8A 1RWPA 3RC2A 3UJPA 1VCHA 1GAXA 2YWCA 4DLWA 5KJ1A 1LPSA 2FTKE 3B3FA 4QFDA 1I4DD 3GMSA 3BD7A 3ZXUB 2F1HA 3BWYA 4B7CA 1QR6A 2A5FA 3O83A 4D9IA 2FP4A 4X7RA 1IY0A 5JD3A 3JCZA 4KV9A 4D5GA 3P2YA 3H9QA 2C4NA 2C7BA 1YR9A 5C18A 2CJYA 4YI5A 5FAXA 5AI4A 1EVIA 4GR4A 4KZKA 5FLYA 2PX8A 2R1ZA 4P53A 1OI2A 1ESDA 4OFWA 4TLMB 5CXQA 4WNIA 1BOFA 4X20B 1VB3A 3EH2A 3LMKA 2Z6VA 4BN0A 5CVJA 2L82A 1WY5A 3PHHA 2ZAGA 1NAHA 4B6GA 2DBYA 3P9YA 3EOZA 4B7XA 4KO8A 3WWZA 4K5QA 3S5UA 4EG8A 1IZ0A 1N8SA 1DC5A 4PNPA 2V9ZA 2ODTX 3HYCA 2XQIA 4Q9LA 4OM8A 2Z98A 4B3TB 1I5EA 3M0EA 2VAXA 3I92A 3M6FA 1IOVA 2DPMA 3ZE6A 4ZD6A 4JI6B 5JROA 5EMNA 1IQRA 4Y2XA 3WNBA 4H3HB 4KKXB 1LC3A 1N5JA 5HQ3B 3KPUA 3KHSA 4JD5A 2HA4A 3LKDA 1UBGA 2WYHA 3IVGA 3MWJA 2DGDA 4QAQA 3WICA 4DJEC 3H87A 1HG1A 1T3SA 1JLHA 4BU1A 1VIYA 4EEXA 1U90A 1Q5PA 3ETCA 1Z7GA 3C7DB 2P2SA 1OHHD 3KQHA 1NQUA 2OY0A 1XCOA 2NU7A 1GXSB 2Q5IA 3DTVB 3LXUX 5AFSA 3T15A 1W47A 4A6PA 3EDQA 4DGQA 1QDEA 5IBPA 5J40A 3HUTA 3DL4A 4DLLA 3ITDA 4URVR 5BWOA 4N54A 1WCIA 3VM6A 1Z38A 3L9XA 1LH0A 2EGHA 3HZHA 1O96A 3L8CA 4DCJA 2OLKA 3BMNB 5GJCA 3UEOA 2AN3A 4B09A 1YKGA 4FZJA 2NO1A 1SKUA 1I5RA 4TUYB 5TMEA 3GVXA 3QVTA 4U2CA 3RO7A 3RYIB 3HYRA 3BICA 4BECA 1V0JA 2O7VA 5I48A 4I5DA 2NVBA 1HOXA 2PKXA 4YLEA 4D3XA 5BUQA 2NO5A 2L2QA 3AOEC 2IQIA 3PJRA 1CZKA 1JW9B 4HO1X 3RVDA 3M6AA 3V6LA 3GBSA 2GR9A 3FCEA 2C29D 3NORA 3C4JA 2GLXA 5ESDA 2D5IA 3AEXA 1K8QA 3WLFA 1WB5A 3CMCO 1I5OA 1MRNA 3O38A 4WNAA 3ZK8A 3FCOA 4R9RA 4BZZA 4QFCA 2VYVA 3ADPA 2QLJA 5I9BA 4TKVA 3LP5A 4QG7A 1V5GA 4JXJA 2YIVX 5GZ6A 1V8ZA 2A7XA 1YBHA 4W6ZA 3A2LA 3SR4A 3IPRA 1H2RS 4HADA 2LW7A 3NGMA 3ZE7A 3WK9A 4EELA 4KPEC 2H51A 1Z2OX 3F4LA 2OD7A 3ENZA 3LDFA 3FHLA 1QF6A 3AGPA 5F5LA 2JI7A 3N8GA 3ID6C 3P5SA 1T3ZA 3STWA 1NUTA 2Q62A 1U0SY 1BWRA 1NF2A 3E9QA 3RC9A 3F74A 1S8AA 1CVLA 3S2FA 4M55A 4D4MA 1QS0A 3DYBA 1L5RA 1FX0A 1LLDA 3EAFA 1S7GA 3KLNA 3QBEA 2X8JB 4UJ5A 2G1KA 1G3QA 3ZKWB 3AEUA 4KFUA 3L7CA 3PWZA 5HS6A 5FOVA 3N6RA 5D7NA 4JJEA 1KF0A 2AZMA 3Q7SA 2GJ9A 3HPQA 1LQUA 2BY4A 3OO1A 3QMMA 5E0OA 2FZCA 4EA9A 1RD4A 1Y9JA 1TE2A 3CRQA 4YNBA 1HNWB 2BZ1A 3ENWA 5JWOA 2BI7A 2VHJA 4CQMD 4PN3A 2VDKB 4ZXPA 1AF7A 2BGMA 3GA5A 1B23P 1V4VA 1ZXLA 2Q6TA 4R3NA 4I4TB 2PUBA 3NBKA 1ORVA 2AOUB 5HUHA 3K0EA 4HK4A 3VR0A 1GHTA 3BXGA 3LO8A 4OHPA 5EEHA 3DVQX 3JATA 2XE4A 3OZUA 1WMDA 4L74A 3T3EA 1N75A 4EG6A 2NXWA 3HEAA 1VYUA 4C7OA 4IG4A 2QRNA 7GPBA 4YJFA 5AVUA 1SUSA 1RIIA 2W6PA 1G17A 1Y3HA 1TUEA 2NO0A 3EUEA 2MJLA 2RGBA 2L18A 4XA8A 2LXNA 1ZH4A 5CX1A 2YN4A 3NHSA 3W5SA 1OXKB 1SHKA 2CEAA 5BSUA 2QUAA 3CKYA 3KSRA 4L95C 3MILA 1QGOA 1KIFA 1QUEA 2MSEB 3O2NA 5ESRA 3T5CA 3BGWA 4CF4A 3QXCA 2PL9A 4C04A 4R41A 1NVXQ 3P0EA 4KQFA 3UOWA 3GJ6A 4EEZA 4R1MA 2H8GA 1J7KA 4NCHA 2FRXA 1WCWA 2PQMA 1KAQA 4QHSA 4YUXA 1Q3KA 3G8AA 1J09A 5C51B 1A5ZA 1AS0A 5LMNB 1XPUA 1ZH8A 2CKDA 5T4BA 2PSFA 3F6SA 2DAPA 4KR3A 1YGPA 3ZVNA 3PDCA 1J0AA 2W6ID 3PWTA 1G3UA 3FD8A 3F67A 3FRIA 3BL8A 4JYAB 2IX9A 4NBUA 5HKLA 1U3TA 1R88A 1X94A 3BHJA 4KN8A 3UAYA 1PS8A 1M0EA 3COJA 5AVKA 1ZIPA 7ABPA 2RSLA 1SVUA 2PT9A 3K2QA 4MINA 4MKHA 3S28A 4CKWB 4HN4B 3BMOB 2M6SA 1YE8A 1S1CA 1LUAA 3NPMA 2Z1NA 5ISMA 2XDQA 4P5PA 2IEBA 4CFSA 3IAUA 1TYBE 3ZBUA 4IVPA 2YXDA 1E9FA 3GRCA 2X1VA 4RJ2A 2FSVC 3FWZA 3NKVA 1TA9A 1WXFA 4INJA 2ABWA 4YXFA 1N2BA 2JFGA 4MVWA 4O29A 4BO0A 5HCIA 5I7FA 5IABA 5C37A 1EFCA 3LFHA 3NBUA 5CIYA 1XP5A 2XCLA 3PXAA 3U9SA 1U4NA 5J2UB 3SXUB 4YMLA 4JSYA 2ZWPA 4ZCPA 2DHCA 4Q6BA 1UOQA 1XIVA 5AQ1A 3I0MA 3WGKA 4WKNA 3D8SA 4MPDA 1BW9A 1RC1A 2HQRA 2WB4A 1S8OA 2JASA 3R5HA 4N01A 4YCBA 2MDTA 4ZRNA 5KNBD 2J08A 2NP7A 3AI7A 1ZWLA 2UZAA 2C2BA 2XNCA 2ENUA 3GEIA 3PCRB 1J06A 1V8BA 2BI4A 3Q9UA 1H6AA 3QU4A 1I2ZA 3QE3A 3OLYA 3PGXA 1PJBA 3FPAA 3PEUA 4MA4A 1CUDA 3PYLA 3RT1A 4ZGWA 2C7OA 3V46A 1TF7A 4UJ3A 2VQ3A 2PUEA 3CVYA 2Z3VA 2C83A 1WV1A 1P6QA 2HN9A 4HVCA 4IKPA 4CCYB 1SZCA 3DBLA 3L41A 4NMXB 2HU2A 1POWA 2AUMA 2IYZA 4R98A 2X2PA 3DLBA 3BN3A 3EA0A 4WBXC 1YQDA 3UANA 2XODA 4P22A 5H5JA 4AG3A 2PH1A 3FSJX 3EFBA 1ZJWA 2WYOA 6CHYA 1T2DA 3WLIA 4RMGA 4RHYA 5E7IA 1U1CA 4GG1A 3WJAA 5TPZD 4IIJF 2XWPA 1FZQA 4D9HA 2QT9A 5JAIA 3T7IA 4HDKB 3BBPA 3RC3A 1QGED 1SRRA 2H3HA 5GOTA 4TZ0A 4PZYA 3CF0A 1SOUA 4Z7JA 4E5VA 4ENWA 5IANA 2P9QA 4BDTA 3CZ4A 3HR7A 3MRTA 4CMJA 4J43A 1Z6AA 3BEOA 3DKVA 1CIJA 1VG9B 2ZB4A 4PHTA 2BGIA 3T5DA 4BZXA 1IOLA 1HE3A 4ENSA 1X8XA 2Q5HA 3WISA 4ZEOA 3AVQA 1EP1B 3H2GA 2PR2A 4F85A 1JB9A 1E60A 4INPA 5GJBA 2DPXA 2OQ2A 3CUEF 3GVCA 2EV9A 2PAAA 4HNRA 4IGAA 2VZ0A 5FWDA 3MAGA 1HY3A 1H2AS 3Q8XB 3K2BA 3VR4H 3U26A 1USUA 1U2TA 2GJSA 1UKBA 1Y5LA 2HEGA 1XVIA 2O6LA 2QVXX 4BNUA 3KSMA 3CLKA 4NBTA 2JFFA 4R54A 1ANKA 1MW9X 3A0RB 1S3GA 2FWNA 1G2QA 1U2RA 1WXXA 4KLZA 4KXVA 2Z2KA 3AKDA 3E3LA 2GCOB 2O8NA 5KTOA 3O93A 4ACBA 5B55A 3RS4A 1L7NA 4OU5A 3RRMA 4D4JA 2JD1A 1H4VB 3FWYA 4J2HA 2B4AA 2IHNA 1L8XA 3JQAB 5THQA 5IDQA 3SJCA 1WPXA 5ESWA 2C0CA 4CTMA 1TMYA 2XDAA 4F2DA 2IUYA 4OB7A 2PV7A 1U0TA 5ILQA 1CE8A 5AKLA 2W2NA 1HDZA 1G63A 1WVIA 4XTCS 1XCLA 3E5MA 2E2WA 2GN2A 3BE8A 4HAZA 2YVLA 2YZKA 4V0MA 3FLMA 4X1IB 3KALA 2R2AA 5FIUA 3WLEA 1OF1A 4BTEA 5AM0A 4COOA 4IUDS 1ZAYA 3ZOZA 5KAMA 3ADDA 3J80A 1ZISA 3ILHA 4L02A 2G07A 1GV1A 1P31A 4FKBA 1W1WA 1C0LA 1DWOA 1WX1A 2CLKB 2CXRA 1ULTA 4Q15A 3LY7A 2PL1A 4UKDA 5LZ5A 4NESA 3CB2A 5A02A 3F6EX 3ZU3A 5L95A 2C5FA 3F7OA 5TLSA 3M4JA 6YASA 1FMFA 3IJPA 5A9SA 1JX6A 3RS2A 1IN5A 3L1JA 5EHZA 3AW9A 3R7NA 4P0TA 2RG7A 4UAVA 3K70B 1PV4A 1XMSA 1Y8QB 2ZZMA 5EP3A 2WMYA 1KY2A 2PUTA 5LQMA 2KX7A 1RE1A 1SAYA 4QECA 5TXGA 5CIWA 2JGRA 4BMXA 3B1YA 5LFAA 3IXLA 5ITWA 4HAWA 3IALA 4BMSA 1U1IA 1JFTA 2GF2A 1C3EA 3IVAA 4IXDA 4OBEA 4YJGB 5LDGA 5F9MA 2ZJOA 2OQIA 2P90A 4KXNA 2OESA 1DT3A 4L5YA 2ZRHA 4WLOA 3L8DA 3D7RA 1H22A 1OXVA 4UZFA 2WTEA 5F2EA 3M70A 1DC7A 4BLVA 5A5GA 2HKIA 3HL0A 4U7HA 1C7QA 1B6SA 1JQKA 3UC5A 3T5MA 3GJZA 3JXEA 3OM1A 4RETA 2IYUA 2G80A 2W9XA 4NFSA 4CLEA 1QIDA 3PHBE 1NTRA 1Q84A 1A98A 4WECA 1KTVA 2ZT5A 2YDYA 5JC8A 1FFXA 3WA6A 2C97A 5HSGA 4PHHA 2H85A 2PFSA 4ZMRA 3FWNA 3LUGA 3H4VA 3T06B 4QUDA 4BATA 4Z54A 2AX3A 3ZV6A 1I51A 4ZU3A 2D1TA 2GK4A 2FAXA 4X20A 4P08A 2ZJ4A 3PT5A 1E2KA 1G8PA 4O1IA 1B43A 5DCYA 3RW9A 4DMRA 4XVUA 1I4TD 2FEOA 2W98A 1OBFO 1OLSB 2C5EA 1J56A 1JJ7A 3IRVA 1Y3DE 2B25A 3GD7A 3PYMA 4UU1A 2AG5A 4LXIA 3V2UA 3DJFA 2E7ZA 2WFLB 2OZLB 3JD4A 1KRXA 2PKCA 1DARA 1MUUA 1OX4B 2B5WA 3X1YA 1VSUA 5CTJA 2OFWA 1PNTA 1WP4A 1IWBB 2FFAA 1TQ8A 2QROA 2LWIA 3C8DA 3HCDA 3UW3A 1B8PA 1M1NA 3H5RA 1QO7A 3KFVA 4D44A 3H5NA 1JEQB 2H11A 2JFPA 3UF0A 5JXWA 5HNKA 3F73A 4I1PA 3V80A 2IHYA 4JUBA 4Q9JA 3ED1A 1UKVY 2FI1A 1WBJB 3PFGA 4V02A 2H48A 3TZLA 1NVWQ 3QW4B 3W90A 2AVDA 2BGKA 2YRWA 5JAOA 1Z5VA 3B6JA 1XGKA 3QHAA 4GE3A 1JWLA 3EVTA 1A8UA 4JC8A 1QHXA 3OFND 4I4NA 4XIYA 1KFCB 1WSWA 4IH1A 5DHSA 3TTTA 3KV3O 3I5YA 1CUGA 2I2CA 1U0RA 2YICA 1QZXA 1UMBB 3BCUA 1U2QA 3QVOA 3JWEA 1K6EA 1L5ZA 3E5RA 1TK3A 1PZEA 3JZDA 4F5ZA 1SVOA 3DTVA 1GXSA 1QHIA 3FPHA 2NNWB 1IY2A 4RK5A 4AROA 2X6QA 4CKBB 2M6LA 4MEAA 1GPUA 3WXMA 4UVEA 2BLNA 2WOJA 1A4IA 4HZUA 4QU5A 2AR9A 3S2GA 2NT4A 5GQSA 5B2EA 1O9GA 1OTHA 3OJEA 1J8FA 1TNDA 3A6DA 3DQZA 1RU3A 3NC1C 1HV8A 3PXEA 1JQAA 3BMNA 4XJVA 3DD1A 2QD3A 3W8RA 2WC1A 2CGEA 2GD0A 3M5PA 3RYIA 4RVHA 4N65A 1EVQA 2FWBA 4MW0A 1U8XX 1IBMB 1Z5OA 1Y7IA 4QPNA 4UNIA 1QHGA 1OZ0A 5H59A 4C20A 1FSGA 3L4JA 3BWCA 2CB9A 5GTDA 1CZNA 3COZA 3TIVA 2B21A 5FPKA 1YQWA 3URKA 1QH0A 3A2NA 5HR5A 3M6MD 4RGYA 4UEQA 3ES9A 2FX2A 1O9HA 1RRVA 1I2BA 1F60A 1FRNA 2WQ7A 1IBLB 6LDHA 2RCYA 3IUJA 4N9QA 5DXJA 4X66B 1BDJA 3AERB 1JMVA 4UBIA 3G79A 4C30A 2RBKA 1O0CA 1ND6A 4OI4A 5DULA 1MC1A 1ORWA 5CTAA 2ZBQA 3FRJA 3G7UA 2ZCUA 1H66A 2Y1EA 3EQ2A 1JHOA 2GARA 3LQ2A 4L9WA 4QPJC 1EUDB 1JEEA 1PZFA 2APJA 1LB1B 2JRLA 1WXQA 3FBTA 4RENA 2IDJA 1SBHA 1YCFA 2RH8A 3DOEA 1HNNA 1K5GA 3QMVA 3A3KA 3H86A 2C54A 3I1JA 1G1MA 4A8TA 4AJ2A 1GQQA 1LSSA 3OFVA 4MICA 4E4TA 3I9JA 3TGLA 3EFHA 3GLRA 4TS1A 1QVZA 4RHCA 1SUAA 2HXGA 3IV6A 3ZHQA 1E0SA 1YK1A 3DSRA 3EIEA 4XM1A 1QBGA 1WB4A 2V59A 5EQFA 3UPUA 1Q2UA 4X60A 2F1JA 2HRBA 5IVIA 3L18A 4MMYB 2Y4OA 4WY5A 1NMXA 4HFNA 2PU5A 4LRQA 4ESHA 1KXZA 1EM6A 1H93A 4DT1A 3ZGZA 2X8JA 3AL3A 3ZKWA 2Y6VA 5JZSA 2YVUA 3UFBA 1FXWA 4Q5IA 5SZKB 1UDCA 5BWBA 5CM8B 1HKHA 5FO0A 1N5OX 1PQ4A 2CCKA 4JC0A 3A7EA 3P52A 1KDOA 4P84A 5A1TA 3U3RA 1I3OA 3R6GA 4AJLA 3TECE 2VUSA 3PHIA 3F6RA 1MO2A 3I1YA 1KY3A 3MIIA 3FSRA 4ZMBA 5A5EA 4FU0A 2X3UA 4HQLA 3RT7A 2XKKA 1DKRA 1C4WA 1WQ3A 5DM60 5DOZA 3PYXA 4I4TA 4JROA 3OT1B 4B2YA 3E05A 4B6EA 4QBIA 5DYIA 2YMMA 2FVYA 5TQVA 4BVHA 4YACA 1XTKA 4G1BA 4BZWA 1E2MA 4JL5A 3CIFA 3RSSA 3T7RA 4LZLA 1VIVA 2HIMA 2B9VA 2IEGA 2XZLA 4HDQB 3RV3A 3ENKA 5AYVA 3JQBA 1X1AA 4ZVPA 2XEXA 5LNK1 1Y3CE 2JHFA 3KT0A 4MVJA 3RHFA 4RKEA 3RVNA 3TQSA 4RTOA 2NZXA 1Z68A 4QX6A 1RYYA 3QYJA 1TM5E 1FA9A 1U0JA 2ZZNA 1Z5NA 4U9UA 4EX6A 1CYEA 1TEZA 2BSAA 3TRKA 4O2LA 1GRNA 2VYQA 4M8KA 4F38A 4LDPA 2O3UA 3OQBA 1Z6PA 2JA2A 2VTBA 3NRBA 3KYDB 1SBTA 4HX9A 5JCXA 4ARCA 4E2YA 1VPLA 2HUNA 1TZCA 4LWQA 5C3UA 1T5HX 1ULUA 2QE7A 1R5BA 2V7QA 4W82A 2A14A 4L2IB 4FJ2A 4ITVA 1RXIA 5CLLA 5DIFA 3SZRA 5FFMA 3ZLUA 4PGMA 3BERA 3RRYA 2XMRA 4G5HA 1U2DA 3DEYX 5EYPB 1E8DA 3D6AA 1WZUA 4HLDA 4KGDA 4ZEXA 2ISQA 3S4YA 3VO2A 3PGVA 1M6EX 5FTNA 3HKBA 3SF0A 2PGDA 4G9BA 4M37A 3BIJA 2XXAA 4NQRA 1OBOA 1OR8A 2JFHA 3JQGA 3FUWA 3FYSA 4G1UC 4YP9A 1JG3A 4Y1GA 1TGVA 3FTPA 3TKLA 5JD5A 1CUAA 1QFJA 3RB8A 1Q0QA 1KYVA 5B36A 2YJ4A 2Y1CA 4ADSG 2C2KA 2GEKA 1CCWA 1NYTA 1PR3A 3QOFA 1ZNYA 4KI7A 1W0JD 2EATA 3V8QA 3WL3A 3F8TA 1CY8A 1XD9A 2ZTHA 4N1AA 4TS3A 3RGWS 3RS5A 1PR1A 1N2CE 1R3UA 2EX4A 4NKRA 5J2UA 3CG4A 3OHPA 1XQ6A 1DKOA 1AHNA 2IT1A 4YRKA 3PI7A 4H3SA 5H68A 5HM8A 2QBYB 3LV8A 1F9AA 1V16B 3I6YA 4HGYA 4M1MA 4KYTA 5KI6A 1HLPA 1NP3A 2QD1A 2R6JA 4F5EA 1R8QA 1U3GA 1BGWA 2ZB8A 2R2GA 3DAOA 4FGWA 4MTLA 1P80A 2GM9A 4KG7A 4UBLA 3RTEA 1SOAA 2BMJA 2CZQA 4P80A 4M9SA 1Y6GA 1Q0HA 1GTL1 5GMOA 4KPFC 4FFPA 4I6JA 4UUMA 1YUMA 3P9RA 2Y77A 4CCYA 4LVUA 1DJLA 5B7QA 4M8LA 4ZOQI 2G8LA 5JADA 5A2QA 3ACCA 3CH7A 1UZNA 1JA1A 4W5HA 3VU3A 1AOXA 1SKQA 1BE0A 4W1QA 4AJ1A 4JI1B 2PDAA 2C2OA 2FQXA 3EVGA 4OQFA 2CNDA 1VKRA 3OCYA 4PFJA 3W2EA 4PEVA 3RANA 4BVFA 2UUPA 4HVTA 1DJMA 1EMDA 1R2QA 2DQYA 1JQDA 1A2QA 3NH9A 4HDKA 3BWEA 4XUCA 4F9GA 3GFQA 3I8SA 3LRTA 2XHZA 1X77A 1BG6A 5B1DA 4QXQA 4D6YA 3OFJA 4W8HA 1C7ZA 1X14A 2AOWA 2CFRA 2XUKA 4L0QA 2OV3A 1Z28A 1NXOA 2OCPA 1MG0A 1UODA 3QP9A 4UU7A 3ZXYA 5F9FA 3WMRA 1X7HA 3C3PA 5JWRA 2PKQO 2QQ5A 1RYBA 3L43A 1H9AA 4UE3S 1W5EA 4HAOA 3UATA 1KY4A 2O2IA 1YDMA 4Q4JB 1KDTA 1QFMA 3T1NA 1IATA 3VPXA 1JEAA 3R77A 4FYKA 5BRAA 3CC8A 3QLVA 1EX9A 3P9NA 4IDNA 1KI4A 2FVXA 2XNSA 5DYNA 2RAFA 3F5MA 1AV6A 4UHEA 4J7XA 4P36A 1CJMA 3JPYA 1DAEA 1BHO1 2X0JA 3I2KA 1KYXA 2WHRA 2RHDA 4L73A 4KPGA 1GADO 4M49A 1R8YA 2AKAB 2D7JA 2GCOA 3MTBA 1N7JA 2JK1A 2Y66A 5CYGA 3TZHA 3WGIA 1UOEA 1FTSA 4GYWA 4PVDA 4PFKA 3D1VA 4MRRA 2GPYA 2P2ZA 1GZHB 3JQAA 4OHOA 4C0BA 1DX9A 4UTVA 1FFWA 3HJAA 4DM3A 4CEHA 1TQ6A 2B4KA 2UUCB 5E2BA 4XH9B 3TTVA 4BZQA 1D4OA 5ENVA 4K6CA 4YAIA 1JKFA 1JV2B 3PGKA 2JBAB 4YXWA 1RXCA 2WV7A 2II6A 3B89A 1M8GA 4I3HA 1U2EA 5FA8A 4H15A 1N5MA 3MF4A 4R6XA 1QQTA 4GLFA 3ELWA 4RQUA 2BONA 4DM7A 1MF7A 4X1IA 2MCFA 5JCOC 2QG9A 4TVKA 1U6JA 3A1TA 3CZ5A 4Q02A 4IWYA 1QVWA 5JAQA 4ERXA 3EGOA 1XEWX 2JI6A 3L7DA 4POOA 3WK4A 2TMDA 3FYCA 1Q16A 3P8ZA 4RANA 2C2ZA 2A0XA 5AHKA 4ID9A 2E1RA 2HU8A 1NC3A 3NTOA 5G3ZA 1ZL0A 3I09A 3KWJA 3UOGA 1BN7A 4JI3B 4XCVA 5C80A 5KNCD 3TRIA 4ZI5A 1HYBA 1ZGCA 1QMGA 4FHEA 4NBRA 4OI1A 2CUTA 3JD1A 2WG2A 3K1TA 3TIIA 1Y8QA 2DUNA 2I87A 4PGHA 4GI3A 4IYJA 2KW5A 5IAEA 2A92A 2F9FA 3WKAA 1WDTA 2NACA 3PGMA 4OP1A 5ECWA 5FLEX 4RE6A 4HGZA 2DQ4A 5LYJB 1P39A 1WU8A 4HRAA 4PRZA 3D3QA 1F7UA 4D25A 2HF2A 5C1DA 4L16A 4C29A 4YFVA 1HDYA 4FMBB 4XEHA 5AVRA 1WD7A 2GPWA 1R00A 2HU7A 4R4JA 1IOWA 5HJ2A 3C7CB 4A73A 1SU6A 5TF4A 3VUFA 1V96A 1U9IA 1WXHA 2NVOA 4XSHA 3H9GA 1X1CA 3NWOA 5FJIA 2ZRBA 3NHLA 3SDZA 2AN1A 2MSWA 2JHCA 1KS2A 1QIEA 3B36A 2VO1A 2WD7B 1T2CA 1UK7A 4M8SA 2NYRA 3F46A 1G5FA 1KGSA 3HDQA 2VPPA 1BA3A 4ZCQA 1SKAA 1G55A 1U7UA 4Z8YA 3K0BA 4MP6A 4UPEA 1WU7A 4GVPA 2B0CA 2H7CA 3IAXA 4MP3A 1W4LA 1XRRA 1K0FA 2P9ZA 3PHCA 1OTYA 4OGFA 1L1QA 1E79D 5I51A 3PXUA 3C5HA 4M76B 4NYJQ 3DPIA 1VL5A 2WRZA 3UJ7A 4NZ9A 1A96A 4TSFA 3CRNA 1N6IA 4Q1BA 2J3QA 4QARA 5IASA 2HJHA 3HCEA 3A4IA 1ODFA 3U2QA 3QWAA 1II0A 4Q3LA 2D4AA 4NSNA 4HDCA 3UJBA 1OLSA 3T7JA 3GAFA 2BR4A 3PUHA 4MJXA 1Z07A 4P8RA 1ECGA 1H2ZA 3TE7A 2WFLA 2N75A 2OZLA 1FYEA 3KVRA 2F00A 3DW1X 5K4AA 1OX4A 2AE1A 1FVFA 2NUTB 3MS2A 4UFNA 4EGSA 3HXLA 2G71A 4LOJA 4PC6A 2WVGA 3F5DA 4W5RA 5EHNA 2XAUA 3DKPA 2ZBVA 5EJGA 1M75A 1JEQA 1Z4MA 4C5BA 3O47A 2BF4A 2H2HA 4G65A 4HWGA 4IKOA 1S9HA 4IJQA 5DK4A 4H27A 1XMQB 4RTJA 4G56A 4BQNA 2FUCA 2JI8A 3BRSA 1HX7A 4ZVRA 4YCAA 2Q99A 4BMOB 1AQNA 2NIPA 2JLVA 2W6QA 2LCFA 3TAUA 1GEGA 1XO1A 1NR5A 2PZAA 3HCNA 4CIDA 2PT7A 5SY4A 4D0NA 4Z9FA 2HMAA 4Q4LA 4V0LA 2ORVA 4H0FA 4OK3A 2BTEA 1QG6A 2ZBGA 5IXJA 1NBMD 3ZQ4A 1IIBA 2HGSA 2QPAA 4NR0A 2Z4TA 2QSUA 5GZ1A 5I01A 4CKBA 3ER9A 2A9PA 1YU6A 5EKTA 4KXWA 3CUVA 4EBBA 2J0VA 4PXSA 8ATCA 1FDSA 1CFJA 3NV9A 4JWKA 1DEOA 2VP3A 1XALA 2YZMA 3KXDA 1UQUA 1YIOA 2FSGA 3GMTA 1D0VA 4L51A 3PWSA 4TWJA 4AECA 5CT5A 2ZBPA 5DP2A 3QTLA 3UB3A 3WLTA 2CLDX 3H97A 3FZGA 3IBSA 1KOJA 1M8FA 1I7QB 2WB2A 4UHBA 4QDZA 2QTNA 4P4LA 1FPMA 3LZ6A 3MWEB 4YAEA 4JXZA 5AW6A 1KU0A 1BH6A 2YXBA 5FI3A 2OC9A 1UXHA 3EN0A 3TQCA 4G63A 3V1YA 4Q3DA 4MX8A 4IR7A 1OKKD 2WJJA 3KSDO 2GK6A 2DLNA 3JV7A 2AN5A 4RJKA 3ZW9A 4ZKDA 4HB4A 4ZO8A 4RFVA 3V55A 2GAFA 3LKVA 4URUR 5D3ZA 1SPXA 3HVUA 4E5PA 3K0SA 4BGEA 1QYIA 2IOFA 4RD3A 3WYDA 1ORRA 2W6MA 5K0CA 2KE5A 3ECAA 3L8YA 4WVFA 3GJ8A 3I39X 2ZQYA 2J33A 3TZEA 4D8WA 3WNCA 1EUDA 3P9ZA 3QM1A 2R11A 4O5AA 3DOCA 5FTWA 4A8JA 4CQJA 2O3JA 3O8NA 2WINI 3VHXB 2H9IA 1M7BA 3IIKA 1NP6A 3JZMA 3FGNA 3NEYA 4AJHA 3JRXA 2VA8A 4IH4A 2VDNB 4E14A 4WKBA 3SBOA 3GDGA 4YQEA 4JA0A 2AKEA 3K15A 1KPHA 2QENA 1PO7A 3F4BA 2I6GA 4DCCA 4MVJF 1PGQA 3LL7A 1ZGAA 1ZLYA 2DE0X 4PYRA 4I66A 1W5BA 1T6BY 2PS1A 3W2TA 1ZU4A 4DLAA 4I5GA 4KR0A 2IPOA 3KBOA 4MO2A 4JSRA 3TLMA 4NZYA 4M1ZA 4AUEA 4RVDA 1TF2A 2W43A 4ZJPA 2QN9A 2YHIB 5CT8A 2GBLC 3GEHA 5LZ4A 1ZG3A 2PU7A 4L75A 4LYJA 1JHQA 1N6RA 4WN3A 3VO9A 2FRVA 2HBZA 1JSZA 4EB8A 4ZEVA 4RTMA 2XB2A 2EOAA 5F21A 2FPLA 3RH0A 1J0DA 1D0IA 4FUQA 2C31A 2XADA 4PC1A 2ODPA 3IDQA 4XQEA 1PG0A 3M8KA 3H5LA 3H2JA 4W8GA 3K5PA 3SS8A 1H8HD 2VCYA 3FR8A 2R7LA 5CW1A 3NLLA 2HW8A 1MLDA 2YFYA 5B7PA 1T0PA 3LVFO 4DJFC 3GLHA 3HLKA 1J00A 1GU1A 5MGNA 4YRSA 2G6TA 3GZTB 3IDFA 3ILYA 3PFKA 4RHTA 3EYWA 2GN0A 3PXGA 5KNDA 3GNSA 3KS9A 2R6R1 3FAZA 5DSXA 3REQB 1CF4A 2G70A 4BVGA 1J0CA 2OFOA 2JDIA 1TKAA 1S8NA 3GEGA 3GT3A 5CDFA 2ZW9A 5C1OA 4QG3A 3Q7PA 2WOOA 2AJCA 4XOIA 5DGDA 4X62B 2NYAA 1XQYA 2D2EA 2VAPA 4B87A 4BX9A 4QELA 2VQDA 1T3GA 3D6MA 2QD2A 1PW5A 2BZSA 1Z7BA 1V5FA 3HHPA 3NTXA 2YTZA 3U4IA 3KYDA 1XDDA 3AZPA 1W0CA 1D2NA 1V2GA 4PIVA 4GOND 5DGXA 4BLWA 2TS1A 1WTCA 3T52A 4L2IA 1QGYA 2HA0A 3AT1A 4C0HA 4F8EA 2EG5A 3NOOA 1KJZA 4GMHA 4JS0A 5HKKD 2ONKA 1OLXB 1Z34A 2NXCA 4JI4B 3L6OO 3BXFA 1G9SA 2JATA 1NUQA 2OZKA 2Q3BA 3G7NA 4LVCA 4ZRDA 1M1UA 1W88A 5EYPA 4FFRA 2XNHA 3C70A 1GKLA 1VJDA 2KHZA 2R5WA 4CODB 4A91A 1EX7A 2H6EA 2P2CA 3QU2A 1U0LA 3T9EA 4E5NA 5J3JA 1Y7HA 5ALGA 4E94A 3IQEA 2P67A 2RGDA 3UZUA 4FGSA 3PA8A 2BBOA 4PHCA 1G4AE 5K8LA 1EEXB 5A5FA 2QT1A 5BSTA 1J0XO 4IHQA 2UZ1A 4C9BA 1NBIA 2OMEA 4FFWA 4MOWA 4OQLA 5DK6A 1RWNA 3S27A 1I3CA 1O08A 1GCGA 1IE3A 2X9LA 4L9SA 4O2BB 3E4CA 1Q83A 1E4OA 1ZM2A 1U9ZA 4IJMA 5J5AA 3UXYA 1NXQA 3V8VA 5FX2A 2YHSA 3OE7A 4QPCA 3T0GA 1V3TA 4W5TA 1GM5A 3LAWA 1K6MA 3CR8A 1WZ2A 5L3QB 4PLVA 3L07A 1V16A 4RHFA 5CR9A 5IMBA 2XOXA 3DUWA 4A3SA 1KZ1A 4JVSB 4UMVA 1T26A 4CPDA 1GKKA 3G9TA 1DFGA 3OTWA 3EXG2 3WLMA 4XR4A 4EUNA 3HCBA 1X7XA 2YZNA 3ONVA 4AJ4A 3I23A 3JSXA 3MLEA 3OHSX 3RHTA 2QJFA 1TK2A 1M66A 4L08A 2AJTA 4XIJA 3PJEA 5AKGA 3TM5A 4TTVA 2OBBA 2MHCA 1K8ZB 2P6PA 2WSIA 5IT9A 2QZZA 3AR7A 2DRIA 3CR3C 3BB3A 3LC2O 1JHZA 1YIDA 3M6WA 2PZKA 2W2XA 3HFRA 4P81A 4UZEA 1IQPA 1UJ6A 4MW6A 3I2FA 2V7TA 1G0NA 2XMDA 2XZTA 4RZSA 4GZLA 5IARA 4BQRA 5E9JA 1MEEA 1I4OA 3QVVA 3D4OA 3SEFA 1CS0A 4ZYZA 1UPCA 5BY2A 5KCZA 1P5ZB 4JGIA 3ZPXA 5K0EA 3FROA 2DLDA 2HM7A 3MUEA 3AR9A 5FFNA 2XA9A 3LGXA 4CIYA 3DE6X 5LQSA 5L4LA 3V97A 1NG9A 3MOSA 4RM3A 2HT1A 3VYUB 3GH1A 3ZXIA 3H8SA 1D1TA 2DOKA 4RSMA 4DRYA 2QYOA 1XYGA 2G40A 4WL0A 4ZO4A 1AUOA 1ZJYA 4ZVOA 5KJ6A 2ZUEA 1KPGA 4GLJA 3QEMB 2UZ0A 2FUNB 4RZUA 3ENQA 3OCXA 1MVOA 1XZFA 2OZPA 2VNJA 1A76A 1BFDA 1L5YA 1TA0A 4JQZA 2GCEA 1DKQA 3FR7A 4HG2A 1DOAA 5FYQA 3T9FA 4EOGA 4O4JB 2EFGA 2FUG6 3WYAA 3ABIA 1EUCB 3ZU6A 4KRFA 1QFXA 3I6QA 3VDNB 1CEEA 3BHMA 1BMFD 4AS3A 5EMMA 1FCJA 1M67A 3NEJA 4O1HA 1TEVA 2BL4A 5C7YA 1QLHA 4NDZA 2G1AA 5FBWB 2R6GA 1E62A 3FHOA 2WPNA 4CLDA 2ZJ5A 4RUKA 4MGHA 3OETA 3TR6A 3QOYA 1AKNA 5HBGA 1E6CA 1L1RA 1AHIA 3IIEA 4UHDA 4F21A 1QONA 3F49S 3A9CA 4GPBA 3W3AA 4NRDA 3ESZA 1WHTA 3OUZA 4S0XA 4E03A 1I1OA 1ZHHA 5IM4F 1PJTA 2H07A 3I9V6 4G5SA 3ER8A 4FGZA 2HDNB 3C97A 2ZULA 2CXUA 1R16A 5IUJC 2JBAA 2HFKA 4RY9A 4YECA 4DEVA 4H59A 3UGQA 1JQ3A 4RTQA 2ZE6A 3VVLA 4NJEB 4UTXA 1YV9A 5ALIA 5ELXA 3OX2A 1WLYA 4WXHA 4BB6A 1VI6A 1YWGO 3WIEA 2WG0A 1T2EA 3PNLA 3U4DA 1YMVA 1E89A 5CGQB 3JQDA 1JSLA 1OZFA 2ZJFA 4MUAA 4R1NA 1N3IA 5DT2A 1E92A 3HTXA 1XQ1A 2PKWA 3LG2A 3OZBA 1NZDA 3FPLA 3I58A 2ZYRA 5LUBA 1TYAE 1TU3A 3W2IA 1OOEA 2GI4A 1CY2A 4OSEA 3NYIA 2Q8PA 5JATA 5CDYA 1FUKA 4Z4EA 4EHIA 2BH2A 4WNCA 3UWMA 1O4WA 5E4FA 3ENVA 1DZ3A 3G8CA 5KQMA 5GJWC 3W5BA 4C6TB 4E30A 1YJCA 2GB4A 4LJAA 1BC5A 4EJ6A 4DJ5X 4IWXA 3Q9LA 3ET5A 1E96A 1NRIA 3FJOA 4MWTA 4ERNA 3TW8B 4B85A 1WZIA 1WNFA 2ID9A 3MJCA 2CY0A 4HTFB 4URHA 1E2FA 4KRGA 5E95A 5JAUA 2YIJA 1NNUA 3WLSA 1H8ED 1YOBA 2ZU6A 3K1JA 4NCJA 4EVSA 1DOZA 1U7TA 3DF7A 4PR0A 3IMCA 1XVVA 4J16A 1NR1A 4C2AA 1P3Y1 1O3YA 1YJQA 2GX6A 3CLTD 2PAFA 2WIGA 3KYBA 2BGLA 1HQKA 2VIIA 2FNAA 4PFSA 3RIXA 3HP4A 4ER7A 2XXJA 4LWPA 2XTNA 3A3YA 3TQRA 3WQBA 3UT6A 4CKCB 5K0LA 4MVCA 1N9ZA 1U3WA 3QFCA 3ASZA 1KZ6A 3ANSA 5DSTA 5E6SB 3WLLA 2F55A 3SS7X 1XDZA 2PMDA 2Q3HA 5E6SA 2ZT6A 4M1TA 1M74A 4WA8A 1EGAA 1JU9A 2AOXA 3AETB 3AQIA 4NV1A 5BVGB 5K0BA 2XUDA 1X2EA 3KDSE 1Y4UA 3KEGA 2DWOA 1L1EA 1P4JA 2O3RA 5LP6C 1VGRA 2GS9A 1D9XA 4O2AB 1P3JA 1B16A 4OAOA 1OWMA 2XOKA 4LXHA 5IF3A 1TM1E 4YJ3A 5EG5A 2VYND 1QYVA 3B5EA 2J9XB 4JWTA 4KO1S 4LYAA 2FK7A 5FORA 3N28A 1CJTC 4LE0A 3ZDXB 1LNZA 2PMEA 1E4EA 4LC0A 4RF2A 1XI2A 2G4LA 4IQ0A 4U3JB 3L6EA 3CTMA 3C6ZA 4LMAA 4TQGA 5BSWA 1YI0A 4YRCA 4URXR 1YB5A 5J9FA 2VLBA 3RWOA 3EVZA 2JH3A 1KH3A 1SFRA 1UJ4A 3OLXA 3F7TA 5JCJA 2P5TB 1DV1A 2LDXA 3CZAA 1KH1A 2IYWA 1QKIA 1TECE 5TQ0B 2NUTA 4LYEA 1YZFA 3AL2A 1H2YA 1P6XA 3G88A 5C53B 1T5SA 3EWSA 3Q0TA 1LI4A 3TDKA 4BMNA 1G21B 5JASA 4FN4A 4QBTA 5ILOA 1FUUA 2MYNA 1UBFA 2CLHB 4CR8A 3COSA 4FC7A 3NW9A 4ND3A 2C98A 1QYRA 4ZVUA 5H9VA 2C8VA 4ZIRB 5LB2A 3ROGA 2ZYTX 5JLJA 4M21A 3LF2A 2GJKA 3LKZA 5ALOA 2I6UA 3KJZA 4MGEA 4WK6A 1TZJA 2PIAA 2QLTA 2ST1A 4D57A 3O8BA 3FMVA 5DGIA 3CJTA 4Z4HA 4WK0B 3ETHA 3E5NA 1TYZA 2V54A 4G6ZA 4XSVA 4DIEA 2Q9CA 2AI1A 5CCEA 3D0OA 3QJ5A 1TC2A 3LHIA 5DCWA 3CYFA 3JAKA 3V1LA 4WD3A 4IDBA 2PBRA 2YYYA 1HR0B 1QP4A 1T9GS 4GEGA 5GM2A 3VOAA 1ISRA 4TTAA 5CFNA 2Z6UA 3RVPA 3T1QA 1EU1A 1E2UA 2NU6B 3I2GA 5DF1A 1DFIA 1Q7BA 1A9QA 1LTQA 2QIPA 2QVCA 4BQSA 3ITKA 3NBZC 3KKQA 2OAQ1 2ETXA 4PQFA 3CVOA 2WJGA 2IIBA 1NX6A 3M9XA 4IDPA 2IS2A 3EIOA 3TPFA 1TFUA 1IYZA 3EHDA 1BA2A 2JAHA 1C9JA 3C1TA 1KBQA 3ILSA 3FMPB 3F8WA 1C1DB 5IRCD 4G25A 2GKGA 4KXYA 4ZQEA 3AIMA 1SZPA 4HAXA 2G9VA 2Y05A 1CVRA 4YQZA 3ZW7A 3GUUA 1N7HA 1SEVA 4JX8A 3EY9A 4F6LA 2CKMA 3LC1O 4CDMA 4QAJA 1DUSA 4D0LB 1NXVA 1PL7A 2A9OA 1LBIA 2XSZD 5T6MA 4K3UA 1AA9A 4CUZA 4XWAA 3H7AA 1CF9A 5AUOB 3KQLA 2ZRQA 3ST7A 2NXJA 3NU1A 2C94A 3P9IA 4JYZA 1T1SA 1RMYA 2GHTA 4NBKA 2JVKA 4HRVA 1VQ1A 2I0FA 3DOIA 1SUFA 3I53A 3P2IA 3VHXA 1U98A 2IXFA 2IEAA 3ZX4A 3UJ6A 5K0TA 3QNMA 5TEVA 2W2LD 2OO5C 3IUPA 5FBZA 2A8YA 3L8FA 3TBFA 2PNFA 1FMCA 1CKEA 4F04A 2EJBA 2YVQA 3EXHC 4X7BA 5J47A 4GGPA 3Q11A 2RCNA 3GMIA 4L8LA 1KYZA 3VVBA 2OCYC 4C21A 4CMEC 1N8NA 5TR9A 3IXQA 1M2JA 1PZHA 3L1HA 3PG5A 4UULA 5A04A 2G72A 4I1VA 3M7IA 5GJVC 4DAOA 3I0ZA 5KVVA 5HF6A 4DKXA 3T1TA 4CTJA 3GARA 3ZI7A 3I04M 5A71A 1PJCA 4PBTA 1ST2A 2JJQA 3I34X 1OQAA 1Y4SA 3NUQA 3WO1A 2QGFA 1U94A 3HJGA 3VNAA 2LKCA 3ZHTA 2TMKA 3LBAA 2ZRKA 3W6OA 1PK8A 5FPPA 4ITUA 2WIKA 3PQ7A 1IM8A 1X9IA 4EY4A 2PGJA 2R7KA 5K8IA 3BJZA 3GR6A 3U1VA 3A4MA 1XAJA 1KDPA 1LS6A 1LZKA 2LD4A 3HKDB 4L50A 4MQLA 3CLHA 3LOPA 5JWHA 2ZBRA 4CIVA 4Z0HO 4OI0A 4IVNA 3W3AH 2VVTA 4L6AA 5A0VA 3NBMA 2X7JA 3HB5X 4JH0A 4O5OA 1HT3A 3C3DA 4FOPA 3W2HA 2BRUC 4IUYA 4D82A 3C43A 3PVCA 1FXUA 3K0FA 4L9AA 1YZUA 3EQ7A 4OYLA 1FNDA 1Y37A 2G77B 3LBNA 5T6BA 3REQA 4K9RA 1HDEA 1RPAA 3TN7A 5B5SA 1WDMA 2PSJA 1E7YA 4MWOA 4QT4A 1EB9A 1YZYA 4XGIA 5FV7A 4DIMA 1XXHB 2WWIA 2NZJA 2HT6A 3JU3A 4IILA 4ZVMA 5G4LA 1O6GA 4GNKA 3ZWVA 1GZ6A 2HNKA 2I8LA 1F12A 1U3UA 1KI9A 3MWDB 3QPAA 1C7JA 1TKRA 2KS6A 4X0EA 2J4FA 4G8JA 5BT9A 3HXMA 4KMMA 4N41A 2J32A 1PNOA 4AZ0B 2GYVA 3HYSA 4DV1B 2Z6QA 4ZDWA 3VPAA 2EJTA 4EMTA 2VYFA 2VRWA 2ZWIA 3N1UA 2GNOA 3VNSA 4BFYA 1M8JA 3WA7A 4HYYA 1A69A 3OOEA 4OJTA 4ITRC 2F7SA 4BXOB 3FRHA 3ZJ5A 3KL4A 1QF9A 1CUJA 3UJHA 3H9BA 2HJRA 4WCDA 4KYUA 3AONB 1XEFA 4MV9A 1P2SA 4RU1A 3VGPA 4M22A 5JDCC 1GPDG 3CBGA 4NWIA 3SX0A 4G09A 3MIZA 4DWJA 1O4VA 1G20A 1J42A 3EA5A 2ZYSA 5B58T 3UMJA 1T0BA 4GZMA 4FQ5A 4TMXA 4UREA 4V1CI 1KRWA 4U9HS 3E15A 5KYWB 1K9SA 2VJBA 1E1RD 3GUVA 5DM0A 4CRWB 5FPTA 2I3ZA 1CUWA 4ZARA 4NX2A 3G0CA 4MS4B 5FOUA 1DRWA 4BO4A 4M88A 3SCZA 1XTUA 4DV2B 3JYLA 2G5PA 2Z9BA 4O2BA 4HAYA 1L8OA 4HAUA 4PZLA 5A4JA 5EXPA 1QPZA 1A5BB 5J63A 5ICCA 1JTEA 1RPJA 3EIFA 1XC7A 4A23A 4JBNA 3VPSA 4N0MA 4JJ4A 4HUTA 4IBOA 2VN8A 1YCHA 5DM4A 4YWJA 4AKEA 5L3QA 3PC7A 1IY1A 4JYCA 3TOVA 2JLAA 5REQB 3C3AA 2XZOA 1WZCA 3W8NA 1I33A 1QGDA 1PIWA 4K6MA 3FBWA 1RQ7A 5ALEA 3H11A 1TAHA 2CWWA 4GLLA 4LXUA 4XDZA 3KD2A 3ULKA 1M1YB 3L8MA 4UAJA 3SEAA 4BNNA 5BMOA 2JNWA 4OA8A 5D3MA 2R6HA 4MCHA 3DE1X 2ZYHA 5BSVA 4J2TA 3WI7A 1UBHS 3SBXA 3VHLB 1Z16A 1TQHA 4LZNA 3ZV5A 1HDOA 1GZSA 1YS9A 4YRFA 5TT0A 1B93A 3ONWA 3BCSA 3O9VA 2ZETA 3BWVA 4FWTA 3ZIAD 3J7AC 3Q1LA 5FT9A 1OJLA 4OGKA 5JVDF 1AJEA 3GFOA 1T0UA 1RYEA 3F6YA 1F1JA 2ZI9A 2CNNA 3ZY3A 1MJGA 4TMWA 4Q7QA 1RZ3A 4NNJA 5SZIA 5JMOA 1YA4A 2IEIA 3OQMA 2LV8A 1NOJA 1Z74A 4YRIA 5M04A 2A94A 2WF6A 3ORYA 1E0JA 3SXPA 1Z4QA 3BFPA 3QPWA 3T4UA 5A4FS 2CHVA 1YUBA 3A36A 2ZXUA 2W2OA 1LX6A 3B1ZA 2OR3A 4PLTA 4QREA 1IZZA 5HF8A 1DXQA 3AFIA 1N3BA 1RXUA 2GZ1A 2IDKA 4AL4A 3K71B 1QU3A 3O73A 1HDIA 1U1EA 2CLLB 1TYEB 3DLAA 4XQ9A 3PR3A 3IBTA 3FY4A 1D7AA 3TFWA 2PQ0A 4H17A 3NEAA 1MOZA 3QEMA 3D7NA 4TTQA 1KO5A 2HRRA 4GPEA 4CV1A 3WWOA 3Q5DA 3I6MA 1LXCA 2PA0A 3FTDA 3KR1A 5ENZA