1TMYA

Chey from thermotoga maritima (apo-i)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
118
structure length
118
Chain Sequence
GKRVLIVDDAAFMRMMLKDIITKAGYEVAGEATNGREAVEKYKELKPDIVTMDITMPEMNGIDAIKEIMKIDPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVKPFQPSRVVEALNKVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of CheY from Thermotoga maritima do not support conventional explanations for the structural basis of enhanced thermostability.
pubmed rcsb
source organism Thermotoga maritima
molecule tags Chemotaxis
molecule keywords CHEY PROTEIN
total genus 42
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 1997-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tmyA00
5IULC 1TLFA 2WWVD 3TD9A 1QPZA 5IBQA 3HUTA 1YK0A 4GNRA 4HNRA 4YCSA 1RNLA 3A3KA 3CRNA 3NNNA 3IDOA 3KYJB 4ZMSA 1JYFA 5T7BA 4JA2A 3KSMA 4JOQA 1GUBA 5GQSA 4O5AA 3OO0A 6ABPA 4F3TA 3UK0A 4QYMA 5D2CA 1XHFA 3F7NA 4Z4IA 1DCKA 3GBPA 1DP4A 3SNKA 3GWGA 4NCAA 4Z4GA 1Z26A 3ROTA 3GBVA 4MR7A 3H5TA 3MQ4A 4QPJC 1TMYA 3SQNA 4S04A 3JS5A 4F06A 1YTUA 2FN8A 3H1GA 3A10A 2R4QA 4EGSA 1S8NA 1RXEA 2ZAYA 3IP9A 3I09A 3GT7A 2KYRA 1YMVA 3KLNA 3O2SB 4NV3A 5CNKA 4CBVA 1NTRA 1QQAA 4N0QA 2JVJA 3GRCA 3HS3A 1M5TA 1SD5A 3KYIB 1E2BA 2QVGA 3I42A 1UDRA 2MSWA 4LE1A 4MS1A 4WXEA 3SM9A 3O1HB 6CHYA 2PUDA 1P8AA 1JLKA 5EWLA 4M88A 1Z13A 3CTPA 2FMIA 3HM9A 5TPZA 2JK1A 5TQ0A 2NUBA 2RGYA 3RVRA 4N47A 1OXBB 1DC8A 2IPNA 4RS3A 4FE7A 4Z9AA 1ZITA 2X7XA 3I45A 3T8YA 1M5UA 3OO1A 3URMA 1QP4A 5IEBA 2HQOA 4Z4FA 2VK2A 3H6HA 4IMIB 1ABFA 5GOTA 2IPAB 3G1WA 3O21A 4RK6A 4N76A 1NXOA 4NCBA 2PKXA 2J48A 4MQFB 3LUDA 3OLZA 4Z99A 3RVMA 1P6UA 5JNWA 5JNVA 3JTEA 3N0RA 1K66A 3VNBA 5KWSA 5JS2A 1VRVA 1BDIA 5FWYA 4EYKA 3O74A 3Q7SA 3QLTA 1PEAA 4JB2A 4WZZA 5EWJB 3NBMA 5FBKA 3MF4A 1TJYA 1DRJA 2IKSA 1NXVA 5CNIA 3CHYA 1QQBA 5CNJA 3ROFA 2JRLA 3HSYA 1FQWA 1ZH4A 2FEPA 3QEKA 3QELB 1DZ3A 1K68A 1EWVA 2QU7A 2WMYA 3JPWA 1CHNA 1GCGA 1Z18A 3LUKA 4RZSA 1Z25A 3N75A 4RY0A 2E4VA 2ZWMA 1VKRA 3DLHA 4IRXA 4EY3A 3HDVA 2WJAA 1B00A 2A9PA 4MYRA 1MVOA 5TPZD 4G0XA 4F12A 2E4XA 5IC5A 3SY8A 3QX9A 4LX8A 2PUGA 4PICA 4RKQA 2FMKA 3CKMA 1E6LA 4YV7A 4IF4A 4MR8A 2HPHA 3H5LA 3M6MD 4IGAA 1KRWA 4O1HA 3T38A 1JFTA 2LPMA 3LUJA 1LBHA 3GYBA 3O1JC 4PZ0A 4XAQA 1DBPA 3OM1A 1IIBA 3HDGA 1AB6A 2FQYA 4Z4CA 3M9XA 4Q7EA 4DN6A 4ETIA 4N0PA 4PE5B 4G0PA 2QR3A 5TQ2B 5DLEA 3CG0A 1PNRA 5JS1A 2PL1A 3EQZA 2BGGA 2VUIB 2FMHA 3BREA 4LZLA 3H1EA 4RK4A 4YWHA 4JAVC 4LDAA 3LKBA 4ZYLA 1W9HA 1USIA 2M98A 1D4ZA 2FN9A 4WXMA 4ETNA 3EULA 2PUCA 2LIVA 4KREA 1QO0D 1ZHHA 4HNQA 5JNTA 4UHKA 2HQBA 3HUUA 2JVIA 3R0JA 3KTOA 3HEBA 2JBAB 3N8IA 1TVMA 1SXHA 3RQIA 2OQRA 2R25B 3I5AA 1M2EA 2A9OA 1YVUA 2CD7A 3N0WA 4KVFA 4G0MA 2CWDA 3BBLA 4KNYA 4JB0A 4KK3A 4H3HB 1E6MA 2JVKA 4RDCA 4UHJA 5PNTA 2CHFA 3TO5A 4QICA 3O1IC 1NXTA 4G0OA 1NXPA 2RDMA 4Q6WA 3NNDA 1EFAA 2FSPA 2WJWA 4L85A 5TPWB 3H5IA 4TMYA 1NATA 2E4ZA 3EQ2A 3LUGA 4TN5A 4KZKA 5FWXA 1H9CA 3MA0A 1U8TA 1DC7A 3KS9A 4MQEA 1JH9A 5EWJA 3QEMB 3IP6A 2NZVG 4RK0A 1D5WA 3GV0A 3RH0A 3HJFA 3EODA 4JASB 2FQWA 3KJXA 3RVJA 4F8JA 5BR1A 1QP7A 1URPA 2L2QA 2NT3A 1MB3A 4YO7A 4G0QA 2L18A 2GX6A 3EJWA 3CFYA 1Z16A 4RSMA 3LFTA 2QXYA 5T3YA 5JNUA 4HNSA 3QX8A 4XLTA 4YLEA 1FFWA 4KV7A 5TE9A 2PUEA 1VLZA 2MYTA 5HM6A 1JDPA 4Z4HA 3H5WA 1Z2EA 2FTKE 3L6UA 5DGCA 2F8TA 3EDCA 4KMRA 1DCFA 1W25A 4RXTA 1PUXA 2Q5CA 1R8JA 4W5RA 3OQOA 2NT4A 2N9UA 3IP7A 4RK1A 1A0OA 4OLBA 4YR7A 5HKOA 5KC8A 4KPYA 5DKFA 4D6YA 1EWKA 3ILYA 1SXGA 4XXHA 1RZRD 1LJLA 2DRIA 1GUDA 2PMCA 2W42A 2V0NA 1XHEA 1SXIA 4LRQA 2MSKA 4H60A 4OTZA 4D74A 1EWTA 3FDFA 3FFXA 1JYEA 3RVSA 3OQNA 3CLKA 3HXMA 3KHTA 7ABPA 2FEWB 3IPCA 4HYEA 3UUGA 3HK2A 4OG2A 1DJMA 4DQDA 4MLCA 1C0EA 1JL3A 4OLAA 3KKEA 1RPJA 2IPMA 1EHCA 1KRXA 4RWEA 4MR9A 5DTEA 2MYNA 3RVPA 5C5CA 2JCGA 2FEKA 4MS3B 3IPAA 3CG4A 4KQ9A 5JNRA 2PE5A 3EGCA 4GPAA 1PNTA 4G0ZA 1YK1A 5TQJA 4MRMA 1DG9A 2WRZA 3IP5A 1QNLA 1YMUA 2XDYA 4QYWA 4RKRA 4W5QA 1DRKA 3NHMA 4OBBA 4MQEB 1BA2A 1GCAA 3GA5A 3LUFA 4IMJB 5KQLA 3KLOA 4P1ZA 2B4AA 4W5NA 4Y9TA 3O75A 1P2FA 4LE2A 3K9CA 1JHZA 4MQFA 4DADA 4EYGA 1GLGA 3OLXA 1D1PA 2HSGA 4RXUA 1OXKB 2R47A 2QVCA 1TM2A 2IOYA 1EAYA 1USGA 4RXMA 3CS3A 3D02A 3KG2A 5BQ3A 1Z2DA 4OATA 3JY6A 3CZCA 1YIOA 4G86A 5KI6A 3LKVA 5FWXB 4RY9A 3C3KA 4IILA 4KRFA 3BILA 4O1IA 1YS6A 2E4WA 5E3JA 4LDZA 2M1ZA 3RVOA 1A2OA 1U2QA 3L49A 3MYYA 3LOPA 4XFKA 1JF8A 2MYUA 3VNAA 3O2QB 4ZJPA 5IEJA 4Z0NA 3DLBA 1SRRA 2IDMA 3OMXA 3W9SA 5JNSA 3Q41A 3HO1A 2FQXA 5TPWA 3CNBA 4H3KB 3H5VA 4JP1A 4B09A 1JFSA 2FKAA 1DBWA 2L17A 8ABPA 1JX6A 2LUOA 1MIHA 1BVHA 2H3HA 5HQJA 2YHAA 1I3CA 5IUJC 4NQRA 4WT7A 2R48A 2GI4A 4WUTA 3T6KA 3H6GA 4EYQA 5KQPA 2PAFA 1JDNA 3N53A 1C4WA 2FW0A 2IYNA 2GWRA 3JPYA 4MS4B 2HJ9A 4YGXB 1BAPA 2B1JA 5IUKC 3FFWA 1ZH2A 2TMYA 1PEYA 3G85A 3F6PA 4YRZA 2WB4A 1KMIY 3C6QA 2FMFA 1AB5A 2P4UA 3OLYA 5FBHA 4E7PA 3NNSA 3CU5A 3Q9SA 3UKJA 3FFTA 3CZ5A 1Z15A 3E3MA 2A9RA 2FLKA 3C3WA 1KGSA 1Y1LA 2OENG 3DZDA 3EAFA 1JFVA 1F51E 3LUHA 3FGZA 5EWMA 3C3MA 2I6FA 4YP9A 1M2FA 3HV2A 4P98A 4W5TA 1DBQA 4MR8B 1NXSA 4F11A 1CYEA 2JBAA 9ABPA 3SG0A 2A9QA 3NHZA 2H0AA 3QLVC 3B2NA 4RV5A 4ETMA 4MS3A 1J56A 4TLMB 4TLLB 3RVKA 4S05A 3MMNA 4Z4EA 4MAAA 4L4UA 1D1QA 4MRMB 2NZUG 4G97A 5FWYB 1ZDMA 3F73A 5TQ2A 2PUFA 3K4HA 3Q7RA 4WWHA 3HCWA 1ZGZA 4MGEA 4E7OA 1NXXA 3LUAA 3LMKA 1T34A 3QLVA 4RY8A 1L5ZA 2PJUA 1YS7A 1FFSA 4KK4A 2P9HA 2F8SA 1PHRA 1MB0A 2CHEA 2AYXA 4RK7A 4EVSA 5KQGA 1QO0A 1Z17A 3RVNA 5ED4A 5EWMB 3TMYA 3QK7A 3D8UA 3A0UA 4NICA 2LP4Y 3T95A 1DCMA 3P9YA 3LTEA 1ABEA 1JBEA 4G0YA 1CEYA 1U2PA 1HEYA 4YS6A 3M9WA 2L19A 3GL9A 4ML3A 3OQMA 3H5OA 3DBIA 5CNMA 5EWLB 1U04A 1XWWA 1ZESA 4MR9B 2VUHB 1LBIA 5HSGA 1NY5A 3BRSA 4MS1B 3RVLA 3ILHA 5I4CA 1RXIA 2GKGA 2QSJA 3E61A 5ABPA 3HVRA 1FFGA 2FVYA 4ZPJA 4KFCA 4XASA 2RJOA 4EVQA 3KCNA 5IX8A 1LK0A 3O2JA 1ZGGA 1ZAYA 3QLUC 1E6KA 3JVDA 3Q7TA 5B3JA 4EVRA 1RZRA 4EUKA 1USKA 3H1FA 1Z12A 2E4UA 4PYRA 2GBPA 4MLDA 3DGEC 3LUCA 3QELA 2VYCA 4Z9BA 4W5OA 1A04A 3HZHA 1L5YA 3N6VA 5KC9A 1ISSA 4MR7B 4PEVA 4N41A 1D2AA 1QKKA 5CHYA 5DCLA 3TX6A 2LBPA 1F4VA 3A0RB 1QMPA 3OLVA 2JB9A 1VPWA 2AYZA 2MSLA 3DGFC 1QP0A 1FSPA 2IPLA 2ID9A 2QW1A 2YHBA 3C97A 3QLUA 4FE4A 4MS4A 1ZVVA 3H75A 1P6QA 3BRQA 4LE0A 2RJNA 2QZJA 3SAJA 5TQ0B 2FXIA 2MYPA 3OMWA 3OM0A 2O20A 5BRJA 1BDHA 4KQCA 4MPTA 2PUAA 2PUBA 1BDJA 5C5EA 1ZY2A 3MIZA 3RVQA 4Q6BA 4FB4A 1JWLA 4D6XA 5KQMA 1U0SY 2ID7A 3S99A 3N0XA 4RK5A 3TB6A 4RU1A 2HQRA 1WETA 3OLWA 2FLWA 5BRAA 3F6CA 2PLNA 3Q15C 1LJUA 2WY2D 1APBA 5B3JC 5F64A 1ZN2A 2PL9A 4XARA 5IUNC 1MAVA 1ISRA 2E4YA 3JVIA 1NXWA 3QEMA 2QV0A 4EYOA 3FMVA 4N03A 3MM4A 4ZMRA
chains in the Genus database with same CATH superfamily
4KV9A 3JYQA 4EB6B 5C81A 1P0QA 3CWQA 5IBQA 1E5VA 3PPVA 1IN8A 1A27A 1B4DA 2ON6A 1IN6A 2LRHA 3GEDA 3GLRA 5EIHA 2PTHA 3PXGA 4CR8A 4ZMSA 1J1UA 1XZ8A 2D06A 3VO1A 2HWWA 4GGPA 4JA2A 4BNGA 2D3WA 2ZR8A 3DE1X 2Z5FA 1MO5A 3KM0A 4LUCA 1NG1A 2NM0A 1SD2A 3MMPA 1DX4A 3GBPA 1DP4A 3EVAA 2WIBA 4FHZA 3VYTB 4BB6A 3QUBA 3S1LA 4UEWA 3SVTA 3HVHA 4QPJC 1W4AA 3MAAC 5FWDA 3JS5A 4PXSA 1VB5A 3E9RA 1ZJ4A 1P5ZB 5J1TB 1YVDA 1KZYC 1JHDA 3WLQA 1ANKA 2WMOB 2DHEA 3WADA 5EJFA 3U3RA 4H3SA 1WDKA 4JVLA 4EHHA 4JXKA 2ZRNA 5BSRA 1N6OA 1LDYA 2E48A 4UQOA 5AHXA 1LNSA 5FPPA 4YPOA 5TJHA 1IUNA 3GGPA 4DLLA 4PLYA 1CUVA 5JYDA 1S1MA 2V58A 4PPQA 4WBXC 1V7PC 2MSWA 5AXBA 2W8BA 5T6MA 1HV8A 1A98A 1I4OA 3RAFC 1U2RA 2P9ZA 1A76A 2ZWAA 3JWEA 3P0IA 2NUPB 3EW7A 5LCXA 3HQ4O 4AJ9A 1WKBA 4KP7A 3GIDA 2HHLA 4O2AF 1O6ZA 4K9PA 3RVRA 5KO2A 4KCGA 1TUIA 3WBJA 1XTQA 1E3JA 1YBAA 3CEJA 3PCTA 3KXIA 2IS1A 4HWGA 1TOAA 4PPFA 4OYHA 5BN3B 1GQFA 3IBYA 1N0IA 3MJ4A 5IEBA 1NLZA 4GKAA 4OHCA 4YQEA 2FRDC 4Q15A 5DCYA 3Q85A 4ALJA 2GHRA 3CNHA 2MINA 3HRKA 3LVFO 3RPEA 4LHSA 1RJ9B 2NSHA 1JTEA 3UTCA 3N8KA 5F12A 1RAGA 4D41A 5AFSA 3MCUA 7REQB 3MTAA 4Q4HA 4HFRA 3A27A 1CR1A 4G5XA 1XVUA 3R77A 2C7GA 1SURA 1KYZA 1XK6A 1KGDA 1M1YA 1PHPA 4R71A 1OHHD 2IU0A 3NDBB 4IH4A 3BQ9A 5HYVA 5LJLA 1W4ZA 2X5KO 4C4SA 1Q20A 2C0CA 2YZGA 4OH1A 3H84A 3TBKA 3TR0A 5A3QA 1TRKA 4HEA6 1JWAB 1FDSA 3Q6MA 3AK4A 2Y1FA 3L07A 5FBKA 1JDTA 3WNVA 2IKSA 2V8BA 3PWKA 2PSHA 4M7WA 4M4SA 4BWYA 5JASA 1FQWA 3IQDB 5CB4F 4AY5A 3LNCA 4BASA 4LRXA 1PDWA 3L8EA 2VUTA 2LWIA 4XQEA 5H59A 5JMOA 3IEVA 2EP8A 2Q0HA 1YZNA 3PYLA 4M76B 1GZVA 1ZCZA 2HIMA 2Q9AA 2ZXUA 4GOJA 4HYTA 4BRWA 1QX4A 3FMGA 4ALKA 4ZAWA 3KZKA 4AG5A 4NU6A 2WJJA 1VP3A 4UEKA 1Z5NA 5FUWA 3WG9A 3IFSA 3NAMA 2JGLA 2JIZD 2AI3A 4E5MA 4G0XA 5J47A 1NJ1A 1ZSVA 1J09A 4IQ8A 4LYYA 1LU9A 3HI6A 1UBKS 3ELDA 3TUJC 2PUGA 1E2EA 4M86A 2F7SA 2H85A 4U8GA 1W5AA 2WYHA 5M2QA 2ATCA 2QX8A 3C2QA 1PFWA 4EGQA 1A4IA 3PRYA 1W2HA 3R5FA 3AC0A 4NMHA 1LBSA 5IS2A 5TVGA 3FDXA 2ONZA 4J1TA 1E2NA 5B7PA 1G63A 4R31A 1ZD2P 1CQXA 3IJEB 2QTVA 2VPTA 1MTZA 4XWAA 2H31A 2QYSA 3L77A 5B58C 5KJFA 5E95A 3WDSA 4ETWA 3W9YA 3HADA 1GL3A 3KZNA 4Q7EA 4TRRA 3X1JA 1M6WA 4DLRA 5A4FS 1J9ZA 2O2XA 1U1FA 2JRCA 2PWAA 4LY0A 2H1LA 6PFKA 3I1FA 4G5HA 1JEQA 3Q2OA 4KMOA 5LBIA 4PLZA 3RC3A 4ZQEA 4U7HA 5TGZA 3VZBA 1TB4A 3U44B 1NI5A 2QQGA 1U7PA 4QFDA 3OPNA 1WMSA 3G5LA 3ZWVA 4L4ZA 3CUYA 2XSZA 1EZ1A 5EKUA 2WVAA 1EFUA 1PFUA 4DCNA 2EWWA 1QO0D 5JNTA 3SQDA 3CUUA 4KXMA 3TD6A 1WULS 1KDYA 4P3KA 4KVGA 1KWKA 3NT2A 1XCBA 2OB1A 1YCDA 3FFAA 4UHCA 4KO1S 4QGFA 3ZOKA 3CZAA 4DUPA 4MWBA 1LBEA 3VR4H 3PQ8A 5FPKA 5K1ZA 1AKYA 1M2EA 1SKAA 2UKDA 3MW8A 1D6NA 3N0WA 1N9GB 2ETVA 4QA9A 4G0MA 3THRA 2VBIA 3VBEA 4C21A 1ZD5A 1F6WA 3MCWA 4IR7A 1RQ7A 4L3VA 1TD9A 3DAYA 1LF5A 2GAAA 4D02A 1WZUA 3QBEA 1YULA 3LDGA 1UOPA 2OFXA 3PD0A 4ZU1X 2R8YA 3AO0B 4WLVA 1SOMA 2HO4A 1VJRA 4QICA 2P9QA 4EMUA 1II0A 2FV8A 1U7DA 2AIRA 3UPDA 2RC5A 3ZD8A 1NXPA 1O0SA 2PU5A 4RVFA 2WEKA 2AF3C 2P2NA 2P3QA 1XLTA 5E7MA 5J43A 4TMYA 2O1WA 1NZFA 2C92A 2C9YA 1Z06A 3KUDA 4NLLA 3V8QA 4FUTA 2DT5A 3E53A 3RC8A 2ZM5A 4NOKA 2AD1A 4B85A 3JSXA 5K0ZA 3IP6A 2PMBA 1YRHA 1GP2A 3AJDA 1V1RA 3G6KA 5KKCA 2UZIR 3NIDB 1GYQA 3IRVA 4Z7NB 2NT3A 4ZCIA 1MB3A 4Z4CA 5ILOA 2B9VA 1XJ5A 1YZFA 3GCGA 3TECE 3F4LA 5AUOB 1DVRA 3CFYA 2H2DA 2WSYB 3X1ZA 2P3LA 5EE5B 1L5KA 1HE4A 2WG0A 4IIYA 3RNLA 3ZXUB 2X9LA 3CZMA 1AMNA 2RGDA 4GO1A 4NJEA 4AVYA 4RA9A 1PG5A 4JLVA 5ITSA 2R9VA 3IVRA 4RF3A 1AUPA 1W35A 1JVSA 3M6UA 5FYDA 4Z7QB 1QIFA 2JLQA 2PUEA 2VHYA 1O89A 1BMDA 2HWYA 1P2GA 1UADA 3H3XA 5HM6A 2VSNA 2BEVB 2AVNA 5DU2A 2VYND 3UG7A 2FXVA 3ASUA 2C8LA 3TIIA 2A94A 2C1EA 1WY7A 3CF0A 4YALA 1RDFA 1P17A 2RCNA 4YDRA 4MRRA 2NT4A 2DVMA 4DA9A 3T7KA 3F98A 3T7TA 1F06A 3A6HA 4JUBA 1V8DA 3ZGZA 1GADO 4FJ1A 3M82A 3A4TA 3KE9A 5JSFA 3HBMA 3KD3A 3FTQA 1AQUA 1TA4A 5FBLB 2EEZA 3AUXA 1A4RA 3RBVA 5LZ9A 5BV7A 5CCEA 3U16A 4ZQHA 4BYGA 5K45A 4M0KA 3Q8LA 3VU8A 4RIHA 1Z4MA 2JJ2A 3RK4A 2C4KA 4P92A 4ZV4A 4KO8A 1UBFA 1I1OA 1EX6A 4OQQA 2CMHA 3HKBA 4BP8A 4CMIA 4TYYA 1J2RA 1ECCA 4OUDB 3VR5H 1FTQA 4KN5A 1WZNA 1GUZA 3HN7A 1IB0A 2PRIA 2HI0A 3BGWA 4LRSB 3GEGA 5DIFA 3GUHA 5C7IO 2ZRPA 1C7ZA 5I9NA 1L7MA 1V95A 4U0KA 3CRW1 3EIEA 3PYXA 4YCBA 1F4PA 1P2TA 3FIJA 5FOUA 1V2HE 1T3SA 4D4GA 3UFXB 3MJCA 2Y67A 1HT2E 4FZ5A 4MRMA 1DINA 4ACBA 5DBFA 2H1IA 2X0NA 3A9RA 4OA5A 3NHMA 3NQ41 5FA8A 3NIGB 1B16A 4TSRA 4WZBB 2Z2XA 3ZIUA 1MBZA 4JBHA 3E7FA 3K0AB 4POAA 4ZVNA 2Q7XA 2P2ZA 1UIRA 5JIBA 4Y9TA 1YVRA 5FHRA 2EL7A 4C14A 3F8WA 1EX1A 2DSTA 4FFMA 4IIGA 4JZYA 4MKHA 5G41A 4AMVA 5KOHA 1JHZA 2EVWX 5ECDA 4EMSA 1XXHE 2R47A 4C05A 5IJ9A 3UGJA 1K86A 4F84A 4HWSA 4TZ0A 3V7YA 4F6RA 4EFKA 5FWNA 4J9UE 1LF0A 3DZHA 3AERB 3I6BA 4OM7A 3OZBA 4G41A 2H1SA 2ZBGA 3WTBA 5ILGA 1MX5A 5JROA 1B2LA 1WMEA 1EVZA 4B3BA 2O5RA 1G8PA 4DCSA 4A3SA 3AMVA 3EYAA 4PSUA 5ARDA 4E30A 1PEKE 1PQPA 3Q9NA 4WERA 2GM9A 3F5SA 4O1IA 3QHQA 2FSHA 2CJXA 1Z73A 1JFLA 3CJRA 2C0PA 2FPLA 1A2OA 3DBLB 3O84A 3HGQA 2V7VA 3KAJA 2MYUA 3R7WB 1RTKA 4Q4AB 5DV9A 1ILEA 3TQCA 5KNCD 3TL2A 3Q8XB 5JV5A 3O8DA 4GLJA 2CCJA 4FONA 1VI5A 3UA3A 3H5VA 4GSKA 3UPTA 3P97A 2RKWA 2VDRB 1YUMA 2CYBA 4OQLA 2FPWA 3GARA 4RD4A 3SKXA 4BQQA 4ZK2A 1PNVA 2H1OA 1RFLA 5KVAA 2EQAA 1SJ9A 1Z6GA 5F2EA 4UMFA 3WICA 2WU3A 3TG8A 4HLUC 1ZOPA 4DWOA 1DT3A 3UUEA 1FNSA 4ZCQA 3UB3A 3LAWA 4QC2A 1HA3A 3UOGA 4NZ9A 3DVRX 4CZ2A 4CJXA 2R6AA 4Q1EA 4DJTA 2QMYA 5BW8A 1X77A 2H4HA 3AF0A 2RAPA 6NULA 5DYIA 1FNMA 4MH0R 2VL7A 2IWHA 4NYIR 3RWOA 5EUQB 5C1IA 1KBZA 1R6DA 4CUJA 1G7RA 1QQ6A 2IZ7A 4BGUA 2X4GA 3THWA 3A1TA 5EI5A 3ZS8A 3L0SA 1WW8A 2X8JB 1MW8X 2RSLA 1PK7A 2B1GA 1NVXQ 2PX4A 2YL2A 3AEXA 3C3JA 5HUHA 4B3SB 3R6DA 4GEKA 3KB2A 4BCDA 1VMIA 3C3MA 3WFZA 4YCMA 1UEIA 4Q16A 4U7WA 3RI3A 2J5BA 1DBQA 2XD4A 3ENKA 3F0TA 2IXFA 3YASA 1GZ7A 3OZVA 1WE2A 3B12A 4F4DA 1GKKA 4NU0A 1V8OA 3AI2A 3NFRA 2O8VA 5IJAA 3RSLA 2HA4A 5T3YA 1YD7A 4BO4A 3V4RA 2TECE 3GVIA 3LFHA 1D8TA 1KJWA 1N25A 4B4KA 2A35A 4B9AA 4B3GA 3E22A 5JC8A 1YJQA 3D0RA 2EERA 2R8EA 3UYKA 1VBKA 4FDUA 5G02A 2QLTA 4ZPXA 2BONA 2OILA 5U1PA 1SCQA 2EX1A 1P4RA 1SO8A 3MCAA 4JX8A 4QXRA 1U63A 4WLNA 5CDYA 2O57A 2PUFA 1GDDA 1CR2A 5GOZA 4BGVA 3K4HA 4PGFA 3CVOA 1R4ZA 1RI1A 4RBNA 5BR4A 2EP7A 3ZWCA 5KTRA 4XWTA 1DPGA 5EMJA 3SFVA 2X7HA 5I5EA 5FDFA 5WRFA 3ZHOA 3LWBA 4YHBA 5DMHA 1Z6ZA 2QPLA 5EEHA 3ST7A 1C50A 3IHTA 1OPRA 5KQGA 3MC1A 4C7XA 1SCDA 1W19A 3HA2A 5LBUA 2M6SA 3BF7A 4ASUD 4BZWA 3A0UA 4P58A 3WNDA 3T3NA 1VL8A 4CNQA 2VP5A 3HU2A 3DXYA 5C32A 3T5AA 2HBZA 4HH0A 1QIKA 2WDPA 3C6MA 1D0IA 1VSTA 1HZZA 3QVWA 4WLUA 4ECAA 2L19A 1N2GA 2ZJ5A 1NBMA 4DLSA 1OGJA 1YQWA 2QW0X 1LUAA 4WFKA 2BFEB 1U1EA 1WB4A 3H11A 1CY2A 4FU0A 2W6ID 4OQPA 1KI4A 3DCYA 4A6EA 3FVRA 4TYMA 3OEEA 3WB2A 1LV7A 1SGWA 1RXIA 4NJMA 1R6VA 1YZUA 2G88A 3QXSA 4JHLA 3D3WB 3DYBA 4PIPA 1KSJA 1WXQA 2FZWA 2RBKA 1YL7A 1TF5A 1CDZA 1DT5A 1HTWA 2RHHA 1HYEA 3O2JA 4B48A 2C4MA 1CUEA 1ZAYA 1PL6A 4AG3A 4A1OA 4DDWA 1RVV1 2Q4OA 1D7AA 3LHKA 1XTPA 3AR8A 4CV0A 4JKOA 2J9FB 2OECA 2D0DA 1F5NA 2BHNA 2XITA 1EE1A 4YAGA 1L5YA 3W5UA 2JLZA 4LOJA 1H6BA 1KI6A 4B3HA 4LPKA 1XVVA 3D8NA 2X8JA 5GZ1A 3U39A 2WF7A 2GD1O 5C1OA 4B33A 5BWBA 3H75A 2YVLA 1VPEA 2FU5C 2IPOA 4X3OA 1C9NA 5DX1A 2VWHA 1U0GA 3EHDA 1S3FA 5EXPA 4NV1A 1IIRA 3M6LA 4YLGA 3OM0A 1ZCBA 2X8AA 3ZG6A 2CZGA 2A57A 2GK4A 4BECA 4DLBA 2UYYA 3HSSA 4BMOB 4FI3F 1YFKA 3VI4B 4CIBA 2QI9F 1M7BA 2XTZA 4IFBA 4KC0A 4MTCA 3HHPA 4MITA 3ZVMA 1XNRB 4URXR 2P4SA 4PG5A 2GEVA 3T1YB 4WN9B 1U2GA 3I58A 4LOIA 2BD0A 3WGYA 1BROA 2PLRA 4KRGA 3K20A 4RK5A 2XMGA 3V8BA 4E3ZA 2G09A 4REQB 4UOEA 4ARBA 2AEMA 3FVVA 4GX1A 4LVCA 2BGLA 4YJ3F 2BEKA 2PJDA 4D0NA 1HURA 3L8DA 1P1HA 1NVMB 2BFAA 1IL0A 1PV1A 3SR0A 4CG0A 2XQVA 5HGJA 4URVR 1YGYA 2OLKA 4KUHA 1RXWA 3ZDBA 4K03A 4YT4A 3LQRA 3GGCA 5HF8A 4DXDA 1W76A 1RRKA 4JJZA 5REQB 4YAOA 8OHMA 3GRRA 2OBLA 4US2R 2REQB 4F6CA 3AJ8A 3O7WA 1A7JA 1GTZA 1PLJA 4DANA 2DQ4A 3A6ZA 4K46A 3ZXIA 3ITEA 1UFOA 1H1TA 1JQJC 3QKSB 4QJBA 1FTWA 1PDVA 3A26A 3A3PA 1U7UA 2WUEA 3FLMA 1B93A 4IHJA 1K7SN 1RVDA 3ZJTA 3KYDB 1E1NA 3JQRA 4RETA 1KA9H 1SU7A 4G5RA 4HBGA 1I33A 4X20A 4MVWA 4GUDA 5SZKB 1SKQA 4MQ5A 4Y0NA 2ORYA 1NVFA 3AJ9A 3JQBA 1SBIA 1PL0A 4R1OA 4ZAVA 1M5TA 2ECQA 2F1KA 2NOAA 2OC4A 3DP7A 1KR5A 1VJCA 1E4YA 1ZKDA 4JU8A 2EF0A 1YS4A 3WIDA 5FPTA 4OLJA 2HLDA 4HC4A 1UJMA 5BSWA 2NAPA 3LGXA 4BZQA 3OJLA 3TH5A 3N2ZB 3QU5A 4Z1MA 3ZQ6A 4YRDA 1LVGA 2KE5A 3HU5A 5I7AA 1T5IA 2C4TA 3UJCA 2WQZA 3C85A 2G1AA 2PMDA 2NU9B 4EENA 3LX4A 1ZITA 1MO3A 4MK4A 3KSRA 3AFMA 1VCMA 4FW9A 2I03A 3N7AA 2ZYHA 5COBA 5C3UA 3F71A 1M2HA 4TM7A 5I45A 1ENOA 4G84A 4PSVA 2ZUBA 3OCWA 4N01A 1Q17A 4TV9B 2P77A 2IS4A 5LIPA 2H52A 4DCPA 4TV9A 1B3BA 2FQ1A 5P21A 1LZLA 5E38A 5EERA 4YMVA 1LPOA 1SXJE 1COZA 4NCXA 4Q19A 4CKWB 3RVMA 4HNVA 3W6ZA 5C8ZA 5AJZA 1OVMA 1RAAA 3TPZA 5BNTA 3CE9A 4QNRA 4FWTA 3ANXA 3W06A 3Q5GA 4LTDA 4CI9A 2QL7A 1PFGA 5DBOA 5KWSA 1GITA 2WF6A 3EG9B 1KE1A 3DDOA 3KXDA 3NWEA 3QLTA 2EU8A 1EVYA 1QDLB 3NW9A 1C3JA 5BXQC 1HF3A 2JKZA 3IOMA 1P4JA 2X3FA 3DQQA 3K4PA 3D54D 5I7UA 3U61B 2QN8A 3RC1A 4PWYA 4NG5A 4PANA 3NBYC 2JRLA 4C7MA 1UK8A 3BHMA 4J6FA 4CM8A 4DDHA 3IPLA 4WGGA 3FH0A 2FUEA 4XM0A 5K2OA 2YV4A 3PXEA 1EK6A 1MQ9A 1FUKA 2WFZA 2XYQA 4I5FA 1SQFA 3OP4A 5AUPB 5BN3A 5A0VA 1U28C 3CH5A 2ZRBA 4KUEA 5K0EA 1G38A 1Z25A 3DXXA 3U1BA 5IK2D 1XHLA 1YKSA 3ANTA 1U3CA 3MTDA 4IEIA 5KTNA 2DBYA 2V7BA 3I5XA 1US8B 1YU6A 2WJAA 1QYVA 5D01A 1EUCB 4H3VA 4I5DA 2H7CA 2IYYA 2ZE5A 1R66A 8LDHA 2ZJ6A 1FFXA 3IS3A 4QX6A 4W1PA 5IM5A 3VZPA 3B36A 1RAFA 1QQBA 3QKRA 1Y9JA 3HXLA 3G5AA 1ILWA 3EOZA 1JZTA 4JYBA 3MPOA 2NV2B 4BBAA 4EPXA 3UMGA 3LK6A 3V48A 4GM1A 1ZK3A 5JWOA 1FXWA 4MR8A 4DJEC 4Y2HA 3R9KA 3LX8A 3OBIA 3OCJA 4AUMA 3EPPA 4XWYA 1V3UA 1MB2A 2VSOA 4ND6A 3DLCA 4P53A 4F1WA 1A5BB 1I7LA 1E2JA 1KZGB 2G0TA 4JIGA 5DHUA 1PS8A 4Y6QA 4YQYA 3ZTWA 1CJTC 3GRUA 3DL2A 1N2OA 1AO3A 5AVQA 3UXHA 3LBFA 3SZGA 1FUEA 3VQTA 2AOUB 1VG0B 4N0PA 1VJ0A 4G24A 4N3AA 4M1WA 1G60A 2QSZA 2XIJA 1NQTA 1R9NA 3B78A 4OGGA 2ACEA 1SKBA 3HB7A 4MI6A 4YCLA 1W9HA 2IW3A 4LV8B 3Q2IA 5GONF 3RJTA 3FWNA 3QVTA 4POOA 1PR5A 1ZCJA 4K1LA 4QNNA 1NNLA 1HLGA 3AIIA 2C07A 1N3IA 3CH7A 4MGHA 1ZJ6A 1BYIA 2TRSB 3UMBA 3W5BA 2FGJA 2V6JA 3CW2A 1F9AA 4OH7A 3OKFA 4LEIA 5ER9A 4QZVA 1LXCA 1Z5PA 4LHXA 2YOGA 3BOSA 4Z3OA 4YTEA 1B76A 1R0KA 3ZCRA 4OQFA 2VTVA 2YS7A 3K0KA 1AHIA 4LOAA 4IJ5A 5A9TA 1OBVA 1CJMA 1Y6JA 2C00A 3JATA 1WG8A 4OLFA 4YCAA 3LUPA 3FB4A 1LSJA 4OQZA 2ZTHA 3D6HA 2GO1A 4BB0A 2HCBA 1V3QE 1EQAA 1WLSA 2WP8J 1NBOA 4PYLA 3WKCA 4LC1A 4DMLA 2K6GA 5E6SA 5A03A 1U7HA 1TIPA 2ZK7A 2NTNA 1G6KA 5BPHA 3PP8A 1AA9A 1AXGA 1OU0A 1SFRA 1OHHA 2EIHA 4DS3A 1JPNA 2F3UA 4Z9XA 1RC0A 1VKNA 1D2NA 1AGXA 3NNDA 3FTCA 3EXFB 1FQKA 1YB7A 2FPIA 4L85A 3ASVA 2ZSKA 3IB3A 2ZIEA 3VR3D 4BN5A 2JS7A 4LF9B 2ACWA 4UCFA 4NABA 2PEYA 2Z30A 2YUIA 4O4LF 4QRHA 4O1MA 5DYGA 3WS7A 1DCTA 4W5HA 2DHQA 2D7JA 1Z6TA 2FPPA 3OCCA 3VZDA 4X71A 1QP7A 2C2MA 2HA2A 2ZAIA 4NS4A 3DAPA 1NKTA 4D4JA 3GH3A 5EYPB 4UNIA 4IOJA 3DXZA 2QI9C 3WQHA 3HR7A 1P31A 1U9IC 1Z47A 4U9IS 1ZM4A 3RUCA 5IT0A 3ENZA 5ADHA 5ITZB 3IHLA 1YQDA 2ZOSA 1KEWA 1USWA 1XMIA 3C5HA 4RVGA 1J0CA 1EFVA 2RG1A 5G4LA 3EWIA 4QDOA 2CV2A 4BNTA 2F8TA 3PQ6A 1TFRA 4UVEA 4RELA 1PZNA 3SJBA 2BEJA 2GPBA 3B5IA 3FR7A 3IQZA 1P4AA 1YHZA 2I4TA 3ZJUA 3K0BA 2JIDA 2V3CC 1JA0A 2VN8A 5B37A 4W5RA 2N9UA 2BM1A 2NU6B 4BQOA 4BUZA 4RJJA 4BPBA 4LJ5A 1AD2A 3I6MA 1RYHA 1KC3A 3P45A 4RJIA 4WINA 2VPXA 1V5EA 3B9RA 4FHFA 4U39A 3A2NA 4G85A 4AWAA 1XD9A 3N3BC 3OIGA 4M99A 2ZATA 1OKKD 2UAGA 1OAOA 3TXYA 3D7SA 1YSCA 4AYXA 1E2IA 4C76A 1U8EA 4K3UA 4RC9A 1OC2A 1X86B 3SK0A 5L45A 1AUOA 1WUKS 4XVQA 4OG2A 1DUSA 2ANBA 4ND8A 2VTDA 1UZNA 1NPTO 1A8QA 2CVOA 4AZSA 4EA9A 2B9EA 3O4HA 4QQ8A 4QBHA 5IKEA 2OZEA 1RAIA 3E03A 3OBBA 4LZJA 5A6VA 2OGUA 2P6NA 3P0JA 1EB9A 1AS0A 1T5SA 2H1VA 3WHLA 2ZBDA 3ZU4A 1RHMA 5B53A 5C8DA 1X92A 5DEIA 2ZVJA 5EMKA 2ZITA 4KXLA 3ZQJA 1XBTA 3KEOA 4EAQA 4MUNA 2XQKA 3QYAA 1BOOA 3K6KA 1KEEB 5DGIA 4RKRA 4D44A 1BA2A 4KWTA 5EJEA 3STYA 3M33A 3NV7A 1GGHA 4C4PA 3WIOA 3C4JA 2ZCUA 1C0PA 2QR5A 1BTOA 2VXYA 4CQMB 5MN6A 1TT5A 2FPIB 3TEFA 3BYZA 4D3DA 3OX3A 1NV9A 5K6RA 3N7UA 3ZE9A 4DG5A 2QDXA 1JEQB 3OOJA 1A2BA 3KOOA 1DC3A 1V26A 4IDHA 2PMKA 4OU5A 2W6QA 3AESB 2DP4E 3ZU6A 3VVBA 3TGWA 4C9BA 4DKXA 1MJ5A 2JLCA 3VJLA 2BSAA 3ED5A 4GWGA 5IHXA 1QYCA 2UZAA 2CLKB 2XYRA 3IESA 4KFRA 2NXWA 4UZEA 4QOFA 2R5NA 1SBCA 2EGHA 3SHOA 3AEQB 4TVOA 5J5AA 3NI2A 3E7XA 3F4BA 2IA5A 3V8NA 4LBYA 3RS5A 4EHIA 4P7JA 2O23A 2Y1XA 2C7BA 4I4IA 5CJPA 5DJ5A 5KI6A 3LKVA 1GZHB 4WZBE 3KETA 4MQMA 1UEJA 5B1EA 1XQWA 1XMXA 3AWIA 3E18A 4BO7A 4DIUA 1TW2A 5BN4A 3F6BX 1EHYA 1Y7HA 1R2QA 4KKVA 3ZX4A 3L49A 1OFTA 3MYYA 4NATA 4X24A 3O8LA 4MJ3A 5LZ8A 3IQFA 3CLTC 3SQWA 2QNBA 3NEYA 2OYCA 3UQYS 2R84A 1NN1A 3A1WA 3V8EA 4EWLA 2L17A 5EA2A 1IY0A 4ZVMA 4HQLA 4D56A 3PC8C 3L0YA 3ZVNA 1RLUA 2QLFA 2H3HA 2J41A 3ESAA 5BRNA 3I0NA 3OX4A 3R7BA 3VFDA 3ZTYA 2C95A 3MOSA 1GFIA 3HDHA 4KOAA 5EGNA 4Y9UA 5D6OA 2O2GA 5ALWA 4C89A 4CN8A 2AN9A 2G04A 2W43A 2Q7OE 1WU7A 1JFRA 2JHCA 2BEUA 1V9CA 3C45A 5IUKC 2X3UA 2ZE6A 3UC9A 2TMYA 3DVQX 1I6MA 4YDQA 1LD3A 2FETA 1TTTA 4I4TF 1KYTA 2IZOA 4WVFA 3UKJA 2IYOA 5LQMA 2IEZA 1L1RA 1Z15A 3IQWA 5IVDA 4AZ3A 1SUWA 3AVPA 3BXFA 1ZGAA 2QAGC 1GNTA 2IQ5A 3EAFA 5JXGA 3THYA 3UAOA 3PT9A 3QVGA 4URWR 1GRQA 3VNVA 1N57A 5EWMA 2FDRA 2H1RA 3QVGB 3UMRA 5BN1A 1MJGM 4RVHA 5HTOA 3DW1X 5JBQA 4XJXA 1G20A 1C9JA 1K4YA 4CMKA 3ADDA 2NAFA 2D5IA 3OESA 4PX3A 4R3UC 3KWFA 4JGIA 2QT0A 3ESBA 4PAQA 4ZFNA 2QAGA 3NC4A 4CHGA 1TT5B 1FDRA 2VPQA 5JQGA 3NHZA 3D7NA 2GRUA 1G64A 2FY8A 2DFTA 3QLVC 3HR4A 1CJUC 4NYIQ 3GCWA 7ADHA 3CF4A 1FRVA 1NQ5A 1YR6A 3HKEB 1D8AA 2XMBA 1CE8B 1YE8A 3PNLA 1AX9A 1RADA 2NZUG 2EQBA 2ZJ0A 3USES 2I7DA 1UAAA 4RFSA 4LBZA 1FU8A 3PQ3A 4QFMA 2FSGA 3ZZ0A 3I9MA 5K5EA 2H7YA 1MU0A 4P2BA 4YRIA 1RKXA 2VAWA 1F2VA 1M34E 3QLVA 3TSZA 1ESMA 1UQUA 1KEUA 5KWIA 1Z82A 1RCFA 3BFVA 5FBQB 3SMVA 2XVXA 1JT2A 3K30A 1UL1X 1F0NA 4MIEA 1M6VA 4EHLA 1ZJZA 2KBEA 2ZT6A 4XUGB 5DRYA 1SRQA 1V11B 2QJOA 4YRMA 2WHRA 2QB5A 3B1YA 3ZZMA 2D7CA 1CEQA 2FW7A 1PDOA 2LP4Y 5IFKA 4JQOA 3OF5A 1A82A 4H0NA 3UFBA 1T8YA 4DMFA 3FTFA 4RM2A 2C7QA 4GZMA 1ZJWA 4JX9A 1K3UB 3UFXA 3PWSA 3BH7A 5FQNA 1IK6A 2QD4A 4OFZA 4QHTA 5F9FA 2TMDA 4AD8A 3GAAA 4MR9B 2ZJOA 4PZAA 2IODA 2FW8A 2J9XB 3EVDA 3ILHA 5CFLA 4HF7A 1PD1A 2P5SA 3NASA 1H3NA 3W1EA 2OBNA 4KKXB 5IJ9B 1FE8A 5LZ2A 2BGNA 4AYTA 1XD2B 3RC9A 3JX9A 2HF8A 3DWIA 5EXTA 1X39A 3AHEA 2H65A 3NG1A 1USKA 2AN1A 3QVMA 2W11A 5TS2A 1OBHA 2D59A 1MNQA 2DJ5A 2Z1MA 4PZYA 4PYRA 5GVSA 3A3YA 4C7VA 1LPMA 5GPBA 4GYJA 3RRZA 3PDCA 4RIEA 4J8PA 3AKYA 5KBYA 2QENA 2XQFA 4KE9A 3PJDA 3MMXA 4QDKA 3RLIA 4RHYA 1D2AA 5AW7A 3IAEA 2I4NA 1VSUA 1WV0A 3GPCA 1TZBA 1ZM2A 3PDUA 1XCOA 2J08A 3KTFA 3L8CA 3EGDB 4Y1GA 1LRLA 4Z5XA 2IPLA 3SQOA 2MSNA 2YHBA 3G9ZA 3L79A 4JT4A 4U3JA 1ZGCA 2LTAA 1NLUA 4G5SA 2OB2A 2FXIA 2LW7A 1XNGA 5TQ0B 3WMFA 1JLLA 3HXOA 1YRYE 4ZAZA 3O3CA 1FK8A 2R1VB 3QOFA 2FPKA 2F1RA 2IOQA 3PFBA 3I8SA 1YDEA 2I78A 3FSJX 5DNAA 4FQ8A 4M38A 1L3CA 4B3XA 4XTRA 5EMHA 2H2GA 3RFUA 1RAEA 1FUIA 2GJAA 5BN5A 1JWLA 3DMNA 5M29A 1PGPA 4UVDA 2BTQA 1YR1A 3OOYA 5DHRA 4P86A 3SX4A 3TB6A 2IU4A 3K1TA 3IBSA 3DDWA 2FLWA 1EU1A 1EJ6A 3JAMA 1Y1KE 3OF3A 1Q7TA 3V2HA 3W6OA 1TECE 4C78A 1UJ6A 1ZN2A 5IUNC 1GGKA 2J6IA 5E3HA 1E7RA 1BN6A 4UOQA 2QV0A 2NUAA 4HOYA 3BK2A 1OFIA 1MDFA 3O8OB 1T91A 2YJGA 3BWVA 3BPSA 4J0CA 3BT7A 3QWBA 5CVJA 5THKA 3AVXA 2FF7A 3AR7A 3PTLA 4MYHA 1IY1A 3ZKWA 1IC6A 1AGRA 1DWUA 2AF4C 1GKYA 1GL6A 3HDTA 3I1IA 2GAOA 5EVCA 5KTSA 1U8CB 3ZHQA 1YZYA 3NRBA 4JOQA 3UWPA 1V4NA 2NO9A 4LDPA 3VDXA 4EITA 1GTJ1 3DT8A 6ABPA 1JE0A 3UK0A 2JFFA 3SC2B 3TAHA 3TK1A 2EAUA 3PFFA 4OI2A 4DCGA 2CMDA 4Z4GA 2QVZX 3ROTA 2G5GX 2GN8A 3AFNA 3D8RA 2D62A 3H5TA 5T4HA 3SPXA 4DQUA 3MRSA 1MX1A 1IBKB 3GLFB 2Q45A 4MVJG 3K1ZA 1JLHA 4IRMA 5T8KA 4A8JC 4AMYA 1E4EA 1GPJA 1PT9A 2PRSA 2VYQA 3CRZA 3DONA 3FRIA 4RADA 4RABA 1QQAA 1IOVA 3OC0A 1H3EA 3FCCA 2ISSD 1T0IA 4F3RA 3KQTA 2N47A 3KYIB 2CFIA 5JCJA 4CTJA 2QT9A 1E2BA 5SY4A 2ZUVA 5KS2A 3TQOA 3HB9A 1C14A 1EVJA 5FTJA 2PUDA 4HUJA 3O1HB 5FD8A 3ZWPA 5KQRA 1YFLA 3OC6A 1QOZA 4ILEA 3ZQUA 3FDZB 3JQPA 2WF8A 4OFBA 1NBIA 3L06A 1DGQA 2PGIA 1KQGA 5LB2A 4UVIA 3LHFA 1F4LA 5THQA 3LFUA 2PMFA 3QPVA 1QFYA 1S2LA 2IPNA 3L7MA 1SVUA 4GBMA 4H35A 1ZINA 3LHDA 1C7QA 5B7QA 1PJLA 2OTCA 2D4AA 4ZU6X 3AY0A 3GROA 1BD4A 4FHCA 1GTSA 3C98A 2BHLA 3GOHA 4AXXA 2MJLA 2G4VA 4RHEA 1DQZA 4Y6OA 3GXOA 4Z8YA 4AU1A 5BWCA 3RYCB 5CM8B 2XA2A 5E6RA 3VTFA 4B6OA 3TLJA 4DDKA 2ZRHA 1C0KA 4HMQA 2GPWA 4O5OA 2W6NA 1QC5A 1YU9A 1XDUA 2QA5A 3TLZA 5HK8A 3DTTA 1P9NA 4DIKA 1FMFA 4PVCA 5J23A 2ZRGA 4DT1A 2ZB2A 5IZCA 1QX3A 3TTTA 2CD9A 3AW9A 4IQ4A 1MZPA 3ZI4A 3CINA 2I2FA 1TQ6A 1XT6A 4A7PA 3FPJA 4V24A 3VR1A 2QBYB 1F38A 1W4RA 3CHYA 3O90A 3HN2A 3ILVA 1SU4A 1RE1A 1Y7IA 4C0BA 4CT0A 2AKYA 2D13A 4P5PA 4YJGA 2HTFA 2OPHA 2LNDA 4XDZA 2XWQA 4CDGA 1T8WA 3QTLA 5CRIA 3AEYA 2ZRJA 3IVGA 1GCGA 3A9CA 1X7YB 4DXHA 3VR2D 4C29A 4Y8VA 4ZCMA 4IZ6A 4N6GA 2OGZA 4W6ZA 2G5PA 1W581 1E32A 3NH6A 4RPHA 4YJHA 1XU9A 3ZXXA 5LJIA 4OGWA 3PGVA 2XMRA 3C3DA 3P2IA 1A5AB 3TJZA 1UQTA 1LDNA 1TTHA 1LSOA 1SVLA 1JXMA 1GZ3A 1SK9A 2BHTA 1A50B 3FSRA 3KB1A 4ZVVA 4RULA 3UANA 4GI5A 3L1UA 5L4NA 3RARA 2WUGA 3HCNA 4MCAA 2B30A 3S55A 4BFVA 2DJIA 4J16C 3DLIA 4MXDA 1JV2B 5CLIA 4WL0A 4BVAA 2A0KA 2I2BA 2VK8A 4FN4A 4P9NA 3NHFA 1M2KA 1Q7GA 3O95A 4E5DA 5AOBA 2BMAA 4EI7A 1E6LA 1U9JA 3OWOA 2FH5B 3AB8A 4YNBA 3PUHA 3EFHA 4JOBA 2HPHA 1KRWA 5EP1A 2DEUA 4BKPA 5BV0A 5KOIA 1HDXA 1V9SA 3FD8A 1K3TA 2GD6A 1D5CA 3FNHA 4I5EA 5AKJA 2OHFA 3RBAA 1ZC4A 1FZTA 1B2RA 1BMFD 4X44A 4KQMA 4PE5B 3H9UA 3OJEA 3LT1A 5JSZA 3CN9A 4ZYLA 1DFHA 4LDAA 1TQHA 2ZQ5A 4G9EA 4IDDA 4CMBA 2R0QC 1XCLA 1GCIA 2RHLA 4WXMA 3VISA 4H7HA 4P3NA 4C6RA 3R4VA 1Q0ZA 1NP6A 3E4CA 2QNRA 3BGDA 3MRTA 5L6LB 3S40A 1N77A 4AICA 4R3WA 1PSZA 1MUUA 4PO8A 3BUSA 1PNOA 1XZCA 2WF5A 1W5FA 3H8VA 4UNSA 2YV2A 2GTPA 3HO8A 4WEOA 2VIIA 1J5PA 3BTSA 4O4IA 1QJ4A 2XXJA 3R5TA 4P32A 1XNQB 3JWJA 2ODTX 3LWNA 1U0FA 1EH5A 1I0ZA 1JW9B 3LW7A 1BGWA 1AHPA 3TO5A 2BF4A 5LWQA 2Q0SA 3BZWA 3E7DA 3IHWA 3OF2A 3T4UA 1RP7A 5KINB 3TBHA 5LDDC 4HDAA 4L08A 4KXNA 1KMCA 1HO3A 2NYAA 3G3EA 1S89A 1U7ZA 1Y4UA 3DMTC 3NDIA 4B3IA 3U80A 2YYZA 4FHEA 1G5RA 4TV8B 2FFJA 3AKZA 1R6AA 3U3OA 2QM0A 3WBFA 4DMGA 1IEWA 2YC2C 2DBZA 3NAQA 3MWEB 4OK6A 2ZS9A 2E0IA 3UICA 3V1YA 4ATNA 4KQHA 4Z7OB 1RKBA 1JMKC 1NJ5A 4I4TB 3RS0A 2JC3A 4EW3A 2H8GA 5BVHB 1XE3A 2OCBA 1AOXA 4CG3A 1GKUB 1ZGHA 1IN1A 3JQ8A 1UR5A 1AKNA 3WLMA 3GGJA 1PT7A 2P90A 3M34A 3OEWA 3DYIA 3RSCA 2RK3A 1VMEA 2Z5VA 3WLPA 2V7WA 1G16A 1X0VA 5K51A 4EMTA 2OA0A 4EG4A 2P2SA 5JZBA 1CFJA 1H1DA 1BJKA 3B20A 4GPD1 4LCBA 5K4HA 4IOLA 1TD1A 2OOSA 5FJIA 1IVSA 4P7FA 4M8SA 3R7SA 5K4AA 3RG2A 4WOCA 3MLAA 4OQEA 5EJGA 1P4GA 5K8CA 3WQRA 1KI7A 1RQPA 4IIXA 2WJ6A 4HH1A 3R3YA 2L0XA 4GECA 5HWSA 5HRAA 3EG9A 1K0FA 3RCBA 1T8UA 2KLBA 4EB6A 2P67A 1KDTA 1N5LA 5JSYA 1IY8A 2Q6VA 4EG5A 4URZR 2J9GA 5YASA 1XNHA 3C7DB 4FVTA 4JOSA 3FOWA 2EATA 4LHYA 4EI8A 2WSSD 1DELA 4GMHA 4IS2A 3FVWA 3IPXA 4HDQB 4LGCA 2J3JA 3T1HB 4H60A 4D74A 3EHEA 3FDFA 2WVJA 1Z2NX 3COWA 4ND3A 3RGWS 2R6HA 3OQNA 4U6SA 3SD7A 2OORA 3FROA 3ULKA 3KHTA 4ZVLA 4EHAA 2FEWB 3IPCA 4MVCA 7ABPA 3ZHSA 1A4XA 2XOEA 3N1UA 5ADWA 1W59A 2VHVA 2EJWA 4QOIA 1SHLA 1F8YA 4DG8A 3LA8A 4ZVPA 1YBHA 4Q9AA 1OYYA 5C34B 3VR3A 3V2IA 4QLAA 1BW9A 1E6WA 2GCNA 3FWKA 2RKBA 1LC0A 2MYNA 4JYAB 4BO9A 2H06A 3AI7A 5JQGF 2FEKA 3ER6A 2FP4B 3CURA 1LQTA 4II3A 2PE5A 1GQQA 3QE2A 4IHJF 5JD4A 5KYYA 4C1NA 3FDJA 221PA 3DLTA 4GXNA 3LD9A 4LOHA 1R8XA 3A37A 2E82A 4QKQA 3UMVA 5H80A 4YI5A 4FOLA 4OMUA 2C29D 4F2WA 2CDNA 3UYLA 2YFKA 4EEKA 1RM5A 3C7CB 1T9ZA 1JSXA 4P80A 3V1LA 2YXDA 4J4TA 1XIVA 2G1UA 1NSYA 4XUCA 3TIFA 1E1LA 3DF9A 4CMEC 1JKJA 4WFQA 1GYRA 1NWCA 1OYOA 1USUA 1CP3A 3NLLA 4TROA 3W1VA 3K70D 5AKXA 3I12A 3SYRA 1ZQ9A 2H9YA 3HYLA 1QHSA 2XVAA 5CG1A 5KKAA 2HLDD 4B74A 3OIYA 4MOWA 1QG4A 5DM4A 1AT1A 4E51A 2O0KA 2YMQA 3L0PA 4X95A 1L7RA 1MJNA 2XUQA 1ULUA 3LS2A 4H31A 2QZZA 1P1RA 2Z9DA 4X93A 2WT9A 4AI6A 4PO3X 4ZZ0A 3PHBE 3PC2A 5ER6A 4R84A 2XDQA 4C20A 3OPYB 3ME5A 3WDMA 3AEUB 1IRXA 1LA2A 1G7CA 1TJ4A 2QUJA 3CSUA 4JXXA 1WM1A 2HRBA 2E4WA 2HX1A 3A6GA 1MLDA 4LV5B 4DSZA 1Q2UA 5CA0A 2Z8YM 3EG5A 2ID8A 3Q87B 2PL3A 2PCLA 3AF1A 1DO2A 3UWMA 3O2QB 4ZV9A 2P27A 4UTRA 2UUAB 3W9SA 3OMXA 5KREA 3OTWA 1FVFA 2P40A 4BTVA 3EXFA 2CFRA 5GY7A 4WZ6A 1CY7A 5JZMA 1QU2A 2WV9A 3SR4A 1LRKA 5ECGC 1IY2A 1E5XA 1OBFO 2GLXA 5ESXA 4ZEXA 1XKLA 3ZW8A 4CLXA 4CTOA 3I3SR 2VDPB 5HIKA 1RLJA 1OWNA 2Q46A 4EJSC 3WNZA 5LLDA 1HE2A 1JQBA 1G6OA 2O2EA 3LX6A 5DI3B 2AOTA 2Z2ZA 4L02A 2VA8A 3LJKA 4V1CB 3B6ZA 3HHEA 1GU0A 2VP0A 4WUTA 4XM2A 1RJEA 2Q3JA 4L6AA 5KNCA 2D8AA 2D4HA 2C2OA 3IVMA 3FWHA 3T41A 2DUUA 4UJ3A 2PKYX 4ZYXA 2X1HA 1PEYA 1HLDA 4TPKA 4B0OA 3A3OA 3B6MA 2I67A 2IP1A 4NNPA 4CIXA 4IVPA 3RW9A 4R69A 5F5NA 4B4WA 1KQPA 2EKBA 3G79A 5A7GA 5M34A 2ZG6A 2BGWA 3VYSB 3KTAA 3UHFA 3L43A 3OICA 2XT6A 4FDMA 3MXTA 2GA9A 5ENZA 3VPHA 1ZFNA 4I0WB 4BP9A 3QPCA 3LLMA 3N2IA 4M1ZA 3IQIX 2YWHA 5EIBD 1ZIXA 5K8VA 1W5EA 2YDXA 2VNHA 2Z56A 1VGVA 5CM2Z 1Z2CA 2WIDA 2TYSB 1XD8A 1J90A 1DXQA 2IIPA 3AKDA 4X64B 4XDGA 2CKMA 1MHTA 3QKUA 4PWZA 2G63A 2CDAA 5DWVA 2GO7A 4FFBA 5AOCA 1JKFA 4LW8A 1G6Q1 4M7RA 4MRMB 3TF5A 2IU3A 1TYEB 5FWYB 2XCOA 1TZCA 1JLSA 4JL5A 4M7PA 3F73A 3N39C 2J46A 3Q7RA 4JCCA 2R11A 3LP8A 2YH2A 1RYYA 4FN5A 3TW8B 3RAPR 1QBGA 4HWOA 1ZW1A 5AQEA 4WKBA 2QR2A 4ZI2A 4P4GA 1XRNA 1T3LA 3ZNNA 1EXMA 3M4JA 5J4VA 1ZU5A 3THSA 5JMPA 4FEYA 4HTFA 4AB1A 1J49A 2E37A 3OE7A 3H65A 5EWMB 3TMYA 1ZXXA 7AT1A 3OD5A 2XTMA 3BCRA 4RCZA 1Q15A 1HBJA 4FGLA 1I7PA 2QVYX 2DY0A 1LVUA 2P7IA 3Q5EA 1LJ8A 1HEYA 2IX9A 5KPDA 3M9WA 2BCGY 4AMUA 2JEYA 1NTOA 1YNOA 3RAEC 1RR6A 4G56A 1R0BA 3T5CA 3D2LA 4GBGA 4IKOA 2CN1A 3TMAA 1HDIA 5CNMA 4ONEA 3TQTA 4J1NA 4ZQFA 4EUFA 4CR6A 3EQ8A 3SSAA 1B6GA 2W2OA 3VZCA 4PLPA 2F43A 3AFHA 3E61A 2OVBA 2AN3A 4PO1A 5CD1A 2OO3A 3PRKE 2WF9A 3QBDA 4OYYA 5J59A 3C1UA 4WUVA 5AJWA 1M33A 1EHIA 2HEIA 2PGXA 3L41A 4TMVA 5ALRA 1KDRA 3RK0A 2IEGA 1CRPA 3NAGA 1YOBA 4Y6PA 3KAKA 4CPDA 1LLQA 1OREA 5KJ6A 5G4KA 2W2KA 1NAHA 3DGEC 2VYCA 2MMGA 4II7A 1XPOA 1XPRA 2C54A 4GZLA 5JDCC 4K2AA 4B34A 2XKAA 4OGKA 3P9PA 3L8GA 1F4VA 4HTAA 4EH1A 4DBVO 3UXMA 2H57A 4Q7MB 4WXHA 5AQ1A 4ZYVA 1UWCA 2QKYA 1Y3BE 2V9PA 4L7VA 4BUCA 4CETA 3SSOA 1JWBB 1NDHA 3S2EA 5MGNA 2A86A 2ZSJA 3CW8X 1YBFA 3WHPA 4M1YA 1KPHA 5BQ5A 5I7EA 1OFHA 3I8OA 1VPTA 2ORIA 2FPSA 1PYOA 4J0DA 3G0DA 4Q3OA 3AVVA 1DIBA 1E2FA 2Y0DA 4ZALA 5H68A 4G0NA 2ZI5A 1K6XA 1VFPA 3BFJA 4HTFB 3HGTA 3O47A 3CEAA 3Q6NA 2FB9A 4KLRA 4Q6BA 3PEWA 5KQMA 3AVUA 4CMIB 4Q7QA 1NRXA 3I34X 3MJRA 5HS6A 3IYLW 4D81A 5EXDA 4Q18A 3U13A 4L0QA 1QLJA 2J7PA 3IP1A 4ARSA 1W47A 2YICA 3HJUA 4UVGA 3HMQA 4YJ2F 3DCJA 3Q5DA 4EKYA 4CMGA 1JLRA 1QE0A 2JARA 3HA3A 2JCXA 1Q50A 3CA8A 4LV6A 3VC3A 1U8UA 3LXXA 3K0AA 4AWXA 2VJAA 1DAMA 3LZ6A 1AMOA 1Q92A 1DWOA 1W8DA 3K9QO 4C7KA 2VR1A 2VT2A 3KR1A 3O91A 4YV1A 1BH6A 4GRDA 5A6SA 5GJBA 1L7VC 1Q7RA 2NADA 3V8RA 2PH3A 4XCVA 5AMXA 1VI6A 1Q16A 1WXXA 2IE8A 1QF6A 1YZGA 4V38A 5A4JA 4X1YA 1NJ8A 5GQSA 1H6AA 1JDBB 2V55B 2WWGA 5D2CA 3EASA 3DMHA 2JH8A 1A9OA 3GT4A 3SNKA 1JPJA 3ACDA 3OFVA 2UDPA 3GBVA 3VPAA 2P6UA 2FSIA 2ZJYA 5BXYA 2BFBA 1I7QB 4YMWA 5KCMA 3KUCA 2G80A 1GJRA 2KM1A 1XAJA 4UPDA 2OGWA 1MQAA 3BE4A 5JCZA 1M1NA 1UJ2A 4E94A 2P2YA 3U0BA 3WYFA 1SD5A 1Y8CA 1C29B 4IMPA 1PJ4A 4QU9A 2QVGA 5CDUA 1B1AA 4OB6A 1AS3A 1U1DA 1N2EA 1ZJ5A 2PT7A 4UFNA 4KO4S 3OU6A 1MG5A 3OSUA 3RSGA 2DGDA 3EPHA 2FMIA 1E3SA 2BFEA 3RSSA 1H85A 2GASA 5TNXA 5TQ0A 3ITDA 3T3IA 4R51A 2PRZA 3QW4B 1TAQA 5AW6A 1K5PA 2FEAA 4H4DA 2J0UB 3BD7A 3ZHVA 4MI3A 1DBSA 3BIXA 3R6LA 3B1XA 4HFMA 1CKEA 1TJ5A 4I9UA 4BFXA 1TVKA 5B30A 2VJMA 1RZ3A 5AVYA 2I80A 2VK2A 1K9SA 1U0NA 2XNKA 3H6HA 3UT6A 1J9EA 5GOTA 3W4IA 4CL0A 3WLHA 2VBCA 4D5EA 3GEBA 1TYAE 4BQIA 2Y0CA 1HYQA 1WXDA 3TZBA 2RI0A 3NHLA 1JT9A 1O5TA 2QROA 5D3MB 2VYVA 4R7TA 3ON5A 1X7XA 4PC3A 5EQDA 5KU7A 1Y8RA 3COJA 1NW3A 1UWKA 3EVGA 1KMMA 2Z3ZA 3B9BA 5LQNA 4YBZA 4TXLA 1BGXT 3KQYA 4JYCA 1ACMA 4RE5A 1N32B 3VHLB 1T6NA 3G0HA 5FYQA 1N5MA 1I0LA 2I66A 3KC2A 4MV9A 4RS4A 3BL5A 1BVUA 3O74A 3Q7SA 4OMCA 3L0BA 2O5EA 3J7TA 3WISA 2WYOA 2V3VA 1JNYA 1QB7A 2XE6A 1S8AA 3M4YA 4D96A 4TMKA 1JIXA 2QQFA 1XTJA 3M7IA 5CNIA 3BIJA 4AJEA 4CMAA 4DA7A 1U1CA 1ZKMA 3UT0A 4NKRA 2BHSA 1WUTA 4Q3NA 3W5DA 3OTQA 1DZ3A 3V8MA 1H6CA 4AURA 3M8KA 1Y6ZA 1EGHA 1ISHA 4M0LA 2WMYA 4LMRA 3RHSA 2XCRB 3KOZA 3PL1A 1YHYA 2J5XA 4HZIA 1L2TA 2ADFA 1IWPB 1QOQB 1XA0A 1W8IA 1V48A 2PHZA 2XHZA 3N75A 5FA6A 3SJAA 4BO0A 1YZQA 2DKOA 1EXWA 1O8CA 1MQSA 4OI1A 2AR0A 2C03A 2JD2A 1AKEA 1ZD1A 3ZHXA 1T1GA 3L7IA 2XZTA 2BMFA 4JR1A 5FX2A 1M1UA 4MYRA 3K05A 3STUA 2REXB 4D9HA 4TTVA 3LIIA 1NF9A 3S2GA 5ICEA 1LWNA 2VYNA 1Q74A 3DQZA 4FYVA 1TO1E 4J0IA 4D9EA 5IVPA 1S2IA 3GRAA 3S4YA 4XVUA 1ODLA 2FPXA 4EPWA 2IOFK 2WYVA 1EFHA 1HK7A 3KB8A 3PNKA 2Z2YA 1XZNA 1RHRA 5HFNA 1NQUA 3H5LA 3QIVA 3K35A 1HZZC 1J42A 2FPUA 1X2BA 3KQQA 1JFTA 4G2NA 4XJTA 1KJ8A 2I33A 3WSTA 1LBHA 1HRDA 3ONEA 1YCFA 1YI8A 5T6BA 3RIXA 2G70A 4YRJA 1M1NB 2O7QA 1GVHA 2CJFA 2JAOA 2QNIA 4QO7A 5LOVB 1RYMA 5K3FB 4RNDB 1XVAA 2FSUA 4TSFA 3U7IA 5K0CA 4LPSA 2FMHA 3BREA 5DTJA 3H1EA 2VRBA 3SS9X 5JJBA 4PRYA 4OHFA 2HYIC 2GEJA 2M98A 3VV2A 1I10A 3NGXA 3O8OA 4DMCA 4YN3A 1T3HA 2DY1A 4KREA 2H54A 4G9BA 4DNPA 4HNQA 1C30A 3BSFA 2GJ4A 4O4JA 5SZJA 3ASYA 5CAEA 2ALJA 5KNDD 2HQBA 3HUUA 4XX1A 5CLGA 4PYMA 2JBAB 4FMPA 4TLCA 3ZOZA 2F17A 3DBHB 1X7XB 4RQAA 1QQTA 2R25B 4A23A 4JU9A 2P1ZA 1ADYA 4Z0PA 5HEKA 3NUGA 1GPWB 4DDMA 4O4HA 1QHEA 2QTCA 3E3NA 1C8KA 2O07A 3JAWB 3JZDA 2ERXA 2A3NA 3KBBA 3DLPX 4Q4JB 5FUVA 5BR7A 1O6BA 2WUVA 2D5LA 3VM6A 2WFLA 1XSEA 4PIVA 5KTPA 1L5HB 3HPRA 2LCQA 3T1TA 8MHTA 1TGYA 4FLMA 2WIGA 2CUTA 1UC4B 4J0GA 4ZCTA 3D7LA 1V16A 1PGOA 2MSEB 2UVPA 5FWXA 2R86A 3IEPA 4CN9A 1PAUA 1QH1A 1XDDA 2ODQA 2G1KA 1GEEA 1U8TA 2OM6A 3PQCA 3QY9A 4LQDA 4NL4H 4R05A 4H2DA 4C5AA 3NHJA 4HXGA 5JH7A 1JG6A 3RROA 1DKNA 3RH0A 3GP8A 1G5QA 3RVJA 5GWXA 2JIMA 1LSUA 4KW7A 2Z6VA 1KDVA 1JMVA 1QCYA 1PR4A 1XVLA 2CB0A 4G0QA 4MYSA 3R44A 3W2HA 3WJAA 5K09A 1Z16A 3PA8A 5ECYA 4R6XA 1T15A 1WO8A 3LVBA 4AIIA 4G3XA 2XW6A 1F6DA 4GE3A 4ZVTA 1WV1A 1BXGA 4IIEA 5JNUA 1Q0HA 4QUIA 4RTPA 3TPCA 5JDIC 2H17A 2XOKA 4RZHA 4XLTA 3C3EA 3HR8A 1KO1A 1U8YA 2QQ5A 2X41A 1KMHA 4X1OA 4ZXFA 5FBVB 4WCVA 3FAZA 1VLLA 1RC8A 4E46A 2YZ2A 1SKMA 2ZFUA 5DO9A 4HFNA 4HDKB 5KDLA 2RGGA 3IV6A 4QDZA 2FKNA 3KXPA 2XWBF 4JMLA 4QFBA 1IOZA 4BJ3A 1B8UA 4DNQA 2MOKA 2J7PD 1W34A 3L8MA 4NEQA 4MA0A 1B74A 2OFOA 3GVPA 3RC7A 1HG0A 3WRXC 1RZRD 3I61A 3AB7A 3A4IA 3CB4A 4HMOA 4YONB 4YRKA 2HMYB 3AIKA 3S2UA 2ATXA 3WA6A 4EUHA 5HKAA 1QOPB 2GA8A 4Y98A 1B42A 4YUZA 2KLHA 3AILA 4S3MA 4BFSA 2ZW9A 3CVVA 1G5TA 4LJLA 1Z4IA 3GJQA 2XOXA 4MA5A 3TG2A 2OBXA 5I8ZA 1L7NA 2EJTA 3G0BA 3CT4A 4B7ZA 3HK2A 3VNRA 1DJMA 3B9PA 3ETHA 3BFPA 2OCYC 4Q4CA 2JAWA 1E0JA 2X1VA 1RPJA 5AKEA 3GUUA 1UJNA 4KZPA 1K27A 4MW4A 5EQJB 3UOAB 1HKHA 4Y0AA 1SUSA 2AFRA 4MWSA 1V4BA 1RBMA 3D31A 5D8DA 5C5CA 1Q7CA 1PR2A 4NBKA 2E6KA 2HLHA 3WAKA 1RT9A 1BWRA 3QUCA 3EGCA 4Y6GB 1W49A 5F35A 2C9OA 5J5CA 1PNTA 1HQCA 4PYIA 3QE3A 1ZK1A 3OFSA 1SZJG 2V74B 1CF2O 1H8HD 2OBFA 3QXCA 1KEZA 1JQ5A 1CQIB 4FDVA 2A5GA 3HJCA 4WKPA 3IIIA 1H5QA 3CGGA 3FN4A 5AJUA 3T15A 1SA0A 1U3UA 4DW8A 3QFHA 3WYAA 2FW6A 4MWZA 1T2CA 4C4YA 5HQTA 1V16B 4YJHB 3GOQA 5AK5A 1WUJS 3AG6A 5JR3A 2OL4A 1KIFA 2WA1A 1Z63A 3NZEA 2Q2VA 1A1SA 2WU4A 1JSRA 4BLUA 3OLXA 3OCXA 4RXUA 2C2GA 5JS7A 1U81A 1JTVA 2AOVA 1J23A 1R4MB 3DXFA 4ZYWA 1HQDA 2LVBA 2OHGA 3MTJA 4CT4B 2WJYA 4ZHQF 5LXTB 3M3DA 1NJ6A 5F2OA 3HRIA 2HZ7A 3D02A 5FI3A 2HW8A 2VZLA 1N4AA 2GD2A 1E7WA 1YJCA 1ZH8A 3R0VA 4P34A 4TVBA 2QQ0A 2ZI3A 2E5LB 4KI7A 2PJRA 3OSZA 5FOWA 3IRUA 3PEVA 3WMEA 1UZLA 5CH5A 4QDJA 4RY9A 2OD9A 1ZG3A 3I6QA 3JZAA 4KYUA 4UU1A 5IBPA 4K9QA 4X54A 4FS8A 1IMOA 2F64A 2M6KA 3RANA 1X8LA 3K2BA 3P5SA 4GNKA 5EPEA 1TE2A 1VSQA 4TYWA 1BXKA 2CL7X 2ISQA 4LIPD 2IDMA 1C80A 1R0ZA 4UVHA 4JLKA 1WXGA 3GQBA 4HH3C 4QTUB 1EQ2A 4UPVA 1R0CA 1CB0A 1X2EA 3PUVA 2IY7A 2I2DA 1YNSA 3QFSA 3TTXA 2C2HA 2CBGA 1FNCA 3GQVA 1Y89A 3NYIA 2FKAA 3IL2A 2C8VA 3E81A 3VSDA 2AHOA 4AZVA 1RM0A 1YAJA 2B7BA 1RWWA 2WSLA 1THTA 1P2VA 2CLCX 3G9XA 3OUTA 1GEGA 2YHAA 2SKEA 3K0FB 5FT9A 4U7GA 4DHEA 2XGSA 2YDYA 4NQRA 3BJMA 1R8YA 3JXEA 1R9GA 1TRHA 3EEQA 4JFRA 4FBGA 3UZUA 1U9IA 1Y48E 2NMVA 3OECA 3L7NA 4ER5A 2IEBA 2BRUC 1KOGA 3LZCA 2HJ9A 2NVUA 1ZRNA 2OM2A 2Y71A 3NEJA 4ZT4A 2HDWA 2WYWA 3BEOA 5JRZA 3TQRA 4M1EA 1TVCA 3L7KA 1CUFA 3C6QA 3DUWA 1TKBA 1MXHA 3IERA 1FDIA 3TBFA 1ORTA 1NAIA 2FX3A 2PYDA 4IWXA 3NHWA 1L9XA 4TWIA 3PEUA 1BXRA 5AM1A 2PEZA 2QY6A 3CX6A 1XCJA 5DHSA 3UT5B 4TS9A 2VPYA 5AVOA 5LXTA 3FOEC 1JVNA 2OFPA 1AQIA 5FTNA 5TGTA 4UCWA 2ODEA 1NHWA 2QZ4A 3K92A 4ZTZB 4KQKA 4C6TB 4P98A 5CLQA 3T0IA 1NXSA 2CSUA 4LYFA 3TM4A 1D2HA 4D2IA 1CYEA 3GZNB 1FRNA 4FD3A 3RRMA 3TTWA 2PXCA 5BWNA 1A7AA 4F9TA 2B0CA 3CPJB 1NMEA 1J6UA 2OBBA 2YN4A 3RQSA 1Z5VA 3VSBA 2H0AA 4CKCA 1QXSA 1IATA 4Z4EA 4URYR 1D1QA 2HM7A 5DN9A 2PBZA 3U3JA 2R65A 4F45A 1ZOOA 1J0EA 3PVCA 1P3JA 1NX9A 1TU4A 2FPOA 1XDSA 2I2CA 3OJFA 4RQUA 1ADFA 4WWHA 3ZBQA 3ZE8A 5C1BA 3EPKA 4A0SA 4E09A 2R8BA 2VAVA 2W22A 5EIEA 4JEHA 3NANA 1SUCA 3KUKA 1P33A 5KNDA 1FFSA 3RSQA 4WHMA 1AM4D 5CEFA 1N4DA 3IT1A 3CKKA 3FIUA 1QO0A 3QG5A 3NCTA 4H1HA 2AW3A 3QKWA 5BNZA 3GMSA 4UC0A 5CPFA 3FLEA 1JIVA 2E5WA 2X15A 2XYPA 3LDHA 4NICA 2VC2B 2GSDA 4C88A 3KU4A 3LTEA 2C61A 4C7BA 4B7CA 3GGSA 1CD5A 1Z4KA 1KBQA 3EC2A 2OCGA 3MS4A 4GI7A 3R8XA 3U7RA 3RUFA 3SHTA 3VV3A 4YX9A 5JQWA 4GEGA 4YCDA 2R62A 5FKJA 2BCEA 2FPPB 4XD7A 2VK4A 2I4RA 1KY5A 2QUBA 1MA3A 4JL8A 4ZREA 1L5FA 4JLJA 3MT8A 1CIPA 3L1HA 2BR5A 3BRSA 4RW0A 2RC6A 2XEDA 4J1QA 5EOVA 3KU1A 2LD4A 4C7OB 3TI7A 4ZPJA 2B20A 3DV0A 2X40A 3ABOB 1GHTA 3PKJA 1M1YB 3EJ6A 3OVMA 3QOYA 4XSGA 2C59A 1ZGGA 3DV9A 3HSKA 4Q9LA 2Q62A 2LKDA 2F55A 3EGOA 4EVRA 5CA1F 3VPBA 16PKA 1NVDA 3CUSA 3V55A 2WHEA 2H18A 3QELA 1O9HA 2AQKA 4E11A 3UM9A 1FX0B 4R0NA 3AVWA 4GPZA 1G4UR 2YJNA 4X8LA 5LL6P 1L4HA 1QB8A 2LBPA 3KEQA 4FCCA 1VBMA 4S2UA 5LQKA 1QDUA 3AKCA 3DGFC 4GGMX 1HG1A 4C4AA 3M6AA 5JXWA 4JBYA 3FRJA 1P6QA 1V96A 4NOLA 4M60A 1XXHA 4GRAA 1SZCA 3ED1A 3AP2A 1SKYE 1TYDE 3H0KA 4JQSA 4BEBA 2QRVA 5A5FA 2BZSA 1P7PA 1KAQA 1E2GA 2VNAA 2O7RA 5BVGB 1YONA 4RKWA 3LVRE 1ODCA 2L69A 3B6EA 3GN2A 1CZRA 3PEYA 3ZW7A 1OH7A 1HETA 3DOJA 3ACCA 3TLMA 1HDOA 1DXOA 1PR3A 1TGVA 3HABA 3L6OO 4OHMA 2QVLA 1OZ0A 4G4GA 4P6VF 4PZEA 3VPSA 3BRCA 3E9MA 3N2EA 4LAFA 4RSGA 1QKIA 4DJAA 5EFZA 5HRUA 4H18A 5TF4A 5CMLA 5C51B 5BV2P 1IOLA 4HUQB 5BUSA 3GO4A 4P36A 3Q15C 1DE0A 1I9CA 1NYQA 4PCVA 4O0MA 4G1UC 5HIJA 3NX4A 4MV4A 3DZJA 5DNVA 1X1DA 1QTNA 1F60A 1RXCA 1ZXLA 2BJWA 2AOXA 2EKDA 3DB2A 4EYOA 3LCCA 3C8HA 1NI4B 1KZHA 1XALA 4L5YA 4K6HA 4UASA 4OREX 2HAEA 1XTVA 1ZCFA 2Q3DA 1E1RD 5J40A 3ZLJA 1L4YA 2C4WA 4PR0A 3RV3A 2X42A 4UREA 2G28A 3W90A 3LPAA 1JDSA 2WHPB 2GOYA 1RFGE 4B79A 2GZRA 4OO3A 4EJSA 2CYCA 5CX1A 1ADJA 2WWIA 5IASA 2HOQA 5LMNB 1AKQA 4V2IA 4Z4IA 3THXB 2B8JA 3G82C 3HDJA 4CM4B 3FUWA 2XYGA 4QTTB 3L8FA 1BX3A 3RT1A 4V1CA 4KH0A 5KWVA 3UHJA 1JYSA 3UH0A 4EGCB 3AESA 3GJXC 1R6TA 1REQB 4RHUA 2YXBA 1CDOA 3E58A 1T8PA 3A28A 3OQIA 2PMWB 3KLNA 3RTDA 5E1BA 1NTRA 1G18A 2PIAA 2WD8A 3LP5A 4EFLA 3WOVA 1V41E 3QX7A 3X2FA 1ZD8A 2WTBA 1IVNA 3KT3A 5AW4A 4ER6A 4A2CA 2QOEA 1BRMA 1KAEA 5AIBA 4EEXA 4XSHA 1IEVA 2DSNA 4M7OA 1OE0A 5ALOA 3ZE7A 4B35A 3WSVA 4IJWA 3SM9A 3EMKA 5IJWA 4AY4A 1MHPA 3I9V6 4BNVA 1P8AA 4YJFB 2AX4A 1S2NA 2X86A 3D8SA 4BFYA 1KVRA 3KDSE 4RHXA 4IUCS 2I65A 3PFIA 2YBEA 4WNAA 4CQLB 3K70C 1N36B 2F3PA 3A2MA 1J22A 3C39A 4S1VA 3UUFA 4DMHA 3UUWA 1HM5A 4KFTA 4PBTA 4US0R 1LLDA 1NP7A 4KTVE 2DXIA 4OLHA 3JQ7B 3SC3A 4BTLA 1ND6A 3SYNA 3U4QB 2XGGA 4KGVA 4W7SA 1MAHA 2N0SA 5I9TA 1W5TA 4PGMA 2Y1KA 5CT9A 2C3YA 5HPYB 3BE5A 3FHTA 1BRTA 1CDDA 1C0LA 1W96A 3GJ5A 3VDNB 4M54A 3BDVA 2NNWB 1ODTC 1YQEA 3A1DA 3C43A 4R2IA 2X5NA 4IKEA 1T4DA 2WYIA 3GUYA 1FUUA 2BHRA 3D7KA 3I05A 3MTIA 4I6GA 5JNWA 4HEA1 1RD4A 3DFMA 2H08A 3QWAA 3PHLA 2UU9B 1OLSB 3VNBA 5TDHA 1K7EB 2HK7A 4WLFA 1N8KA 3AUKA 3LO8A 5FORA 5FWYA 3DG9A 1UPUA 2ZRLA 1JXQA 3PXBA 1V4VA 1SB9A 2R7NA 3W8RA 4ALLA 1K06A 4RVDA 4EF5A 1N9ZA 2RAFA 1UUFA 2E5FA 2FWJA 3TLGB 4JJFA 4JV5B 4X8HA 1KJIA 4ZEVA 1JE1A 3UG6A 2IS2A 2YV5A 5JPDA 5HR5A 3E23A 4EW6A 521PA 3BDIA 2YUTA 2UV8A 3OLCX 5JU6A 1W85B 3GT0A 3C4QA 1X1RA 2BE7A 1JJVA 4ZT7A 4RY0A 2IX3A 5FI5A 1VKRA 3RU9A 3AF2A 2GM5A 4INZA 4ZOLF 4U9UA 1SIBE 3IUNA 2B6HA 4E5VA 1N6KA 3UKOA 2X9NA 1CUIA 3ZWMA 5C46F 4W1QA 1SUAA 1NVAA 1HC7A 4GVXA 4QBIA 4RPKA 3UHPA 3KQLA 1QUFA 3FZGA 4OK5A 1A9XB 5EY5B 5A3VA 1QIHA 4N0DA 5GZ6A 4B84A 2JFGA 2AXNA 2F4NA 4HP8A 1RPTA 1W88A 1EGAA 3WGUA 3C8MA 3S6JA 1OV4A 1BU8A 4B7XA 2PS0A 1L5HA 1N2CA 1IXRC 3K9NA 1NJGA 3SXPA 1XMQB 2WKWA 3BXZA 4FIDA 1DJPA 5CU7A 5BUZA 1XMOB 3O3MB 1XTBA 2JGDA 5BURA 2O2JA 3EZYA 4HQOA 2WK1A 1C1XB 5AWFC 3LUJA 2VK1A 4OUDA 5KX5A 4OP2A 3EXHA 2GWHA 1WDLA 3OM1A 1QJCA 1VE6A 1KSGA 4CQMD 1T5TA 4CKZA 1BKDR 2J0VA 3IMKA 3OPXA 1H4SA 4R8RA 2AOWA 4O25A 2IYRA 1ZM9A 1AKRA 1X9IA 3ABQB 2CCGA 1QF7A 1UKBA 1ZLXA 2IQIA 3H17A 1Q12A 3SIRA 4F97A 4MQUA 2F9LA 4W8HA 5JCOA 1VLJA 1MC5A 1JFFA 3ROQA 4DIOA 4Z1MD 3WLAA 2FN9A 3D3JA 2JLVA 4GZ5A 1RSZA 2Q8QA 4PSAA 4Y1FA 3LX5A 4AMZA 4A4DA 2FEOA 1JSLA 2F90A 3GFFA 3W1WA 2AG0A 4QWWA 5T8KC 3VVCA 4QSHA 3N2GB 2E18A 1PZMA 2VJQA 3N8IA 2O7SA 4U2GA 5JFGA 4KVFA 2MHCA 2QG6A 5HQ3B 2NG1A 3A2LA 2XWPA 3KQMA 1U7XA 1E2LA 1M54A 2WI8A 3EZ7A 4D42A 1RLTA 3V7UA 5I7WA 2AFIE 1KYVA 3JRXA 1T0BA 4PLHA 2IYFA 4RA9B 5BY2A 5AVUA 2CHFA 1P5JA 3E2PA 3KIPA 4I9FA 2B61A 1BE0A 2QMHA 3FUXA 1FU4A 2ASEA 3ORRA 4GOXA 1THGA 3WRYC 4O02B 3QVLA 1LCIA 1EFAA 1EUDB 1ZA2A 2ECPA 4MKZA 4WEQA 3W7VA 4OOEA 1QFMA 3R7DA 2CMGA 1FCJA 2O3QA 1WPRA 4JP3A 3MQ2A 1FYFA 1D1TA 2WSMA 3F3MA 3ZNOA 1Y9EA 3UJBA 3LP6A 2BR4A 4OJMX 3Q3JB 4F8JA 1AN9A 2ACKA 3OI7A 5EUBA 3FCSB 4HB4A 2GX6A 3K73O 3CX8A 5FV4A 4QELA 5FJJA 4B6JA 2Z9CA 3LPDA 9MHTA 2ONCA 2CBZA 2YQZA 4F8EA 5IC4A 4MMYB 1YC2A 1WWKA 2DR0A 3IAXA 4LG1A 2BTQB 3FKJA 3QX8A 5ECWA 1VCIA 2HHHB 4JJ7A 4YLEA 5FPSA 2Z3WA 3FOCA 3TOVA 4CM9D 3H3JA 2P5UA 4MWDA 3QOWA 2YVQA 3PF8A 2Y68A 1SIWA 5TJ9A 2IBMA 4HNHA 1NRWA 4BFLA 5CJJA 2D5BA 2HCTA 2SECE 3H11B 3AUUA 4KR6A 1GNRA 1BQ4A 1HGXA 4TL8A 4TUYF 2W2PA 2ZI6A 1ZQ1A 4FYYA 4K9SA 4CU2A 2YTZA 3TXAA 2Z58A 3Q1KA 4LJ8A 2CMFA 2F2TA 3IKMB 5EZQA 4C3UA 3JVVA 4HS9A 4KBGA 4XGNA 3RSFA 3U4DA 2MSKA 3D8BA 1KERA 4BMYA 5CDGA 4FGJA 1J1IA 2QUKA 2YNMC 1GIAA 2XRFA 2A3RA 2J9FA 2WJGA 3IR6A 3R1IA 1TK3A 4L4RA 4ARZB 4JDPA 3HXMA 5IKMA 3CPSA 1UBCA 1HR0B 2NQ2C 2DQYA 1I0IA 3G0CA 4IWYA 2JJQA 2PXHA 3DFIA 3T52A 3CUKA 3DTVB 4RL6A 3RBXA 1K8XB 3KV3O 1KAGA 1PF7E 3DFZA 1X7YA 3G9TA 3VX4A 1SA0B 4UCQA 4KL8S 4A9AA 1MMFB 2M9MA 2JIQA 2ZB7A 3L1KA