1I3KA

Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
347
structure length
347
Chain Sequence
b'AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAMGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNVVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-GLUCOSE 4-EPIMERASE
publication title Molecular basis for severe epimerase deficiency galactosemia. X-ray structure of the human V94m-substituted UDP-galactose 4-epimerase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 127
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1i3kA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1i3kA01
3VKVA 1XCBA 3VAZA 2O3RA 4F6LA 3JQ6A 3NDRA 1LU9A 4CLOA 5IJZA 1Z45A 1FXSA 3V1YA 4XR9A 1A7KA 1XEAA 3PWSA 2C2XA 1NPDA 2GN6A 2PGJA 1J4AA 1UDCA 2FMUA 1E7MA 1ADGA 1YBMA 3E18A 3RU7A 5CDGA 5CDYA 3C1TA 4D46A 1E7WA 4NFSA 1OMOA 1GUZA 3DONA 4EEZA 3PYXA 4PG6A 4RDHA 1I01A 3IUPA 1XSEA 3MJTA 3A4VA 3H9QA 4OOEA 4UVHA 2NACA 1DRWA 1R4MB 2CFCA 5CEJA 3LT0A 1P77A 1U8XX 1PJSA 1QYVA 2VHZA 2X9NA 1ZNQO 2Y0CA 2YQ4A 2P9EA 4OO3A 5ENDA 2Q4BA 4DLBA 5TSDA 3V2GA 4YRDA 1ZW1A 2HU2A 1WDLA 1KVTA 4QQRA 5CPFA 3W4KA 2VT2A 5EINA 1I2ZA 3FTPA 4CQLA 3KYDA 2I66A 4W6ZA 3PPIA 2YDXA 3EZYA 4W9NC 2J8ZA 5FI3A 4AJLA 1Y5MA 2X0NA 4L8VA 4YJFA 1KOLA 3S8MA 3VPHA 5LDHA 3EAGA 3SLKA 3M6IA 2ZIZA 5DOVA 3WGOA 3GR6A 4M55A 3PQDA 4OM8A 2VN8A 4PIVA 2WD7B 3HDQA 3NTQA 1BMDA 1HSOA 2FZEA 1SMKA 2OO5A 3UXYA 1E1MA 1R66A 1UZNA 5KTKA 3LU1A 5EPOA 3BMOA 4CM6A 1N1EA 2B4QA 3WFIA 1DC6A 1FDVA 2C82A 5HBRA 1HLPA 2PKQP 4XQGA 2I5PO 4FC6A 3VVCA 2V7PA 3EW7A 5DOZA 4NMHA 1SPXA 1UH5A 3KXDA 4RF3A 4UEKA 5I7SA 1VKNA 1DIRA 3WTBA 1GYQA 2C7GA 2VHYA 3CKYA 4B4UA 4O0LA 3JQAA 1T25A 3Q2KA 4BNGA 4NJMA 1NQAO 5JC1A 3QE3A 1ZKMA 3ASUA 3KRTA 3P5SA 2RH8A 5CG2A 3DBHB 5JMWA 4E5PA 4ND5A 4RDIA 2EJVA 3GY0A 1PQPA 2G76A 1H94A 3H9JA 2C20A 1ZXBA 4D3SA 1ADFA 3LYLA 1A7AA 2BD0A 5G0TA 1D1SA 4MINA 2NU7A 1BTOA 2O4UX 1PR3A 5BSHA 4U6SA 3JQGA 3C1OA 4B7CA 1K6JA 4UUNA 4DC0A 3W4IA 4W4TA 4QFCA 3FN4A 5C7IO 4AL4A 2GYYA 3IS3A 2ZQYA 5A3VA 1J6UA 4KUHA 3TZKA 4NI5A 3TZHA 2NQ8A 2DU8A 4U5QA 5TRTA 3BMQA 3NYWA 3CEAA 1H6CA 3JQBC 2W2KB 3DBRA 2NADA 4JP2A 4NJOA 2DTXA 1DO8A 3QQPA 1PL6A 1BVRA 4GI2A 4XJTA 3QVXA 2IEDA 5ILGA 4W99A 4BKQA 2AEFA 2RH4A 3U4IA 4NK4A 3A28A 2J3HA 1M76A 3AK4A 1A4UA 1A9ZA 1JWBB 5B4VA 1RM3A 3OJEA 5T8KA 3V2HA 1RM0A 3RROA 1LA2A 4XX0A 5CDUA 2IYOA 4OQZA 1HE4A 3U49A 1ORRA 2JL1A 1YB1A 2HQ1A 1NTOA 2B69A 3O9ZA 4A5OA 3RUIA 4XGKA 3MEQA 3IC5A 4XDYA 1YH3A 5U1PA 1Y6JA 1RM4A 2I3GA 2UDPA 2VZ9A 4BNYA 5TF4A 3UAGA 4KTTE 3D5QA 2Q1WA 4MKRA 1AN9A 4BKRA 2EKPA 4RQUA 4NG5A 2B35A 4BV8A 4Q3BA 2GRAA 4JJIA 4WJZA 4QEDA 1N7GA 4XQCA 3U4CA 2OFPA 4XGNA 3ZW9A 1Z7BA 1WWKA 2B5WA 4QUKA 4UAGA 5JLAA 1BHSA 1CF2O 3LC2O 2JCYA 2HK9A 1J5PA 1WLYA 4OYRA 3C24A 1R0LA 2CDCA 3NDIA 2NVBA 1N2SA 3WIEA 2PD3A 1F14A 1DRVA 3ZWXA 5TT1A 3FHLA 4J49A 3WNQA 1P1HA 2WYUA 1C1DA 3I4CA 4AJKA 4Y6PA 3MJCA 4QXMA 4QTZA 3MCVA 1EE2A 1H2BA 3R6DA 3V5NA 3PZRA 2V6GA 1OBFO 4MVJG 4NZ9A 2ZATA 2B83A 4UVDA 4YQYA 3Q2IA 3VPSA 5JAZA 2HK8A 2VWQA 1NFRA 1P74A 1V35A 3AM5A 3U9LA 4CV0A 2XPCA 3Q9NA 3H3JA 1TT5B 4PG8A 5KVCA 4IIVA 2E37A 1Y9EA 2YV3A 4XJSA 4U0KA 3ROPA 3JYNA 4GMFA 1I3MA 7ADHA 1P45A 3D3WB 3A14A 3NGLA 1GEGA 5BR7A 1KC3A 1PEDA 4ZQHA 3CSDA 2DPHA 5HS6A 5TLSA 2FOIA 3WJAA 3BTVA 4DIBA 5JYEA 1A9YA 1TT7A 5I8ZA 1B0AA 3F1LA 1DAOA 3IL2A 4J90A 2RHRA 3GK3A 3GQVA 2BMAA 2DUUA 3WFJA 1BXGA 3LC1O 4KZPA 2FR1A 3D4OA 3GVIA 3DHNA 2WD8A 3BMNA 4JN6B 4OAQA 2W8ZA 1CIVA 5CFZA 4XGIA 4EBFA 4YR9A 3KOUA 1U7HA 4EZBA 3DZGA 3STHA 3OQBA 4YCAA 1JKJA 2O2SA 3D1LA 1HLDA 2BFAA 1X15A 3PLRA 4A2CA 5HTOA 3L4BA 4RQTA 1J49A 3UW3A 1XIVA 4OKIA 4IJVA 3WSWA 1ARZA 4I9UA 1E7SA 1PS0A 3RWBA 1SO8A 1U3WA 3VH2A 1UR5A 3OQ6A 1E7RA 2P4HX 4CQMA 2P5UA 3PTZA 1XR3A 3RUHA 5K0ZA 5AOVA 1BXZA 2WTBA 4XDZA 5JCXA 4OXYA 4XD2A 3QHAA 4INAA 2PZKA 2Z95A 1EQ2A 1YJ8A 3F9IA 4ZN6A 1ZSYA 3GPDG 1RYDA 3TWOA 1I10A 5F5NA 3GPIA 1QYDA 2B36A 2QZZA 1UAYA 4QO8A 3ZWBA 4B79A 4IQ0A 2GUGA 1TLTA 5TJ9A 1T2DA 4J7CA 4IGEA 5COQA 4Q3DA 4RF5A 3U62A 5I7FA 1NYTA 2AEMA 2Y1OA 3NRCA 3OICA 3RFVA 3LLVA 4FB5A 3I9JA 4L9RA 4IY1A 3L9WA 1GTMA 5A1TA 4XYLA 5KKAA 3WWZA 1YGYA 4YBZA 1BG6A 2Q2WA 2GZ2A 4TKMA 3UCFA 3A9WA 4D3FA 3LDHA 4PLHA 4ZA2A 1W8DA 2IE0A 2RCYA 4A0SA 4DBVO 3UF0A 4UREA 3U3XA 3UH1A 3LT1A 4DMMA 3P19A 3BMCB 3OETA 1PWZA 1DRUA 1M66A 1T2FA 4N18A 3QWAA 3DOJA 5H81A 5GMOA 1I30A 2ZYAA 5JDCC 3ANLA 1MXFA 1OFGA 4CR7A 4ZQFA 4DMLA 1MC4A 4RPGA 3ZU4A 3IJPA 1UDBA 5IDQA 1F06A 4NPCA 3AOEC 4PLTA 3ZCXA 5L40A 3U09A 4JJGA 4E2YA 1HDYA 1YBAA 2IEBA 5AXCA 4RVSA 4EYEA 4D7AA 3ETDA 5CDTA 1WAMA 1SEVA 4L74A 3F6YA 2WD7A 1I3NA 4XYEA 2Y0DA 4CLOB 3ZHZA 4J9UE 1ONOA 3QVWA 3DAGA 4S3MA 1PJ4A 4OJNA 5KWEA 4AJJA 4IDAA 5IZCC 3ST7A 1OC4A 1FDUA 3DAFA 2O3JA 3M2TA 6LDHA 3O4RA 3CPSA 3DHEA 1ISGA 2FPIA 2ZYGA 3PGXA 5A06A 3NTRA 1G0OA 1VJTA 3HUDA 3OIDA 2C5EA 1IPFA 1Z82A 2PZJA 4LRSB 4NR0A 4M86A 5EMHA 1PJBA 2EXXA 1HZJA 4NK5A 3PEFA 4I5FA 4ILKA 4R9SA 3R0IA 2CZCA 2OORA 3LF1A 4Z3DA 2NLOA 4CMGA 4YAKA 5K6AA 5ER6A 3TFQA 1GL3A 3OA2A 1MXHA 1QMGA 5KKCA 1ML3A 3G1UA 4BKOA 1NQTA 5JMPA 2HSDA 4CM8A 3GNQA 4E2XA 3VZSA 5BNIA 3QVTA 4FOOA 4YJFB 2BRUA 3ETEA 1U2DA 4CLHA 2PD4A 3DWFA 5JE8A 1I3KA 4PCVA 5DP1A 3SJUA 2VUTA 3HFGA 1PGOA 1T24A 1U28A 4R3NA 4BNWA 3AUAA 1DJNA 1P3DA 3TOXA 2Y05A 2AQKA 5CDSA 3JD4A 3AFNA 4CV3A 1ISMA 4D0RA 4Y6RA 1YS4A 4CLEA 1IUKA 1GEEA 1FDWA 1EVJA 1VSUA 4H3VA 2ET6A 1KS9A 4LK3A 1GCOA 4TZKA 5JXWA 1Q0HA 3QJ5A 1G6KA 4PLGA 2VNSA 1ZMOA 3Q3CA 2ZTVA 2OZPA 5TT0A 3JQAB 3FNEA 4P8RA 3WQRA 2VNAA 1B7GO 4J1QA 1KEVA 3PYMA 1YBVA 3KUXA 3AM4A 4L75A 1HT0A 2CSUA 4UUPA 1YXMA 2JCXA 1SCUA 2PKQO 3S2IA 2UVDA 4TKLA 3VZQA 2HMWA 4CMEC 1RKXA 2DPGA 2VOEA 1LDGA 2J5KA 3TQHA 3PIDA 3I4FA 2D59A 4CM5A 3HADA 1HYGA 4PG4A 2PWZA 2JFFA 3JQGB 1D1TA 4WE3A 1YVEI 1O8CA 2C29D 3E5MA 5AQ1A 5EQFA 4YWJA 4KQXA 1SC6A 4PVCA 4BNVA 5AXAA 2OHXA 3RUCA 1T4DA 2OL4A 4WLFA 4NFHA 2PGDA 1ULUA 3CMMA 3UFXA 3BMQB 4BQPA 4FN4A 3NKLA 4RPKA 2TMDA 3V1TC 1F8GA 2AHRA 3UGKA 2NV6A 1KVUA 1V8BA 3LZ6A 2VYVA 4RVHA 3HDYA 1KVRA 3E03A 3IP3A 2A35A 4Y67A 1P1JA 3K2BA 1IB6A 3SC4A 2BLLA 2Q49A 3WTCA 1JU9A 3ASVA 4XQ9A 4WCFC 1YB4A 4P38A 1TT5A 4M49A 2D5AA 5KVVA 4FR5A 1PGJA 4YDRA 3E9MA 3VTZA 5I9MA 4JJFA 1ID1A 3LQFA 4HNHA 4M89A 4UVIA 1R6DA 3ZNQA 4PVDA 3VTFA 1LTHR 1W6UA 3GDOA 3SC6A 3D3WA 4QT0A 4HWKA 4MVJI 1WZIA 4HFMA 4RZIA 1D4FA 2J5RA 4ITUA 3WNVA 1EUDA 1GZ6A 3H9GA 3IUSA 3OH8A 3MWDB 5KJ1A 1YRLA 3C7CB 1X14A 4WLOA 5AVOA 4DLLA 5FI5A 1UP6A 1OC2A 3D4PA 4BO5A 4MJLA 2C2YA 3KTDA 3RVDA 1MV8A 2GDZA 1EFLA 4CLXA 1RM5A 2ZTMA 1HYHA 4IQGA 2EP5A 3PHLA 1DDOA 1HDZA 1PS8A 1E3WA 4P4NA 4J1NA 4N54A 3WGYA 3R3SA 4ZGWA 4Q3CA 4DXHA 2YV1A 2W2LD 3AWDA 1PX0A 2Y0EA 2P9GA 1ZJYA 2VWGA 1C1DB 2WMDA 4XYMA 3JQAD 2GN8A 4ND3A 4Q3NA 1A72A 2GN4A 4HUJA 4J16A 1P1RA 2C7VA 2Y67A 2O2YA 3WWYA 3JQ8A 3JQFC 4FGSA 1LLCA 2PH5A 2CNBA 5BNFA 4CL8A 5T57A 3WGIA 2OMEA 1H6BA 4NHEA 3H6KA 4IMRA 4YA6A 3EZLA 1QLJA 3C1AA 5JDIC 4CLRB 4Z6KA 3AY7A 1VLLA 3H2SA 1LDEA 2VCYA 5IG2A 2DM6A 3CE6A 4FW8A 1YB5A 1E5QA 3C8MA 3DMYA 4GGPA 4KWIA 4GAEA 4NH4A 1XLTA 4NNJA 3TN7A 2ZB4A 4YPOA 4YYZA 5DP2A 1LC3A 4RGBA 1JQBA 1DC3A 2Q46A 3PYLA 4BUCA 4MVJA 3PWKA 4XIJA 4XR4A 2GERA 1LSJA 2UAGA 3ENKA 4A03A 4DREA 2YFQA 3QWHA 1GUYA 3EUWA 4E31A 1PQWA 4IXTA 1SBYA 1DSSG 1Z75A 2BGKA 3PZBA 1K5HA 3P2YA 2VQ3A 4C7KA 2J3JA 4DLAA 4Y8VA 4HFRA 4KOAA 2UYYA 2Y1CA 3HSKA 2Q2QA 4BVAA 2OP0A 1B3RA 1ZK1A 3WYCA 3BMNB 4EGFA 3KYBA 4AG3A 1E92A 3AUSA 2Q4EA 1N7HA 1ZZEA 2EKLA 3I9LA 4IDBA 4L73A 4DPLA 1LDYA 4MVJM 5JAMA 1K6XA 1PWXA 1K0UA 1NQOA 4YT2A 1GDHA 3WMWA 4IUYA 3I9KA 2VTEA 3JD1A 3WGZA 4ALKA 4PG7A 3ZU3A 5A9SB 2VT3A 4CV2A 2R00C 1Z73A 1DIAA 1O9BA 2G1UA 4CQMB 4E5YA 5L7YA 3H65A 1OOEA 4FFPA 1PS9A 1HE5A 3TPCA 4ESOA 4FQ8A 1WNTA 3ONFA 4RCVA 3CTMA 3KETA 2H63A 5DBIA 3WGHA 3NAQA 4GX5A 4J4TA 5IDWA 1IHXA 2ZTLA 2V6FA 4F46A 4JBHA 4RPLA 4Q39A 3WGTA 2PA3A 3B1FA 3VDRA 3N7UA 4BO7A 1PJTA 2GO1A 5CHEA 1UZLA 5DT9A 4OSOA 5BT9A 5JC8A 2O4CA 1QYWA 3P2OA 4IS3A 3K73O 4KMSA 4J1SA 4WOJA 5B12A 4MIOA 4DIOA 1U7TA 2HRBA 3DZKA 1ZSVA 1D7OA 1UXHA 4IDCA 4B4VA 1P1KA 2EW8A 3FNHA 4BMSA 5IAAA 4FPXA 2XXBA 1QKIA 3FSRA 1HDXA 2I99A 1MG5A 1NVMB 3WX0A 5AYVA 2BFMA 3KSZO 4IDGA 3WXBA 2J6IA 1ADBA 4LVCA 4ID9A 3OJFA 1MB4A 1UUFA 1V3UA 3OA0A 1DB3A 4FJ2A 4R1TA 1JN0A 4P22A 3EVTA 3DXFA 2X86A 4BGEA 3AI2A 3PFFA 2DT5A 3WYEA 2J5QA 3OJOA 1NAIA 3DMTC 3E82A 2AEJA 4AJ1A 3MTJA 4E2ZA 3SBOA 2Z1NA 4KUGA 4QX6A 3GN1A 1HZZA 2AE2A 1ZK0A 3AY3A 4B3JA 3ZGYA 4BQRA 5JW6A 4FFOA 2BFPA 3JQ9A 4GH5A 2W2LA 1YO6A 2CF5A 5F1OA 4ALIA 3D0OA 3ZV3A 4PRLA 3JTMA 1QXSA 3M2PA 5KJEA 3BYZA 3I52A 4R54A 3PHJA 3HE3A 3RFTA 1YQXA 1ZUD1 3C7DB 4CQMD 3KYCA 3T7CA 1GQQA 4FBGA 4A10A 2RIRA 3QVSA 2NUAA 3H2ZA 3ITKA 2YQ5A 3MTGA 2HK7A 1Q7BA 2A94A 3Q6IA 3GZ4A 4OGWA 1OAAA 1LQTA 2PY6A 4CMBA 5I9NA 2IZ0A 3DBLB 2PV7A 2NTJA 3PWZA 4MVJF 1RPNA 1C1XA 3U0BA 3L4SO 2DQ4A 3ZWWA 4D43A 1X13A 3VHRA 1M75A 4CMKA 3NV9A 4CM8B 4HFJA 1C3VA 1GYRA 5ES3A 5TC4A 1B8UA 1KVSA 2W90A 1V0JA 1KIFA 1M6WA 4U0JA 4JQCA 1F12A 4RZHA 1JWAB 5L3ZA 3GEGA 3RUDA 1OI7A 1U3VA 3K6JA 1CQJA 1R0SA 2X0RA 4GSKA 2VRBA 4B3IA 3L6DA 1BXKA 4XZ3A 3S2EA 1PJLA 2QRKA 3BTOA 3I83A 3MZ0A 1K2WA 2NVUB 1DFHA 2WJPA 2D5CA 3D64A 4MVJP 2X9GA 2X1HA 1P1IA 1Z6ZA 4ZQEA 3EHEA 3KLPX 1O5IA 5ILOA 3PK0A 3GNTA 5IN4A 5TX7A 1SB8A 1XKQA 3T4EA 2BFOA 2OP1A 5JO0A 4RPHA 2Q99A 4BGIA 2YZ7A 3VH1A 5C3MA 1A71A 1T1RA 2DBRA 4TRNA 2NTNA 2PK3A 5TQVA 3DZIA 1QORA 4WPGA 4D79A 1KY4A 2J3KA 5LDGA 5GZ1A 1LXCA 2QHXA 2WDZA 1TEHA 5JYDA 4GWKA 3RUAA 2E48A 3BAZA 3VH4A 4DQVA 1UZMA 4R41A 1IULA 1E3IA 4YQZA 2I67A 3H9UA 2D8AA 2OBNA 4TQGA 2NU6A 5JAIA 4BGUA 2QX7A 4KQWA 2QYSA 2VRCD 3TJRA 3TFOA 4WCDA 3ROKA 4L4SA 3L07A 5CG1A 3E5RA 1NP3A 4EITA 1LSSA 1H6AA 5HM8A 4EUHA 1RJWA 2X5OA 3H3FA 3JQCA 4CL3A 4GVLA 3ZDFA 3JD0A 3CMCO 4M1QA 4R69A 1ZBQA 4E5MA 4II3A 1YKFA 2HKIA 4GX1A 1GPJA 2E49A 5FYDA 4CLRA 3WBBA 1HYEA 2R2GA 4JBIA 4PZCA 4PN3A 3ZNNA 1QLHA 1ISFA 4Y6SA 4F3YA 4ALNA 3F5SA 4FJ0A 4IXWA 3IQDB 4PFJA 5DNAA 1PJ2A 4P4LA 4CM4A 1IHYA 4R68A 4D41A 4B3HA 1JKIA 1IPEA 2X6TA 2Y1FA 3NT2A 2JHGA 3Q1LA 2OGUA 4BO3A 4N5NA 4WOKA 1NQ5A 1LRJA 3AI3A 3ZV4A 3IIEA 3L9XA 2O3SA 5AXBA 3QWFA 3AFMA 1VL8A 1PZGA 3PI7A 1NFFA 3RUEA 3VPFA 4IINA 2EG9A 2O3TA 3W8FA 4TROA 5COAA 4AJEA 4FFMA 4YAJA 2HMSA 2G17A 4IDEA 3FTNA 5JCJD 3OFSA 1VJ0A 1O94A 4BIIA 3RBVA 4TVOA 3I5MA 2B4TO 1E3WB 4BV9A 3OEYA 2UV8A 4CM3A 5A3JA 3GEDA 4J7XA 3ZU2A 1N92A 1IY8A 1P0CA 1N9GB 2CUKA 4KDFA 4NBWA 2Y66A 3H7AA 5HWSA 4OHUA 1MX3A 3FWNA 4LCEA 2B37A 1KVQA 3NT4A 3RJ5A 1Q7GA 2OBYA 2QQ5A 1VL6A 3JQ8B 2JFHA 4E6PA 2FP4A 1MP0A 1ZK4A 1U4SA 1G1AA 1I2CA 1U1IA 2EIHA 5A9SA 1DAPA 3MJEA 3WOHA 3ABIA 4MDHA 1MFPA 1ZH8A 5G0VA 3FPCA 4ZRMA 3ICPA 1LLDA 3RFXA 2H1SA 2JD1A 3PRJA 9LDBA 3ADOA 5A04A 1R12A 2V6MA 1L7DA 1MUUA 1SOVA 4BNNA 2PNFA 5C7OO 4ZVVA 2PGLA 4CPDA 5EQDA 2EGGA 1TXGA 4EW6A 1I32A 3JQDA 1CYDA 4YRAA 1GFSA 2DBVO 3GMDA 3JSAA 1YDWA 2VYVD 5AXDA 5KOIA 4BKPA 3ZH2A 3C85A 3EDMA 4K26A 2ZYDA 1E7YA 5F5LA 3ZWCA 1VRWA 4LMPA 3T7EA 3VVBA 4BL5A 4OKNA 3QP9A 1HDRA 3PVZA 4WUVA 1KY5A 1TA4A 1O89A 1T4BA 1GV1A 1BSVA 3W8EA 2UUOA 1VM6A 1DJQA 1P33A 3FD8A 1NHGA 5JSFA 4LISA 2LDBA 3JQEA 1R37A 1BW9B 5DCYA 5HS4A 4TVBA 5H82A 3CZRA 4IMPA 4J4BA 3FNFA 3GVPA 3I1JA 3B6ZA 1PJ3A 4EDFA 2Q50A 3OQ1A 3H5AA 2Y93A 4Z9FA 1H9BA 2E82A 1GPDG 2NM0A 4IM7A 3P7MA 4E30A 4OOFA 3V1UA 1PL8A 2EHDA 5IZ4A 2HLPA 1I2BA 2GGSA 4FC7A 3RC9A 4IQ8A 2NU9A 4N5LA 4H15A 3EYWA 1Y8QB 4RV9A 2FRDA 3GFGA 4BB6A 1KEPA 2H5LA 1QSGA 2AXQA 5TS3A 4WGGA 2DFVA 1CERA 3KO8A 3G49A 4MOWA 2AQHA 1YE3A 1SOWA 3I3OA 3KM0A 1NPTO 4E13A 3I6IA 2FZWA 1ZSNA 3VZRA 3JQ7A 4GVXA 1E1NA 4XB2A 2YV2A 2VRCA 1E6WA 1EFKA 1WMAA 2J3IA 2HCTA 1LLQA 3D4NA 5IF3A 3AJRA 2ZK7A 5LC1A 3ETGA 5T8KC 4DL9A 3I9NA 3KB6A 4CR6A 4DQUA 3AUTA 3O03A 1EVYA 1LDBA 3HN7A 2OUIA 3BHIA 2FR8A 2Q2VA 1QYCA 2HAEA 1LRLA 3PHGA 4E3ZA 5EERA 5I7EA 1R4NA 2WYVA 3GOHA 4J2OA 1O6ZA 1AUPA 3GDFA 4JIGA 4EJ6A 3PJFA 4E5KA 2FPPA 2CDBA 1H9AA 1GQ2A 1Z74A 3DBLA 5EESA 1PJCA 4MVJD 4MP8A 3DDNA 2NSDA 2VTDA 1E6EA 1N1GA 4M54A 4JXKA 4TWRA 3UOGA 2VWPA 4PLYA 1AHHA 1XG5A 1I3LA 4R1SA 3QWIA 4BNTA 1ZEJA 4PG5A 3BXXA 4E0BA 1EBUA 3F5QA 2IODA 2AG5A 1M6HA 2BI7A 3FBGA 3IKVA 4JP3A 3OJ0A 3DFZA 2IDZA 1V9LA 3TZQA 1U5AA 1EK5A 2HRZA 4FFRA 4YJHA 5JCJA 3SXPA 3ZHBA 1JKFA 4MIYA 1U2GA 4R3WA 1DPGA 1K89A 4AJIA 3HJAA 2VYNA 1H6DA 5I7VA 1DFIA 2PFGA 3H9EO 2NVUA 1BRMA 1NVGA 5DCWA 4EJ0A 3W1VA 2WE8A 4YAGA 2YW9A 2ZB3A 5KVQA 3NGXA 3PQFA 3SX2A 5JY6A 4J6FA 2GN9A 3ZWPA 4Q3AA 4HV4A 1C14A 1XQ6A 3RIHA 3QWBA 4AJHA 2FY8A 4H7PA 4BNMA 3DL2A 1EEHA 3KV3O 4DYVA 3O26A 4JLWA 3TZ6A 1P31A 3GEMA 1LEHA 1B14A 3KYCB 2ZB7A 3TNLA 3BA1A 1QG6A 1X7HA 1T2AA 2I65A 3T4XA 1ZVMA 1PTJA 4PGFA 3A06A 1CJCA 3KEQA 4GLLA 1GD1O 4ZQBA 1GCUA 3CH6A 4GLOA 4WNCA 2HMTA 4BNXA 1ENZA 1WPQA 1Y8RA 1DFGA 4I5DA 4XWYA 4R51A 5COBA 3GAFA 1NR7A 3NDJA 1C1XB 4OIMA 3ZU5A 1Y5RA 4YT5A 4YEDA 2AE1A 4WKGA 5FEUA 5DN9A 1C0IA 2B5VA 4FIZA 1S6YA 3WGGA 4RVDA 4KP7A 4ZICA 2PH3A 1UP7A 2Z1MA 3OM9A 3C7AA 2X5KO 2JD0A 3PXXA 5CEEA 1ZO8A 4W9NA 5GY7A 6ADHA 2B4RO 4FFNA 1FJHA 4Q9NA 4BHTA 3IAHA 1YQGA 2GNAA 5FWNA 3L6EA 3IMFA 1WMBA 1MGOA 3L4BC 4R16A 3ONDA 1AHIA 4U6QA 5K9ZA 2Q45A 4L4RA 1RWBA 2JJYA 3BTSA 1NVTA 2C0CA 4ND1A 1NR1A 4RL6A 2C5AA 2CD9A 4ND4A 4XQEA 3RQSA 1JA9A 1KEWA 3DFUA 3Q9UA 3X2FA 3VPXA 4BO6A 3GFBA 2YDYA 2Q1UA 3N58A 1JDJA 1EQUA 1VKOA 3C3XA 3WGQA 3K92A 5KVSA 2W4QA 1D8AA 5H83A 4CJXA 2QG4A 4RVFA 3MWEB 4UVEA 2HMVA 3F4LA 4ALJA 3F46A 2GLXA 2E6UX 4K1LA 1BVUA 3GZNA 3RJ9A 1VL0A 2EJWA 4I1IA 1O0SA 3OMLA 1HE3A 5BSFA 4Z9YA 1F0YA 1UXKA 2DBZA 5B1YA 1GV0A 4KTVE 4AJNA 1N9GA 2YYYA 5A4DA 3QRWA 4B7XA 2AMFA 1GUFA 1VI2A 2O7SA 4B8WA 1FK8A 1U4OA 3HG7A 3GVCA 3WICA 1R16A 4C4OA 4PRKA 3JD2A 5KCZA 4QO7A 1ZJZA 4PLPA 1DXYA 4HNGA 1W4ZA 4HADA 3TL3A 2C54A 4CMIA 3BIOA 2GR9A 1B8VA 2D4AA 3IDSA 1UXIA 3GHYA 3NEPX 3JQBA 4O6VA 2X58A 4B7UA 2CF6A 4C7JA 4N7RA 1LQUA 3WR5A 4BO9A 4AJ2A 4BO0A 2D0IA 3WDSA 3TRIA 1V6AA 4OL9A 2YHIA 4CM4B 2E4AA 4JBGA 1UP4A 2P5YA 3WBFA 4GPD1 4J2HA 1HF3A 2YHUA 4RPJA 5EIOA 3GLQA 4YACA 3RU9A 4ZD6A 2F1KA 1H2HA 2O3UA 2ZKLA 4M87A 8ADHA 1NAHA 4U8GA 3GMSA 4LGVA 4RF4A 3B1KA 4BO4A 2X9VA 3VPGA 2Y1EA 3HN2A 2O48X 1E3EA 4NBUA 4L4XA 3S1LA 5IXSA 1IYZA 4M8SA 1T2EA 3RKRA 1M2WA 5F3RA 4AVYA 1IZ0A 1JAYA 3V2UA 1HEUA 5TIIA 3D5TA 4TSKA 1YJQA 2H6EA 4IDDA 1XU7A 4Z0HO 1XQ1A 2B0JA 1HTBA 4LW8A 1BW9A 2I9PA 3EGOA 3O8QA 1ULSA 3FF4A 1U5CA 2XF8A 5A02A 5K6AC 4W7IA 2YY7A 2SCUA 4HX5A 1ZK2A 3IOYA 2BH9A 3GGOA 2QW8A 5KIAA 4FSHA 3PJDA 1KC1A 3ORFA 2DLDA 3RBZA 7MDHA 2IZZA 3MOGA 4CUJA 4FFLA 3L77A 4R1UA 1U9JA 1GY8A 1LUAA 2NQTA 1Y8QA 3DHYA 5T5QA 1IZ9A 1TVEA 3RC1A 4BNIA 4K28A 3TL2A 2BF7A 4EUEA 4HBGA 1ISIA 2YUTA 4GKBA 3GT0A 4XEHA 3K8ZA 2R6JA 1NXQA 2JCVA 2PTGA 4I8XA 3S55A 2X22A 2BELA 5MDHA 1VSVA 4LSMA 4CM7A 1HDGO 1X1TA 3PHHA 3CZMA 4EEXA 1LI4A 2GZ3A 4MIEA 2GCGA 2IXAA 4UVGA 4JCOA 5ICSA 4PLZA 4Z0TA 3HFSA 5L53A 2ZB8A 3H5RA 1PZFA 3OP4A 5MGBA 1WP4A 1Q1NA 3JYPA 1I0ZA 5ENVA 4E33A 3QV1A 3AW9A 2G0TA 3G1TA 4JK3A 4D44A 3LT2A 1GU7A 4IGFA 4H16A 2UUPA 2POQX 1B15A 3RKUA 3WB9A 1GADO 1N5DA 3DO5A 1HRDA 4FGWA 1PGPA 1NFQA 3CIFA 3B1JA 4ONEA 5F21A 3TDKA 3ZHXA 1JVSA 4NBRA 1LSOA 1QR6A 4A73A 4FOSA 4NDNE 2PZMA 1EUZA 1BDBA 1YQDA 1KYQA 3DZFA 4MKXA 5JO9A 3UHAA 4BNLA 1YOVA 4BO1A 1XGKA 3DZBA 1X7GA 4IZHA 5GZ6A 1IL0A 3DC2A 5B4TA 2AQ8A 5DCUA 3B70A 1EDZA 4XRGA 1MLDA 3TZCA 4I5GA 5EJ2A 3NJ8A 2YFHA 5JBIA 4CUKA 4WLUA 2H9IA 2VUUA 1YL5A 2FHSA 1R15A 1E6UA 1HE2A 1AGNA 3EMKA 3JQ7B 5G4KB 1ZMTA 5DBFA 1C0KA 4LCJA 4YTEA 1P9LA 5L9AA 4A27A 3BHMA 4YAIA 1QV6A 4MP3A 3HB4X 3ZWVA 4FJ1A 3E48A 5L4LA 2X8LA 2IYPA 1B3BA 3PDJA 2ZCVA 3QW2A 2AG8A 4IBOA 1DIGA 3GGGA 4XIYA 5CP8A 4LRTB 1O95A 1W0CA 5L7WA 4BO8A 1ENPA 5A9TA 1PZHA 4IIUA 1R4NB 1GZ3A 4KWHA 3TSCA 4YXFA 3HB5X 3ICCA 3HHPA 4GX0A 3N74A 2EV9A 4YJGA 4OXNA 3HZZA 5A5FA 4WASA 3GVXA 1PGNA 2DTEA 3O38A 4ALLA 3H8VA 3UCXA 3G17A 3LSYA 5T67A 1E1KA 2Z5LA 5JDCA 4O63O 5L4SA 3RSHA 3K9QO 4HFNA 3ROMA 3WS7A 3V8BA 1I33A 3INRA 3UKOA 1DOHA 3AOEA 5BSEA 2WE7A 4YJHB 3G3EA 2Y1GA 4QECA 4OQYA 3HWRA 3I9MA 1ENOA 1X0VA 1NWCA 2X5JO 4XCVA 2EW2A 2WSBA 2G82A 2XAAA 4JROA 1E7QA 3SJ7A 5KJCA 4J4HA 5IZCA 5L95A 1LNQA 5BSGA 4FS3A 3DZJA 3K5PA 3KBOA 3U4DA 1C0LA 1E3LA 2HJSA 2VZ0A 1AE1A 3DQPA 4Y98A 1SEPA 1A5ZA 2FPGA 3WQQA 3GGPA 3RI3A 4J9VA 3VC7A 4J1TA 3WJ7A 1UXGA 1Q0LA 2BI8A 4R01A 4NIMA 5A5EA 2QRLA 1NBOA 4NU6A 1HSZA 1Y8RB 1LDNA 3FI9A 3CINA 1T2CA 1PQUA 3ULKA 4PLFA 5F1PA 1DEHA 3NJ4A 4EUFA 4F45A 3DAPA 1B16A 2X7HA 2V6BA 3WQSB 3DTYA 4EJMA 1LSUA 1OZAA 4E12A 3PQEA 5C7LO 3RD5A 3MJ4A 2ZJ1A 1HDCA 4E4YA 3WMXA 5GZ3A 4LMRA 3S2FA 4O59O 2GASA 3INTA 4CLDA 1XHLA 1H93A 3ANMA 3B20A 5G2OA 1PR9A 5ITVA 4PLCA 1CEQA 4UULA 2NTVA 1Q7CA 5FFFA 2P4QA 4TRRA 2A4KA 1HDOA 1SNYA 1XA0A 1RYEA 4L0QA 1EZ4A 3AY6A 3BZUA 1LJ8A 3PLNA 2C07A 3PGJA 3WSVA 2P2SA 5EN4A 2BHLA 1LDMA 1U3TA 3WLEA 1ISHA 3UN1A 2P68A 4RF2A 5LCXA 2IZ1A 3VH3A 4YT8A 3SVTA 4OSPA 3L6OO 4HKTA 3ITDA 1BWSA 2EWMA 4N5MA 1BDMA 3FR8A 1ENYA 1K6IA 1ZCJA 1JW9B 2ZQZA 3LC7O 3WIDA 4BNKA 5G0WA 3GZNB 2DKNA 3ZNPA 5A9RA 4UUMA 5T64A 3ZWAA 2EERA 4BO2A 3FRJA 5C37A 1JTVA 1LC0A 5THQA 2VHWA 2VYND 3A1NA 4MVJE 1WDMA 2NVWA 4CMEA 1WW8A 3DR3A 1G0NA 4FD3A 4ZU3A 4FDAA 3FBTA 2FN7A 3AU9A 2PKRA 3OIFA 1LRKA 3S2GA 1UDAA 1I5RA 3U5TA 3GRKA 5TNXA 3RAJA 5G0SA 3LF2A 3JYOA 2I3AA 1D3AA 1EK6A 2CVOA 4GWGA 1MA0A 3CUKA 4IJWA 4S1VA 4CM9D 1J0XO 2WM3A 4OXKA 4BB5A 3H4VA 4CMIB 3PJEA 1PZEA 4E5NA 4XYBA 2QZ9A 5DDIP 4PZEA 4DC1A 1V3TA 5KJFA 4Y9DA 4GBJA 5CPBA 1Y7TA 4J0EA 1CRWG 4IJUA 2PD6A 5ITWA 2EGHA 1B26A 3AOGA 3HDHA 3Q0EA 4MO2A 4TMFA 3RC7A 4BNFA 4CR8A 3RCBA 3EVNA 2YHIB 4DYDA 3NX4A 3DTTA 3UUWA 4E21A 1DHTA 2FSVA 1DC4A 4WCFA 4Z3KA 3VKUA 1Z7EA 3D7LA 2JAHA 1Q0QA 4J0FA 2AQIA 2IRWA 5CAEA 1KBZA 4RJTA 4YB8A 1ISJA 3W6UA 2ZTUA 1EUCA 3IP1A 1E3JA 1XDWA 4CMCA 4K9DA 4E32A 3K30A 1GYPA 3GG9A 3JQ9C 4A7PA 2A92A 1YL7A 2DFDA 2A9FA 1NPYA 1PJQA 1KEUA 1P0FA 3LT4A 3MOIA 3I23A 3M1LA 2VZ8A 5JY1A 5ER9A 4AICA 1QRRA 2BGLA 3FNGA 4BNHA 4BNUA 2GSDA 4ZQGA 3BTUA 4I9HA 4ND2A 1EE9A 3OBBA 4NFYA 4R5MA 2G5CA 3GDGA 3HDJA 5G0UA 4A26A 4CMJA 1HWYA 3O8QB 1XYGA 3KSDO 5IDXA 2WWRA 4EI2A 4WECA 1FDTA 2P9CA 5JFOA 5L51A 5J23A 4TZTA 1NNUA 1R4MA 3JV7A 2P91A 1L7EA 3NTOA 2CVZA 2JD2A 4GGOA 3E9QA 4DIFA 4I08A 2DVMA 3OSUA 1TB4A 4LVUA 5DZSA 1KETA 3JQFA 3OIGA 4IS2A 1W73A 2Y99A 3ON5A 4ALMA 2X4GA 5JDIA 4U7WA 3MJVA 1WXDA 4E2WA 3OECA 2Y68A 1V3VA 2EKQA 3ANNA 1NWHA 5L7TA 3JD3A 3ZWOA 1JVBA 2O50A 2VWHA 3GF4A 3K96A 5IN5A 5G4KA 1KERA 5T6BA 4CV1A 3GNSA 4DRYA 1R0KA 3E8XA 4CODB 4YRBA 2PZLA 4UUOA 4AJPA 2ILTA 4JX8A 1Q2XA 2I6TA 2VUSA 3VDQA 2CMDA 1DLJA 4WNIA 1JLLA 1LX6A 2CVQA 1VPDA 2RHCA 3E1KA 1TI7A 1I8TA 4G65A 3QY9A 4D0SA 1I24A 3GN2A 4UEOA 1T26A 3GVHA 3PJGA 4DBZA 2DC1A 3I9OA 4RVUA 4R9RA 2FSSA 2O3QA 2VOJA 2O7QA 2D2IA 3G79A 3K31A 4XA8A 1B2LA 5DBGA 4CUZA 3JYQA 4FCCA 4DA9A 4TRMA 1B8PA 3AU8A 4DVJA 1H0KA 2YJZA 4RVGA 5L45A 3NT5A 5B4UA 4I5EA 3DBHA 3R1IA 4CMAA 3KVOA 5JNLA 2HMUA 2HUNA 2X23A 3FCOA 5JAQA 4ZJUA 4J7UA 2X0IA 1PIWA 4OH1A 1YOVB 3INGA 4HXYA 4WLNA 2XOXA 4AJOA 1DHRA 3KZVA 1P44A 4IJKA 2EEZA 3KSUA 1XELA 4R1NA 2R00A 5THKA 4OMUA 2OXIA 2JKVA 5HRUA 1NHWA 3Q11A 4CQLB 3ZI0A 4HP8A 3KYDB 4GL4A 3IKTA 1NASA 2HJRA 4LN1A 3X2EA 3HQ4O 1DBVO 2EF1A 4G2NA 3GUCA 2GD1O 3DB2A 3GRPA 1EVZA 4BKUA 2HDHA 4MP6A 4L76A 3RBXA 3PFWO 1MG0A 3TF5A 3DOCA 1YONA 4XYGA 2W2KA 4LSWA 4JGBA 3ZWYA 1UAGA 4WK6A 1GQYA 4O5OA 2AA3A 5IDYA 2NWQA 4YVFA 2Q1TA 1M67A 5DULA 4AFNA 3M1AA 3BMOB 1EMDA 1SZJG 4WEOA 4YAEA 4CM9A 1C0PA 1X0XA 2F00A 4B4WA 5G4LA 4CM1A 5BNTA 1X7DA 1F17A 3EC7A 4I9NA 4XB1A 1E3SA 5TJHA 5EL0A 2Q3EA 1XWFA 1ADCA 2XXJA 3H5NA 4CMHA 3ADPA 4URFA 3F47A 2HO5A 5B37A 1HL3A 1UXJA 1Y9AA 4NQZA 5I9LA 5DF1A 1E77A 4YJGB 4BMNA 1VJ1A 4NJMB 2QIOA 1SB9A 3GG2A 1WVGA 1DIBA 2RBEA 3ZWMA 3F4BA 3GAZA 4RLHA 4GKVA 4DQXA 3QVOA 2VHVA 2IXBA 4UEJA 2WEKA 2X0JA 4BMVA 1PL7A 1DIHA 5CEFA 1A27A 5F1KA 1CETA 1S7CA 2VHXA 1WDKA 3RC2A 3ROQA 4XKJA 5L4NA 1K3TA 2GPTA 5A03A 3MJSA 3JYLA 2EP7A 1GAEO 4O1MA 4J91A 9LDTA 3RASA 3ZV5A 3FWZA 2C59A 4DUPA 4GSLA 1IOLA 3NUGA 5IFLA 2DBQA 1ZEMA 3DMTA 2V65A 3R3JA 5IXYA 3UCEA 3EY4A 2LDXA 2DUWA 1QYXA 5ADHA 3DBRB 4BNZA 3D3EA 1EDOA 2QYTA 5U4QA 2CDAA 3OHSX 1EVIA 3KEOA 1NM5A 4D45A 3VOSA 4X54A 1L1FA 1LBEA 3ZWNA 5KNLA 4DTIA 3UICA 3RUFA 4Z0PA 4BGVA 1PGQA 2ZCUA 3PIIA 4D3DA 2PLAA 4R4JA 3AM3A 1JAXA 3COSA 2D3TA 3HNPA 4PLVA 3L0DA 4QSMA 2FWMX 1ONPA 3G0OA 4G81A 4Z9XA 1BGVA 2GZ1A 4PZDA 2NNLD 4YJDA 4W7HA 4AJ4A 3DZHA 4DPKA 1CWUA 4GMGA 4D42A 5KJ6A 4ZHSA 1ZFNA 3WLFA 5C5IA 3PDUA 4ROSA 1MFZA 1PU2A 4DWVA 2QRJA 1GZ4A 1X1EA 1ONNA 3PHIA 1CDOA 1HKUA 5ICMA 2O23A 2RAFA 4MPDA 1E1LA 4RORA 2GF2A 3QIVA 3ZZNA 3WYBA 1SAYA 1MC5A 1Y1PA 3OF2A 4G5HA 2JFGA 4J3FA 4IZIA 1T1SA 1VC2A 3E6AA 3GC6A 1LLUA 3AUUA 4YT4A 1PSDA 2BKAA 2I76A 3F3SA 2BGMA 4RLSA 3QLJA 4XRRA 3UVEA 1DLIA 4II2A 1F8FA 3JCZA 4KUEA 3E9NA 3PP8A 1XU9A 4MKZA 2JHFA 3KHUA 3ZN2A 1GR0A 1QP8A 1ZXLA 3OEWA 2WYWA 3I6QA 1E0DA 4NU5A 4WEQA 3SEFA 4P4GA 2DTDA 4JNKA 2OOSA 1UJMA 3QA9A 4QFDA 4W82A 8LDHA 3GHHA 1P1FA 3ENNA 4KDEA 2NU8A 4DPMA 1HETA 1A4IA 4K6FA 1E5LA 4MVJH 2Q1SA 2Y1DA 4RO0A 5TGDA 1U8FO 5JS6A 2JAPA 3LLSA 2D1YA 3FR7A 4ZRNA 1HXHA 1CQIA 5JPIA 1ZIDA 2FR0A 3TOZA 3W8DA 3F1KA 5FF9A 3AI1A 4B4OA 3DEYX 1FF9A 1N8KA 1YL6A 1ZK3A 4IDFA 3SLGA 2AW5A 2ZJ0A 1Y81A 1EBFA 1U3UA 2DAPA 3EK2A 3ZNOA 4B8ZA 3W4JA 1WZEA 3KLMX 4GQAA 1BXGB 3W6ZA 5U9CA 4R5HA 4J43A 3QSGA 1I36A 4WLEA 3ZV6A 4NBVA 1QV7A 1YWGO 1NX6A 3VZPA 3FPLA 1FMCA 1YDEA 4HY3A 3GA0A 3ONEA 3GUYA 4IPTA 5I8WA 3BMCA 1H5QA 2W98A 2TMGA 3LVFO 4K6CA 5BQFA 4Q3EA 4F6CA 3DBVO 4PLWA 3LK7A 1VE9A 4GX2A 4WCFB 5A05A 4DGSA 4WLVA 3WG9A 1AXEA 3DOOA 3ZW8A 2PR2A 4BNJA 3GH3A 5HA5A 3OJLA 4TRJA 3CXRA 4NBTA 1DC5A 2CY0A 3IJRA 4BS9A 3U4HA 1FDSA 1AXGA 3BHJA 4BOYA 3K2EA 1IE3A 3ZHYA
chains in the Genus database with same CATH superfamily
3C5WP 4I4CA 4YRPA 1TA9A 1XCBA 4YRQA 3VKVA 4ZMBA 2BGWA 3IVGA 4OGKA 3DPSA 3AQ4A 2BCJQ 3JQ6A 4XD7A 1HT1E 2OD9A 5IJZA 1NV9A 5IYZF 2J08A 4QUAA 2VZEA 1RAEA 1A7KA 4LJKA 2I7TA 1OH5A 3WHIA 3IELA 4LXHA 5F9HA 1E7MA 4CKYA 5HQTA 1NI4A 3E18A 5CDYA 3KHSA 3N2EA 1I7DA 1Q57A 2C31A 4NCIA 5K03A 3MWJA 1Y8ZA 4DAEA 2FZLA 3EZNA 3R41A 2HFKA 2MSNA 2IXEA 4EEZA 3IQWA 5HQ3B 5DM4A 2I1VB 5FWAA 2OXEA 3MJTA 1XSEA 3RIGA 3A4VA 2YMQA 1H8ED 3H9QA 4LRYA 3V3TA 4DCNA 1PTJC 2PL3A 1GPAA 2ERCA 5B36A 1OIVA 2A3RA 1E2LA 3U44A 2O8CB 2WW8A 2IPAB 4UBIA 4Z8XA 5CEJA 4C4ZA 1P77A 2NZUG 5ES4B 3GH1A 2FE4A 3H42B 3CO5A 3MINB 4YMVA 5DBHX 2HMYB 5CCXA 4DBLE 3NHBA 1RLJA 2O2GA 2QXUA 3IPLA 3P9YA 2WY2D 1PQYA 3S7TA 1N3YA 3IRVA 4OTZA 4QQRA 4AY5A 4E5SA 4BLQA 2YWBA 3MF4A 5K51A 2XMRA 1I2ZA 4MV8A 3FTPA 5B6JA 2FWPA 2R5WA 5DHUA 2G9NA 2JH3A 2OFWA 2WHPA 4UMDA 2GDJA 3IHTA 1NF2A 2XRZA 3H84A 2I9KA 3EZYA 3I73A 1KAOA 3H0KA 2XB4A 3P2JA 1Q2UA 5FI3A 1F5SA 4LIPD 5I9TA 2WJWA 3SG0A 4AJLA 3VPHA 1CZLA 4NULA 3EEQA 3S8MA 3S68A 3T9FA 1JG2A 3EAGA 3SLKA 1FDIA 3AEUA 3HY3A 5DOVA 2BUBA 3EEFA 2PAAA 1DPFA 4ODIA 3W2HA 2IWRA 5CFPA 4DB4A 1BMDA 1JLLB 4QXQA 2J0EA 2VSNA 4OYHA 5EPOA 3SEAA 3F97A 1MGPA 1OWPA 2XEXA 2C82A 5HBRA 1R1DA 1UFRA 2PKQP 2I5PO 4TKVA 1J1IA 2OBXA 1GA1A 1OBCA 2KWIA 2V7PA 3CU5A 4BFVA 4HQ6A 2FB9A 4UEKA 5GWXA 3K0CA 2AOUB 3UGJA 3N07A 3T9AA 3KVYA 4JWTA 5E9WA 2HHHB 2C7GA 3CKYA 1JPJA 1NVEA 4TLEA 1J1ZA 4TS4A 4B4UA 1NQAO 3PTLA 5JC1A 1WHSA 4OI0A 3QE3A 1VZ2A 3RSGA 1ZKMA 3ASUA 1AMNA 3ZJUA 3CYFA 5K6RA 2TSYB 1ULBA 3CLUC 5CG2A 4B6QA 1CUHA 1KYZA 4WACA 4D3YA 1A2KC 1M1ZA 1PQPA 1T0IA 2ADFA 2G76A 3H9JA 2GJ4A 4I66A 1ZXBA 3RG8A 2OY0A 4H3SA 3W5SA 2OCPA 4EM6A 2ID9A 5BWLA 4KPEC 4Y2VA 4B9AA 5FTWA 2OCYC 2IWHA 2EBFX 2X4DA 3MFQA 2NQ2C 3PKZA 2M1XA 4EF5A 2WWXA 3BWXA 3C1OA 4A8PA 4Y1FA 2O52A 3TLXA 1CE8A 1OXKB 2BGIA 1CUEA 2RB5A 4MUFA 3U3KA 4H6XA 4LV8B 3W78A 4AL4A 5A3VA 2G28A 5KPJA 5GIPE 1XXLA 2HCJB 3DW3X 4YCSA 4PC1A 2ZB2A 4LJ5A 2IBTA 1X9IA 1GZUA 1M1XB 2L18A 4LKOA 1K2VN 5LQUA 1A9TA 1UZAA 3EXIB 3RGWS 5KNDH 5AVTA 3O7MA 2BFDA 2E7ZA 5G3YA 1MO5A 3Q7RA 4EJ2A 4LWOA 4I81A 4F4CA 1AKTA 2TMKA 1Q0SA 2JFYA 3BG5A 2YXDA 2WFAA 3CZ5A 3OOHA 1YZKA 3STUA 3UGQA 1ZNZA 4GI2A 3DGFC 3PIRA 1VIYA 3QVXA 3QX7A 5A71A 4FBLA 1K7FB 2AEFA 3IUEA 4O08A 4YX9A 2WKRA 5FORA 3D0QA 3U4IA 4S1NA 2HA0A 2H2AA 5ETJA 1P2UA 3AK4A 1WZCA 1JU3A 5LBTA 1T0HB 2PRIA 3KVNA 5BSUA 3CUVA 3OT1A 2YFYA 4N0DA 5LUBA 1V5EA 2IYTA 1AJEA 1W47A 4OQZA 3ITNA 1ORRA 4JHXA 4ZAGA 2NSJA 3B3FA 1YB1A 4TTTS 5CM2Z 1BVYF 3VTAA 3O9ZA 3GAMA 2WTAA 4II7A 3USZA 3FVVA 1I5OA 4RESA 3C15C 1L3BA 3IC5A 4BMCA 5HKOA 5U1PA 1YH3A 3DDZX 4G1UC 1E9EA 2YTZA 3UAGA 1WLSA 3D5QA 4TUYB 3ZZMA 4BKRA 2CUTA 3TDMA 1N1MA 2B35A 3EOAI 4Q3BA 3V6MA 3MERA 2ODTX 5DTQA 2LIPA 4YJ2A 4QEDA 3U4CA 2OFPA 4XGNA 1W88A 2ORED 2EVWX 3R0XA 4R8MA 3F74A 1GN9A 3GLKA 3QXSA 4OF4A 1T0JB 2B9VA 1XA4A 4EMBA 2IIQA 1CUCA 2JCYA 4C0SA 1GFZA 1J5PA 5F73A 2VDJA 4IFBA 5E0OA 3RYIA 3WRWA 3OWHA 1XA3A 1M1NB 3NDIA 4LYJA 2M32A 1J2EA 2NVBA 1N2SA 3CF6R 3WDLA 2BZ1A 3WIEA 3Q5EA 2PD3A 1JDBC 3MLAA 2XWJI 1ABFA 1ZH6A 2V0CA 5DGDA 2ZJBA 1GN8A 1P1HA 2ECQA 3JQRA 5F78A 3UFXB 3L7BA 3E35A 3UG6A 5LBIA 3UAXA 1N0VC 4QPNA 4C4PA 3UB2A 1Z16A 4PHHA 3V5NA 4IDQA 4P7JA 2X7JA 4AIIA 5LP1A 1ZMXA 2AYZA 2GVDC 1H8EA 1RKVA 1QPBA 2XMDA 3O2QB 1UIRA 4RCYA 2XWBF 3MC1A 3TQQA 3O9VA 3OX1A 4CT5A 5BWBA 1RYMA 2B83A 2NSLA 2FKNA 2FXIA 3EVGA 4NCXA 3U9LA 1JR2A 3Q9NA 1DUVG 2WTMA 3WL3A 1TT5B 2DCMA 1PWEA 2CL6X 2NTEA 4V0QA 4F5WA 4U2FA 4D0LB 1CNEA 5BOVA 1UMBB 3ROPA 1AMUA 3KJFA 3MJFA 1I3MA 3OPXA 4MR7A 4ASUA 4Z4CA 2IUSA 1RVV1 3KD3A 4KHZA 4CFYA 5AVKA 4EQZA 5BR7A 2C5SA 2VTVA 4IJ5A 5H02A 3IAS6 1YTLA 1ADYA 2QW1A 3CSDA 5DTRA 4WKBA 1LVHA 2VF4X 1WKBA 1B0AA 4YMLA 2P1ZA 1DAOA 4LY9A 3PCRB 1OLSB 4TTSA 3AVWA 2GK7A 4ENUA 2GFIA 1T3LA 4MRSA 1Q50A 2DR2A 3EG9A 2AN9A 3VR0A 3TW0A 1BXGA 5JJBA 3TSZA 2FR1A 1NZFA 1CR0A 1NVAA 2N46A 3IB3A 4F97A 4PAOA 3AZPA 3NIDB 2FWIA 3D3QA 4OAQA 2BPOA 2VDKB 4M9CA 2ZT7A 4EDHA 4TS3A 2LE0A 4Z7JA 3TLEA 1G8SA 4XGIA 5CFZA 1QM5A 2KLHA 4ZYYA 3QF7A 4CNBA 2A1TR 4L7QA 4F2DA 2AGVA 5AVYA 1E63A 3OESA 3OZFA 4LCBA 2O2SA 2HIAA 4TKUB 2BFAA 1X15A 3FJYA 5HTOA 1LV7A 1Q84A 2ODPA 3FSGD 4RQTA 5JV5A 3C2QA 1JQAA 2I80A 1RP1A 2DHCA 2SBTA 1V48A 2BR4A 3L7IA 1PS0A 2YV4A 3URKA 3D8TA 4OHKA 1U3WA 3HP4A 4H1HA 3VH2A 3ZBQA 5DCLA 1E7RA 2ECFA 3DLBA 1ECFA 2IDKA 3LP5A 3PTZA 4DQKA 4W5RA 4XDZA 4FD2A 5JISA 3FRHA 2Z43A 4XD2A 3KQYA 2PZKA 3ZS8A 1CUYA 1EFVA 1ACMA 5GP1A 3GPDG 3FDZA 1RYDA 4R2KA 5AKIA 2G04A 5KTYA 3C6KA 3S2SA 4G0MA 2Q5OA 3UK7A 1WZ2A 5F5NA 2ACEA 2WUFA 3ACDA 4NZNA 1I4LD 5KHOC 3LGSA 3ZWBA 1VPWA 4QNMA 2H18A 3D1VA 5EYPA 4B79A 3RYCA 5D00A 3W6NA 2GUGA 1JYSA 4S1OA 2DULA 4JYBA 2G07A 2A9VA 1Q83A 1P2TA 1ZD2P 2IDJA 5K3SA 1A1VA 3UG7A 3NRCA 1B93A 1JNXX 1YR9A 1YNSA 2ODAA 3C3KA 3DEHA 4O4IA 3MJRA 4IYJA 4L9RA 4LRQA 1GTMA 5I6DA 1E8NA 2D1RA 5CM8B 1REQB 4N3GA 3ZIUA 5JS7A 1XN1A 4A6XA 1L5YA 3ILXA 3OTIA 4S24A 3PFCA 3WWZA 2Q2WA 3U7HB 2JGLA 1PW5A 4LJSA 1YF3A 1OB5A 3ELWA 2IX3A 1C7RA 5J4VA 4BCBA 2JLUA 5LL6P 3CN9A 2WI8A 4LRXA 1I7PA 3BMCB 4US1R 3O84A 1XDBA 1DRUA 1UMCB 4N7BA 1M66A 5H81A 3WNCA 1E8DA 5GMOA 1I30A 1M6NA 2YVUA 3JW8A 2GI4A 1TCCA 3ANLA 3LPCA 4S1TA 4B44A 5LR6A 2VQFB 4RPGA 5IDVA 3ZZTA 1D04A 2PS0A 1F06A 3MQ2A 4PLTA 4R81A 3YASA 2W42A 1PW7A 4E2YA 4YJ2F 2QL7A 3WLSA 3CLTC 3WK8A 5AVJA 1SCIA 1D2CA 3ILHA 3ZC3A 1IJKA 1M54A 4CKEA 3NASA 5CDTA 5K01A 3F6YA 2AL7A 3MAGA 3GFSA 3IRUA 4XYEA 2R48A 4IRMA 3RHTA 1H3EA 5AHOA 5F12A 4CLOB 4J9UE 2XLCA 3HCBA 2CLLB 3AKDA 3G7NA 4S3MA 1RFGE 3GJ0A 5KMGA 1ILEA 1Y4SA 1L1EA 3EZGA 4OJNA 4PX9A 4AJJA 4E88A 5LMZA 3N7TA 3T5BA 1ATIA 3NVMB 2MMGA 3B12A 5ALQA 3B1VA 1NY5A 3DFKA 3T5GA 4HGOA 5AK6A 1I3CA 1ZOIA 3B1WA 1EBBA 3G5MA 5FBVB 2JLAA 3MCAA 2ZYGA 3BE6A 1FPQA 4U9IS 5A06A 1L4BA 1G38A 4OHCA 3OHPA 1VJTA 4Z4IA 4Y2JA 2QUKA 4P80A 4C4XA 4LRSB 1XTJA 5KQSA 1J1UA 3FGOA 1PJBA 2IV7A 2FX3A 3DKVA 1C4XA 2HF2A 2OCXA 3OOYA 2OXTA 1N57A 3T61A 2X6QA 4AF7A 4BZPA 2CC2A 5JQGB 2OFXA 4R9SA 1IBKB 4P6VF 1NP6A 2CZCA 1A96A 2QAGA 3MMPA 2IBSA 1ZKDA 2OCGA 3LF1A 1X80B 3N1UA 1W4AA 1AKYA 4Q9LA 3BSFA 3K70D 1W2HA 4CKBB 4TL8A 2EOAA 1KMNA 2AFHA 3FHCB 5IBPA 5IX8A 2HEIA 4FB4A 4F7WA 1JE0A 2CUZA 4MWSA 1GPUA 3GRAA 4CTKA 3K8QA 1UKZA 2A1IA 3L82B 4NATA 4NMXB 5REQB 3G1UA 3Q6NA 1SKBA 4WXEA 1KXJA 3KOWA 2HSDA 2VAMA 4MS1A 3L40A 2H9AA 2BYTA 3ZEAA 1TVMA 3NOXA 4IJQA 4E2XA 3EPHA 3VZSA 4BTEA 2G9UA 3QVTA 3V4LA 1DBWA 1W9MA 3VDNB 4LECA 1Q7TA 3CLKA 3DWFA 5CX1B 5JE8A 3UJDA 2HYDA 3SJUA 4KXYA 2NZWA 1YR1A 1FQJA 2ESRA 1S4MA 1HTTA 3AF4A 4G6ZA 1U28A 4R3NA 4N41A 1FVFA 4JYZA 2H7YA 2H57A 5F3DA 5KYNA 3TOXA 1QS0B 4W5TA 1CEXA 5LLSA 2A86A 2AQKA 3JD4A 2HQBA 2OLJA 4ICIA 1TQ4A 1Q0TA 1R5JA 4DM3A 5CDHA 4CLEA 4E2FA 5EJGA 1GEEA 1FDWA 2IIBA 1EVJA 4H3VA 3SR4A 3SBXA 2ET6A 2D7DA 4MDEA 4LK3A 1IQPA 2CMFA 2ZRLA 3A6KA 3E1GA 3NBUA 4NI5A 5TB5A 5JXWA 4OH7A 1GZDA 5KU7A 1G6KA 2WPNA 5F3WB 1PYOA 1PFKA 4BRSA 2OZPA 5TT0A 1H5UA 2O54A 1MENA 3JQAB 1LBIA 3FNEA 2H16A 3V1LA 2H06A 1L7XA 3FOWA 1KEVA 1BFKA 1N75A 3DBOB 1TMGE 1DBQA 1FLNA 4IWNA 3SS7X 3P2EA 1ATZA 1UBSB 5BURA 3R8XA 7REQA 5HOQA 1XZKA 4EB8A 1SCUA 5JG7A 3NHSA 4Q00A 3L79A 3AUFA 3MYRA 1KQ3A 2J33A 1KH2A 1RKXA 2DPGA 3L7NA 2VOEA 5GM2A 3IIMA 4HL6A 4JLVA 1ZH2A 3HADA 2VRNA 3A6DA 3LOUA 2JFFA 1D1TA 1WCIA 4WN9A 1FFXB 1O8CA 2B61A 3QXJA 3MTQA 4CKZA 5BYAA 4GOOD 1T8SA 1W19A 3PE6A 4YWJA 2OQ2A 4BXOB 5B6PA 1G8HA 1X87A 4V0ME 3VYTB 2O8DB 4KSYA 4BNVA 5AXAA 1DCFA 2WNIA 1I4DD 2R8PA 3G5TA 3NHJA 4WLFA 2R7LA 3FG9A 2VDMB 2Q9UA 3BKWA 3Q12A 5A4FS 3CMMA 1Y4AE 3COPA 4MJ3A 3BMQB 4BQPA 1LPMA 2RC6A 4O4IF 2NMVA 1K6EA 4KSCA 2BFFB 2ZU6A 3B9QA 3NKLA 3V1TC 3HLKA 3NBKA 4URXR 1FXWF 2N9UA 3LP8A 2Q0QA 3O4IA 3A58B 3UMFA 3F5DA 3HDYA 4X61A 3DWIA 4HJRA 3RGGA 3AF2A 3SC4A 5KNBD 2CXHA 2Q49A 2QDKA 5IJ0A 1YI1A 3U61B 4UPVA 1Z7WA 3A27A 3IE2A 3AJAA 1MB3A 4GEKA 4DMHA 621PA 2G06A 3K0FA 3UAWA 4DLRA 2YIVX 2ZAOA 4BBJA 2OHIA 4FR5A 1FUYB 3IEMA 1W4BA 3D8NA 4YDRA 3V8EA 2IHNA 4XX0B 3DF9A 4B3GA 5EPEA 3JVEA 4IFTA 1ID1A 2IOHA 4JOCA 3SC3A 1KYXA 1R6DA 4M9SA 3ZNQA 5IFKA 1W6UA 4IL5A 3SC6A 4QUGA 1RLMA 2IHYA 5CW1A 3UB4A 3AFOA 1UBNA 3GFRA 4AYWA 3C8DA 4WZBA 3THOA 1D4FA 3NR2A 1E0AA 3OMXA 2VBIA 1EUDA 4HRAA 1GZ6A 4TLMB 4WXYB 4XIFA 3MWDB 1QHIA 2J7PA 1G5PA 3DAYA 1YRLA 4I8IA 3THXB 1HLFA 3IQIX 3DQQA 3UQZA 3HCWA 1OC2A 4KB5A 5FBZA 2V7QA 3CQ9A 1NYLA 3F6BX 2C2YA 3KTDA 3IAFA 3RVDA 3CT4A 4CLXA 4ZOLB 2FWJA 1NXPA 4JJEA 4ZVPA 3PHLA 1OBHA 3JZAA 4PXYA 4H08A 2FMHA 2FEPA 1T5DX 2FCAA 1DBRA 1A8SA 3WGYA 1C3JA 2Z6UA 1H1DA 4HD8A 3HXMA 3AEXA 2W2LD 3AWDA 1LF5A 3T5DA 3WLRA 5CXXA 3I0ZA 2Y0EA 1JFLA 2NXNA 1E79A 1VHLA 1ZJYA 3PR2B 4ZV7A 2UUBB 1F6BA 5IABA 4P35A 4XYMA 4TZ0A 3GI1A 4PPNA 2ZR9A 4Q3NA 4HUJA 3G2LA 4HTFB 2C7VA 2Y67A 2WUEA 3GP5A 3OZEA 4EJSA 3OPNA 2ZR0A 3JQFC 2HN9A 3T54A 5T57A 4IIFA 1KBQA 3AI7A 3R9KA 4DN6A 4WJLA 1R74A 2MYPA 4ZXFA 1UKAA 3EZLA 3CWZA 5B1EA 2QV0A 3CX3A 1H05A 4DDTA 1RXSA 4XUEA 3H2SA 5FRDA 1LDEA 3VX4A 4Z2YA 2VCYA 1IBRA 3UMSA 3WAJA 2QA5A 2DM6A 3CE6A 4MGKR 1Z35A 2E4UA 4UE3S 2OKGA 2IHTA 3TN7A 4GAEA 4WY2A 1XLTA 4Q9IA 2OKCA 1RC0A 2QLMA 4CDGA 2R8ZA 3V7NA 3RARA 1AKWA 2A9JA 1PLJA 1WZNA 1PFWA 2XYHA 4MTLA 3HK2A 4RGBA 4RXTA 3R76A 1NN0A 3L6UA 3PYLA 2JFWA 1JH9A 2B25A 4PZPA 1JVNA 3CKLA 4XR4A 1JFSA 3VISA 4DRXB 1LSJA 2UAGA 2OYRA 5LB2A 1HH4A 1F4VA 1T0BA 3DDUA 5FWYA 2FWRA 4NBKA 1L8XA 3VNSA 3W7VA 1SBYA 1DSSG 1XD2B 4AMBA 2P6PA 2VPIA 2I4TA 5ALZA 1Z3IX 2M6SA 4LZPA 2GXAA 4BVEA 1PBNA 2G1KA 4KOAA 2UYYA 1OF1A 2Y1CA 3VBCA 2Q2QA 3OZVA 3PUVA 1V16B 4R0VA 1PFGA 2Q0SA 1ZK1A 3GGDA 4XWGA 3KYBA 4AG3A 2QM3A 5HPYB 1OXVA 2FFAA 4Q01A 1PNTA 5K3OA 2COUA 3NAGA 3SC2A 4MS4B 4DG5A 2QPAA 3S3TA 3SS8A 1EI9A 3HDVA 5EKXA 3QPWA 2EKLA 4IDBA 4NCKA 4L73A 2G7MC 4PYNA 4DPLA 1LDYA 2IF0A 3FUTA 3IVAA 3BRSA 2QVCA 1KRXA 1JKJB 4MW0A 3UGTA 1SA0B 1J7JA 3GU3A 2EBWA 5F33A 1N5JA 4F9TA 5A4JA 3L8GA 1M34A 4CU5A 2CKDA 2ZBVA 2NX2A 4HDSA 4D25A 2HJVA 2O2HA 3MAJA 3PTAA 1E2NA 2C88A 2YS6A 3COVA 3LKZA 5EQJB 3OM1A 1OOEA 1NL3A 4CQMB 1HE5A 3TPCA 3ZOKA 1R0WA 4X8OA 5E4TA 3K16A 1LTKA 1K6MA 3ETNA 2ZSUA 1XQXA 4LOJA 2IU3A 4OQPA 1B6GA 1IUOA 5JXGA 3H2IA 2AOWA 1MAAA 3UJCA 4OUDB 4DA4A 3QX3A 2VTKA 1RE1A 3H75A 5EXTA 1E4YA 4JBHA 1CJBA 4MI6A 4CFSA 1JXOA 2QMHA 2XNCA 1UPAA 4YO8A 2AH5A 2EWVA 2DFKB 1RWOA 1P9WA 5TMEA 1PJTA 4HWGA 4AZ3B 3AL0C 1TKRA 1CUSA 2NT4A 2WWFA 2WV9A 4I36A 5AICA 1RJ9A 3EVCA 1XMSA 2CFIA 1LI5A 3K1YA 3K73O 3LX6A 5A3SA 3W79A 4F96A 2D54A 2PVCA 4NECA 2P0EA 1U7TA 3CCFA 4C4RA 1T91A 3RFFA 3ZVMA 1C50A 4IDCA 4YO7A 1IBMB 3QW4B 1B8NA 1SHKA 2DT8A 3V4VB 1KYTA 1YBFA 4K2HA 3CBGA 5IAAA 2PZ8A 2BJWA 1QKIA 4XB6B 3FSRA 2W9XA 4EFLA 2JFOA 2AJ8A 1PT8A 4H7DA 2AN1A 2YJ3A 4NBLA 3FPKA 1NVMB 2Z2IA 2ZBEA 1ZNXA 3WX0A 2IEIA 4B3SB 1X8LA 1KZ1A 3MWFA 4IDGA 2O7VA 4P54A 3NLLA 1ADBA 4YUAA 2F43B 2NYAA 1EWKA 4MSUA 3K71B 1MB4A 1UUFA 1V3UA 4PYJA 3ZWKA 1ECJA 3E5HA 1KNQA 2F1HA 4G5FA 2BP7A 1JN0A 4YALA 2YX1A 3DO8A 4YRMA 2WWYA 4UM7A 3DXFA 3V7YA 5K09A 3K1AA 2WRZA 3WYEA 1O7JA 4K5QA 3D7KA 2QI9F 1NAIA 4QU0A 3E82A 2AEJA 2IHVA 3RHSA 3F8SA 5D2CA 3BIXA 1ECCA 3MIZA 3RFCA 5HKKD 3O9MA 5DV9A 2C92A 3PR3A 3GZTB 1ZK0A 3KVRA 4FUQA 1JHXA 3DE2X 3ZGYA 4B3JA 1UEXC 1VG0B 2LKCA 3R6GA 4FFOA 4KLRA 3SDSA 5JW6A 1EUYA 3JQ9A 4GH5A 2YC4C 4R6WA 2W2LA 1B41A 1YO6A 2IPOA 2XW6A 3K5IA 4MROA 5IS2A 1JR3A 5J5VA 3FKSD 3ZV3A 2R1TA 4JLOA 1IY9A 2BKLA 1EVLA 2WZDA 4UD6A 1BVHA 1L6RA 3IQXA 1HNXB 1Y5IA 3IQHX 4B47A 1BHQ1 1FLAA 3V8QA 2BDUA 3AR4A 4MJXA 3RFTA 4B6EA 2EJBA 2DERA 1T13A 5E7IA 3ZZ0A 1CEYA 1TFUA 1U9IC 2JIBA 3LG2A 3T7CA 2C57A 3VHQA 4NYIR 3QVSA 4TWBA 3TTXA 2A94A 1G8MA 3BJMA 1OA1A 3ESDA 1V41E 5DI9A 4AF6A 2QUZA 4R1PA 3TSOA 4R2HA 1NMXA 4A15A 4LS3A 1QH8B 1LQTA 3AIIA 2PY6A 2CD7A 3L01A 4G1BA 2FQXA 3OCZA 5I9NA 3PWZA 4NAVA 1C1XA 1GG5A 3L4SO 3SF8B 1CLEA 2XZOA 1X13A 3BCHA 2AOTB 4PBRA 5J40A 3VHRA 3WC4A 1K8XB 3NV9A 1XE3A 3DKKA 1KKUA 2BEVA 4TYQA 4V39A 3KWJA 5C4GB 4P86A 3AKZA 3VKGA 3OI7A 1FMJA 1KVSA 1VSQA 1YTUA 4GLFA 2GCEA 1CNFA 3MVEA 2HQRA 4M1WA 4C20A 1CVRA 1F12A 1N6PA 4C21A 5L3ZA 4ID3A 1Y3BE 1H5NA 2J45A 1EEXB 1B6SA 1CQJA 2FMKA 3ABSB 3K6JA 5IK2D 4GSKA 2ZM5A 3WKDA 4L27A 3V00A 3PRYA 4M8NE 1BXKA 4XZ3A 3DDCA 3OIYA 4J3NA 3S6JA 1MX5A 1PJLA 2QT0A 2QRKA 3I83A 1EGAA 3MZ0A 1K2WA 3QJGA 1DZ3A 4G25A 4KQ1A 2NVUB 4LJ9A 3IMEA 2CXTA 3M70A 5IJ9A 3HU2A 2FQWA 1JIQA 2HWWA 4MZXA 4F4UA 1QP4A 1P1IA 1NSFA 1WMFA 4DG9A 3ZTTA 1O5IA 2VP3A 4K2AA 1D5CA 1G5IA 3GGSA 4MB6A 3GNTA 5ILOA 1KO4A 6REQB 5IHPA 4X20B 2XE8A 5J4KA 4N7JA 1OXSC 4D8WA 3P9IA 5KB3A 4QULA 4HR7A 3X0DA 5EE5B 3V1KA 2BFOA 2OP1A 4MWTA 2QTHA 1MB0A 1C3XA 2CJYA 3VH1A 1C7ZA 3JARA 3FOBA 3MWEA 2PJUA 4C7BA 5C8VA 3E7FA 2ZUWA 1C9MA 2IOYA 3C3DA 3S44A 1FSZA 2PK3A 3QVVA 3RS8A 4KAJA 3TB6A 4DV5B 3PL1A 1WOYA 4Y2HA 2PVPA 1JBKA 1K4YA 4N0PA 3SYTA 2WDZA 5LJLA 3I61A 2QU7A 2ZYIA 3PF8A 4DQVA 3BAZA 3OU6A 1IM2A 2AXEA 4HUQB 3ZCUA 3A7EA 4TQGA 4FE4A 3VOTA 4DZRA 1KR2A 1ZOPA 4DCGA 3P2IA 2VJLA 2VP9A 3OEED 2BGUA 4DLVA 3T5CA 3CRMA 5KTSA 3VMFA 1S4QA 1Y3AA 5F7OA 3FDIA 4JC8A 1MN6A 3FNQA 3RABA 1YFLA 4A1FA 1M5RA 3PUJA 7AT1A 4KV9A 3GLGB 2E5LB 1NT4A 3ZDFA 1NF9A 1RPAA 2HEGA 5E4JA 4ZOQI 4M1QA 5LOVB 4FQ5A 2ZRQA 3TUJC 3DEZA 1YKFA 1Q3TA 4DB2A 4NAUA 2FW6A 4P08A 5FYDA 2R96A 4JBIA 2JFQA 3ZBUA 1F2UA 1Q5PA 4FT4A 4MI9A 4ZTBA 1MJHA 3U37A 1O8BA 5KYGA 3IE0A 1OREA 2QTRA 4B40A 3HDGA 1UQTA 2XECA 6AT1A 1XPRA 2O8EA 4CEIB 4P4LA 3ZWQA 1DEOA 4A9AA 2GCIA 4ZO4A 4EF4A 2WJVA 4V0SA 2OQVA 4B3HA 1W4LA 2X6TA 1O97C 1QK3A 4H17A 4DR4B 2H08A 3U80A 3AI3A 3VNUA 3VO2A 3IYLW 1FDRA 2GTPA 3ZLAA 2I71A 3D02A 1PZGA 3WYDA 1OILA 2LKDA 3RC3A 2N1BA 2PH7A 4IHJA 2W6ID 4X6YA 2HMSA 3KKZA 3L93A 4LOAA 4P3PA 2EQBA 3WADA 2GHTA 5A5DA 3LBNA 3ZGZA 4MUXA 1IZ8A 2RCNA 4QOJA 1L3CA 4BV9A 2UV8A 1IUNA 2F1RA 3OCVA 2FEAA 3E3LA 3GEDA 4HAOA 5EZQA 5JADA 4OAOA 1Y1SA 2WB4A 1BMQA 3T15A 3V34A 1N92A 4ZVNA 2JEYA 4WXPA 5EKDA 3TQOA 4B81A 5J2TB 1C5KA 1XNGA 4S12A 2DY1A 5HWSA 2BLNA 1TW3A 4PY2A 3JQPA 1H0HA 5H3HA 1MRNA 4LJRA 3NDPA 3ECCA 3L1VA 4LCEA 1KVQA 1M1YA 1P5FA 1TTPB 2DFLA 2I0FA 2FFJA 3FKSA 4E4RA 1JG4A 2QQ5A 3K5HA 3JQ8B 3QA3E 1P17A 5KDLA 1EX9A 2JFHA 1CJSA 2LXNA 4JBWA 4UQPA 1ZVJA 2AMVA 5JJCA 2Q5EA 3CR8A 1RHJA 1SBZA 2FP3A 1PWYE 2H2WA 3WOHA 3HKCA 3V2IA 1OTXA 3DP7A 1OH7A 3IESA 3FMGA 2ZYHA 1VE1A 2AMLA 1YK0A 4IVPA 2IY8A 2XCLA 1S2MA 4JQSA 5HJEA 4TMYA 3A2LA 1VYVA 5G0VA 3FH0A 3RFXA 1EXWA 2YOFA 4BBAA 2V3WA 3SBDA 1MZPA 3X44A 3KPYA 5IEBA 1FTNA 3H9CA 4MCAA 3WAGA 4RH3A 1Z0KA 2V6MA 1MUUA 5FNVA 4BNNA 1H2XA 1XWWA 2EFEB 1NW4A 2XQKA 2EATA 2PGLA 1G41A 4MW2A 4CPDA 3BK7A 2PKXA 2VQDA 3E4CA 1NQXA 5A0FA 2QD5A 3U5ZB 4KMMA 5LP6F 1T9AA 4TT3D 5EP4A 4YRAA 2QVYX 2WWGA 4QDTA 3RT7A 2DBVO 5L3QB 1FPMA 1KMIY 3GMDA 2BEKA 4X6LA 1YDWA 5AXDA 1YAHA 3SSNA 2ZIEA 1NVVR 4BKPA 5BOSA 3ZH2A 3W5BA 3QNMA 3EDMA 1Z13A 5F5LA 2ZZKA 3T7EA 3K0CC 3NV7A 5ALOA 3VU3A 3PVZA 1UF9A 2XUZA 1O89A 1T4BA 1BU5A 5IK2A 1GNRA 1DJQA 4ZALA 4DLNA 1X7WA 2Q7DA 1TAUA 3KZKA 2C2MA 2CLFB 4ETNA 1NHGA 5JH7A 5JSFA 4LF6B 1S1MA 5J2UA 2QUIA 1BW9B 2YZGA 5HS4A 1AV6A 2VAXA 4M21A 1K3UB 3CZRA 1TU0A 4JLUA 3TGWA 4F8EA 4TL6A 4BUJA 3NYQA 4J4BA 4K6GA 4QYMA 4YN3A 5EJ5A 3GVPA 3NHAA 1HC7A 1V8OA 3CCBA 4DJTA 3ZQ4A 1YB6A 2PJZA 4UNQA 1P60A 2JGDB 2ZI4A 2NM0A 5EXPA 4AROA 5CB0A 3P7MA 1RABA 4Y2TA 1NQUA 4KK4A 2MSKA 1XLWA 1RHRA 2CFTA 2OG1A 5FPTA 3LIIA 4FC7A 1UT6A 1E64A 1DU4A 4IQ8A 3T7TA 3GXBA 4FFVA 1U7WA 5M7EA 2CDNA 1TMOA 3EYWA 4W5HA 4YHHB 2DKOA 4GMDA 1N33B 5D86A 2H5LA 3KE8A 4P81A 4U5XA 4MQBA 5JFTA 1UBCA 3I05A 2NUBA 3QKSA 4O8ZA 1QV9A 1XZFA 4PHCA 1SIUA 3OZRA 4LJLA 1TQDA 1YE3A 1CIPA 1QFYA 1VCNA 1NW5A 1RRVA 3RVJA 5CM9C 3RK1A 4G8DA 1QF6A 4RMGA 2O5VA 2YV2A 3OEEA 2XZLA 1P9RA 1VFNA 1E6WA 2J3IA 2QJFA 4WADA 3TKYA 5KOJA 3OAAD 4YNBA 3QFRA 2XTNA 1K1EA 4M8IA 1R3DA 1IMJA 2V7VA 2ZK7A 3CX7A 3ETGA 3M82A 1TUBB 3NC1C 3OZXA 4ROTA 4DL9A 1IBCA 3RQIA 2IBMA 3WI7A 4H7IA 4X94A 4CXMA 3LWZA 1TC2A 4L2IA 4RKEA 3WGLA 4YWHA 1XYYA 4C30A 3UT5A 1LK5A 3AZOA 4BTVA 4YV0A 1R3UA 2GKSA 3FCYA 4ZYUA 5EP2A 4AS1A 3VSEA 1HOTA 2BMDA 1ISRA 1DTSA 1O6ZA 5CVJA 3HVRA 1NG9A 2XADA 3BX1A 2FJUA 1QH1A 2CHUA 3E7PA 1VECA 4G9EA 3EZFA 5L3SB 4ESVA 2J3EA 3ZJTA 4ZVMA 2CDBA 3DBLA 3I8XA 3TBFA 2OMKA 4BN5A 4C1NA 1ZD4A 3THWB 1N1GA 4J0JA 4JXKA 2AYXA 4TWRA 3UOGA 4B31A 1JI0A 1AHHA 4JR2A 3AP2A 4TYPA 4J07A 3IX7A 4O4JA 1QHSA 4IHJF 2Q6KA 3GJ5A 3AWIA 1ZEJA 4LY0A 1JLMA 2DH6A 3T5MA 3TI9A 1VHQA 5LNK6 4G5QA 2PQMA 4QAQA 4D26A 2IODA 3LCMA 2OCKA 3ZHOA 2WIDA 2H7XA 1KQNA 2LBPA 2I6XA 4ZT7A 3CH5A 2X2FA 2WJHA 4A2QA 1V9LA 3TZQA 5HG0A 1EK5A 5C1PA 4HVAA 1JKFA 1NR5A 1SXJA 1U0JA 2GXUA 5SYMA 1KDYA 1K89A 1G2PA 3ETJA 4AJIA 2FZ5A 1H6DA 1YI8A 4NPHA 1KAGA 2AR0A 3AKYA 1UJ2A 4ZT4A 2CLSA 1NVGA 1U2ZA 2PJDA 1USUA 2RHOA 3W1VA 5BV2P 1IIRA 1CT9A 2E4VA 2IEGA 3T6KA 3V3KA 2CMHA 2ZB3A 1A8HA 4XDGA 1DX9A 3SX2A 3KTOA 5JY6A 4KQMA 4MQ4A 5AOBA 1F4PA 3V1NA 3C8UA 4BN4A 4UNSA 1IB0A 4Q3AA 3UJBA 1CQXA 3WZMA 1XQ6A 2YOHA 3U4MA 4IDXA 1JJAA 2ZBFA 3HBAA 1Y9ZA 3H11B 2WJ6A 1RYYA 5CDFA 5CB6A 2I2DA 3NUQA 2PS3A 2ZB7A 2CLOB 4KE6A 5PNTA 3BA1A 1FFGA 3T4XA 3RAEC 3DL7A 1TMYA 3KEQA 1ECLA 4AK9A 4EZEA 4ZCMA 3CH6A 4GLOA 4QWWA 3SQMA 3K32A 2O6LA 4DA0A 1YOBA 2E87A 1Y8RA 5FNVF 1GGMA 4H0FA 5COBA 3EC2A 1G7TA 4CL2A 1BAPA 2VUIB 2H48A 3UHFA 2G6BA 5FOTA 4YPFA 3L8EA 1X94A 2A67A 3CLRC 3EXAA 3FFBA 4TLDA 2JPDA 1EFPA 1XTUA 2XUOA 4LJ7A 1SIWA 2FZVA 2R84A 2B5VA 4LQDA 4RVCA 1I51A 4FIZA 3D7SA 1M2OB 2BJHA 3I2KA 4ZICA 3LUHA 1JS1X 1UP7A 4GOND 1KEZA 4FHEA 2Z1MA 5GOZA 4O4HF 1XD9A 3C7AA 5AI8A 1M2VA 5ARBA 3PXXA 3MCWA 5CEEA 3ZHUA 3IQEA 1N0WA 4IH1A 3RW9A 5ELMA 4DUYB 4Q7JB 4RY0A 3CC8A 1IEQA 3IAHA 1T9KA 5DGTA 5IC6A 1YQGA 2GNAA 2P8SA 1JHOA 5DX0A 3RVNA 2I7XA 4E22A 5FWNA 3IMFA 5J2UF 4FSXA 4K87A 5FTNA 1X1BA 4R16A 1ZLXA 1XMQB 2PX6A 3ONDA 3GD7A 3ZHQA 4IXDA 1QRSA 1RWBA 2FRXA 1NW6A 1R8YA 1J22A 1NVTA 2VZLA 1ORTA 3GFTA 4L4UA 3CH4B 1TD9A 5D5QA 3RQSA 1KEWA 2Q29A 1NLYA 1ZUNA 1OY1A 2P1DA 4I1RA 4KLNA 4E08A 4HZUA 4F92B 4I8DA 1IAVA 3HZOA 1EQUA 3HZHA 4AP6A 1VKOA 4HEHA 4TVSA 5E2BA 5KSZA 1NN5A 2DWUA 3AEZA 3CX4A 4N6NA 4GM0A 1NVBA 2C77A 5H83A 5JEEA 3KX2A 3VR3D 1PK7A 1UM9B 2GLXA 2K2QB 3KLBA 1BVUA 2VTBB 4O1HA 1V43A 2EJWA 3RJ9A 3FNRA 3JATA 1KU6A 1EKXA 1O0SA 2DR0A 4I1IA 2QTLA 5BSFA 1HE3A 1QIHA 1WRBA 1F0YA 2FRVA 2AI2A 2OHJA 3H4IA 3WHLA 1UXKA 1PNVA 3OLYA 1V26A 4PBTA 4RIHA 1H9CA 2YS7A 2OGZA 2Q27A 2ZSIA 3MGGA 4GS5A 4V3CA 3IVMA 1FUIA 2NU6B 1OUMA 4HT3B 2QOEA 3H5TA 1D8TA 2J4FA 3B1YA 3PC8A 1V1MA 5D5PA 4B7XA 1VI2A 3LLUA 4XOIA 1GNVA 1R16A 2KYRA 3H18A 3ROZA 2VPYA 3N3BC 3UJ9A 1S9HA 4XWKA 1N6KA 3TPZA 1VI5A 2RH9B 1L0BA 5ICCA 4JI4B 1ZJZA 3OAAA 2CXSA 1C8LA 3PSHA 2YXNA 4HNGA 1W49A 3SZUA 1W2GA 5CFNA 4O4LF 3AJ8A 1XAGA 2FEOA 2VEDA 2D4AA 3LHSA 3T9DA 2WJGA 5HMMA 5CXQA 3JQBA 4O6VA 2JJQA 2CF6A 5AO9A 5EXSA 4CIXA 1LQUA 2PMCA 3JALB 3KT0A 2OO7A 2WJZB 1HE8B 4AJ2A 2D5IA 5CNKA 4JASB 3S4YA 1W48A 2GWRA 3WDSA 5JSZB 4LWZA 4IEFB 4LF4B 4KX3A 1G17A 2YHIA 3QU4A 1BXRB 4OL9A 5CIYA 3KSBC 2WSSD 4KVZA 2GZRA 5I7HA 4ZAVA 3PKJA 2C98A 4MYRA 1UP4A 4AZTA 3TR0A 3AV0B 5HUHA 5BW5A 2YHUA 5IW8A 3H04A 5EIOA 3TEMA 1EHYA 1XZLA 4O4JF 5KOHB 2F1KA 1H2HA 2ZKLA 4F8YA 4U8GA 1U8ZA 3LO8A 4GZ3A 2M6RA 2PSHA 2QF7A 4I4IA 1SVLA 4RF4A 1EK1A 3B1KA 5ULLA 1OGYA 2XIQA 3STTA 3TYXA 4DM4A 3RSCA 3JWIA 2XNSA 3C3EA 2ZIGA 3K1ZA 4MUEA 1KMHB 2O2XA 4JEHA 5EMMA 1Z4PX 4WKNA 3IKMB 1IYZA 1ZN9A 5K20A 3PT5A 2X5NA 1THTA 3V4PB 3QG1A 3EIWA 4MKFA 5JALA 3UPDA 2ZZMA 3VR4D 4OQDA 4Y6QA 1NDUA 3RVRA 3WMEA 1XU7A 2WD9A 4G26A 3GP8A 3LECA 4LW8A 3SJAA 3T38A 2OXCA 2BGNA 4R83A 1E98A 1SIBE 4GPAA 3IDOA 4U7JA 3PUIA 4WXMA