1I3KA

Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
347
structure length
347
Chain Sequence
AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAMGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNVVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for severe epimerase deficiency galactosemia. X-ray structure of the human V94m-substituted UDP-galactose 4-epimerase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords UDP-GLUCOSE 4-EPIMERASE
total genus 127
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1i3kA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1i3kA01
1LTHR 1MG5A 2P9GA 4KQXA 4B7UA 4BQRA 2ILTA 4GKVA 2B4TO 3QW2A 2PFGA 3TFOA 1VJ0A 1B0AA 1GYRA 3KYCB 1YH3A 5THKA 4XKJA 4E32A 2LDXA 2UV8A 2VHWA 3HE3A 3AY6A 1B26A 2JAHA 1TI7A 4IMPA 1HYGA 1VL6A 1V3VA 3LT0A 4FGSA 2WDZA 3IC5A 4CR7A 4BMSA 3OICA 3MOIA 3PHGA 4OXNA 1N7HA 3B6ZA 3F1KA 1XGKA 3GQVA 1EK5A 4Y6PA 3DR3A 2I66A 3FWNA 4AJJA 4CM3A 4A2CA 4XCVA 4O5OA 1YOVB 4YAGA 4K9DA 3HDQA 3HHPA 3DMTA 2CUKA 4J1SA 1ML3A 3B1JA 3X2EA 2PD4A 1U7HA 2BFOA 5DP1A 2O2SA 4MVJP 1Y8RB 4CUZA 2WD7A 3TL2A 5I9MA 5L40A 3F3SA 3ZV6A 5F1OA 4CM9A 5KNLA 1KEUA 2ZYAA 5EIOA 4O59O 4BKQA 2GD1O 5DNAA 3I9KA 5AXCA 1U3WA 4QSMA 3RVDA 1YGYA 4DIFA 4E3ZA 2AEFA 1P0FA 1C0KA 4YVFA 2QW8A 1LLDA 1DHTA 2IYPA 4CMEC 3E5RA 1NXQA 2EGHA 1M66A 4IUYA 1VE9A 4AFNA 4CR6A 4LCEA 4YACA 3GGPA 1NASA 5ILGA 4MIOA 4IXTA 3FBGA 1R16A 1NYTA 3Q3CA 4K26A 4B4VA 4TRMA 3K2BA 2B5VA 2PZMA 3OJOA 2C7GA 4UUPA 5FWNA 1LLUA 2DBRA 1V3UA 1XKQA 3PLNA 5ICMA 1WXDA 1GQQA 4E5KA 3BZUA 4X54A 1PS9A 2W4QA 4M1QA 5A5FA 2X5KO 4BO0A 4G5HA 3RKUA 1JA9A 3WXBA 3RBZA 1R66A 2A4KA 4M87A 4BNYA 1RM0A 2AW5A 4IZHA 2XF8A 4R16A 3KOUA 2HKIA 3QP9A 1WDMA 5G0VA 5JE8A 2HMTA 4F6LA 1NTOA 1YJQA 3BMQB 4GMFA 4MP8A 3SLGA 5BNTA 5GMOA 2QZ9A 4L4RA 3WGTA 1KC3A 2DUUA 2HCTA 1NFRA 4H7PA 4WLEA 1P77A 3PP8A 1ZK4A 2NTVA 5TJ9A 2VOJA 1D8AA 1E5QA 1KEPA 1ZK3A 3VH1A 2Z1NA 5A9TA 4HFNA 3CSDA 1GADO 1FDUA 5JXWA 3WB9A 2UAGA 4RZHA 4YR9A 4YRDA 4NZ9A 4LVCA 4ZD6A 4LK3A 2POQX 2EKLA 3SXPA 3VPSA 3TDKA 4NFSA 2ET6A 4ZQGA 5B37A 3GOHA 1YL6A 3WJAA 4ALLA 2EERA 4MVJA 1DEHA 3GHHA 2AQ8A 4NBTA 5JCXA 4YJGA 3DMYA 3F47A 3BXXA 2HSDA 1E3IA 3BMCB 4MP6A 5HS6A 4BNGA 5B1YA 3ETDA 2C59A 3VPXA 3ROKA 3H9QA 4GLLA 1NVGA 3EK2A 2QRLA 4JN6B 4FFRA 3SEFA 4CPDA 2AE2A 1R4NA 3SC6A 1R4MB 1UDAA 4HX5A 4IPTA 1I30A 3TZKA 3A9WA 5EMHA 4BNUA 2QG4A 3ST7A 4WECA 4DVJA 1QLJA 4FFPA 4M55A 4CV3A 1E7RA 4GAEA 4OAQA 1U8FO 5GZ3A 4G2NA 1I3LA 1V8BA 1E6EA 3FSRA 4ITUA 1HEUA 2AMFA 4NNJA 3WNQA 4IS3A 5EL0A 4XJSA 2HK8A 3LC1O 4WLFA 1R0LA 3VAZA 4U0KA 3VZPA 4NK4A 4CJXA 1MG0A 3GMSA 3MEQA 1UUFA 1YBVA 4A7PA 4OIMA 1DIBA 3GT0A 4XIYA 4IS2A 4BNJA 4QFCA 1YRLA 3NV9A 3H2ZA 4Y9DA 3L6EA 2JCYA 3ANLA 4B7XA 3VVCA 4HP8A 4O1MA 3W8FA 3FRJA 1LEHA 2E4AA 2QYSA 4MIYA 4WCDA 3DHYA 4BIIA 1Y5MA 2P5UA 2B5WA 3DAPA 1XQ6A 4PCVA 4JBGA 4TQGA 2JKVA 1A4IA 5DDIP 2QQ5A 4E12A 2VQ3A 1P45A 2J3IA 4IQ8A 1HSOA 5EQDA 3GHYA 4B8WA 3ANNA 2WMDA 3ZU3A 2GCGA 2AQIA 2Z95A 4NH4A 4Q3DA 2YZ7A 3TJRA 3I6QA 3K96A 3AUUA 1TT5A 1IOLA 1ADFA 1H6AA 5HS4A 1DBVO 4OOEA 5FF9A 3MOGA 1M6HA 4ND3A 1JAYA 2FP4A 4I9NA 2HMUA 1TLTA 1MB4A 4WLOA 4QECA 5G0SA 2EP5A 4WASA 4NDNE 5B4TA 1IB6A 2FOIA 2VYVA 4NPCA 3AWDA 1A9ZA 5CPFA 1H9AA 4DLAA 1GTMA 3U4HA 1NNUA 5IAAA 2O4UX 3C8MA 4FS3A 2NVBA 1SB8A 5ES3A 2YQ4A 5JCJD 4F3YA 2FN7A 2GO1A 3BHIA 1X13A 4GGOA 3VDQA 4HUJA 4GH5A 3JQ9A 3MWDB 5CDTA 1U4SA 4CUJA 4JP3A 2FRDA 2UYYA 4CM7A 2JCVA 1HYEA 3IP1A 3MJCA 1DDOA 5AOVA 3VPHA 5I9NA 1JLLA 3DBRB 4RJTA 2Y1OA 3CUKA 2I6TA 1DRUA 1XR3A 1E77A 2XAAA 4ZJUA 3PLRA 1NWHA 3HSKA 5IZCA 1JKFA 4HNHA 1HLPA 2VUSA 3AUSA 2EGGA 1PL7A 1Z7BA 1G0NA 3ZWOA 3LQFA 2C54A 4IGFA 4XYGA 2Y1FA 1UP6A 1ADGA 5ADHA 3H9EO 1PJTA 4A10A 5JCJA 1XU9A 2VWQA 4IZIA 2OXIA 2F1KA 3PYXA 3GNTA 3WOHA 3ULKA 3LYLA 1MA0A 4CQMA 5IXSA 5IZCC 4R69A 4ZQBA 5LCXA 4L75A 2O3QA 2OL4A 2Y68A 1EUCA 1D1SA 1QR6A 3E5MA 5ENVA 1I2CA 1N92A 2IEBA 4EUHA 5TF4A 4I08A 4YCAA 4O6VA 5DBGA 2IODA 4II2A 2VZ0A 5JC8A 2CMDA 4URFA 5ITVA 4PRKA 3OEWA 1UXIA 3BAZA 3VH4A 3V2HA 3P7MA 3BTSA 3GA0A 2C07A 3AOGA 1X1EA 4BNZA 3VC7A 1PL8A 4L9RA 3RBXA 1UP4A 4HKTA 5K9ZA 1LX6A 1EE2A 3VH2A 3WTCA 5CDYA 1H5QA 1TB4A 1PGNA 4OM8A 4FFNA 4K28A 4EYEA 4I5EA 2PK3A 2FPPA 4OGWA 1PZFA 3QVOA 3RI3A 2GUGA 1F06A 2J5QA 2UUPA 3OJEA 3T7EA 1P1JA 4CQMD 3WYEA 1P31A 1LUAA 1QYCA 1AXEA 2NU7A 4P4GA 5K6AC 4JBHA 3C1TA 1ZNQO 4J7XA 5DZSA 2UDPA 3HNPA 4XX0A 2P9EA 3DOJA 1JU9A 4NK5A 3M2PA 3OJ0A 4Q3EA 3RJ5A 3M1AA 2HJSA 3R6DA 2ZQZA 2DT5A 5AVOA 5F5NA 3DB2A 3NT4A 4BNNA 4KWHA 3HQ4O 5H82A 4BNFA 4JXKA 3PXXA 4LSWA 3BTOA 1AGNA 3RFTA 3DZJA 1SAYA 5BNIA 3QA9A 2H6EA 1ONNA 4E13A 4UREA 1MC4A 1VRWA 4IY1A 2PD3A 2UVDA 4XA8A 1P9LA 4LSMA 3ZWVA 4L76A 1RYEA 1RJWA 3V1YA 4A26A 3WGIA 2D8AA 2FZWA 4E4YA 1N1GA 4UVDA 4WCFC 4CM1A 3QWFA 1QXSA 3CEAA 4UEJA 4GQAA 4Y6SA 1LDYA 3HFSA 1PWZA 1SOVA 1Y9EA 3DAFA 3KHUA 4W9NA 3RD5A 3W8EA 1GYQA 1MFPA 1T2CA 2B37A 2FSVA 2HDHA 2H5LA 3RJ9A 3C1OA 4J9UE 3DZFA 1PZEA 4GSLA 3E18A 4PG8A 1XSEA 4YTEA 4U6SA 4CUKA 1F8FA 2NU6A 3JQEA 3RUAA 4LN1A 3WBFA 3GAFA 4NJMB 5CP8A 1VC2A 2NSDA 2TMDA 3GFBA 1Z7EA 4G65A 3WLFA 1C0IA 3RC1A 2HK9A 3H2SA 4XGNA 1Z45A 3C24A 1DHRA 4DPKA 4NQZA 1KVSA 3V5NA 3ZN2A 3N74A 3ZI0A 1LC0A 1ZJYA 3UHAA 1DXYA 1GV0A 3E03A 3L4SO 3UVEA 4CM4A 3BMNB 4QTZA 1M75A 5A9SA 2CDCA 2Q1TA 1Y5RA 3FPLA 5BNFA 3S2GA 2VWHA 2NU8A 2DBVO 4Z9XA 4W99A 3DO5A 3HZZA 3OJFA 4HFRA 3EW7A 3RASA 3ROQA 3JYLA 3K6JA 4CMBA 1AXGA 2Q1UA 3ETGA 1J5PA 1B16A 3ANMA 2IEDA 4BL5A 3PWKA 2ZQYA 5FFFA 1B2LA 2VCYA 3ICCA 1CERA 4LISA 3UUWA 1MUUA 1BRMA 1ONPA 3TOZA 4CQLA 2W2KA 5AXBA 1L7EA 5L9AA 2XXBA 2HMSA 4JIGA 1NVMB 3GFGA 1DLIA 4NJMA 3INGA 1U2DA 4QQRA 1Q7BA 1KBZA 4CLXA 1N1EA 4BKPA 1M6WA 2NQTA 4RLSA 3GR6A 2AEJA 5THQA 3UCEA 4EJ0A 5T5QA 3ONEA 3SBOA 1C1XB 2A92A 3OSUA 4CQLB 3IQDB 4EEZA 2B69A 1YBAA 3GK3A 4J1QA 3RC2A 4XD2A 4F6CA 5DF1A 3KV3O 4S3MA 4J0EA 5L7TA 1JAXA 3ZWNA 1M2WA 3WS7A 3L0DA 2RHRA 4YJFB 4B3IA 2Y93A 1I2BA 1A72A 4AJ4A 2JJYA 1FDVA 3EVNA 1MLDA 1E3WB 2ZYGA 4GPD1 3PVZA 4Z6KA 3OA2A 5JDCA 5I9LA 4HBGA 5KJEA 3WQQA 2WTBA 2O3SA 2E82A 1RM3A 2AG5A 2CZCA 5CDGA 1Q0HA 5JW6A 2OO5A 1B7GO 1WDLA 3OIDA 3SLKA 3AM4A 2BHLA 3D64A 3NT5A 2BKAA 4UUOA 5FI3A 4I5FA 4M8SA 3HWRA 3EAGA 3O38A 1DJQA 4MKXA 2YFQA 1O0SA 2HMWA 2R00A 4CM8B 1LA2A 5JDCC 3ZNNA 1VI2A 3NT2A 3CMMA 4GWKA 2R6JA 2D5AA 1P74A 3PJFA 4IDDA 4J7UA 4Z0PA 4DYDA 1QMGA 1WP4A 5JYDA 3UCXA 3H65A 3ZW9A 1T4BA 4KQWA 4PLPA 4RQTA 3L9WA 4RPJA 3A28A 2PV7A 4ALMA 2BFPA 5A06A 2C5EA 1E7YA 3E48A 4FD3A 4EITA 2HJRA 3PQEA 4LMRA 9LDTA 3QVTA 3JYQA 4J4TA 2X8LA 1NFQA 2AEMA 4TVBA 5DN9A 4KZPA 1MP0A 1YXMA 5AXDA 4B79A 1HKUA 1K6JA 2WM3A 3K2EA 2FWMX 2CVQA 2WEKA 3GDFA 1A4UA 3HADA 2ZIZA 1I24A 4IDAA 5JAIA 4RVDA 2JFGA 2D3TA 1OI7A 5A05A 1C3VA 1R0KA 4PRLA 1QYDA 3D5TA 2W98A 3S2IA 1XQ1A 3EGOA 3H4VA 1PR3A 1YWGO 4TKLA 5KOIA 1PJ4A 4CV1A 4MDHA 1U1IA 5BR7A 1ORRA 1LRJA 2OBYA 1PGPA 4EJMA 2YYYA 4D42A 4RF3A 5A04A 1CYDA 3I4FA 3NX4A 3WWZA 1DFGA 4NBRA 2QYTA 4C7JA 3BMOB 3JD0A 5DCUA 3L6OO 3VPGA 2C0CA 4J16A 2AXQA 1HSZA 4KUGA 4UVHA 1UXKA 2IZ1A 4PG6A 4D45A 2G5CA 5L4LA 3KYDA 3AFNA 1FDSA 3Q0EA 5JAZA 4ZQHA 3IDSA 3RIHA 5A5EA 1TT7A 3GUYA 2O23A 2VRCA 2VUTA 2RIRA 3JQ7A 2QIOA 1C1DA 1E7SA 1NHGA 3NJ4A 1I01A 5F5LA 2PY6A 1LQTA 5DT9A 2B35A 3Q9NA 4J43A 2JFFA 1X15A 5CDSA 1SZJG 3OFSA 3DOCA 1ISJA 4CLOA 4NIMA 5G4LA 2FR0A 1K0UA 2OOSA 3FBTA 3F4BA 4LW8A 4AJPA 1C14A 3N58A 3V2UA 3KEQA 3U3XA 1I10A 3FNHA 3KYBA 2PD6A 4RF2A 3DOOA 3R3JA 2NUAA 4QUKA 2C2YA 4IBOA 2Y0CA 4MJLA 3TZQA 4AJKA 2AE1A 4MVJE 5ICSA 2CY0A 4CLOB 5I7FA 3JD2A 3H3JA 4AJNA 4C4OA 2Y05A 3VZQA 4Z3KA 4MVJH 3NDRA 3K31A 2VRCD 2WE8A 4D79A 3CE6A 4K6FA 4RVGA 3AU8A 4OOFA 3F1LA 2CDBA 1CF2O 3PJGA 1YL7A 4INAA 5TRTA 4BNMA 3GG9A 1PZHA 1U5CA 3K30A 4A27A 4R5MA 3W4IA 4OL9A 4GX2A 4CMJA 2F00A 3ENNA 4MKZA 1UZLA 4TROA 2PKRA 4L0QA 1K5HA 4UVGA 1ENOA 4PZDA 2ZTUA 4RPGA 3RU9A 4ND5A 1XEAA 2FZEA 2WD7B 1OFGA 1GYPA 3PYMA 4NBVA 2O3RA 3LDHA 4XB2A 4TVOA 4WCFB 7MDHA 2X0NA 3Q2KA 4BHTA 1HE2A 5GZ6A 4D0SA 1LDGA 5EJ2A 3WGZA 1F0YA 1E1MA 1AHIA 4W9NC 1U4OA 1X0VA 1Y6JA 4W7IA 1UR5A 5JY6A 3IMFA 3V2GA 5TX7A 4PLYA 2P2SA 3EZYA 4NJOA 1UXHA 3LSYA 4N18A 2IXAA 4PFJA 1CQIA 4I1IA 3AI3A 2O4CA 4XJTA 4DA9A 4R3WA 1E92A 3PIDA 4IDGA 5KKAA 3ZWWA 3PJDA 4PZCA 4WNIA 3ON5A 4GSKA 1ISFA 3MTJA 3DFUA 5IG2A 3QVSA 1GFSA 4DRYA 3U5TA 2V65A 1G6KA 3KM0A 3WGOA 5EN4A 3GEGA 4HFMA 1I3NA 4LRSB 2OHXA 3ADOA 4R68A 3LT2A 3QVWA 4BO1A 1NR7A 3Q6IA 1LRKA 3E6AA 3NTOA 4YJDA 4J1NA 5C3MA 2IZ0A 1HZJA 3H8VA 2NVUA 4BO6A 4YJHB 4DLBA 3WGQA 1YB5A 3KETA 2Q1WA 3JQFA 4FBGA 4YA6A 5LC1A 2P4HX 1ZJZA 3D3WA 3E82A 1GDHA 1OOEA 4YXFA 1OMOA 3TOXA 2PZLA 3VKUA 1PGQA 4PG4A 4LGVA 4GX1A 4BNHA 3GPDG 4J4BA 5G4KA 4BKUA 3R1IA 4BO2A 1SCUA 2X86A 3I5MA 1QYWA 2VHYA 3NTRA 4BGEA 2X9NA 2V7PA 3FNGA 3ZNOA 1MFZA 3IS3A 3WQSB 2I65A 3D3WB 3GZNA 1PU2A 4PN3A 1A5ZA 4H16A 2PH5A 3PIIA 3M2TA 1I36A 1HDXA 5JBIA 3GRKA 4DTIA 1V3TA 4M89A 4L73A 1NM5A 3WFIA 3DWFA 1ENPA 5G0TA 4B4OA 3V1UA 1RPNA 1DC3A 2EW8A 1DAPA 4RDIA 3P2YA 4YYZA 2A35A 4OSPA 1U3TA 3BA1A 2B36A 3FNFA 2I67A 2NVUB 1PQPA 2DVMA 4M54A 4NG5A 3F5QA 1VJTA 2J3JA 3SVTA 1LSOA 3U09A 3L6DA 3IKTA 2G1UA 2Q46A 3QLJA 2Q1SA 4XYBA 4EW6A 2H1SA 5IDWA 4RVFA 2LDBA 3G49A 4ZQFA 2VHZA 1EQ2A 5I8ZA 3BMOA 5T8KA 4A0SA 1GCUA 2D0IA 3DL2A 1JQBA 3WYCA 5JFOA 4H3VA 3ZHZA 1PJCA 4F46A 2HRZA 3KYDB 4ZGWA 3NGLA 2NNLD 2HRBA 2EKPA 1XU7A 2HUNA 4IJKA 4PGFA 4QEDA 1UZNA 5G0UA 1ID1A 1UP7A 5KJCA 2YDYA 3IUSA 2O3UA 1NR1A 4J2HA 1T4DA 3WNVA 5U1PA 1UXGA 5K0ZA 3GVCA 2GN8A 3K92A 1JTVA 1DSSG 2IRWA 4XQCA 5HM8A 1JN0A 3DHNA 1QV6A 4WK6A 1WNTA 2Q99A 4U8GA 4KDFA 3WR5A 4ESOA 4UEKA 4WKGA 1BGVA 3U4CA 3AJRA 1A7KA 3UXYA 3RUFA 4W82A 3GEMA 1MXFA 2DTEA 3ADPA 1PQWA 4R5HA 4AJ1A 2ZB7A 4BMNA 3DZHA 3ABIA 3GPIA 1ZIDA 3QJ5A 1E7WA 1KYQA 3LLVA 3ZH2A 3O8QB 5TLSA 1KIFA 4AJHA 1HT0A 3VZRA 2GF2A 5CPBA 2OORA 4UUNA 4ILKA 3KO8A 1KERA 5L4SA 4D3SA 1TT5B 1XYGA 2WWRA 3CTMA 3I9LA 4KTTE 4ALJA 4HV4A 4LVUA 4RVUA 4YT4A 4YEDA 1X1TA 3EY4A 1ZSNA 1BWSA 3FNEA 1Y8RA 3DONA 3HB5X 2GR9A 4FFMA 4J1TA 4N5LA 1LRLA 4KOAA 3ETEA 1O89A 3WSVA 4G81A 2J8ZA 4CMKA 5GY7A 4IDBA 2GZ1A 4TZKA 4AJEA 3H9UA 2C7VA 2V6FA 3LT1A 1EDZA 2JHGA 1EVYA 1PL6A 3TFQA 1GQYA 4B4UA 5L51A 1B3BA 4CLRB 2RHCA 1IL0A 4XEHA 1HDYA 3PDUA 5KWEA 1NX6A 2BRUA 2FY8A 1BVUA 4BV8A 2X5JO 1S7CA 2WE7A 4J90A 4U0JA 2GGSA 4IJUA 2X5OA 3DBRA 3CZRA 5KIAA 4KMSA 4YT2A 1PJQA 2EJWA 2O7SA 5TJHA 3WDSA 1OC4A 3PQDA 1XA0A 4CLRA 1CJCA 2AG8A 4Q3CA 2OMEA 5DBIA 2VOEA 4B3JA 4HXYA 3ZNQA 1Y8QA 1UH5A 2X23A 3DEYX 5ILOA 2YFHA 2GYYA 4L74A 1WWKA 5C7IO 3E9MA 3ITKA 3QWBA 1EBUA 3IJPA 3AM5A 3ASUA 4BNWA 4GL4A 2PZKA 4MVJF 2IYOA 1V35A 4FQ8A 5A1TA 2CF5A 4CM6A 5F21A 1PEDA 1HE5A 1IY8A 2AA3A 4BNVA 2PZJA 3X2FA 3CZMA 1UDCA 4FGWA 4AVYA 4GX0A 3ORFA 1B8PA 4E21A 3DBVO 1EVJA 4H15A 1BMDA 3E9NA 5MDHA 5A9RA 1Y9AA 1KVUA 4E2YA 3EC7A 4BO7A 4BS9A 1P1KA 4Q39A 4MKRA 4IJVA 3GVHA 4ROSA 3PGJA 3TZHA 4WNCA 4KTVE 3JQ8A 1PGOA 4BUCA 1LDEA 3OECA 4RORA 1T24A 3I6IA 1NHWA 3O4RA 2JL1A 5U4QA 3AOEA 4EUFA 1HF3A 3DMTC 1F14A 4BO9A 3V1TC 3D4PA 2Z5LA 5IJZA 1HDRA 2ZCVA 3ZDFA 3PK0A 4EUEA 4FDAA 1DC5A 2AQHA 4JX8A 3JD1A 4N5MA 4XRRA 3G0OA 1PR9A 2EKQA 1SBYA 1Q0QA 2YHIA 1JVSA 4NFHA 3HDJA 3B1FA 3N7UA 2WYVA 4DGSA 4CODB 5IDQA 1ISMA 3JYOA 3ZWMA 1XIVA 3INRA 4I5GA 4IINA 1ZXBA 1UXJA 5A9SB 1SC6A 4DC1A 3GC6A 1YONA 2FR8A 4NBUA 4GX5A 3CINA 1RYDA 1A9YA 2Q2VA 1B3RA 3Q1LA 3DC2A 1Z73A 4JK3A 3JYPA 4Z0HO 1ZKMA 3NAQA 4RZIA 1B8UA 3NKLA 4ND1A 3RC7A 2H63A 4ZVVA 1ZSYA 2PGDA 4GI2A 2BFAA 2IZZA 2WYUA 4CM4B 1DIRA 4R1NA 1VPDA 2VNSA 1EBFA 1I5RA 4PLFA 3AK4A 3PJEA 3GVIA 1DO8A 4Z3DA 2WJPA 2VWPA 1KY4A 2J6IA 3RUEA 1Q2XA 3DQPA 3HN2A 2OBNA 1CDOA 4CV2A 5CFZA 9LDBA 2E6UX 1JWAB 5B4UA 3FN4A 1SOWA 4D3DA 4XZ3A 5L53A 4MVJD 3F5SA 4DC0A 4WE3A 4R4JA 1LDBA 4FOSA 2DQ4A 2X22A 1SMKA 5CG1A 3GUCA 4JJFA 1U2GA 1PJBA 2I3AA 1HZZA 3EZLA 3FD8A 1VKOA 4NHEA 3FF4A 4JBIA 3OJLA 4ZRMA 2R2GA 3GN1A 1E1NA 3I9MA 1BW9B 1OC2A 1YB1A 5J23A 2R00C 3DZGA 4XDYA 2XXJA 1LI4A 3MJSA 3OEYA 5BSHA 3BHMA 1H6BA 4EGFA 1OAAA 1P33A 1IULA 1GUYA 1YDEA 4O0LA 4IIUA 2EXXA 5HBRA 1B14A 5KTKA 1GCOA 1XG5A 3UW3A 3ZWAA 4Y8VA 1PSDA 5BSGA 2J3HA 4KP7A 2VT3A 4FJ0A 4RVHA 3ZHXA 3W6ZA 2D2IA 1Z74A 3H9JA 4UUMA 6LDHA 3L07A 4JCOA 2EP7A 1WZIA 2QRJA 3DHEA 5KVCA 4UVEA 1PJLA 1E3EA 3LC2O 1L1FA 5K6AA 1GZ6A 4JGBA 1ZZEA 5F1KA 4B3HA 1SEPA 4RDHA 2Q45A 2GN6A 4R1SA 1O9BA 1K2WA 4FPXA 1PZGA 2BGKA 1Q1NA 2GSDA 4EBFA 2B83A 1I3KA 3KZVA 3P5SA 1U8XX 1BXGA 4WOKA 4CLDA 2DBZA 1BHSA 2ZYDA 4XQGA 3GAZA 1W73A 1ZFNA 3OM9A 3AOEC 3LF1A 4OXKA 3NTQA 2HAEA 1YBMA 1U3UA 2V6BA 1XCBA 2Q2QA 4I8XA 3NDJA 2QX7A 1Y7TA 2CVZA 3W1VA 1GV1A 1BVRA 4CMHA 4YWJA 2ZJ0A 4Q3NA 3OBBA 3Q2IA 1DJNA 4Y6RA 4YBZA 4LMPA 3ZWXA 2D5CA 4E5PA 3GN2A 3G1UA 1L7DA 4E2WA 3TPCA 3W4JA 1O94A 4RPHA 4PIVA 1W0CA 2P5YA 3EHEA 1MXHA 1ULUA 2QHXA 2EJVA 3DTYA 3JQAB 1ISIA 3RBVA 4P38A 2Z1MA 4IIVA 4BV9A 1VSUA 3GLQA 1CWUA 1JW9B 4ZA2A 4UAGA 4P22A 4RVSA 1HWYA 1ZEMA 3VKVA 1N9GB 3A06A 3ICPA 4RPLA 1VKNA 5C7LO 3QIVA 2EV9A 2DU8A 3ITDA 1ARZA 2P4QA 1R37A 2RAFA 3PHHA 1FDWA 3H5RA 1A7AA 3PWSA 4NI5A 4TRNA 3DBLB 2I9PA 2J3KA 4ALKA 3ZU4A 4N54A 1NWCA 1N7GA 5IDYA 3OA0A 5JPIA 3QWIA 2E48A 3VH3A 1PJ3A 2ZCUA 1WMAA 3ASVA 3RQSA 1E7QA 1JDJA 4IQ0A 4FB5A 1ZCJA 1OBFO 3WLEA 4JLWA 3JQ7B 4FOOA 1H9BA 2O50A 2BELA 2WD8A 3OF2A 3F46A 4MP3A 4PLTA 4R1UA 1U7TA 3ZV3A 4R54A 5IN5A 4I9UA 4ALIA 5A4DA 3G17A 1JKJA 1VLLA 2YJZA 4A03A 3ZV4A 1IZ0A 4E2ZA 3IIEA 1HDZA 1ADCA 3AI2A 4IDCA 1J6UA 5AYVA 4BNLA 1ZK0A 1QLHA 3JTMA 3JYNA 3E1KA 5HA5A 3OMLA 1WDKA 1UAYA 3EDMA 1VL8A 4DQXA 3CXRA 4OSOA 1Q7GA 4YQZA 4JQCA 3SJUA 5F3RA 2VHVA 2YDXA 4AICA 1H6DA 2GRAA 3BTUA 2DC1A 4I5DA 2PH3A 4A5OA 5T57A 2J5RA 4NMHA 2DFVA 4FCCA 3RFXA 1IE3A 3KSUA 3JCZA 3K8ZA 1Y81A 5KJFA 4D43A 1LLCA 1ZMTA 1ULSA 1ZMOA 2PTGA 3GMDA 3L4BA 5L7YA 4CMAA 1QYXA 1XELA 4F45A 1EVIA 5I8WA 2X4GA 3W4KA 1DOHA 3NDIA 4L8VA 3UF0A 5MGBA 3UOGA 4W7HA 4BO8A 2TMGA 2JFHA 4QT0A 1YVEI 4E6PA 5TT0A 4E2XA 4IXWA 1LSSA 1ISHA 1X0XA 1GR0A 3A14A 2IDZA 1ZUD1 1NQAO 3JD4A 1SB9A 3C7AA 2NM0A 3FTNA 3COSA 4PG5A 3B70A 3CPSA 4S1VA 3ROMA 3QQPA 1D3AA 3OHSX 3ZNPA 4DIOA 3BMQA 3LT4A 1LSJA 1WVGA 4WCFA 5HRUA 1E6WA 4FR5A 2OGUA 4BGUA 1I0ZA 3H3FA 4QXMA 2VRBA 5JYEA 5DCWA 3WG9A 4XYEA 3VZSA 1PGJA 2G82A 2QZZA 4OXYA 3NYWA 1LNQA 4I9HA 3IAHA 4MVJI 4RCVA 4DLLA 5JY1A 1UDBA 4YPOA 5KVQA 1BSVA 3JQAD 3FR8A 3VHRA 4ALNA 4AJOA 1QRRA 3DBHA 3KVOA 2W2KB 3HDYA 3WICA 1GZ3A 3ZU5A 3RU7A 3LVFO 2DPHA 3STHA 1NPTO 1P44A 3PYLA 3HFGA 1KC1A 3CMCO 5JAMA 5JMWA 4OKNA 3HN7A 2H9IA 3JQDA 2ZJ1A 4FSHA 4WLNA 4CL8A 4DQUA 5FEUA 5AXAA 3LU1A 1GD1O 1ZO8A 4E5YA 1PS8A 1I2ZA 3AUTA 4E5MA 2GZ2A 3MJTA 5TS3A 2ZB3A 4YJGB 5EERA 4J49A 1QORA 1HETA 3GZNB 3U9LA 4ZRNA 3BMCA 3W8DA 1NBOA 3LLSA 3PEFA 3R0IA 1XDWA 3VTZA 1P0CA 4PVCA 2FHSA 3HDHA 3D4OA 4M86A 5TC4A 3DFZA 3RWBA 2C5AA 5LDGA 4W6ZA 4CMGA 2BI8A 4NFYA 5ENDA 4CLHA 4DUPA 2PGLA 1R4NB 2B4QA 3B1KA 4QO8A 1PJSA 3MZ0A 4HADA 3NRCA 1EUZA 2PKQO 1WAMA 4MINA 3WMWA 3NJ8A 2GZ3A 4PVDA 2Y0DA 4FN4A 3WYBA 2GERA 2NTJA 2YV1A 2HK7A 4AJIA 2YHUA 1AHHA 3IP3A 4OO3A 3GF4A 2VT2A 4ID9A 3SC4A 8ADHA 5T6BA 4DQVA 3RKRA 4A73A 5T8KC 2Q2WA 3BTVA 5L3ZA 4EI2A 2YW9A 1IUKA 3H9GA 2DUWA 4ZQEA 4AG3A 2FPIA 4YDRA 5IF3A 4DPLA 4J4HA 3GRPA 3JSAA 3WGHA 2PNFA 1EE9A 2DKNA 2GN9A 4LCJA 4DXHA 4YB8A 3D1LA 4DIBA 2ZTLA 3WQRA 2E49A 2I99A 1HRDA 4JJGA 1ZW1A 5B4VA 1ZH8A 1GPDG 3WX0A 3MJ4A 4MOWA 2DM6A 3JQCA 1H93A 1T26A 1O95A 4BGVA 1LBEA 1F17A 4IJWA 2G0TA 3HUDA 1H94A 1J4AA 1ENZA 1PQUA 1BG6A 5IN4A 1GQ2A 1BTOA 1E3LA 4DMLA 1YJ8A 3PI7A 1YQGA 2BD0A 3JQBC 3IOYA 3GZ4A 1RWBA 1DFIA 3ZCXA 2RH4A 3QSGA 3UAGA 3O8QA 2X7HA 4GBJA 4FJ1A 2JD2A 5L4NA 1NP3A 3D0OA 1GEGA 2BF7A 4U7WA 2G17A 4AL4A 4J2OA 1K89A 1YDWA 5JDIA 1EK6A 1Q0LA 1X7GA 3GNSA 4B7CA 3QV1A 1BDMA 1XWFA 2X58A 2IXBA 2B4RO 2CFCA 1GUZA 4ND4A 3UCFA 1ZEJA 3KXDA 4FFOA 2FMUA 4YAKA 1PS0A 2HMVA 5JS6A 4E33A 4II3A 1EFLA 4OMUA 3UKOA 4GKBA 5CAEA 2CSUA 3NEPX 5TGDA 1ADBA 1ZK1A 5DOVA 4NR0A 4BNIA 5A3JA 1A27A 1G0OA 3O9ZA 5C37A 4Y98A 1WMBA 2B0JA 1FXSA 1J49A 3KYCA 5BSFA 4FC6A 4Q3BA 5KCZA 2G76A 4B4WA 1E5LA 1T2AA 2O7QA 3D7LA 3UICA 1HE4A 3NUGA 2J5KA 4BKOA 4FIZA 1V6AA 2JD0A 4E5NA 4R41A 1N8KA 5H81A 3KTDA 4MVJM 2DTDA 3QHAA 1YOVA 2FPGA 4XYMA 2X1HA 5CG2A 3FI9A 4Y67A 2YQ5A 1I3MA 2VTEA 4MPDA 1ENYA 4WUVA 1KVTA 1CIVA 4IGEA 3OQ1A 1WLYA 4JROA 1K6XA 4ND2A 1GU7A 2YUTA 1YQXA 5CHEA 3RFVA 3I4CA 1AUPA 4AJLA 3KRTA 5EPOA 2X0IA 1E3JA 5ER6A 4DYVA 1Z82A 2PR2A 4OH1A 5ER9A 4K6CA 3FWZA 1PX0A 1ISGA 3WJ7A 2ZTVA 1GUFA 3VDRA 1ZK2A 1T2FA 3VVBA 3WWYA 2BLLA 4BO4A 4JNKA 5TSDA 4PLVA 2BMAA 3GVXA 3UN1A 5L95A 5C7OO 3PHLA 2W2LA 3GEDA 1R0SA 1NQ5A 2OP0A 3LC7O 2AHRA 1Z75A 2PGJA 4ZHSA 4MO2A 3VTFA 1KVQA 2PKQP 3K9QO 1XLTA 1F8GA 2OFPA 2A9FA 2A94A 1DFHA 1GL3A 1MC5A 3IUPA 5JO0A 1D4FA 1GAEO 3FTPA 1I33A 5JAQA 2DTXA 1Z6ZA 2UUOA 4P4NA 1AN9A 4BKRA 4RLHA 3U49A 3M1LA 5JC1A 3QWHA 1HDOA 2RH8A 3EYWA 1VL0A 2O48X 2NADA 2X0RA 1Y8QB 5B12A 1EUDA 3DZIA 5CDUA 5HWSA 1N2SA 3GDGA 4OKIA 4EDFA 2EEZA 3INTA 1DIGA 1X7HA 3TZ6A 1X14A 4OQYA 3AUAA 5JMPA 1WZEA 5TIIA 1AE1A 3BYZA 4NU5A 4RO0A 3OQ6A 1KOLA 2ZK7A 3DZBA 3Q9UA 4CL3A 3HG7A 3S1LA 2C2XA 4YJHA 3VOSA 1K3TA 3WMXA 3JD3A 1HXHA 2GPTA 2ZKLA 4DWVA 4J91A 4XR4A 4WGGA 3JQ9C 1KETA 1U28A 4OYRA 3DXFA 3GDOA 5JDIC 4JJIA 1B8VA 4M49A 1CETA 2PWZA 2W8ZA 4XGKA 4OQZA 5G4KB 3PQFA 1ZXLA 1I32A 1IHXA 5JNLA 4DL9A 4CM5A 3C7CB 3ZWYA 5CEEA 1UAGA 3KLPX 5JSFA 3ZWPA 1IZ9A 2AQKA 3JQ8B 1NFFA 1E3SA 3ZZNA 2Y1DA 3B20A 1NQOA 4GLOA 1HYHA 2BI7A 3QY9A 3ZWBA 3U62A 2HLPA 1KEWA 4KUHA 1O5IA 3RUCA 3GY0A 1P3DA 3JQGB 3WTBA 5BQFA 1ONOA 1R4MA 3L9XA 3TWOA 4FFLA 1T2EA 4IMRA 4WLUA 4U6QA 2Y1CA 3AW9A 4J9VA 1CQJA 1DLJA 1YB4A 4TMFA 3IJRA 2P91A 5U9CA 1CRWG 3E9QA 1C0PA 2JHFA 4WEQA 2ZTMA 5A02A 4OJNA 3I9JA 3AU9A 3O26A 1V9LA 1W4ZA 2NACA 3OQBA 5TT1A 5DBFA 1RM4A 2CVOA 2ZB8A 2GNAA 3PWZA 3PZRA 5COQA 1LXCA 1BXZA 4P8RA 4N7RA 4RQUA 2BFMA 5LDHA 3VPFA 4Q9NA 5G0WA 5JO9A 1QG6A 5DOZA 5BT9A 3M6IA 1BDBA 1A71A 1MV8A 3R3SA 4GWGA 2VWGA 3OIFA 4KUEA 4W4TA 4E0BA 1NVTA 2Q4EA 2X6TA 4DBVO 3SJ7A 1EEHA 4GMGA 3T4EA 4DBZA 3K5PA 5COBA 3MWEB 1PIWA 3H5NA 3TQHA 3NGXA 3RC9A 1H2BA 4RPKA 3L77A 4L4SA 4EZBA 1LQUA 2WYWA 4R51A 4BOYA 3OETA 4ZICA 3K73O 4JP2A 3I23A 4CQMB 3C7DB 2DPGA 4GVLA 2OUIA 1KVRA 3MCVA 1KY5A 4CR8A 1DC6A 2X9VA 4NU6A 1FJHA 1BXKA 1HDCA 2YV2A 3C1AA 4TWRA 3TZCA 1UZMA 1DPGA 4UVIA 4D0RA 3JQFC 4CMIB 4WJZA 2XOXA 4QFDA 5F1PA 3T7CA 4PLHA 4BB6A 4HFJA 1CEQA 4Z9FA 1U9JA 3UFXA 4UULA 3H7AA 4CM9D 2P68A 2VUUA 1GEEA 4KWIA 3RCBA 4D41A 2Y0EA 2DBQA 4WLVA 1C1XA 1E6UA 3JV7A 3PDJA 3KSDO 3KSZO 4J0FA 3S8MA 1MX3A 3FCOA 3WGYA 3I52A 4RL6A 3F4LA 2EW2A 3C85A 4R01A 4NBWA 5A03A 1IPEA 2NU9A 2HO5A 2JAPA 5EESA 1MGOA 2RBEA 4EJ6A 2OZPA 3AY7A 4BNTA 3QE3A 1D1TA 5ITWA 3AY3A 3JQAA 4DPMA 5H83A 4ZU3A 3Q11A 4TRRA 1Y1PA 4GVXA 2Y1EA 3MJEA 1YO6A 4PLZA 1QV7A 2X9GA 2E37A 3BIOA 4O63O 1R6DA 1U3VA 2VN8A 1GY8A 4PG7A 4D7AA 3PPIA 1IPFA 4TRJA 1IHYA 1FDTA 1EFKA 3QVXA 3ROPA 3ZV5A 3FHLA 3I9OA 1TXGA 2VHXA 2FSSA 2VZ9A 4XDZA 4WEOA 5COAA 3WGGA 3DBLA 3V8BA 4BGIA 4XQ9A 3DAGA 1UJMA 2CD9A 3KEOA 3HB4X 2Y1GA 1EDOA 3TSCA 4CM8A 4CMIA 1LLQA 3D4NA 1W8DA 2Y66A 5EQFA 1JKIA 4CMCA 2W2LD 5KVSA 3GG2A 2OP1A 4XRGA 1TA4A 1G1AA 3EVTA 7ADHA 4U5QA 2Y99A 5IZ4A 1V0JA 4UEOA 3U4DA 3WSWA 1NQTA 4XQEA 1FK8A 1HE3A 3H6KA 1I8TA 4E30A 3LZ6A 2IE0A 3EUWA 3MTGA 3L4BC 2GASA 1DRVA 1QYVA 3WIEA 4RV9A 4LRTB 2W90A 4J3FA 1IYZA 2Q50A 2CF6A 2JCXA 3ZWCA 4HWKA 6ADHA 1DB3A 4XGIA 5TQVA 2YHIB 5G2OA 1J0XO 1GPJA 1H0KA 1LJ8A 4GGPA 4R9RA 4HNGA 4XR9A 1ZBQA 1EMDA 8LDHA 2I76A 3E8XA 4RF4A 2VYNA 2DFDA 3DTTA 2VZ8A 3GVPA 2Q49A 3PHJA 3CIFA 2EWMA 3RUIA 1X7DA 2NVWA 2O2YA 1FMCA 1WPQA 1SPXA 4C7KA 4TSKA 1RKXA 1T1RA 3CKYA 3UGKA 5C5IA 1K6IA 1VJ1A 2EHDA 1E0DA 5A3VA 4N5NA 3WIDA 5IDXA 5IXYA 1O6ZA 3ZGYA 1PJ2A 3G1TA 3PRJA 1EVZA 4D46A 3PFWO 1PTJA 3S55A 1P1FA 4B8ZA 1H2HA 3S2EA 1P1HA 3OP4A 2WSBA 1TVEA 4RF5A 1SNYA 2I5PO 1YS4A 3PHIA 3S2FA 4YT8A 1LDMA 3UH1A 5AQ1A 1T2DA 3JQGA 1VM6A 2JD1A 2NQ8A 3AFMA 4BO5A 3QRWA 1W6UA 3TRIA 2CNBA 4R9SA 3ENKA 3HJAA 4ONEA 1ZSVA 3I9NA 1LC3A 1HTBA 2VYND 2VYVD 1F12A 3GGGA 3KUXA 3OIGA 3TN7A 1T25A 3DDNA 4BB5A 3F9IA 3O03A 2I3GA 1NPYA 4BO3A 5CEFA 3QWAA 3AI1A 3KBOA 3PGXA 1YL5A 3FPCA 1O8CA 5TNXA 3ZW8A 4E31A 2YY7A 3ZHBA 1Q7CA 4P4LA 4BNKA 1DIHA 3JQBA 3BMNA 4YQYA 3RROA 4HY3A 3LK7A 5GZ1A 3IKVA 2Y67A 4IQGA 1HDGO 5DP2A 4PLWA 4PZEA 1GZ4A 3ZHYA 1DRWA 3RUHA 2PA3A 3W6UA 4IM7A 4OHUA 5JLAA 2GDZA 4ZN6A 4BMVA 3I3OA 5BSEA 1E1LA 1RM5A 3LF2A 2O3JA 3WBBA 3KB6A 4FW8A 2C20A 1FF9A 1R12A 4KDEA 1DAOA 1KEVA 5I7EA 4CV0A 4XYLA 5T67A 3EMKA 2BGMA 2HU2A 2V6MA 3GGOA 1E3WA 1JVBA 4WOJA 1HLDA 1QKIA 2Q3EA 2XPCA 3JQ6A 1SO8A 2O3TA 4R1TA 4AJ2A 1B15A 3G3EA 4L4XA 3PTZA 4RGBA 1LSUA 4FJ2A 5HTOA 4XWYA 4BNXA 2ZATA 2FR1A 3G79A 5FYDA 5KKCA 1C0LA 2D1YA 3D5QA 4FC7A 3KLMX 1PWXA 2NTNA 4D3FA 1U5AA 1EZ4A 2P9CA 5DULA 4YAEA 3A4VA 3TNLA 4CLEA 1ZVMA 4DREA 3AM3A 3U4IA 3MJVA 2C29D 2CDAA 4WPGA 5I7SA 2NV6A 3TF5A 1KS9A 4PLGA 3CH6A 2C82A 4DMMA 4YRBA 2VTDA 4CMEA 3TL3A 3P2OA 2HQ1A 1EQUA 2PLAA 1NPDA 1BW9A 1XHLA 2NWQA 4J6FA 4MIEA 3OH8A 2BH9A 5KVVA 1BXGB 4EEXA 1HL3A 3PZBA 1YE3A 1D7OA 1DIAA 1NAIA 3RSHA 2V6GA 5T64A 2GLXA 4YAIA 5KJ1A 4D44A 2QRKA 1T1SA 1LDNA 3DBHB 2GN4A 4QO7A 2EIHA 3D3EA 5FI5A 2VNAA 5KJ6A 1S6YA 3I1JA 3F6YA 4YJFA 2X0JA 2EF1A 4Z0TA 1NAHA 3U0BA 4BVAA 2SCUA 5EINA 4YRAA 1YKFA 3RAJA 1M67A 5I7VA 1N5DA 3GNQA 3I83A 5L45A 3H5AA 1WW8A 3GH3A 2D4AA 4IDFA 1E1KA 4PLCA 2YV3A 3SX2A 1P1RA 1M76A 1OZAA 2RCYA 3ZU2A 4BQPA 2DLDA 3T4XA 4MVJG 1YQDA 2NLOA 4R3NA 1TEHA 2D59A 4TKMA 4XIJA 4J7CA 3RUDA 4TZTA 1C1DB 1QSGA 4YAJA 5CEJA 3P19A 1E7MA 4Q3AA 1SEVA 2Q4BA 3FR7A 5DCYA 3BHJA 3C3XA 2DAPA 1JWBB 3ONDA 1P1IA 1VSVA 5L7WA 3DZKA 2EG9A 1R15A 2ZB4A 1DC4A 4IDEA 3WFJA 5IFLA 4QX6A 1LU9A 1N9GA 3A1NA 3PFFA 4K1LA 4Z9YA 1QP8A 3ONFA 4XB1A 4YT5A 3IL2A 2BGLA 1H6CA
chains in the Genus database with same CATH superfamily
1LTHR 2VK2A 4G67A 4B7UA 1MEEA 2OXEA 1T91A 1FPQA 4O2RA 1KY2A 3EWNA 3L4KA 1GYRA 3NW9A 3S4YA 3BEDA 1SIOA 4MR9B 2LDXA 4MI3A 4KVZA 5F23A 1AX9A 3FB1A 1O0BA 2UUBB 2I4NA 3HXMA 2CUNA 3PGVA 2A9RA 3AY6A 1N7JA 3GRAA 2JAHA 2QTZA 4URXR 3LT0A 4CR7A 2L17A 1XRNA 3IC5A 2ZQ5A 2H4XA 1N7HA 4UD6A 2PS0A 3B12A 4QU9A 1L5GB 4Y6PA 3DR3A 1YFZA 2XD4A 1XPUA 4AJJA 1UWVA 1HT1E 4TSFD 4XCVA 5LA6F 1Z2CA 3CZ5A 2FPGB 4K9DA 1WZCA 3HDQA 5H16A 2YZGA 3UPUA 2CUKA 4J1SA 5AICA 1H42A 2B99A 5LNK6 1VE6A 2JI6A 4YP6A 4AF6A 1CY7A 3NHJA 3R76A 5LL6P 3K6SA 1YZGA 2IPMA 1NA5A 4MVJP 2IF2A 1RAFA 2LIPA 1SURA 1LVGA 2WF7A 1Y8RB 3AV3A 1JJAA 3TL2A 4EFLA 3HPQA 3ZV6A 1TEVA 4FILA 5ALYA 3RAGA 1KEUA 4JEIA 1ZRNA 1DJOA 4Q6BA 1FX1A 2Q5JA 1US8B 2VH1A 2GD1O 3FHJA 3G6KA 4JBWA 4BKQA 2YOFA 1PJ8A 5DWDA 3ZCUA 3FKJA 2XWBF 5HQ3A 1XN4A 4D4IA 2HGZA 4OCZA 5F7OA 4MWBA 3Q98A 3UUFA 1NTRA 2QSYA 4M7RA 1ZN8A 2IYPA 3M9XA 3H2YA 1XCJA 5AJWA 3ND9A 2VIIA 1TLFA 1M66A 4MTCA 4LG1A 1M0EA 3AF3A 4IR7A 4WKBA 3GGPA 3TRKA 5ILGA 4H1TA 2FPWA 1KPIA 1XZ8A 2ODNA 5LD2C 4DHEA 3N6XA 5E1BA 1NW8A 3FOBA 1NXPA 1G9TA 2MJLA 4HEHA 4WINA 2EVWX 4TRMA 4QT4A 3I3SR 3K2BA 3MQ2A 2XMQA 4DN6A 5LIRA 1Z63A 4GFDA 2E87A 1N0IA 1XKQA 5KQLA 4O08A 1JDZA 2BEUB 3DP9A 5ICMA 4E5KA 4X54A 2OVBA 2PWYA 4OUKX 2P35A 4M1QA 4OMCA 5BYAA 1FCJA 1DRKA 1MB0A 2X5KO 5K99A 2XZLA 1QHHA 2O7VA 5EE1A 1GO2A 4L7QA 3L84A 5BQPA 1IY1A 3NETA 2MU1A 4PBTA 3D2LA 1Z4PX 2VJBA 3CLKA 3GJ5A 3REGA 3EVAA 4IZHA 4N65A 3QP9A 4C7OB 5JE8A 1DGQA 3RTGA 4M2LA 2HMTA 2P9HA 2RHLA 4F6LA 2PH7A 1NTOA 2BEVA 1NF8A 3SLGA 4MP8A 1U1GA 2DHCA 3G8YA 1XYYA 1QCZA 1II8B 1NN3A 3MJDA 5GMOA 4DCJA 5BNTA 4EWLA 2QUBA 3GZTB 2ZVJA 3WGTA 4F1JA 2DUUA 2OKGA 3FJ1A 2VCHA 4H7PA 4MVYA 3GQBA 4W9MC 5TJ9A 2B92A 3EXFB 4LI0A 4GOOD 4QDKA 6ABPA 1AB5A 2QN2A 3DEIA 1N33B 1VJDA 1ZK3A 3VH1A 2Z1NA 3B8EA 2WU8A 3CSDA 4AMZA 1GADO 4CKWB 4GMKA 3NHFA 4P35A 1S3IA 1L7NA 1E60A 1GZDA 4PX2A 2Q7DA 2YXEA 2QMQA 5TQJA 4A1OA 1H2AS 2UAGA 3QX7A 2PX2A 2QAGA 1X74A 3U4QA 1QX4A 4YR9A 1RWOA 2CXRA 3C41J 3L7JA 4D4GA 3BC1A 3DEZA 2ZUVA 4UFNA 2X5NA 3QVVA 3W7VA 1I7PA 4ZD6A 4EFMA 3SF8A 2QR5A 3D6VA 3VPSA 4M1WA 2FMKA 4RC9A 1G6OA 3SWWA 2VAMA 2ET6A 3LCRA 2ZDGA 4RSRA 5B37A 2G9UA 4JT9A 4LE0A 3WJAA 2I6UA 2QGFA 1MF7A 3PXUA 4P34A 1YE5A 3GHHA 1XNJA 2VXCA 3AJDA 4HAWA 4RSMA 4XFDA 3H0KA 4V0RA 4MYHA 3FE2A 3HZOA 4G8BA 4C0QC 1PFUA 3V4OA 1TM3E 2PAAA 2YXPX 5A7HA 3CW8X 2FYTA 3AUKA 5C1DA 1UQTA 2ZUBA 4M8KA 4MP6A 5CVCA 4BN0A 1QUEA 2JJQA 3LUPA 4YCSA 5B1YA 1K92A 3ETDA 2H1OA 3HRKA 1KPGA 4OV6B 1SQGA 2GRJA 2MDTA 1EDBA 4GLLA 1L5HB 3M7IA 5JZ9A 1DEAA 3ETCA 5ICEA 4BV3A 1XVUA 4YO8A 5EUMA 2WJ4A 2IEZA 2YYAA 3KQVA 4KWEA 3RO7A 3DOHA 4P9NA 1OI4A 1I30A 1EHIA 2G72A 3JR7A 4D9NA 1A4XA 4GHWA 1RQPA 4MULA 4Q1CA 5EMHA 4EYOA 1RKBA 2OGSA 3FBWA 3MCAA 3ST7A 4LC9A 1ZJJA 1JUDA 2EDAA 2W6QA 4FMBB 4IL5A 3NFRA 4X94A 5A7GA 1OLUA 1XD2B 4CV3A 4TTIA 1WUIS 2W6ZA 2HH9A 4GAEA 1G1MA 1MJNA 3OI7A 1VKZA 1E6EA 3WISA 3FFTA 1Y1RA 4BFZA 1F4LA 2OAEA 2WR8A 4NNJA 3ZKAA 1KQFA 2VZEA 2X2PA 4JU9A 5EL0A 2Q0SA 4DKXA 4S04A 4WLFA 4CIVA 1OKKA 4U0KA 1DVRA 2AZTA 3CLVA 3AL0C 5JTTA 1CLUA 3IXLA 3JZIA 5DRYA 4B4DA 1ZGGA 2C96A 1IU9A 4A7PA 2IH2A 3GJTA 2Z04A 1TFRA 2HA0A 4U39A 4XIYA 4Z7NB 4BNJA 1O6GA 3TUJC 3IVMA 1UDRA 3H2ZA 5A4JA 1UBKS 2BCJQ 1GPH1 1KFEB 2HMYB 4H27A 4RH1A 1VG8A 2QY9A 4UNRA 4HP8A 2R65A 3RSCA 4PTYA 2GD0A 1BS2A 2WILA 4WCDA 2QYSA 4MH0R 2C94A 4AY6A 4DRXA 3W9SA 1Y5MA 3HL4A 3IFSA 4UHCA 2B5WA 4JBGA 3G89A 1OX6A 1A4IA 3HGMA 5DDIP 1FY2A 3KHSA 1AHPA 2CLEB 3GRFA 1RQGA 1VMDA 2J3IA 1F8XA 5FPYA 2RE8A 1AKQA 3FUCA 3O7WA 1IZ7A 2ZYRA 4G63A 4PS1A 2PA0A 4PQFA 1QZUA 1REQA 1SA0A 2ACEA 1EB8A 2WFAA 3QTLA 4K05A 3A1CA 4L9WA 5H9WA 3TJRA 1SBQA 1JHOA 1GSHA 2PQ6A 2XIQA 3JALA 1TT5A 2G5TA 4BZZA 1IOLA 1PQYA 2WICA 3ZY2A 1DBVO 3IKMB 5LXTB 1JIIA 5E1DA 1C3JA 1JAYA 1N2XA 2HMUA 1DWOA 4OGLA 4WLOA 4EG4A 5G0SA 2IT1A 2AOUB 2CL0X 4WASA 1VA4A 1VHQA 2IP4A 4NDNE 5B4TA 1IB6A 4NPCA 2C5BA 1L7BA 1QYIA 4DVGA 2MTBA 4WN9A 4DLAA 1GTMA 3EGXB 3U4HA 3HBAA 3X2SA 1T5HX 1SBTA 1N3IA 5DLQC 1FP6A 1SB8A 5ES3A 4BMYA 4F4DA 1GKYA 1JAZA 1OAOA 3AJAA 3FWKA 4KDCA 1X13A 5HNKA 2FDRA 1SUEA 4GGOA 4GH5A 1U2SA 2QLBA 4TTQA 2XT0A 1ZX1A 3R3XA 4JP3A 4L5CA 1JG6A 2FF5A 1A2KC 3BBLA 5KTNA 3OHMA 1DCTA 1UFOA 3VPHA 3GFTA 1TW2A 3M6WA 2HCRA 3DBRB 5E6SA 3LKZA 4RJTA 2BGGA 2Y1OA 1RPZA 1G19A 3L4EA 4D8VA 3VRHA 2RGBA 1GN9A 4D2IA 2Q4RA 1KGSA 4JASB 4X1YA 4LHVA 4IWNA 2W4IA 5DHPA 1VMKA 4KVAA 4BLUA 3WL4A 1RR6A 2ODAA 1DBPA 2IVZA 1PL7A 1T8YA 2QK4A 2SKDA 3P2JA 1DAHA 5CDFE 3LQFA 5FA5A 1I80A 2FHPA 2Y1FA 3T3DA 5AVUA 4JV5B 3MD9A 4V24A 1MT0A 4DLRA 5HX7A 4MV8A 4RKQA 1COZA 2W9XA 1E66A 2GAJA 3BK1A 4A10A 2IE8A 2L69A 3ES9A 4QDOA 5HBGA 5TVGA 5AVKA 3U26A 3CUEF 2VWQA 1R6AA 3DCNA 1VHTA 3PL5A 3AINA 3QVLA 4JELA 5CIQA 2OXIA 3PYXA 3CZQA 3GNTA 4PICA 3PFHA 3U7IA 3LYLA 4EPYA 4CQMA 2ZVQX 3W34A 4ZQBA 1XTTA 2BP7B 2H4YA 3MSXA 3QFRA 5LCXA 4CCSA 2O3QA 4F5DA 1WMDA 4K81B 2C00A 4K5QA 1EUCA 1D1SA 3E5MA 3VR5D 2BEVB 4JQYA 2IEAA 5ENVA 5SYNA 3FNIA 4OJTA 2JIQA 1HTWA 3ABQB 4O6VA 4DBLC 1WE2A 5BXYA 4LF9B 2HLHA 4HMOA 4OYHA 5JI2E 2RHOA 3H87A 4QYTA 5DNCA 1S2GA 4C2AA 2H07A 3OEWA 1UXIA 2V0CA 3BAZA 1UKAA 1WRBA 1GZHB 1XJ5A 1YK1A 4NFLA 4TMZA 3DJFA 3ESRA 3GA0A 2RKOA 4P6VF 4URZR 1T8TA 2FTKE 1X1EA 3AOGA 1FRQA 4BNZA 1NT4A 2QLJA 3FETA 1NN0A 3W77A 4BCDA 5KOJB 2H0QA 1SKUA 3AEQB 3G2KA 5C5EA 1EE2A 3T94A 5DHSA 2CYBA 2NN3C 3CCBA 4G89A 2AMJA 1PFYA 2O1WA 2FMFA 3MXOA 4FFNA 2EJUA 1JFFA 3TEMA 4TTTS 1W0JA 4I5EA 4DA8A 1JEYA 5JG7A 3L7CA 1YJXA 4ZHQB 1DBRA 1K27A 2VT6A 3I8XA 1PZFA 3IDAA 3C45A 3MF4A 1F06A 1GA6A 1PK8A 2JI9A 2QJRA 3BSFA 3OJEA 4IUDS 2QRNA 4KO2S 5I7WA 3WYEA 3AR7A 4LZPA 1P31A 1QYCA 1T5LA 3FZYA 5T3UA 4YRNA 1E69A 1JDVA 3C1TA 3H1FA 1ZNQO 4JBHA 4MQ5A 3ZPXA 1IPHA 2UDPA 3HNPA 2M6LA 4XX0A 2R11A 3HYTA 1EAYA 3Q7EA 4ABTA 4NK5A 3M2PA 4KAXA 1SOUA 1USUA 5EJFA 4Q3EA 4BU0A 3M1AA 1MTOA 1IDOA 1SXJC 4UTRA 1I7DA 1KYWA 1MMFB 2ZQZA 4HDNA 3QBJA 3B53X 4R8KA 5CNMA 2BKVA 5GV7A 5AI0A 2DLCX 3CF4A 3E9EA 1DADA 4IOLA 4MQEB 4KWHA 4BNNA 1HUQA 1CQPA 3UV6A 4O4JB 4EF4A 3H13A 3HQ4O 3IB6A 2I91A 2P4EA 1CD5A 2ZWVA 2VH2A 1XD8A 1E79D 4C9BA 5EJ4A 1SVUA 2I4IA 4JYZA 2PX6A 4A82A 1YMQA 3H9BA 1WX1A 3Q5DA 4YAWA 1CYEA 2D2EA 4WK4B 1NI4B 4L0DA 1Z68A 4IMIB 3QA9A 5YASA 4MV3A 1ONNA 3DULA 1B74A 1CFZA 5EJ5A 1MC4A 4CT5A 1M8FA 4RH0A 2PD3A 5AKZA 4DMCA 5BYJA 3JAWB 3PEWA 1WEKA 1P9LA 3NHAA 4L76A 1XD2A 5AW0A 3CR3C 3UB3A 4A26A 4LJ6A 5EMJA 4DSTA 4ER7A 2GYUA 2Q4DA 3MGCA 4TMYA 3KCQA 4CM1A 4I3GA 2IX3A 3LYAA 2BFDA 2AFVA 1XDBA 3CEAA 3ESBA 4MLZA 1UBSB 1LDYA 2WC1A 1G20A 2JGMA 1SOVA 2NU7B 3W8EA 2NYUA 4W9NA 4MQ4A 3OOEA 2VJKA 4FYXA 4O4IA 4CN9A 3FAZA 1JDBC 3C1OA 5K3EA 1PZEA 3L1IA 3MTBA 1TW3A 4FONA 4U6SA 1KI8A 4ZCQA 4AYTA 4CUKA 3JVIA 3RUAA 3GAFA 3LUFA 5DCLA 5GOTA 5E1OA 4PYMA 4R0VA 3UGQA 2BY4A 3KQUA 2TMDA 1R3UA 3R3HA 1EP3B 3HY3A 1XDUA 3RT1A 3H2SA 4FR0A 3CB2A 1BA2A 4WY8A 2PGIA 1G17A 1WHSB 4QOHA 4F85A 5HYVA 2V9PA 1ZVQA 3HU1A 1ZJYA 2H85A 3K1TA 2IBTA 4YCCA 4OHFA 4OHKA 5K0EA 1QDLB 2B2NA 2CXNA 2QUZA 1Y48E 3C3YA 3IA7A 4HEA6 1M75A 4QE3A 4QTZA 5IW8A 5A9SA 2XBLA 3UJAA 1TKAA 3IPAA 3S2GA 2VWHA 4D99A 4EPVA 5HKOA 4Z9XA 3RV4A 1JSXA 2XI4A 4EBBA 5LUAA 1BZYA 1ECGA 2PL3A 5TEVA 3DO5A 3OJFA 3DE1X 1KJQA 1OIWA 2MCFA 3RASA 4AWXA 3ROQA 2BONA 2JEYA 3K6JA 1WW3A 4LSZA 1AXGA 4WVFA 3TLKA 2AXEA 1B16A 3ANMA 1SH7A 5K0NA 1H3EA 1E6MA 1BJRE 3AEKB 3PWKA 4QPDA 1IHOA 2ZQYA 3DFMA 5FFFA 1FSGA 2Y6VA 1LF0A 3A4MA 3LA8A 4LISA 4DMRA 1B42A 2RAPA 2W6OA 3I2YX 4R2WA 3UUWA 1CEXA 1DUSA 1Q77A 5DMHA 3ZKWB 1H4VB 2W2KA 5EEHA 2C99A 2QVYX 2PUDA 1L7EA 3UQZA 2XXBA 2LE0A 2XCUA 4N5HX 5EIWA 1ZVKA 3GFGA 3D43A 3AT1A 3HCCA 3P4YA 4WZBA 4R0MA 4NJMA 3INGA 2BOVA 5HQJA 3L8DA 4Z86A 3LY5A 1Q7BA 4LWZA 4MNTA 3CN7A 4CLXA 3I8OA 5KTYA 3PNQA 3OMXA 9ATCA 4KYTA 2XCQA 4XCQA 2BCEA 4C0XA 5T5QA 1H8ED 1QCYA 2HL6A 3V1LA 4B47A 4TUYB 5JZSA 4N39A 5E6UB 1FYFA 3IEPA 3GK3A 2E3JA 4RM3A 3AHCA 3NNSA 4UMFA 4XD2A 5DT2A 3IL2A 1RKQA 4J0EA 1XD9A 5A6VA 2EGUA 4IJQA 2VFAA 3KHKA 1CJVC 1JMYA 3AONB 4PRYA 1M2WA 3ZWNA 3HA2A 4UZSA 3L0DA 2RHRA 3PEEA 4B3IA 3WRWA 4AZ3A 2Y93A 4HGOA 5C4MA 4YONB 2RHWA 1FDVA 2AFHA 3O4JA 3W9YA 1M2OA 5HCNA 5DM70 1D2MA 5I9LA 2XUDA 4DQKA 3GJYA 2HW8A 2WTBA 1GGEA 4HI0E 3PPYA 3DF9A 5K3FA 3L0OA 5JATA 5BSVA 5F9FA 3ECCA 2R96A 4K86A 3JYHA 3UUEA 2VLIA 3E8SA 3TCXB 3OQOA 4HGYA 1J0BA 3PQ5A 4BFWA 2E89A 2JCGA 4X84A 1W35A 2RI0A 2RHGB 4I5FA 4M8SA 4MQLA 4INOA 3VU0A 4IGIA 2IYXA 4I50A 4W63A 3DG9A 1SGWA 3VOTA 4MKXA 3DMRA 4OHPA 5IBPA 1OTHA 2J59A 1D07A 5TMPA 3ZNNA 3VSEA 2D5AA 3HI4A 4Z0PA 1QMGA 4X3CA 2CC2A 1TUEA 4G0XA 4BLQA 4NV1A 3UCXA 5JYDA 3T5MA 4BQFA 2R25B 2ZJ7A 3CF4G 4FMCB 1YGPA 4RQTA 4PN7A 2AJDA 2ZVPX 3L9WA 2PV7A 5GONA 4QOJA 4YBRA 1Y4DE 1L4EA 1VIDA 3S3TA 3AEQA 5A06A 2GEJA 3I0MA 1E7YA 1MT3A 5K8LA 1PX2A 3PQEA 1PVVA 2UVPA 3QVTA 4LMRA 3V8RA 9LDTA 1RT9A 2X8LA 3M4JA 5DN9A 3IXMA 2VC2B 3EVZA 1YXMA 3NUZA 2HI0A 4N47A 1K6JA 2B6HA 5LZ5A 2CVQA 3GDFA 5JBNA 1A4UA 2OV2A 4ZCPA 1I24A 3IDZA 2G9VA 4EHLA 1ZY2A 1TJPB 2JFGA 2D3TA 5TPWB 2C2ZA 4NDZA 1Y5NA 4KQCA 4U8HA 2R3SA 8AT1A 1SUWA 4FYVA 5FEMA 1Z36A 2VDMB 4FVTA 3NHMA 3ERCA 4X5OA 3SR3A 3G2MA 2ZIXA 1IXZA 2FSIA 2H2GA 1X70A 2KS6A 1UBNA 3E9ZA 4JJ4A 1WXGA 4C5CA 2R8BA 5KOIA 3BAFA 4A91A 4BMXA 3MGBA 5DRTA 4QBGB 2FEMA 3ND6A 2R68A 2WB4A 4WKPA 3RUPA 5I4BA 2IYAA 2YVKA 4M1OA 5BR7A 4KIGA 3BXHA 4UZFA 1T3SA 4K9OA 4P86A 3AVPA 4C78A 3BH0A 1QLWA 1AS3A 4JHLA 4RF3A 4EYKA 1CYDA 3I4FA 3NX4A 4G5OA 4RKYA 1DFGA 3AFOA 3A37A 3BFVA 3GUZA 3O3NB 1L9KA 3SQXA 5FO1A 4N03A 3JD0A 4EP1A 2C2KA 3KIPA 2QAGC 1SVSA 2XE4A 4J16A 4Z9AA 1L5KA 3ONNA 2AXQA 1HSZA 4GBGA 1UXKA 3VNVA 5AK0A 5J9FA 2OV6A 4AG6A 5L4LA 3GXBA 3KYDA 4C0KA 1FDSA 3Q0EA 5JAZA 4EPRA 4D9MA 4PPFA 5A5EA 1TT7A 3GUYA 2A58A 3CF6R 4CKBB 4BGDA 2POCA 4OFWA 1GQSA 5EIFA 4BP1A 1E7SA 1NHGA 1DKMA 1I01A 3AIOA 3NJ4A 1XI2A 2X8JA 2PY6A 4GXQA 4LWQA 5K4AA 4CF3A 5EE9A 2B35A 4FB4A 5AT1A 3Q9NA 4U2CA 5KWJA 5LQAA 3G0DA 3T1QA 4BFUA 2GYVA 2DETA 4RIIA 1CVLA 4XPIA 3CSUA 2JANA 2XKJE 1PTJC 2WT9A 3MS2A 4KEAA 2B8TA 4MA4A 2WJYA 4NIMA 3ZGNA 1E2MA 2FR0A 2OOSA 3VYUB 1NM5C 3CHYA 4CI9A 3A04A 1X8KA 3HA5A 3QNWA 3V2UA 4HMPA 5KNDD 4PYOA 5TVKA 2NUAA 4ZFNA 4UDOA 2ZBQA 3F73A 5CK5A 5IKOA 1VCIA 1JDTA 2C2YA 4IBOA 3G5AA 4MJLA 4LFCB 4EAAA 1XNQB 3RC8A 1Y6ZA 2ODQA 5I7FA 5D2CA 1TAGA 1RWVA 3JSXA 3H3JA 4D8XA 3KVVA 4B80A 1TJ3A 4L16A 1YJ5A 4PIMA 1CR4A 2VDOB 3QG1A 4E51A 4E07A 4MVJH 4O4LB 3NDRA 3WLPA 1YIDA 1C7QA 3CE6A 4K6FA 1RWKA 2WMNB 1OQAA 2Z6AA 1FLNA 2HLDD 4A8JC 1LJUA 4L9AA 1G60A 4HLQB 3W8NA 3R7WB 1DUVG 3TE6A 1Z5PA 4MK4A 1R50A 4LY9A 1YR8A 1YL7A 1ZP6A 3QELB 1U3DA 5TMBA 5TRTA 5CFMA 3GG9A 1PEKE 3OFJA 1AKRA 3Q15C 1MIOA 3ZOKA 4CTMA 4RDXA 2A1UA 4H0NA 3DVLA 4OL9A 2M6KA 4CMJA 1AU9A 1WB5A 5EIEA 3T7RA 4KGZA 4UVGA 4L0QA 1K5HA 5EE5B 3T3OA 4D25A 4LF5B 1U80A 1XEAA 4ND5A 2PR7A 3IP8A 2H16A 4TVOA 3FHCB 1SKBA 1T9CA 4GKAA 1PFWA 2XOKA 4LOKA 1EWTA 2AK2A 2Q8QA 2BTEA 2Z2KA 1JTFA 2IYRA 3WYGA 4BHTA 1Y1QA 1HE2A 5GZ6A 4D0SA 4QPZA 2JLQA 2HDWA 4UM7A 3THXA 3L7MA 1Y33E 1E1MA 6YASA 3RB8A 3GYBA 2X19A 1AKUA 2AWOA 3HA7A 3B9PA 4YY3B 1WLSA 4E4TA 2PIAA 1ESDA 5JY6A 4L07A 1W0JD 5BSRA 2OXRA 3IEXA 3V2GA 4ZDKA 4PLYA 5KQSA 3EZYA 2BCGY 1AMUA 4QL3A 1Q0SA 1I14A 5CHYA 1GDTA 1W59A 4HAOA 4PFJA 1DL5A 3FB4A 3AI3A 2UZ4A 1FFYA 1HDEA 5KKAA 1V8ZA 3FNQA 3PJDA 4ENVA 2QSZA 4PZCA 3RVPA 1D2RA 2B1IA 2I62A 3KAKA 4DM7A 4M21A 5ISMA 3A1DA 2AR7A 2XMRA 1VMAA 5HZGA 1MJFA 4L6IA 5IG2A 1GTVA 4AUEA 2AFHB 1AKMA 4O1IA 4P5DA 1RYNA 4QSHA 1OX4B 3KM0A 1TUBA 1TMKA 2FE4A 3GEGA 3R0QA 4HRYA 1E6LA 2JH8A 2HIAA 2CYAA 1UT8A 2A0XA 2X77A 4W8GA 1G7CA 4KXUA 3LT2A 5JCPA 4BO1A 3QLVC 3E6AA 4KPUB 3NTOA 4YUYA 3FG9A 2AN3A 2DKOA 1XEFA 1FFEA 4O4JF 4BMPB 2YXBA 5IKEA 3RW9A 5C9ZA 1CE8A 2NVUA 3RTEA 3GNLA 5AM5A 3KETA 4CEJA 5TEWA 3O4VA 3REFA 4FBGA 4YA6A 2D2FA 3ZCSA 5B57C 1U8EA 2PT7A 2CWDA 5LBUA 2YICA 1UOEA 4C3OB 1OMOA 3TOXA 3VKUA 2NZXA 2QN1A 4Q7KA 1ZD3A 4PG4A 3ILSA 4GX1A 4IDHA 4BNHA 3IBYA 3RFFA 1PV2A 4KX3A 5G4KA 1THTA 1X19A 3BXGA 1CV2A 1OHHA 3R1IA 2ZR0A 5HZHA 5CIYA 4GMXA 4BJ6A 1CB7A 4FZ5A 4NZNA 4WH0A 2B8NA 5IVHA 1IM8A 1SXJD 4X7RA 4BGEA 1MEJA 1O58A 2V7PA 3FNGA 4FMCF 4WUTA 1JHDA 4H2DA 5JS7A 1UANA 4PN3A 4H16A 5K0TA 4F8EA 2JDID 4DG8A 1BD3A 4J6EA 1YJCA 3U39A 3EXIA 5JBIA 4FFVA 1M2FA 3GRKA 4JR1A 4DTIA 1YR3A 4GMDA 2ANCA 4L73A 4DIEA 3PGMA 3SDBA 4B4OA 2HN9A 4KAJA 4WNAA 4QRDA 2Y9PB 1O5TA 4URWR 2EW8A 1PNTA 3H2GA 3NATA 3P2YA 5BV8A 3BKWA 5J4LA 4I99A 4U2DA 3R7NA 1Q0RA 4TYWA 1WKVA 3VSBA 1U3TA 4HPWA 2OYRA 2CVFA 3FNFA 1CPYA 1CUZA 1J42A 4XUGB 3EF1A 5LQMA 3MGKA 4LJ8A 2ZI7A 3HEAA 5IVIA 3REQA 3T3PB 3VHLB 1PQPA 4G84A 4PAOA 5FTNA 4MWCA 2QTVB 1YA4A 2GI4A 2QVCA 3K8YA 1LSOA 1KYZA 4P82A 3RVKA 1PT7A 3V32A 8ATCA 2XCRB 4HGPA 3L6DA 5JI3E 5KMGB 3OEED 3MT9A 4G0PA 2G1UA 4JLOA 1LPAB 1T1IA 4XTCS 5IDWA 4PBRA 3CRZA 2LDBA 1HPLA 4HJXA 2DFTA 1EQ2A 2VHZA 3M4YA 4MR9A 4R2MA 4ZQFA 3BM5A 3TZEA 4A0SA 1GCUA 2D0IA 2YZ2A 1PJAA 3WYCA 3GJXC 421PA 4H3VA 3PEYA 3HVRA 2WJAA 3ZHZA 3DWGA 4A8JA 1PJCA 2V7BA 2WUVA 3DM5A 4YMVA 3KYDB 1WXHA 4J03A 2NNLD 3GH1A 2HRBA 4KITB 3BGDA 3OPVA 2C31A 1E2UA 1UZNA 3ILHA 1ZWLA 4DSNA 4C20A 5A4AA 1Q7EA 1YE8A 4H18A 5KJCA 3KOYA 1NNI1 3MFQA 3MMNA 3OCJA 1L4KA 4LTDA 3KTAB 3QENA 4MYTA 4O4IF 1M2KA 1UXGA 2WF9A 4MGIR 3A6EA 5HM8A 2GN8A 221PA 1JTVA 2IRWA 4WA7A 4ZZ0A 3DHNA 2Q99A 4LHWA 1Z6QA 1YUMA 4WKGA 3OVMA 1A7KA 3HABA 4HPJB 1T3ZA 3H5OA 4J16C 1W2GA 4WZZA 4X8MA 5JANA 2C8JA 2V4MA 2P3OA 1W34A 5JHHB 3GEMA 1MXFA 2NGRA 3COZA 3COYA 3UHOA 3AVWA 1X6VA 4JUIA 1TJ5A 4R5HA 3RSGA 2KI5A 3O3CA 3DZHA 1YRYE 3ABIA 3N76A 1ZIDA 4GKKB 3QJ5A 1KYQA 3IH5A 3ZH2A 4EW3A 3RVRA 4EHFA 3L5OA 1HQDA 1QOQB 4UMVA 4AJHA 1CEEA 1P2DA 2FPUA 3VKHA 4P4SB 2GF2A 3O6VA 3CX4A 3ECAA 3E3MA 1CNMA 3I9V1 2O2EA 2QXUA 1XZNA 3M6FA 1Y89A 4J3NA 1XYGA 1Y3DE 3H0CA 3O9VA 4ALJA 4RVUA 2YS7A 4B74A 3EY4A 2WTUA 3ODGA 2ZWPA 1Z28A 3S29A 3P26A 1MZPA 2G7ZA 2QQEA 1GITA 4FFMA 4G8DA 2I7VA 1AF7A 1GNLA 3GGSA 4KOAA 3ASYA 2H7YA 1PCXA 1TMGE 4M1SA 5F5XA 4QICA 1OH5A 4FDUA 2Z09A 3EEFA 3JWIA 1KYIA 3BE4A 5CIWA 4TZKA 2H2AA 1KH2A 4BQEA 4AJEA 2HLDA 1NKSA 4PS0A 5DYYA 1SQSA 1EDZA 2HWKA 1RE0A 2ZUUA 1U0GA 2ZSBA 1RD4A 4HNQA 5AVZA 3NDBB 3RJMA 3RK1A 4B4UA 2Z43A 1BS9A 1CJMA 1QDUA 1T36A 2VVTA 2WA2A 3EBLA 3FYCA 1II8A 4JLVA 1MO5A 4N0PA 1IL0A 4N49A 3DAOA 1HDYA 3QVGB 2IH5A 4HO1X 4BV8A 2HIGA 2YVAA 2W22A 1SCKA 2LKCA 3I6BA 3IBTA 1S7CA 4DDWA 2FZKA 1QS0B 4RZSA 2GGSA 3E3NA 2HA4A 3F8WA 2PV0A 2PKEA 4YT2A 2QJWA 3A1SA 1RZVA 2E4ZA 2J9FA 5CT8A 1H22A 1TADA 3E1GA 1CJCA 3IEUA 4KYVA 4RQBA 4CLRA 3B52X 2VOEA 3FF1A 1E18A 2ASVA 2Z0MA 5DBIA 5HIIA 4B3JA 1Q20A 1RQ7A 5ILOA 1M2JA 3CVUA 1OBHA 2YFHA 2JRLA 3KLNA 4HL6A 3ZGVA 5BMVF 4BC0A 3QWBA 4IH1A 1T5TA 4RHTA 4LXYA 3SF8B 5IDVA 5HHTA 5JPCA 4BFVA 1SXPA 4ER3A 2GN0A 4BNWA 5EWLB 4MVJF 4MV0A 1VCHA 4HB0A 5A5DA 1CRQA 4DANA 3KKKA 5EUBA 1EHYA 3WLSA 5LMZA 4R8RA 3G5UA 4CM6A 1S8AA 1VHWA 1DINA 1HE5A 4BNVA 1SIWA 3QEOA 1Y5LA 3RNLA 3QBDA 1OJ7A 1TYDE 4AVYA 3R9KA 4GX0A 1UK6A 3BULA 4I50F 3Q3JB 2FKNA 3CRVA 1OB2A 3E9NA 5MDHA 5TXGA 3C7TA 4HBZA 2VF7A 2OILA 2ZIEA 3EC7A 4E2YA 4BO7A 4CIAA 1P1KA 3U7QB 3A6HA 4B2IA 2SKCA 1TM4E 3C7KA 3TZHA 1JBQA 3N05A 1T9GR 4QRHA 2V45A 1PI3A 4BFSA 4C76A 4CKEB 3ZLJA 2ZYSA 1S7GA 1QUFA 1M1YB 2VNHA 3DE7X 3DMFA 5EVJA 1K06A 4N0MA 2H4FA 3OECA 3RPEA 4EUNA 4RORA 4BPBA 1A9TA 1IXKA 4YRKA 1MW8X 3ZJYA 5AK5A 5HKAA 2HWXA 1AA9A 3O4RA 5U4QA 3IMKA 3U37A 1FNBA 4A0QA 3GJ0A 4I3HA 1HF3A 4X66B 2RKWA 1F14A 4RVCA 5IJZA 2H9AA 1CC1S 3ORSA 4Y6QA 3LP6A 4F2GA 1XTKA 1V1RB 2OECA 2ODEA 2QI9C 2J0VA 3JD1A 3K0HA 3OESA 1OXSC 3HLKA 3QXSA 5CGQB 5CLFA 4N5MA 4XWGA 5JXIA 2BHTA 4ENWA 2PSSA 2GCNA 4MV9A 1E8MA 3NAGA 1PR9A 1CW2B 2YRXA 4MRSA 4Y9SA 2Z2YA 1JG3A 2J30A 4D97A 2HXYA 3HU5A 3FCXA 4J0GA 4O5AA 4F5ZA 5K8JB 2Q5QA 4RTNA 1CIPA 3F71A 3CX6A 5J47A 4MSUA 2QMYA 1YQWA 5I9SA 1E1QA 2BMVA 2HIMA 1E2EA 1JTEA 4HB2A 3VOAA 5BOSA 5GIPE 1J1IA 3JYOA 3ORRA 3ZWMA 3KOXA 4DMHA 1UPCA 5KU1A 4Q7QA 1QTQA 2R4TA 4QODA 4PYJA 5IFKA 2BGNA 1OAOC 1D04A 3SOPA 3U19A 4P7JA 3GC6A 1KE2A 4WN3A 5LU8A 1G59A 4ZVKA 3GA5A 3V42A 2J0SA 2QTVA 1JDSA 1RYDA 1Q95A 2H00A 4FE3A 3KX2A 4KXLA 3WSTA 4E1VA 4AMBA 2Q2VA 1U7WA 1L3IA 4PNHA 4B6PA 4C21A 3AR6A 3HJGA 3DEHA 5A62A 1U0BB 5LM3A 3RHTA 1M6NA 2XQJA 3O21A 3A2MA 3DC2A 1Z73A 3NHUA 4ZOQI 4W5JA 3HCDA 2AVDA 3HB9A 4BV2A 4Z0HO 4HEQA 4F93B 5B36A 5JRDS 4AN4A 3WK8A 2QYOA 4OG2A 4D8UA 4EGSA 3DT8A 1MQ8B 5CCDA 1B8UA 4EPTA 3RC7A 3RU2A 4EHDA 3OEEA 2C0QA 3VV3A 4EMUA 5AQEA 1E9DA 3A1VA 2IXDA 3HUFA 3P9IA 2IZZA 5G1PA 4CM4B 4DIMA 4R1NA 1RYBA 3R7AA 1NVBA 5JEEA 3T0GA 4M0MA 1EBFA 1I5RA 1DKRA 5HCUA 3UGTA 4Z3OA 3EFEA 3BFKA 3GVIA 2DFLA 1I6MA 1SXQA 5ESDA 2WJPA 4I55A 1KP2A 4F1WA 3R3VA 4M6WB 2HFJA 3IBGA 3KWLA 3RUEA 1OCEA 1JHPA 2W6CX 3GDHA 4GQIA 1FFBA 5L3SA 2ZRPA 3A2LA 4R31A 1Q3HA 4JT4A 4D3DA 1ZL0A 3L2OB 1G3QA 1EPUA 2C8KA 3CX8A 3ZV7A 3QUAA 1T3GA 1OXKB 5F76A 5IANA 1R4ZA 4FHEA 3AF5A 5A7FA 1CU1A 3IODA 4HQNA 1W2HA 1VPLA 2WZDA 2D0PB 4PHGA 1T0BA 1NGSA 1TMYA 1WOYA 4PZAA 5I7AA 3AETA 2ZUEA 2DCUA 3TLJA 4JJFA 2RJNA 1U5BA 4JXJA 5ARDA 1WS6A 4DLNA 4RV4A 3D6AA 1LPMA 3QXGA 1GFIA 3D2CA 2VA9A 1NF9A 3FF4A 4P0TA 4JBIA 5DXAA 3SZOA 2I22A 1K5DA 4TT8A 4GGMX 1GU1A 2H52A 4QXRA 3SHWA 1ST2A 2CBGA 1BWPA 3KFVA 1JSCA 3OM1A 4GR5A 1ORDA 1HX7A 1IWPB 1OC2A 1YB1A 2ZE8A 1EVQA 3ZZ1A 3GBPA 2QXTA 3AXTA 1FYDA 3MJSA 5LP6A 1C7EA 4OXIA 2XBUA 5FPSA 2X0KA 1EFPA 4O0LA 3V7WA 1TOAA 3LY8A 3WLNA 1U7XA 4NAHA 5CB4F 1B14A 4KXNA 1XG5A 3ZWAA 4Y8VA 1DAGA 5FCDA 2YWJA 2Q3DA 2XDWA 1WXEA 2VT3A 4FJ0A 4B6QA 3W6ZA 1U04A 4QUAA 4WBXC 6LDHA 3RVNA 2EP7A 2PUWA 2FZ4A 3B7GA 4UVEA 1PJLA 3FWYA 2RHTA 4UNNA 1H8HA 4GEGA 2BM8A 5E3IA 3U7HB 4MARA 4B3HA 1N5RA 1SEPA 2E55A 3PQ7A 5D01A 2EX1A 2GN6A 3TQFA 2XNHA 3FOEC 3FZEA 3KPUA 2CHVA 3KJNA 3NM6B 4FPXA 4QEKA 5GVRA 4Z1MD 2AR9A 2IU0A 1ZYUA 4OATA 4X3PA 2GSDA 2R6GA 2ZANA 3TGWA 4R84A 3P5SA 1U8XX 2GCEA 1V5EA 3D2BA 1Z56C 3QMVA 1OZ0A 2ZYDA 3Q41A 4XQGA 3CCFA 2Z2ZA 1EFTA 1VHLA 1W73A 3GAZA 1G2QA 1U1CA 3PF9A 4C4PA 4OXKA 5J4YA 2GPBA 2HAEA 3OKCA 4PPYA 1U3UA 4ZHQA 3ISJA 1H66A 2Q2QA 3ZL9A 5D8DA 2CVZA 3AILA 5LB2A 1GV1A 1ST3A 4X62B 3N7AA 1KJ8A 4OI2A 1KDVA 3G13A 4QVKA 2ZJ0A 2E6KA 3GWGA 3Q2IA 4FS8A 4J75A 4P36A 4Y2PA 3VUEA 1E9RA 1G8YA 4Y6RA 1JR6A 1V16B 3ZD7A 5DHFA 3GN2A 1BJKA 3VBCA 4E2WA 4P98A 4UDYX 3SS8A 1F1JA 4AX4A 5ALVA 1O94A 1YR9A 4PIVA 1NUQA 2I1VB 2RGNA 4RPHA 3G0HA 2WF5A 2Z1DA 3EHEA 1MXHA 4UQPA 1BU8A 1XZIA 2QHXA 1O6FA 1PQ4A 1ISIA 1JXQA 4ZV7A 1YACA 4P38A 5AJVB 2YMLA 1E2PA 4IICA 1EM6A 3KQYA 4QLBA 3WHPA 4MQEA 1LPPA 4QTUB 2Q6IA 4QM6A 1JW9B 4KIWA 1CUVA 4ZA2A 4UAGA 1ECBA 3MTIA 2B8WA 1TIBA 2AYYA 2VUIB 3QKSB 1N9GB 2B78A 1YZFA 2EFJA 3ICPA 3B2QA 4RPLA 2IY8A 5C7LO 4QGFA 1AK9A 3ADDA 2R87A 4ZK6A 3ZGZA 2P4QA 1YF3A 2B2CA 3G59A 1NZDA 1W0KA 2GILA 3PHHA 4K87A 1A7AA 3PWSA 4XVUA 3K09C 1CB0A 1C0EA 1AGPA 3BT7A 5ALQA 4ALKA 1A8IA 2FMXA 4AY2A 1T1EA 3VKFA 3X1DA 5AIBA 1NWCA 3OWOA 4IKOA 1L5OA 1N7GA 3GJZA 5IDYA 5LP1A 4AS1A 3FROA 1OH8A 4D0GA 1SUCA 2N0SA 2AKEA 3CU5A 4JHXA 2GN1A 1O9HA 4ZT4A 1S02A 1IY9A 1YZKA 5AP9A 4ZO7A 4YMLA 5EPUA 1CJUC 3ABSB 3Q7SA 3EGCA 1Q1QA 4RLQA 4IQ0A 1TK2A 2CSXA 3L05A 4XJXA 4BTEA 1OBFO 4NBLA 1VQ1A 2EQ5A 4FOOA 1H9BA 4N5DA 2O50A 4Q48A 3URKA 2BELA 1XO1A 3DZ8A 2PCLA 5I8PA 1QQBA 2ONYA 4R0NA 3QPAA 3F46A 1CEYA 3CLUD 4PLTA 4R1UA 3ZV3A 3EZGA 3QIAA 3KALA 1R6VA 4I9UA 3BWYA 3G17A 1JKJA 2YJZA 2NYVA 3DHWC 3KUCA 3VR4H 5EZYB 4A03A 3IIEA 2G70A 1KI7A 4H1UA 2QTNA 3M1IA 3KV1A 4BNLA 2F59A 1ZK0A 1QLHA 3JTMA 3CUVA 4NCIA 3RAEC 3DMDA 2JFBA 5JSYA 2PEZA 3RHZA 2CLSA 2FFBA 1UAYA 4DA4A 4BLWA 4DQXA 1RJDA