1I3KA

Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
347
structure length
347
Chain Sequence
AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAMGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNVVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords UDP-GLUCOSE 4-EPIMERASE
publication title Molecular basis for severe epimerase deficiency galactosemia. X-ray structure of the human V94m-substituted UDP-galactose 4-epimerase.
pubmed doi rcsb
source organism Homo sapiens
total genus 127
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1i3kA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1i3kA01
1LTHR 1IYZA 2OHXA 3PHJA 1GV0A 1PJSA 3HN7A 4MO2A 4MP3A 4UEJA 3ZH2A 1YE3A 3DBLA 4YB8A 3ICPA 5F1OA 1LLQA 5JAZA 3DZJA 4HX5A 4BS9A 3ADOA 4OHUA 3RU9A 1E1NA 4CR7A 2X0IA 2CD9A 1ML3A 4CMHA 1QYCA 4J6FA 1W6UA 3WR5A 4YVFA 4OXNA 2XF8A 1NAIA 1E1MA 1JA9A 4E2ZA 1VKOA 1SB9A 5I9LA 2VN8A 4XGNA 5JYEA 2NVWA 2YW9A 1DAPA 3B70A 3F5SA 2OOSA 3IP1A 2VNAA 3U09A 2PD6A 4XCVA 4BNMA 1XKQA 4NI5A 4J4HA 4ND2A 4NU6A 1E5LA 4RVGA 4AJHA 1TLTA 2IEDA 1C14A 1SNYA 3E18A 3I9OA 1KEUA 1YJQA 5F21A 2OBNA 3RUHA 5AVOA 4AJ4A 4YAKA 3OETA 2P5UA 4CMGA 3SEFA 4EUEA 1A9ZA 1MC5A 3ASVA 2VUTA 4R01A 4B4WA 3PDUA 4BQRA 2VT2A 3KEOA 4JJGA 4OOFA 2FY8A 2X5OA 3L77A 3GGOA 4R4JA 4J90A 3QIVA 4AICA 5JNLA 2Y99A 4MKRA 3AUUA 3LU1A 3Q2KA 1NPTO 1R37A 1PJCA 4BNZA 3AY6A 4E30A 1DC5A 3VZQA 3DO5A 4CUJA 1GUFA 3GEGA 3VVBA 3B20A 2G0TA 2W98A 1K6XA 3OMLA 2JFHA 4RPLA 3WQQA 4JJFA 4D0SA 4QSMA 2Y1FA 2PD4A 1PEDA 5JLAA 3PLNA 1P1KA 3U5TA 3AM3A 3IQDB 5KJ1A 3ZWVA 2QIOA 3Q1LA 2LDBA 3JQ7A 4PN3A 1DDOA 4B3JA 5ENDA 3NT5A 2GLXA 2DFDA 3OA2A 3WS7A 2HO5A 3R3JA 1H5QA 1ZJZA 1CETA 3BHJA 4FFLA 3BMOB 3BMQB 1ZSVA 2D2IA 3ANLA 1L7EA 4JROA 3UICA 4CMIA 4ALMA 1IPFA 1K2WA 1R16A 3TOXA 3W1VA 1UAYA 5L95A 1TB4A 2GN9A 1CWUA 1LRKA 4CV1A 2PR2A 2ZYAA 4MOWA 4IDCA 2HRZA 2O4CA 1OBFO 3E03A 2AE1A 4G81A 1R0LA 1Z75A 4CLXA 2Q2QA 4HNHA 2Q1TA 1P9LA 1JAXA 4IJKA 2Q4EA 4BO5A 4O63O 1NM5A 3RAJA 4FFNA 4K1LA 4LMRA 1QYDA 4ZQGA 4TKMA 4YAEA 4QO8A 4J7UA 1I3MA 3WFIA 3G17A 2ZB4A 2CDCA 2EWMA 1UXHA 3DZKA 1R4MB 1P33A 1VL6A 4FB5A 4IDGA 3EDMA 4AFNA 2WSBA 3ZWAA 5ILOA 2UDPA 1EVJA 3WNVA 4O6VA 4IDDA 1YWGO 2NADA 3QWFA 5TGDA 1I3LA 2O23A 3FRJA 3QV1A 4HNGA 1UP7A 2ZB3A 1YQDA 3QLJA 5EIOA 3E6AA 4R5MA 2PGLA 4D3DA 1DFGA 2AXQA 4DQVA 3GGPA 5JPIA 1ONNA 3JQ9A 2XOXA 3K92A 4ZHSA 5L51A 3NEPX 1U3VA 2PZLA 4PLHA 4TVOA 1F8GA 4NJOA 4JX8A 1OFGA 4O59O 3ZI0A 1PU2A 1GQQA 1HL3A 5FFFA 4BO9A 1H6BA 2ZYDA 4GSLA 1HDGO 2YQ5A 4ZA2A 1KY4A 1XELA 2R00A 5BNTA 1HSZA 4MVJE 4XQEA 1Y9AA 4OSPA 4WCDA 2A35A 4OH1A 3I9JA 4E2XA 4O5OA 4E5MA 2D5AA 1GTMA 3P2OA 4JJIA 3S2IA 2WEKA 2X0RA 3GAZA 2X23A 4I8XA 2VZ9A 4WUVA 3H4VA 1QR6A 2NVBA 4A7PA 1PWXA 3JQFC 2JCVA 3K31A 3H5AA 2AEMA 4R1NA 3F46A 4PLTA 4XYMA 1YQXA 5KNLA 3AU8A 4ALKA 4WPGA 4CM6A 1T2FA 1R6DA 3UAGA 2TMDA 1E7MA 2J8ZA 4YJDA 1H6AA 3DHNA 4UEOA 3D3WA 3Q9NA 5TJHA 4AL4A 3NTRA 3CE6A 5C3MA 4XA8A 3TZKA 3QWAA 1DIBA 2ZB8A 1GYRA 2D1YA 2VNSA 4E2YA 1Y8QB 4P8RA 1Q0LA 1ISIA 1V3VA 2DTEA 2DVMA 2R2GA 3IC5A 3C7CB 1UP4A 3S55A 3WMWA 1N2SA 3ONFA 1M76A 1Y5RA 1N92A 4R54A 3RCBA 1UXGA 1W4ZA 2JHGA 4IDAA 1IL0A 2YV3A 1N8KA 4RVHA 3TFQA 2YZ7A 4NDNE 3NGLA 4XB2A 1KEPA 4YCAA 5DP2A 3T4XA 5DCUA 3BTVA 2HAEA 3LT0A 3SX2A 1PGOA 1AXGA 2YHUA 4KDFA 3SBOA 4AJEA 2QW8A 1T1SA 4G65A 3NUGA 4BMSA 2DLDA 3A4VA 4OL9A 2W8ZA 3ZWPA 2O3QA 2W2LD 1LSSA 4RCVA 1OZAA 2WTBA 3DAFA 4Q39A 3ZNOA 1P77A 1J5PA 4CQMD 4YAIA 3F9IA 3QA9A 4FJ1A 4ZQEA 5JDCC 3ZWXA 1YB1A 4R1TA 1GR0A 3KYDA 3OJFA 1I8TA 2RIRA 2B69A 4NMHA 1QLJA 5U1PA 4DQXA 4ESOA 5K6AC 4IGFA 4PLZA 1KEVA 3BTOA 1E1LA 2FN7A 1EBUA 1GEGA 1FK8A 1HZJA 4HADA 3U4CA 3FR8A 4B8WA 1YBMA 3PYMA 4DMMA 5B4UA 3HB4X 4II3A 3NKLA 1DHTA 5KVCA 1T2CA 3ETDA 3HJAA 1MV8A 4YDRA 2EGHA 2J3HA 2QYTA 1GFSA 2ZKLA 1EE2A 2HJSA 4E0BA 1QV7A 4DBZA 3A1NA 1P1FA 4U0KA 4B3IA 1KETA 4WASA 4DUPA 4FFRA 4K6FA 1ZIDA 3FF4A 3WJAA 3VHRA 1V8BA 3LZ6A 3RC7A 5ICMA 1QLHA 3PZBA 2NACA 4WNIA 1I3KA 5JC8A 1LQTA 3GDGA 1PJBA 3JQEA 1UDBA 1ZUD1 3OICA 3SJUA 2ZK7A 4TZTA 3AFMA 4PCVA 3JCZA 3K30A 2I99A 2V6GA 3WGZA 2WMDA 4M1QA 3F6YA 4LRTB 5HWSA 3OIGA 1UJMA 1PJLA 2FMUA 4NR0A 1YL7A 4FQ8A 3WB9A 2YJZA 3ROQA 1W0CA 2BMAA 1ZMOA 2IRWA 4TKLA 3SC6A 4C7KA 1U5CA 1ONPA 4B79A 5KWEA 5DOZA 2FR1A 3PWSA 5DP1A 2FWMX 1YDWA 4AJNA 3RD5A 2JCYA 3NAQA 4OJNA 5KVSA 2G17A 3KSZO 4L75A 2WE7A 3G1TA 1UXJA 1I32A 2Q49A 1IZ9A 1V35A 2BGMA 2YHIA 3I9KA 3PHHA 4GL4A 5JE8A 2HMWA 4IQ0A 3VPFA 4P4LA 1FJHA 1EDOA 1DBVO 1N9GA 3I23A 2WE8A 4CM9A 2QYSA 3HZZA 3RASA 1NP3A 1R4NB 2W2KB 1AE1A 1YKFA 1Z7BA 1P44A 4NBVA 4BNGA 3JYNA 2C54A 4D45A 1B3BA 3OSUA 4UVIA 3RBVA 3AUAA 3RC1A 3QY9A 1NWCA 2A9FA 4MIOA 4CV2A 2B36A 3E82A 3H2SA 2WM3A 4M86A 4R3NA 5T6BA 4XIJA 4RF5A 1GAEO 3OHSX 4GKVA 1OOEA 5AYVA 5A9SB 1CJCA 4F3YA 1M6HA 2XXBA 2VWPA 1CERA 2Q1WA 3RFTA 4DYVA 5FEUA 5HRUA 4WOKA 3BIOA 1Y6JA 2VRBA 2JFGA 1K5HA 3QVWA 4H7PA 1TI7A 3ETEA 2PY6A 4ID9A 1ZK4A 1D1TA 1XHLA 3ENKA 3GG2A 3O26A 3R0IA 1LEHA 2IDZA 1HWYA 4KTTE 2P9EA 5EL0A 2EKLA 4IBOA 4M89A 4F45A 5TT1A 3DB2A 1WDLA 5HM8A 1GQ2A 1VJTA 3LC1O 4D44A 5A5EA 2C82A 3INRA 1RPNA 4WCFB 3RSHA 5EQFA 3DZGA 4J0EA 1VL0A 4IM7A 4XDYA 1FDSA 3KSDO 3L4BA 4J4BA 4U5QA 1ADFA 2Q3EA 1E7YA 4I9HA 5AXBA 3B1FA 2PLAA 3TF5A 1NNUA 4UUNA 5ER6A 1D8AA 2D0IA 1C1XA 4DC1A 4FFOA 2PZKA 1TT5B 4FN4A 3UOGA 4NQZA 4YTEA 2C0CA 2X86A 2ZTMA 1MUUA 3LQFA 2PWZA 1A72A 1E3LA 2YUTA 1KBZA 2GZ1A 3W4KA 2D4AA 2GZ2A 4LCEA 4J7XA 4IXTA 1LDNA 3DTYA 1U4OA 3JYPA 3OECA 1BXGB 5KVQA 3CPSA 3HDHA 2NQ8A 4KUGA 5BNFA 3IUPA 3MJ4A 2FOIA 3K2BA 2EHDA 4JXKA 4AJLA 3DC2A 3WSVA 3AI1A 1KVQA 1PL7A 4L4SA 3FPLA 3GNTA 1GEEA 3MJTA 5CDYA 4ND5A 4YA6A 4JLWA 5EINA 4JK3A 3KBOA 4MIEA 3D4PA 2HJRA 1FDUA 3FNEA 4AJPA 1J49A 1MP0A 4IDFA 3GEMA 4ROSA 4BV9A 3CIFA 2GR9A 1VSUA 3H9QA 3E9QA 3X2EA 4BO8A 4LSMA 5CFZA 3DXFA 3H5RA 2X9VA 5T64A 4KUEA 3DOCA 5JY6A 1LNQA 2CDAA 2E37A 1U8XX 4INAA 5CEJA 1ZK2A 2RHRA 1WMBA 1HLPA 4BO0A 4YJGA 3UCFA 1LU9A 3FTPA 4BHTA 4RGBA 4BMNA 5H81A 1UDAA 1P0CA 4BNHA 5AQ1A 2BKAA 4W7IA 2J3JA 4PLGA 1BG6A 1U3TA 2P4HX 2VYND 2GDZA 2PH5A 2FR0A 2PKRA 3E5MA 1Q7CA 5A4DA 3EK2A 4E4YA 4NK5A 3HN2A 1UZMA 2P2SA 4BGIA 3L9XA 1BSVA 1QRRA 3ON5A 5ICSA 3WNQA 4D7AA 1PJ3A 2IEBA 4YRAA 4JBHA 1GUZA 3PPIA 4PZCA 1GPJA 2YHIB 3NV9A 1LXCA 4RO0A 1HEUA 1YOVB 4ZU3A 3KV3O 2EGGA 5DBIA 5FI5A 5I8WA 3CINA 3I83A 3DDNA 4FW8A 1B0AA 4A0SA 1R0KA 3KLPX 4PRLA 1AUPA 2JD2A 4CLHA 1QYXA 4MVJM 3BAZA 3JTMA 4HFRA 3V2UA 2B35A 2EV9A 4GBJA 5L4LA 2PZMA 3E9NA 1LDBA 2BH9A 4BNTA 3S1LA 4QXMA 3AOEC 1DRUA 1T26A 3DZFA 3U4DA 4Z0HO 1LDGA 2AEJA 2C29D 1JTVA 2C07A 4XB1A 1UAGA 3MWDB 2O2YA 4H16A 1HE4A 4A26A 5B12A 4NPCA 4DLBA 1DLIA 1GUYA 4NJMB 1DO8A 3PEFA 4UUOA 3MOIA 2X1HA 4YACA 2XXJA 4MKZA 4CMBA 1H6CA 1YH3A 1I0ZA 3F4BA 4TRRA 3SXPA 1U8FO 5JDIA 4RVFA 3OF2A 1CEQA 3JQCA 1NQ5A 1PSDA 2NTJA 1DOHA 3WTBA 4HXYA 4CMKA 1B8VA 2Y93A 3FTNA 3CTMA 5F1KA 3GH3A 4DC0A 4R68A 3OEYA 4GGOA 1E7RA 3A14A 2B5VA 4L0QA 3TOZA 2O3TA 1E5QA 4PG5A 5A04A 1IULA 1ISMA 2GYYA 2P68A 4EZBA 4NZ9A 3ZV4A 3F1KA 3LYLA 3UKOA 1HE2A 1EUCA 1HDCA 4EUFA 5MGBA 1YDEA 3BMCB 3ABIA 3AUTA 3MZ0A 1YO6A 2YV1A 3FD8A 1F17A 4RDIA 3H65A 3WLEA 4XKJA 5T8KC 3KTDA 2LDXA 4BB5A 3K73O 3BMOA 3BMQA 1S7CA 4BGVA 5CDGA 3KETA 2HU2A 1IZ0A 5KJFA 3RFVA 3K9QO 3CUKA 4UREA 3VKUA 2XPCA 4AJOA 2V6MA 4MVJF 4KUHA 3JQAD 3A9WA 4FBGA 4HY3A 4OAQA 3C1TA 5CDUA 1Q2XA 4YXFA 1YBAA 4IIUA 4N54A 4U0JA 1JDJA 3RI3A 5CG2A 4BNWA 2UUOA 4PLCA 1ZO8A 1H94A 4ZRMA 3NDIA 4R5HA 3FNGA 2DFVA 3GN2A 1M75A 5TLSA 1MC4A 3F47A 3I1JA 4I5EA 4IQGA 2FPGA 3FNFA 3JQGB 3H3FA 4A03A 1XEAA 1JKFA 3BA1A 1E0DA 1DC4A 4GKBA 1YBVA 3WSWA 2HMSA 3IMFA 4WLNA 2Y1CA 2OUIA 1B3RA 2DTDA 5EJ2A 4QQRA 1SCUA 1Z73A 2H63A 3V1TC 1LRLA 1ADCA 1DLJA 2DC1A 4UVHA 3RUCA 3RUIA 1BDMA 3OH8A 4XWYA 1DJQA 2EJWA 5EQDA 4BKUA 1U28A 2NVUB 1FMCA 3EYWA 4FD3A 1MA0A 3DAGA 4WKGA 1LBEA 3KOUA 1JAYA 5JAIA 1EFKA 1Z7EA 3NTQA 5IJZA 1YGYA 2O3UA 3FCOA 1EFLA 1T24A 2Q2WA 2VYVA 1IUKA 1E3SA 3LSYA 1HF3A 1O94A 3ENNA 4MINA 2A94A 2EKPA 2OP0A 3OQ1A 4A10A 4CQMB 1F06A 4BIIA 5BT9A 4YQYA 3AY3A 2NQTA 2D5CA 3GY0A 1U1IA 4A5OA 2VWHA 3PIIA 1ZXLA 4XRRA 1D4FA 2DU8A 1ENYA 2IXAA 3EGOA 3F5QA 4JP3A 4W99A 4AJ1A 5CEEA 1E3EA 2IXBA 1AGNA 2O4UX 1QKIA 4O1MA 3ZWOA 2E48A 5I9MA 3ZGYA 5COBA 1UH5A 1G6KA 1X0VA 1EQ2A 4J1NA 1JKIA 1JLLA 3GDFA 5EN4A 3ZW9A 4DLLA 1B2LA 1PGNA 2GGSA 2AQHA 1DB3A 1Q0HA 4G5HA 3ZWYA 4DTIA 1DIRA 2EERA 1EUDA 1E3IA 2DBZA 2GRAA 3QQPA 3ASUA 3M1AA 3GFGA 3WIDA 2QG4A 4OSOA 4P4GA 3P7MA 3UH1A 1E3JA 1BXKA 4Y67A 3ROKA 4FPXA 2CVQA 5CHEA 1TEHA 4IDEA 4YRBA 1C1DB 3TSCA 3TQHA 1R0SA 4I5GA 1HKUA 1Y8QA 4OIMA 1ARZA 5G2OA 2E49A 3ANNA 5G0SA 2JD1A 2QRKA 3MOGA 2WYWA 5BQFA 4E5NA 1B14A 2VRCA 1MXHA 3GVCA 5KJEA 1HDRA 1LC0A 2TMGA 4Q9NA 1XIVA 2Y05A 1I2BA 2PGDA 2AQKA 2JD0A 1WVGA 1IOLA 2H6EA 4B7CA 1NXQA 2C5AA 2H5LA 3I6IA 2NU7A 1WMAA 2CF5A 3RUAA 4IJVA 1UXKA 1U3UA 1H9BA 2CVOA 2FRDA 3GEDA 3L07A 1A9YA 3ZCXA 2DKNA 5L4NA 4PLPA 4ZQBA 5EPOA 2HRBA 1E7QA 1BVUA 1JWAB 1LDMA 1GV1A 3V2GA 3ZV3A 4D41A 3AUSA 3DMTC 1SB8A 1N7GA 3M6IA 1G0OA 3BYZA 1W8DA 3CH6A 5TF4A 1ZBQA 2O3JA 5I9NA 1OMOA 5DULA 2PV7A 4XZ3A 4KQWA 1C0LA 4CM8B 3JD4A 2VUSA 4GMFA 1AHHA 2ZB7A 5JCXA 3ZN2A 3H9GA 3I6QA 2I66A 4U6QA 1X15A 3PJDA 3V1YA 1JKJA 2ZCVA 3T7CA 4ALIA 2VOEA 4BL5A 2QQ5A 3V8BA 4PG6A 1IE3A 2DUUA 5G0TA 3JQ6A 3PQDA 5KVVA 4NBUA 5G0UA 4TRNA 3JQ9C 2AG8A 4GAEA 5FYDA 5DT9A 4LCJA 1HYEA 2CUKA 1VI2A 2HQ1A 4EGFA 4R69A 1A27A 4A73A 4WLVA 2VHWA 4ND4A 4TROA 1DJNA 3AI3A 2DBQA 4KWHA 4FSHA 3ZWCA 5TNXA 3GRPA 2AHRA 3S2FA 2J3IA 2ZTVA 3KB6A 2EF1A 5L7YA 1EQUA 4RQUA 3RVDA 1E7SA 4FOSA 3VH4A 3ZNPA 2R00C 4DYDA 4XYGA 1HYHA 1HRDA 1DHRA 1CYDA 1BDBA 3DBVO 4L9RA 4CV0A 3DBRB 5G0WA 3UW3A 4CM1A 3H9JA 3DFUA 5ITVA 5U4QA 4DVJA 1LLCA 4J4TA 4J1SA 2IZZA 4CQLB 2FZEA 3SC4A 5EERA 3RUDA 3O4RA 3CXRA 1R4NA 2W2KA 2X22A 2ZCUA 4JN6B 4GX2A 4GH5A 4ZGWA 1HSOA 1GCOA 3GPDG 3ZU3A 1Y8RB 3B6ZA 4KTVE 2CFCA 3NTOA 4BMVA 3PK0A 3U4HA 1A4UA 4TVBA 5C7LO 5JY1A 1X0XA 3ROMA 2BF7A 5FF9A 2C7VA 5C7OO 4JCOA 3UN1A 4M49A 1Q7BA 4Q3BA 1X7DA 1YXMA 5A9SA 1XLTA 1GZ3A 3HB5X 5IG2A 3T4EA 4ND3A 5LDHA 5IDQA 2FSVA 4S3MA 2AEFA 1YS4A 2HLPA 4YJFB 4ZD6A 1PZHA 5HS6A 4JGBA 2DUWA 1E1KA 1H2HA 2HK9A 4NHEA 4BO3A 4BQPA 4DIBA 3KRTA 1PZGA 4U8GA 4RLHA 1LJ8A 1PGQA 1H0KA 1MB4A 2CF6A 2RHCA 3UXYA 4CMEA 3E48A 4WCFA 4J0FA 2DPGA 2EW2A 1RYEA 4Z0PA 4MVJH 1Z45A 5TX7A 3PI7A 4DGSA 3EW7A 2W90A 2OMEA 5K0ZA 3LF2A 3TJRA 3QHAA 2OXIA 3VPGA 1MG0A 1A71A 1FDVA 1ZW1A 4P22A 2PD3A 3UUWA 2OBYA 3BMNB 5ADHA 1TT5A 1LDEA 3BZUA 1Y1PA 4GX5A 1U7HA 4J1TA 1EK6A 1BGVA 4CMJA 1LLDA 1GZ6A 1NASA 1QXSA 4N7RA 4ND1A 4F6CA 1ZSYA 4M54A 4MVJD 3OJ0A 1F14A 1M6WA 3MTJA 3IJRA 5JYDA 2NU6A 3RWBA 1TXGA 3FNHA 4E33A 2BGLA 5A3VA 1BXGA 1DPGA 1UXIA 1X7HA 1PTJA 3GA0A 3HQ4O 1F8FA 4URFA 1LX6A 3LT4A 1WZIA 1GYQA 3TZCA 1LI4A 5I7VA 3GOHA 3ZHYA 3X2FA 4R51A 4FC6A 4BKRA 1XCBA 1NPYA 2GF2A 1F12A 1E3WB 2HDHA 3RIHA 2POQX 3UHAA 3EUWA 3WYBA 4AG3A 2Y1DA 4I9NA 3WQSB 3FR7A 4A27A 1RM5A 3KZVA 4CUZA 1SAYA 2FHSA 3ZWMA 2J5RA 1MLDA 3H7AA 5LCXA 3CMMA 4Z6KA 3PQFA 4IQ8A 5K6AA 4OKIA 3JYOA 4RF4A 1YONA 1U9JA 1ISFA 2AA3A 2BFPA 4WECA 4WLEA 2BD0A 5JCJD 1VE9A 5IZCA 1NFQA 1E6UA 3JD1A 5CEFA 4IMRA 3KHUA 3FI9A 4RV9A 4BNVA 2G1UA 4M8SA 3ITKA 4ZJUA 1O0SA 4Y6PA 2UAGA 3WJ7A 3E9MA 3VDRA 3DFZA 4N5LA 4MP8A 2X5JO 1R15A 3OQBA 2IE0A 4ALLA 4I08A 1ENPA 4XYEA 5DOVA 1X14A 2YDXA 3P19A 1QP8A 1HETA 4UULA 1NBOA 4E21A 5A3JA 5MDHA 1YOVA 3LVFO 1EVYA 1XQ1A 1C0IA 2O3RA 3QRWA 2H9IA 5JFOA 3IKTA 1BW9B 2OL4A 4PVCA 1E6WA 4ALJA 5KCZA 3ETGA 4HUJA 1I33A 4RPHA 5CDSA 3ZZNA 5KKCA 4GLOA 3TZQA 4BO6A 2Z1MA 4GVLA 3JQAB 5L40A 3H2ZA 1NYTA 2VZ0A 3IAHA 4CLRB 3KVOA 1VRWA 4Q3NA 3WFJA 3GVXA 4PZDA 2UV8A 2BRUA 1ADBA 1DXYA 3PWZA 5AXAA 4BKPA 1HE5A 4F6LA 4QFDA 4NJMA 1VPDA 3G0OA 4ONEA 2BFOA 1N1GA 3PDJA 4G2NA 1PL8A 3FPCA 2EXXA 5B37A 1K6IA 3ONDA 1F0YA 2RH8A 1AXEA 2UVDA 4XJSA 1WLYA 2VHVA 4CL8A 1X1EA 1SC6A 2QZ9A 1I3NA 4Y6RA 3INGA 2NTNA 3WMXA 2WWRA 1YJ8A 3D0OA 1IHYA 3L4BC 1PJ2A 2CSUA 1FDWA 1P1IA 1KIFA 3UCXA 3D7LA 1KOLA 3I4FA 3K2EA 3VC7A 3MJCA 3W8FA 3WX0A 1XDWA 5JMPA 3AY7A 4Y6SA 1SOVA 2Q2VA 1UR5A 3BMCA 3WYEA 3RQSA 4OKNA 3PYLA 4TSKA 3GHYA 1I5RA 3GVPA 4DXHA 4EW6A 3D4NA 1YQGA 2DTXA 4I5DA 1GY8A 4YR9A 2QZZA 3INTA 5I7SA 1GQYA 5KJ6A 5COAA 2FR8A 3AOGA 4YT4A 1E6EA 8ADHA 3BTUA 3HADA 4CUKA 1J0XO 2DPHA 7MDHA 2EW8A 1AN9A 1LSUA 1QV6A 3TDKA 3PXXA 1PWZA 4J1QA 1GYPA 1ZEJA 3ULKA 1DRVA 4C4OA 2VQ3A 5G4KB 3W8EA 4D0RA 2AG5A 4RVDA 1C0PA 2O50A 3WGTA 3E1KA 3LT1A 3NJ8A 3JQBC 4BNIA 4DIFA 5DCYA 4EJMA 8LDHA 3S2GA 3ZV6A 3COSA 2NLOA 3BHIA 1V9LA 1B7GO 4YT5A 4EJ0A 3QWHA 4KOAA 2PKQO 4K6CA 5B4VA 1ULUA 1T4DA 4EYEA 3RJ5A 4HFNA 4OQYA 5IXSA 1GD1O 3I9LA 4IJUA 1M67A 3ZHZA 4FFMA 1CDOA 4TQGA 3JQGA 3WDSA 4XGKA 4QEDA 4WEQA 5L3ZA 5FWNA 1HDXA 1PL6A 2GASA 1NWHA 4YAJA 1HTBA 1P1RA 4KDEA 4RQTA 5KTKA 1ZMTA 4UVEA 5A02A 2CNBA 4M87A 2NVUA 3VVCA 1YVEI 3D5TA 3W6ZA 4IXWA 5I7EA 4XDZA 3OJLA 4DREA 4MDHA 1MX3A 1PZEA 1U4SA 2ET6A 4GSKA 4LMPA 3O8QB 4PLWA 1XA0A 3MTGA 4OO3A 1ULSA 5I8ZA 2W2LA 4DLAA 3HNPA 1PQPA 2DAPA 2PTGA 2JJYA 1XYGA 5A1TA 4B8ZA 4IY1A 3D4OA 4CQMA 4KQXA 4BNUA 4CMAA 1DIAA 3OJOA 2Z95A 3LLSA 3IKVA 2Y1EA 4TRMA 2C5EA 4ITUA 3NDRA 4HBGA 4Y8VA 3OA0A 5IN5A 4RF3A 1Q1NA 4W7HA 5A06A 1P31A 3PHLA 2BGKA 4E31A 4W9NC 1WDMA 1XR3A 4IGEA 3W4JA 3M1LA 4D79A 4WGGA 3TFOA 2V65A 3CZMA 5TC4A 3GNQA 1UP6A 4J9VA 1WP4A 3L4SO 4IDBA 2XAAA 1PS8A 1MXFA 1W73A 4RLSA 4Z9FA 1ZEMA 3FBTA 3H9EO 1ZH8A 4DPKA 4MJLA 5JDIC 5L9AA 1DFIA 1EMDA 4DBVO 4DPMA 3MWEB 3DZIA 2VOJA 3QJ5A 3Q0EA 1B26A 3U9LA 2QRLA 2ZATA 3JYLA 4PRKA 1IPEA 2UUPA 4KMSA 1NVMB 3DWFA 5JO0A 3B1JA 2HMTA 2OZPA 4LVCA 2JKVA 3VZSA 2VHXA 4E5YA 4EDFA 4NG5A 1KERA 3RC9A 1C1DA 3K6JA 3PWKA 4Q3CA 4QFCA 1P74A 4BNKA 4DPLA 5BSHA 4PG8A 5GZ3A 4E2WA 1B15A 2AE2A 2E82A 3DONA 3L6DA 4GPD1 1IHXA 2P5YA 4J2OA 1NTOA 5T67A 1ZK0A 3ST7A 2YQ4A 5DN9A 3I9MA 1DRWA 1MGOA 4BKOA 4B7UA 5F5NA 2X58A 3O9ZA 2RCYA 3FSRA 1G0NA 1EUZA 4L74A 1BMDA 5T57A 5LC1A 3L0DA 2ILTA 4FGWA 5HA5A 1NFFA 2OP1A 1HE3A 3ZNNA 4E5KA 2IODA 5DZSA 1PJTA 5EESA 1HT0A 3CZRA 2B83A 5JSFA 1ENOA 2QHXA 3UFXA 4Q3DA 3SVTA 4PVDA 4GLLA 3WBFA 4HWKA 4KP7A 4LW8A 1KC3A 3C24A 4S1VA 2O2SA 2EG9A 2JHFA 2VTEA 4ZICA 3JQ8B 3HDJA 1L7DA 5CPBA 4BO2A 1TT7A 3QW2A 2J5QA 1B8UA 5U9CA 1LUAA 2E6UX 3DBHB 3FN4A 3GLQA 4KZPA 5DNAA 3D64A 2X0NA 2EEZA 2GCGA 3JV7A 2I9PA 3QP9A 2FP4A 1S6YA 4MVJP 2VUUA 4CM8A 4R9RA 3LC2O 1N7HA 4MKXA 4P4NA 3U62A 3WGGA 4RDHA 2FZWA 3QVSA 3C1AA 4TWRA 3GMDA 3DMYA 2IZ1A 3KYCB 4DA9A 3I3OA 1NHGA 3GFBA 4AVYA 1RKXA 3GDOA 3VKVA 1U7TA 2F00A 2I3GA 3PVZA 1A5ZA 3CEAA 3GHHA 5G4LA 1SZJG 1I2ZA 3EHEA 4YJHB 1BWSA 1U2DA 3EY4A 4MVJG 1A7AA 1P45A 4QT0A 4QECA 4K26A 1D7OA 3NDJA 3RFXA 3TWOA 3W8DA 4M55A 1WAMA 2AQIA 3PFWO 1KY5A 1K0UA 1NHWA 4XYLA 3ADPA 4OM8A 4ZN6A 3DHEA 1FXSA 5GY7A 1HDOA 3HUDA 3MJEA 1HXHA 3RC2A 3VH2A 5L53A 3GZNB 1Z74A 2C20A 2O7QA 1Q7GA 2AW5A 1VKNA 4WJZA 1H2BA 2C2XA 3ZU4A 2ZYGA 2CMDA 3AFNA 2X0JA 1DSSG 1ZVMA 1V3UA 2HUNA 3NJ4A 4YWJA 3MEQA 3WWYA 3DBRA 4JQCA 2Z1NA 2PFGA 1DFHA 2WYVA 5I7FA 3ORFA 3UF0A 5F5LA 4CQLA 4P38A 4EEXA 3GUCA 1QG6A 4B7XA 2P9GA 3GC6A 4LGVA 1LC3A 4WE3A 3I4CA 2E4AA 1Y8RA 2Y0CA 3PRJA 4Q3EA 3V5NA 5IXYA 2GN6A 4J7CA 3LDHA 2VWGA 3KSUA 3ONEA 2CDBA 3ZW8A 4IZHA 3JSAA 5ER9A 3RKUA 3KUXA 2Q45A 5IN4A 1XU9A 1HDZA 4CJXA 3EMKA 3IOYA 3DHYA 2I5PO 3PHGA 3EVNA 4IPTA 3MJSA 4YJFA 4IINA 4TRJA 3DR3A 2CY0A 1EK5A 3EZYA 3HDYA 3VOSA 4N18A 3KO8A 4GGPA 5FI3A 4PLFA 4Z0TA 2NU8A 1DEHA 1ENZA 1SPXA 3GR6A 3IJPA 5B4TA 5GZ1A 3ITDA 2VYNA 4Y9DA 5JAMA 2WJPA 3DL2A 2GN8A 3PTZA 1PGJA 3H3JA 4LN1A 1MFPA 3GN1A 4W4TA 4H3VA 4YAGA 3QVOA 4D43A 1JWBB 3WWZA 4EUHA 2G82A 5L45A 4CODB 5AXDA 1E7WA 4BO7A 1DC6A 4UAGA 2OFPA 5JS6A 1T2DA 5THQA 3BMNA 3VTFA 2YY7A 1RYDA 4E5PA 2O48X 1ZZEA 5DDIP 1CF2O 4J43A 3O38A 1XWFA 4OMUA 2Y0DA 3TNLA 2GSDA 4PG7A 1C0KA 3RROA 1RM3A 1U2GA 4C7JA 4J2HA 4BNXA 3MJVA 3ZU5A 2Y67A 5J23A 1KC1A 3KYBA 4CM4B 3IIEA 1E77A 4Z9XA 4CL3A 2BELA 2H1SA 5EMHA 4J91A 4XD2A 1EVZA 5JXWA 2X6TA 1JN0A 1VJ1A 1EVIA 2HSDA 3PJGA 1WDKA 3IP3A 3NT4A 4OOEA 3UCEA 3PGXA 2Y1GA 4X54A 2IYOA 1KVSA 2ZQZA 2Q50A 1E3WA 1ADGA 1BVRA 3HWRA 1PGPA 2HMVA 1T4BA 3DEYX 2GNAA 3PLRA 4WOJA 4FGSA 4BNYA 4L76A 4CM9D 1UDCA 1YRLA 2GO1A 5KIAA 1UZNA 4XJTA 3WGIA 3V1UA 4NNJA 1KS9A 3VTZA 4NK4A 4BGUA 5JMWA 3GG9A 3DMTA 2YYYA 3RU7A 1ZXBA 3WOHA 4FJ0A 3C7DB 1ID1A 3KLMX 4CR8A 4DWVA 1TVEA 3C1OA 5A05A 5CG1A 5L7WA 1PX0A 5JBIA 4HV4A 4OXKA 2B4RO 4D42A 5TT0A 2J6IA 1I30A 1B8PA 4E6PA 3QWIA 1LQUA 4RVSA 3WXBA 1I36A 3TL3A 4N5MA 3PJEA 4FOOA 5THKA 4CLEA 2FSSA 4DMLA 1ISJA 2Q1UA 3ZV5A 1GADO 4FJ2A 4CLOB 1PJQA 3DQPA 2EIHA 2NUAA 1T2EA 1PR3A 2X9GA 5IZ4A 3Q9UA 4RZIA 2DM6A 4CV3A 1VSVA 4MVJI 4U6SA 1IY8A 3JD3A 3GMSA 3PIDA 2GERA 2PZJA 2UYYA 4E32A 1P1HA 4GQAA 5A9RA 1BW9A 3JQDA 2PGJA 1ORRA 4RORA 3WGQA 1SEPA 1R12A 4FC7A 1JVBA 4DL9A 3DBLB 3OIDA 3ZHBA 1E92A 2J3KA 3JQAA 2Q1SA 4ILKA 5CPFA 3QE3A 1T2AA 1ZNQO 3A28A 1RWBA 4LISA 3PJFA 6ADHA 4CLRA 2P91A 1LSJA 3HFGA 2VZ8A 4QX6A 1NVGA 4PG4A 4IS2A 3DZHA 3N58A 4XGIA 1N1EA 4Z3DA 3S2EA 1G1AA 4L4RA 4BOYA 4W6ZA 2HKIA 1OC2A 1NVTA 3SLGA 1CIVA 1RM0A 5GZ6A 4EITA 4BNLA 3K5PA 2C59A 4HKTA 5COQA 3Q3CA 2ZIZA 3AM4A 1I01A 3OJEA 7ADHA 2VHYA 5DCWA 1LRJA 1LA2A 5A5FA 5H82A 4WLUA 4CMEC 3BXXA 1O9BA 4WCFC 2RAFA 2D59A 3RJ9A 4R16A 1ISGA 2CVZA 2WD7A 1FDTA 1Q0QA 3JQFA 2I6TA 3GUYA 3K96A 2A92A 3IL2A 3KXDA 4IMPA 2ZJ1A 5BNIA 4XR4A 4CM7A 3QSGA 4PFJA 2Y66A 3WICA 3K8ZA 2IYPA 3Q11A 4D46A 1KVRA 4NFSA 1PS0A 1NQTA 3N74A 4FDAA 5K9ZA 1BXZA 5IDYA 2Y0EA 3C7AA 2EP5A 1FF9A 3PZRA 3L9WA 3AK4A 4BV8A 4BVAA 1QSGA 4IJWA 3L6EA 3M2TA 3I5MA 4TZKA 1WXDA 1DIHA 3Q2IA 3WGYA 1PIWA 1J6UA 3OM9A 2DBRA 4OYRA 4DQUA 3O03A 3M2PA 1Y7TA 3WLFA 3NGXA 4WK6A 1WNTA 1TA4A 3Q6IA 4HFMA 5TSDA 5G4KA 3BTSA 3HG7A 3JQ7B 1VLLA 2NU9A 4GI2A 3HE3A 4FFPA 4GWGA 4UUMA 3U49A 2V6FA 4JIGA 4E3ZA 1ZK3A 3R1IA 5TIIA 3ZNQA 4IS3A 4CMIB 3GNSA 1U5AA 5DF1A 4CR6A 2EKQA 3IS3A 4JNKA 5KJCA 4R1UA 3UVEA 2VWQA 3GVIA 5C37A 5JDCA 1P0FA 2GD1O 3C85A 3SLKA 5DBGA 1MFZA 3U3XA 2B4QA 5IZCC 3AI2A 2NSDA 3MCVA 1XG5A 2B0JA 2PK3A 4XIYA 1CQIA 4I1IA 4N5NA 2DBVO 1WWKA 3PQEA 4WLOA 1NR1A 5AXCA 3RUFA 1UZLA 4B4VA 4EEZA 1Y5MA 3G49A 5C5IA 2NTVA 3JD2A 4BO1A 4F46A 1HLDA 1DIGA 2Q99A 1K6JA 3O8QA 4JP2A 4L73A 5F3RA 4CM3A 5G0VA 1L1FA 1K3TA 5DBFA 1ZCJA 1D1SA 4ALNA 4YT2A 1T1RA 5IAAA 3DZBA 3GZ4A 3WTCA 2DQ4A 3ANMA 1EDZA 1O8CA 2P4QA 4RPJA 1XGKA 1KYQA 1NX6A 5CDTA 4XR9A 1VL8A 1QMGA 4CM5A 2FPPA 4Z3KA 5AOVA 1X13A 1PQUA 4BGEA 3FWZA 3VPSA 3L6OO 1YL5A 2PNFA 3AM5A 4BNFA 4OXYA 5LDGA 3TN7A 1HYGA 1N5DA 4HP8A 3TRIA 4OGWA 3TL2A 4CPDA 1DC3A 3RBZA 3JYQA 4E12A 4XX0A 5JO9A 3TZHA 1KEWA 2G5CA 3VZPA 2X9NA 3P5SA 1WW8A 2RBEA 4YRDA 2Y1OA 3C3XA 1Z6ZA 4RPGA 3CKYA 1BTOA 5L7TA 1ZSNA 1O5IA 2I67A 3PYXA 4GMGA 3ZDFA 4D3SA 3VPHA 4NBRA 2DT5A 5IDXA 2Y68A 1JQBA 4JBIA 2BHLA 3QWBA 4I9UA 2D3TA 4PZEA 4W82A 3T7EA 1GU7A 4LVUA 4NBWA 5TRTA 5BSEA 4RL6A 5TJ9A 2JL1A 2F1KA 2AQ8A 2WD7B 2JAHA 4DIOA 2J5KA 3D3WB 4CMCA 1O89A 4FS3A 4XQ9A 1QYVA 1HDYA 3G3EA 1SOWA 4AJKA 4B3HA 1V3TA 2QX7A 1PR9A 1V0JA 3DOOA 9LDBA 2NWQA 2V7PA 1VJ0A 4U7WA 3VZRA 5HTOA 3ZHXA 1VM6A 4AJJA 2OGUA 2OORA 2G76A 1RM4A 1KVUA 4R41A 5ILGA 4UEKA 4UVGA 1T25A 1UUFA 3JQ8A 3HFSA 3LT2A 4O0LA 4AJIA 1XU7A 4B4OA 1Y9EA 5HBRA 1I10A 1YB5A 5C7IO 3HDQA 3H5NA 4XQGA 1SEVA 3DBHA 1IB6A 2AMFA 1OAAA 2BLLA 1O95A 3U4IA 1PS9A 3GT0A 2VYVD 3PHIA 3HSKA 5A9TA 4R9SA 1GPDG 3I9NA 2X5KO 3WGHA 4BKQA 4BNNA 1PQWA 3EC7A 3EVTA 3W4IA 5IDWA 4ZQHA 4IUYA 5F1PA 2I76A 2PKQP 4AJ2A 4YT8A 2QRJA 2HK7A 3KYCA 4KWIA 1NPDA 3ZWWA 5A03A 2ZJ0A 3KYDB 1ONOA 3SJ7A 1NFRA 1PJ4A 1P1JA 3KEQA 2NNLD 2ZQYA 3HHPA 4H15A 2C2YA 3EAGA 4D3FA 3NRCA 1EZ4A 1P3DA 2PA3A 5HS4A 4GWKA 4A2CA 4J16A 4Y98A 4YJHA 5CP8A 3JD0A 5JAQA 3GVHA 1H93A 2VTDA 1ISHA 2BI7A 4BNJA 1Z82A 1R66A 4FCCA 4IIVA 2Z5LA 4QO7A 5KKAA 1OI7A 3VDQA 4QTZA 4MPDA 4BO4A 2YFQA 3F1LA 3JQBA 1XSEA 4JBGA 5ITWA 5IF3A 2GUGA 3DTTA 4K28A 3GPIA 4NBTA 3RUEA 3GZNA 1GCUA 2BFMA 2WYUA 2JFFA 4DRYA 4QUKA 2BI8A 2I65A 2VCYA 3LK7A 4FIZA 4PIVA 4WEOA 2B37A 3WIEA 5JW6A 4YYZA 3CMCO 4MVJA 5KOIA 3LC7O 5JC1A 1J4AA 3OBBA 4YBZA 3AU9A 4XEHA 3DAPA 1A7KA 1Y81A 3D3EA 3RKRA 4B4UA 4EI2A 1ZKMA 3ZWNA 3WG9A 2ZTUA 2VRCD 2R6JA 4IZIA 1JU9A 3D5QA 1LSOA 4GX1A 2EP7A 3IDSA 4XYBA 1KVTA 2NM0A 1VC2A 2X8LA 3GRKA 2SCUA 4Q3AA 4UVDA 2HMUA 5CAEA 5TQVA 6LDHA 2VHZA 1EEHA 3FBGA 3I52A 4TMFA 2NV6A 1EE9A 1M66A 1EBFA 3ZWBA 3OQ6A 3LF1A 3OEWA 3V2HA 1C3VA 3BHMA 4FR5A 4RZHA 3STHA 2O7SA 4EJ6A 5L4SA 1N9GB 1X7GA 4UUPA 1OC4A 4LK3A 4ZRNA 2OO5A 3P2YA 4NFHA 4L4XA 3GAFA 1LLUA 3R6DA 4R1SA 2BFAA 4YQZA 4BUCA 4ZVVA 1SMKA 3CSDA 3GF4A 4W9NA 3OP4A 4NH4A 1GL3A 5JCJA 2Q4BA 3WYCA 4EBFA 4NIMA 2O3SA 2X7HA 9LDTA 3S8MA 3ZU2A 3C8MA 3AOEA 3F3SA 4PLYA 2HK8A 3ICCA 3G1UA 4J49A 5GMOA 3RBXA 2A4KA 1NAHA 1X1TA 3WBBA 3F4LA 5TS3A 3VAZA 3W6UA 3GGGA 3WQRA 3TPCA 1WZEA 1LDYA 3FHLA 3VPXA 3VH3A 4GVXA 4PGFA 1QORA 1JW9B 1HZZA 3PP8A 3NX4A 4J9UE 1SBYA 4CLDA 1B16A 1WPQA 5ES3A 4J3FA 1CQJA 3A06A 1I2CA 4XQCA 5H83A 2P9CA 5ENVA 1XQ6A 2ZTLA 5T5QA 1GZ4A 3FWNA 3NT2A 4Z9YA 4E13A 5B1YA 3H6KA 1D3AA 4WNCA 1AHIA 5BSFA 4CM4A 3UGKA 3ROPA 4ZQFA 3R3SA 1BRMA 1C1XB 1JVSA 1H9AA 1NQAO 1H6DA 1M2WA 1DAOA 2B5WA 2YV2A 3IUSA 2B4TO 1YL6A 3LLVA 3NYWA 1ZJYA 2JAPA 3D1LA 1RJWA 2RH4A 4R3WA 4RF2A 1PZFA 3U0BA 2GPTA 3GQVA 5T8KA 4RPKA 4RJTA 3N7UA 4L8VA 3H9UA 5BR7A 2X4GA 2Q46A 4RVUA 4MP6A 4HFJA 2WDZA 1CRWG 1V6AA 3TZ6A 1I24A 5BSGA 3E8XA 4BB6A 2YFHA 3VH1A 1BHSA 4GX0A 3QVXA 4OQZA 4I5FA 1ZK1A 3AJRA 3G79A 3KM0A 1ZFNA 2HCTA 2PH3A 3PGJA 3WGOA 3AW9A 3E5RA 3AWDA 4XRGA 3GK3A 1YB4A 1K89A 2EJVA 3H8VA 1O6ZA 2C7GA 1R4MA 3B1KA 4PLVA 3QVTA 2CZCA 2I3AA 2WD8A 4MIYA 1SO8A 2IZ0A 4CLOA 3EZLA 3OFSA 1U3WA 1MG5A 2GN4A 1A4IA 3OIFA 4NU5A 4WLFA 3PFFA 2YDYA 4II2A 2FPIA 2GZ3A 1QYWA 4YPOA 4YJGB 1NQOA 1GDHA 4YEDA 2JCXA 2VT3A 4NFYA 4LRSB 4K9DA 2D8AA 2V6BA 1NR7A 3DOJA 5IFLA 4LSWA 2W4QA
chains in the Genus database with same CATH superfamily
5HIAA 4UOEA 5JHGB 3PHJA 4XASA 1GV0A 5BSMA 3DBLA 1VHQA 2ZE8A 1YBFA 1N6LA 3ICPA 1LLQA 2AYXA 2Q6KA 1AGPA 3K1TA 5D7NA 2I4TA 1UJCA 2HY7A 2ZT6A 1CZUA 4OHUA 3TLEA 2VTKA 2BGRA 4M0DA 4RABA 1ML3A 4NOJA 2GVDC 1QYCA 2D1FA 4BC1A 5EJ8A 2QRMA 3GU3A 4NZPA 4MV1A 4MSUA 3VVMA 4RAOA 2VN8A 3C4JA 1XVLA 2DQKA 2AUTA 5FT9A 4XGNA 4JI6B 3B70A 3IUEA 2QMYA 2BCGY 2VNAA 1JQLB 5F98A 1X7XA 3G2PA 4G0QA 3LLUA 2RGXA 3NWOA 4BZXA 3OFNA 4BNMA 4D9FA 1SUFA 3KQMA 4QODA 3JPWA 2JIZD 4I7EA 4RVGA 4ASUA 1C14A 1SNYA 1XNQB 5FUXA 2V98A 1KEUA 5F21A 2ORVA 2OBNA 1P75A 4D9NA 2Q5JA 4G1UC 3W2EA 1ATIA 1T9DA 4CMGA 1M0EA 4WZZA 3TJMA 1A9ZA 1IXSB 2WHQA 3AV3A 3EEOA 2FK7A 2VUTA 1KMQA 4R01A 3P9PA 2VT2A 3DJYA 5JI3E 4BJ5A 3FMPB 2X5OA 3Q4GA 4BJ1A 2FUKA 4G01B 3WDMA 1FVHA 4AICA 4ZODA 1RBMA 5EIBC 4G9BA 5JNLA 4RWZA 3H2GA 2ERYA 1CY7A 2I8LA 3LU1A 3Q2KA 1RJFA 1PJCA 3HYTA 5IWAB 2V7QD 1DC5A 1JX6A 1Y48E 2L82A 5LD2B 3DP7A 2Z3ZA 1C80A 1CSEE 4DMKA 2AC4A 2G0TA 2C03A 2W98A 4X3PA 1BHJA 3NVDA 4N0PA 1DO0A 1LKZA 3AHFA 1C4XA 4RE5A 3QHQA 2FW6A 2Y1FA 3PE4A 4DAEA 3NBZC 3E9EA 4JMPA 2WLTA 3CN9A 4TMXA 1WLSA 4BXOB 1FYXA 4XAQA 1IRIA 1OREA 1EUCB 1PWEA 1LFDB 5HJ2A 4PZUA 2I4NA 4YRKA 1J00A 1T0BA 4E11A 2XT6A 3RVMA 2UU9B 4V03A 1CYEA 1XK6A 1KO1A 5TEWA 3ILVA 1C1HA 5E6RB 2WF7A 1FFYA 2HO5A 1L8QA 1REQB 1H2EA 2O5RA 1H5QA 3DPSA 3T3PB 4FFLA 3BMOB 2GRJA 3R75A 2D2IA 3ANLA 1NMXA 2EJUA 2CNNA 4CMIA 2IYXA 4G5GA 1Z0AA 3BF8A 3TOXA 5ETJA 1YRHA 1IM5A 5JD4A 5A71A 3B7WA 1VIYA 2GEVA 2ZSDA 2WIAA 2FMHA 4F85A 5AVXA 2O4CA 2EZTA 3LCMA 3DAHA 4MS4A 4ZDKA 4HDRB 3CZ5A 5LQMA 4IDUA 3ZGOA 1NT2A 4CLXA 4X60A 3DG9A 1GUDA 2Q1TA 5ECWA 5SYMA 1P9LA 4XCQA 1JAXA 3WYDA 4IJKA 4BO5A 3FFBA 2R6CA 3KFXA 3RAJA 3AEXA 3EMDA 2RBGA 4R8LA 5DI9A 2QTHA 4KNWA 5JFGA 4TKMA 4JQSA 4QO8A 1NI4B 1ZH0A 5DX1A 5JPDA 3RVNA 3WFIA 4L0CA 3M9XA 1SBHA 2CDCA 1UBUS 5B58T 4IUDS 2QTVA 3DZKA 3ZDZB 5LJIA 5LMCA 1J1ZA 1YI0A 2E4WA 3A4MA 4IDGA 4O4JA 1EFHA 1GL6A 4KFUA 4MB6A 1AZSC 3WNVA 1EXDA 4O6VA 4IDDA 4REQA 4A3SA 3I8SA 3L6BA 4R8KA 1Q92A 3OZGA 1F2TA 5B3AA 4BGDA 3S44A 3FBWA 3TM4A 4US0R 2BI4A 3M1IA 2OO3A 1B8OA 1Y9JA 3QLJA 1Y34E 4KZKA 3SI7A 2W6ZA 3GJYA 3L6UA 3JRXA 5H9WA 4ZVPA 1WY5A 2AXQA 3NTVA 5EWJA 2ZYWX 3UFBA 3U9SA 1OKKD 3WL8A 3VVLA 5B1DA 1PK9A 3K92A 4ZHSA 3W79A 3ZHCA 3I5UA 3D2LA 4PLHA 4TVOA 1K8ZB 1Z5WA 5K2OA 3N8HA 4NJOA 1LBTA 1MO2A 3M7IA 1GTSA 3VBCA 3HL0A 3RAFC 4BO9A 3WXMA 2B8JA 1P62B 4MHSA 1D9ZA 1N6RA 1J06A 1W25A 3C5HA 1HDGO 2X1VA 1AF7A 5TPWB 1XLTC 3LGXA 2YQ5A 1CDEA 4FMCB 1XCPA 5D85A 3AB7A 4G9EA 1ZGCA 1JH8A 1K6EA 2VPTA 2R60A 1Y6RA 3A6ZA 1QGOA 3CE9A 3EF1A 3FCYA 4MVJE 3RC3A 1RJEA 1Y9AA 121PA 2NZXA 2P69A 4BDSA 5BW8A 5LWQA 3K6SA 4WOCA 1QU3A 4OH1A 1CY4A 1XQWA 5K4HA 5JD6A 3K9FC 4U02A 4E5MA 4R1LA 3PF9A 5E38A 1GTMA 2GZHA 3CG4A 3UGTA 1FMTA 3EQ6A 4LDNA 3D8SA 1S8OA 1L8XA 1KP2A 3WBJA 3KPYA 1JEDA 2OCAA 3SK0A 3UMSA 1O0CA 4NFLA 4UTNA 1IXYA 1ULBA 2EARA 3KV1A 3IE0A 1FJ2A 4QGHA 2CLIB 2D2XA 3H5AA 3SOPA 1DWOA 1PVVA 4V1CA 2AWNA 2JJMA 3F46A 3CUTA 2YICA 4UASA 4V0ME 4ALKA 5J2UA 4CCWA 4MV6A 4UEWA 4P81A 1GLGA 4K9KA 2FPOA 1NP6A 4UEOA 1KJQA 3P8ZA 3KZOA 3Q9NA 3QU5A 3VU3A 5C3MA 3ZX5A 4W5NA 5M7EA 5IM5A 1OWOA 2J9FB 3WL6A 1EWTA 3IEMA 4Q1CA 2ZB8A 1GYRA 4KR6A 3G0IA 2D1YA 2VNSA 3MT0A 3HBMA 5FBVB 3FOWA 3GJZA 4Z49A 1ZNXA 1YK0A 1U2ZA 1ISIA 2CXOA 2DTEA 1ILWA 3IC5A 3OKFA 3S55A 1NF8A 2BZSA 5IUKC 4B3XA 1N2SA 3RW9A 3ONFA 4EMTA 1Y5RA 3Q7TA 3VPBA 2VPQA 1JALA 1OFHA 4R54A 2V1XA 4O25A 5C5EA 2UYGA 3MLBA 4KXFB 1ECCA 1PT6A 1SD5A 1UJNA 1W4ZA 2PIAA 3IPRA 4UC0A 2D8MA 4P35A 4UFOA 2CJPA 3MHPA 5C1PA 1T3ZA 2YV3A 3TIGA 4QUJA 4PF1A 2YZ7A 5BYJA 4KQIA 4NDNE 4C0LA 2QPAA 3DBOB 3TSWA 4HT3B 3O8OA 3C3JA 4YCAA 5AJXA 3WYGA 1FA9A 4DM4A 3T4XA 1GKKA 1L5FA 1SRQA 2RKWA 4Q4JB 3SX2A 1BMFD 1AXGA 1CCWA 3A6DA 4URYR 5KWVA 3GAMA 3TD9A 5K0BA 3IKMB 3M5DA 3A4VA 3OE5A 3ZWPA 2W8ZA 3GEHA 2J1LA 2O3QA 2QPTA 3FUXA 2OT3B 4YXWD 3DAFA 1P77A 3L40A 2Q9AA 3QA9A 4KLCA 1ECJA 3WL3A 2Z2JA 1SR8A 4M38A 3ZWXA 1R0BA 3D0RA 1CLEA 1Z5OA 4C89A 5AHRA 1I8TA 1QJ4A 4RXTA 1R6VA 4C5BA 2BSQA 2OLKA 1K88A 4QG7A 4F4DA 2BLNA 1E1LA 1PE0A 2W71A 5HKKA 3KSAC 4TTAA 4TWZA 4D9JA 4HADA 2P7HA 3IMCA 3PWTA 1BKDR 4YCBA 3TCXB 4TV8A 1P5HA 2FNAA 4FYVA 4YUXA 4II3A 2PXXA 4UXHA 1DJPA 1YZHA 1DKNA 5KVCA 2I6QA 3ETDA 1A9RA 1K8QA 2JLAA 3HJAA 3B85A 3SKXA 1P4SA 1TYDE 5JMTA 1GFSA 1F8YA 1MQ8B 1NVBA 4RTRA 1QV7A 4DBZA 2WG1A 4DIEA 4RY2A 4B3IA 3CCBA 1EFRA 1CLUA 1BOFA 1JKJB 4L9SA 3WJAA 1U2QA 3VHRA 4GEGA 5CNKA 3VC3A 2O1WA 2V7QA 3LZ6A 3C3KA 4DMHA 3D6AA 1JHDA 4YHBA 2XT0A 4W63A 3K70B 5JC8A 3CH5A 1LQTA 1XTTA 3T3MB 1PJBA 1P7YA 1UDBA 1ZUD1 4OJYA 2ZK7A 4TZTA 2IOQA 3JCZA 4MUJA 3K30A 4HD8A 2DWPA 4PZZA 4YMTA 4YI5A 3UO8B 3E0QA 1V25A 3AEYA 3ZHTA 2J87A 4EW1A 1J7JA 4ZOLA 2BGUA 3EUFA 3FHJA 4G8CA 4LRTB 1A2QA 1XWWA 1UJMA 3CNLA 4NAVA 2FMUA 5E9WA 3UK2A 1W36D 4FQ8A 4I55F 5F52A 3ROQA 3HKEA 4ZT5A 3WB9A 2IRWA 1ZMOA 4IV0A 2WNHA 2BFFA 2BKEA 5IJWA 4JASB 1ONPA 3IUBA 1FU4A 4B79A 1B6TA 2J9GA 2B2XA 5DOZA 2DFLA 3GYBA 1FXUA 1YI8A 2HT6A 2QM7A 3K09C 1UKEA 3LX4A 1YDWA 3PWSA 5DP1A 3CCCA 3RD5A 3RJTA 4AJNA 5BNWA 2QLMA 2DRIA 3QPBA 1A8HA 1CS0A 4OJNA 4OH7A 5CMLA 3TI9A 3WRYC 4BX2A 3TEFA 4L75A 4P83A 4TMZA 3TEMA 3WLSA 1XWIA 5EMMA 3K9CA 1H8ED 2QTMA 1UXJA 1NL3A 1VIVA 3G1TA 3P9CA 3PHHA 3VNBA 4YS6A 4EPTA 5A4JA 2JAOA 2XCOA 4ARUA 4JB8A 5FBWB 4FMDF 4IQ0A 4Z7NB 1FJHA 3PQCA 1EDOA 1T8RA 4GYWA 4QXOA 1LPBB 5CA0A 4PSAA 4WWHA 5DGHA 2XUFA 4CM9A 1A69A 1NP3A 2ZRQA 3ZJUA 5K1ZA 2W2KB 4O3FA 3G6WA 1QZXA 2P62A 4QPCA 2FHPA 3H11A 1P44A 1QH8A 3FJ1A 4JI7B 5LLTA 4NBVA 4DRXA 3A3NA 2WQZA 2XIJA 3I8OA 2ZJ6A 1SVNA 4MS1B 2H2FA 4D45A 3PDCA 1DMRA 4RY8A 2DHEA 4UVIA 5AKXA 3R9XB 2HPVA 4YLEA 4BQIA 5HNKA 4ETWA 4MIOA 5KTYA 3E82A 3CLRC 5IC6A 1UZAA 5LQAA 2P0YA 1M6EX 1DARA 4G0PA 3DDHA 3HM9A 5EKUA 5AH0A 4DV3B 1W88B 2Y1LA 4GKVA 3OHSX 4OHZA 3WC4A 5F7OA 4N76A 3B12A 1QU2A 1R9GA 4AN4A 5A9SB 5CBPA 1UKAA 2A8YA 2QL9A 4F3YA 2XXBA 4AF7A 3T35A 1CERA 1TEVA 2Q1WA 4KH0A 4HAZA 4M8NE 3VR3A 4WOKA 4YMGA 3PVSA 1W29A 1ULTA 2O2EA 2WHYA 3HABA 1VMKA 4GIBA 4UNSA 2WTAA 3WFZA 1E4EA 4RS3A 1D7AA 4ID9A 2ONZA 3KT0A 4URZR 1ZK4A 1RLOA 3MBIA 4LTMA 5HIJA 1OAOC 1DKQA 1Z6AA 2HBRA 5EZYF 1U63A 2PXHA 3Q40A 1PJAA 5FUYA 4BLUA 3GLGB 2JCBA 3W3ZB 4KTTE 3MGAA 2AJTA 5IDVA 3ZIDA 4M9ZA 3DB2A 1C9DB 1P2BA 1MENA 5IT5A 5HM8A 1A4XA 3LC1O 1W44A 4OB7A 5K8UA 1F2UA 4V0LA 1KDVA 3QMVA 3CUVA 2WIBA 3KJQA 5EQFA 4ZI7B 1B4DA 1VL0A 3BOSA 4LJSA 4HS9A 4NCJA 1W2HA 2Q3EA 1XJ0A 3UXEA 5LP6A 1ZCFA 3LY9A 3DP9A 3KJHA 1ODFA 1PW7A 2OPBA 2PLAA 2YHBA 3W5CA 2OQRA 4BP3A 1D6SA 1NNUA 4UUNA 1D8AA 1YSCA 1C1XA 2D0IA 2W2PA 1B1AA 2CHQA 4OP2A 4UPEA 4L9AA 4UHFA 2PH7A 4FEEA 1PHRA 4NQZA 3UOGA 2C0CA 1MUUA 3LQ4A 3B7GA 2FQQA 4ZVNA 3MLEA 1XRMA 1K7EB 3W4KA 2RB4A 3EZGA 1FOEB 3OQOA 2DGDA 4JBXA 1XO1A 2O0JA 4BCBA 1ULAA 4IXTA 1KO7A 5KNCD 1SZDA 5KYNA 4KAJA 3JYPA 2GA9A 2X2EA 4A8JC 1UOOA 2IYUA 1AKMA 2JFBA 3FOCA 3IUPA 1T3LA 3LL7A 3ODPA 2ZZMA 3VNUA 2EHDA 4UMDA 2PL1A 3U4GA 1CRLA 3GNLA 1WUHS 1TEZA 1Z5ZA 4NPAA 2NPFA 4QRHA 5H3LA 3HWX1 3GNTA 1GEEA 3P9ZA 2NYVA 1RSZA 4O4LB 1RKUA 3TE7A 4D3YA 1VCOA 3D6MA 2X6RA 4JLWA 3EODA 2ZRKA 5B6PA 3KBOA 2CEAA 2A0XA 1VBKA 2ZETA 4L4ZA 4LK2A 4R9NA 3EXFB 3MTBA 2QR3A 3FNEA 4JLKA 4BVGA 3QH4A 4ZYUA 5JNUA 4A2QA 1HG0A 3WHLA 1EIWA 2AXEA 2M2IA 5HK9A 4J1JA 4OUKX 3CIFA 2OLEA 3H9QA 3E9QA 5K0GA 2OHGA 2IL1A 2FZVA 2QJRA 4LSMA 1KSGA 1F1JA 1G6HA 2AKYA 4JEIA 4D6YA 5AUNB 5GINE 4X1IA 3Q2OA 2CXHA 1U8XX 2E37A 3MWFA 1ZK2A 1JLKA 1HLPA 1X9HA 2FUEA 2YOHA 3ESDA 4B6FA 5ABPA 3JAWB 4TWIA 4BHTA 4MKGA 3PIRA 4RGBA 2O6LA 3PPXA 5DTRA 4GFDA 5CH3A 1P0CA 1ULZA 3KD3A 4DLUA 4AO6A 4BNHA 2BKAA 1S7GA 4H4DA 4PX2A 4J3JA 4LF6B 5FULA 4XCXA 1PYGA 1H1TA 2GDZA 3GARA 3KAKA 4C76A 1PF7E 1P0MA 1HL7A 1BMFA 4DG9A 1JQDA 2LXNA 4NE7A 1UMKA 1POWA 2AZDA 2FG7C 4MJXA 4P86A 1EM6A 4QATA 4BGIA 3AF6A 1QRRA 4TYQA 4D7AA 3PNSA 4NBSA 1Y4AE 3FMVA 2JGIA 4YXWA 5BUCA 4H1UA 4H1HA 5IK2D 1N2OA 1T0IA 2WF5A 5C8YF 1GUZA 4PZCA 5HFNA 2X4IA 2YHIB 4RTOA 1GRRA 2O2JA 3GA7A 4ZU3A 4YR7A 2WM8A 5DBIA 1BU8A 1G9SA 3ANXA 3B52X 3CINA 3LC0A 2AUMA 4MW6A 5TR9A 3C3WA 1F4VA 3RGWS 1P3Y1 4FW8A 5BN1A 3TIIA 4A0SA 2WZBA 3KLPX 4G24A 4WH0A 1AUPA 1QYXA 1V16B 4HFRA 2VAMA 4F96A 2E1PA 2B35A 3IJ5A 3V2UA 3ZK8A 4GBJA 2O19A 3F71A 4MA0A 3U81A 1O58A 1OXSC 3H13A 3IBTA 3P71T 4M76B 1XALA 5ELMA 4BNTA 2X41A 2NGRA 1LBHA 1EUYA 2EYUA 3NXKA 3FOFC 1U2TA 4ZOBA 1ZR4A 2P6PA 1QVRA 4JC5A 1P5RA 3QI7A 1LDGA 2G4CA 2AEJA 4V1CI 4YUZA 1JAHA 4ESVA 2FN4A 2O8FB 7GPBA 4DR5B 4XPZA 3GZJA 2XH8A 4IZ6A 1UKYA 1ZRNA 4NJMB 3AB8A 1A04A 2GAOA 1LBQA 4HDSB 1UBOS 2XXJA 1NBHA 1H6CA 1YH3A 2HN9A 4JAVC 5CR9A 3SXPA 1U8FO 2RHHA 2XNDA 3OURA 1M7HA 1URPA 2CFIA 3I5AA 3JQCA 2GPAA 2BSXA 3EIHA 1YZ3A 3KQOA 4NATA 1TTQB 1KAGA 1Z38A 2GYWA 4OP3A 4RW0A 2F3PA 4DDHA 3NOQA 4ZJPA 1TCVA 2G3YA 4Q34A 4LI3X 1B0PA 1U11A 3VHLB 3KJGA 3GH3A 5B1HA 1CKEA 3GFTA 2CMGA 2E5FA 3O6VA 4GGOA 3GJ7A 221PA 1E7RA 4GOLD 3WB0A 3OOHA 3V42A 3U16A 3ENZA 1N5JA 3TOZA 2O3TA 1E5QA 4G0NA 2HPAA 4EZBA 1KI1A 4NZ9A 2VQSA 3ZV4A 1KDTA 3DTVB 4YDQA 5KX5B 3UKOA 1EUCA 4EUFA 5MGBA 2RBKA 1YDEA 3MELA 1N2CE 3CLUD 5CA1B 2QJWA 3AUTA 5I9SA 1I7DA 4MKHA 1Y3AA 1L0BA 3H65A 1JPNA 1NLYA 1UJ2A 5FOXA 3GOQA 3VUFA 5K0JA 3AONB 4XKJA 5LQCA 5E6RA 2I2DA 3BERA 2CHFA 3AG5A 3CNOA 2CL0X 2LDXA 1REQA 3M6AA 3K73O 4L3WA 5AJVB 5DIZA 4PYJA 3DQQA 3BMOA 2DUNA 4U8HA 1S7CA 5HILA 3O7MA 4TLAA 2WZDA 3BWXA 1DEKA 5JS1A 1GJRA 1IZ0A 2VDUE 5KJFA 4GMHA 1SVIA 1D2EA 1TU0A 2GBGA 3OESA 4EI9A 5IT0A 3FMGA 3CUKA 1WDWB 3NYRA 1YDMA 4GW3A 1R27A 3P32A 3T3EA 3VKUA 1EVQA 5BN3B 5GP1A 1CZHA 1EK1A 3T0IA 3U4MA 1M2JA 1VSTA 4HDRA 4OG2A 2Q6TA 4JJZA 1DTEA 3ETJA 5IPFA 1J2RA 1JMKC 4HY3A 1E20A 1TO6A 1AKYA 4NNOA 4Q7MB 3FNIA 4JR0A 1KDOA 4EHBA 4YXFA 1YBAA 4IXDA 4N54A 1J0BA 2YCLA 5DW0A 2WTXA 5CG2A 4M1KA 1N6OA 2Z2YA 4PLCA 3U7IA 2XGJA 3WKCA 2H5IA 2JLRA 1H5NA 1WD5A 3ND8A 1KRHA 4FGJA 4LYDA 4ZRMA 3OPYI 4IX1A 1GKLA 1YDGA 1NI4A 2BKUA 1EFTA 4L07A 4QWWA 1M75A 4ZXFA 1MC4A 2QVBA 2ZANA 3F47A 3FVQA 3I1JA 1X6VA 4EATA 3A3YA 5HQ3B 3IBYA 3ADCA 5BUQA 4A03A 1XEAA 2REXB 3SZ3A 1JKFA 1XN1A 4GKBA 1DC4A 1NQUA 3WSWA 3JATB 2ZFUA 1N6HA 3WAKA 2MYNA 3OE7A 4WLNA 2VT6A 2UKDA 5AO9A 5EJ2A 3S5JA 1Z73A 1GTZA 4PV7A 4UBKA 2P0AA 4BKMA 4MDEA 3MK31 3DNMA 1G16A 5M5BA 3CNNA 1BDMA 4XWYA 2I6GA 2ZRMA 3LRXA 4BZZA 5EQDA 4NY1A 3L0OA 2BY4A 4HH3C 4LC1A 1RRPA 4YCNA 1E5XA 1U5BA 1MA0A 3E5HA 4QUIA 1PVDA 4JOQA 4PFKA 1LBEA 5F73A 4RD0A 1Z7EA 2V8OA 5BWCA 5JAIA 3DCJA 1G3IA 1FRVA 3GLIE 1ESDA 5AJZA 2O2CA 4F7WA 1HY3A 3IAS1 1D1PA 1EFLA 2IPLA 4WKOA 2VYVA 1IQRA 1JR6A 1IUKA 3PGA1 1E3SA 3LSYA 3N0XA 1HF3A 1Q77A 3N75A 3UH0A 4QQNA 2OP0A 1OLSB 1XRSB 5TPWA 4CG2A 3AY3A 3PQ4A 5JZOA 1U1IA 1OXXK 3PIIA 3W5BA 4XRRA 4YJ3B 5CXSA 1ENYA 2Y4NA 3EGOA 1CDDA 4M9QA 3VDXA 3Q7EA 1E3EA 2ZTSA 4LOLA 4MLZA 4YIHA 4IFBA 1L1QA 2I22A 1BZYA 5LLSA 3UOAB 2OD2A 3IR5A 1A9XB 4RVNA 2TS1A 1KJJA 1BX3A 3S8YA 3FGOA 3QEBZ 1JLHA 3PQ7A 1SC4A 1EQ2A 2EATA 2QAJA 1PLKA 3GDFA 5DRYA 3FNQA 3K72B 4LOKA 4NQRA 2QSJA 5EQJB 3UC9A 2JPDA 3P52A 2PL9A 2AQHA 4MMYB 1Q0HA 3O95A 3HCWA 4ZCQA 2D7DA 1PEYA 1FNCA 5JYBA 3D02A 4XTRA 1E3IA 1T3TA 1SELA 2DBZA 3GT4A 1UK6A 1W4CA 3M1AA 3QKIA 1JP7A 1T9AA 1JQ3A 3AF2A 4RYDA 3VR4H 4P4GA 4A8TA 5CLGA 2J9FA 3KFVA 3ROKA 4YREA 1EESA 2G9VA 3K9LA 2L2QA 3NGMA 3SHFA 3C3EA 3ZOZA 4IDEA 2W43A 3FTFA 1R1DA 2OM6A 4Q5IA 5CD1A 5HZMA 4R6XA 1KNQA 1M2OB 2HCFA 3O8LA 4I5GA 2PMEA 1AS3A 1SCJA 4OIMA 3BIXA 4B1FA 2B1JA 1ZJ5A 4AUKA 1E9DA 2JD1A 1H3EA 5FNZA 2FZCA 3MOGA 2ZSEA 3P4YA 4ARZB 1R0YA 5A7GA 3COJA 4PTLA 3T1OA 3L06A 4Q1FA 4E5NA 1TLLA 2JH9A 3ORQA 1HQCA 2B5OA 5C8XA 2PMWB 1EEXB 1Z4NA 2PGDA 3D3NA 4O2RA 2AQKA 1ZNWA 3HBNA 2JD0A 1KJYA 3LFHA 3HVHA 4M0MA 1UBNA 2MINB 4II7A 1JXAA 3OOWA 3KTAB 1DE0A 2O8VA 4MR9A 4Q4JA 1NXQA 1G8YA 1Y37A 3AFOA 3AYZB 4TTSA 3EVAA 1VPLA 2Z6UA 1VYVA 1X1AA 3IIIA 3RUAA 1GGVA 3G2JA 3TW0A 3GAAA 1H0RA 1GGJA 4TLCA 3A4LA 1A9YA 4UQOA 4QSHA 3TBFA 2J6CA 4RH0A 1E7QA 1UC8A 2A86A 2C8KA 1JWAB 4ZEWA 1SCIA 4DHEA 2JH3A 4JLUA 2G8LA 3A1SA 2ZXUA 2AC7A 3AUSA 4TMTA 1DDIA 1N7GA 2QS9A 3ZY5A 3PNLA 3S7ZA 1SUEA 3I6BA 1I4DD 1HFEL 1ZBQA 2O3JA 1OMOA 5J4VA 1D6JA 2XE6A 3NHPA 1K7FB 1T9KA 2PV7A 3ASYA 3KOYA 4HLUA 4XZ3A 5B57C 1B76A 2IHJA 2IOFA 2FX2A 2QZJA 2WM9B 4R1QA 4K6KA 5EFOA 1J90A 4J0JA 3W2GA 5HVNA 2VUSA 2F3TA 2ZU0C 4DLKA 3QKRB 4R3UC 4UU7A 2X5XA 3ZN2A 1N5MA 3H9GA 2F7SA 3IEXA 4N3CA 4WNAA 1NW5A 1N78A 3DKVA 2DCMA 1YS7A 1JKJA 2F9FA 2FSPA 2VOEA 4CWAA 3HY4A 3SEZA 1IY2A 1T5BA 1FLDA 4LHWA 4PG6A 1HPLA 1TK9A 4OXXA 4PO3X 3ZDDA 3Q98A 5G0TA 3KKQA 3W9YA 1UKBA 4LOJA 1M8PA 4NBUA 4F86A 5CFLA 10MHA 3PHBE 4ED9A 3M6LA 5FBZA 3TLAA 4G89A 4GRAA 4B3FX 4GAEA 4LI0A 2BEJA 2WV7A 3FYUB 3LH5A 4Q16A 4LCJA 2BZGA 3NVAA 5T3YA 1I6KA 4BATA 1KJWA 2WT8A 1XZJA 2HQ1A 4DSTA 5I7HA 1IUNA 3ZOKA 4LJ4A 4OA8A 2W0MA 1E58A 2IYFA 2Y8EA 1A27A 2BGJA 4DDMA 4EA9A 4WLVA 4G0UA 2K2QB 3BB3A 4TTTS 3KZCA 4AYWA 1DADA 4TROA 5T7BA 1VLQA 3DLIA 3BL5A 4HWPA 2FPWA 5IC5A 2AV6A 3OJXA 5DGIA 2ZM5A 4FZ5A 1ZONA 1TUGA 5FNVB 3M5CA 1OD6A 1ZY2A 4RQUA 1LJUA 2GHQA 5CLHA 3MT8A 1Y1RA 2M1ZA 3LUGA 4XYGA 3RWOA 3HNRA 3KQKA 2GBIA 5EVJA 1XNRB 2WVJA 1DBPA 5FUMA 1A1VA 4L9RA 1U3DA 4CV0A 2JFNA 3UW3A 1D09A 5C0OE 3WIUA 5EIEA 1WSWA 3N87A 2UZ4A 2BEVB 2W4IA 3LKVA 4D9MA 1YC2A 1ACJA 2FZEA 3SYMA 1YVPA 3O4RA 5ELXA 4P92A 3K1ZA 2ZIXB 5BSRA 2W2KA 2C9CA 1ULHA 4L3VA 5LYYA 3HVKA 1J20A 2XBMA 4GH5A 3HA5A 3UBMA 4ZGWA 1L4KA 4HGQA 1A4RA 1YHZA 5GPBA 3V33A 1UKZA 4MS1A 4S12A 5CLIA 4KTVE 3NTOA 5E7JA 3DV9A 2ZRGA 3L0IB 3PK0A 3U4HA 3R9XA 2V6JA 2C9OA 3BWBA 1Z25A 4FUTA 3R7SA 4LDPA 1TW2A 4TVBA 1O95D 3BGOS 3IXQA 3KJIA 3ROMA 1Y5IA 1T5IA 2OCBA 2FSGA 3CONA 1W88A 2JS7A 2RGCA 2E5LB 1RR6A 4J0KA 3PUZA 2Q2OA 1D2NA 4TTRA 3GGDA 2R5WA 4NF2A 5A9SA 1EGHA 1GZ3A 1UWLA 2J59A 3ABSB 1OU4A 2IZ5A 2Q4RA 5IG2A 5EZSA 3FROA 2VJKA 3B3FA 3RS7A 1AS0A 1Z7WA 2N47A 3ED5A 4K2AA 1OILA 4ND3A 1Q0RA 2FPXA 2MMCA 3WZLA 3UNXA 1YS4A 3HUEA 4QLAA 4EUSA 4DEYA 5LZ5A 4JGBA 5E2AA 1XPJA 3GLGA 1JYFA 2HQSA 2IX3A 2B34A 3R7FA 1XMOB 3NV7A 1HE8B 3DR5A 2PMBA 1SXHA 2AJLI 1PBTA 1H0KA 2ZJ2A 5LJLA 4AS1A 1Z4MA 3T15A 1EX7A 3DKIA 1U7UA 5C32A 2H0AA 4J0FA 1RYEA 1YR2A 5TX7A 4ZI7A 3NDBB 3PI7A 4N65A 5K0ZA 1P1BA 4B43A 2GXUA 1FSFA 3OT5A 3EC2A 1JNYA 2I80A 2OXIA 1EG2A 1JSLA 4P22A 1ZW1A 3DFIA 3RYIB 2PD3A 3DOIA 1NURA 4XLLA 4QOHA 2HEIA 4DAOA 3OQMA 3S1SA 3H1EA 1LDEA 2ZPAA 2CV0A 4GX5A 4Q48A 4HXGA 4CMJA 3H04A 5FUBA 1P1CA 4N7RA 2J32A 5JRZA 2WD9A 3ZGNA 4OU4A 3L18A 4DA7A 2ZJ3A 1ZSYA 1XV5A 2C88A 3QELB 2P9HA 4M54A 3KKLA 4MVJD 3UV7A 4E94A 1JA1A 2ZUDA 3UW1A 2Z6QA 1M6WA 3Q5EA 3IJRA 5JYDA 1H23A 2YTZA 3CUEF 3RWBA 4E33A 2WJIA 2RONA 4LJAA 5A3VA 2BYTA 1UXIA 3DWEX 3ESCA 5H0IA 2IHVA 1UCFA 3U39A 3GA0A 4ZT6A 2CMFA 4URFA 4PYQA 3LT4A 4ZVQA 1GYQA 2Z56A 1U65A 1QO7A 2E2WA 1SXGA 5EPEA 3IE2A 3C6MA 1E3DA 2GD2A 3DZ8A 5H1YA 3TJZA 2B3DA 3X2FA 2Q5CA 4L5BA 4R51A 3SXJA 1QFZA 4FC6A 5HJ5A 1P2FA 3A31A 2YJ4A 4O4LA 3RYTC 2IW1A 2C97A 3WGJA 3RIHA 2POQX 1OX6A 2CXUA 4DLTA 2VSXA 2IHUA 2AJDA 2OXRA 5CK5A 4I19A 3WYBA 2Y1DA 3FOBA 2PQ2A 3FR7A 4A27A 1V95A 1NG9A 2H4FA 2O8CB 5FUQA 5ITSA 3T8YA 3T9DA 2FG6C 4HTAA 1LF0A 3PQFA 4BYGA 1X7YB 2PVPA 4IQ8A 3SD7A 4OKIA 3RT9A 1UFOA 3SVZA 4B4KA 4EL5A 3ZCPA 1KRXA 3N53A 5LQDA 1AKQA 1DG9A 4ER0A 2GKOA 3HCBA 1XZLA 1R0WA 4Z4QA 3JAWA 3FB4A 2ID8A 3NCTA 3D81A 5IZCA 3O74A 1E6UA 5FAKA 5AKJA 4Z53A 2IZ6A 3VR3D 2F62A 3KHUA 5B7NA 4GRIA 4RV9A 2I2CA 3G7UA 4M8SA 2O1EA 3EIEA 1G21B 1WO8A 3SSAA 3JWJA 2C95A 3E9MA 3WHPA 4K2HA 4ZZ3A 4YFYA 4G8JA 5C9ZA 2ODWA 2X5JO 3K9BA 1AQLA 4L0DA 4IEIA 1G41A 3MMSA 3R09A 3P19A 1QP8A 1S96A 1IATA 2FF7A 2E87A 1G4HA 5KWSA 3B3QA 5A3JA 3ESQA 3U7FB 4P2GA 2GCPA 2YL2A 4EL0A 2PSFA 1GGFA 1VGVA 2H9IA 4DE5A 1BW9B 2OL4A 3KZKA 5JFOA 3LCRA 3OOEA 3KLNA 5KCZA 4LVOA 2XITA 4HUJA 5DM2A 4WZAE 5LU8A 1I33A 4ZI3A 1V16A 2XQJA 3REOA 2WZQA 3HV0A 3IRVA 3TZQA 5KKCA 4KE7A 3C14C 1GZ7A 1USWA 4IHAA 2W5UA 4M0LA 4WDRA 4AJ9A 4N48A 3QBEA 4QOFA 2XMCA 3MUEA 4G25A 3QOFA 4TYMA 3GWGA 1C8KA 3KVOA 1GU0A 2IPNA 5LDDC 3GVXA 3P0FA 2F4NA 4L4UA 2KWIA 4PZDA 4X1YB 3N2YA 2O8FA 1RNLA 3LBFA 2BMFA 4I50F 5EUCA 1DXYA 2OZLB 2EX1A 4JL5A 4RCYA 3W5VA 1HE5A 3L7AA 3WE7A 1IUPA 3S99A 5DK4A 4F6LA 4IHQA 1AQNA 4NJMA 1ZM4A 3BIJA 1A50B 5KQGA 2GS9A 4HDSA 2ZWVA 1NI3A 5K3BA 3DVRX 4HVAA 4DLWA 1Q95A 4US1R 1A97A 2DERA 2CFOA 1RTTA 4H7KA 4UBLA 3KHSA 4A16A 2ZIVB 4JI2B 1AKRA 1BE6A 2OAP1 4HX2A 3T9EA 3VSAA 2QZ9A 1M34E 4CKCB 2R8XA 4WL0A 5FLEX 3QF7A 1F0PA 2JEZA 4BPBA 1K98A 1QO0D 4ZO6A 1YJ8A 3OTQA 1U31A 4L6AA 3U1TA 3PDWA 3ZGXA 4HVTA 4EG0A 1JLMA 1N2CB 1Y1QA 2M98A 3LUPA 5B30A 4U9HS 1P2TA 1GNPA 1T0UA 5KX5A 1ZOIA 5JMPA 3DTVA 3AY7A 3SKYA 4F7DA 2G40A 4NULA 1SOVA 4XDGA 1IAQA 4Y6SA 4YDHB 3W6OA 3FAZA 3PYLA 1GLVA 4FCWA 5CA1A 3ZW7A 2RKOA 1O57A 4K88A 2UVQA 4ZRDA 3GVPA 3OG9A 4IVRA 3D4NA 4BMXA 1RP7A 2DTXA 2UYQA 4BX3A 1GY8A 3H2JA 4LUCA 3IIMA 5D5QA 1CW2B 1QFYA 1QFJA 3PGVA 4I3HA 3AOGA 4YT4A 1EJ2A 2BE7A 2WW8A 2ZPTX 5JXHA 4BB9A 5I3ZA 2GEUA 2Q5FA 3AR3A 1FVFA 3BTUA 4WFJA 4N49A 4XIJA 5REQB 5E9QA 3LXXA 2XYHA 1LSUA 1XZEA 1SY7A 2ZT7A 3QNMA 1QV6A 4J16C 4IKPA 5EHGA 3PXXA 4J1QA 5HR5A 4EGJA 4HZUB 4KQ6A 4TVKA 1N36B 1F9AA 3BK2A 1DRVA 2VQDA 1OGIA 1MGPA 2VQ3A 4NX2A 4FSDA 3IBGA 2XJ4A 5CB4B 2GZSA 2R86A 4U7TB 3E1KA 3LT1A 4FKBA 2QI9F 4EYGA 2MYTA 4ISCA 4WADA 1YR9A 3JQBC 4EJMA 4B81A 1WBBA 1UAAA 1XZ8A 2VP0A 4YMUA 3I5XA 5G1PA 4C4AA 3AW8A 3CX3A 4WIAA 2H0QA 4OHCA 4YT5A 4EPYA 1K8YB 1F7VA 4RK6A 1Z4KA 4I14A 4KOAA 3MWKA 1FDRA 2JJ1D 2N9UA 2QYHA 1T4DA 3IT3A 3R77A 4K6CA 3RJ5A 3D6NB 4OQYA 4KFCA 4UBIA 5IXSA 1GD1O 3R5TA 1M67A 4U63A 2R751 1KAOA 2QN2A 5HQ3A 1CDOA 3F6BX 4UMFA 1J1UA 1XMXA 2AFIE 1SHUX 4MH0R 4FDUA 4XVCA 4DR6B 3DEJA 4DBLC 1A95A 3JATA 4GXRA 2YBDA 2GASA 2J33A 1DKMA 4YAJA 3Q8XB 1HTBA 1P1RA 2GZDA 3QBVA 4TGLA 3EVCA 1JDPA 3K20A 2E3JA 1WQ3A 2W6NA 2F3UA 4UVEA 1JS1X 2OTCA 4PRZA 3ZD7A 4FGUA 3DAYA 4AURA 3V4ZA 3Q72A 3Q5DA 1RJGA 3E3OA 1L5SA 3D5TA 4HVLA 6Q21A 2C2KA 1DUVG 1RU3A 3H99A 5HCNA 3NNSA 4DREA 3OPXA 2ODTX 5DKFA 2O2HA 1PZEA 2R1VB 5JAHA 1NRIA 2W6OA 1JLRA 3NKFA 4GUDA 3V2IA 1BFUA 3AVTA 3DMGA 4RIEA 4PGHA 3GRCA 4JVMA 5ULLA 1PQPA 2PTGA 2QL7A 3P9XA 5A1TA 1A77A 1YHNA 4O2AB 5FOTA 1OLSA 4HYEA 4BNUA 4B87A 1JHMA 3LLSA 2B7BA 3ENWA 2QGZA 3IKVA 5KNDD 2Y1EA 4IICA 3G0DA 3PQ6A 4YJ3A 4DYHA 4Y8VA 1JJBA 2RMKA 1OBOA 1P6UA 3OA0A 3S70A 5IKXA 2VJAA 1Z0ZA 2IUFA 1OGYA 4IGEA 5LUBA 3V34A 2WAXA 3EISA 4UFPA 1A9XA 1Z8HA 2V65A 4BVJA 3CZMA 2XNHA 3D7SA 3GNQA 1HOXA 2Y1KA 1L5GB 4EGQA 3ZQ6A 2XAAA 4GWLA 4ZU1X 1MXFA 3H4MA 3NHZA 3FDJA 2Z8YM 3L4KA 1QMPA 1ZEMA 3ZHSA 1M5RA 1IBCA 1ZH8A 2ZAOA 3Q3EA 2GPYA 1RYMA 4RS4A 2HRQA 2A84A 2XYQA 5T4BA 3THSA 2IP1A 4KQGA 1BEZA 3PQ2A 4DBVO 2GJKA 1P0QA 2IYWA 3DZIA 1MMFB 4AMBA 4EX7A 2EX4A 5EJ6A 4DR3B 5IU6A 2JRLA 4MGEA 3U9LA 1RLIA 4KIUA 1UM8A 2FI1A 5I5EA 1GSOA 2EJTA 1U0RA 3R5SA 4B48A 2E7ZA 4KMSA 5LD2C 3LS2A 2IKSA 1I1QB 3B1JA 3D7RA 3TTXA 2JKVA 2I3ZA 4EDFA 2JI6A 4F4IA 5I4KA 4NG5A 1QZTA 4EKDA 3RC9A 4BZWA 2JHPA 1PK8A 2LPMA 4YJ2F 1XJCA 2WKPA 1M2OA 4FYWA 3STTA 4ZMRA 1JEQB 1RQNA 1BO6A 3A9UA 3FX2A 1ZCBA 3JWEA 5YASA 2QQEA 4XD7A 3ZE1B 4OQPA 3ZV7A 4J2OA 1NTOA 1EZ1A 1QQTA 5KYVA 4Y30A 2XTZA 4RIHA 3X43A 4ARZA 3R0QA 4IEFB 2BM8A 2JKYA 1CUSA 5BSUA 3M6MD 1H2YA 5MFZA 4F97A 3JASB 1A88A 2C57A 2Q5IA 3FSRA 1G0NA 2XYRA 1EFPB 3C41J 1NXWA 3NANA 1BMDA 4L74A 4QRIA 4ZANA 1KEKA 5BVHB 1IWBB 1BA3A 2TSYB 3HXPA 5HA5A 2BGIA 1SU8A 4C3VA 1HE3A 4E5KA 3T12A 5B7QA 2IODA 4WXPA 3KTAA 1PJTA 5DZSA 2XUQA 1UBCA 1AZLA 3C98A 1YDHA 2HXSA 2G9UA 2QHXA 4BLPA 1T8YA 1YRBA 2TRSB 4H3SA 4ICIA 4PVDA 5FTJA 3SVTA 4GLLA 3WBFA 3V8MA 3AV0B 4LW8A 5HBGA 1T5TA 4TWJA 4TL6A