1I3KA

Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
347
structure length
347
Chain Sequence
b'AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAMGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNVVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-GLUCOSE 4-EPIMERASE
publication title Molecular basis for severe epimerase deficiency galactosemia. X-ray structure of the human V94m-substituted UDP-galactose 4-epimerase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 127
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1i3kA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1i3kA01
1X15A 1GTMA 3STHA 4Q39A 5IXSA 1NXQA 2P4HX 4IMPA 2DFDA 5FFFA 4D3FA 3PQFA 3EC7A 4H7PA 4FS3A 4KDEA 1PX0A 3FBTA 5G0SA 1U5AA 5CEJA 4CM1A 3E82A 1ADBA 2PD6A 3O03A 1E3EA 4I9UA 3WLEA 4LCJA 4NK5A 2ZCUA 4KZPA 2YZ7A 3ZZNA 3TZCA 5AXCA 1GCOA 1KYQA 4BNKA 1PGJA 3X2EA 2I6TA 1ZCJA 3ZWBA 5C5IA 3COSA 3DAPA 2C7GA 1PSDA 3AUSA 4WPGA 3KB6A 1OOEA 1I32A 4FGWA 4I5EA 2OL4A 1VE9A 1GUZA 5JDIA 3PWZA 1GEGA 1KEPA 2QYTA 1HLPA 3F3SA 3GGOA 3DAGA 1ZEMA 4W7IA 5IDYA 3DB2A 2DQ4A 3RU9A 5K6AC 1E7YA 1R4NB 3ZV3A 1HDXA 3OJ0A 5TJHA 5TIIA 4JBGA 4U6QA 3LDHA 4PG5A 4G2NA 2WD7B 4KMSA 3HFSA 2QRLA 4BKQA 1RYDA 3OQBA 2Q2WA 4U5QA 1P74A 1PJTA 2V6BA 5EINA 3H5AA 1ZMOA 4M54A 7MDHA 4QX6A 4WOKA 4CM7A 1YH3A 5U1PA 3RCBA 4J7XA 1KC1A 3GNSA 1IOLA 1VJTA 4B7CA 2EHDA 1CEQA 2Z95A 3C85A 3VDRA 4WLVA 3RROA 3GAZA 2P5UA 3LYLA 4MIEA 4ALIA 2PV7A 1YO6A 2JD0A 2W2KB 3F1LA 5HS6A 2D3TA 5G0TA 4A26A 1SEPA 3INRA 4TRNA 3KV3O 4CQLB 3HNPA 2GZ2A 2CDCA 1E3JA 2RCYA 3DOCA 5F3RA 3WB9A 1E1MA 5IJZA 2ZJ0A 5JAQA 1CYDA 3DMTC 3JYOA 4EI2A 5JC8A 4LMRA 2AQIA 1YRLA 3ON5A 4GL4A 4DUPA 1SB9A 2RHRA 1QYCA 1Y1PA 3BMQA 1WNTA 3FRJA 4TZTA 2Z1NA 3CH6A 4GKVA 1BXZA 4Q3EA 3K8ZA 3ZN2A 2YFQA 2ZB8A 5GZ6A 1EE9A 5GZ3A 2EV9A 4IPTA 1Y8RA 2QHXA 3NTRA 4M8SA 1F8GA 4TWRA 4BNUA 2C59A 3HADA 4WK6A 3JYPA 4HWKA 1EDZA 4E13A 2FY8A 3UOGA 5A02A 1A4IA 4FGSA 3QV1A 1RM0A 3WGYA 4E0BA 4HNHA 1UZMA 4TVBA 4BNHA 1NP3A 2PZKA 2Q45A 3E48A 3TPCA 4IGEA 4BGEA 4CMKA 4G65A 5L4SA 4GAEA 4A2CA 1AE1A 1BDMA 1J49A 4GVLA 3DBLB 1AHIA 4E2ZA 3K30A 3MJCA 4MKXA 5IDQA 1E6WA 1EVYA 3KM0A 1X1EA 2FZEA 1I3MA 4WNCA 3VHRA 4IXTA 4E5NA 1YL7A 4MKRA 5LDHA 1G6KA 1S7CA 3WBFA 2EEZA 2E82A 3S2IA 3BMOB 9LDBA 3FNHA 2QYSA 2XPCA 1U8FO 3ROPA 5KVVA 4BV8A 3O8QA 1A5ZA 1ENPA 1X7GA 4FJ1A 4JCOA 3X2FA 4DIBA 5A3JA 1VPDA 1B7GO 1N92A 1EVIA 1ZO8A 4ZRNA 4YYZA 1IZ0A 4TKMA 4GSLA 4XGNA 4AJPA 3PIIA 1LC3A 3AK4A 1NQOA 3AU9A 1U3VA 4RF5A 5C7OO 3FF4A 2CD9A 4J7CA 4GLOA 1PWXA 2BGLA 5IAAA 3H6KA 5K9ZA 2PH5A 3V5NA 3GMDA 2I66A 2UUPA 4ZICA 4HXYA 3EY4A 3Q6IA 3TL3A 3OJLA 4NHEA 5CDUA 2O3QA 4RPGA 3QVSA 2FHSA 5L3ZA 3L4BC 1GV0A 3ANNA 3BTUA 1C1XA 4DTIA 2VUSA 4E5PA 3F9IA 3EMKA 4GPD1 3ZH2A 3OSUA 4JBIA 3KYCA 4OKNA 3WXBA 4E2WA 2JHFA 4O59O 3B20A 3DHNA 4JNKA 4NU6A 5EESA 1DIBA 5EQDA 1DEHA 3FHLA 1DFHA 3QQPA 1K0UA 3QWHA 2UVDA 4UUNA 2EF1A 2IZZA 1KETA 5JNLA 3I23A 4CMJA 2JCXA 4QSMA 2EKPA 1Q7CA 3KOUA 1I36A 4OOFA 3UVEA 3H5NA 1VJ0A 2FPPA 4DWVA 5COBA 1XLTA 1AGNA 1UXKA 3DO5A 4RL6A 3R0IA 1O95A 4OXNA 1PL6A 4JQCA 3UFXA 1XA0A 3HDYA 1A9ZA 3H2SA 3R1IA 1LDEA 3ANMA 3H3FA 3QE3A 4WKGA 3HFGA 3ICPA 1VRWA 4QQRA 1O0SA 4RV9A 5DCYA 5THKA 5DBIA 5BNFA 4O1MA 2WE8A 3ENNA 3P5SA 2P9GA 4CLHA 3RC2A 1V8BA 4OHUA 1T2DA 3E6AA 3FN4A 4XA8A 1U2GA 5G2OA 5ER9A 3F5QA 3QVXA 3K73O 4NBRA 3IUSA 5C7IO 4WJZA 2VOJA 1IE3A 2B69A 3CMCO 3Q9NA 3WDSA 4D41A 5FI3A 3IP1A 3SVTA 2H9IA 1OMOA 4EEZA 4DC0A 3DMTA 1RWBA 3RQSA 2EERA 1GCUA 1NVGA 2RH4A 4UEOA 5B37A 4IIVA 1HE3A 4Z9FA 1EBUA 4R41A 4GGPA 1M76A 1PGQA 3MEQA 2DPGA 2NU9A 3IAHA 2AQKA 3FBGA 3GHYA 3PZRA 4WEQA 3SC4A 4NG5A 2UYYA 5KNLA 1EVJA 1OAAA 2D4AA 4RZHA 3AOEC 5IN4A 2P68A 1X7HA 1PIWA 4LRTB 1LDBA 2VOEA 4OGWA 2W2LA 3K31A 1HETA 1MFPA 2G0TA 4L8VA 1JLLA 4JLWA 1EMDA 1GAEO 2CVZA 2G82A 2JAHA 4NJMB 2PKQP 2J3JA 2PA3A 4DPMA 4XQEA 2A92A 3WIEA 1PJLA 3E5RA 3HN2A 2OZPA 3BA1A 1XQ1A 3JQAB 1E5LA 4ZGWA 5HTOA 2Q2VA 1FJHA 4CM5A 4LRSB 5JPIA 4QTZA 1VKNA 3ZV5A 1UZNA 2FSSA 1E1LA 2VHXA 3GPIA 4XWYA 1H9AA 4TROA 3WYCA 3RD5A 2Z5LA 2HU2A 3C7AA 4P4GA 4HBGA 1Y8QA 2P5YA 2ZTUA 3DWFA 3K6JA 3AFMA 3L07A 5JC1A 2X4GA 4PRLA 2IE0A 3INGA 2DTXA 1UH5A 1MXHA 2FR1A 2Y99A 3VH3A 3VAZA 1V3UA 2JJYA 2BI7A 1HTBA 2DBRA 1XCBA 3I9KA 1LDNA 1PL7A 4IDEA 3GEGA 4O5OA 1GFSA 3AWDA 1BMDA 1H6DA 4PG7A 3D3WA 3DONA 1F12A 1XG5A 1P44A 2HMTA 1WPQA 2FR0A 2Q50A 4GX1A 4BO3A 3GF4A 4MP8A 2JAPA 3OEWA 2GNAA 4DLAA 3UW3A 2NTVA 1RM4A 4UUMA 2CDBA 4YB8A 3SEFA 3JQFA 4E32A 1BGVA 1SOVA 3LF1A 1X14A 4NDNE 3DAFA 3EZLA 1Q1NA 3L4BA 3RWBA 1CF2O 4GMGA 3EGOA 3E5MA 2J5QA 1XELA 2Q1TA 5TJ9A 3IJPA 1EQ2A 5MGBA 5KJCA 4XDZA 1GZ4A 3VVCA 1P1HA 2FPIA 1NAHA 4CV3A 3KO8A 2OBNA 4Q3DA 3GN2A 1PJQA 3ZV6A 3GRKA 3U4CA 3F5SA 1EUZA 2BLLA 1QYVA 1L7EA 4RF3A 3I9OA 3JQBC 3TZKA 3F1KA 4MP3A 4KWIA 1MUUA 1NPDA 4HUJA 3B70A 3K96A 1UXHA 3BZUA 1YL6A 1DSSG 5BSEA 4B8ZA 4YJDA 4XDYA 3QSGA 1YGYA 1LA2A 5KVSA 1LLUA 4GQAA 3S55A 4CQMD 2Y68A 4NFSA 2FZWA 4IGFA 2AA3A 3RC1A 4UULA 4ALMA 3FR7A 2HSDA 3AJRA 4ZVVA 3D4PA 1MG0A 1E6UA 2OO5A 4CLRB 5F1OA 3OF2A 4FC7A 1N9GB 3RUAA 5TF4A 4GWKA 5TC4A 2Y0EA 2FWMX 1UP4A 3CE6A 2AEJA 1G1AA 1TB4A 3GDFA 3I3OA 4ND5A 1NVMB 1JDJA 3O38A 3P2OA 4CLXA 3N7UA 4M86A 3MOIA 2VHVA 1E0DA 1ZKMA 3KXDA 1Z73A 3TOZA 4CM4A 2GN8A 4P8RA 1LLDA 4ZQGA 1R15A 1N2SA 5JMWA 1KBZA 1KY4A 4AJJA 3WNQA 4DL9A 4B8WA 4CLOB 1JKFA 2CDAA 1ISIA 1V9LA 4WCFB 3GVHA 2GRAA 4XQCA 1H6AA 3RKRA 1U7TA 4PLWA 5ITWA 4MVJP 3PZBA 3A9WA 2QZZA 4E5KA 4NH4A 3ZU3A 1EFLA 4A03A 3NT4A 2VZ8A 4F6CA 4HFNA 3AOEA 1E6EA 1UDBA 2UAGA 4J1TA 1P1JA 3VH1A 4JROA 5KCZA 1UZLA 3ZNQA 2C0CA 4CMAA 4ND3A 1XU7A 3ASUA 1WVGA 3ETDA 3IOYA 3GVIA 5JW6A 3UKOA 2Q1UA 3CZRA 1A27A 1TI7A 3PPIA 2O2YA 4FN4A 4QUKA 2CSUA 2C20A 2ZB3A 3AY7A 3DQPA 4J1NA 1GEEA 1QKIA 3B1FA 3G79A 3JYQA 3ORFA 5JDCA 3A28A 3P7MA 4LMPA 2IODA 3IP3A 2VN8A 4R9RA 3T4EA 4FR5A 1ZSVA 2CY0A 2X5KO 3AM4A 3PJDA 2GUGA 3PQDA 4BMNA 2OHXA 4WOJA 4JN6B 5JCJA 1ZEJA 2RIRA 4NFHA 1JKIA 2C2XA 4WLEA 4S3MA 2CUKA 4YT8A 1GV1A 4D44A 4E21A 4K26A 3TFOA 1DLJA 1KY5A 1I3LA 5G0WA 3BMNB 4MO2A 1VJ1A 1YB5A 2PGDA 4FFOA 4KUGA 3RVDA 1C0LA 1V3TA 4DIFA 3E9NA 1SPXA 1ZXBA 4Q3CA 2AW5A 4CV1A 1NPTO 1JN0A 1F8FA 3LT4A 1R66A 2Q1SA 5CDTA 1U4SA 3RJ5A 2DAPA 5DN9A 3QA9A 4DPKA 5IDWA 3OHSX 2X22A 3JQDA 1PJ2A 3OA2A 4CMCA 2YHIB 1HDOA 1M75A 4B7UA 1MX3A 3C1AA 3SJ7A 1I8TA 3DZJA 1JTVA 2D5AA 4Z3DA 3SLKA 4FIZA 3ASVA 2WSBA 1LLCA 1E3LA 4L4XA 4J1QA 4PLTA 4XCVA 1DAPA 3ZWWA 3ADOA 1ZBQA 3NGXA 3BTSA 4J7UA 1Z7EA 1ZJZA 3A4VA 1EE2A 5FF9A 5A9TA 3KYBA 4CMIB 2O2SA 1BW9B 3JQBA 4Y6PA 2BMAA 5DP2A 1LXCA 1L1FA 1V3VA 2B35A 1IPEA 4CQMA 1YONA 2V7PA 3GAFA 4R5HA 5HA5A 4CM8A 4D0RA 5B12A 5CFZA 4S1VA 4GI2A 6ADHA 4XGIA 3OJOA 4YXFA 1BHSA 2WD7A 1IULA 1ISMA 4W7HA 4J4BA 1W6UA 4FFLA 4PN3A 3S2EA 4QEDA 4XYLA 1UDAA 2NU6A 2VWPA 1KIFA 2PFGA 2ZIZA 4WE3A 2EW2A 5IDXA 3RSHA 3U4HA 2NVUB 5CHEA 1PJ3A 1YJQA 3DTTA 2DC1A 1LDYA 4F3YA 3L6EA 4KOAA 4EBFA 2AQ8A 2PD3A 1VLLA 1ZUD1 3AW9A 1MA0A 1I24A 4CJXA 3UGKA 2IRWA 4OYRA 3WS7A 3KYDA 3GMSA 4PG4A 4CQLA 2HMSA 2YFHA 2V65A 3L9XA 4GKBA 2W90A 4IZHA 1E5QA 2Y93A 1WZIA 3GH3A 1GDHA 4LK3A 1T2EA 3C1OA 4Y98A 2EW8A 4AJLA 2JFGA 4OJNA 3HB5X 1BVRA 3WWYA 2P4QA 3VPXA 3RUFA 1YKFA 2ZB4A 1BTOA 3JQ9C 3NGLA 4W99A 5F5LA 3D3EA 3RC9A 4BO2A 1O94A 1ZZEA 7ADHA 4BNNA 1UXJA 4M87A 4UVIA 4D3DA 1ARZA 3LK7A 4NPCA 1HEUA 3GVPA 3I83A 3MCVA 1LSJA 3GQVA 5LCXA 2Q46A 1TA4A 3PJEA 4WUVA 4UEJA 3OIGA 4QT0A 5H83A 4K6FA 1L7DA 3UAGA 2GO1A 5BT9A 1C0KA 2D8AA 2DVMA 3BHJA 2VWQA 2VT3A 5DBGA 3ONFA 3F46A 2W4QA 1V0JA 5AOVA 3FNEA 4GGOA 5G0UA 4BKOA 4P4NA 1PWZA 4TRRA 4EEXA 5IFLA 3HE3A 4DC1A 1ISGA 1W0CA 1WAMA 3BXXA 3RBVA 1PS8A 1YBMA 3LT0A 5U9CA 1JWAB 2EKLA 1HDZA 1P1FA 2BGKA 3GC6A 4UVHA 2R00C 4L73A 1R0KA 2B36A 2NTNA 4ZRMA 5IN5A 1P3DA 3Q0EA 5F21A 8ADHA 3NJ8A 3EUWA 3OIFA 3HN7A 4QFCA 1SAYA 3NX4A 3WFJA 2X0IA 1LSSA 4YRAA 5BSHA 3DC2A 4CL3A 3DZFA 4RVSA 1Q0LA 3GFGA 4Z0PA 1YDWA 1FDWA 4A5OA 4JP2A 3L4SO 1ULUA 2PKQO 4FFMA 5B4UA 2X0NA 1LU9A 1A7KA 5AQ1A 4BB5A 2C5EA 3U9LA 1IL0A 5A1TA 5TS3A 2VRBA 2CFCA 2Y1OA 4JJFA 4DYVA 4BO0A 1HWYA 3B1JA 3EVNA 3WJ7A 5GY7A 4E6PA 3WYEA 3ZWPA 2BFPA 2NLOA 1GZ3A 4BKPA 3PHLA 1U3WA 1UP7A 1SNYA 2Z1MA 2UUOA 2DT5A 2GCGA 4YWJA 3QP9A 1K6XA 2J3HA 4CMEC 5BQFA 3ZNNA 3OQ1A 4BO6A 2GERA 4CR6A 3I6QA 3V1UA 1PL8A 3PGXA 2X1HA 1EVZA 4HP8A 1M2WA 1TT5B 3Q2IA 3E03A 1ZK4A 4AVYA 1D8AA 1PJSA 3DBHA 1U28A 1WP4A 2GASA 4UVEA 4YAEA 4CM9A 4CLEA 2YYYA 4ZU3A 4NK4A 4Z3KA 1T1RA 3H9UA 4E12A 1X13A 1LX6A 1XDWA 3EAGA 5L40A 5KJ6A 5L4LA 3S8MA 4OL9A 3ITDA 3CKYA 1KC3A 3HDHA 4BO1A 4HNGA 4YAGA 4KQWA 2ZTLA 2LDXA 3JQ7B 4PLYA 1T1SA 1K6IA 4Q3AA 3WFIA 2NTJA 3W4IA 3ZWNA 4CV2A 3HQ4O 1DHRA 4NR0A 4BMVA 3WQQA 2OBYA 5T5QA 2JFFA 3OETA 2W2LD 3WSVA 2WEKA 3I1JA 2I5PO 4PLVA 1HL3A 5CG2A 1H6CA 4IQGA 3JQ9A 3ZW8A 3WTBA 4EITA 1U9JA 2PK3A 3JYLA 4D42A 1AUPA 3QWFA 3OJFA 1CQJA 4AJEA 5I9NA 1B15A 2C7VA 3EW7A 3K5PA 4BOYA 3DHEA 5KVQA 2WTBA 1RPNA 4GX2A 1TEHA 1HDGO 1DC6A 1P77A 5CEFA 1DRWA 3JD0A 1W73A 1XEAA 2NU8A 3V2GA 3CTMA 2W98A 1DHTA 2Q1WA 2EP7A 4AFNA 1EZ4A 4YVFA 1GY8A 5I9MA 5EMHA 2NU7A 5I7EA 1YQDA 2W8ZA 3K92A 4URFA 4CL8A 3QLJA 3LF2A 3VDQA 1LSUA 5JAMA 1C3VA 1ZIDA 2EXXA 3TQHA 2CMDA 2GR9A 1CERA 2AXQA 2HK8A 3C7DB 3JCZA 1ONPA 4A10A 1DLIA 4IDCA 2Y1CA 4XQGA 5KKAA 2EWMA 4R54A 1M66A 3PWKA 1VKOA 2R00A 2X58A 2O7QA 3GPDG 2DUWA 4DMLA 2CF6A 2I67A 4XKJA 2QRKA 2O4CA 1QR6A 4MPDA 2NUAA 3JQFC 2FMUA 1TLTA 2B4TO 2IYOA 2NNLD 1CQIA 3ZDFA 2Y0DA 2WD8A 3PLRA 1F14A 3R3SA 4U0JA 2NADA 3RJ9A 4R1SA 1DIGA 5MDHA 4MVJA 3RUIA 3VTZA 3RBZA 4FW8A 3JD2A 2JD1A 5GMOA 3GNTA 4H16A 2O3UA 4N54A 1F0YA 1WWKA 2R2GA 3C24A 1X7DA 4FFNA 1Z74A 4XB2A 5TQVA 4W9NA 1ZK0A 1BXGB 3AUTA 4BO4A 9LDTA 4AJHA 2E6UX 3A1NA 1KEWA 1KVTA 1LI4A 4RF2A 2Q4EA 4INAA 4Y8VA 2X0JA 4PZEA 2VHYA 2I3AA 2CNBA 1J0XO 3ZV4A 1EQUA 1RM3A 1DRVA 2O3RA 4OQZA 1OFGA 3JQGB 3GZNB 4KUHA 1HF3A 2R6JA 3UF0A 2RBEA 4YPOA 2C5AA 1XSEA 1GPJA 4OSPA 2A4KA 2X9GA 4H15A 4KUEA 1OC4A 1P45A 4B3HA 1MG5A 3O4RA 1HDYA 3OIDA 4U0KA 1C14A 5HBRA 1PJ4A 1EEHA 4CMEA 4XYMA 1B3RA 1E3IA 1LQUA 3CIFA 4FDAA 4IDGA 4A0SA 1LSOA 2ZTVA 1Z75A 2ZQYA 3JD4A 4MVJE 4P22A 2NVBA 2H1SA 2VNAA 4YQYA 2NV6A 4FQ8A 1I2CA 3ZWOA 1I3KA 4RO0A 1R0SA 1XIVA 1Z6ZA 2ZB7A 1H9BA 1M6HA 1E3WA 4BNWA 3GA0A 5L53A 4RPKA 3ZWXA 3NTQA 4RVUA 3HG7A 2OORA 1MB4A 4XIJA 5DDIP 1NHWA 2GF2A 2YDXA 3GEDA 3ZI0A 2XOXA 4AJIA 4YTEA 1SCUA 5TT0A 2JFHA 4WASA 3VTFA 3OM9A 2PD4A 1ZK2A 4YAIA 4BNYA 1VL8A 3PQEA 2ZYGA 1N7GA 3QVOA 4BNMA 2X5JO 4LVCA 1D1TA 1IUKA 3KSDO 5I7FA 4LISA 2FN7A 2IYPA 5EQFA 1NR1A 1Y8RB 4R9SA 2ZATA 1JQBA 3BHIA 4YACA 3CZMA 3ZWAA 4PLHA 3SBOA 4GLLA 3GUCA 1DJQA 5G0VA 4NZ9A 5EIOA 1GZ6A 2HQ1A 1SZJG 4RVDA 4IINA 1A71A 4CLOA 2A94A 1PR3A 3DL2A 4WCFA 4BNLA 3FSRA 5TNXA 3PGJA 3VZPA 1T2CA 3JV7A 4MKZA 1Y5RA 4DLBA 4RORA 4JBHA 5JDCC 3ST7A 1UP6A 1YJ8A 3E8XA 4DQUA 2XAAA 3LT1A 3GVCA 1DRUA 2YV2A 5TX7A 4ALKA 2HDHA 5DCWA 4BMSA 4DREA 4AJ4A 5L4NA 3TRIA 3KLPX 4J3FA 3V1TC 2Y1FA 3Q9UA 3RUHA 4D79A 1SO8A 4LW8A 4J49A 2PY6A 5JCJD 1XHLA 4B4WA 2XXJA 3BYZA 4AL4A 1FF9A 2GD1O 3W8EA 2HMUA 5EPOA 1KS9A 1GYRA 1ULSA 5A05A 5LDGA 4RPHA 5DZSA 5A9SB 4PLGA 4BO5A 4A7PA 3IDSA 4ZQBA 5JBIA 3RFTA 3CINA 2I9PA 4F46A 3DZGA 4OXYA 1YB4A 3AI1A 3DEYX 3OEYA 4YQZA 3PHJA 4I5GA 1NQTA 3IC5A 4EUFA 4WLUA 1QMGA 3L6OO 1M6WA 4HX5A 4CUKA 2Y1GA 5IF3A 3NTOA 2B37A 3BMNA 3FPLA 3BTVA 4B4UA 4R5MA 1G0OA 1HE4A 3WGGA 1W8DA 1JVSA 3W8DA 3QY9A 3ZWVA 1LRKA 3AU8A 3E1KA 4OKIA 5H82A 3BHMA 4I5DA 3I9MA 4XX0A 3TZ6A 4D3SA 3H2ZA 4TVOA 4TKLA 1B2LA 4WLFA 1NYTA 5A03A 1MFZA 3E18A 2YHUA 1VSUA 2D1YA 4YEDA 4BUCA 1ZK1A 2IXAA 4FD3A 4EUHA 4UUPA 4K28A 5AXBA 3ZU4A 5ENVA 5CPBA 1WMAA 5JS6A 3IUPA 1GADO 2NQTA 2X6TA 3QWIA 1WW8A 5I7VA 3N74A 4PRKA 3ZU2A 1R12A 3NDJA 2PTGA 3G3EA 4OMUA 4NNJA 4PIVA 2G17A 4LVUA 4WEOA 1O89A 3IL2A 2FOIA 4B4VA 1FDSA 1I3NA 3KSUA 5BNIA 1UR5A 4YRDA 1MXFA 1Z82A 1X1TA 1HDCA 3I9NA 1BW9A 4Z9YA 1P33A 4XQ9A 3ZCXA 3GEMA 5TSDA 1IPFA 2AHRA 4O6VA 2YW9A 1HE5A 3N58A 1DIRA 4NBVA 4CMHA 1PJBA 4Q9NA 5DNAA 1LEHA 1PS0A 1UJMA 3PHGA 4J4TA 2VYNA 2GSDA 1GQ2A 3A06A 4BS9A 5FWNA 1PGPA 3PK0A 4J1SA 5L7YA 1NM5A 3VH2A 1VSVA 3DDNA 2ZTMA 3MWDB 1T26A 4ZQHA 4DVJA 1O8CA 5TLSA 3W6ZA 4LCEA 4EYEA 3INTA 1DDOA 1YB1A 1QSGA 4XR4A 4R68A 4J90A 5EERA 1ADGA 4RDHA 4UVDA 3DTYA 1HDRA 2NVUA 3LVFO 2PWZA 4XIYA 3UUWA 3RFXA 1J6UA 4YJHB 5JSFA 4RVFA 3LQFA 3UN1A 4ND2A 1LNQA 3DXFA 4CV0A 3GUYA 1DFGA 2VYVA 3DZHA 3G1TA 3O9ZA 4PLZA 1OBFO 2BD0A 2J5RA 2Y67A 4W4TA 4Z0TA 2POQX 1R37A 1R4MB 2HRBA 3GLQA 4I8XA 1JWBB 3DBRA 3RUCA 2BKAA 2ZYAA 4FBGA 4XYEA 4R01A 3NV9A 1E7QA 1SMKA 1VL0A 2OP1A 4ALJA 3H65A 5JO9A 3QWBA 1CWUA 4BNGA 4CUJA 3PHHA 2Q3EA 3IIEA 1P1KA 1CIVA 4GH5A 1IB6A 2BI8A 3RASA 3S1LA 4E5YA 4XJSA 3GDOA 3T4XA 3WGOA 4MVJH 2HRZA 3VH4A 3ZHXA 5JAZA 4R1UA 4KTTE 2D59A 4DXHA 1I33A 2P9EA 3U49A 3QRWA 4QFDA 4DIOA 1X0VA 2VTDA 1HE2A 4MIOA 1Y9AA 3QWAA 3LU1A 2ZCVA 1Y8QB 2HJRA 3F4BA 1DC3A 3RIHA 3UXYA 1LC0A 4XGKA 2V6MA 2Y66A 1DPGA 4P38A 4WNIA 1H6BA 4L74A 2DTDA 3GHHA 3Q3CA 2O3TA 1BVUA 1C0IA 1YOVB 3OJEA 3P19A 3GG9A 2Y1DA 5ILOA 5IG2A 4HY3A 2EP5A 4IQ0A 4AJ2A 5JFOA 5KTKA 4CM3A 1NQAO 4MVJF 3D3WB 3KBOA 3QIVA 2IDZA 1GUYA 3Q11A 1GR0A 2C54A 1P31A 2DKNA 2A9FA 5JXWA 1A72A 3ETEA 2PLAA 1HYHA 2GLXA 1R0LA 4TQGA 4NJOA 4XYBA 3NRCA 1Y9EA 3OP4A 4PLPA 1DIAA 3BMCB 4R51A 2O3SA 4F6LA 4RLSA 3I52A 1SB8A 4BNXA 4LGVA 1C1DB 1B26A 5A06A 1NASA 1LQTA 4EJMA 3U4IA 3AM3A 4J9VA 4KWHA 4I5FA 1HZJA 2Y0CA 4PFJA 4BNZA 1YQXA 3GOHA 1LLQA 4E5MA 3D0OA 2J8ZA 3G49A 5KVCA 4IJVA 3OH8A 4BB6A 5CPFA 3H9EO 4PG8A 1DB3A 2AG5A 4RGBA 1LTHR 2BFAA 1GYPA 1H5QA 4QO7A 2VHZA 2VHWA 1R4NA 2PZLA 4FJ2A 3GR6A 5TGDA 3VC7A 3WTCA 1ID1A 4ZJUA 1NFQA 1W4ZA 3HSKA 4HFMA 3FR8A 4W6ZA 4BIIA 1K2WA 3W4JA 4IMRA 3NDIA 2WE7A 4MJLA 4CM9D 5DCUA 1HKUA 4CLDA 3PTZA 1NTOA 1S6YA 4CR8A 2P9CA 3KZVA 1QLJA 4F45A 4UEKA 2QZ9A 1O9BA 4II3A 1ADCA 1TT5A 5IXYA 3ZHYA 4FOSA 2EKQA 4XD2A 3WYBA 1PGNA 4OQYA 1EDOA 2IEDA 2YQ4A 4MVJM 2W2KA 1DIHA 3K2EA 3SJUA 5I7SA 1XQ6A 1GL3A 1YQGA 1U5CA 5BSFA 2JHGA 1ZSYA 4EDFA 2HK9A 2FPGA 3G1UA 4XJTA 2AQHA 5EJ2A 4UVGA 3WJAA 1D3AA 4CM4B 3MOGA 3PFWO 4I9HA 5BSGA 4L9RA 3AFNA 4D45A 4Q3NA 1PS9A 3GG2A 2E48A 2HAEA 3D4OA 2ZK7A 1UAYA 3ZHZA 5COQA 1K89A 2CVQA 2DBZA 2X0RA 3HDQA 3JQ7A 4BV9A 1LJ8A 1B16A 3CXRA 4RF4A 2JCYA 3JQCA 3ZWMA 1YBAA 2OGUA 5CG1A 1XKQA 1K6JA 1MV8A 3H9GA 4RVHA 3D4NA 1Q0QA 4A27A 5DP1A 2JL1A 5I8WA 1GYQA 5CDYA 2NVWA 1FMCA 2IEBA 2F00A 3CSDA 4CMGA 3MWEB 4NBWA 3GVXA 4ESOA 4J0EA 5ER6A 4P4LA 2VZ9A 4CM6A 4NFYA 2VWGA 3VZSA 3TF5A 3DBLA 3JQAD 4MVJG 2DTEA 3JQ8B 3DFZA 3JD3A 3PYMA 4YJGB 3NJ4A 3D64A 3DFUA 4DMMA 3KETA 1KVQA 2NSDA 1EK5A 5I8ZA 1JW9B 1Y6JA 2O3JA 4EJ0A 2D2IA 1F17A 2VT2A 3A14A 3AOGA 3D7LA 3TL2A 2DU8A 8LDHA 5C37A 3BMOA 4YCAA 5B1YA 3K2BA 1WXDA 4ZD6A 1Y81A 3W4KA 1J4AA 4G5HA 3RAJA 5IZ4A 2XXBA 4Z0HO 1KVRA 5ES3A 1FK8A 3DOJA 2RH8A 1H93A 3VVBA 3LLVA 3V2UA 4NBUA 1Q0HA 4AJKA 1NPYA 1SC6A 3P2YA 5H81A 1XGKA 4MVJD 2BGMA 3ADPA 2E37A 4J4HA 1V35A 3E9MA 4GX5A 4W9NC 4ALNA 3WQRA 4R3NA 3R3JA 1QRRA 4K1LA 1EFKA 1RYEA 4IS2A 4JP3A 4L75A 3QVWA 2D5CA 2WWRA 4DRYA 3WGQA 3U09A 4FCCA 1P1IA 1H94A 4DGSA 1HYGA 3SX2A 1KVUA 1MC4A 1PR9A 3M1AA 4AJNA 6LDHA 2I99A 3QW2A 3KHUA 1LBEA 2QW8A 2VUTA 5DBFA 5BR7A 4Y9DA 2O48X 5L9AA 3ETGA 1WDLA 3F6YA 1GUFA 3C7CB 3TWOA 4JIGA 4PGFA 1BXGA 3AUAA 4J91A 4J9UE 3UHAA 5FEUA 5CEEA 2OXIA 1ISJA 3WOHA 1E92A 1DOHA 3FNFA 4CQMB 3M1LA 3DR3A 3KEOA 1ISFA 1Q7BA 1B8UA 3H9JA 1ML3A 3JQGA 4CM8B 3GZNA 1O5IA 4DQXA 5AXAA 4BNFA 4B3IA 1O6ZA 2IZ0A 3CEAA 4HADA 4OXKA 2OMEA 1PZGA 4DQVA 4YT5A 4JGBA 3MJTA 4C7KA 1XU9A 1IZ9A 4CODB 5KJ1A 4U8GA 4B79A 5G4KB 3H7AA 4IUYA 1QYDA 3TZHA 5HRUA 1BRMA 1U8XX 3RBXA 3R6DA 3WMWA 3IKTA 1E1KA 3PFFA 3OBBA 3GY0A 4R1TA 3QHAA 4FFRA 4I08A 3UCFA 4J2OA 2QG4A 4ZQFA 3TN7A 2B4RO 3W8FA 4TSKA 3M2TA 3L6DA 2X23A 1SOWA 4OH1A 5EL0A 1NX6A 4MDHA 1YE3A 1ZJYA 3MJVA 4IM7A 4ZA2A 3KYDB 3DZKA 4ROSA 4C4OA 3F4LA 5JMPA 3VPGA 1I30A 4LN1A 3PRJA 1EK6A 2EG9A 2AEFA 2IXBA 3FI9A 3TSCA 4WCFC 2QX7A 1D7OA 3PYXA 4KP7A 3PWSA 4M89A 4U7WA 4XYGA 3WMXA 4PVDA 4IJUA 1T4BA 3L77A 4UAGA 4M49A 1AHHA 3QVTA 1RM5A 2QQ5A 1P1RA 3QJ5A 4H3VA 4DYDA 4B4OA 2YUTA 3JSAA 4QXMA 1GQYA 4G81A 2FP4A 1OI7A 5AVOA 5JY6A 5DOZA 1E7SA 1ENOA 4N5MA 4XZ3A 2G1UA 3SXPA 1BG6A 1A4UA 3TDKA 4NJMA 2PGLA 2O7SA 1FDVA 2C07A 2YJZA 1VM6A 4ND1A 3HWRA 3S2FA 3Q1LA 3JQAA 2OFPA 3I9LA 3IKVA 1AXGA 2AE1A 4BHTA 4CR7A 4C7JA 1ZXLA 1U4OA 4L76A 4FOOA 5IZCA 4JJGA 5CP8A 4JJIA 1E7WA 4Q3BA 3NEPX 2ZKLA 4M55A 3WGHA 1HLDA 4Y6RA 2G5CA 1WZEA 3JD1A 5COAA 3JQ6A 1XWFA 1OC2A 3VKUA 1I5RA 1E77A 2HKIA 4YJFB 4RDIA 4GSKA 4QO8A 3MJ4A 2ZQZA 4BNTA 2VRCA 3PLNA 1Q2XA 4ITUA 2JKVA 1F06A 5T67A 1Z7BA 4IJWA 2TMGA 1G0NA 1KERA 1PU2A 3LSYA 3NKLA 4K6CA 5A9SA 4M1QA 2VTEA 3UCXA 5JE8A 3VZRA 1NQ5A 4FPXA 3TJRA 1N8KA 5CDGA 3ICCA 4BQRA 2V6GA 2VZ0A 3G17A 5HS4A 1Z45A 4JX8A 3KRTA 1T24A 3C3XA 3WGIA 4IIUA 3M2PA 5L95A 3H9QA 5BNTA 2HMVA 2OOSA 1U1IA 2BELA 4IXWA 2Q99A 2BRUA 2C29D 1ZFNA 5ICMA 1HT0A 3RFVA 3RU7A 1ZSNA 1IY8A 2OUIA 4MVJI 2B5WA 3I4FA 3TNLA 1LRLA 1HZZA 4KTVE 2H63A 3ZWYA 4BL5A 1D1SA 1EUCA 3DOOA 3PYLA 5ADHA 1PEDA 5CDSA 4FB5A 4WLNA 2AG8A 4Y67A 3VOSA 2Q2QA 2WMDA 2NM0A 4ZHSA 3WICA 2J6IA 2X5OA 2CF5A 3NAQA 3ZGYA 1QG6A 3TZQA 4WCDA 4FSHA 3ROMA 2B0JA 2D0IA 1MLDA 1PJCA 1U2DA 5K6AA 1B0AA 3OECA 1YDEA 2GYYA 2VYND 3DBHB 5JO0A 1HSOA 4IY1A 4ONEA 1Q7GA 5F1KA 3LLSA 4CLRA 3ABIA 2VNSA 5AYVA 4D43A 1AXEA 1KEVA 3L0DA 4IDBA 1AN9A 1N9GA 4RPJA 2G76A 4N18A 4RZIA 1NWCA 2O50A 1QP8A 3PIDA 3ROKA 4RVGA 3H3JA 5A3VA 2X8LA 4PLFA 4I9NA 2QIOA 2ILTA 3V1YA 3BMQB 2BF7A 2PNFA 2X9NA 2NACA 2FR8A 4R16A 1N7HA 2P91A 1M67A 3WLFA 3HHPA 1TXGA 4IS3A 4WLOA 1HYEA 5KJFA 2VYVD 3U4DA 4RLHA 5J23A 4FC6A 4OAQA 2FRDA 2J3KA 3H8VA 5JLAA 2JD2A 1PZEA 2PZJA 2I76A 4YA6A 1TVEA 4J16A 1DC4A 4YJHA 5KWEA 5AXDA 4EJ6A 5G4LA 1NNUA 3MTJA 2ZYDA 3U62A 4X54A 4YT4A 1JU9A 3LC2O 5FYDA 2WYUA 5A4DA 3I5MA 4OIMA 4BVAA 1V6AA 1R4MA 5U4QA 4R1NA 4YT2A 3FWNA 2X86A 3OQ6A 4BO9A 4BNVA 1I0ZA 3JQEA 2NQ8A 2O23A 4YDRA 1JA9A 4MOWA 3DBVO 4Z6KA 3L9WA 5TRTA 4OO3A 4L0QA 2B83A 2YY7A 4L4SA 1DJNA 5HWSA 3KSZO 2F1KA 3O26A 4MP6A 1C0PA 2Y05A 4I1IA 5EN4A 3O8QB 1P0FA 4ND4A 1JAYA 3GGPA 3FTPA 3HUDA 2PZMA 1ONOA 2BHLA 2CZCA 3VPFA 2YQ5A 2PH3A 3NDRA 2I3GA 2AE2A 4FJ0A 5L45A 3PJGA 3GT0A 1Y5MA 2HJSA 2ET6A 4N5LA 2DM6A 1LUAA 1MP0A 2C2YA 1K3TA 5DT9A 2DPHA 1DO8A 2PKRA 2GDZA 1XR3A 4GX0A 4CUZA 4TMFA 1CDOA 1N1EA 5A9RA 1YOVA 3NYWA 1B14A 2FSVA 4ZN6A 1DBVO 3DHYA 5TT1A 2HCTA 4D46A 3H4VA 3C8MA 1PGOA 1C1XB 2VCYA 4Z9XA 3GNQA 4E31A 4NI5A 1ISHA 1QYWA 3KYCB 3BTOA 1CJCA 3K9QO 3NT2A 3WR5A 3KTDA 1NWHA 2A35A 3WX0A 1RKXA 1QLHA 3JYNA 4ILKA 5ILGA 3RUEA 1I10A 1T2AA 1BWSA 1R16A 2WJPA 5JYDA 2YHIA 4IJKA 5L51A 4II2A 3BMCA 1ENZA 1NVTA 1SBYA 2WYVA 3GK3A 5T64A 5JAIA 3DMYA 3T7EA 4BKRA 3AM5A 1C1DA 3MJSA 1NR7A 2VWHA 2X9VA 3BAZA 3PHIA 4PVCA 1JAXA 4E30A 3ONDA 3BIOA 4O0LA 1SEVA 3VPSA 4PCVA 3ENKA 4B3JA 1ZMTA 4AG3A 4PZDA 1LRJA 4YBZA 1YBVA 4TZKA 4BO8A 4E33A 4CMIA 1T2FA 3VZQA 3ZW9A 4PG6A 3OFSA 3IQDB 4OM8A 3W6UA 3ZWCA 4R4JA 3GRPA 4ID9A 3FD8A 3AI3A 1IYZA 1DC5A 3V2HA 1QV7A 1D4FA 2WM3A 3IS3A 3AY3A 1N5DA 1UDCA 2HLPA 1HXHA 2I65A 5FI5A 3IJRA 3W1VA 2GPTA 3PDJA 4XB1A 2PR2A 4RPLA 4RJTA 1DAOA 1YXMA 3AI2A 1JKJA 5LC1A 2GN9A 5JY1A 1WMBA 3PP8A 4WGGA 3RC7A 1I01A 1NHGA 1H2BA 4YAJA 1E3WB 4RCVA 4D0SA 1FDTA 5KIAA 4CMBA 4BGVA 1RJWA 5I9LA 4ZQEA 4J0FA 2HK7A 5ICSA 4XR9A 4QECA 4BGIA 1KEUA 4NQZA 5C7LO 3FPCA 1NFFA 5B4VA 3CMMA 1CETA 1E3SA 4IDFA 4XRGA 4MIYA 4JK3A 4N5NA 5DULA 3SLGA 1GPDG 2PGJA 5T8KC 1ADFA 1IHXA 2BFOA 1T4DA 2B5VA 1VL6A 3GFBA 3LC1O 4HKTA 1T25A 1ZH8A 3OMLA 4YR9A 2EJVA 4DPLA 3HB4X 4UREA 4DLLA 1ZVMA 1BSVA 1GQQA 1UXGA 2EGHA 4N7RA 2RAFA 4U6SA 2RHCA 2B4QA 1GU7A 2YV3A 1UAGA 5DOVA 3C1TA 5ITVA 5KOIA 1N1GA 3KEQA 4PZCA 1MC5A 5A04A 3PI7A 3U5TA 2C82A 3PXXA 4E3ZA 5JCXA 4YRBA 3KVOA 1PQWA 4EZBA 4EW6A 2P2SA 3E9QA 4KQXA 3EHEA 1FXSA 5F1PA 2YV1A 3I6IA 3JQ8A 1YS4A 3ONEA 4EUEA 2DBVO 4AJOA 5JYEA 2VUUA 4XEHA 3FNGA 4PLCA 1ZK3A 4YJGA 2DFVA 4GBJA 3ITKA 3WQSB 3D5QA 4B7XA 3AUUA 3FWZA 1K5HA 3AY6A 5C3MA 1MGOA 4J6FA 5B4TA 2E4AA 2Q49A 3NT5A 5KJEA 4BGUA 1XYGA 3IMFA 1U7HA 4HFRA 5T6BA 4BQPA 3I4CA 1YL5A 4IDAA 3T7CA 3F47A 4R3WA 3WIDA 3V8BA 4W82A 4E4YA 3D1LA 1PQPA 3EDMA 3GZ4A 1QV6A 2AEMA 4OOEA 3WGTA 2ZJ1A 1U3UA 4IDDA 1FDUA 4TRJA 4NIMA 4GWGA 4J2HA 1PQUA 3RI3A 5KKCA 3RKUA 2UDPA 1A9YA 3MJEA 3UH1A 3WWZA 2V6FA 2Q4BA 3PDUA 2J5KA 4RQUA 5JDIC 5L7WA 2WDZA 1KVSA 3DZBA 3LZ6A 3OICA 1WDMA 2VQ3A 3LC7O 4YAKA 2DUUA 4IQ8A 1YWGO 3CPSA 3D5TA 2XF8A 2DLDA 1U3TA 1ONNA 1E7RA 2X7HA 3U3XA 3U0BA 2AMFA 1ZNQO 3UICA 2GN4A 1QXSA 4JXKA 3MZ0A 4E2YA 2GZ3A 4LSWA 3WSWA 4DA9A 3GGGA 3EVTA 1H0KA 2EGGA 2SCUA 3JTMA 3ANLA 3HJAA 1NFRA 5CAEA 4L4RA 1B8PA 1LDGA 2J3IA 2HMWA 4A73A 1Y7TA 1LDMA 4BNJA 1NAIA 3PJFA 2HUNA 4DBZA 5L7TA 4AICA 4IBOA 4LSMA 5K0ZA 3ZNOA 3NUGA 4EGFA 3KLMX 2UV8A 4NBTA 1VC2A 4R69A 1B3BA 3SC6A 4BO7A 1E7MA 4K9DA 3PVZA 3KUXA 1NBOA 5G4KA 1YVEI 2Y1EA 3WGZA 5THQA 1PZHA 4UUOA 3ULKA 1DXYA 2E49A 1P0CA 2HO5A 5ENDA 1EUDA 1TT7A 3HZZA 5F5NA 1KOLA 4E2XA 4J43A 2YDYA 2GGSA 2O4UX 4Y6SA 3FTNA 2TMDA 1ENYA 3TOXA 3GDGA 2EJWA 4KDFA 4D7AA 2GN6A 2OP0A 3MTGA 1WLYA 3WNVA 1ORRA 5T8KA 5T57A 4GVXA 1PTJA 2IZ1A 3B1KA 4TRMA 3S2GA 1VI2A 3DBRB 4WECA 3VPHA 1A7AA 3G0OA 1E1NA 3OA0A 3EYWA 1HRDA 4FFPA 4RQTA 4BKUA 1BXKA 3RUDA 4ALLA 1OZAA 2EIHA 3ZHBA 4AJ1A 3I9JA 5HM8A 1PZFA 3EK2A 3WBBA 3ZU5A 4BNIA 3LT2A 3PEFA 3ROQA 5IZCC 3DZIA 2NWQA 3M6IA 1UXIA 2H6EA 1R6DA 3ZNPA 3H5RA 1P9LA 2H5LA 2LDBA 1HSZA 4NU5A 2BFMA 5DF1A 4OSOA 2WYWA 1QYXA 1EBFA 2JCVA 1I2ZA 1X0XA 4HFJA 4O63O 4MINA 3B6ZA 3VKVA 4DBVO 4HV4A 2GZ1A 3TFQA 3FCOA 1ZW1A 1GD1O 4GMFA 1UUFA 2QRJA 1QORA 1B8VA 2CVOA 5GZ1A 1CRWG 3GN1A 1IHYA 2VRCD 5A5FA 1I2BA 4NMHA 3Q2KA 1WDKA 2DBQA 1BDBA 3CUKA 4CPDA 3WG9A 1DFIA 4IZIA 2BH9A 3UCEA 5A5EA 3HDJA 1J5PA 4YJFA 3EZYA 4XRRA 1JVBA 1H2HA
chains in the Genus database with same CATH superfamily
1GTMA 1NXQA 4UW9A 2OOKA 3DJFA 1R00A 3R6WA 4D57A 4V1CA 5E2IA 1NN3A 5BNZA 4Q9AA 4FOPA 3FBTA 4F5EA 3A6ZA 3K4PA 3MCUA 1DEAA 2WAXA 2N46A 4OYHA 3N87A 1TU0A 5EIEA 2GVNA 3GRAA 3FFBA 3IT0A 3HJUA 4I9UA 3K6SB 3V34A 4LCJA 5F7XA 1WTAA 3RSSA 1AQIA 2ZCUA 3AIIA 4KZPA 1CB0A 1SC4A 3KUCA 3I28A 2YZ7A 5EE1A 4ZGBA 1FW8A 1M8PA 5AXCA 4IJMA 1GCOA 4LEIA 1JIKA 2V03A 4DM3A 4U4AA 1QCZA 3FYUC 3UGQA 1P7PA 2I6TA 3PJRA 1ZCJA 1GRQA 3ZWBA 4DTCA 2HIAA 3D02A 5H5JA 2ZG6A 3V8MA 4I14A 2C7GA 4MV8A 1M10A 4WPGA 2Z3WA 5K6RA 1OOEA 1ZISA 1I32A 1IN5A 3L0CA 1KIAA 2J59A 3B9BA 1ECBA 4MRNA 3V00A 4M1SA 3KE9A 1KEPA 2W6CX 4R2MA 3QXCA 1A95A 4H6XA 5THXA 3SY8A 3F3SA 3QVMA 4FGJA 1ZEMA 3NBUA 3L7YA 1G21B 2DQ4A 3RU9A 5FDFA 5K6AC 1E7YA 5KQLA 1UPXA 5A62A 3JW8A 1HDXA 2QMEA 5GIPE 1NJFA 2QZ4A 4PIMA 2XQKA 2I2DA 4KMSA 3UT5B 4DJTA 5KB3A 4BKQA 4ZYTA 4CVNA 2H29A 2Q2WA 3OUUA 1GOTA 4U5QA 1PJTA 3ZDBA 1IWOA 1M1ZA 1PJAA 1Z0KA 2G9RA 4F4IA 1AHPA 2C03A 1H1LA 4GRIA 4RZXA 5EINA 4FDMA 3ZXUB 1J9GA 5ICFA 1OFVA 4AW9A 3E2IA 4CM7A 5AVYA 1X3LA 4NYJR 5F52A 1EGHA 2WSSA 3C87A 3T6KA 5K0CA 1IJBA 1KZGB 3VDRA 4ZANA 2P5UA 4AQYB 3RK4A 4YS6A 5H3HA 1GFWA 1HV8A 2VSQA 4RJIA 1SEPA 5K3AA 4TRNA 4CW7A 2GZ2A 1QAOA 1O3YA 5EKUA 5IJZA 3CE9A 3KSMA 4YY3B 3JYOA 1KKUA 1N3YA 1II9A 1SG9A 3BG5A 4B3CA 1YRLA 4YX9A 4BQFA 2JAUA 3ON5A 4ZVPA 3L6CA 4I50F 3R20A 2RKOA 1SB9A 2RHRA 2JZCA 1XZMA 2ZR9A 4LK2A 4TZTA 4OH7A 1EX6A 2PIDA 3UAZA 2QDXA 3K8ZA 4MW6A 1R9MA 1F6WA 1GU1A 2QTVB 2YFQA 1UZAA 3W06A 4BLPA 1UBTS 3BAFA 1I4TD 2ERCA 1L9KA 3NTRA 4YNBA 4HYQA 4D4GA 3P9SA 1GKKA 1G3MA 2BKVA 3KT6A 1EDZA 1TZBA 3QKWA 4WK6A 3UOGA 4E13A 2GD0A 5JAOA 3OHMA 1IXSB 1W44A 5JSHA 4HNHA 4MQUA 2DT8A 2F64A 2X77A 5ITSA 5E0KB 3FB1A 4K9QA 1NP3A 2PZKA 1R9NA 1D0SA 3TPCA 4W8OA 2JDIA 5CRIA 4J75A 5HIMA 1KRWA 1I7LA 5K7SA 3DMGA 1K4KA 4A2CA 1AE1A 1BDMA 1R0ZA 2I87A 1M5TA 2WAOA 5CB8A 2OPHA 1AHIA 4C87A 3KU4A 4P3PA 3RVPA 4E2ZA 4IIFA 1EVYA 4KVZA 1KY3A 5HKLA 1XCPA 5KC9A 1PK8A 1PDOA 1WCIA 1T6ZA 2FUCA 2FZEA 5JHHB 3ZQ4A 3PC8C 5GP1A 4LF9B 1TJNA 1QF6A 1UC5B 1ZHFA 5LXTB 4MKRA 2O8BB 4CE6A 4QC2A 4H9GA 2QTCA 1F60A 2EEZA 2FW6A 2A8YA 3BJMA 3UJHA 2OECA 4I1UA 5H9WA 3PDHA 3PICA 1A5ZA 4RTKA 3QBDA 2G8LA 4OP2A 5A3JA 2BR3A 1DJPA 3ND7A 3QK7A 2GTPA 3HU2A 3H04A 4MQEB 5CNMA 1N92A 3TEJA 3HA7A 3SQDA 5LKAA 3U44A 1QLWA 4M8NE 3PGKA 4KR0A 1QZTA 5EKDA 1IXZA 4ML3A 1SCJA 2ZYHA 4IHQA 3TTSA 2H4ZA 2V58A 4QJ5A 4J7CA 1XLWA 4QDJA 5I4IA 1PWXA 1WOYA 1Y1SA 1I9GA 3DL0A 3D7RA 3H6KA 1A2OA 2G7ZA 3LY9A 4YJ3B 4WKNA 2AC4A 2PH5A 2ZBFA 3V5NA 3GMDA 2UUPA 5EIBD 3V6MA 4E7PA 1V8DA 4HXYA 3MFQA 4NHEA 2W6NA 5A3RA 2JFBA 3G02A 2OQRA 1W93A 3S2SA 4J1JA 2O3QA 2OBBA 2WIFA 4QPCA 3DDSA 3L4BC 1GV0A 1E9BA 3G85A 4EI8A 1TVKB 3KZOA 4UXHA 4EKYA 5KYNA 2VPWA 1L7MA 3F9IA 2CLOB 1QK4A 2VNKA 4JBIA 1PTKA 3FYUA 1CUJA 3WXBA 3G8YA 5IANA 5EESA 3GLVA 3RS7A 3TL6A 4NE2A 1AGRA 1E5XA 2W2XA 1DEHA 3K0CC 5EQDA 2PANA 1DFHA 2MSLA 3PKZA 1YBFA 3HL4A 3ZE9A 4OHKA 2AZXA 4C7VA 3CR8A 2HWUA 2WV7A 4B4DA 1M1XB 3O31A 1DWOA 2WSIA 4JAVC 3LO8A 3C6XA 1Q7CA 3MJDA 1I36A 2P6UA 3BXOA 3GD5A 4WZAB 3ROTA 2EX1A 4EY5A 3IUEA 4F6RA 5COBA 1N34B 4XX1A 3IULA 4PZYA 1P5ZB 1N4DA 1YB6A 4OXNA 3RE1A 5IJ0A 1PL6A 4KX3A 1J7KA 1P18A 2RAVA 4TTRA 3OM1A 1GDDA 4C4SA 4M21A 3FSJX 3GAAA 5KOJA 4G1VA 4ZPXA 4Z1OA 2FQYA 1JT9A 1XKXA 4IOJA 3ANMA 4WZ6A 4V0NA 2GT1A 4EPYA 3O9VA 2APJA 5LQKA 4IILA 4V39A 1FYXA 1N57A 3ICPA 1O0SA 1QDEA 5THKA 5BNFA 2IUSA 2QTAA 1F0KA 3CV3A 5NLLA 3TD6A 4C7OA 3RC2A 5EHZA 3E6AA 4P4UA 2GBPA 3I04M 3LIPA 1T5DX 2EDAA 1N2CE 4YRQA 3T54A 1G6Q1 5C7IO 1N2OA 3FMFA 3EOZA 4O2BF 1THMA 1IE3A 2H07A 3CMCO 2ICAA 4J94A 3Q6NA 4LQ4A 5FI3A 4CDGA 2H9IA 5FTNA 2R6FA 1OXKB 4M9RA 3REFA 1YMVA 4P7GA 1RW4A 4D0GA 2N47A 4DC0A 2DHEA 4UCFA 2G9ZA 2IXEA 4MWBA 2OCXA 1GCUA 3AKZA 4UEOA 5ARDA 1ZD9A 4DDUA 4R41A 1M76A 1EFRD 5A7FA 2PBRA 3LX4A 4DG5A 2NU9A 4WEQA 4BP9A 4D74A 1ZOPA 2HBRA 3GLUA 1TZKA 3SOPA 4RZHA 1MC8A 1Y48E 3AOEC 4HB4A 2O8NA 2REBA 2BMJA 3GNLA 1EPUA 3RV3A 2EIXA 1JIXA 3C8ZA 4KCGA 4IIHA 4OGWA 5KWJA 3HKCA 3K31A 4JYZA 4L8VA 3TGPA 2ETVA 4WZBE 3VOBA 1YQEA 2CVZA 2G82A 4NV1A 1U9YA 2BI4A 2DE0X 2ATXA 1F6BA 1RAFA 1EA5A 1EJ2A 3FGNA 1PJLA 4I4TF 4XSHA 3E5RA 3HN2A 2A5LA 4CN8A 3C41J 2GBGA 1FJHA 1JHVA 5FH9A 2X15A 3E3MA 1WY5A 5IYZB 1K6EA 1ZBDA 2I6GA 4V0QA 2AVDA 2FETA 1UZNA 3GPIA 1RPJA 2IPNA 3HVHA 3JVVA 3G7SA 1ZJ5A 3MJHA 3WL4A 3OTHA 4M8LA 4G0PA 2FUG6 3NHLA 1F4LA 3PC8A 3EZNA 4CKWA 4G1UC 5E7IA 3PB3A 3ZXSA 3K6JA 1FJGB 5GVRA 3AR9A 3L07A 5JUWA 1ZD1A 1SVNA 4IICA 3F6EX 2IE0A 1CS4C 1KRHA 3INGA 4URHA 2ZWPA 3MQFA 4DM7A 1U99A 1UH5A 2H2IA 4OQFA 1X1AA 1ODCA 4QYSA 4GEKA 4Y2JA 3ZLAA 4GQIA 2FR1A 2AYZA 1GSHA 3KUDA 4X8LA 5TPZD 3UJNA 2YRFA 1CQIB 1BA2A 1HTBA 2L0XA 4I4NA 3QKRA 5HFAA 4EI9A 3QLUA 1HORA 4FXPA 2BUBA 3L79A 1GFSA 2YS7A 1E9SA 1PNQA 4EB3A 3R5TA 3NXSA 4RIHA 5T7BA 1GPUA 3FSGD 3D3WA 1F12A 3BH0A 5LLTA 3D9QX 4C0LA 3U7RA 5C5EA 3AKDA 3GF4A 3VOAA 3RRYA 1N2CB 2FB9A 3ZDZB 4G4SO 1SKAA 2PL5A 2NTVA 1RM4A 2V74B 3UW3A 5HQTA 3RREA 4YB8A 3SEFA 4URYR 2G77B 3AX6A 3KTAA 3MFYA 4BASA 1SWVA 1X9HA 2BBTA 5H4HA 1KDPA 3I8SA 1FUIA 5HJEA 3U7EB 1XHEA 1UODA 4X6YA 2LW7A 1GGEA 1TF7A 2XDWA 3AHFA 3L4BA 4POAA 3EOAI 3RWBA 5C81A 1GWNA 2MSWA 2YYZA 3QA3E 4ZHQF 5ISMA 1MB0A 3V7WA 1XELA 2Q1TA 5TJ9A 4HS4A 4DRXB 5MGBA 2IYEA 2JHAA 2PYIA 1YA8A 4CV3A 3NRBA 4P5PA 2CJYA 4Q3DA 4YRFA 3K0CA 4KLAA 1UJNA 3GRKA 1KJ9A 1EEXB 2B7BA 3BSYA 1WKCA 4Q7MB 1QYVA 4LI3X 1K06A 4PO9A 1WVIA 4ZU1X 4X44A 1QYIA 4RF3A 2YS6A 1REQB 1QRDA 1OLSA 2O2HA 3F1KA 4MP3A 1C7IA 3QF4B 4HUJA 3RVNA 3KD2A 1YFLA 3GZJA 5FO0A 5BYKA 2DHQA 2IPLA 4QOFA 1VOTA 4BQNA 2J87A 2QBYA 2X8JA 4L51A 3AR2A 4YJDA 1GT91 1YGYA 1RI3A 2CL5A 4EKEA 5KVSA 3H7IA 5KS2A 3A25A 3NHAA 1DAKA 2CNKA 3A6KA 3CKLA 4DKJA 1YQWA 2Y68A 2G71A 2FZWA 1L5HB 3RC1A 3WLLA 4AMZA 4ALMA 2PUTA 2PFKA 3FR7A 4M9SA 1BJKA 1D6NA 3ONWA 4PBSA 4QWWA 4XEUA 4HDNA 2GHQA 2WT9A 2CLMB 2FJ0A 4JOQA 2I29A 3L8ZA 1U0JA 2NGRA 1K3FA 2WI8A 2GBIA 4MI1A 3ZLJA 2FZGA 3AETB 1N9GB 4ZT3A 3NBKA 4BJ3A 1L9XA 3CX3A 5F78A 2FUG1 4TWIA 2AEJA 2BGIA 1GVNB 3C4JA 4M0CA 1RP7A 4ND5A 1WZNA 1XNJA 4JCCA 5I48A 1YULA 2XUHA 3O38A 5F12A 5FPQA 4CLXA 5ICEA 4R05A 1TM4E 4U2CA 4NXMB 3VJRA 1QK5A 5ALWA 1DUSA 1WXXA 1Q3HA 4A23A 1MVOA 3B52X 2XGMA 3BRQA 2RK4A 1YHNA 2Z83A 3HJFA 4P8RA 4ZQGA 1OIVA 2BSAA 4JI8B 1R15A 2J4DA 3P52A 4A92A 1R88A 4G09A 1KY4A 1ZY2A 2O57A 2YX1A 4O4HB 2QXTA 2CL6X 5AJZA 3RIGA 4AJJA 3WNQA 4H35A 1YI8A 4HQOA 3UC5A 4CLOB 1FNNA 1ISIA 4WCFB 1XD2A 4PYOA 5FOUA 1Z9BA 3RKRA 2HJHA 2J46A 3U3DA 4I3GA 4ILEA 5ITWA 3A9WA 2QZZA 4E5KA 4OCZA 2B0CA 1EFLA 5EE9A 1DCMA 1A7JA 3AOEA 2UAGA 1UDBA 3HJNA 1LW6E 2ZRAA 2V3CC 3KJXA 3VH1A 1CJVC 1TK9A 3Q3JB 1UZLA 2ONJA 1UJBA 3NRJA 4PWYA 1UANA 1XCMA 3V7UA 4CMAA 2MSEB 1SUPA 3L5KA 1WVGA 4Q12A 4TM8A 1TPZA 4M7WA 1BS2A 5JADA 3P9KA 1RBMA 3F8WA 4L8LA 3ZTTA 3G89A 1PJRA 2ZAGA 2C20A 1NXWA 2ZB3A 3IB6A 5C51B 3AUYA 2R0QC 5AO9A 2WG0A 3G79A 4G56A 4J03A 3ORFA 1FXWA 3N2KA 4LMPA 3FF1A 2BEKA 5AJTA 3JZMA 5ICCA 4QEZA 4EOGA 4BLOA 4W5JA 3IP3A 2VN8A 1KIMA 1LD3A 1N6NA 4CKEA 2CY0A 3AM4A 2GEJA 2LRHA 2VDVE 1CC1S 4WOJA 5L8VA 2ZI4A 3A1WA 2WQ7A 2J48A 2WF7A 1Y4UA 2I4OA 3GBPA 4S3MA 4WLEA 5L3SA 1KAMA 1QHXA 3OWHA 4UDNA 1QBGA 2QLTA 3REQB 5E4JA 2F1JA 3KDAA 2B2NA 4QYMA 1KY5A 3UUEA 2YFYA 1US8A 2NV2B 2ONYA 4DLSA 1EFUA 1YB5A 1TTQB 3JAWB 4KUGA 5A6VA 3LE8A 1C0LA 2Y76A 5ERXA 5H59A 2FQWA 3E9NA 4NATA 4O2AA 1ZXBA 3F97A 4Q3CA 1Y34E 3RAEC 4V0OA 3IB3A 4F71A 4C1NA 3KOWA 3NPAA 1X7XB 1Z6XA 3O95A 4KO1S 4W8HA 2Q1SA 2Z3VA 1SUAA 1Y3CE 2D1SA 4N39A 3PR2B 1T1EA 1VFNA 3PXUA 4B17A 3M4YA 4DPKA 4E22A 1OFHA 1GTSA 4XASA 5IVPA 1NF8A 2ZUDA 1OLXB 1IZYA 1YI1A 4DMCA 4UHJA 1HDOA 1N5KA 5BMVA 1MX3A 2DWPA 1Q0TA 3IBSA 1UC4B 5B1YA 4R2WA 4Z3DA 3SLKA 2XXAA 3IKJA 3M6LA 5YASA 1E3LA 3ZYZA 3D6NB 1TGYA 1AO3A 1G3IA 1GSOA 1DAIA 2R6R1 2ORWA 1SWWA 4RMGA 2HGZA 4DV3B 3NGXA 3TI9A 2R25B 3ZIUA 2YIVX 4LNUB 2AC7A 1YAHA 3KYBA 1N2ZA 4Q6WA 2O5RA 3HHEA 3UPDA 4ASUA 5IM4A 1KNXA 1PG0A 4BKMA 1XJ0A 4FCVA 1MH9A 2BMAA 2GK3A 1ESZA 3GYGA 3NBMA 1LXCA 3P2MA 5DP2A 1L1FA 2UVQA 1QCCA 4BFYA 4QDKA 4D1YA 1YONA 3HJRA 5HA5A 3BXZA 3D7KA 2NYVA 4OFZA 3UPTA 2FZKA 1OF1A 1U28C 3ETHA 2GN2A 5JNWA 3H5IA 1UKAA 3HB9A 2PT6A 2QTZA 4HMQA 4XGIA 3OJOA 1XZNA 2ODPA 1IULA 3PEVA 4W7HA 2ZSJA 4ZCQA 3C6KA 3IVCA 1PSZA 1W6UA 2ZXFA 4FFLA 4XQ0A 1OBHA 4Y2TA 4D92A 3TM4A 2VATA 4B34A 1UDAA 4ZTUB 4WH0A 1NNEA 3QXGA 4TXHA 1U2ZA 3EIFA 4BEVA 1N6OA 1QAMA 1QO0D 3HCWA 1UAAA 2IW1A 4P1ZA 3GGSA 4Y6LA 4HN9A 3R7BA 3S2YA 1SR8A 4EHAA 5I7RA 3E84A 1HX7A 4M0LA 1Z8NA 1G6HA 3TLXA 3Q0TA 1E5TA 1CUCA 1HQYE 1ZUD1 3M34A 4BE7B 2SKCA 4L95C 4C7OB 3AW9A 4DR6B 1I24A 3W3AD 1OXVA 3RRXA 2IRWA 3PG5A 1XRMA 1XZFA 3TW8A 4JDUA 2UUCB 5B7QA 2HMSA 4Y9RA 5EIWA 2JH9A 5EZYF 1LCIA 3G5MA 2Y93A 1RAAA 3GOQA 4G1BA 5G40A 1RMYA 3ZGXA 4CKYA 4E32A 1HNNA 4EVIA 4K05A 3OLVA 2BEVA 2A9JA 2X2EA 3C1OA 1KS2A 1IOVA 2JFGA 2WZBA 4KGZA 1BVRA 2YWDA 2WF8A 2NT3A 2I7TA 4LYGA 1Z38A 1BN6A 3JQ9C 2ZRJA 2ZYIA 4DDWA 1XPRA 1P73A 4L8WB 3WL7A 1J8FA 5LB4A 1NI4B 3GLIB 4BO2A 3ROFA 4KFUA 2W6OA 4W5WA 2GXUA 1YTUA 5K0FA 2DJIA 3FGOA 3PUIA 3C3YA 1UDWA 2OPBA 3STXA 4BNNA 1UXJA 2D2XA 5DGDA 4HAIA 1ARZA 4BB9A 3D0KA 1HEUA 1RPZA 3GVPA 3I83A 5C5DA 3C14C 4ENTA 3EVEA 1J09A 2DEUA 2Z8YA 1J0CA 5LFAA 3SF8A 4QJ4A 3L4KA 3COZA 3E7XA 1I4EB 3LQRA 1ORHA 4K6FA 1JZTA 3MTQA 4Q1CA 5H83A 5AD1A 2WG1A 4YAOA 5EWLA 5M34A 1GG8A 2QX6A 3HBAA 3RHZA 2P8SA 1OSNA 5EJGA 3BB3A 4PZUA 3ONFA 3NNNA 4DJAA 1E1DA 4YRMA 5CXSA 3EDOA 3BOSA 2JIOA 3DNMA 4DDTA 4LJRA 1T9AA 4CNQA 4IJ5A 3UMBA 1QNLA 5BSTA 3DUFA 4EJFA 2A57A 3HE3A 1MQAA 5GIOE 3QEBZ 4UM5A 4FR0A 4BZPA 1W0KD 3FTCA 2FPLA 3SF0A 3LT0A 1YBMA 4RSRA 3UK0A 3JQPA 2QLJA 1UFOA 1CY4A 2C5GA 3TLCA 1P1FA 4WDQA 1RJFA 1UC9A 2A0FA 1XRJA 4K9PA 4UVHA 3CNQS 5ALHA 5AW5A 1Z5UA 4FMBB 2XUAA 3S40A 4BEJA 4KU4A 1YUNA 3ML1A 3NYIA 4TKZA 1KTIA 1L5QA 1SUEA 1ZNZA 1ECPA 2GN0A 1MJGA 1Y63A 1VKZA 2JFQA 3H9CA 3EVFA 3L8YA 5FBWB 8ADHA 1RE0A 1H2YA 4JZYA 2CN1A 3N8HA 4QYIA 3GRVA 3SIXA 3O8OA 3HN7A 4OGGA 2ON6A 5CM2Z 4Q7EA 2UZAA 1JIUA 1OXSC 2X0IA 3UJ9A 1BXRA 3IMEA 1I4OA 5FWYB 4YRAA 2O06A 1RRVA 2HT6A 3DZFA 4IJQA 1Q0LA 5CLHA 4Z0PA 2ZWAA 3QBEA 1TYBE 2MSKA 2GZDA 1JLSA 1ZM2A 3FETA 4DCJA 1YE8A 3L4SO 3D31A 1HR0B 2QL5A 2VS1A 1K1EA 4NZZA 3N70A 1KP9A 4E5VA 3VPCA 3WA6A 1RHJA 4JKYA 3IE2A 1Y3BE 5WRFA 2AXPA 3P0FA 4YPVA 2MJLA 5HDQA 3U4QB 1QE0A 5A1TA 2V7WA 4L3OA 2O6HA 4ZVRA 5DLQC 1N2HA 2CFCA 3W2EA 3EISA 1C4KA 3M5PA 3QBTA 5HTKA 4HDRA 3HKEB 3GEBA 2AUTA 3BULA 1KBOA 4XIGS 3WJ7A 1XZGA 2RGWA 5GY7A 3WYEA 1TNDA 1RMQA 4BKPA 3DUWA 3GQBA 1M0TA 1UM9A 1JKXA 3OCYA 3EASA 2B21A 2YN0A 4JD5A 1XKLA 1SIWA 2DT5A 2QM8A 1KMHA 3GLGB 3M4JA 3UJCA 3ZZMA 2QNIA 1CY8A 1E8NA 3UY4A 1Y4ZA 3TM5A 3V1UA 2IY7A 2BGTA 4PGGA 4ZMBA 1EDDA 5DNDA 1GILA 2CWDA 1GGVA 1SBNE 3DE6X 3EULA 3O1JC 5IK2A 5SZIA 1W36D 3E03A 3OIUA 4YP0A 4EZIA 2BDTA 2JFYA 3TR0A 3N39C 1GGJA 4P9NA 1KDZA 1TUIA 1U28A 1G8SA 2GASA 4UVEA 2Z2ZA 4ZU3A 3JU3A 1NXOA 3N0VA 1VJGA 3KR9A 3LL4A 1ILWA 1T1RA 3QNUA 4JUBA 5CVDA 4Z3KA 4W5RA 4E2FA 5HRAA 1EK2A 2QV7A 3WK4A 5KJ6A 1DXOA 4X7RA 1C81A 4H59A 2HNAA 1GPH1 4N7JA 3NBYC 1CJBA 3CKYA 3EPRA 1KC3A 3UH0A 1MT3A 5KPJA 4JL5A 1KDTA 1TLLA 4EA6A 5DO9A 5JVDA 4HNGA 4EPTA 4ZOQI 3MJRA 4ES6A 2ZTLA 1QIMA 4UU7A 2MYNA 2H4YA 1K63A 2LDXA 3KKOA 4QWMA 3UK7A 1K6IA 3V32A 5IXJA 1EYZA 3FHJA 3WFIA 2ACKA 1X8XA 3A4IA 1QVWA 2I78A 1OWLA 3ZWNA 4INJA 2A9KA 2CXUA 4NR0A 3KKEA 4X00A 2XTAA 3SM3A 5J5VA 5T5QA 2QR2A 4QFMA 4EUNA 4F3NA 1G8HA 2W2LD 4M9ZA 4MLZA 4M0PA 1SBTA 5BV8A 3R6LA 2YJNA 5J4HA 3JQ9A 3ZW8A 1EXDA 1Q2UA 2ZGVA 4EITA 1Q1AA 1WPXA 1Z4PX 1PVDA 5AK3A 3WAKA 3JYLA 1RRMA 1QBKC 3QG5A 3I30X 4QVKA 2OQ2A 3OZUA 4M7PA 3H1AA 4DUGA 3W0LB 1EG7A 2R1VB 3FWYA 3QWFA 3A0RB 3IQHX 4AJEA 1IBSA 3H0EA 1B15A 3OLYA 3K5PA 1AKYA 2H7CA 2QF7A 1MTOA 1RC0A 2A9OA 1NY5A 2WTBA 5KVQA 3RRBA 1COWD 2HFKA 1RQNA 4EB6A 4XLZA 4HLUC 1MJNA 1VMKA 1DRWA 4WBXC 5DT2A 2NU8A 1VHQA 2QU8A 3V2GA 4G1CA 3I09A 3CTMA 5IC5A 4N0EA 5IH3A 1GQOA 4M1TA 3CNEA 2G40A 5DI3B 1FZQA 2OBFA 4B48A 2H8KA 1PYGA 1U2EA 3DOUA 2X76A 4KK3A 2W8ZA 2AIRA 2P7IA 5T3UA 3TUIC 3RM3A 4MROA 5I7AA 4OK3A 1HTTA 4BRSA 1R4AA 3VDQA 2EBWA 3GGJA 3DYBA 1R1DA 1PNTA 2YZMA 5CBPB 3G0DA 4MS4B 1ZVKA 4OMFG 1EDBA 4UTNA 1K8YB 2GR9A 1YZKA 1CERA 2Q3MA 2AXQA 2YVQA 4LOHA 1YR2A 4G0OA 4C04A 1HG1A 3JCZA 4FYWA 1ONPA 4A10A 4IDCA 4DWWA 1QVRA 3EXHC 1GP2A 1QHGA 3LBYA 3MGKA 3G0BA 1FJ2A 1RC1A 3HVKA 2PX0A 2X58A 3B51X 4UUQA 1H2AS 4PTYA 4DMGA 5JI3E 2FH5B 2FMFA 4KB5A 1PT6A 4R2IA 1TDJA 4Q9LA 2G1KA 2NUAA 4V0RA 4AG5A 4C4TA 1PNRA 3GDWA 2XTMA 3FVQA 3VSCA 4JLJA 1V8ZA 2Y0DA 1M6VA 2WD8A 3Q41A 4UHHA 3TLGA 4U0JA 5HOQA 4ARBA 1K4MA 2BCEA 1PUJA 4IR7A 4MWOA 4DEYA 3THXA 4GBGA 4TS1A 2A59A 1TU4A 4D99A 4MVJA 2P4EA 1FFBA 4MWZA 2JLZA 2ZPAA 2OO7A 4FW8A 2VYFA 1T2UA 1MAAA 3D3JA 3IO5A 2O3UA 3LBIA 1F0YA 2R2GA 3C24A 3A4NA 3OKAA 4NONA 4OQPA 3RVKA 2VXOA 4LHSA 3Q3HA 3DFKA 5KTNA 3OOYA 2FEXA 4XB2A 2XODA 4AZWA 5C1DA 2K2WA 3ILVA 3ND8A 4FGLA 5FL7A 1ZK0A 2V7QA 821PA 1BXGB 1B6GA 1E2FA 2RAPA 2YIMA 3KJEA 4HEHA 3TQOA 4JS0A 3TKAA 3OC0A 1JFLA 3SXUB 2AOTA 4INAA 1POWA 1VJRA 2R65A 4Y8VA 2QSYA 3OX4A 5F64A 1PW5A 3RU2A 5BWMA 1OA1A 1EQUA 3EG9B 1RM3A 1DRVA 4V0MA 2GARA 1UOEA 4P3XA 4Q7KA 4UTXA 5C1IA 1HF3A 1SM4A 1ULAA 3UF0A 4OGLA 1F2UB 1XSEA 2OD2A 5LVAA 4OSPA 2WFZA 2X9GA 4KUEA 2J0EA 4ARZA 2C8KA 2NP7A 3ZVMA 4QYTA 2DLNA 4EY4A 1KFEB 1PJ4A 1RWMA 1VMIA 1I7PA 1E3IA 1LQUA 1QHHA 4IDGA 4F2GA 3PQ7A 1GITA 1Z75A 1C1YA 1U3FA 3JD4A 4MVJE 4P22A 2NVBA 2IS2A 4E08A 2Q6KA 1TIPA 2H1SA 2OM2A 4X1KB 2I55A 2NV6A 5DX1A 4QJ3A 3R6TA 4FQ8A 4DM4A 3BWVA 3F74A 1L4NA 3UZUA 4W63A 3PXBA 2WWTA 2AI2A 2ZB7A 3BE8A 4YCSA 4MEJA 1ODFA 5BNWA 5J43A 1NXXA 4JJZA 3GA0A 2P3QA 1JZQA 1QVAA 2C2HA 4RPKA 5L53A 3VR3A 1ZQ1A 1B42A 1UOPA 3FYHA 3MCAA 4LAFA 3CPHA 1MB4A 1BH2A 2D1RA 1NHWA 2CMKA 1AKRA 4RZ2A 3GEDA 3R7AA 3RNLA 3X0DA 3FLAA 3MINB 4V0ME 4YTEA 5TT0A 4NE9A 3TX2A 2FV8A 3O8DA 4AJIA 4C0QC 4DSNA 1J0BA 5I3CA 1GN9A 2GA9A 1CZKA 1TVMA 3OM9A 4C1BA 1BX0A 1P9NA 2HV9A 1SOAA 4ME6A 5GQSA 2NO0A 3SQOA 2WAYA 3H2KA 1FLVA 1LW7A 1LLFA 1G60A 1N7GA 2ZYGA 3DV9A 3PQEA 3KSDO 5DU2A 3W8RA 4BNMA 4CQJA 3A4LA 5CFRA 2IYPA 3FMIA 5KBYA 4R9SA 3ECCA 5IVDA 3HEAA 1JQBA 1RBYA 4RTNA 2VBFA 3ES9A 2H1IA 3IMCA 4NLLA 2BY4A 4DANA 1P2BA 2NZWA 4NZ9A 1GZ6A 2FK7A 1RBQA 2X4DA 3EGWA 3N8DA 2C8VA 4JBNA 2ZJFA 3LPLA 4IINA 4U3JA 2A94A 5KCMA 4RV4A 4MYRA 1ZR4A 3X1XA 5JH7F 2QD5A 1W25A 4LGCA 1DQZA 3VZPA 1X77A 3L02A 3JV7A 2YCBA 1QIIA 4RORA 1JHDA 3LS2A 3HBNA 2DX7A 4IUBS 3EGCA 1VL1A 2AZ4A 2I03A 3GVCA 4NBSA 3VNQA 5TX7A 4ETMA 5DCWA 4HPWA 4JWTA 3TNFA 3I61A 4CEHA 2BFCA 4DREA 2Y2UA 2C61A 5EWMB 3AYXB 5L4NA 4KV7A 3MD9A 3TRIA 5LYJB 1I6MA 3UK6A 4D79A 3V1TC 4J1GA 3RUHA 4Z8YA 1SO8A 2AD1A 3OF3A 2J33A 2PY6A 2YW2A 1TCCA 1NW9B 3C4VA 3BYZA 3DDZX 3V4LA 1S8FA 1COZA 3H2JA 2MMGA 4YHBA 4D9EA 1ZJJA 4QRDA 2FWPA 1LWNA 3DXZA 5HZKA 1MABB 1KFCB 4IHJF 3DLIA 1CIJA 2TS1A 5BURA 2IPAB 1QCDA 3V8VA 5JXJA 3R9XA 1AUVA 2XWBF 4WOPA 4MYDA 4RPHA 3SI7A 3X1ZA 5A9SB 1X9GA 1DUVG 2ZJ7A 4IWYA 1AK9A 1XEWY 4UBNA 5D6NA 3IDSA 3HP1A 3UEOA 4BO5A 5JBIA 1WA5A 1TYZA 3RFTA 2K7FA 5GPBA 1T4CB 3PTLA 1GFIA 2FZ5A 3OEYA 1U81A 1E2JA 2RC5A 2RHMA 4FP9A 4EUFA 3DH0A 2EU8A 1O6GA 1GO2A 3L6OO 4KAFA 3FDXA 1MRSA 3EXHA 2FFJA 4P36A 4RFLA 4HX5A 4ARCA 4UJ5A 2IZ7A 3L0ZA 4C06A 4RK1A 3IIIA 2JPDA 2OHVA 2QVXX 5IAGA 2B37A 1L5KA 4DEVA 1HDEA 3KUKA 3VI3B 4R5MA 1UJ5A 1G0OA 5FBRB 3VQTA 1W8DA 1X1DA 3WGGA 1YMQA 3I8OA 4AURA 3PGA1 3JWGA 3WC4A 1V47A 4ZXPA 4PO3X 3KELA 4X60A 5F33A 1LPSA 1GAXA 1VRVA 3I9MA 4XX0A 1WX1A 3DC7A 5DN6A 3TZ6A 1C3EA 4Q4JB 3SN6A 4PM4A 2L69A 4LECA 4ENUA 2BJHA 5A03A 4L75A 4WXHA 4B0PA 2TMKA 1UIRA 3NH6A 1T6XA 2WP8J 3VC3A 4C20A 1ZN8A 4M1EA 4N8DA 1Q0SA 4K28A 5B3JC 3H6GA 2HU7A 2Y1LA 5AVZA 4IIGA 5KQPA 3NC1C 3QWIA 1E89A 2F6RA 3R7LA 4U9IS 4HMPA 3N74A 2CLIB 3W3AH 3TOCA 3WV4A 3DGEC 2PUBA 3DMHA 3ZK9A 1MAUA 2OENG 3O4IA 4LBVA 2GVZC 1KZYC 1QZUA 3JATB 4ZI7F 5K0GA 2ZJBA 4RY8A 2VDNB 2O5VA 3U7GA 4P7FA 2QM0A 4B4VA 2FLKA 3WMFA 5HJ5A 2VFAA 4X63A 2Q4RA 3ND9A 4YRDA 1VSBA 1NQUA 1X1TA 4Z9YA 1BW9A 1Q6YA 2EFYA 3SX0A 1MHTA 4XQ9A 2I8LA 2IFTA 2IV3A 2AHRA 2ZETA 4S1WA 5CBKA 2QS9A 5KYXA 4Q9JA 2PH7A 3EODA 1LEHA 3W1WA 4N65A 2GSDA 5DNUA 5FWNA 1XNRB 1H85A 3P9PA 1YNSA 2CVFA 4WESA 1CY6A 5L7YA 4JI5B 2VA8A 3SU8A 3LCJA 4E94A 2BSXA 1QM5A 3C45A 3VH4A 5KNCA 5IH7A 1JEQB 2QTRA 3WAGA 1QSGA 4XPIA 2E4VA 1GUAA 4ZYLA 1LJUA 3RHSA 1UBSB 3D2CA 3DYIA 4PAGA 1ZJ4A 2YHSA 3I9FA 4RDHA 4HLCA 2C42A 2F48A 2NVUA 3L1KA 1V1RA 3ANYB 1K75A 3MWKA 1QVVA 4CI0B 3UN1A 1WQ4A 4ZAYA 4YI5A 3SEZA 3CLTC 1VLQA 3GUYA 1YRWA 2COEA 3DZHA 3Q10A 1HFWA 1KGSA 3BK2A 3L40A 2J0VA 3M81A 4GF5A 1OBFO 4KK4A 3IXLA 3T3MB 3LO5A 2LV8A 4Z0TA 1VCMA 2HEIA 2POQX 1Y9JA 3QPDA 3GLQA 1RVV1 3IVXA 2XCRB 1L8OA 3DBRA 4LBZA 4WFIA 2BKAA 4HGPA 3RUCA 5JISA 1XZCA 4GOKA 2ZYAA 4FBGA 4XYEA 4R01A 5LYYA 3T38A 1RHMA 3O83A 2QRQA 1T9HA 1VL0A 1FMFA 3H65A 4FNOA 3GA7A 1QH8A 1W2WB 2Q3EA 3NW9A 3GJQA 1PE0A 5FOWA 5HF5A 3IIEA 2XYPA 4GH5A 5JYCA 3RASA 2EDCA 1KK0A 5IJWA 4RIIA 2IEAA 3O3MB 4XJSA 3K9WA 5INTA 3GJRA 4G4JA 4NENB 3ZHXA 4R1UA 2G9QA 4YUVA 1NXTA 1GKUB 2ESRA 5IABA 2O1XA 1Z6TA 1CUFA 4X8HA 4DIOA 1ZA1A 5I7WA 1EXWA 1HE2A 4S2UA 1MEEA 3HL0A 3QWAA 1SBZA 3LWDA 4KIJA 4H6WA 1TKBA 1DBQA 2QN1A 1DC3A 1XI2A 2O54A 1OA0A 1L7AA 2MSNA 2Y66A 3AJEA 4IGIA 4IKEA 5K8UA 3OQIA 2IHZA 1NBME 1FTGA 2PFSA 1IOZA 2ZXEA 1GAJA 5DLDA 3L46A 5HHTA 1H6BA 2FW8A 2MU1A 3D8UA 3GHHA 1P19A 3N7TA 4B3XA 2ZJAA 5J47A 2WBLC 4DBLC 2BJWA 1QDUA 2P1DA 2BDEA 4NCBA 3OJEA 5ENZA 5KAPA 2XA1A 2WWGA 3G9TA 2ZJOA 2Y1DA 3PVCA 5IG2A 1DMSA 4IQ0A 5JFOA 2I4MA 1XRSB 4CM3A 1NQAO 1RSZA 1P3JA 3LOPA 1QRSA 3NC0C 1AIPA 1VJDA 3ZZUA 4QTUB 2XUZA 3EMDA 1JHZA 1GUYA 3TJZA 5CB6A 2A9FA 2J9YB 2B8NA 2PLAA 3HV2A 1HYHA 2JHCA 4C5CA 3EY9A 7MHTA 4TQGA 3A6HA 5EPUA 2QUZA 4MUIA 3LUHA 3NRCA 4XYBA 3T1VA 3VBCA 1UPAA 3OP4A 4PLPA 4WXPA 3K6SA 3UXHA 4LGYA 1RLJA 5ALEA 4KQCA 4Z99A 1E6LA 1XRRA 4F6LA 2PMBA 4RLSA 2J9GA 3BQMB 5B2ZA 3B7WA 1I1NA 3SFVA 3CCBA 1NKVA 1NASA 1J8YF 2EFJA 1T9KA 2C9OA 2EATA 2FX2A 2BAGA 2PG3A 2GAFA 3OQPA 4HVAA 3SZOA 4CFYA 3DLCA 4TL8A 4PFJA 1M8KA 1YQXA 3NETA 4X62B 2EFDB 5BV1A 2FG5A 3D0OA 1V8FA 3PUHA 3OH8A 3WQHA 1BWPA 1NLMA 2R6HA 5CPFA 4BB6A 1EM8B 3NH9A 5LR6A 1ESDA 1JTEA 5B3JA 1LS6A 3NANA 1K8QA 5CH8A 1ZGGA 3C8HA 2DPYA 4N3NA 3KE8A 4EMUA 1BGWA 3TSYA 4GICA 1Q7TA 5F98A 1X42A 5LBTA 1H5QA 1RKQA 3MWYW 1G21A 4D9MA 2D2VA 3P0JA 2PZLA 3MCZA 3VC7A 3FWPA 4R8LA 1A9RA 2VO1A 1L7RA 4O4IA 1QJ4A 2PGIA 1F5NA 4ID3A 2V3VA 3RIXA 1XJQA 2ODTX 3HSKA 1KKMA 4HFMA 2FKAA 3BF8A 1K2WA 4BWYA 1TPYA 4YV7A 1VPVA 1JKJB 1JYEA 1J5XA 3CZAA 4NBNA 3UT5A 1WE2A 5EUBA 2WE7A 2RKBA 3JALA 4LIPD 1QH1A 4X6UA 3LX5A 5AUNB 1Z6PA 3WP1B 3BRSA 3GYBA 3AFHA 5TQ2B 1T10A 1A98A 3KZVA 3RAPR 2PH1A 4MB0A 2QZ9A 2BEWB 3D4IA 1CIPA 4PQEA 2ZT6A 1ADCA 5CLQA 1TT5A 3RFCA 5AWFC 5ADUS 4U9UA 4TSRA 2DWUA 1T0PA 4XD2A 1JI0A 5FWXA 5TMDA 5IF9A 5FADA 2HC9A 5AVRA 4QE3A 4GZ6A 2YQ4A 3L7BA 3QNWA 4CKZA 1C41A 1DIHA 3QPUA 3CGGA 3QXHA 2AK2A 1U5CA 5BSFA 4WADA 1QGOA 3SYMA 5TB5A 2FPGA 2BN4A 2P9ZA 4DKXA 6PFKA 3IBYA 2AQHA 4MUNA 4XJTA 5K3SA 1LPNA 2Q41A 1D03A 5DYTA 1DNPA 1JIVA 4I9HA 4KX5A 5BSGA 4G0YA 4LRWA 2AB0A 2WKWA 2XEXA 4Q3NA 3T3PB 1MMFB 1UBEA 4BMDA 2Y2VA 3P20A 5FBVB 4XOIA 1GZVA 2ZP1A 1EGVB 1ZRNA 2ATCA 2ID4A 3O91A 4V02A 3IAFA 2Q9BA 5COQA 1K89A 2Z5VA 3HDQA 4TUYB 4DMRA 2KLHA 4BDTA 5JYBA 3K0AB 2JCYA 1FRVA 1BA3A 1Q0PA 3KV1A 1YBAA 3ZWMA 4B31A 2VPQA 2EYUA 3WHIA 3QBJA 2PUDA 3ZDRA 1JQJC 1J2UA 2EW1A 1QV9A 3QU4A 1V4BA 1Q3KA 1DO0A 2GVDC 2Q6VA 3K9HA 1GPNA 2OO3A 2F00A 3PCRB 4X65B 3EZ6A 3H1BA 4ESOA