1I3KA

Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
347
structure length
347
Chain Sequence
AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAMGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNVVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for severe epimerase deficiency galactosemia. X-ray structure of the human V94m-substituted UDP-galactose 4-epimerase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords UDP-GLUCOSE 4-EPIMERASE
total genus 127
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1i3kA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1i3kA01
3F1KA 4Z6KA 2QX7A 4RF5A 4PG6A 4XYGA 3CMMA 1SEPA 4BO1A 5LDHA 1BMDA 1EVIA 3RC2A 5JSFA 5K9ZA 1ZK1A 3CMCO 3M1AA 1PQWA 4WPGA 4EYEA 5A3JA 3KEOA 3N7UA 2EKQA 5ER6A 3K2EA 1BW9A 1U2DA 2VWGA 3WR5A 1QYCA 3I9KA 4FIZA 3S2GA 2I3AA 4ZICA 4E3ZA 1X15A 2O7QA 5L9AA 5CHEA 1I0ZA 4B3HA 2D8AA 3HDYA 3IKVA 3LC2O 1WDKA 3PGXA 1UZNA 2WMDA 2DBQA 5AYVA 4CL8A 1NP3A 3JYNA 2J5QA 3IOYA 1K3TA 2OBYA 3KSUA 4LRSB 4ZD6A 5JAZA 2VRCA 2PD4A 3BMOA 4MP6A 1BXGB 2FRDA 4CV0A 4E4YA 1K0UA 3JD4A 5GZ3A 3DBVO 4IGFA 5G4KB 5L3ZA 1I01A 4QXMA 4XGIA 4KTTE 4L76A 1ENPA 3RSHA 1Q1NA 4CM4A 3WX0A 5EJ2A 4UVHA 1PX0A 1M75A 5IZCC 3TN7A 1MG0A 3BMOB 4EEXA 5JCJA 3UW3A 2RH8A 1A4IA 2JAPA 1BXGA 1YB1A 3QWHA 2C5AA 3CINA 3K73O 4R5HA 2NVUB 1MB4A 3UH1A 1RJWA 4EW6A 4ROSA 4BNGA 2UDPA 2VWQA 5T64A 3DO5A 2CY0A 2I3GA 4DLLA 1ZJYA 3B1JA 1E6UA 2OO5A 4J1QA 1R0SA 2E48A 2W98A 2IXBA 4XEHA 2X0JA 3KBOA 2WEKA 2NTJA 3OSUA 4PLYA 2GLXA 4YA6A 4EZBA 5JO0A 1QYXA 4FCCA 2F1KA 5L4LA 1VE9A 3V8BA 1Y8RB 4JQCA 1P1FA 2EIHA 4BV8A 1X13A 2X22A 5EL0A 4LVCA 1E7SA 3LYLA 2YQ5A 1N7HA 2W2KA 2B5WA 2DBVO 1J49A 3QJ5A 4B79A 1UDAA 3W1VA 1YBVA 1H6BA 1WZIA 4D46A 5JAMA 3UKOA 5L7YA 4XKJA 3RFXA 1PS8A 3OIFA 4B4WA 4JROA 1B0AA 1W73A 3PEFA 5JMWA 5FI5A 1AXGA 4YAGA 1R15A 3K2BA 3WIEA 4ZVVA 1Y7TA 1YDWA 3D5TA 3VC7A 2R00A 1RYDA 4FJ0A 4BNVA 5IDXA 3U3XA 4RDHA 3OIDA 4YJGA 4Q3CA 4I9HA 3D3EA 3NV9A 2IEBA 4YBZA 3P19A 4OAQA 1ZH8A 3D1LA 4BMNA 1HDCA 3R1IA 1DIBA 3V1YA 1T2AA 3TDKA 1KC1A 4M87A 1NHGA 3I9OA 1KEPA 3F5QA 1R4MB 1NVGA 4NR0A 1D3AA 2O2SA 3PWZA 4Y8VA 4GPD1 4Q3BA 5A05A 2ZB3A 4QFDA 4B7XA 4YPOA 1KC3A 4PZDA 3MOIA 3PYXA 3DTTA 5L4NA 1ORRA 3WMWA 2C07A 1DXYA 3K6JA 2CDAA 3PQEA 2VHWA 3QRWA 5KVCA 3DHYA 1PJSA 3OP4A 2X0RA 4K1LA 1BRMA 5K6AC 1DJNA 4DIBA 4X54A 3QV1A 1LXCA 3PPIA 4ND5A 5THKA 1LQUA 1XU9A 3H65A 3WFJA 4MPDA 2I65A 1GUZA 3JQ8A 3FRJA 3EVTA 3ABIA 3GY0A 3AOEA 2PGDA 1M6WA 3OA0A 1F0YA 3VTFA 2JAHA 3S8MA 4D45A 1H6CA 1OI7A 1P0FA 4UEJA 4UUOA 1DC5A 4NBWA 1K6IA 2X9GA 2VHVA 1FJHA 4NJOA 3ANLA 3RC9A 1ZK4A 4CLOA 1B8PA 1Y9EA 3OJ0A 3TFQA 5BSEA 2D4AA 1DPGA 3CZRA 1PGQA 1ML3A 1XU7A 2NWQA 1IB6A 5JFOA 4XX0A 4A73A 3DFUA 4JXKA 3NT5A 1F8FA 2GCGA 3ONDA 1HXHA 3P5SA 4A5OA 4C4OA 1PL6A 5G0VA 3PJEA 2ET6A 4GX0A 4L4SA 2P9EA 3PJDA 1I36A 3L07A 1YOVA 4ZQHA 5EMHA 3VDQA 2IEDA 3EDMA 1LDEA 4NBRA 2O3TA 5KVVA 3H9EO 4DLBA 1AXEA 3JYLA 1YONA 2QYTA 3VVBA 5I8ZA 1H2BA 4W9NC 3QVOA 4JP2A 3ZU3A 4R9SA 2RCYA 1A4UA 2NNLD 4IY1A 4MKRA 2EP5A 4BQRA 3F4BA 4IDFA 2NU8A 1PJTA 4RF2A 4AJIA 1QRRA 4D44A 5IDWA 4AJOA 4I08A 1GQYA 3BHJA 1LDMA 1YS4A 3LSYA 4R3NA 3DAPA 1R37A 4U6SA 5TF4A 3OBBA 3OF2A 4OOEA 3OFSA 2EJVA 3I3OA 4UEKA 3C24A 4ND3A 5G4KA 2CD9A 2XOXA 4Z9XA 1F17A 3PHGA 1M76A 4XQEA 3R3JA 3BMCA 1DSSG 3KLMX 2EERA 5BNFA 1KERA 3WGQA 2WWRA 4Y6PA 5B4UA 1LSSA 1NHWA 1P9LA 4FJ2A 3VHRA 5ITVA 3Q1LA 3C7DB 4Q3EA 2OXIA 3RROA 4CMBA 3DZKA 1SOWA 2GZ2A 4J2OA 4IQ0A 1GQQA 3E03A 3VPGA 3UCEA 4CLRB 3CZMA 1GZ6A 3RQSA 1HKUA 4NBTA 3G17A 3GR6A 3V1TC 2UUOA 3ICCA 4WLEA 2W2KB 1CRWG 5EQDA 1EK6A 2V6MA 4TROA 2AEFA 2AXQA 1H2HA 2Q4BA 1FXSA 3CPSA 3QVSA 2EJWA 3P2OA 3B6ZA 3M1LA 5MDHA 4IJWA 4OKIA 4IQGA 3OJEA 3JTMA 3RFVA 2DQ4A 3GLQA 4O63O 3EVNA 3OJOA 3K92A 4J9UE 4RF3A 4CM9A 4E12A 4F6CA 4AJHA 1EK5A 1HRDA 5U4QA 1Y5MA 5I7SA 4XQCA 1AN9A 4YCAA 1OAAA 3TL3A 3DZFA 2WD7A 1IL0A 5KKAA 1PJLA 3BTOA 4J16A 4BO4A 2G82A 1P44A 2VT2A 4MVJD 3Q3CA 4E30A 3KYDB 2G0TA 2P9GA 3FF4A 3IJPA 4YVFA 4P4NA 3PDJA 3ZHXA 3ANMA 2Y0EA 1C0KA 3EMKA 4RCVA 4CMEA 1EZ4A 4OSPA 3ZWPA 3ZDFA 1I32A 2G76A 3VH1A 1I2ZA 2HRBA 4ZHSA 5F3RA 4CM6A 1WW8A 3U0BA 3JCZA 1UR5A 4CUZA 3WWZA 1AE1A 4BKPA 4XQ9A 4HUJA 2HK9A 4IJKA 3WGYA 5K0ZA 3WLFA 4LCEA 3O38A 1CWUA 2C0CA 4GSKA 3WYEA 1DHTA 4HXYA 3RUEA 1ENOA 5EESA 1T2CA 2AA3A 5COAA 5F1KA 1P77A 5IZ4A 2PGJA 3SXPA 1B16A 3T7EA 4E33A 5MGBA 1T4BA 3BTVA 2HLPA 3PHJA 1MV8A 1LUAA 5CDYA 4XDZA 1E1NA 4OL9A 3AWDA 2Q2WA 4J7XA 3AI3A 3RUCA 2JFGA 4UUMA 1BVRA 3CUKA 1KIFA 1YDEA 1H94A 4NIMA 4E5KA 4KZPA 1E6WA 1FMCA 2DKNA 3NTQA 5TGDA 3CEAA 1T25A 1O5IA 3JD3A 3EY4A 3MJCA 4A7PA 4R51A 3P7MA 3H6KA 4BGEA 2ZTUA 4OYRA 1C0PA 5JLAA 2IZ1A 7MDHA 1J6UA 4BO0A 4AG3A 2WD7B 2GNAA 1LRKA 3GK3A 2BGLA 4D3DA 2VYVD 3LT1A 3WJ7A 3HQ4O 1IHXA 4Y6SA 1YQGA 3TRIA 5KOIA 3ZWAA 1GD1O 1NPYA 2YHIA 3UXYA 3FPLA 3W8FA 1NBOA 5EIOA 3DBRA 5C37A 1NASA 2QG4A 1MXHA 1TI7A 1W4ZA 5F1PA 1CIVA 3TL2A 1UXJA 2F00A 3KRTA 3GUYA 4BL5A 3O8QA 2I67A 4TZKA 2X5JO 2PGLA 5TSDA 3ZW8A 5G0WA 2QIOA 1T2EA 1XLTA 1LLDA 4H16A 4R9RA 1IPFA 4Q39A 4NJMA 4L4RA 1P45A 5AVOA 1NX6A 1HF3A 4R4JA 2WE7A 1HETA 3ZNPA 4F46A 5ILOA 5FYDA 2Y1GA 4K28A 2RHRA 3TFOA 3UGKA 4RPGA 5ER9A 4YRAA 3PWSA 1W6UA 1LQTA 4XJSA 4JCOA 1R12A 3ZWWA 2W90A 2NACA 3PZBA 3FNGA 3SC6A 2D1YA 5EINA 2X6TA 4Z9YA 3EZLA 1CDOA 3JYOA 3RUIA 1ZFNA 3QVTA 3RUDA 1NFQA 2PZKA 4L4XA 5FFFA 4CQMA 2JCVA 1Y9AA 4BOYA 3NJ8A 4IJUA 4FSHA 4J3FA 3AI2A 3MOGA 1TT7A 3FSRA 5LCXA 4IGEA 3IAHA 3W8DA 1EQUA 4K6FA 1I2CA 4IQ8A 3WLEA 5L53A 1HL3A 3SJ7A 5HRUA 4U8GA 3LVFO 3HADA 3I5MA 1U4SA 1GV0A 4MVJA 3DBRB 5TT0A 1T4DA 4RLHA 4XQGA 2X4GA 1BVUA 1OOEA 1UXKA 1NFFA 2FP4A 4CM8A 2O3RA 1E3SA 4QQRA 1VSUA 1FK8A 4QO7A 1BXKA 1WZEA 4Y9DA 1Z6ZA 1E1LA 4HFJA 3BMCB 3FR7A 4QUKA 1M6HA 3H3FA 4NK4A 4CLEA 4BKUA 5KTKA 3VDRA 1K6JA 3L77A 1PGNA 3LT2A 1OC2A 3ETEA 1Y81A 1C3VA 2FOIA 2B4TO 3AUUA 2EW2A 5KVSA 1ULSA 3R0IA 3S2EA 4KUGA 3WGOA 3CIFA 4OJNA 3GOHA 3MJSA 4W4TA 5TS3A 4LRTB 4BNXA 4Q3DA 4D42A 2P5UA 5JDIC 4QFCA 1VL0A 4BO8A 4GVXA 3CKYA 1RM5A 3HSKA 1JN0A 4II3A 4AL4A 4MDHA 1GTMA 2CDBA 3TF5A 3RJ5A 1GZ4A 2W2LD 3NRCA 3Q2IA 5G2OA 1O9BA 3VTZA 3TZCA 3LQFA 2Q3EA 1EEHA 1WVGA 2E6UX 2V65A 3D3WA 3O4RA 2WYWA 2HKIA 2OFPA 4M89A 4XGKA 1EE2A 3L9WA 2NTVA 1G0OA 3GVXA 4HWKA 3IMFA 3U49A 4GKVA 2B0JA 2Z95A 4CR8A 2VWPA 3I4CA 5C7LO 4R5MA 3UCXA 4ID9A 2O3SA 4WASA 3VKUA 1IYZA 1EVZA 2OOSA 2NM0A 1ZVMA 4ESOA 1ADBA 3WYCA 2Y1DA 4CLOB 2BFMA 2J5KA 4RPLA 5DBIA 4DYDA 1E7YA 4F45A 2EKLA 1GL3A 3OQ6A 3OJFA 4GMGA 1S6YA 3G0OA 5DOZA 4NU6A 1YWGO 4DC0A 2G1UA 4YJDA 4HFMA 2P4HX 1LBEA 4AJEA 3AY7A 2UYYA 1YKFA 1QG6A 4J2HA 3ZWYA 1SOVA 1LDYA 2JD1A 5G4LA 3PP8A 4LK3A 4YR9A 3S2IA 4EJ6A 2E49A 3BMNB 4XZ3A 3KO8A 2GUGA 5IZCA 2QW8A 2GO1A 3DTYA 1KOLA 3GNQA 4L74A 4PLFA 3SX2A 4R1UA 3KYCB 3PHIA 5TT1A 5A06A 1N7GA 2NADA 2O7SA 2FR8A 3GZNB 4HBGA 1XR3A 4GX5A 3VH3A 2ZB8A 2PZMA 2GERA 2WM3A 2HJRA 1T2FA 1U9JA 2DPGA 3HUDA 5AOVA 2DVMA 3S1LA 2H63A 3GN1A 2ZATA 3C85A 2AW5A 3OH8A 4IPTA 3DQPA 1KYQA 3ITDA 4RVGA 2YY7A 5C7OO 4DMMA 2ZTLA 4U0JA 3JQBA 2J3KA 3WWYA 1IHYA 3ENKA 3RU7A 3UICA 4FJ1A 5I9NA 3DB2A 4QECA 1L7EA 3GDOA 2R00C 5IF3A 2E4AA 4JLWA 2PNFA 3ZHYA 3JQAB 3NGLA 3ZGYA 4DPKA 1NXQA 3K30A 2DU8A 3QW2A 4PG8A 2JHFA 4DUPA 4MP8A 2YHIB 3C8MA 2X1HA 2VUSA 4CV1A 3OECA 5TQVA 4O6VA 4YJFB 1NAHA 4XR4A 5DP1A 2VYNA 1GY8A 4UVDA 2JL1A 1VJTA 5TJ9A 5F5LA 3H3JA 1BHSA 1JU9A 3ROPA 4B8WA 1I3NA 9LDTA 1V3VA 2NSDA 3HNPA 4OQYA 5COQA 2HMVA 2GRAA 2D0IA 3MZ0A 3VPFA 2JFHA 2JKVA 1PTJA 1R66A 3C1OA 2RHCA 2AHRA 1YBMA 1HE3A 3AFNA 3LDHA 1BXZA 1PZEA 2HQ1A 2EKPA 3LT0A 2C54A 1SAYA 4FD3A 3H7AA 2P2SA 3H5RA 2C29D 3I9MA 1OC4A 1Z7EA 4PIVA 1V3TA 1Q7GA 3NDRA 3OQBA 2D5AA 1PJCA 1VLLA 3UAGA 1DIHA 2E82A 2WTBA 4IM7A 3WMXA 1W8DA 3ZWXA 4E32A 4PLTA 4EJMA 1UUFA 4YAIA 2CSUA 4I9NA 1VJ0A 3O9ZA 4AJJA 1O6ZA 3I4FA 2GD1O 5IXSA 3GA0A 4E5MA 3KTDA 5A5FA 4K26A 1UZMA 1ZNQO 1JVBA 1CF2O 3RUFA 4TQGA 3R6DA 3HDHA 1SEVA 2VOJA 1R16A 5G0UA 1C1DA 2VCYA 4TRNA 4HNGA 4MVJG 1NM5A 4R3WA 5K6AA 3WQQA 1HSOA 3TSCA 3RASA 4A10A 4N54A 1Q0HA 1Y8QB 3JQFC 5HM8A 4R69A 3DFZA 4O1MA 2B69A 1SC6A 4J0EA 1E7WA 5DF1A 5BNIA 5JYEA 1PU2A 4LMPA 2OORA 4NG5A 2Q46A 4IIVA 5IFLA 3NT2A 3IC5A 3IP1A 3KETA 4NHEA 4LSWA 3F4LA 1CYDA 4WK6A 4GH5A 2HRZA 4DMLA 1A71A 2HK7A 3T4XA 1IY8A 2G5CA 1E7MA 4D0SA 1H9BA 1P3DA 5I7VA 1PZGA 1QP8A 1DJQA 3WGZA 4N18A 5A5EA 1DFHA 5KIAA 2PZLA 2JFFA 3ZWOA 1ISJA 1PQUA 4J4HA 4NU5A 3A14A 3C3XA 3K9QO 3BIOA 5CEJA 1UDCA 2IZZA 2BGKA 1I24A 4MVJH 4YJGB 4YAEA 1MLDA 1A9ZA 2X5OA 2O4UX 3GMSA 1R0LA 4WECA 5HS6A 2Q1SA 3AW9A 3H9JA 3WSVA 3ROMA 3NKLA 1DLIA 4D7AA 3E5RA 4PG5A 2BFOA 4IXTA 4PGFA 1CERA 1CQIA 4MVJM 3ZU4A 2DT5A 3PDUA 2PD6A 2O3UA 4LGVA 4NPCA 1GUYA 3GDFA 3W6ZA 2BFAA 1DLJA 1EQ2A 4W6ZA 1Z75A 4Q3NA 2BLLA 3U4CA 1PIWA 2PFGA 3FI9A 1DIRA 3U09A 4L73A 3WDSA 4IXWA 3OIGA 4M55A 5GMOA 2Y67A 3ZV6A 1JWAB 5J23A 4Q3AA 2HUNA 3D0OA 3PZRA 4PLVA 1KS9A 3RIHA 4A03A 2A9FA 2WDZA 4DA9A 3GAFA 5ILGA 3U5TA 3W6UA 1JTVA 3H9UA 2VOEA 2O2YA 5U1PA 4KDEA 4ZQBA 3VZPA 1H9AA 1DC4A 1C0IA 4CMCA 3JQGB 5GY7A 4BNNA 2D2IA 4OOFA 4BB5A 1XQ6A 2VZ9A 4TRMA 4HP8A 3AI1A 3UOGA 4PRKA 3JSAA 1N9GB 3FHLA 5CG2A 4ALIA 1BTOA 4U6QA 1G6KA 4MVJP 2WJPA 4EITA 2VWHA 3DZIA 4A26A 2B36A 3RKRA 4RL6A 3P2YA 4RVDA 3SJUA 1GYQA 2PLAA 5JYDA 5LDGA 1E6EA 3PQDA 1ADGA 1YL7A 1LSOA 1MFPA 1WMBA 5AXCA 1P33A 1AHIA 2D59A 3M2PA 4CM8B 3GRKA 2Y99A 1H5QA 3H4VA 3H5NA 4GSLA 3UN1A 3PIIA 4AJ2A 4BNYA 2X8LA 1LLUA 3R3SA 4XIYA 4FW8A 3JV7A 4QSMA 5ES3A 1LTHR 4PZCA 4DPMA 3QWFA 3GVHA 3Q9NA 4F6LA 2ZJ0A 3ROQA 4FN4A 1A5ZA 4JBHA 2E37A 3MJ4A 4ND1A 1A7KA 1XG5A 2AQKA 4G65A 3ITKA 2AEJA 2BMAA 2C5EA 2GF2A 4RZHA 1UJMA 5JY6A 1I3KA 2G17A 4C7JA 4CQLA 4GKBA 3ETGA 1YL6A 4LSMA 2J3JA 1DIGA 2FR1A 3RBXA 4WGGA 1WDMA 3CE6A 4JN6B 5ENDA 4WNIA 5JDCC 4XYBA 3GC6A 4J7UA 4UEOA 1GADO 3BAZA 3CXRA 3ENNA 3W8EA 1B14A 1M2WA 3E8XA 5A9SB 4O5OA 3BA1A 1X14A 2GZ1A 1X7DA 4RJTA 4RVSA 8ADHA 4NH4A 4CMJA 3G3EA 4J91A 4M1QA 2HO5A 5JAIA 1LC3A 1HDZA 2DFDA 1ZBQA 3WGTA 4FQ8A 2EXXA 1UXHA 3BTUA 1AGNA 4AICA 4PN3A 4UVGA 1E77A 5THQA 4PFJA 4KOAA 3KEQA 2DAPA 4MKZA 4WJZA 4BHTA 2ZYDA 1Z7BA 1HLPA 5CAEA 4EI2A 2ZQYA 1CEQA 1RYEA 1UP6A 3A9WA 3FNFA 3O26A 5A03A 1ENYA 2X58A 1TVEA 1E7RA 3GN2A 4YYZA 3ZCXA 1E92A 5L4SA 4JJGA 4RQUA 1K5HA 3H9GA 4DL9A 1NPTO 3IJRA 4PVCA 3ZU5A 1T24A 1XCBA 1JLLA 1PGPA 4BO6A 1SZJG 2PZJA 2YJZA 2BI8A 1PJBA 3E18A 1HE4A 3FBGA 4O0LA 4EGFA 2NU6A 4BVAA 2XF8A 3WSWA 3OETA 2ZB4A 4MP3A 2X9VA 1KEUA 1KY4A 2X0IA 1A9YA 4I9UA 4PCVA 3F6YA 2FPPA 3KYDA 1Y8RA 5T5QA 4MVJE 3E5MA 2HU2A 1PR9A 1DAPA 2Y1OA 1HYEA 1ZEJA 1NYTA 4YT2A 4IMPA 3JQ6A 4JBIA 1PGOA 4FFPA 3GMDA 4LW8A 4P4GA 2VNAA 1ZW1A 4FFOA 3D4NA 3KYCA 4F3YA 1D1SA 2PV7A 3OICA 4IDBA 1YO6A 5CPFA 2FR0A 4YDRA 2JJYA 4FGSA 4INAA 1P31A 3G49A 3WNQA 4L75A 2B4QA 4JP3A 1MP0A 2C2XA 2JCYA 2OP0A 3ONFA 2A94A 3E9MA 5B37A 4YXFA 1VL8A 2BD0A 2YQ4A 4MVJF 3UF0A 2ZCUA 4WLNA 5DOVA 3V2UA 1UZLA 1YH3A 3JYPA 1C0LA 4RZIA 1MFZA 4YTEA 2GASA 3JYQA 2PKQP 2EF1A 2HMSA 4UAGA 4XIJA 3DHNA 4RORA 4ALMA 1KVSA 3BMNA 4WOJA 1EUCA 4PVDA 3ZHBA 1C1XA 3ZWBA 2IRWA 2Y68A 2ZKLA 3UFXA 3ZW9A 2H6EA 3DDNA 4PLCA 5BQFA 4O59O 4UREA 4CR6A 4WCFC 1PSDA 3JQGA 3OHSX 4J1TA 4OM8A 4OHUA 1OBFO 3G79A 2PH5A 1LI4A 1EVYA 4ZGWA 2FPGA 2FY8A 2VTDA 1P1JA 1XSEA 4DREA 3EAGA 4XJTA 4DPLA 1YB5A 3JQ8B 1E1MA 4BO2A 5A4DA 2BKAA 3PRJA 5A02A 3C7CB 2AG5A 4LN1A 3VPXA 4E21A 4MKXA 2O4CA 1RWBA 4ZU3A 2Q2QA 1P1IA 1QMGA 4ZQEA 2QQ5A 1YVEI 3ZNQA 1LEHA 4FOSA 2HMWA 4NJMB 4CM5A 2YV1A 4B4OA 4EJ0A 4OGWA 4RGBA 3ZV3A 4XYLA 4J49A 1XDWA 3VZQA 1ISGA 1EMDA 2GN6A 4IDEA 1WPQA 4UUNA 3WTCA 1XYGA 4BNUA 3FWZA 4I1IA 5AXAA 1DRWA 1U3UA 3RKUA 3WNVA 5EPOA 1DC3A 2X7HA 4CM1A 3LF1A 3HN7A 5A3VA 4J90A 5CEEA 2WYUA 4ZJUA 4CLHA 1QR6A 2PTGA 4CLDA 1BSVA 3VPHA 1ZSYA 3EHEA 1ZK3A 1KVQA 3NAQA 2HMTA 3WQSB 4CQMB 3PIDA 1HDRA 4YT5A 5FEUA 1X1EA 1WNTA 4FFMA 4BNMA 1GV1A 1DO8A 3DAFA 2UV8A 3O8QB 5A9SA 1WLYA 1XQ1A 1V9LA 3ZH2A 2AEMA 1LLCA 1KEVA 4CJXA 3OM9A 1GYRA 5JC8A 3KOUA 1KVRA 2B35A 3DBLA 2C82A 3H9QA 4RLSA 4KP7A 4TVOA 1XEAA 4AJ4A 1EFKA 4FC7A 5FWNA 3ON5A 4HX5A 4RO0A 4AJNA 2CVQA 4CQMD 4NFSA 3C1AA 3B20A 3B1KA 4H15A 4NQZA 4PLWA 4E2WA 4DWVA 3UUWA 3UVEA 5B1YA 3ZNNA 1CETA 2C2YA 1FF9A 2CDCA 1KVUA 2X9NA 2CUKA 2NLOA 3DMTA 2YUTA 3JQEA 1PS9A 5CFZA 3FNHA 3OQ1A 5T8KC 5L7WA 1AHHA 4JNKA 2AG8A 4B4UA 1GPJA 2C20A 5DZSA 4XRRA 1PS0A 4ZRNA 1RPNA 1LRLA 3GVPA 4E13A 5TC4A 1LSUA 3U4IA 4R68A 2YV2A 2DLDA 3PI7A 4EDFA 2W2LA 4GWGA 4CODB 5IXYA 4Z0TA 1K6XA 2AE2A 2C7GA 2OZPA 3ZZNA 4CM7A 4OIMA 3INGA 3GZ4A 4RVUA 3GNSA 5DBFA 4B7CA 1NTOA 2FWMX 3MJEA 3SLKA 2QRJA 1BWSA 4BNZA 4J6FA 2GN8A 2J3HA 2FZWA 2TMGA 2DTXA 3DL2A 3WIDA 5BNTA 3WBFA 4D3FA 2ILTA 2YZ7A 3F3SA 3PJGA 1YL5A 1VKNA 2CFCA 4I5DA 4TZTA 4D3SA 4G2NA 4DXHA 4E5PA 5TX7A 1I2BA 3E9QA 5B4VA 3H2ZA 3A1NA 3I9NA 4W82A 1A72A 3WTBA 1HEUA 1O0SA 3IUSA 1LA2A 4URFA 4YQZA 1E3IA 3GEGA 2Q49A 3IDSA 1HE5A 4XYEA 4BNFA 4WCFB 2DBZA 3H5AA 1MGOA 4WLVA 3ZHZA 5JCXA 1NNUA 2I76A 1EVJA 3AY3A 3LZ6A 3AM5A 1P1RA 1Q7CA 1JQBA 4WKGA 4DQVA 4KUEA 1YB4A 3QWIA 4WLOA 3GGPA 4E2YA 2TMDA 4R1TA 4RPHA 2Z1MA 4L8VA 3TJRA 4FFRA 1Z45A 1GR0A 5JW6A 1ISFA 1ZKMA 2B37A 1IOLA 1U28A 4K9DA 3EW7A 5DNAA 3W4JA 1W0CA 1QLHA 5JAQA 4ALNA 2DM6A 1JDJA 1ONOA 2Q1TA 1GEGA 5IN4A 3DOOA 1RM0A 2NU7A 4J43A 5A9RA 5HWSA 1NWCA 4PLZA 2DBRA 3BHMA 1YQXA 4U0KA 4AFNA 1U8FO 3PK0A 4Z0HO 5CDGA 5KCZA 4Y98A 1B2LA 4EUFA 3NYWA 4NDNE 2PR2A 3I52A 1PQPA 4CMGA 3WG9A 5KVQA 3WGGA 4KUHA 4FFLA 2VHYA 3PYLA 4GGPA 3INTA 3L6OO 5JC1A 5L95A 4MIOA 2YHUA 4WCDA 3GVIA 2Y0DA 1P0CA 1IPEA 4IUYA 4E6PA 4EEZA 4W7HA 2I9PA 1ZSNA 1B26A 1SB9A 3M2TA 1EDZA 1HDXA 2I66A 3IUPA 5BSGA 1OFGA 1HYHA 2EEZA 2GN4A 3HHPA 3ASVA 3RI3A 3U9LA 4BNLA 4OXKA 1EBFA 4D43A 3F1LA 4GLOA 4CV2A 3SC4A 3KLPX 1I30A 1O94A 1Q0LA 1O95A 5KKCA 1WXDA 2Y1CA 1DOHA 3RFTA 3AU8A 3WICA 4KDFA 4E5NA 1ZXLA 1EBUA 3QVWA 3PYMA 1B8VA 1E3LA 3DR3A 5A9TA 5FI3A 3V2GA 3Q11A 3VKVA 3D4OA 3LK7A 1VC2A 4LMRA 3FTPA 4R01A 5FF9A 3TOXA 4BIIA 4DIOA 2DTEA 3KZVA 2YYYA 3ORFA 4IINA 4D41A 1JA9A 2XAAA 1NPDA 1UP4A 5TIIA 2IXAA 3QQPA 2VYND 4ALJA 1RM3A 1N8KA 1NFRA 3CTMA 3F47A 1ZIDA 2D3TA 3JD1A 2QZ9A 4IDDA 1LX6A 4N7RA 2B83A 3ULKA 4GQAA 1V0JA 3QWAA 4II2A 2IZ0A 3WGHA 2QHXA 1R0KA 1MC5A 1V6AA 4R16A 1ENZA 1X7HA 4FS3A 4OMUA 2QZZA 1YJ8A 3RC7A 4WNCA 3SBOA 3BXXA 3DZGA 3Q0EA 3RAJA 4RF4A 2J3IA 1YE3A 2WYVA 3TZHA 4ALKA 2VUTA 3Q6IA 4R54A 2ZYGA 3KUXA 2A4KA 4B3IA 1DEHA 4BGUA 2B4RO 4CMKA 6ADHA 1N2SA 3JQDA 3U62A 1HTBA 2CVOA 3KXDA 2BRUA 4Z0PA 2VYVA 3AU9A 2O3JA 1B8UA 4TVBA 3ETDA 4NFHA 5ENVA 3SLGA 3QA9A 5ICSA 2GDZA 3ASUA 3X2FA 4MIEA 1FDWA 3PLRA 1Z74A 5CDTA 3TOZA 3HWRA 1PWXA 2UAGA 3TWOA 4GWKA 4NMHA 1TT5B 1B3BA 1Y1PA 1QXSA 5BSHA 5JXWA 1NAIA 4Z3KA 4WOKA 1KETA 3QP9A 4BNKA 2V7PA 2I99A 1T2DA 1I33A 2WE8A 4DBZA 1DC6A 2VN8A 3RWBA 1A27A 3C7AA 1PZFA 2OGUA 3RD5A 1YJQA 2DUWA 3DEYX 5DBGA 3GNTA 5BSFA 1P74A 2EW8A 3DONA 1VRWA 3HFGA 3WYBA 3QY9A 3VOSA 2UUPA 1NVMB 4JJFA 5IDYA 1WP4A 2ZJ1A 1SPXA 3TQHA 4TKMA 1SCUA 4S1VA 2AE1A 4FR5A 2P68A 1MXFA 3GEMA 4U5QA 1CJCA 3QE3A 3JQAD 2Y1FA 5T67A 4JIGA 4W9NA 5T6BA 1FDTA 4AJ1A 4IZHA 2JHGA 3KSZO 3FR8A 2GN9A 1F14A 4J1SA 1FDSA 1D7OA 1R6DA 3RJ9A 1PL7A 5EERA 4HV4A 5HTOA 3L4SO 3WFIA 1DHRA 4FC6A 5F5NA 3HB5X 3GDGA 3DC2A 1LDGA 1HDGO 3I9JA 3HDQA 4E0BA 1B7GO 3BMQB 3I83A 2PH3A 2C7VA 5I7EA 1L1FA 1GPDG 4BGIA 3OJLA 3QVXA 1Y6JA 4WEOA 5JO9A 1UAYA 4PLHA 4NZ9A 1PZHA 3N74A 4ZQFA 3EZYA 1MC4A 3QHAA 1GQ2A 1DDOA 1XELA 1EE9A 1BG6A 4OO3A 4IJVA 3WJAA 3MWEB 1MG5A 4RDIA 3HG7A 3VZRA 1YBAA 1ISMA 2YDXA 4NBVA 3PGJA 5IN5A 2QYSA 2SCUA 1YOVB 1JKIA 5DCUA 1VPDA 1DIAA 2AMFA 4BKQA 3GFGA 3A28A 3IIEA 5DN9A 2FPIA 5I9LA 4IDCA 3V5NA 5AXDA 2NVUA 1YRLA 1V3UA 4DIFA 3DZJA 3ZWMA 5ITWA 3AFMA 1A7AA 2Q1UA 1VM6A 3PJFA 1GFSA 3E1KA 3PLNA 1JW9B 4MIYA 5JS6A 1VL6A 1U7TA 2YFQA 3X2EA 3PVZA 3L9XA 2EGHA 4ZA2A 5H83A 1X1TA 1ZK2A 4DLAA 4DYVA 3TNLA 4BNWA 2WSBA 4Y6RA 5AXBA 2YDYA 2VRCD 1WMAA 5CP8A 4L9RA 1HZZA 1OZAA 2D5CA 1DRVA 3M6IA 2IYPA 1JVSA 4XDYA 4MOWA 4PG7A 4IS3A 4J9VA 1Q7BA 1N9GA 1JKFA 1FDVA 1ONPA 4D0RA 4YJFA 5KNLA 1VSVA 4XCVA 3HN2A 3A06A 4CMIB 4IIUA 3SEFA 4P8RA 4IBOA 4FGWA 4BNHA 2DFVA 4YQYA 1LRJA 3ZNOA 3JD0A 3L4BC 3EGOA 4CUKA 3RVDA 4U7WA 3V2HA 4I5FA 4PLGA 4YRDA 1E3EA 2VRBA 7ADHA 4HADA 5KJCA 3K96A 5CPBA 2BGMA 3JQ9C 4ITUA 4J4TA 1WDLA 1PGJA 2O3QA 3KHUA 5IDQA 1QYDA 3EK2A 4P38A 5I7FA 2FSVA 4WEQA 3HE3A 3WB9A 4WUVA 1H6DA 1R4NB 2FMUA 5CDUA 1K2WA 1N1GA 2GYYA 3RBVA 2A35A 4YAKA 4XRGA 2H9IA 4GLLA 1KEWA 2PKQO 1NQOA 1ZZEA 2VHXA 2VUUA 4R41A 4ZQGA 1NQ5A 3JD2A 8LDHA 4XGNA 4ALLA 1E0DA 1I5RA 2O48X 3WQRA 3ICPA 1PJ2A 1TLTA 1V35A 3WOHA 3AUAA 1I8TA 2BI7A 1GCOA 2P4QA 3BHIA 3GZNA 4OKNA 1X7GA 3ANNA 4NNJA 4W7IA 3D7LA 4OQZA 3ONEA 4BO7A 3GQVA 4P22A 1ISIA 5L45A 4B8ZA 1IZ0A 3GH3A 2Q4EA 1G1AA 5TRTA 2R6JA 2GGSA 4H3VA 4Z9FA 1KY5A 5KJ1A 3MJTA 3FNEA 4DQUA 1QYVA 2PA3A 4YRBA 1S7CA 2NVWA 3OEYA 4QTZA 4A2CA 4R1SA 2Q50A 2W4QA 3SVTA 3CSDA 1HZJA 5GZ1A 3HZZA 4JBGA 2DUUA 4D79A 1PJQA 1BGVA 1HDOA 1Z73A 2I5PO 3N58A 3VH2A 3IL2A 1JWBB 1ZEMA 1Y5RA 1YXMA 2H1SA 2PD3A 3GHYA 3JQFA 3PFWO 1TT5A 2V6FA 5B4TA 3PHHA 1B3RA 5A04A 2NV6A 1ARZA 4QX6A 2BF7A 3AUTA 4FFNA 4QO8A 2Q99A 1E5LA 1R4NA 3ZU2A 3GG9A 2RIRA 2Y1EA 1U5AA 1ULUA 4UVIA 1V8BA 6LDHA 1DB3A 3DBHB 3TZ6A 3ZWCA 4B3JA 3NJ4A 3RUAA 1D1TA 2B5VA 3HFSA 1BDMA 2CF5A 4AJKA 4IMRA 3C1TA 2Y05A 2BHLA 4KMSA 1PL8A 3GPDG 1M66A 2FSSA 3B1FA 4PRLA 5DULA 1GAEO 5DCWA 5TNXA 1GU7A 1N92A 2V6GA 2IE0A 2HMUA 1U8XX 1ZK0A 3QWBA 5EQFA 5C5IA 4E2XA 2OBNA 3W4KA 1E1KA 5L40A 4AVYA 3AM4A 2NTNA 3LC1O 4YT8A 2HDHA 4ND4A 3ZWNA 1ZO8A 3LT4A 4HNHA 5F1OA 4I5GA 2VT3A 4ZN6A 2LDXA 3INRA 1L7DA 4HY3A 4DQXA 4GGOA 2RH4A 3DMTC 5CG1A 2VNSA 1X0VA 4W99A 3MEQA 1EFLA 3I6QA 3BMQA 3EUWA 2J8ZA 3D5QA 4GX2A 5T8KA 4YT4A 4OSOA 2CMDA 3K8ZA 2IYOA 1BW9B 2RBEA 4XR9A 2IDZA 4TRRA 5JNLA 4BS9A 5KJFA 1WWKA 3W4IA 3PWKA 1U1IA 1PJ3A 3S2FA 3RCBA 4R1NA 4NI5A 4YACA 5CEFA 1HE2A 2CNBA 1LC0A 2ZTMA 2Q45A 3BZUA 4FPXA 2X86A 1K89A 4IS2A 4RPKA 1PJ4A 1KVTA 9LDBA 3IP3A 2EHDA 4OH1A 2X0NA 4RVFA 1PWZA 3I23A 3JQ7A 4OXNA 3GUCA 1LNQA 5IG2A 4IZIA 4GAEA 1IE3A 2X23A 2EP7A 2ZYAA 4TMFA 3BTSA 4JJIA 1E3WA 5H81A 4B7UA 3H2SA 2ZIZA 1GZ3A 1B15A 3D4PA 3DHEA 3HDJA 3ZI0A 5G0TA 1TEHA 1MUUA 2CZCA 3CH6A 1U3TA 4M49A 3FD8A 4BMSA 1NR1A 3Q2KA 4ND2A 4C7KA 2YW9A 1I10A 1O89A 2OP1A 4M8SA 3VVCA 1F06A 4BKRA 1LU9A 4KTVE 3U4HA 1UXIA 4BO9A 4WE3A 3LU1A 1OMOA 3NTRA 5L7TA 2Q1WA 1LJ8A 3DZHA 3NEPX 5T57A 4BB6A 4IDGA 1QKIA 2R2GA 1DFGA 4JX8A 4CMAA 4TKLA 2Y66A 1ADFA 2AQ8A 3I1JA 3KYBA 1TA4A 4N5NA 4TWRA 4ONEA 4CM9D 5IJZA 5JBIA 3TZQA 3E48A 3L0DA 1JAXA 2Y93A 1WAMA 2H5LA 2NQ8A 2ZQZA 1HDYA 3K31A 4N5LA 2C59A 4XB2A 5ICMA 5COBA 3ZV4A 2BH9A 1JAYA 1F8GA 2CVZA 1C1DB 3GFBA 1HT0A 4PG4A 4XWYA 1DBVO 2O23A 1LDNA 3NDIA 3T7CA 3PTZA 4RPJA 1Y8QA 2FZEA 1ZMOA 1PEDA 4RV9A 2ZCVA 2P9CA 3FCOA 3FTNA 3OA2A 4XYMA 2V6BA 1LLQA 2Q2VA 2HK8A 1NQTA 1P1HA 2DTDA 3GF4A 4MINA 3NDJA 4L0QA 1UDBA 5HS4A 3NX4A 1G0NA 4H7PA 2OHXA 4HFRA 3PXXA 5DT9A 4EUHA 2DC1A 2P5YA 3RUHA 1ADCA 4CMHA 4JGBA 3KV3O 5KJEA 4E2ZA 3ROKA 2EGGA 1YGYA 4BUCA 4KWHA 1U7HA 1ZMTA 1ZXBA 5I8WA 4BKOA 4GI2A 5JMPA 5ADHA 3WS7A 3K5PA 3GAZA 1DAOA 5C3MA 4AJPA 2BELA 3D3WB 3F9IA 1D8AA 3DOCA 2GSDA 2ZB7A 1NVTA 1RM4A 4G81A 1IZ9A 4WCFA 1ISHA 2HCTA 4EBFA 4I5EA 3FBTA 3AK4A 3PHLA 3VH4A 5TJHA 3O03A 4MO2A 4TRJA 1VJ1A 4Z3DA 3ZN2A 1U4OA 4BO5A 2FN7A 5H82A 1QV6A 3JQCA 3MJVA 1Q0QA 4NFYA 1O8CA 2HAEA 2Z1NA 3NT4A 4UUPA 4QEDA 1ZJZA 1LDBA 4HKTA 3V1UA 1EUDA 3LLSA 4IDAA 3Q9UA 1DFIA 1M67A 3WBBA 4M86A 1IUKA 5JY1A 4RVHA 4BO3A 4LVUA 3DWFA 3GG2A 5B12A 1VI2A 1GDHA 3FN4A 3TPCA 3QIVA 3JQAA 3AOEC 4CL3A 5KJ6A 3QSGA 4GX1A 2HSDA 3DZBA 2NU9A 1GUFA 1XIVA 3UHAA 1E7QA 1HSZA 3GRPA 2WD8A 4BNJA 3KB6A 3WXBA 1SO8A 1X0XA 4MVJI 1HWYA 5F21A 1GCUA 1BDBA 4KQXA 4YEDA 5GZ6A 3ZV5A 2QRKA 1Q2XA 4FBGA 1J0XO 4CMEC 4BMVA 1J4AA 3COSA 2VZ0A 2CF6A 2J5RA 3TZKA 4CUJA 5I9MA 4LCJA 1FDUA 3KM0A 1ONNA 4KWIA 4YJHA 5DCYA 2NVBA 4XA8A 1F12A 5BT9A 1MA0A 2PY6A 4DTIA 1UXGA 1XHLA 2EV9A 4Q9NA 1QSGA 1ID1A 3FPCA 4UULA 3DAGA 2PWZA 3L6EA 3JQ7B 3E6AA 1D4FA 1QLJA 3D64A 3KVOA 4XD2A 5HA5A 4BNIA 2AQHA 1CQJA 3IKTA 3RBZA 3JQBC 2UVDA 1E3WB 4NK5A 4CM3A 3BYZA 4YJHB 5CDSA 3GT0A 1NQAO 1H0KA 3DBLB 3UCFA 4NBUA 4DBVO 4A0SA 4J7CA 2GR9A 3AY6A 4FOOA 1Z82A 3L4BA 3LLVA 3G1TA 4CMIA 3GGGA 2X5KO 3EC7A 2P91A 4GL4A 1QYWA 3LF2A 1E5QA 4J1NA 4CLXA 1QORA 2OL4A 3AUSA 3U4DA 3RC1A 2OUIA 2DPHA 5JE8A 2FHSA 1JKJA 5U9CA 2PK3A 3KSDO 5AQ1A 2Y0CA 5L51A 5G0SA 1NWHA 3NTOA 1XKQA 3T4EA 4CLRA 4CM4B 4PZEA 2EG9A 4J4BA 1C14A 3ADPA 4G5HA 4M54A 5A1TA 4UVEA 1HLDA 3LC7O 1UH5A 1H6AA 3I9LA 3WGIA 2QRLA 1N5DA 1I3LA 2I6TA 3OEWA 4DC1A 1TXGA 4BV9A 4DVJA 3GEDA 4YWJA 5JDIA 1H93A 3AOGA 5JCJD 3I6IA 1GYPA 3ZWVA 4CR7A 4LISA 4XB1A 1EUZA 3A4VA 3GGOA 4CV3A 2NUAA 4GMFA 5DDIP 2ZTVA 3S55A 1EDOA 4Y67A 4FB5A 4DRYA 1U2GA 3VZSA 3ADOA 3FWNA 4GBJA 3HJAA 2O50A 2VTEA 4N5MA 1SMKA 5HBRA 3NUGA 2NQTA 5KWEA 3DBHA 3MTJA 3HB4X 4CQLB 3F5SA 2ZK7A 2A92A 2JD0A 3E82A 3EYWA 4RQTA 1GEEA 4OXYA 3IS3A 5TLSA 1QV7A 4GVLA 3ST7A 4E31A 2JD2A 1YQDA 2JCXA 2POQX 3RU9A 4QT0A 1MX3A 1I3MA 1RKXA 2VHZA 2GPTA 1HYGA 3PFFA 1P1KA 3IQDB 1SB8A 3AM3A 4B4VA 4BGVA 1XWFA 2EWMA 2XXBA 3E9NA 3G1UA 4BQPA 1E3JA 4P4LA 5IAAA 4BNTA 2AQIA 2IODA 2BFPA 3MWDB 4YAJA 2J6IA 4JK3A 2HJSA 2GZ3A 1C1XB 2LDBA 1ZSVA 1SBYA 4PLPA 2VZ8A 1DRUA 1NR7A 5JPIA 1U3VA 3AJRA 3DMYA 5LC1A 2XPCA 4DGSA 3JQ9A 1N1EA 4E5YA 4WLFA 1VKOA 4J0FA 4I8XA 4S3MA 2VQ3A 3MTGA 3DXFA 4CPDA 3GVCA 2Z5LA 4YB8A 1XGKA 3L6DA 1R4MA 5BR7A 5DP2A 2YFHA 1IULA 4K6CA 1SNYA 4KQWA 1T26A 1TB4A 4AJLA 5C7IO 1T1RA 4FDAA 1XA0A 3QLJA 1T1SA 4HFNA 4ILKA 4MJLA 2XXJA 3F46A 1J5PA 3PQFA 3VAZA 1U3WA 1UAGA 3MCVA 3VPSA 3OMLA 1UP7A 4ZRMA 2RAFA 3NGXA 4TSKA 4A27A 5EN4A 4EUEA 1ZUD1 3GPIA 2YV3A 1KBZA 1U5CA 2PKRA 3GHHA 4WLUA 1AUPA 1PR3A 5JDCA 3STHA 1ZCJA 2W8ZA 3H8VA 3B70A 1LSJA 2OMEA 3DOJA
chains in the Genus database with same CATH superfamily
3AB7A 4LGYA 2QX7A 3T3MB 2IXFA 3BF7A 1ESMA 4KX5A 5DWQA 3LGXA 4X1KB 4ZMBA 2ZTSA 4H3HB 4BO1A 5EJAA 2RGNA 4YAUA 1RYBA 1AF4A 2QVGA 1O1YA 1OFVA 3RC2A 4UCXA 1ZL2A 1LW7A 1E3QA 3DT6A 3DVAB 1IIRA 1JFFA 3PFCA 4KK3A 3CMCO 2ECKA 1M5UA 1PQ4A 1PQWA 4P3OA 4ENSA 3ND9A 1E1RD 3K9FC 2WJWA 2X7XA 3L79A 5FWXA 1YF3A 1NBAA 2J48A 3V4VB 3LTEA 1UJBA 1FW8A 1BW9A 3AL3A 1OXBB 3EPRA 2VDUE 2ZSKA 3IP6A 3L7OA 3S2GA 4DG5A 2F90A 3PHCA 4OQPA 1L8QA 3SM3A 3PXEA 1I0ZA 4GNKA 2D8AA 4B3HA 1RHMA 1VLMA 3IKVA 4ZTUB 2WMDA 4FYWA 3QOWA 4ZHQA 1G5RA 1W5TA 4P3YA 4CL8A 3HPRA 3HL0A 3C3YA 2OBYA 2EFEB 2ZSEA 2COEA 3V2IA 2VRCA 2ZSBA 5EAIA 5MN5A 2QVYX 3C3EA 2PS9A 4CV0A 4ZCTA 2VQ6A 2BONA 4A16A 1NYLA 5I3CA 1SQ0A 1PT5A 3LSTA 3A58B 1NLMA 1X7ZB 2I6FA 3HYRA 4PYKA 2VA9A 4GUAA 3SPXA 2Q3MA 3PR1A 1X1RA 3IE1A 1G2IA 1XQXA 4TTIA 2OZLA 4IGFA 2XGGA 5L3ZA 4XGIA 1II0A 1AU9A 1NI3A 2J45A 1IVSA 4O2AA 2ODQA 4B5LA 5AI9A 3MMZA 1WNFA 5EJ2A 1PX0A 3NUQA 4JZKA 5IZCC 1U2TA 4JELA 1U3FA 4EEXA 1T0UA 3EXG2 1XA4A 5F73A 3T0IA 3UMGA 4EG5A 3D0RA 1UK9A 2K7ZA 1YB2A 2A67A 3QWHA 3L8CA 1MB4A 2MIIA 4BE4A 1M6YA 4FXOA 1R0ZA 2XDAA 5E7IA 3UH1A 4KVGA 3AHHA 1L4BA 3BCSA 2ORYA 3HYLA 1F51E 1VE7A 1ZJYA 2GJ4A 4GPBA 5K20A 3EZ9A 1XRJA 1E2HA 4QPPA 4JR0A 3UG6A 4OMFG 4XEHA 1WM1A 1CFJA 3I45A 1WUTA 1DKUA 2CHVA 2HRCA 5TARA 4A0HA 4EVQA 1J90A 3THXB 4IFTA 4CBVA 4AKGA 5DLYA 1ZD4A 3LHDA 2SKEA 4PLYA 4R8KA 3FVVA 5ESRA 4IVQA 2FXIA 4L72A 5K3FA 5JO0A 4PF1A 5INTA 1RYHA 3MWFA 4H4CA 1Y8RB 1P0MA 3R8FA 3CKMA 4BV8A 2PKXA 1RRCA 2X22A 1UPTA 1G17A 3MBIA 1Z6GA 3GIWA 4ZXPA 3SJAA 3R7BA 2YQ5A 2H7CA 2HRQA 2JJ8A 3BWVA 5LQCA 2E4XA 1PFQA 2H2IA 4EMTA 2B5WA 2DBVO 3RADC 2BKXA 1KMHA 1T8RA 1VHDA 1JLHA 3ECSA 2REBA 3HCPA 3IJEB 4MW0A 3BBPA 4B79A 2F1RA 3MILA 4GMDA 2BN4A 4B45A 2Q1YA 3LL4A 3TLMA 4M83A 3B78A 4Y2TA 5JAMA 1JEOA 5L7YA 4HWGA 3OIFA 1KPHA 1PUXA 4R7ZA 3LIPA 3PEFA 4UFPA 3IIKA 4EKYA 3NBUA 1AJEA 4IMIB 5DGTA 2B61A 3ABZA 4YAGA 2R5NA 4D80A 5LMNB 1U9IA 4MPPA 1KMMA 1Y7TA 1YNOA 2C2MA 3OZSA 1R8JA 1YDWA 4GDMA 3D5TA 3UH0A 2R00A 1SXJD 1RQPA 2K4MA 1QH1A 3A36A 3KQWA 3SSAA 2ZRMA 1GN8A 1TUGA 2HL6A 1ZITA 3QOYA 2Q3CA 1KY2A 1JHYA 4Q0MA 4RIFA 4WJKB 1KQOA 4YJGA 1UZAA 4D9GA 2EJCA 4QNRA 4ZI7B 3AVVA 3BGSA 1A98A 4BCCA 3SFTA 3TTWA 1WZCA 2HU5A 2NXNA 3NV9A 4YBZA 1HI9A 4XARA 4OAQA 4UXIA 3D1LA 1XKLA 3SZ3A 2BEVA 1DIBA 3TDKA 4M87A 5C1DA 1MPXA 4G9BA 1XTTA 1YOBA 3NHYA 4QNNA 3F5QA 1R4MB 4TM8A 1PYOA 3R8CA 2ZT6A 2GWRA 2KE5A 2ODPA 1S01A 2FMXA 4G84A 3VC3A 4QFDA 3T34A 3TLCA 1M54A 3GCWA 3PYXA 5JPCA 1RTKA 1W46A 2Q8NA 4TLMB 2ZUTA 3RTAA 1YRYE 1W34A 2CDAA 1KP2A 5IYZF 4UPVA 1G4UR 3MNFA 1D2EA 2GBGA 3HB0A 5KVCA 1EDDA 1PJSA 3Q41A 1PLKA 1DJNA 3Q5GA 4X54A 2JLZA 5BSKA 4DLVA 2GKOA 4EI8A 2YWJA 1MH1A 5THKA 2FCAA 1XU9A 3AL2A 1E64A 4M0DA 1KDYA 4AM8A 3NCHA 3TGWA 3UANA 3TVYA 3WFJA 2RKBA 4Q47A 1Q17A 9ATCA 4MH0R 1U8EA 4WXHA 2JIRA 4UCFA 3DKIA 2PKCA 2Q3FA 2FK7A 2FW8A 2ZJ7A 3HSSA 1I2MA 2REXB 3CZ5A 3GY0A 3H1TA 2Z2YA 4GR5A 5E3IA 5FLEX 3UJ7A 2O0MA 3S8MA 5LZ7A 5IEJA 1H6CA 2CZGA 2YOHA 4JA2A 2A1UA 3BFPA 4P9NA 4TKVA 2X9GA 1FJHA 4DSNA 1G2OA 2ZYSA 3R0XA 5EUQB 3ANLA 1CUEA 2C2ZA 3RC9A 3TFQA 3OJ0A 1G7CA 1K5PA 1DPGA 3TW6A 4OH7A 1BJTA 2XYRA 1AO3A 4XWWA 3G2OA 4ER3A 4A73A 3ESDA 4ED9A 4DIUA 1D6JA 1OLSA 5F12A 1XF1A 3L6CA 4PW0A 4R8VA 4DFDA 4W5QA 3R7DA 2GCGA 3OIYA 4YPVA 5EHZA 5FBHA 2WWFA 3AR3A 2E21A 4DCNA 1I51A 4KWCA 2OGTA 4AF8A 3N76A 4L4SA 4EGAA 2P9EA 2XV1A 4MV3A 3E8MA 4LPSA 4P31A 4M1MA 4QXRA 4H1WA 1QZ3A 3ANTA 1LDEA 3EDMA 1QPZA 2VBCA 1BQ3A 4AZ0A 1DX4A 4H7HA 5A3RA 3D2CA 3W3ZB 1DRJA 1H2BA 1PNOA 1EGHA 3QVOA 4JP2A 3RYCA 2QRNA 1E79D 4QG7A 1A4UA 2NNLD 3ZV7A 3JVDA 1G21E 4IY1A 1NNEA 4JI6B 1YHZA 4IDFA 5FUMA 5B3LA 2NU8A 5JJIA 1QTRA 3B82A 2ZAOA 3PC4A 4PYNA 4RF2A 4AJIA 1JLSA 2WNIA 3KSMA 2PX0A 2XCIA 4OJTA 4Y3UA 3B1ZA 4F9TA 1RMQA 2I2AA 6YASA 4DR7B 2HV8A 5GM1A 2D7DA 3V7NA 1GQYA 4P0PB 3BHJA 2QVBA 4G85A 2WBLC 2HIGA 1K66A 3DAPA 1QBGA 4R7GA 1YV9A 1RZUA 5KYUB 1OWLA 3OF2A 4OOEA 2H1HA 4PR0A 4F9FA 3W2FA 3I3OA 2CD9A 5F3DA 3ADCA 3EAFA 4BEJA 2W43A 2C5SA 2H48A 3SBEA 4J0KA 5JLJA 4M0UA 3KLMX 3KTOA 3MS4A 2EERA 2H29A 3U6KA 4NECA 3CLSC 2BEKA 3WGQA 5EPEA 1MOSA 1F5SA 3EG5A 1EUYA 1JDNA 2OBLA 3OT4A 3ELYA 5HUQA 3CW8X 5ITVA 4Z4CA 2XXAB 1J5XA 2IYYA 1Y6QA 2OXIA 3RROA 1M6NA 3CTPA 4QDOA 4B3XA 3F3KA 1SOWA 3TDNA 4EA8A 1LJUA 2XKBA 4X24A 3EARA 2YICA 3R3XA 4ARSA 3K9LA 1BE8A 3WLJA 4JKOA 1OWNA 5EI5A 3S1SA 4E4TA 1HKUA 4HHEA 4NBTA 2I8CA 4J0IA 3CNHA 4B48A 4G5YA 4DZZA 1R6TA 1YC5A 3OZCA 1PJ8A 2V6MA 5SV2A 1W4BA 2AEFA 4BASA 3HJBA 3KZXA 1TF7A 4JYPA 4EF6A 1Q84A 2DY1A 3AEQA 2OZKA 1NLUA 4B09A 3P2OA 3SS8A 1AG9A 3B6ZA 4KO3S 4LK2A 2X6RA 4WK4B 3ZCUA 1WHSA 4I4TA 5JCOA 3RYCB 2AVDA 1MX1A 1UL1X 2EIXA 1J56A 3JTMA 4R2LA 4JP8A 5HILA 1UT5A 4FKZA 3EVNA 2OMKA 1WZNA 4J9UE 1J0AA 1P18A 2IUUA 2O7RA 4AJHA 4UTRA 2ZQ5A 1TZKA 5U4QA 4HGYA 4O4IB 3ET5A 2FN8A 4PZ9A 3MM4A 4DCSA 5KCMA 1FFBA 3USES 1OB2A 1IL0A 3NQ41 3I9V6 3RF7A 2OO5C 3U3OA 4J16A 3ZWDA 6ABPA 4HDRA 1P44A 2XYPA 4BFZA 5JBQA 1UC8A 4MVJD 2HIMA 1NVUQ 1EB8A 2G0TA 2GUWA 3MS2A 5DX0A 3EX7C 1TRKA 3PQ3A 3VU3A 3DW1X 3CRNA 3CLKA 1J22A 4MJXA 4YVFA 4DA4A 3ZHXA 5BWBA 2Y0EA 3IUMA 1U3CA 3RS8A 4BLUA 4QLBA 1JTFA 1V8ZA 4CMEA 5JNTA 2ZJBA 1EZ4A 4OSPA 2JHAA 3TLXA 4EZIA 4ZIRA 5IBCA 1I32A 1DTWA 4WW0A 1JJVA 1ZUNA 2J3DA 1V2HE 3RABA 4RXUA 3D02A 1MEOA 2OB1A 3TVTA 2C9BA 2EL9A 4LKRA 4MICA 1WW8A 3V4LA 4CM6A 3JCZA 1UR5A 3HDGA 3K1AA 5EXSA 3NAMA 4PBSA 1AV6A 1WULS 1AE1A 2IYTA 1JU3A 4XQ9A 1U0EA 2PKYX 2ZAMA 3KX2A 5IS2A 1UKZA 3KJGA 4LBWA 1CR2A 4LF9B 2VDWB 1SUSA 1DHTA 4OTZA 2F8LA 3RUEA 3B2QA 5EESA 2HLDA 4OGGA 2EFCB 3GLHE 1USIA 5COAA 3J81A 1C30A 4FOLA 4FTWA 4JSYA 4OK3A 3ZZ0A 1MNQA 4E33A 4HRYA 1RHJA 2B3TA 4QTXA 1M2JA 1T4BA 1MV8A 1PG2A 5K3SA 4HUTA 1EFPA 4OL9A 4UFNA 3AWDA 5FOTA 5HFNA 2AFIA 2J0UA 2JFGA 3BG5A 3OT1B 4UUMA 4G41A 1H94A 1P72A 3C15C 5FWAA 4HVCA 4KZPA 1FMCA 1XALA 5TGDA 1QIHA 2O7NA 4M8NE 4MGEA 4E3WA 2BSAA 4C0KA 5F7ZA 3N0RA 4A7PA 3GV0A 4R51A 3LQRA 5DHUA 3PXUA 1W9HA 1VKZA 4TS1A 5A62A 2ZZKA 1BE1A 1BMFD 1C0PA 4Q03A 1U4NA 4B7AA 4EECA 4CQJA 4DUGD 4EDHA 5JARA 2CUZA 3FIJA 1TF2A 2VI5A 2WD7B 5GONF 1KY3A 3PF9A 2CFSA 3GK3A 4PXAA 4X41A 2VYVD 4GLJA 1GZUA 3PQ4A 3WJ7A 5EE9A 3NOOA 1VE5A 3V1NA 2EJUA 3EULA 3P9PA 3ZWAA 5LP1A 2YHIA 4CIDA 1X8JA 3CF2A 3FPLA 3H84A 2RGRA 3DBRA 5C37A 4IH1A 2XQFA 2WSSA 1TI7A 4AWBA 4GVPA 3GT4A 5DSZA 4E5VA 1X8XA 3TL2A 1UXJA 2F00A 2C31A 2ZPTX 1J23A 2C9CA 3GU3A 3KRTA 1XHFA 1F2DA 4GYJA 3DDWA 3M9LA 3NS7A 4BL5A 1S0UA 2X5JO 3KJNA 2OQIA 5TSDA 3TB4A 4GS5A 4MYDA 3FOAA 4MGIR 2QIOA 4DS3A 2HYIC 5KOYA 1LLDA 1QQ5A 3MCZA 1I7DA 5C34B 4G9EA 4B84A 1ZR2A 1PZXA 2W6OA 1K7EB 1L4YA 1P45A 2A9RA 1PJZA 4PSDA 1HF3A 4L95C 2WE7A 3P45A 5C52B 1E1QD 2RCNA 1VDZA 2QXYA 1IZZA 1G8GA 1Z13A 2Y1GA 3L0ZA 3MWEA 4FX5A 4OY3A 4IX9A 4RPGA 4XTRA 3LBAA 3TFOA 4D1YA 3PD0A 3M4ZA 3D3QA 5JFTA 2ETXA 1QUEA 1JIUA 2YCLA 3DL7A 4JSRA 4K3VA 2ERYA 3EC1A 3PZBA 5ALTA 3FFBA 1W93A 4IIXA 4H4EA 4CEJB 4DSAA 4YQEA 1CJVC 3ZOKA 1KSJA 3K0FB 1W4CA 2X6TA 2NYAA 1CDOA 3QA3E 1ZFNA 4KV9A 5HF8A 1H1LB 2BY4A 1RMTA 2JCVA 2GNPA 2J7PA 2IBSA 1DELA 4BOYA 3RIMA 3H2BA 3MGCA 5BN3A 5BNZA 3NJ8A 2CLLB 3PA8A 4H60A 1EINA 3NU1A 4F6RB 1M33A 3K9NA 1IAQA 3MOGA 2PVPA 5J58A 1DAFA 1OIWA 1W8IA 1T8WA 3A1SA 5TS2A 1XZKA 3BXOA 4IZOA 5E8RA 1I2CA 2WV9A 3GYGA 3ZDRA 1GT6A 1HL3A 3K16A 4MPTA 4O8ZA 5JNUA 4BFYA 1D7AA 3F9RA 2M1XA 5HRUA 4JLSA 3GJQA 3PUWA 3C98A 4OXXA 4F2WA 1II8A 3PDHA 1GV0A 4MVJA 4C20A 4DF3A 1O94C 2J4CA 3DBRB 4XQGA 2BFCB 1NJ8A 3LE8A 3M6AA 2R751 5TT0A 1NFFA 3X1DA 3U7HB 1OA1A 4HGNA 4PXSA 4S35A 3K09C 3N2YA 4QUEA 5BQOA 4F3RA 4NV3A 4IGKA 3ZHSA 5IBPA 1FK8A 2XZDA 5AKJA 5FOXA 5TVKA 1DOAA 1JR3A 1L5VA 4ZYWA 1YVRA 2IE8A 2VF7A 2DH5A 4NK4A 1L4EA 1SKUA 5KTKA 1JJ7A 2CVHA 4AMYA 3IMKA 1OC2A 2ZIAA 3LT2A 1Y81A 3ZIUA 1T9GS 1ULHA 1TAQA 3NB0A 3GPLA 1R0CA 4WZBB 5KVSA 1ULSA 5C1BA 2O8NA 1U99A 1ULZA 3S2EA 4OJNA 4PO9A 3HKEA 4BNXA 3VR4D 3DKRA 2P5UA 3AKDA 4K05A 3DEFA 4Y2XA 2W6PA 1SXGA 4G5FA 5KHAA 3HYTA 3BQ9A 1RM5A 2QD3A 3HSKA 1JN0A 3W90A 4NU8X 5KTRA 2I7TA 4JKIA 3RJ5A 3TCXB 4BU0A 3SNHA 3T7AA 2ODEA 3R4VA 3L3BA 3FPGA 1XRPA 2A14A 4B3SB 3SHWA 3EUAA 4UNNA 3D3WA 4MLZA 2JGNA 4M89A 4C08A 5ICGA 2WB4A 3L9WA 1UPAA 2PBFA 1RAFA 2YRFA 1MN6A 1VHWA 2JI8A 3IMFA 3OOYA 4GKVA 5ERXA 4DSTA 1V45E 2V55B 3O4JA 1QWOA 1JUDA 4L8WB 5A4JA 1F3OA 4Q4DA 2VWPA 2RJ3A 2LZ0A 3STWA 1COWD 4R5MA 3TR0A 3UCXA 3L7LA 1Q0UA 2GD6A 3SVZA 2BHNA 4F9GA 2NM0A 1ZVMA 5DSTA 5BVHA 1W5BA 4CLOB 2BFCA 3PGVA 1C4WA 3HA5A 1E7YA 2J0VA 2VQSA 3OQ6A 1GXSB 2TMKA 2X0KA 5C7YA 2A5GA 2NYVA 3IUEA 4GLBA 1MJNA 2AOWA 1EWVA 2GDJA 3FCXA 3L7IA 1YU9A 4I1OA 4S1OA 5E38A 1Z4NA 3A1VA 5EE0A 4DLSA 1CIJA 2ZSJA 1LBEA 1ZP6A 3FDZB 2X3UA 4KLRA 4MCHA 3HVIA 3ZWYA 5CNMA 2EDCA 4LK3A 4MK4A 2AFHA 3ZGXA 4G07A 1DBQA 1NXWA 1EP2B 2BEWB 4JT9A 3WRVA 4LCBA 3F67A 3KELA 4L22A 2HPZA 2RH9B 2JIZA 1ODJA 1OD6A 2EZ9A 2D13A 3KO8A 5EZYF 2W6MA 2XKKA 1PZMA 5IZCA 2QW8A 3DTYA 4I50B 5DHSA 4NAHA 4XIGS 4LQDA 3SX2A 4HUQA 3PHIA 3G5LA 4C03A 2NADA 2O7SA 4CHGA 1ZVKA 1RRGA 1U80A 1USVA 4PHHA 3N2LA 2QGFA 4QGFA 4C0LA 1T2FA 5SZIA 4QTUB 1NQVA 4LY3A 3AYXB 2GZRA 4OFBA 1PTKA 5TEVA 4QUHA 4LFCB 2YY7A 4QU8A 5C7OO 4DUZB 2YR0A 4BEVA 2JGLA 2D5BA 1I5OA 1Q12A 2P35A 4FFVA 4HDQB 4QULA 4U0JA 4LXTA 3FFXA 5EHIA 3IV9A 5AVTA 3F5MA 3V6MA 3DB2A 1RWKA 4HH4A 3CFYA 1KDZA 4XASA 2JZCA 1W2WB 3EGWA 3AKEA 2PNFA 1KYWA 3DEIA 3B38A 3ZGYA 3K30A 3QW2A 4XFDA 2RGNC 5DHTA 4CZ2A 4B40A 1FFEA 1UANA 2YINC 1JILA 3QYJA 4DUPA 1E20A 2QI9F 3UWPA 5BN1A 1XYYA 2X1HA 1SC4A 2R6GA 3U9SA 1DUVG 2MR6A 4Q7LA 2VF2A 4L7QA 5TQVA 1WPGA 3HR8A 4O6VA 4YJFB 1DKQA 2H7YA 2Q3HA 3OZVA 7YASA 4ZAWA 4UVDA 2JL1A 1VJTA 1KDVA 1XVVA 4CU2A 4IOJA 5KQSA 2WIAA 2Q4DA 3AEYA 3C3JA 1JU9A 3E7XA 4WWHA 2KS6A 1K4MA 3H5LA 5AK0A 1ZN7A 5EQTA 3P8ZA 4PNZA 4ENPA 1I3NA 2O0LA 2RARA 3JWEA 4OI2A 1O6GA 2B98A 2Q6LA 5EYPB 4OQYA 2QX9A 5COQA 5FPHA 4NULA 2OSVA 1VZ2A 3DTVB 3MZ0A 3VPFA 4QGGA 3JZFA 3ZY5A 4BV3A 2JKVA 4DV4B 4DA7A 1DNPA 3C1OA 4W6QA 5AVJA 2RHCA 2AHRA 1YBMA 2KI5A 3AFNA 4FQ7A 1PZEA 2DT8A 1LFDB 1GITA 1T6YA 2ZE8A 1FE8A 3ELDA 2WHEA 2Z2IA 4MYUA 1O96A 4OHRA 3MW8A 4F5YA 2C29D 3U7QA 3I9MA 1OC4A 1Z7EA 4PIVA 3WP1B 4RXTA 3TMAA 4JITA 2QIPA 3NDRA 3I62A 3N0VA 3UAGA 4DQ0A 4EB0A 1DIHA 5TQJA 4JY7A 2XKJE 4QNMA 2ZRHA 5FWXB 3WMXA 3ZWXA 1NVEA 1AX9A 2XIJA 4H3SA 4MRSA 1OXMA 1G5QA 1Q1ZA 4I9NA 5DHAA 4EZEA 4AJJA 3GFVA 4JUDX 1QVZA 3FOZA 5IXSA 5F5XA 3BS4A 3C8DA 3SU8A 4K26A 3DUFB 2VNJA 1JVBA 5K0SA 1KRXA 2CCJA 2PMBA 3V7UA 1LF5A 3S27A 3E2IA 5HKLA 4D4MA 4YDQA 1IXKA 1DJLA 4R3WA 4TRNA 1OQAA 1L5FA 2IQ5A 5G1PA 4HLQB 3TSCA 2IV7A 1Q0HA 1Y8QB 2D4HA 4ZVRA 1RJ9B 2ZJ6A 3ZK9A 1MABB 4FSDA 5EPUA 3ETNA 2BCEA 4O1MA 1SUWA 5DF1A 1H3EA 1GLVA 3K4HA 5AKEA 1H2RS 3D8UA 4XVUA 4HDCA 3LQ4A 1X1QA 5KTTA 5ARDA 3FRHA 3M49A 3NT2A 4AAYA 2WHPA 4F2HA 1WG8A 3NIFB 4B6QA 1XX6A 4A6DA 1CYDA 1C7FA 3SQNA 3FUVA 4C3UA 2Z56A 4BQOA 3LPDA 3I92A 3U9TA 1A71A 1A9XA 1ZJ5A 2XSZD 1NLYA 1X70A 3HBFA 2G5CA 2GESA 2IVFA 3GMIA 5A7FA 4F4DA 1H9BA 3HGTA 3ZDXB 1MW8X 1VG8A 1N1DA 2FWPA 1BA3A 3L1VA 3T7RA 1E2KA 1SQFA 5D2CA 1DFHA 1E6KA 2AV6A 2C0QA 5A5EA 2JFFA 1ISJA 1MQ8B 1XPOA 3MHPA 4G86A 4W1QA 3K9QO 2HK6A 3DZCA 1WMDA 1FNMA 2BGKA 1FFXB 3LY9A 1X2BA 4P35A 4LX8A 4LYJA 5ED4A 1Z37A 4DLLA 2IU0A 3QXHA 3EYAA 1A9ZA 3L7CA 3GMSA 3IDAA 3NP9A 3P4YA 1RD4A 2Q1SA 2VP0A 3H86A 3ROFA 5ALXA 1JA0A 1ESDA 1CERA 5HG0A 4MVJM 4EVIA 1N2ZA 4V2IA 3ZU4A 1Y8ZA 2J30A 4QDJA 4Y7DA 1NJ2A 4C29A 1ML4A 2DHQA 2VP4A 3KQVA 1QG0A 4UM8B 2QTVB 3I2GA 3R75A 3VSDA 2O3UA 1KYZA 1R18A 2EL7A 3TSOA 4RKEA 1KA9H 5ALLA 3G2HA 4GE3A 2EFJA 4MV0A 2V97A 3KBBA 5JSZA 3WWCA 5BMOA 3U26A 4P4SA 4DJ5X 4W6ZA 5AW0A 3AUFA 4UM9D 4HAXA 3WNZA 3C41J 2AH5A 2BLLA 2B25A 2D1FA 5E6UB 3NETA 2MCFA 5IM4A 3TUIC 3CEHA 5FNVB 5C8YB 2NU9B 1JWAB 3SY8A 4NPAA 3UJ8A 1O6FA 5DCLA 2GEFA 2RD2A 4C7VA 3PZRA 4PLVA 2IKQA 2WDZA 4DA9A 2IPOA 4Z4QA 5ILGA 3U5TA 1KP3A 4KR2A 1QC5B 2YC4C 3HKBB 4HAYA 4L5JA 4PQYA 3DXZA 1MJGM 3H9UA 2JFPA 4HMQA 1KWKA 3G2PA 2J5XA 1ADYA 1RXIA 4ZQBA 5C5CA 4RTPA 1DC4A 1C0IA 1OUMA 1UPXA 2IZ7A 3R6TA 2M9MA 2QRMA 1FZTA 2R65A 4KGXA 4HAUA 4WFKA 3Q9LA 4OOFA 4BP8A 1ZOOA 1KHHA 2RC6A 121PA 2YWDA 2VZ9A 4KN6A 1CP3A 4OB7A 3FCAA 3LX8A 2GMWA 3AI1A 3BWXA 2CYCA 4HP8A 2Y4OA 4NU0A 2KLBA 1D0SA 1F38A 3A9UA 3JSAA 4ZCRA 3NOQA 4U6QA 1MAVA 1VG0B 2OC4A 4UMEA 2OXCA 2W2MA 3GFQA 3LPNA 3N59A 4EPVA 1TUIA 4A26A 1OCEA 2WAYA 2VAWA 3E3AA 3FFTA 2LNDA 4R40A 5T3YA 1RRPA 4P6VF 1G21A 2FRVA 2VHEA 4IXMA 2DHDA 4FLEA 4P0QB 4E5UA 2AFIB 2PLAA 3SE7A 5TE9A 1D8TA 2ICAA 1OXXK 4S0XA 1E6EA 5IULC 3L40A 1NVAA 2HNAA 1K1EA 1CRLA 1N0IA 1YL7A 2VIIA 2NN3C 3L04A 4BMZA 3DLBA 4W8GA 5AXCA 1J97A 3FI0A 1OASA 4JBYA 3AY0A 2Y99A 1IBKB 2FB9A 1HUQA 2IHBA 4YRKA 2JEOA 4ZAXA 5BUQA 5LD2B 1X80A 2ZKIA 4GSLA 5EP3A 4DNPA 4RK1A 4GIBA 1J2YA 4EPRA 4AJ2A 1HNXB 2I4TA 4LYYA 3I53A 2X8LA 4XIYA 2QUKA 4QSMA 4KDCA 5TPZD 3D7SA 3U3ZA 3OZ7A 3GVHA 4F6LA 4FCVA 3PUXA 3GLHB 4EF4A 1A5ZA 5I01A 3LW7A 2E37A 3S29A 2PX5A 1A7KA 5IYZA 5IH3A 5J9FA 2AQKA 5FNVA 5C8YA 3ITKA 4X65B 4WJLA 5JS1A 1CYEA 3EF3A 5JQGA 3ZD6A 2G17A 3D2AA 1W19A 3G68A 2UZIR 4C7JA 5KOJB 1YL6A 3ZE0B 4GQBA 1ZLXA 1RS0A 1J2TA 3NIWA 1DIGA 2FR1A 3L41A 1NRIA 5ERYA 2Y27A 5B7PA 4IIBA 5ENDA 5BUSA 4BXOB 3GC6A 3IVAA 1LZLA 2W48A 4UEOA 3QX8A 1RE1A 2O1WA 3TLKA 5JTTA 1DV2A 1NBMD 2V7UA 4D81A 1BCRB 4D4KA 1JP7A 1M2WA 3EE6A 5A9SB 1XK6A 1L9KA 2W83A 5IMSA 5KTYA 1DDGA 4RVSA 5AW4A 4I99A 4AKTA 2COKA 2FE4A 2Q9CA 3DH0A 1LC3A 1HDZA 2XRYA 1HOXA 1JGTA 2YYZA 4FINA 3WGTA 3T3DA 4DA0A 2EXXA 1UXHA 3N6RA 3OZAA 4GBGA 4AICA 4PN3A 3KPWA 2AC7A 4UVGA 4WK0B 3ORQA 4JB8A 1V5IA 3CUEF 2BMFA 1G21B 3P0HA 2P40A 4WJZA 1D2AA 5CLHA 4BLRA 1I4DD 4BHTA 1QIKA 1E2LA 1IMOA 2BGTA 2C3UA 3WLKX 2ZQYA 4EA9A 3U3RA 4EI2A 2GEJA 3ZGZA 1UP6A 1UDRA 2B4YA 1TYZA 1POWA 1ULAA 2HF8A 2OBBA 1H2ZA 1ULTA 3FAKA 3O26A 4KO1S 1AMOA 1L5NA 3PX7A 2DP4E 2XNCA 3OI7A 1B0PA 4DY4A 1H1LA 1IQPA 5IW8A 2CV2A 2WNSA 3LRTA 1E92A 3H9GA 3GEPA 3IJRA 1W88A 1PR6A 1M8KA 3V55A 1RYFA 2FI1A 3TQSA 3VHQA 1PEYA 3HM9A 3SSOA 4ZVQA 4FEAA 1W7AA 4IDUB 5JCOC 1FLNA 4ZOQI 4HL6A 1HFKA 4Z4IA 2BI8A 1RVV1 4FFDA 1BZYA 3QTBA 4EGFA 2JH9A 4EQZA 3TKAA 4BVAA 2BGJA 3TAHA 1CNEA 2XE6A 3WSWA 4MS4B 2VF8A 2HJ9A 5DYYA 3L0IB 2ZB4A 4CF3A 5K0CA 1E2UA 2X9VA 3OHMA 4AC9A 1A9YA 3LRXA 2FPPA 3KYDA 1THMA 1Y8RA 2NSLA 3R2JA 5T5QA 4BE9A 2P78A 1QRTA 1NVWQ 2QPLA 4L8YA 3EIUA 4CKCB 4L27A 2HQSA 1HYEA 1NYTA 1UJ4A 3MWDA 2QP4A 4IMPA 3P0RA 1XJ5A 1PGOA 3AR6A 3MUEA 2I1WA 5AJZA 5D85A 3GMDA 1FSPA 2PYZA 4LW8A 4P4GA 2VNAA 1ZW1A 1Q0SA 1FSGA 2RE8A 1M8JA 4CG1A 3FM9A 4Z4FA 1WMSA 3GFOA 4H1UA 2PN1A 2XR1A 4D8WA 2WJHA 2A5YB 1OREA 3P2IA 4IDBA 3RSOA 1AKQA 1MTOA 3KT0A 4ZT2A 4EM6A 3NWPA 3OKCA 1SKYE 3EDRA 1XTQA 3SD7A 1E2JA 3G49A 4KPEC 1JECA 3RVSA 1EK0A 3C3WA 4MV6A 3K2QA 1RWQA 1UBMS 3HB1A 1A8QA 5AD1A 5FH9A 2B4QA 2DPLA 1SIUA 221PA 2OP0A 2GB4A 2AOTB 3E9MA 4YXFA 1VL8A 5F3WB 2FKAA 1JMKC 2WUFA 1KYYA 2YQ4A 2ZT8A 3TQOA 3GJ4A 5FUYA 2JJ2D 3MTQA 3I01M 4QUAA 5FPSA 1RXCA 4IILA 2F7SA 1Z63A 3LFTA 4RL4A 4D9IA 1KRWA 1QCCA 1WF3A 3JYPA 1CUCA 3ORRA 4RTQA 2FPRA 3KR0A 3KXLA 2EP8A 1MFZA 3JYQA 2EATA 2JLUA 1SBHA 4XIJA 2HJGA 3IPRA 3L1JA 4KR3A 4JOSA 1DTSA 2QJTA 1DADA 3BD6A 4ALMA 2VTVA 4NY1A 2EFGA 5IAEA 3DC7A 4Y1EA 4Z0NA 2NXEA 1R88A 1ZI9A 3IB6A 1AQUA 5F23A 4YJ3A 3CQ9A 3PRHA 4WV3A 1ZI6A 3C4QA 1Y5IA 2JATA 4LUCA 1EX9A 1GKKA 1SUFA 2MT9A 1WF6A 4BMDA 2QMQA 1XRQA 1ZH2A 4PLCA 3T5CA 3NBMA 3ND7A 1RXEA 3JQGA 1VA5A 3QYPA 4UNSA 3CLRC 4OHUA 1K92A 1D09A 1TAGA 1EG7A 4WZ6A 1PLJA 2PH5A 4M1TA 4MVYA 2FY8A 1GQFA 2QBYB 4LRQA 5E4FA 4ETMA 3WLHA 2OBFA 2FWBA 1E1MA 4X6YA 4OHYA 4B3TB 2ORVA 4M1ZA 5TQ2B 2R87A 5JD5A 4LVOA 5EIXA 3VPXA 1N2HA 1QGDA 1UKBA 1Z3IX 2YN0A 4H4DA 3A4LA 2FUCA 5F2KA 4IDXA 4J0QA 3I04M 3O8DA 1TJ5A 5CDFA 3BCHA 2PGOA 4V0RA 4UPEA 2E55A 3P20A 5D6OA 4F3KA 1DO0A 2VXOA 4Q9IA 4ZHQF 1YVEI 3UMMA 2GYUA 5IAJA 4FOSA 3S8EA 3WZLA 4H7FA 4MV4A 3RTCA 4CN8A 2AFRA 1AZSC 2CBGA 1PE0A 3KUUA 4UHFA 4EHJA 3SC2A 1EM8B 2E5WA 5E6SB 2I0FA 4J49A 1XDWA 4EY8A 3L7BA 1E9RA 3QITA 1Y1TA 5GONB 4UUNA 3WTCA 4CKBA 3DR5A 4QXQA 1OA0A 2Z5FA 5I7UA 1C0EA 2C04A 3MGAA 2QTGA 3STYA 4DN6A 4O4HB 3HN7A 4M22A 1WV0A 2X8AA 2M32A 4CLHA 1T10A 2B21A 4WY2A 2PTGA 3RVRA 1IRXA 4MYSA 4R8LA 1BYIA 4RHTA 3D6FA 1KVQA 1EJBA 2HMTA 1TM2A 1W30A 2O19A 4RELA 2H8GA 1YUBA 4QDZA 4HGQA 1TM7E 4YT5A 3RRYA 4ZJZA 5FEUA 4IF4A 1QFMA 1X1EA 2Q21A 2W70A 5DYIA 4FFMA 1XWWA 3H0EA 3QKSB 1Z15A 4BNMA 5ILQA 4W9MC 2UV8A 4A8HA 3ZJTA 3IE0A 3O2JA 2NUPA 3BN3A 3W5BA 2XRZA 3DE2X 3M1YA 2BGRA 1V9LA 3D6TB 2PSDA 3ZJYA 3GGJA 3CUVA 1LV8A 3DDUA 5EUMA 1LPPA 1F8YA 1L7PA 4CJXA 3ISTA 5EIEA 3KOUA 2B35A 3QPBA 5CX1A 1V96A 3BGVA 4Y2SA 2XGOA 4AF7A 3W3AA 1BX1A 1UPCA 4CQMD 4C1BA 3ER9A 3DV0B 3PKZA 4H15A 1S96A 2VLIA 1UBJS 2GD0A 5SY9A 1QGYA 4DWVA 2BM8A 1EFVB 3DM9B 3H17A 1EK2A 1CETA 2VH1A 2JI9A 1SG6A 2JBWA 3QG5A 3S70A 1N2BA 4CIBA 3A04A 3ZHOA 2CUKA 1I6WA 2H2FA 4OUDB 4UAJA 5D5HA 1JA1A 2A0UA 3FNHA 1KMQA 4RM3A 1HTTA 2V4ZA 2FUNB 3BC1A 3OQ1A 4DLZA 4JNKA 3PNBA 4F11A 1NC3A 5GVSA 1N9KA 2YBDA 5FB3A 3GVPA 3PQ6A 3VV3A 3WADA 2E85A 5IMBA 3ZD9A 3L4KA 1Z34A 3B3AA 3I12A 3D7MA 3A0UA 3M6FA 5K0NA 3PI7A 4EDFA 4OL0A 2W2LA 4LNUB 1ZJ6A 4S1PA 2VHTA 3M6UA 3S0JA 4UARA 3TSWA 1M8FA 2FF5A 4LIPD 2C7GA 2KBEA 3QUSA 3ROEA 4WHMA 4IUCS 1NBME 5DBFA 3DLTA 3GNSA 1GAXA 4IOMA 4C89A 3SLKA 2OZLB 3I5YA 4DB4A 3G89A 4J6FA 2GN8A 4TV8F 2YJTD 1UDXA 5BNTA 2V7QA 3ZVLA 3PBKA 4PTYA 3UAWA 4URZR 3ZQ4A 4RIIA 3N8NA 1N0UA 1XVAA 2ILTA 5IKPA 1CB7A 1A9QA 3ZZMA 1CJBA 2WR8A 3QKRA 2QN6A 2FDCA 1LBQA 1RADA 4DLKA 3AW8A 3E9QA 4GZ3A 1TYAE 4AXBA 1Q3TA 4M9XA 3KKLA 1HEUA 3W5DA 4OHVA 3SS7X 1WB6A 2C1ZA 4L5YA 1E79A 4QUIA 1Z5VA 4TUYF 4ZO8A 2B4KA 4YQZA 1E3IA 2ADFA 2AUTA 3GEGA 3ML1A 3RG8A 2C77A 1OBVA 3PEEA 2WUVA 3W3AH 2ZU0C 3BB1A 3H5AA 3AMVA 2V54A 1OYWA 1JDUA 4QOIA 3UATA 1UQUA 2YZ2A 2O8BA 4XX1A 2A9OA 3QMMA 4WKGA 5HOQA 4JUIA 4RV4A 4TXJA 1Q3HA 3FTFA 3TUJC 3P0EA 3HJFA 3KE8A 1OWOA 5FTMA 2ES4A 4R1TA 3U4QA 2EBHX 4RPHA 2Z1MA 4TS4A 2C7BA 3FHCB 3T7SA 1VJ5A 3BJEA 2ZJYA 3M6WA 4PSKA 5FHRA 1ZA1A 1GR0A 1RLIA 1MRNA 4LZJA 4N8EA 1FYFA 3UMFA 3W5VA 3O47A 4E88A 2HW8A 3CNOA 5DNAA 2BH2A 1N25A 1OWPA 3C6XA 3CF4A 3FLMA 3HDVA 4ALNA 2BW0A 1SA0A 1JDJA 1NW3A 1UEJA 1ELOA 4AZWA 4WZBE 3LY5A 2G9RA 3DOOA 4LWPA 4M0EA 5IN4A 1ORWA 3K0AA 4J43A 5HWSA 4HB3A 4NE2A 5DXFA 3BHMA 4KXMA 3ZGLA 4DZTA 1YQXA 4ZGGA 4U0KA 2OCGA 4AFNA 1U8FO 1GXSA 3P71T 4MB0A 1YQQA 4LZOA 5CDGA 1ABBA 3WGNA 4C78A 3U4GA 5CB0A 4Y98A 4YR7A 3DL4A 3W78A 5BV1A 3HRKA 3O84A 2EZ4A 2BMDA 4UFOA 4NDNE 2MTBA 3I52A 3KVYA 1ZAKA 4V0MA 3ZX5A 2Z8YA 5A0FA 3WG9A 5JSZB 2EOAA 3WGGA 3FZGA 3M9WA 4I2VA 1APBA 2VHYA 3LUHA 4Q05A 3RYIB 2QR2A 5F9HA 2EBUA 1CUYA 5AOCA 1NVVQ 4X6XA 5DNYB 1UFVA 3L6OO 1RXSA 5K0GA 1O7JA 1WIWA 1ZC3A 2G7ZA 2G28A 1NYRA 2WV7A 5FTKA 1HYQA 4JDPA 1GG2A 5KTPA 1Y3FE 2NTYC 2H92A 1V1MA 1SB9A 4JVOA 1IXRC 4EYGA 3NH9A 6NULA 4P80A 1GSHA 4C7BA 3VR5H 2GN4A 3F6BX 5ESDA 1PG5A 3ASVA 4GOND 1B8NA 1Z22A 4BNLA 1PFGA 5FXMA 2OQRA 5EKSA 4KRXA 3HLYA 4Z86A 2C7QA 4KYUA 3GYBA 3SC4A 3JATA 3V8NA 4MQBA 1I30A 1O94A 2GBLA 2R8PA 2MSDB 2OGSA 1CZHA 4R1LA 2NZ8A 4R9NA 1AXRA 1L7BA 1YZFA 3OTQA 4WNAB 3WICA 1PT6A 5CB8A 2QAGB 3WLRA 1JDBC 4LJSA 1LKZA 4E5NA 4DR6B 1B8VA 2OB2A 5A9TA 1ZD1A 3I4LA 4BFSA 3URKA 1TCBA 4LMRA 3H4MA 4Y1FA 2GX6A 2OY0A 5FF9A 4BIIA 4IFEA 2Q0SA 2QORA 2DTEA 3KZVA 2YYYA 3ORFA 5FJJA 2XAAA 1UP4A 2IWRA 5KYWA 1NUUA 5TPWA 2PMCA 1RWOA 2VYND 4QU9A 1RM3A 1NFRA 4M0KA 1YB7A 4NCHA 5DLQC 2HDNB 4HD8A 4JU8A 2C8JA 1A82A 4IDDA 4NOJA 1Q5PA 4XOIA 8ABPA 2QU8A 4GQAA 3ZWKA 2PUFA 4PQGA 1EUQA 1AURA 1UM9B 3TG8A 3WGHA 3L7AA