4YK7A

Crystal structure of s-hydroxynitrile lyase from manihot esculenta (his103leu)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
b'MVTAHFVLIHTICHGAWIWHKLKPALERAGHKVTALDMAASGIDPRQIEQINSFDEYSEPLLTFLEKLPQGEKVIIVGESCAGLNIAIAADRYVDKIAAGVFLNSLLPDTVHSPSYTVEKLLESFPDWRDTEYFTFTNITGETITTMKLGFVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKIFLPDFQRWQIANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVADAYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (S)-hydroxynitrile lyase
molecule tags Lyase
source organism Manihot esculenta
publication title Crystal structure of S-hydroxynitrile lyase from Manihot esculenta (His103Leu)
rcsb
total genus 95
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yk7A00
4A16A 1HPLA 1QFMA 5C8XA 4DNFA 2WUFA 3H1AA 5EGNA 1MO2A 2VSQA 2IX9A 1Q0ZA 3PFBA 1GKKA 2JGFA 1VKHA 1YAJA 3WL6A 4KE6A 4UFNA 5DNWA 2R8BA 3H2IA 4P9NA 4ROTA 5DYWA 4H7DA 3FYUA 3CXUA 1H2ZA 1F8UA 4Y2SA 3ZPXA 3V48A 3FCYA 4X7BA 5HF5A 4U2EA 2G63A 2XUGA 5K3FB 4L0CA 4EY5A 4B84A 4GEGA 1LPAB 3L1HA 1F0PA 3V1MA 5ISMA 2XB6A 2FJ0A 3I28A 3Q8WA 2QTBA 4BDSA 2PSFA 2YYSA 3O9VA 4JUIA 2HIHA 1XLVA 5JASA 2QZPA 3WK6A 1XRNA 3F9CA 1DX4A 2QM0A 3JYHA 5AI8A 1FSSA 1JJIA 3BF7A 3H2HA 1YA4A 2XUJA 3FYUB 2WUEA 2AJDA 5ALMA 3A2NA 4XX1A 1TCBA 4DMCA 2PPLA 5EIAA 2XMDA 3D4LA 1EDDA 1MJ5A 3D3NA 4Q3OA 4GDMA 2AJ8A 2HU5A 4A5SA 5EHNA 1XKLA 1CUAA 4BB0A 4J0GA 4YASA 3I2HA 4H7JA 1UK9A 1G66A 1R4ZA 2GZRA 3I1YA 2YXPX 1W75A 4DNQA 1OXMA 1WCYA 4BVKA 3W04A 3KDAA 5HK8A 2XUPA 3F98A 4X71A 1C7JA 2CBGA 5D7BA 3C43A 5LZ5A 1IUNA 3S2ZA 1J06A 1YA8A 2XLCA 1UWCA 2ACEA 1MN6A 3JWEA 2D0DA 1W52X 1QIGA 3STVA 2RGUA 1QTIA 2Z8ZA 3DYVA 3IUQA 4PSUA 5K5EA 4YK7A 4Y7DA 1AC5A 3DNMA 4Y2RA 1F0NA 1IUOA 1GPKA 2B20A 2BJHA 4XVCA 2CB9A 3HSSA 4CG3A 1R9NA 3H2JA 2PUHA 3TGLA 2WIKA 3I2KA 1GGVA 4KYVA 4Q05A 4ZI5A 1AKNA 1WHTA 5HK9A 1Z68A 3C6ZA 3FCXA 5AICA 3MVEA 5ALDA 1R50A 4DNOA 2JGLA 1AZWA 4RE6A 4K6KA 4ZXFA 5JAPA 1ZIXA 1TCCA 3T52A 2V9ZA 3C70A 4BYMA 5JALA 5K3DA 1CUGA 3I2JA 3W2TA 2CMFA 4U2FA 5AI9A 5LZ4A 2OCIA 1QO9A 2HA2A 4KE9A 5E2IA 4BAZA 4H35A 2WJ6A 1T2NA 3CCBA 3QPAA 2OCGA 5BOVA 1MAAA 5JD4A 3D7RA 2BUCA 2PSHA 1VXOA 4G9EA 5AM3A 1CUFA 4C4ZA 4WDRA 4G4GA 2JGEA 4X97A 3QH4A 4FNMA 1XRMA 2JGJA 2Y6VA 2ZVDA 3WWCA 4HAIA 1LPMA 3ZV7A 3RM3A 2HL6A 1W6RA 3VXKA 2QS9A 2HA0A 5DNVA 1R88A 1DINA 1GQRA 5DYYA 3WKDA 3IDAA 1ZOIA 4GI1A 1KEZA 4C6HA 4OD0A 2H7CA 1UKBA 2OLEA 4Y2QA 4DYHA 1O6GA 1BCRA 5AKHA 1Q83A 2XUIA 2OAEA 3ESBA 5K3CA 4E11A 2Z5GA 4L3WA 1CR6A 3CN7A 4GLBA 1Y7HA 2DR0A 3PF8A 5ALGA 1A88A 5HFNA 1Q84A 4PQEA 1A8SA 1YCDA 4B82A 3FYUC 1UK8A 2GYUA 3DQZA 5I8PA 4CCWA 2Z3WA 2XMGA 3HACA 1E89A 3LLCA 1MNAA 3ZWQA 5SYMA 2JGKA 4TPKA 1EH5A 2BUAA 3QBJA 2ACKA 5E4YA 5AKJA 1DWOA 1DX6A 2O7VA 2XT0A 4W1QA 4MEAA 2DHEA 3IIIA 2PU7A 5EHQA 1B41A 1WOMA 2ORYA 3DOIA 4X6YA 3ESDA 3DD5A 1XQYA 3KXPA 4AO7A 1A8UA 2D5LA 1X2BA 5AO9A 2H7XA 5BWCA 1EDBA 4H0CA 4EUSA 2OCKA 1CUXA 1DWPA 4N8SA 5ALPA 3QM1A 3QPDA 4CCYB 4QNNA 1TRHA 1XLUA 4MWSA 3KOOA 1PFQA 5AI6A 3C87A 5HFAA 4BAGA 3NOXA 3AFIA 3S8YA 4OYYA 1CUVA 4AQDA 4CG1A 3C6YA 5A62A 3IUJA 5A7GA 2JEZA 2DQZA 3A6ZA 1QONA 3GA7A 3BDVA 3QITA 1XFDA 4G8CA 2XLBA 3C8HA 1ODTC 1XQVA 5ALWA 2ZYRA 5EFZA 3U0VA 1UT6A 1WB5A 1EK1A 1NX9A 2AJBA 2RONA 3FBWA 5EHZA 2AXEA 4V2IA 4OPMA 3KD2A 3KWFA 2PX6A 2NW6A 1QFSA 3HI4A 1GQSA 4J03A 3X3HA 3DCNA 4B85A 4CI9A 1LZLA 2QUAA 4QWMA 2I78A 1QJ4A 1G4HA 1ORVA 3G8YA 3R0VA 1QIIA 1RP1A 4AMYA 1RWQA 3L1IA 4GWLA 1GXSA 4B7ZA 1XZDA 4Z49A 2HADA 1U8EA 1ZJ5A 3BJRA 3VJMA 4BATA 1XZBA 3AJAA 3IUNA 1ZD4A 2WG0A 1UK7A 3DEAA 1BCSA 3DL7A 2XUHA 1VE7A 5JANA 4BRSA 1ZI6A 5CXXA 3ZI7A 5FOQA 4RPCA 4WY5A 3F67A 2ZYIA 3ED1A 4X00A 3WQHA 3K6KA 4BBZA 3TEJA 2B9VA 4DM7A 4LXIA 4X90A 3ESCA 3ANSA 3U1TA 2PKYX 3C6XA 1EINA 2RHTA 1BEZA 2WJ4A 5AKXA 1RYYA 2B4KA 4G4JA 4QLAA 2DQYA 4F60A 2BGRA 4KE7A 1MX1A 5LKAA 1ZD2P 5CT8A 3BIWA 1YS1X 1CUYA 4MEBA 5CH5A 2FJPA 4J0DA 1QGED 3ZLUA 1ODSA 4GECA 2CZQA 3IA2A 3ICWA 5HF6A 2EDCA 5E4JA 4J0KA 5AKKA 5IH7A 1WB6A 1BN7A 5HQ3A 3VDXA 1E8DA 4CIAA 4FTWA 4OYLA 4AMZA 3SWWA 3QPCA 1D07A 5ALNA 3WIBA 3STYA 4M0MA 4QDXA 2Y2UA 4Y9SA 1UK6A 2G4LA 3O4GA 1QIMA 3P2MA 2WU4A 1LPPA 2I3DA 1XZKA 4HXEB 4BZWA 4BP9A 3O95A 1XZCA 4OB8A 4O08A 3B5EA 4EA6A 2R11A 2XDWA 1ACLA 3HC7A 5ALSA 2C5GA 5ALTA 2VJBA 3WWDA 1AGYA 4WFKA 4AO8A 1OILA 1DU4A 5CT6A 1H2WA 4OB7A 2XMZA 3UUEA 5FRDA 2XI4A 2ZSIA 1DT5A 3WK5A 3G9XA 5ALLA 1CUWA 2UZ0A 2O2GA 4KR0A 2XQIA 4P08A 1UKCA 2OQVA 1E8NA 5DYTA 3R40A 4K2AA 5JZ9A 4HVTA 3IULA 2DSNA 4B6GA 4JEIA 1QZ3A 5ALHA 5E4TA 5LZ9A 3H19A 4U2DA 3EQ9A 3WLAA 3DLTA 1IUPA 4CCYA 4FLMA 2LIPA 4UBIA 4U2GA 2DHDA 4YX9A 4QEKA 2H1IA 3M83A 4B0PA 5ALEA 5D3KA 1ZJ4A 1Y7IA 2BKLA 1K8QA 3BF8A 5T4HA 4UBNA 4C4XA 1AQLA 4Y2UA 4P93A 3DL4A 1UZAA 2QMQA 2C58A 2CKMA 2HRRA 5ALKA 5JAHA 4M0EA 5AI0A 1QIJA 1XRRA 3M82A 1T4MA 4KEAA 1N5MA 4C89A 3WK8A 2JF0A 5EIEA 5FXMA 4X94A 5CT4A 4UPDA 2HU8A 5KREA 3G0CA 2ECFA 1FFBA 4BTVA 4IO0A 3A2LA 4H77A 1UXOA 2VAXA 5HCUA 3NWOA 4F5ZA 2XUQA 1E3QA 1EA5A 1ZICA 3GUUA 4K6GA 2WIDA 2WM2A 5A6VA 5FPPA 4G4IA 4IH9A 4JH0A 1CUIA 1UOOA 2GZSA 3H04A 4DGQA 4KAJA 5LYYA 1YAHA 4GW3A 2HA6A 1SCKA 4FWBA 2XUDA 3R3VA 2WG2A 1TQHA 1JKMA 5HKAA 3GROA 1GPLA 1QTRA 5AK5A 3ESAA 5AK6A 3ZLTA 3WI7A 1VXRA 1MU0A 1ACJA 2CUTA 1YS2X 3OC0A 3PFCA 1EI9A 5AM1A 1L7QA 1ZI9A 1E8MA 1TKRA 1XRPA 5IVIA 2O2IA 3PDCA 4Y2TA 1DT3A 1TIBA 1JI3A 5I7UA 3KWJA 1XZEA 3WL8A 1ISPA 3VKFA 1GT6A 1L7AA 1SOMA 2I3ZA 4UHDA 5FLKA 5CRIA 3D5EA 2HFKA 1VA5A 5D3ZA 4I3FA 1A7UA 2O7RA 2QOEA 1HL7A 3LCRA 4BAUA 3WJ1A 4FHZA 3VVLA 4G8DA 5ALVA 1CFJA 4DTCA 2VEOA 5DNUA 4I4CA 1WHSA 4Y2VA 2HHAA 2HDWA 3W06A 2FX5A 1Q0RA 2C4HA 2GBGA 2C0PA 4CIBA 3OG9A 3FLBA 1X2EA 4B9EA 3D2BA 2V97A 1O6FA 2QVBA 2JGMA 4KAAA 4KJXA 3O4HA 5ALQA 3AUKA 4C88A 4Y2PA 1XZGA 4S0XA 1P0MA 2AJLI 4GBGA 2DCMA 5ALRA 4WFIA 2HA7A 3ILSA 3FSGD 1MPXA 1SCIA 2WQZA 3E4DA 3C45A 2K2QB 4LXGA 1N8SA 4NVRA 3LIPA 1NU8A 1VZ3A 3O9MA 3PICA 5ALIA 2WUDA 1H22A 4JYPA 2YH2A 1XZMA 4CFSA 4UHEA 3R3WA 3V1KA 4X6XA 3ANTA 5CXUA 5KWJA 1JFRA 4FBLA 4B81A 3FYTA 1EB9A 2PSEA 3NUZA 1ZD5A 3I6MA 4LKOA 5T4BA 3IB3A 4J0HA 1BS9A 3CCCA 4DMHA 1ZI8A 1P0PA 4X91A 3C6BA 2X5XA 5ALFA 3SX4A 3WA6A 1EB8A 4JNCA 3K2IA 4B9AA 2OAGA 4EZIA 3I6ZA 2PU5A 3WJ2A 3D59A 3I2FA 3T4UA 5AKGA 1LPSA 2Y1KA 3GFFA 2WFLB 4P92A 5T4FA 5CBKA 1W4LA 4Y2YA 1LPNA 4UBOA 2B61A 5K3EA 3DDUA 1R3DA 1OCEA 4LHEA 1TCAA 5ALYA 1A8QA 2VF2A 3HXKA 1MAHA 3F96A 4UBJA 4C87A 5C8VA 2QXTA 4LYDA 2V98A 5JADA 2ROQA 3KSRA 1H2XA 1QIHA 5FKJA 3GELA 5ALXA 1PJAA 2WKWA 4ZREA 4PSDA 4B83A 3E1GA 3B12A 1HKHA 4DNPA 5AJHA 1CUEA 5HKBA 1F6WA 3STTA 4IQ4A 1LNSA 4UBKA 4AXBA 4E14A 3TJMA 5JATA 3IVMA 5AIBA 1X70A 2BFNA 5AKIA 5K3AA 1DTEA 4J0JA 1XRLA 5D6OA 4C01A 5CTAA 5J3JA 1CUUA 2BAGA 3H1BA 5JD6A 1VJ5A 5DTJA 1CUJA 4Y2JA 1XZFA 5DTIA 4IH4A 2WJ3A 3DYIA 3LS2A 4TGLA 2VT6A 3AZPA 4INZA 1HBJA 5BV7A 5F4ZA 1LLFA 4EY6A 5AI4A 2PUJA 3RLIA 1VLQA 3BWXA 1CVLA 5DJ5A 5CURA 3H2GA 4DMKA 1UKAA 5IVKA 1THGA 2X8BA 4ZWNA 5AKYA 5IKXA 2QKYA 3PF9A 3STUA 3NGMA 4G1FA 3GZJA 2J4FA 1M33A 4E15A 1EX9A 1QLWA 3SC2A 4B0OA 1ZIYA 2WTNA 5FPQA 3RARA 1J1IA 4BCBA 2JGIA 1CQZA 5AM5A 3WA7A 5FUMA 1LPOA 4QDZA 4FLFA 2WHPA 4WFJA 3IUMA 2QR5A 3DS8A 4H7EA 4ETWA 4BZZA 4DSAA 3G0GA 1YSCA 1BN6A 2VAVA 4MXDA 3WWOA 5AKZA 4ZV9A 4J7AA 4FDMA 5JZBA 1N5RA 4UBLA 3OTQA 3MGAA 4QDTA 3EBLA 1CV2A 1HLGA 2OPHA 1CUZA 3C5WP 5HF9A 1SFRA 5C7YA 3F8SA 4NMWA 4NS4A 4KRYA 1VOTA 1LGYA 1FJ2A 4Y2XA 3G9TA 2QRUA 5FDFA 6YASA 3I2IA 1MTZA 4QZVA 2QXUA 2C7BA 3R3UA 2WG1A 5C81A 1IVYA 3LIIA 3IURA 2CEKA 1MX5A 1R1DA 3G02A 5JD5A 3FNBA 5C8ZA 3OOSA 4G8BA 2J3QA 1ZGCA 2OGSA 2VA9A 3V9AA 3WK4A 1U4NA 2GBFA 5K3BA 2GBCA 4ITVA 3AILA 4U2CA 1JMYA 5BWBA 4X92A 3EF3A 1CQWA 3HZOA 4HS9A 4W63A 1B6GA 4EBBA 3EQ7A 1R9MA 2XQGA 3R3YA 4BVJA 1BROA 3HLKA 3H18A 2ZJ7A 4UHBA 3G0BA 5AK3A 4LYEA 5LZ8A 3BL8A 1QOZA 2VATA 5CH8A 2VJCA 4UUQA 1CIJA 4BC0A 2WHPB 1QIDA 2RAUA 2RIPA 3DOHA 1XQWA 4FBMA 1XZAA 4KAFA 1JU4A 1WB4A 3EQ8A 1LBSA 1XRQA 3JW8A 1JMKC 2WFZA 3B3QA 2PBLA 5JZSA 3G0IA 1WM1A 4OB6A 3G9UA 4BVLA 1E5TA 4UFOA 2IIVA 1CUHA 1CRLA 1GPNA 2VT7A 2QJRA 5ALJA 1THTA 2ZSHA 1U65A 4QDOA 4ARBA 3BJMA 1XQXA 2O2HA 4PSCA 3IBTA 4Q3LA 1JJFA 2HU7A 3WWPA 3A70A 2G5TA 1FFDA 3AIKA 3VJKA 1XROA 3AZQA 2BGNA 2AJCA 1CPYA 3TRDA 4A23A 2JEYA 4LXHA 1XZIA 1SC9A 4MYSA 4KRXA 2J3DA 1JU3A 4F0JA 2IITA 3V1NA 4ZRDA 2HA4A 1K4YA 4ARAA 1TK3A 5AKEA 4H7IA 4AX4A 3QMWA 1QE3A 5T4EA 1AURA 2XQJA 3K9BA 3G0DA 1AX9A 1USWA 3F97A 3H0CA 3E0XA 3WYNA 3D2AA 4HXFB 1ZD3A 4Q34A 1BRTA 2HRQA 3AIOA 1QIEA 2WIGA 3GBSA 1QIFA 3PUHA 1UFOA 4AZ3A 3VISA 2JIDA 4OU4A 2WU3A 1QO7A 2G5PA 4DMFA 3PE6A 1L7RA 5ALZA 1VE6A 3WL5A 1C4XA 1HDEA 4E46A 3OM8A 4DIUA 4W1SA 3D0KA 2HA3A 1WPRA 4MYDA 1FFEA 4QDUA 4QA9A 4FLEA 1SCQA 1AMNA 5CW2A 2XQKA 1H2YA 4J0CA 4EB0A 5AOAA 1XKTA 3FWHA 3W9UA 5K3FA 4AN0A 3A2MA 1EXWA 3C8DA 5HZGA 3EIOA 3WKCA 2RHWA 5IVDA 2WFMA 3I2GA 5JYCA 5AM0A 2GYWA 5AM2A 4HZGA 1LZKA 2QJWA 3VVMA 3AZOA 2WILA 3W05A 4ZGBA 1LBTA 2OGZA 2P8SA 2W6CX 4K6HA 3I1IA 2EDAA 3R3XA 4XIIA 3G9ZA 4OSEA 5YASA 4WJLA 1ORWA 4QLOA 5ALOA 4BDTA 1UOPA 1K63A 5AKLA 4B80A 1W1IA 1U2EA 1YR2A 1UOQA 2C5FA 4BCCA 5CMLA 2XMCA 1YB7A 3HABA 2Q0XA 4UHFA 2GBIA 4HRXA 4DLNA 5AIAA 4BTLA 3O4JA 5FV4A 5CT9A 4J0IA 4AZ0A 4BC1A 2I03A 4F21A 5KWIA 1GZ7A 3STWA 5H3HA 2ZYHA 3HJUA 4EHBA 4H18A 5AH0A 4HRYA 1FFAA 4PW0A 1JJBA 3H2KA 3L1JA 3ZLVA 3WK9A 5A71A 4X85A 2WHRA 1CUCA 5JARA 4JYMA 4KACA 2E3JA 3N2ZB 3UUFA 4X95A 5JAOA 3WWEA 4X93A 4Q1VA 4GHWA 4FFVA 4MQMA 3WZMA 2CJPA 4J3JA 2WHQA 4MQLA 1K6EA 3M81A 2QT9A 1JT2A 2HM7A 3QMVA 2XMSA 2EEPA 4N8DA 5LLSA 4W1RA 4W1PA 1CUSA 4KE8A 2RI6A 1MNQA 1Y37A 2QUBA 4N8EA 4N5IX 3CN9A 1PV1A 1LPBB 2WIJA 1IZ8A 1EVEA 1YB6A 3WKBA 3AINA 2HA5A 2X76A 5ALUA 2OQIA 3PUIA 3G7NA 3E3AA 2XUKA 4FOLA 2PSDA 4M0FA 2OG1A 1H23A 1EVQA 4PO3X 3FOBA 4BCDA 3MUNA 2DHCA 3O0DA 4TVKA 3DKRA 4GXNA 4PNZA 1CUBA 2VTVA 3Q0TA 7YASA 2ZYSA 5AI5A 4WDQA 2FUKA 4MWTA 2ZJ6A 4G9GA 3WKAA 2HFJA 5JAUA 4H7HA 3STXA 3M3DA 3D2CA 1AUOA 3AIMA 3QMMA 2WUGA 4RGYA 1S8OA 2WSLA 4Q3KA 2ONCA 4LIPD 3ICVA 4L9AA 2VJAA 1CUDA 1G42A 1EDEA 3SK0A 1DWQA 4IH1A 5A7FA 2H9YA 4FMPA 2PSJA 2PM8A 4PV7A 5LP1A 5I9IA 1MT3A 1YASA 4EY7A 1K5PA 1XLWA 2XQFA 4RNCA 3RKSA 2DFPA 2V96A 3WKEA 3YASA 3OPMA 5AOCA 1XZJA 2C0QA 1XZHA 1QIKA 2OXEA 3O4IA 4OCZA 3UMJA 2Y6UA 2OGTA 3BDIA 4OU5A 4BRZA 3FLAA 3MUOA 1WPXA 3OURA 2XUOA 4OUKX 3VJLA 2H7YA 3HYSA 1XZLA 4FNGA 1J07A 1GKLA 4U2BA 4BP8A 5KBYA 4UHHA 4W9RA 3WYDA 1C7IA 3R3ZA 2Y2VA 5CH3A 4ZV7A 1KU0A 1VA4A 2WIFA 4AO6A 5EHXA 3FSGA 5SYNA 4G5XA 3HEAA 1W76A 5DLPA 2WTMA 3WIOA 5CT5A 1P0IA 3PI6A 1EHYA 4HTAA 3QVMA 3FVTA 3HRHA 4UBMA 2JBWA 1ETHA 3N0TA 1ZGBA 3FAKA 1VZ2A 4C4YA 4UFPA 1N1MA 2Z8XA 3RK4A 5JIBA 5A2GA 3DKKA 4PF1A 2VQ6A 3C5VA 1NU6A 4HXGA 4X6UA 3QZUA 2BCEA 5HF8A 4L72A 2J4CA 3WK7A 4H7KA 1DQYA 3R41A 3H17A 2XMBA 2XE4A 4H7FA 5A7HA 4Q82A 4UHCA 5LZ7A 4EY4A 2VJDA 2Z3ZA 3QYJA 4I19A 3BXPA 2OCLA 5DWDA 4IHAA 1IZ7A 1P0QA 1E66A 4QWWA 5ESRA 5AP9A 4BE9A 1FFCA 1ODCA 4WY8A 4YPVA 5EIHA 3V1LA 3WL7A 3DJYA 3BE8A 4QE3A 5AOBA 5HQ3B 4XWGA 1CLEA 4WCVA 2XMQA 3BIXA 4AB1A 2BUBA 1BEEA 4MJ3A 4N5HX 1CEXA 1BU8A 4D9JA 2XUAA 1KU6A 5AK4A 4FFWA 5LZ2A 3LP5A 1J2EA 3WZLA 4X3CA 4NZZA 2WLSA 2XUFA 4RE5A 5AHXA 1IMJA 1G5FA 4CG2A 4FKBA 3WMRA 1BE0A 5LIPA 1EK2A 3W9BA 1DQZA 1I6WA 2PVSA 3I6YA 2W22A 5AM4A 2PL5A 4EY8A 3FVRA 1HQDA 5FP0A 4XJVA 2YASA 5EI5A 2XMRA 2WFLA 4K5QA 4BE4A 2ZJFA 5LKRA 1TAHA 5IVHA 4AN1A 2GYVA 1MX9A 4DSZA 2ES4A 3FLEA
chains in the Genus database with same CATH superfamily
3GPBA 3UB4A 4YQFA 4QHSA 5J47A 5E6UB 1CR1A 2QTFA 3RC1A 4BFZA 2B4TO 1E0KA 1NSTA 1CJUC 3TTUA 5ADHA 1Q14A 5EE0A 1IEVA 1CDEA 2JLRA 2YDXA 1YT5A 3H16A 3LKVA 9LDBA 1YK0A 3L5KA 3VSBA 5EGNA 3CURA 1FQOA 4ZT7A 2BZ0A 4ZIRB 1IBCA 2QVLA 2IX9A 3EZ2A 3EZLA 5BUZA 1OX4B 3IO3A 4LF6B 2ANCA 4NE7A 3ZJVA 2JZNA 3ANMA 5JS7A 4UCWA 1OPRA 2OD9A 1NVGA 3CLTD 5DN9A 5BURA 4LYHA 1JP7A 2R8BA 4D4LA 3R8FA 3A31A 4IYRA 4ARSA 1Q0LA 1U2GC 4YRQA 2W2XA 2QX9A 2GJKA 2BMAA 2OAQ1 3GNTA 4ZTUB 1DOAA 1Y1SA 3H4IA 3IFSA 1I24A 3JCZA 3L8ZA 2KYRA 3GLRA 3SHWA 2IYXA 2PBRA 2Q1TA 3OWOA 3V6MA 3MWFA 4DABA 3L4SO 4XFJA 2VZ8A 3FOFC 3KM0A 2W2NA 1E79A 3ZPXA 1KK2A 3NDJA 1QE5A 2QMZA 3NC4A 3V48A 5FX2A 5H9WA 3GLIE 5EJ7A 4U2EA 2OUIA 2XUGA 4L0CA 4NCKA 1ZU4A 2GLXA 1GNQA 2Q3DA 2VIIA 4I6GA 4OMCA 5ESWA 4ZVQA 4X65B 1A5TA 4B84A 2R8YA 4L9WA 4Q4HA 2V1UA 2B3TA 1H6DA 1XNGA 1LPAB 4CMEC 2NSHA 1F0PA 3T5CA 1FFXB 2QF7A 4OQZA 5MFPA 2D62A 4IQGA 3FKSD 4F93B 1AG9A 4LRXA 4V0KA 1NDHA 3ZVMA 1FMJA 3I28A 3Q8WA 4PAGA 4R7TA 3H9CA 4IIJF 4K7JA 1GDHA 1E7RA 4ZHQB 1O95C 4ZCMA 4RU1A 2PSFA 3NDRA 5H4HA 1A7JA 1SA0B 3EMKA 4C3OB 4JUIA 2HIHA 2ZYVX 4I50B 5B6IA 1J8DA 4BMNA 3OEED 1SIUA 2VSOA 3GRUA 1ELOA 3ASVA 4WEOA 2C20A 1CY6A 1M8GA 4YRLA 1U4SA 3F9CA 2CGEA 3HGQA 3JQAD 4QU5A 1YZVA 2BH2A 5EKXA 1GGKA 3NRBA 3ORHA 4X24A 4N7BA 2D1TA 3PC8A 1TUEA 3EAGA 1VYHA 2QR3A 2PKXA 3IDZA 3EDMA 2G67A 4IBOA 4DG9A 3L8EA 1B0UA 4O6VA 4B76A 1YA4A 3LWNA 5BQ5A 2XF8A 2XUJA 1H9AA 3FYUB 4O25A 2DTDA 1WY5A 4LBYA 1VL0A 1CR0A 1DKNA 1YB5A 2PKQP 5ALMA 3ZGZA 4HDSB 1U7XA 1GAJA 3A25A 1KSHA 3O38A 5EXTA 5H3CA 3FOEC 2OY0A 4NTZA 4ZJYA 3MBKA 1L4UA 5JT1A 1ZD8A 1T4GA 2P9ZA 1EAMA 2PPLA 4HN4B 2XMDA 5EIAA 1EWKA 2L18A 2EEZA 1EDDA 1NXPA 2WMDA 3D3NA 4LSGA 1XEAA 4HWPA 4PLPA 4EEZA 2O2DA 3TRIA 4M49A 1IEWA 2ERCA 2F3QA 2ZTUA 5TNXA 4E32A 4ZOLA 1W36B 2VJPA 2BTOA 1ZUWA 5CK4A 5EHNA 4C29A 4TTAA 1Y3AA 3NDPA 2QGZA 3C14C 1UODA 2G04A 5EE1A 1F2DA 3MBOA 2I1QA 5FUYA 4U63A 4KX3A 1KXZA 1DDOA 5DSTA 3ZHOA 3F1LA 1EBFA 4DDTA 1XZ8A 3M6IA 1C7FA 3JQGA 4MP3A 5IJ0B 1Q1GA 3DTVB 4O4JA 3RS5A 3WAKA 3IERA 3TM4A 3S6JA 1YO6A 4KIGA 1O9GA 1RJ9B 3MJVA 5BOSA 2IIBA 2G17A 2HK7A 3I1YA 1W75A 3W4JA 3MSCA 3IV7A 1OXMA 2HOQA 3FYHA 3T9BA 4DNQA 2QN2A 2CNDA 2WVGA 1JDZA 2WWVD 4C6SA 2DR3A 2C7QA 3PNSA 4EG3A 2WBLC 4RZUA 4ZTZB 3BMOA 3TPFA 3KDAA 5HK8A 2Z5VA 3K16A 4I6EA 1PZXA 2EG5A 4L02A 4YTEA 5LQSA 1JI0A 1JLMA 1XU7A 3COSA 4HLQB 1BKYA 3U3RA 4DHWA 2PZFA 3DULA 5JPCA 4EATA 3BGSA 2VP0A 1IUNA 2BC9A 5B1HA 4EKIA 4A8HA 2VT2A 4RM3A 5FUBA 3Q2KA 5IF9A 1I5EA 1DG1G 3NLLA 4K87A 3V4OA 1YA8A 3TTTA 1KI1A 1P0CA 3IP1A 4TRMA 2ACEA 1EE1A 3CSDA 3JWEA 1UP7A 3HP7A 3HNRA 2VTBA 1Z5UA 4JELA 2FHPA 3DE7X 4I1IA 1E9BA 2C9CA 4BJ5A 2Z04A 1ISJA 3LUPA 5EE3A 3IIJA 4C0LA 3V46A 2YX1A 2PRJA 1RYEA 1MQ8B 6REQA 1TEZA 5CFZA 4CEIA 4YK7A 3DVRX 4L6IA 4GKVA 3EZNA 1C1HA 2FP4A 2AWOA 2ZTHA 1KYYA 3AF5A 1AC5A 2VKTA 3PZBA 4Y2RA 1WVMA 2E87A 4BMPB 2O8DA 1GPKA 2XZTA 2B20A 2EKBA 2HBYA 4TYQA 2BJHA 1SKQA 3IUSA 5I6DA 1GRRA 1X7YB 2NQ2C 1TTTA 1OBFO 3AFNA 2I6QA 3FSJX 5CM2Z 4ZT6A 5BVHB 2P27A 1U28A 3A3YA 3F8TA 1WUYA 2EATA 3OCXA 1QFZA 4LGVA 2PDAA 3R7DA 3AETA 5AJTA 1UFVA 1WF6A 2W4QA 4UAJA 2WIKA 5EWMA 2P6PA 3C74A 3DT8A 4JI4B 5JXIA 1N5OX 1RADA 5FEUA 4Z9FA 3RJMA 2CXTA 4M0DA 2RGCA 1AKNA 2JHFA 2PH1A 2PSSA 2VRNA 4D44A 5HK9A 3H1FA 2VQFB 1II8A 4XB2A 2DU8A 5DK6A 4JI2B 2GHQA 5CDUA 2A94A 1OA1A 2HF8A 2X8AA 2ZJOA 3MELA 4G2TA 1GTL1 4GI2A 4LRUA 3UAWA 3WNBA 4DLXA 4DNOA 1E79D 1AZWA 5IZ4A 3REQA 4RE6A 3V4SA 4BRUA 3VR3D 2P9JA 4YPOA 1ULUA 4KBGA 1TCCA 3AHJA 5ENVA 3QHPA 5FLEX 5J58A 1G17A 4A15A 4GZLA 3OZIA 2XEDA 4BYMA 1IE3A 2H57A 1E2NA 1CUGA 1U5BA 4CR7A 5KHOC 2OHOA 1JBKA 5J2TF 4CR6A 3HGTA 1CRQA 3W2TA 4HH0A 2H18A 4II2A 3QUTA 1GCGA 2BGJA 2H1HA 2OCIA 1LXCA 1QO9A 2DFVA 4GOND 2HA2A 2KW5A 2DBYA 3LC1O 3U60B 2EX4A 4E94A 1YZQA 2IYWA 1Z0ZA 4MS1A 1EWQA 2BR3A 2BEWA 1TZKA 3ZE1B 3QEAZ 4BAZA 1FDWA 2D3WA 1K7CA 4MW9A 1JUDA 4Y8VA 5JD4A 3D7RA 5GTDA 2BUCA 4JROA 3T7CA 5C32A 4OG2A 3U7RA 2CV2A 4BZXA 2XVZA 4C03A 1RACA 1NI5A 1VXOA 3S5JA 1R0SA 2YZNA 4Z0TA 1YUBA 1U8XX 4RZSA 3OA0A 4P84A 4PSKA 5DW0A 1YR9A 4HZIA 2QK4A 3ZVKA 1CCWA 1NE2A 5C35A 1KMHA 2NACA 3TGWA 1ID8A 2EFJA 3QKSA 4HOYA 1GSHA 4P5EA 5TX7A 5AW8A 4FJ0A 2IWRA 4GSKA 2IHKA 1B6TA 3N7AA 3MQ4A 5EZSA 2XF2A 4FNMA 3S7ZA 2ZIEA 4W4TA 2NZVG 3K94A 4EVIA 3QKUA 2PN1A 3VSDA 2WJJA 4N5DA 2B5VA 5EIXA 4RHTA 1JDBC 1V8PA 3FB1A 2B99A 1YQUA 2IZ0A 3OOYA 4YGYA 3AKYA 4G3XA 1GL9B 2ODTX 3ZV7A 5IPFA 3T5AA 5KO2A 3VXKA 1W6RA 2G9UA 2IDKA 3MC1A 1RKQA 1E5LA 5JR3A 2OQRA 3GW8A 3A1CA 3ITKA 2HA0A 4TRRA 5DFAA 4MI1A 1C5KA 2H3HA 3A6GA 5IRCD 1KMQA 4BN4A 4NLLA 2J31A 2V5VA 1DINA 3RS7A 2QQEA 2O7QA 1KAQA 1UBNA 2RGYA 1M8KA 2YV1A 1ZOIA 3KP1A 4GI1A 1ISGA 1MVNA 4OD0A 3JXEA 1QQBA 2AN5A 1KSJA 4ERXA 1B2LA 4XA8A 2H7CA 3TW8A 1VIYA 2WSSD 4J75A 1JA9A 1NN5A 4LCBA 3SBEA 1ZUNA 2J5RA 4WTOA 3CYFA 4DZZA 5HIAA 3K1AB 4L8GA 3JVEA 3HCRA 3LY8A 4G85A 4GOMD 4ASUA 1NKVA 3HCCA 5BN5A 1RW4A 1QH1A 2HT1A 3A58B 4NNPA 1BCRA 2ISSD 5A6SB 5LA6F 1Q83A 3B89A 3T15A 4FIDA 3D5TA 2OAEA 5F2KA 1DBRA 3WLTA 4FONA 2X0FA 2P3QA 3RYFB 1TQ4A 2QV0A 4G5RA 4L2IB 3DDSA 4OFXA 3VC2A 4E11A 4ACBA 1EFAA 4DDKA 1Y82A 2XDAA 2IL1A 3PJDA 2ERYA 1DC4A 4DIEA 4L3WA 2QTVB 2ZIWB 4F4HA 4DIKA 4NU8X 2CD7A 4OA5A 2FFJA 2VQEB 3E1KA 3PUJA 3EPJA 4OK6A 2L0XA 2B9EA 2BV3A 1SIBE 2HPVA 2ST1A 1KH2A 4AMUA 4W5TA 4YAEA 2YVKA 3ZZ0A 1A8SA 3X43A 5IX8A 3FYUC 4HZUA 1IWPB 4FR2A 3FVQA 1UP4A 1RXVA 3W5VA 4Q16A 4Q9AA 1CHDA 5HGJA 3PS9A 3T9EA 4XYLA 2Q07A 2VNJA 1MB0A 4PZLA 1J8QA 3E35A 3QSGA 2IYQA 3QKSB 5C8YF 4ENSA 3HDQA 3EVBA 5JSZB 2XMGA 3HACA 1J8YF 5EJFA 1Z2OX 2FMUA 3CMCO 3DKVA 1I7QB 4O2RA 1HQCA 4IIUA 2N46A 3BJIC 3LLCA 4H9GA 4JQCA 4M1YA 4W5WA 1KDZA 5SYMA 4DMRA 2JGKA 2RC5A 3RIEA 1KMNA 5EJIA 1MB9A 1SWVA 2C94A 3D1LA 3BFKA 5E4YA 5AKJA 1K08A 3TIIA 4DRXB 2OGUA 1QU2A 1W4ZA 1M2VA 1TMGE 2H9AA 2I2BA 3R6GA 1W0KD 3TUIC 1PTKA 2ZWMA 4DZRA 2XTZA 1GL3A 2P5UA 1NMQA 4JT2A 4B3JA 1CLUA 1GA4A 1NXVA 2PK3A 1F3LA 3P9PA 3IIIA 1ZGZA 3PC6A 1WUHS 1MW8X 1F2UB 1WOMA 1XV5A 3MHPA 3DOIA 3Q1LA 4X6YA 5FBQB 3MCAA 2OBMA 4Y1RB 1XQYA 1BH6A 4NJOA 4ZAYA 2PO5A 2ZM5A 3AL2A 4RTNA 3O2NA 4RESA 3LI2A 3MWYW 3AUFA 5EWJB 5K09A 4B4WA 4CHGA 3CPJB 3MMZA 3VR6H 5CCBA 1XDBA 2H7XA 3W1WA 2EFCB 1M34A 2H4WA 3WRXC 5BWCA 3A0RB 1RQPA 1N57A 3IBSA 2KM1A 4MYRA 4U7GA 2XAUA 2HNKA 4MQFA 2VXOA 4EUSA 5JVDF 1PUJA 3GT0A 2NN3C 1X0VA 5ED0A 4WBSA 1CUXA 3L7LA 2QD3A 4O4LB 3LYHA 4X60A 4AT1A 1HFWA 4TLCA 2YHIB 2Z6VA 4TUYA 1ZVMA 4OSOA 4D8WA 4I0WB 1ZH8A 4BX0A 2QLBA 1PW7A 1TRHA 1XLUA 1YVDA 2EJWA 4ZEXA 4K86A 1ESCA 3CU5A 2BELA 3RUAA 1JB1A 1GPBA 3CB2A 3NC0C 1E1KA 4NBKA 2C8VA 3L4KA 2BHLA 4NONA 3MN1A 2JFPA 4DHEA 3GGSA 1B93A 1VHJA 3P9NA 2ZRPA 3C87A 4LRYA 4LHXA 1U81A 1IJFA 3H0KA 1NYRA 1GIAA 1IBSA 3D0OA 1R0YA 3BTOA 3NOXA 4NAHA 1Z0DA 3AFIA 3S8YA 4MO9A 4PZEA 4CKWB 4RVCA 4E2ZA 2P30A 1K3TA 1T3TA 1JEEA 4LV8B 1PVVA 1IPHA 1R15A 1ZK1A 3A6ZA 4X54A 1ZSVA 1PSDA 2IHUA 3DBOB 3KKMA 1ZUHA 3OF3A 4F72A 1XFDA 5JDCA 1K7EB 1NBWB 2PUGA 4IRXA 4YUXA 1W87A 2XLBA 4Y1GA 4ZEVA 1CF2O 1ODTC 2OBLA 2HEIA 4B46A 3B8HA 4NULA 1E96A 3IHTA 5DX8A 1PJBA 3MUFA 3GLFE 1EX6A 4MVXA 1KPIA 1WB5A 2ZSKA 3JSAA 4DSNA 1MXFA 2BSXA 4Q9JA 4AKIA 4COOA 1VFPA 4CQJA 1G0OA 3UAVA 3LHDA 2O3SA 4EYKA 3DWEX 4CIVA 2AXEA 1XD9A 4EA8A 3KD2A 3KJZA 3ESYA 3NETA 3MRXA 4TZ0A 1AMUA 2VWHA 2PX6A 2OK7A 2WKSA 5MN6A 1GAXA 1E3WB 4AS3A 1T1RA 1SC3A 4KN9S 3C7KA 4R2XA 4D81A 3R2JA 3GJ0A 2NX2A 1ND6A 2IFTA 3O90A 1SM4A 1Z36A 3AWIA 3HKBB 4W7HA 4IHJB 1QLHA 3H5WA 3MCVA 3VR4D 2WUVA 2F43A 4ZAGA 1CP2A 2JJMA 4YHHB 3K9FC 4F6RA 3HZHA 1ORVA 3TZ6A 1PKXA 3R0VA 1IN7A 421PA 1QIIA 4ZVKA 1E98A 5CLGA 4B79A 4IJMA 1QPBA 2BTQB 3QUAA 1ORDA 4BVAA 2O05A 3TUZC 2GN6A 3I09A 5ELLA 2HC9A 3IP6A 1QHEA 3VNBA 2AMLA 3CE9A 3L1IA 3CX7A 5DTRA 1EXDA 3CJTA 2R7MA 5EYPA 4Z49A 5BOSB 5C53B 5EAIA 5CLLA 1U8ZA 4EMTA 2ZK7A 1FUIA 3H75A 1R16A 4BX3A 4UMDA 4BLSA 3FRJA 3ZV5A 1CEYA 3NHRA 2UXDB 3Q40A 2O8CB 5K3OA 2JAUA 2NU6B 1NIPA 2VUTA 4BATA 4F71A 5M5BA 2D00A 2W8BB 3LWBA 1HI9A 3SJBA 1EUCA 1QVWA 3DE5X 3BHIA 4N5NA 4UXHA 3CNLA 1W0JD 3K2EA 4CM8B 4DQLA 3MTIA 4CXMA 4TXLA 3OP4A 3IUNA 2OV1A 3VDMA 4LFAB 1NR5A 3ICEA 2WG0A 4ZRNA 4DUZB 3EB9A 5GM1A 2QMOA 1E3MA 1UK7A 5LQDA 1BCSA 4HNVA 3DL7A 4XB6B 5DO9A 1U4OA 1WDTA 3MWJA 3RU2A 5BV8A 4R0MA 2Y4OA 3MGBA 1OMOA 4LZPA 1VE7A 3TEFA 3UXHA 4KITB 5JANA 4BEJA 2FF5A 1ZI6A 3UCXA 5ICGA 1E3IA 4BXOB 5FPKA 3O1LA 1KFBB 2AXNA 3UJBA 2XCRB 4YNBA 3COPA 1BA3A 4IJWA 2I3BA 2XTNA 3KOYA 3RSHA 5CITA 5KX5A 3O8QA 4R7GA 3PC7A 5FOWA 6PFKA 5LU8A 4H6VA 3EGDB 3EXHA 1VLZA 1D2MA 2ZWOA 3LQ2A 2IS2A 5TB5A 1I7DA 3LQ1A 4X00A 4NU0A 3RI3A 3GUVA 3BGIA 4XASA 3EQ2A 4DS3A 5JHHB 2DWOA 3HUUA 3K72B 2VUIB 3LUFA 3MXTA 3PV0A 5LP6C 5CYFA 5JV5A 2QN3A 2GERA 3SYRA 1XPUA 3JQAA 3R0XA 4IDAA 4YCDA 3U1TA 2LCIA 4J90A 5ESDA 4OQXA 2XJ9A 3TSOA 1GRVA 3RRZA 4EZBA 5CXQA 2QPTA 3P0EA 2XYRA 5IEJA 3TDMA 5DM60 5TE9A 1BEZA 3ZBPA 3OEWA 1YQEA 1CG6A 1Q2UA 1L7NA 2RJ3A 5ITZA 1RYYA 1NXTA 2QRMA 4TKVB 1I0LA 1KVRA 2CNWD 1NR7A 3ERCA 2JFGA 2DQYA 3T3IA 4F60A 1UWVA 2HDHA 4BNYA 4IVNA 1D1PA 5LKAA 2B1GA 1V3QE 3VTAA 2V7PA 2Y0DA 2DC1A 2W2KB 2H8KA 3RVNA 1T8UA 3BIWA 4IGFA 3PQFA 2DUJA 3PTLA 4WBXC 4URWR 4L74A 5K51A 3JTMA 4WA8A 5EOVA 1OH6A 3ZLUA 4MNTA 3I9NA 4AM8A 4BO1A 1XAGA 2CZQA 1WHTB 3BZBA 5KTSA 5FBWB 2C5HA 2FR8C 4UEJA 3UK6A 2O5EA 2EDCA 3NHFA 3RD5A 4EQ6A 4MARA 4FINA 1C14A 1V5WA 2HEGA 3OT5A 1ZVJA 3FZEA 4YJHB 2Q4EA 4EABA 1ULBA 2QIPA 4I1OA 3LXMA 4RKFA 4L8FA 1TFUA 5HQ3A 2N75A 3TLZA 1OAOC 1LB1B 4U39A 3HM9A 3S2EA 1JPNA 2NTVA 1IN4A 5HG0A 1J99A 1V9CA 1ULTA 2B36A 1VTKA 1G64A 2VJLA 2WJWA 1EFDN 3AV3A 4WKOA 3R7BA 4CIAA 2KHZA 3WRWA 4GKJB 1QH8B 4P82A 5ELMA 5B7PA 3V97A 4BPRA 1SD1A 2RSLA 1X14A 3OZAA 1P31A 5KTMA 3STYA 1RQ7A 4G1EB 2HMYB 2Y2UA 4GPAA 3O4GA 2G4LA 2ZBDA 4MS3B 5F2OA 3PD0A 4EG4A 1WIWA 1EVYA 2VZEA 2G0TA 1NBEA 3AF6A 1VYUA 1JXQA 1MOQA 1TD1A 5A9TA 4CCSA 1XZKA 2BEWB 4G5SA 1P2SA 4JR1A 1R6UA 2UYYA 3WDKA 2LR0A 3ADDA 2ZSUA 2JDID 3HA3A 1NI4B 3M9LA 4ONEA 5HA5A 5JWHA 4RTJA 4MGKR 4OB8A 2OHJA 1GWNA 1SBNE 5MDHA 1IM8A 2I76A 1T9HA 5CDTA 3EULA 1RLMA 2B1RA 2ZJ5A 4TMTA 4BQEA 4EA6A 4P7FA 3PXGA 1ZLXA 2XCOA 2H4ZA 5BQ3A 5C4IA 4YJFA 3ADCA 2DHQA 1BH2A 1FMLA 2GF0A 3KZXA 1GHTA 1Z7WA 3NVDA 1ACLA 3TB6A 4ALMA 1WCIA 2X9LA 5TGTA 1FBTA 3OX3A 1QAOA 1O5IA 2VRBA 1Y9EA 2PX2A 3K9CA 1KVQA 5TXGA 1K68A 1Z5WA 3WWDA 1H2AS 1C1XA 3A26A 2F3UA 3EGWA 4R1QA 3W5CA 4F5EA 4ID9A 5HMLA 5K2OA 2CBXA 2HTFA 4GF5A 1AV7A 3UUEA 1WXHA 2C0CA 2ECPA 2XMZA 3BTVA 3KZCA 4KIUA 1XAJA 4ZDWA 5FRDA 1H4QA 1JIQA 1ZOLA 3P4YA 5ALLA 3D54D 1NFQA 5A05A 1QGOA 3PDUA 2CLOB 3PNKA 5F35A 3V7FA 3CX6A 4KWTA 2XQIA 2AFHE 3IAS1 2UZ3A 4P08A 3KQOA 2QORA 3N3BC 5LXTF 2OQVA 1E8NA 4S1NA 3DOCA 3TIFA 4AS1A 1JHZA 2YWCA 4ZQBA 1M1NB 2RCYA 1J09A 5DYTA 1DS6A 3R40A 4YAOA 3KHSA 4BJ6A 3V1YA 4UAUA 2J7KA 5JZ9A 4N76A 1GFWA 3LZDA 2Y1DA 2PFGA 4JEIA 5GADl 2I1WA 2VYQA 5KYWB 1O4VA 1PR1A 1QZ3A 1TFRA 3AB3A 3ZD7A 5LQMA 2GS9A 3ER6A 3TW0A 4IMPA 3NWEA 1U63A 2Y77A 4YLGA 1DMSA 1YK1A 4Q0MA 3R0QA 1P72A 3C1TA 3IBGA 3T06B 5CEJA 2NP7A 3KSUA 1N2OA 3BULA 3GFTA 4YJ3A 4ZPJA 5EKSA 3I3OA 4WE3A 2PD6A 5C52B 1RM3A 3UANA 4U2GA 1PVDA 1Y5LA 3IAXA 3PC4A 3PFHA 4M1KA 1EP2B 4YBZA 1A98A 4FZVA 3M9WA 4B0PA 3QEKA 2FW7A 1L7EA 5KDLA 3UW3A 1Z07A 1S3SA 1Z45A 4W5RA 4HYEA 5TC4A 1SZPA 2NVWA 3BF8A 3RVLA 2Q2OA 2WD8A 4R6WA 3REGA 2Y66A 3FGZA 3CLSD 4X0EA 4QPNA 3K6JA 1P17A 2VHQA 4MVWA 4V3BA 3RFFA 4A82A 2UUCB 1AS3A 2VPWA 1PG0A 2BZ1A 2FNAA 1W4BA 3L05A 1NONA 4ND7A 4YI3A 2HRRA 5LQKA 4OAOA 4AMVA 5F9FA 3HHPA 3SIWA 3LSYA 4PCLA 4KQGA 1PDWA 3KE9A 4XCVA 4CDGA 4YRAA 2WD7B 1EFRD 1R2QA 2I65A 3FMIA 1UPCA 1P1KA 4TWJA 1ZU5A 3ZQKA 3QK7A 3RAPR 2H5LA 1N3IA 1CJVC 3B5IA 2R7LA 1LVUA 5BN4A 3N75A 1PZNA 3FUXA 5FXMA 4M0KA 4BJ3A 1CK4A 5KREA 1IRXA 2ISCA 3OX1A 221PA 2XVMA 3JQGB 2E1RA 4JUBA 3KPWA 4RSRA 1QP4A 2QP9X 2YN4A 1UXOA 4QUHA 2VOJA 2VAXA 2XT9A 3NWOA 3VZPA 3DMRA 1AB6A 3CIFA 3AKZA 3I52A 2VK1A 2F4VB 1E3QA 3AIIA 1CYEA 1IN6A 2WIDA 2BDTA 5K05A 5BV0A 2WM2A 3DHEA 3DOOA 5GM2A 3VPBA 3VGJA 3QUQA 5JHGB 3MK31 8AT1A 3NCTA 4C4OA 4NICA 1B73A 1Y8AA 4I5GA 4CHTA 4AZ3B 2QNRA 5F7JA 4G4IA 1K75A 4RS4A 3GGCA 3V4ZA 1DAFA 1DP4A 3ZX4A 3FHCB 1HE3A 1CEQA 1CUIA 1YJXA 3M0EA 2YYYA 3OFKA 1KZHA 1OFTA 2GZSA 3RHSA 4DSUA 5ADWA 3J80A 3TRFA 5CDFA 3EGCA 2A4KA 1BIFA 4G1VA 4GW3A 4KAJA 5A5FA 4ZVUA 1SCKA 2EP7A 1KVSA 1R5NA 3R3VA 2HW8A 3WYGA 3OICA 3TQOA 1UPXA 2DG2A 5C8DA 2L2QA 1TM7E 4HLUC 3H2SA 4Q9DA 1JKMA 2JHAA 4AL4A 1QTRA 4XLTA 3NALA 2CN1A 3GMDA 1E62A 5AK6A 4KR6A 4DLUA 3KUUA 4KIWA 2GVNA 1BW9A 4PZUA 4OXQA 3T3NA 4O1MA 1VXRA 2I6TA 2JA2A 2R6GA 3O8CA 9LDTA 1NJ2A 1VMEA 5KNDA 2NTJA 2VJOA 2CUTA 1DRJA 1R74A 4TT8A 4DV3B 4Q9KA 3L6BA 1EI9A 1TM2A 1W94A 1YZKA 1L7QA 1ZI9A 1DXHA 1YDHA 1FYDA 4P53A 1X0XA 1IAVA 3E5NA 1ORRA 1C3VA 4MDEA 1J8VA 1PFUA 4A73A 3TVTA 1GGEA 4MYCA 2JB9A 2E2WA 1JI3A 3M4JA 5L3VA 3KWJA 1CT9A 1KS9A 1XZEA 2WW8A 4HAWA 3HSKA 4Q3EA 5TVKA 1KTVA 4R6XA 3BRQA 2YY6A 2DFLA 1GU7A 4RVNA 5IM4F 3E8MA 4UDXX 5ECYA 2CVPA 2DF8A 4R1TA 3S1LA 3TIGA 3GLIA 3MW8A 1C0KA 3A1VA 4HQLA 3QQPA 2Q5JA 5D3ZA 1IVNA 5IKPA 5JFGA 2BBWA 1E5XA 3AEKB 1DKRA 2HSDA 4TYWA 3S8EA 5E7JA 3M6MD 1J7KA 1XPJA 1X80A 1J2YA 2EL9A 5EC8A 1DVRA 1Z12A 3F7MA 1QHHA 3HYLA 4YJKA 3PLAE 3KVNA 4DDVA 1TZCA 4BAUA 1OWPA 3WJ1A 4JP1A 3R09A 1D2HA 5I8ZA 5DB4A 2GN0A 1ISFA 3Q1KA 3IIKA 4YUVA 2GJ4A 2AQ8A 2PX5A 3LKBA 4UD2A 4M6WA 5BSEA 3ORFA 4LY3A 3GJZA 3BD6A 4YUYA 3KUDA 1BG6A 2QMHA 4LOLA 5H16A 1JLSA 3REFA 3NAGA 4Z54A 1VRCA 1V3TA 1S5PA 4YCBA 3PJGA 2C2BA 2JLSA 4RTSA 1BXGA 4QQFA 2Z83A 2A5DA 3AHGA 4QUGA 4CN9A 3J81A 3I6QA 4ARCA 4EJ0A 4TMFA 1FYVA 3HWWA 3BGVA 4ZVRA 5HJ7A 1NRXA 3OI7A 5CVCA 3GGPA 5LJIA 3X2EA 1FZQA 3A1FA 3W06A 4E4TA 2FX5A 1BA2A 5LPNA 4DV2B 4UCQA 5H5JA 2JLAA 3HEBA 5HIIA 5ECGC 1N78A 4FFOA 1FTYA 1Y9AA 4CIBA 1B8UA 1ECJA 4MS4B 4LE0A 4RZHA 5GV7A 1AQNA 2F8SA 1BKSB 4L1KA 1FTWA 3RWOA 2ZJ0A 3FH0A 3HPRA 2H4HA 1O6FA 3ZZUA 1H4TA 1ADGA 2I71A 2BFEB 3L0IB 5P8WA 3O4HA 5ALQA 2O8EB 2QRNA 3RVQA 1BMFA 2WRZA 3QP9A 3C6KA 4C88A 1XZGA 2D2EA 4KFRA 4S0XA 1YZYA 5BWOA 3TMKA 4DCJA 2O8EA 3GFSA 3OTHA 3WISA 5TMPA 2IPOA 1B1CA 4N82A 4ZODA 3ICQB 1VI2A 1CQXA 4HC4A 4XB1A 4KKXB 2HA7A 4C1BA 4B43A 3DTVD 3ILSA 1QKJA 5LA6B 1SCIA 2JJ2D 3HDHA 4J29A 4F45A 5F9HA 3BIJA 1H93A 1HE8B 3IAAA 2A30A 5HKKD 1JSRA 3NAMA 2K2QB 4QOEA 2P0EA 3JASA 4JMPA 1M6HA 4LXGA 1LKZA 1YUMA 3OZ7A 3RSFA 2A9FA 2OR3A 3HDGA 3ZC3A 3SJAA 4QX6A 3FA2A 3ZCSA 3CS3A 3KJEA 4RHUA 3RYTC 4EYOA 1U99A 3ENQA 3QYAA 4OHUA 4XVQA 5ALIA 5GWXA 1Y8ZA 2FFAA 2W48A 4U5XA 4QODA 4QSHA 4YMGA 1O54A 4BQRA 3B6ZA 2WNIA 1AKUA 3MWEA 5JEEA 5KQLA 3PEEA 1MB2A 4UHEA 1TCVA 1ZISA 4HGPA 4DREA 3K71B 1N0HA 4U7WA 4TKVA 3RIYA 1CQIA 2Q2NA 4I7EA 4H1VA 2GARA 4K28A 2ZI5A 4X6XA 4DLLA 5B30A 3PLRA 2GK7A 3F5FA 5AQEA 3RF7A 4JT4A 2Z4SA 3MPOA 5CXUA 3TRJA 1V5IA 3LY7A 4HJXA 4RETA 1ZMTA 5IYZF 1T8WA 3EIEA 2PQMA 3GDGA 3OF2A 4BNKA 3CNNA 4WXHA 4CT5A 2ZJ8A 2VLBA 3OQOA 1T29A 4WZ6A 4DA9A 2XX3A 3N1UA 2Z6UA 3SXPA 1C1DA 4I8IA 5DNDA 2FZCA 4DMHA 3DYBA 5BORA 4X91A 3FX2A 4E5PA 3M34A 4N03A 1E1QD 3UZUA 3C6BA 3I04A 3QEMB 3TTVA 4KW7A 3BHNA 1NRWA 1Z6AA 4M9UA 3DHYA 4UZSA 3KFVA 3SX4A 4PG7A 3WA6A 5IJWA 2FPGA 4OHYA 4HNAB 2D0IA 4CQMD 1NATA 3Q6IA 1F9AA 4QYIB 4OYHA 4WAUA 3OZDA 2Q2VA 1SVLA 3KB1A 4EENA 4YCMA 1BMDA 1VJCA 3N6RA 4Q00A 1GPMA 5CBPB 2R2AA 3MRVA 3T7SA 3BKWA 4C2UA 1RAHA 1XVUA 2V7QD 3VSCA 5I9NA 4RIEA 4LXTA 1RYNA 2CXPA 2BM1A 3KT3A 4YH1A 2SICE 3OZUA 5CVUA 4YMLA 4G0VA 3N8NA 4CMIA 3OKAA 1NVUQ 4I5FA 4RD2A 4PCAA 1BMTA 3E3OA 3IR5A 2BFEA 1ILWA 4JLKA 4JDUA 1W1WA 2COKA 1EGQA 1ZFNA 1D0SA 3FPKA 4M87A 3HEMA 5AKGA 1DBSA 3GFFA 4BBPA 1BD4A 4FE4A 2AQIA 3ASZA 3DBIA 1DKOA 2E18A 2J3KA 3EZ7A 5IJ9B 3L3BA 5M34A 1SQ6A 1WUJS 3MYRA 1H1DA 2O0LA 1D4AA 3I32A 5CJ2A 5JZOA 5D51S 2V7TA 1OAKA 4PAWA 3Q7QA 1A50B 2RARA 2NZXA 3OHMA 2JD0A 3WHLA 1U6JA 3RLFA 3RROA 1Y4UA 3PGA1 4LHEA 3IODA 3JR3A 3ZIUA 4JJGA 1V16B 1XR3A 1DXOA 2YRFA 3IJPA 4OAQA 3VI3B 3OTOB 3HXKA 3KQKA 3VPAA 3F96A 4UBJA 2QD5A 1M2VB 1H1TA 1SU8A 2QXTA 3I12A 3NWJA 4UU0A 3N86A 4P7GA 5BRNA 3RYCB 5D1NA 3KSRA 4PWZA 3NC1C 1H2XA 1E61A 4QT4A 2BFWA 3GELA 5ALXA 4EKYA 3U16A 2QU7A 3LT2A 2P67A 1NOKA 3FFXA 2HCJB 4UHKA 3DP9A 1F4PA 1QV9A 1MOZA 1DOZA 2AFHB 4P4SA 3W6UA 2EX0A 1RWNA 2BEVA 1GYPA 1D2EA 5M3BA 5C37A 3EFOB 3OE7D 1KKMA 4UXJA 1DAGA 4DA7A 1XRSB 3N87A 4G0YA 4Y2GA 1KI3A 3ILYA 3BQNB 1XHEA 1E3JA 1I3CA 3OSZA 3RE1A 3SE0A 2LWIA 4ZCTA 3S0JA 5EQTA 3IAFA 1KF0A 1J6UA 1U3CA 2H31A 2AV6A 4QYSA 4GI7A 1Y9DA 4L7QA 4P4TA 5FFMA 2GPAA 2DLCX 4AULA 3BIFA 1B6SA 3AUYA 3N2IA 4WD3A 2A9QA 3DXYA 3IESA 5FFFA 3IVMA 3VX3A 5AIBA 1JKJA 4JJZA 2SNIE 4NESA 3OVMA 4MVJD 2CK3A 5K3AA 3NHAA 3CRRA 1EWVA 1DTEA 4HDKB 1MD9A 1XRLA 1Z39A 4PR3A 4EMBA 5JMWA 3EA4A 2I4LA 4Z9YA 2HD4A 3EUFA 3LOQA 4HNGA 5GVRA 4I08A 1RHJA 4LVCA 1BOFA 1LRLA 4YONB 1GZSA 5L3RA 3N6VA 3K9QO 1BX0A 4NYMQ 4V3CA 2DP4E 4D9IA 1Y48E 3UATA 4XWWA 1ARZA 1FDVA 2G9ZA 1G8GA 1NOIA 1S1MA 2BAGA 1MO5A 2ZIUB 3GLSA 3ZZNA 2VP4A 4YUWA 2TMDA 2P75A 3K9GA 2ZI4A 5DTJA 1CUJA 4F5DA 4XVUA 1XZFA 4PSAA 3RRYA 3K5IA 4C2BA 3PDJA 1YFKA 3L41A 4HDMA 3QOXA 1APBA 3AZPA 2OCBA 2QVCA 4FYWA 4ZOQI 1M1ZA 4NFLA 4LF4B 1EFPA 2FKNA 2ORED 4PGFA 4QICA 4RCVA 2PGNA 4V0RA 5HE9A 4MQUA 2I4RA 1Y98A 3CUTA 4V0NA 3TS1A 5A4JA 5JNVA 4QVIA 2AI3A 5HS4A 2Z8YM 1Z0UA 1ORTA 2PUJA 2R6FA 3CW2A 5DNCA 4J1TA 4EFNA 5CA1B 2DWPA 3UA4A 3VI4B 4R1MA 4X61A 3TFQA 2JFZA 2VPXA 3K9WA 1X6VA 1N92A 1CNMA 1CVLA 2SHKA 5DJ5A 1ADYA 4EMSA 4I99A 1QQ5A 3LUJA 3CBQA 4H15A 4XSHA 1JR2A 3H2GA 4XGQA 4L9SA 3UKOA 1N1EA 2KSQA 2O4CA 4M98A 4FYKA 1THGA 3USCS 2ZAOA 1SK8A 3KYIB 3UCFA 3WB2A 1UPBA 2X8BA 2Y99A 4PTYA 1R0WA 3WLEA 4MIOA 2GSWA 1EFLA 4MVJI 4AVYA 4EITA 1T4DA 1O7JA 3I92A 4CMEA 3RRNA 1F0YA 1S2IA 1D7AA 2GCPA 2HZ7A 5FYQA 4C7KA 5J2TB 3K35A 3GZJA 2I7DA 3MTJA 1QYIA 1NW9B 2GO1A 4NQZA 1A9PA 4PRZA 3DE2X 1E1NA 4RFVA 5FR2A 4EI8A 3PNYA 4DY4A 4K2HA 5TQ2A 5K6RA 1DBIA 3CVXA 1OBCA 2O3TA 1YDMA 2P2GA 3RJTA 3GEMA 4CDNA 4AYTA 4DADA 2H2FA 2A0YA 1ZIYA 3QF4A 1I8TA 1L4GA 1NN1A 4IIXA 1KC3A 4TVSA 2UYGA 4FJ1A 2CMGA 2FG6C 3GUZA 1GUZA 3ND9A 1EGMB 2VHCA 4FQ8A 4D45A 4D4JA 2FMFA 4AP9A 3ZU6A 4ME6A 4CLHA 2JGIA 2L42A 1CQZA 1X94A 4LPSA 4AZ0B 1WQ4A 5BMVA 1NVVR 3GUYA 3EAFA 1CERA 5DBFA 4POAA 3EZGA 2HLNA 3AY7A 4MRNA 4X8HA 3WICA 2QR5A 3GL9A 3DS8A 4G25A 4QELA 2P62A 3ORYA 1DCKA 1CY2A 3DEFA 1CW2B 3G0GA 1YSCA 2H0AA 3F2VA 3TG8A 3EWNA 4EX7A 1UDXA 1X7ZB 1J20A 4YREA 3WWOA 4FYMA 3LQFA 3FSRA 4CGYA 2VNKA 2BR4A 1GSIA 3OHPA 4FDMA 3CWZA 4BLWA 4K9RA 1N5RA 3V4LA 3ADOA 3OX2A 1V1MA 4K6OA 4UBLA 3RDPA 4ZDKA 1MVOA 4L07A 2PNFA 4B3CA 4E2XA 5AW7A 2FKAA 4U2KA 1RAIA 4KQKA 4LY6A 3CT6A 4WKNA 4AJKA 4MVJM 4QUAA 4QDTA 1I1HA 3HKEA 2CDAA 2XQVA 4JT8A 3EBLA 1HLGA 2XIQA 1IK4A 3GLHE 4MKFA 4BGIA 1CUZA 2SBTA 3QVKA 1U9JA 3ZHBA 4EGAA 1SUWA 3DOJA 3L6CA 5HF9A 3MGGA 4RZQA 3PLNA 4G1MB 1H85A 2JLCA 3PCTA 1PV4A 4G09A 1RNLA 2PKEA 3P9XA 1AUQA 1MJGA 2EZUA 1S2LA 3F8SA 4JC0A 4PVDA 3Q41A 1GITA 5M7EA 2YIMA 4RGVA 3SZUA 2YC4C 1JU9A 2P2YA 4HV4A 3S2YA 4RYLA 5SY4A 5AQ1A 3VU8A 3KB8A 4Y2XA 2EKLA 1NNSA 3IC5A 4KX5A 2GCNA 3OBIA 1FJGB 4P98A 3C3PA 1OHHA 2EAUA 4DWJA 4ZT5A 3I2IA 5CPBA 1L7DA 1DAOA 2GHRA 1HE4A 2OPBA 2QXUA 2C7BA 3KYCA 4JL8A 2O06A 4RW0A 4UJ3A 3BGDA 1J24A 1X80B 3DHNA 1W8IA 1M66A 2X23A 2WU1A 3EDCA 4YJGB 3SC2B 2XBMA 5I48A 1KQNA 5HMMA 5T6MA 1HDYA 4WI1A 4BB6A 3IURA 4URUR 1R1DA 2VP3A 3U3KA 1OE0A 4PC2A 5C7IO 1PJLA 3RRMA 1Y8RB 4ETNA 3UV6A 3DB1A 1O95A 5IAGA 1ATZA 3WAJA 1YRAA 4E2FA 2RGDA 2QVGA 4PO8A 3MWDA 1JR6A 4YIHA 1FRQA 4CTOA 3PQEA 5JD5A 4D25A 3PPVA 4A2CA 3SKVA 2XKAA 4MV6A 1C9MA 1U31A 3VYVA 2E7ZA 1FTGA 1MV8A 4MPDA 1IM5A 5G3ZA 5DKFA 2GGSA 4LOIA 3T5PA 3NNNA 1VSVA 1QTNA 2WA1A 3WK4A 1QRAA 2BGTA 2X8JB 1X39A 3H4VA 5IAOA 4Q4AA 3KQTA 3H3XA 2GBCA 3G2MA 2V7VA 2CXHA 2P2CA 3AILA 1NV9A 1FP4A 4INPA 4QXAA 4BLTA 1AN9A 2VF4X 5BWBA 2GH1A 2NIPA 3ACBA 5FWAA 2WKRA 2RHHA 5CFLA 1KE2A 1XMJA 3EQ7A 3N2NA 3QU9A 4RFSA 1SHUX 4CQLB 3ZJUA 1NBOA 4BVJA 5E1MA 4GBED 2JKZA 1R6TA 1BROA 1PG2A 3H18A 1G3UA 2ZJ7A 1XDGA 2YDYA 5TLSA 2WTBA 2IOYA 2LW7A 2J9YB 1GZ6A 3D31A 3AI7A 3DWGA 3CUVA 3NFYA 2R2GA 5EIBC 1HKUA 3DL0A 5LZ8A 1Z2AA 3BL8A 1V4NA 3EW7A 1ZM3A 1OWNA 5CH8A 4TV8A 4C5CA 4UUQA 1OFIA 2AE2A 2J48A 3THWB 3G2IA 3WLMA 3WIVA 1KI6B 1QIDA 2BF4A 5IVPA 3LUCA 3DOHA 1D3AA 1GJRA 1PQWA 3MT0A 4FBMA 4ZZIA 5G41A 2Y71A 1F2UA 1KMMA 3WB0A 1VGRA 3SFVA 3THXA 2OESA 4UREA 3EQ8A 3GCDA 4OGGA 3P9RA 2Z9CA 1OH5A 1PO7A 4QDJA 3OT1A 3AEUA 1SY7A 2OORC 2GEVA 4WOBA 4YP0A 1DXYA 5DI9A 4F2PA 3B3QA 3SZLA 3LAWA 4JSTA 1C8LA 4JXXA 4UEQA 1K06A 5FFNA 3G0IA 4EDFA 4YAIA 1HSOA 1A1VA 4J4HA 1L5LA 3G9UA 3ONNA 2IEIA 3HKBA 3KZ1E 2OFPA 1B6RA 2ZWIA 3KDPA 2JAWA 3WG9A 3U44B 2HF9A 3GYGA 2EZ9A 2GILA 3MTGA 4OGFA 4C22A 2PRSA 3PXXA 4R1LA 5AJXA 4YRKA 1L5RA 1SXJD 1TPZA 3HO6A 2QJRA 1E20A 2C5AA 2AH5A 1OUMA 5ERYA 4WZAB 2CXUA 1E4VA 4HUQA 1C3EA 4MLZA 2C88A 4N0MA 3BB3A 4QDOA 1B74A 2A4MA 4TXNA 5K8TA 1U3WA 3WJ7A 4R3WA 3PJRA 3BMXA 4ARBA 2ZUBA 5M29A 1GAQA 3JAWA 3T3MB 2ADOA 2J6BA 4YALA 3HFSA 3HXPA 4IF4A 5DULA 3EEBA 1JJFA 1JVSA 2HLHA 2HU7A 1XP5A 2YZKA 4RORA 1GDTA 1R6BX 3E2IA 2VTBB 3OHSX 4TYMA 3GNLA 8ABPA 1SCBA 3GVXA 1X1EA 4S1WA 4BO6A 1SRQA 1NMZA 4JI6B 5JD3A 3CNQS 1B2RA 3TRDA 2PYZA 2GHTA 2PUBA 6CHYA 2GNOA 4CKXA 3Q3IA 2KMLA 4LXHA 5DHUA 1SC9A 2H06A 1FPMA 3K6SA 1IL0A 3HJRA 4K6MA 3AHFA 4GWKA 5DM2A 8ADHA 4OQYA 1JU3A 4IJQA 1JIJA 2X41A 4LY9A 4KAXA 2QRQA 2PZJA 2HA4A 3GCGA 3GDWA 5CIWA 5HZMA 4ARAA 1M2KA 1SB9A 5H80A 3G8BA 3IGFA 2ANBA 2VG8A 2TSYB 3OQPA 2P40A 5F7XA 5LJLA 1QE3A 3ADBA 3HADA 3FTFA 4EHIA 1FNCA 1IH8A 4LVUA 5DM0A 3L06A 2AYYA 4PC1A 4D9NA 5HJ5A 3PPXA 3WYNA 4MZDA 4G5OA 4XFDA 3UENA 2R87A 5BRJA 3M3HA 1BRTA 4BV8A 2HRQA 1YB2A 3ZEAA 3I5XA 3TKLA 4E0BA 1AGNA 3ZHUA 4RHYA 2O3QA 3ETGA 1XTIA 2P9FA 2RAVA 2VHXA 3NBKA 5BR8B 3AUSA 3GBSA 1ZHOA 3PUHA 1JIIA 1U8YA 3WNQA 4AZ3A 1R5OA 5TJ9A 1GTG1 2R1TA 3DF7A 3VR5A 4ER5A 3B6KA 2E4YA 4FEAA 3ZHXA 3ZKWA 3RAGA 1BFDA 2WT8A 3E3LA 4O5OA 3WBKA 2Z2YA 4AP5A 4DUGD 3FPJA 1D9ZA 2QUJA 2I99A 1Q0SA 3C41J 3KTFA 4ZQFA 3FPCA 2G5PA 3HGMA 3TD2A 4GXRA 2CXOA 2Y9PB 3ENWA 1YE3A 4HDSA 1OXKB 1KAOA 4HGQA 4PQGA 4XVHA 5JTUA 4ZVVA 1L7RA 1VE6A 1SBCA 2VZLA 1MO6A 1GPH1 1D1SA 3ASYA 1C4XA 2IDMA 3IAEA 3P94A 1F60A 1AGPA 1NXQA 2J3IA 1XZQA 1HDEA 3D6JA 3QVOA 3OM8A 1T9GR 2NTEA 4HBZA 2WYUA 4W7SA 3T3PB 1DI0A 2HA3A 4EA7A 4EF4A 5I9MA 1QP7A 2JIPA 1TTQB 4KV9A 2IEDA 4AKTA 3CRZA 3H6GA 5K0CA 4NSNA 2VDKB 1FFEA 4QDUA 5FL7D 1JYSA 3IUYA 1SCQA 2AX3A 2RK6A 4WHMA 4B74A 1KO5A 1N2EA 5KYVA 1L8OA 2BLNA 2AL7A 1QHNA 2X77A 3BSSA 1I32A 1AMNA 5CW2A 1NZJA 2XQKA 5LIRA 2JH3A 2BMJA 4EB0A 3L8HA 3AKDA 4M1MA 4PQRA 2CK3D 4MR7A 2NO6A 1S2DA 3I76A 5J2UA 1LSOA 3KQMA 1JAIA 1SOUA 3L4BA 4DXDA 2NLOA 3H1PA 5AUOB 3K5HA 1ONBA 2XIJA 1P3Y1 1TJNA 3T1VA 3WLJA 3IXLA 2IYLD 5K3FA 3I6BA 4B7AA 2H16A 3EG9B 5I5GA 1F9EA 5HJ2A 3FZYA 3I05A 1AXEA 4IGKA 1EXWA 2PX3A 4QUBA 4XD7D 4ZO9A 2VPTA 5HZGA 2YHBA 1VLMA 5TF4A 1YU9A 2OHGA 2DRIA 5CFRA 4NXMB 4RSGA 3WKCA 2WZDA 3W3AH 1SVMA 1TLFA 5H68A 1JWBB 5CM8B 3OWHA 2IU0A 3I2GA 1AHIA 4Q1AA 4QUIA 3VOTA 4B3HA 5K8VA 1N6KA 3NB0A 2F9LA 3HNOA 4GR5A 5AVUA 2XWPA 2Q5HA 4QG3A 1MR3F 4N5MA 5L7YA 1ONSA 4QATA 3ICOA 4U7PB 5BUQA 4LRQA 5KQPA 2MINA 3V00A 5NULA 5AM2A 4DV0B 1U1DA 1L4KA 2QJWA 1BHJA 3WLSA 3KT8A 2WILA 4LMBA 1LBTA 1E99A 1PX0A 1X38A 4HFMA 1M75A 1TO2E 4J91A 4KYTA 3SHTA 1VI6A 2W6CX 1LX6A 3DO8A 3VH2A 1AGXA 3I1IA 3O9ZA 4LZOA 1J33A 2GF2A 3NTQA 4R2HA 3W7BA 5KVAA 4RO0A 3RIGA 4BFCA 3R3XA 3JQFA 4KO3S 5EUQB 3AUXA 1E2JA 3N5CA 5EL0A 5YASA 3FDIA 4E1VA 2N9UA 1AY0A 2HQOA 3GXOA 4BDTA 3NDIA 4ZI7A 4RMGA 4EUFA 3OZXA 3E48A 1KEUA 1XKQA 4YAGA 1K63A 1PVOA 2HWUA 3HWRA 4R7ZA 3BM5A 4LQDA 5KTRA 4B3SB 1QBKC 1ZN9A 1KDPA 1UOQA 2JFBA 2PPVA 3ZS9A 4YYZA 3ELWA 2IHVA 4RMNA 1BAPA 1GOTA 1IB6A 4B3FX 2UYCA 1NUUA 3HABA 3G23A 4FZJA 1UIMA 2RI1A 4P8RA 5B3AA 3RF6A 4TV8F 1D6NA 1TNDA 3GFVA 4IV8A 4Y9DA 2CFIA 1KPHA 3SMQA 3W7AA 4A36A 1R0BA 3UQYS 5ECWA 4H4CA 4RV9A 1QYCA 4UNSA 5C1DA 1L1EA 2FR0A 4LN1A 2AXPA 1OLSA 3N2GB 821PA 2WSBA 5CT9A 2G8LA 2OL4A 3ZD8A 5FV4A 5LVAA 5A3RA 4X3PA 1BHO1 2AFIB 1G9SA 2QG6A 3AEQA 4BC1A 4CTNA 4FGKA 2O6LA 2GUGA 2ENUA 1QO0D 4RKEA 1W5SA 2PL3A 5IBRA 2ZLBA 4C6TB 4NMMA 1BX1A 2QVYX 2JVKA 3NEPX 3ESXA 4F21A 3K09A 2OBNA 3JARB 1B7GO 3ROQA 4BVHA 1ADCA 2FQWA 3IOBA 1M3SA 1RYFA 2AD1A 3BB1A 4UNNA 4RQBA 3R5TA 2ZYHA 3I9JA 2FUG6 1YRBA 4FC6A 3QBDA 1XMSA 2XWQA 5AH0A 5ITVA 4BUZA 3EZYA 3F3MA 4Q4JA 1JJBA 3ZLVA 3G2KA 3L1JA 4PICA 4N3NA 5A71A 3KOZA 3QJYA 4KFUA 3PSAA 3TOVA 2IELA 1DIRA 2WHRA 3FZGA 3L4BC 5HILA 2K7ZA 2XEXA 2QR2A 4KACA 1TJ5A 2FJUA 4JKIA 4MYHA 5CIQA 2E3JA 4JP5A 3H2BA 1NBIA 2GK3A 1GGNA 1KJYA 2JKVA 3P96A 2O0HA 1V1RB 2R97A 2AQHA 1VECA 2ZBPA 3DE4X 3SBOA 5BSGA 3G49A 3J81k 2PKCA 5JAOA 3AR7A 3WWEA 3AX6A 1S8AA 1VG8A 4Q1VA 4MKHA 2IV3A 3DAGA 1DC6A 4L7VA 2O2YA 3A4IA 1XN4A 3QWBA 1MC8A 4UM9D 4D9BA 4ZCRA 2DQKA 2FLKA 4RABA 3WZMA 2CJPA 1IOVA 4J3JA 2WHQA 2RG1A 3AP2A 4IMJB 1K6EA 2PKWA 3JWJA 5EY5B 4YP7A 1UJ6A 3HCDA 5CVTA 4PPGA 2AVDA 2QTHA 1ODKA 3BREA 2BFPA 3IEIA 3EJWA 2QE6A 5JPDA 2MMGA 2XMSA 4O2AA 2EEPA 1XP8A 3PRJA 4RTMA 1OR8A 1RZRD 2ZB3A 4K8RB 1KDRA 1B16A 3G2PA 1RWKA 2LP4Y 4W1RA 3HHEA 2B2CA 1NVXQ 2DUMA 3GMSA 1CUSA 5EESA 3AWDA 5JCOA 2XGOA 2OXIA 1Q91A 1E1RA 5IWAB 1KZ7B 1N8NA 1J9ZA 4O29A 4ZJPA 3WYBA 2MDTA 1SCUA 3NIGB 3RVDA 3THYA 2P2ZA 2P65A 3CN9A 3GFPA 3QLUA 2WIJA 1F4LA 4TS1A 1CQPA 1RD4A 1TEXA 2EU8A 2VDUE 2YFQA 1IZ8A 2FSIA 4RAQA 1LU9A 2QD4A 3IMGA 1Y1KE 2OM2A 3NEJA 4R9SA 4FNOA 3QU5A 4AZWA 1AK9A 4MP6A 2ZCJA 3FUTA 4DT1B 1PK9A 2HA5A 2ZTVA 3U40A 4QOFA 3W7VA 1PI3A 3EG9A 1FFXA 4I5IA 4DJAA 4C30A 2FAXA 3O8QB 5DDIP 5ALUA 1QS0B 2NAFA 2HK9A 3N74A 2QSYA 3QXXA 2PGAA 2BHRA 2Y1FA 4M7WA 1SUSA 3FW1A 4TMWA 2Q3BA 4ZO6A 4K46A 5BWMA 5E6RB 3ZK7A 4RJIA 4KO2S 1E2FA 4RVUA 2PA0A 1YA6A 3PNPA 4FOLA 3WGUA 3JASB 3Q72A 4DJDC 3MIZA 5IK2A 4A8JC 2VSYA 4DY6A 1M7HA 2O1EA 3AC0A 2GK4A 2J1LA 3BK2A 1NJ5A 2JIZD 5LA6A 3WWYA 1GV1A 2FDCA 2YUIA 4RFLA 2RIRA 3DF9A 2DHCA 3T1OA 4O4HA 3TTYA 4QYXA 1LLUA 3EDQA 3C7CB 4CLOB 1M0WA 4TV8B 4WCFB 2EW2A 2JFOA 3D6VA 3F6EX 3Q2IA 4MQBA 5GZ3A 2JLWA 1NF8A 3I5MA 1F4VA 5DHFA 3INGA 4X41A 2XNHA 2XYVA 1SVNA 1XYYA 1XHLA 2PT9A 3HVUA 4YMSA 3ONWA 1YI0A 4ND8B 5FULA 4C4PA 4UUMA 2NUTB 3N05A 1AZTA 1E6CA 3M5CA 4PC7A 3O03A 2WJVA 4GRIA 2RHRA 4CLRB 3W5DA 2Z4RA 3LW7A 3UWDA 1V0JA 1MJHA 2ETXA 3AYZB 1OAOA 4JWKA 3UWPA 3AIMA 3OZEA 1B14A 3OZWA 1PR0A 4RV5A 5HCIA 3RS8A 4RGYA 1EK0A 1RIIA 1S8OA 1ULAA 2Y0PA 3CF0A 1FX0B 5FWYB 3T3GA 2FPRA 1VPDA 3PHJA 2ONCA 2VHWA 2PAAA 2H4JA 3ICVA 1PHPA 1U1CA 2KJQA 5BMVB 4MLCA 2HV9A 1CY1A 5TMDA 4BJ1A 3C1OA 2FOLA 1E3WA 1FXSA 1NVDA 2CDBA 3EK2A 3PNQA 3WLKX 2XGMA 1NW3A 4LC1A 3X0DA 4PN3A 1T2AA 4NYIR 1B0AA 2RKOA 6ABPA 1V9SA 3GXBA 1SC4A 5K0FA 2I9KA 1EDEA 1RI4A 3TL2A 1DWQA 2H1RA 1QOQB 3EXEA 4YO8A 4AJPA 5JNUA 1IBRA 1WU8A 4GZ3A 2HHCA 4JLVA 2MSNA 3D8UA 3DZBA 2WR8A 4LJAA 3OIFA 1T5LA 5KYUB 3C3YA 8GPBA 1TLLA 3F8WA 4L5AA 4MB2A 3FZQA 4DL9A 4P35A 4PV7A 3BFJA 1KY4A 3RG8A 1BE8A 5GIPE 3I9FA 1XMIA 3OFJA 2H1WA 1MA0A 3D6AA 1E4OA 3URKA 5C46F 1EXNA 1U7UA 1HYBA 5TDHA 1IZ0A 3I53A 4BKPA 4HZUB 3QYFA 2XQFA 4HKTA 3RKSA 3HXQA 1OU0A 2DFPA 2XB4A 4ZYLA 2JIZA 2WA2A 3AJ8A 2WF7A 1WXIA 3ZNOA 1R6VA 1R4MA 2YWEA 4L4UA 1VB3A 5JJBA 1T0PA 1XZJA 4RGQA 2WWIA 2XRYA 4RACA 5BRAA 3GRRA 1JIKA 2VJYA 2R66A 4G1UC 1RJEA 1WUIS 3KK0A 3LE8A 4TMZA 2JGRA 1C30B 1N7HA 1SELA 3EUEA 3GNQA 1CB0A 1RHMA 5COQA 3UMJA 3CEAA 3IPLA 5D1HA 1UBLS 1MKYA 1FNBA 1QYRA 2NPOA 3PC3A 4IDHA 3W3ZB 3DV0A 3F0TA 3H9QA 2ZITA 4W8HA 4U3JA 3O82A 5TIIA 3FLAA 4E5DA 2X3YA 2OCPA 2ZS9A 1FY2A 4HAOA 3MD9A 3ZQ6A 2PJRA 1YR8A 1MO4A 2FZ5A 3OU2A 1TU3A 1A9TA 1PRYA 2H7YA 3C48A 4OUKX 5DIFA 3VJLA 4LF5B 1KAGA 3CHYA 1II0A 3HYSA 1OH8A 4AJEA 1SUIA 1YV9A 1M1XB 1DQPA 1SOAA 4AIRA 3AW9A 1YL7A 1GKLA 1MQAA 1MQSA 2C4TA 2BSAA 3MOGA 5TARA 3TSZA 3UK7A 3CVWA 3OO0A 2ZDQA 3PZRA 1EQAA 4CI0B 3B6JA 4DUGA 5BXYA 1KEEB 2EJBA 2J46A 4I66A 4RKYA 1JAHA 2IXBA 3HVHA 4MWOA 1ZZGA 3WL5A 3VR6A 1SPXA 1Q3TA 1KEEA 3R3ZA 4H1HA 5HX7A 2H65A 4PLFA 4NMLA 2WIFA 3A6HA 4Q7LA 4DLYA 5EHXA 2EKZA 2OV4A 1OIVA 4GR9A 4ZOBA 3CR3C 3LPMA 4ZKDA 1JE1A 1LV7A 5H83A 4RQUA 2IU4A 2X7HA 3FETA 2VHTA 5GJBA 3TTSA 1BD3A 4N7MA 5EVCA 1RKUA 5SYNA 1N33B 4NCNA 4QEZA 1KI4A 1SK9A 2VH1A 3DW1X 1WXEA 4QUKA 1ENZA 1L7MA 4MUHA 3X2SA 3DAYA 4O8ZA 3WIOA 1VLHA 2JPDA 1GRNA 5KJEA 4R1UA 1ZKMA 5BNWA 4HTAA 3RYHB 1RRPA 1CP3A 4IF6A 4MA4A 2XOKA 3T7JA 4UQPA 2W2LD 1UH5A 4LHYA 2JBWA 3HO8A 5D6NA 3DEKA 3EVFA 1ZXLA 3IRUA 1QYDA 4RF4A 2FEXA 2ZI3A 4UFPA 3SEZA 4XJXA 1J39A 2PRKA 1QJCA 3UV7A 4CMJA 1O03A 3BXGA 4PF1A 1HTWA 3TL3A 4UMEA 4JB0A 4XYMA 4FFBA 3DDNA 3K05A 4H1UA 4WA7A 4HSGA 3MPUA 4C06A 1NU6A 5K9ZA 3C3CA 1X7HA 5FL3A 4X6UA 3PWZA 3BXFA 1JQKA 3KJFA 5KYXB 2D1FA 5CFMA 1KJWA 3TECE 2IHTA 2Y1CA 3SM9A 1RXIA 3RC7A 3ZU5A 2YV4A 2JEOA 1OI4A 4MCAA 2PRIA 4IOJA 3UF0A 3MGKA 2YJGA 1MCZA 2AYXA 1I2BA 3ETLA 3MTBA 4JJKA 3VDQA 4F9TA 3NKVA 5KNDD 1DFHA 4XQGA 3WV4A 4CL2A 2ILVA 2R8OA 3HJBA 4NBRA 1XL0A 1AMOA 1CRZA 2WIBA 3TCKA 3BXPA 1R0RE 2OCLA 1U0GA 1S2MA 1Z4MA 5DWDA 1KWGA 1J0AA 1NFRA 4C0AC 2XJ4A 1TB4A 1X42A 4B4UA 1B8OA 4BE9A 2C7RA 4ABYA 3JALA 5FWYA 1G21E 4JQSA 3H87A 3Q3JB 4E22A 2ODQA 1TAUA 3IPAA 4B17A 1H0HA 5T8KA 3DJYA 4KP7A 4XGNA 3X1WA 3FWZA 1QGAA 2R4TA 1IIBA 1QQ7A 3PPIA 1E2LA 4CIWA 2YW2A 5FEMA 2XHEA 4LJLA 5CB4B 4RPLA 4TL9A 1HYQA 1CLEA 1KFEB 2VBCA 4JS0A 4NJMB 3M6AA 5E7QA 4C3UA 4R31A 4NFYA 1ODLA 5IBPA 4RTKA 1N0VC 2BUBA 2B30A 3SE7A 4LWQA 4N5HX 4HUJA 1KK3A 2DPMA 3HBMA 4XSGA 1BU8A 1FMTA 2UAGA 3OPQA 4FYYA 4Z1MD 4ZYZA 2XUAA 3KFLA 3VNSA 1WNFA 1KU6A 2Q0SA 4JOSA 4RA9B 2MYTA 3EFOA 4PG4A 4FKZA 3ESQA 1C9KA 2O23A 4XAQA 3U1BA 2PLAA 3I04M 5CD9A 1CRPA 2NNLD 1NKSA 4RS3A 2XUFA 5EUMA 4OVKA 4TXJA 4TM7A 1XWWA 4G1CA 2ZIXB 1BWSA 5TV2A 5U4XA 3M4NA 1J70A 1YVRA 1O57A 2PBZA 4ARUA 4IFEA 4YJ3F 5LIPA 2PZBA 1FXWA 1Y6ZA 3OJCA 5CVVA 3RREA 2XXAB 1O0BA 3MAAC 4WMLA 4X1YB 1OIXA 3R7FA 2GCEA 3GJ5A 3LYUA 4YPFA 2PG3A 1JA0A 2GBPA 2PL5A 2OXFA 4X20A 3UGTA 5A3SA 1WD7A 2O1WA 4R1NA 4EY8A 1HQDA 1CR2A 4WBNF 2J07A 4NCAA 1SXPA 4D6YA 4HN2A 2A1IA 2NZ2A 1T2FA 3EVGA 3KLBA 5JCXA 2WTXA 3MT7A 1WETA 3D9QX