4YK7A

Crystal structure of s-hydroxynitrile lyase from manihot esculenta (his103leu)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
MVTAHFVLIHTICHGAWIWHKLKPALERAGHKVTALDMAASGIDPRQIEQINSFDEYSEPLLTFLEKLPQGEKVIIVGESCAGLNIAIAADRYVDKIAAGVFLNSLLPDTVHSPSYTVEKLLESFPDWRDTEYFTFTNITGETITTMKLGFVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKIFLPDFQRWQIANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVADAYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of S-hydroxynitrile lyase from Manihot esculenta (His103Leu)
rcsb
source organism Manihot esculenta
molecule tags Lyase
molecule keywords (S)-hydroxynitrile lyase
total genus 95
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yk7A00
1SFRA 5A2GA 1WPXA 4KE6A 4AX4A 1UK6A 5F4ZA 4CG3A 3SX4A 5HFNA 3PFCA 5AIBA 5AP9A 1ORWA 5ALQA 1R9MA 5A7GA 5ISMA 4GW3A 1AC5A 3I28A 4QNNA 5ALVA 1GPLA 5EIHA 3WA6A 4FWBA 3WYDA 3WWEA 2H7CA 3G0GA 3GUUA 4ZRDA 3WMRA 3G9XA 4PV7A 1ZI8A 4B84A 4DIUA 3QBJA 2G4LA 2Y2VA 1CUEA 2PSEA 3FLEA 2E3JA 2GZSA 2DCMA 2GYWA 1HQDA 3R3YA 3FOBA 4UHFA 4BP9A 1P0IA 3QITA 3VJKA 5K3DA 5HK9A 3WLAA 4KE8A 1CEXA 3E4DA 5ALUA 3TRDA 4DMCA 1DINA 1QIFA 2DQZA 1TK3A 3H04A 3F98A 4GXNA 1HPLA 3HEAA 4H7FA 2WTNA 4FBMA 4MYSA 2ZYHA 1LLFA 5DTIA 5CH3A 4FNGA 1YA4A 2D0DA 4B0OA 4B6GA 5LLSA 2XMRA 2H7XA 1PJAA 1F0NA 1ZJ4A 3UUFA 3IUNA 2NW6A 3WA7A 1X70A 5E2IA 4BC1A 1GT6A 4Y2PA 3K9BA 3EQ9A 4CIBA 1ODCA 4FFWA 2HA2A 4L3WA 4O08A 3CN9A 3WKCA 1QIMA 2CJPA 4DM7A 3QZUA 2QUAA 2OQVA 1K8QA 3S2ZA 1E66A 3AIKA 1QLWA 3OC0A 5FPQA 1XQXA 1QIGA 2W6CX 4B81A 4EB0A 6YASA 1EB8A 1P0MA 5AKEA 1S8OA 3AUKA 3FYUA 1K63A 4UUQA 1J06A 3KSRA 1ZIYA 1CUWA 1AX9A 3FNBA 4XWGA 2EEPA 5AKKA 3KOOA 4H7HA 1CUUA 3A2NA 5CTAA 3ESDA 3LLCA 5C7YA 4W1SA 1CUXA 4Z49A 4G4JA 3H1BA 4YX9A 1GQRA 3BJMA 2EDAA 4KAJA 5DLPA 3BWXA 1EK1A 1UXOA 1H2YA 4QZVA 1K5PA 4C01A 3V1MA 4FLEA 4NS4A 1UT6A 4KEAA 1XZAA 2YH2A 4CG2A 3WK4A 1QTRA 1MU0A 3FYUB 5FLKA 1BU8A 4QDTA 2C5GA 4ZGBA 4XVCA 1DWOA 1XZBA 1SOMA 5CT6A 2LIPA 4P93A 3ESBA 3PICA 3G8YA 2AJLI 1LPSA 2WFLA 2JGKA 1N5RA 4Q3OA 3WZLA 1FJ2A 1LBTA 5HQ3B 5JAHA 2AJCA 3ZPXA 4EHBA 3GROA 5SYNA 1QO9A 2ZJFA 4M0MA 1IZ7A 3ED1A 2V96A 2JIDA 1R4ZA 3I2IA 4OUKX 3X3HA 4CCYB 4FLFA 3A2LA 4EZIA 1W76A 4X93A 4BCCA 4HVTA 1QZ3A 4LXGA 1TCBA 1QE3A 4DLNA 2FX5A 4J03A 1ZI6A 4NZZA 4DSAA 3M81A 3WWDA 2OCKA 4C87A 1YAHA 1WOMA 4JNCA 4Q3LA 1CUAA 4ARBA 4C88A 3G02A 1DT3A 1CUFA 4GDMA 4GEGA 3O4GA 4BCDA 2WM2A 1CFJA 2WUDA 5JANA 1F6WA 1BROA 1HL7A 1U4NA 2WU3A 4OD0A 3GELA 4U2FA 4C4XA 1G66A 1Q83A 3L1JA 3MUOA 4AMYA 2JEYA 1EX9A 3FWHA 2QUBA 1DX6A 2C5FA 3ANTA 4X6XA 3WZMA 1XLUA 5ALPA 2DHDA 3K6KA 1XZIA 4EY7A 2Z5GA 3ICVA 5CH8A 2XE4A 4N8EA 3OG9A 3D2CA 3AZPA 1E89A 2WIKA 5AK5A 4DGQA 2VTVA 3VJMA 3G7NA 3PFBA 1WM1A 1FFCA 5AK4A 4RE5A 1BE0A 4BE9A 1FFEA 5IKXA 3FVRA 4H18A 3STUA 3HC7A 2VJAA 5JZBA 4X85A 2DFPA 2P8SA 4CCWA 1E3QA 5LP1A 5HCUA 4AB1A 1MNAA 4FOLA 1K4YA 5J3JA 1XRQA 1QOZA 3KDAA 4W1PA 2Z3WA 3O4HA 2OGTA 2JBWA 4UBOA 1MT3A 1GKKA 3V1LA 1ZGCA 5JADA 5KWJA 2J3QA 4DMHA 1I6WA 4MWTA 1BEZA 4B82A 1ZJ5A 1N8SA 4F0JA 2XUAA 2OPHA 1XRLA 1X2BA 3O4IA 2PBLA 1XLVA 3QM1A 1AQLA 4OB7A 2G63A 3AJAA 1BCRA 3DS8A 3VVMA 1N1MA 4J7AA 2WUGA 2XMCA 4FNMA 4DNQA 4Y2TA 4MXDA 1FFAA 4UBLA 2ACKA 5EIEA 5FXMA 1MX5A 3QMVA 5ALGA 1DQZA 1J1IA 3WKBA 1F0PA 5C8VA 1L7QA 2XUJA 4YK7A 3R3XA 4Y2JA 4PQEA 1THGA 5CT5A 3V48A 4AO7A 2JGJA 3ESCA 2WSLA 5ALZA 2PSHA 3R3WA 4DNOA 1VXRA 2Z8ZA 3BXPA 1HLGA 4PSUA 3F9CA 4DSZA 2PU5A 3O4JA 1M33A 3HLKA 1CUBA 2ECFA 3D7RA 3MUNA 5K3FB 5DTJA 4J0GA 1W4LA 3DL7A 4WJLA 1XZCA 4N8DA 1CUVA 1XROA 3H0CA 4OB8A 2GYVA 4QDOA 4I4CA 3IIIA 1AURA 3HI4A 1YASA 4BAZA 1A7UA 1B6GA 3AILA 1UOQA 1ZOIA 2PSJA 5I8PA 2WFMA 4FLMA 3LCRA 4AXBA 3M3DA 4X94A 4GI1A 3M82A 3QPAA 2VT6A 2H7YA 1CUYA 3PF9A 3AZOA 3UMJA 4J0KA 2ZJ7A 4X7BA 1XZLA 3ZWQA 4E11A 4UHBA 3E0XA 2JGLA 1CVLA 3O95A 4FHZA 5I7UA 1EH5A 1CQZA 2GBFA 4K6KA 1ZIXA 1XZGA 3WK9A 3ZLUA 5KREA 5LZ7A 4EUSA 1MX9A 4JUIA 5AM1A 1JKMA 1PV1A 2VJDA 3DOIA 2PM8A 1Q0RA 3RARA 5LYYA 5FRDA 1QGED 3BJRA 3C43A 1WHTA 3GZJA 2PPLA 2QJWA 3WWPA 1XFDA 5AOCA 4WY8A 1JU4A 1CIJA 2PSFA 2XMSA 2QXUA 1JU3A 4UHHA 1UZAA 1VXOA 2I03A 4EY4A 4WCVA 4QE3A 3V1KA 4WY5A 3R3ZA 1XQYA 3W9UA 2QMQA 3G0CA 2VA9A 3HSSA 1QFMA 2FJPA 3VKFA 1C7JA 4X6UA 4OCZA 3IVMA 1A8SA 4FMPA 5JAUA 5AKGA 4I3FA 2RI6A 2HA5A 2XQGA 3H2JA 4E14A 4B83A 4CIAA 4FDMA 4ETWA 4DTCA 2HL6A 2JEZA 5ALJA 4X3CA 4W1QA 3C6YA 3FCYA 1UWCA 3FBWA 1VLQA 1CUJA 3FYTA 5K5EA 4IH4A 1JI3A 1JJFA 5ALHA 3V1NA 2WIDA 1ODTC 4J0JA 4N5IX 3G9TA 1L7RA 2VATA 1G42A 2BCEA 3BF8A 3B3QA 3PI6A 5I9IA 1GKLA 1CV2A 2WG2A 4G8CA 5LZ4A 1EB9A 5DWDA 1CPYA 1BN6A 2QM0A 3I6MA 1DX4A 3QMMA 5JAPA 2CB9A 4DMFA 1EK2A 3KWJA 4U2GA 1YS2X 2HDWA 3WWOA 5C8XA 4X90A 3BDVA 1MPXA 5LZ2A 5EIAA 5HFAA 5A62A 5SYMA 3FLBA 3IURA 4BAUA 3PE6A 4J0DA 1U8EA 2HADA 2I78A 3ZLVA 4B85A 3QMWA 4YPVA 5ESRA 3WIOA 5IVHA 1NU8A 2XUHA 3RK4A 5AI9A 2VAXA 3M83A 3KD2A 3FSGD 1DQYA 4H0CA 4H7JA 5E4JA 3WK5A 5D7BA 3C87A 2ZJ6A 3W04A 4XJVA 3PF8A 1QONA 4XX1A 2XQIA 3RKSA 5H3HA 1TAHA 2PX6A 2CBGA 2HA0A 5JASA 2PUJA 3W2TA 1CUDA 2HU5A 5ALRA 4BYMA 4EBBA 1P0PA 4UHCA 2WJ4A 4Y2RA 4PO3X 1GZ7A 2DQYA 4FFVA 2OGZA 4BB0A 4HRXA 3DDUA 4Q3KA 3ANSA 4Y2VA 4JYMA 5CT4A 3C5VA 5DNVA 1XZFA 3IUJA 1FFBA 1F8UA 1IUNA 4D9JA 1WHSA 1WB4A 1AZWA 4BC0A 3L1HA 1KEZA 2IX9A 1UFOA 5CT8A 1VA4A 4W1RA 2WJ3A 4KE7A 4QLAA 4H35A 1ZD2P 2WU4A 1ZICA 3NOXA 1XRRA 4UPDA 2RGUA 4HRYA 2O2GA 4MJ3A 4A23A 3WL7A 3D4LA 1EVQA 3IB3A 1Y7HA 3ZI7A 3DNMA 3MGAA 3DYVA 4UFNA 4X6YA 4OPMA 5AKLA 5HZGA 5AIAA 3AIOA 3ILSA 2H9YA 1LPBB 1UK8A 1XZDA 5FOQA 4EY5A 1MO2A 5LZ9A 4HXEB 5T4BA 1IUOA 1FSSA 4HZGA 1LPNA 2J4FA 1TCAA 1QIIA 3F96A 2BAGA 3D59A 2D5LA 2Z8XA 2V97A 3HXKA 3IBTA 1BRTA 4YASA 2XMBA 1WPRA 1H2ZA 1JMYA 4M0EA 2OGSA 2XMDA 5JZ9A 1A8UA 1UKBA 3WKAA 2YASA 4B0PA 5HF8A 2XUFA 4NVRA 5HF5A 3R3UA 2JGMA 1AKNA 2ONCA 2HFJA 3GBSA 5CXXA 2HFKA 1C4XA 1JT2A 4IQ4A 2BUBA 4CG1A 4OU4A 2Q0XA 2XQKA 3K2IA 2QXTA 2PVSA 4JYPA 4H7DA 5K3CA 4G5XA 2B4KA 5ALFA 1THTA 3H2GA 4WFJA 2AJ8A 5JARA 2DR0A 3RM3A 1CUCA 4H77A 1XZJA 1LPOA 1T2NA 1USWA 1XRPA 1TRHA 1CR6A 2DHCA 3O0DA 4BCBA 2WQZA 3CCBA 3DOHA 3ESAA 2HA3A 5HF6A 1BS9A 3WI7A 3A70A 3HABA 1H2XA 2K2QB 2C58A 4BVJA 1EDDA 2WILA 2HM7A 2RHTA 2G5PA 3DQZA 2J3DA 2WKWA 3I6ZA 1JJBA 4IH9A 2ZVDA 5JD5A 2PKYX 4BDTA 3VDXA 1Z68A 2JGEA 1VOTA 1WB6A 4LXHA 5AM5A 5EGNA 1QIHA 3FVTA 1IVYA 4AN1A 3H19A 3L1IA 2AJDA 4K6HA 2IITA 4UFPA 4BZZA 3G0BA 1XKTA 5FP0A 3IUQA 4L0CA 4X97A 5D3ZA 2ZSIA 3KXPA 4Q05A 4B80A 2O7VA 4K6GA 1XKLA 3QPDA 4QEKA 1ISPA 3G0IA 2ZYRA 4KAFA 4OU5A 4J0CA 4FBLA 3W06A 1QIKA 1XRMA 2HHAA 2XUPA 3DKRA 2QJRA 2VSQA 4I19A 1LNSA 5BWBA 3BF7A 1YA8A 3QVMA 3YASA 2QKYA 1C7IA 3I2GA 3WL8A 4G4GA 5C8ZA 4BE4A 1XQWA 4U2EA 4C4YA 4MYDA 4EA6A 2BGNA 1EVEA 3G0DA 4G8DA 3OPMA 4S0XA 5LIPA 1UKAA 1L7AA 4ROTA 2OCIA 3EQ7A 2YXPX 5AO9A 3STXA 4OYYA 2BKLA 3IDAA 2HIHA 2QVBA 1MTZA 1G5FA 4P9NA 4BBZA 2ACEA 1D07A 4J0IA 4QDXA 4Y9SA 4V2IA 4AMZA 4JEIA 3H2IA 2HU7A 2HA7A 1E8MA 2WFZA 4KE9A 1IMJA 2HA6A 5YASA 1U2EA 4QWWA 1MAAA 4WFIA 3W05A 3OTQA 4E46A 2I3ZA 2QRUA 4OB6A 3QPCA 3C6ZA 1YAJA 4U2BA 4N5HX 1ZD3A 4K2AA 5IVDA 4UHDA 1T4MA 5DNWA 2XMQA 1MAHA 1IZ8A 4MEAA 1E8NA 2PUHA 4HTAA 4AQDA 3DKKA 1XRNA 5IVKA 1OCEA 2HRRA 1LGYA 2VF2A 2YYSA 2WJ6A 2XQFA 4N8SA 5ALMA 5BOVA 4UFOA 1GXSA 4Y7DA 3R3VA 1CUSA 2B61A 5AI8A 5AKYA 3H1AA 4GECA 4ZI5A 5JD6A 1W6RA 2J4CA 3LP5A 3CCCA 5CXUA 4DNFA 3DEAA 1G4HA 4K5QA 2XLCA 2ZYSA 5AKXA 4G9EA 1JFRA 5DNUA 5CMLA 4TPKA 2VQ6A 1AUOA 2EDCA 3SWWA 5JZSA 3AINA 5JAOA 5ALEA 4G9GA 3CXUA 3HRHA 3Q8WA 1E5TA 2GBIA 3IUMA 2GBCA 1CQWA 5DJ5A 1LZLA 3I1YA 5T4HA 1K6EA 4LIPD 2XMGA 4C4ZA 3PDCA 4IHAA 3T4UA 1Q84A 3BDIA 2WHRA 4MEBA 3C70A 4AO6A 1VA5A 5CW2A 4GLBA 3FLAA 4ZXFA 1GQSA 5LKRA 2JGIA 4Y2UA 1XQVA 3E1GA 2WHPA 5D3KA 4KR0A 1P0QA 3G9UA 4OYLA 4HXGA 5EHQA 4XIIA 2O2IA 5E4YA 1ORVA 4P92A 5LZ8A 4DYHA 2XUQA 4LYDA 4QDZA 3W9BA 1JMKC 1UKCA 4TVKA 3QH4A 4ZV7A 3I2FA 2UZ0A 5ALIA 3A2MA 5FPPA 3WJ1A 4A5SA 1FFDA 3WYNA 2PL5A 5AI6A 4AZ3A 4BVKA 5A71A 3D5EA 4HXFB 3WK6A 3B5EA 5BV7A 3I2HA 1RP1A 2BUAA 2OQIA 4G1FA 1QO7A 3ICWA 2CEKA 3R41A 1A88A 1YB7A 1SCIA 4BDSA 4FTWA 2RONA 3C45A 3WWCA 1TKRA 4QWMA 1X2EA 2VT7A 4BZWA 4Y2XA 4BP8A 3C5WP 4BRZA 4KJXA 2OCGA 2Y6VA 3TJMA 4J0HA 3UUEA 4MQLA 4LYEA 3VJLA 2X76A 1YSCA 2C7BA 3S8YA 5AKJA 1VZ2A 2XUIA 2Y6UA 3O9MA 2HU8A 3DJYA 5ALWA 3NUZA 1E8DA 4GWLA 4Y2SA 4F21A 1EINA 4RNCA 5CH5A 2XUKA 3EQ8A 4X91A 4X00A 1LPPA 1XZHA 4QA9A 1YS1X 4BAGA 4C6HA 4ZREA 3FYUC 4QLOA 5A6VA 2WTMA 1LPAB 2WG0A 2V9ZA 2QR5A 3WQHA 1Q0ZA 4Q34A 3JYHA 3BE8A 1ETHA 2CKMA 2R8BA 3D3NA 4HS9A 1DWQA 4J3JA 3QYJA 5JYCA 3STVA 1YR2A 2C0PA 2PSDA 1XZKA 1LBSA 2DSNA 1WB5A 3HYSA 3WKDA 2VJCA 4PSDA 4Q1VA 1A8QA 2GZRA 4RGYA 1EDEA 3T52A 1CUZA 2XLBA 4PSCA 5AM4A 5ALLA 1DTEA 5HF9A 4BRSA 3E3AA 1SCQA 1U65A 3D0KA 1W52X 1IUPA 3TEJA 1OILA 2HRQA 3I2JA 2WFLB 3LIPA 2ORYA 1QIDA 2OLEA 1O6GA 2OG1A 1SCKA 4KRXA 1LZKA 3C6BA 4PNZA 4WFKA 3O9VA 4L9AA 3C6XA 3HJUA 4MQMA 2C0QA 1UK9A 3P2MA 2OAGA 3DL4A 4LKOA 2R11A 4UBMA 5CURA 4AZ0A 1QIJA 2XDWA 4ZWNA 4QDUA 1MNQA 1QFSA 5A7FA 3B12A 2XI4A 4INZA 4B9AA 1HBJA 3HACA 4AN0A 2QOEA 3ZV7A 2Z3ZA 5AM3A 1GPNA 1VJ5A 3STTA 1H2WA 2XUGA 3U1TA 3EF3A 2VEOA 3R0VA 2FJ0A 1R50A 1ACLA 2OAEA 2GBGA 1ACJA 4X71A 2OCLA 4G4IA 1HKHA 4TGLA 3FCXA 5AJHA 5T4EA 3ZLTA 1BEEA 5K3EA 2O7RA 1HDEA 5AM2A 3CN7A 1H22A 1NU6A 1ZI9A 5CT9A 3WK7A 3V9AA 1W1IA 4B9EA 4U2CA 2X5XA 2GYUA 4RPCA 2RHWA 4L72A 3A6ZA 2CMFA 1UK7A 1EXWA 1DWPA 4X95A 1KU6A 3STWA 3WKEA 4WDQA 4EY8A 2WHQA 3I1IA 5EI5A 5HK8A 5CBKA 4Y2QA 4GHWA 5FV4A 2JF0A 3OOSA 5ALOA 4BTLA 3H17A 1O6FA 1EHYA 4Y2YA 2WIJA 1MJ5A 2DHEA 2BJHA 2XT0A 5AOAA 3WL6A 3D2BA 4UHEA 2AJBA 4X92A 3G9ZA 1Y37A 2O2HA 4CCYA 1LPMA 2XUOA 5T4FA 3WK8A 1MX1A 3NGMA 4H7KA 5K3BA 2H1IA 1YCDA 1ZD4A 3BIWA 5AI4A 5EHXA 1B41A 2VJBA 4F5ZA 3DLTA 3F97A 2RIPA 3RLIA 2QS9A 1UOOA 4BTVA 3DCNA 3VISA 2BUCA 3EIOA 5HKBA 1CUGA 2OXEA 2B20A 3FAKA 3LIIA 3JWEA 2C4HA 4F60A 1Y7IA 1TCCA 1UOPA 1QIEA 5IVIA 1GPKA 5LKAA 5FKJA 3VXKA 2BFNA 4P08A 4AO8A 3I6YA 3KWFA 4ARAA 5EHNA 3OM8A 2WUEA 5HKAA 4OSEA 2ZYIA 2WG1A 4H7IA 5JALA 2XB6A 3F8SA 2AXEA 2W22A 1R88A 4ZV9A 1QTIA 5AKIA 4UBIA 1EA5A 5EHZA 1H23A 4M0FA 1J2EA 3MVEA 4A16A 3AIMA 4BVLA 1VE6A 2I3DA 4ITVA 3HZOA 5JIBA 3PUHA 4LXIA 5ALTA 3GFFA 5AI5A 5ALYA 3SK0A 4KAAA 3I2KA 3IA2A 2HA4A 3F67A 2XQJA 3OURA 3PUIA 2WLSA 5ALSA 4C89A 1XZMA 1MN6A 4HAIA 3IULA 4KACA 4UBNA 5AK6A 5AK3A 2WHPB 2PU7A 2WIFA 5LZ5A 4EY6A 4W63A 5JD4A 4JH0A 5FUMA 5E4TA 4KRYA 4UBJA 5K3AA 3C8DA 1DT5A 1SC9A 2XMZA 1DU4A 4RE6A 1YB6A 4PW0A 5KWIA 5CRIA 1R9NA 1TIBA 2WIGA 4H7EA 3WJ2A 5DYTA 2FUKA 1BN7A 1GGVA 5AM0A 3STYA 5BWCA 4PF1A 3EBLA 1TQHA 1AGYA 2V98A 2CUTA 5JATA 3TGLA 2QZPA 2VAVA 3R40A 4LHEA 2G5TA 3Q0TA 5DYYA 3N0TA 1AMNA 5KBYA 3C8HA 3AZQA 5AH0A 4U2DA 3VVLA 1R1DA 2QT9A 5ALNA 3SC2A 1PFQA 4FKBA 5AI0A 3BL8A 2XUDA 3WL5A 5IH7A 2RAUA 1EDBA 5K3FA 2JGFA 4W9RA 5ALKA 1ODSA 1QJ4A 3H2HA 3WIBA 1CUIA 3DYIA 2ROQA 1XLWA 1VKHA 4UBKA 1ZGBA 3DD5A 1R3DA 1XZEA 2ZSHA 5HQ3A 3D2AA 1CLEA 2Y1KA 4MWSA 2CZQA 2QTBA 4WDRA 1JJIA 3FSGA 5FDFA 2B9VA 2BGRA 5ALXA 3JW8A 5D6OA 5AHXA 1N5MA 4G8BA 1EI9A 5DYWA 4CI9A 4KYVA 1RWQA 1BCSA 4B7ZA 1J07A 4IH1A 5EFZA 1W75A 3N2ZB 5AKHA 4DNPA 2WUFA 4Q82A 4DMKA 3NWOA 4IO0A 3H2KA 3BIXA 5C81A 1ZD5A 5AICA 3U0VA 3GA7A 1CUHA 2X8BA 1KU0A 5AKZA 1OXMA 3H18A 4NMWA 4E15A 1WCYA 7YASA 5AOBA 1RYYA 2IIVA 3AFIA 4BATA 1NX9A 1VE7A 4GBGA 5A7HA 1CRLA 3LS2A 5ALDA 1VZ3A 2ES4A 4CFSA 2Y2UA
chains in the Genus database with same CATH superfamily
3DB1A 4D9GA 5HOEA 3VR2A 4K8OA 1L4BA 1X8KA 4B3GA 4KE6A 1SVMA 2DC1A 1I2DA 1XCMA 2I8LA 2C9CA 3HDYA 4UE2A 1EFHA 1N6NA 1UK6A 3OZDA 3MAAC 1XDGA 4IILA 5ENZA 1NUHA 2VTEA 1UBTS 2WA2A 1Z17A 3WAGA 1G4UR 1T2EA 2CDNA 4PCVA 5G1PA 1T1SA 3PR1A 4EPVA 1EWTA 3W2IA 3EZ2A 3EXAA 1M6YA 1R9MA 3K71B 2IYWA 3TOVA 4HT3B 4BNUA 3I28A 4UD2A 4QNNA 2OCBA 3SC2B 3CINA 5ALVA 1GPLA 1PWEA 1N8NA 2HJ9A 2ZSUA 3CLSD 3F5QA 3DVSX 3TN7A 4IICA 1JFFB 3H9EO 4NY1A 1DAFA 5JYEA 4P2BA 1TYZA 4PO9A 2ETVA 3GRZA 4R1TA 1RE1A 4F5YA 3SIXA 2YXBA 3WWEA 1YTLA 3NXSA 4Z86A 4AJKA 3EMKA 3ESQA 4ZRDA 3RFVA 3FOEC 2Q2QA 3FCUB 3I73A 4IDAA 2X9QA 2V6JA 1OXXK 4R1NA 3WMRA 4PV7A 1ODIA 1FTQA 1W4RA 4B84A 3E7FA 4ID9A 4UMEA 4PSKA 5H4HA 1U8AA 2OZPA 4RACA 1C7RA 1Q1GA 1CUEA 1ISJA 3NC0C 4P4TA 3LBHA 1EXNA 2ID8A 2E3JA 2NXCA 1V4VA 2GYWA 3FLEA 4GI3A 1OH7A 4DARA 4MVJE 4Q16A 1OBHA 3ZS8A 1EFUA 3KE9A 3DPIA 5JMPA 2P4UA 4NYJR 1DCMA 4D0GA 1IZ0A 2QTWB 2C03A 1Z62A 2I1LA 2JG3A 2PJDA 1P0IA 4LZJA 4IOMA 2GQ0A 2R00A 3VJKA 4DJ5X 4NJEA 1J33A 2P91A 3GLSA 3OU7A 3P9RA 5H5JA 5JO0A 5HK9A 5KWJA 2EZ8A 3ECCA 2IXFA 4KE8A 4HNTA 1JU9A 3HQ4O 1NRXA 5KPJA 3ZWAA 1BCRB 4H16A 3GXOA 2BP7A 4O4HA 4D8WA 1JHVA 2BM9A 3ELYA 4RW0A 1SIUA 4PR3A 4C3ZA 3HP4A 3IMCA 3GD7A 5T57A 2B82A 2PUTA 4BNZA 1EESA 3EW9A 4CLOB 4NI5A 2I54A 1FX1A 2NO4A 2JCYA 3R5TA 1JAHA 1LFAA 1QIFA 3S7TA 1YZUA 2B9EA 3KZMA 4ZAWA 4B44A 5IZCA 1A97A 1SXQA 1CJVC 2NSYA 1RI5A 3D0RA 1PG5A 3ANYB 3L18A 3DZBA 4GXNA 3WGTA 1M10A 1W36B 1HPLA 3HEAA 1BW9B 2I4OA 4RPIA 2ZYHA 4HRAA 4MO2A 4O59O 4YWHA 5GP1A 3S2SA 1CE8A 3M8KA 3NUGA 4GVLA 2V7PA 5DBEX 2XA1A 3DVQX 3T9AA 3ZU5A 2VUSA 2GCEA 3B48A 5DTIA 5F76A 4E94A 5L3SA 3ZW9A 1L4MA 3MMSA 4EUHA 1YA4A 1N92A 3N58A 2XOXA 1F4VA 1BZYA 5LLSA 3ZJYA 3AVTA 4OP1A 1J5XA 4JODA 5G4KB 4KYTA 3PGA1 3O8RA 2I3BA 5ERXA 5FBKA 4JKOA 1VKRA 4O4JB 1E60A 1SD5A 3GNTA 2P4SA 2SKCA 5KO2A 1GNTA 1ZOLA 3D7NA 4LJRA 1E79A 3E0QA 3ETLA 4UOEA 1OKKA 5FX2A 3ROZA 4AXXA 3WA7A 1XEWX 5F12A 3B2QA 4Y2PA 4TKLA 1AB5A 1KO7A 4V0QA 4DEXA 4NJEB 4JQZA 4LZAA 1M34B 2F6RA 1ODCA 3P9IA 1Z4QA 4ZVRA 4TMWA 3SF0A 1JB9A 2AQ8A 4L3WA 1PJ8A 4KLCA 1PG2A 3HR8A 3EJ6A 1U0NA 2XB2A 2CJPA 2W0SA 1N78A 4TWIA 4QGHA 3W6ZA 3QZUA 1ZGZA 3D3KA 5A4DA 1UWLA 4UTRA 2BBTA 5ITZB 1H4VB 4DIEA 3DR5A 3WB2A 4F4IA 1K8QA 1L5KA 1UT8A 4RD3A 1O2DA 1PSZA 4ZO7A 4M1ZA 1TZJA 1E66A 2QNBA 2DH5A 4RY8A 3AIKA 3ZGZA 1EWVA 4FCTA 4B3TB 4C0LA 2VH5R 4OJYA 5IABA 4BO6A 5BVHA 3I9FA 1PJBA 3ABIA 1RAHA 3RI3A 2HRCA 4KJZA 3EZLA 4R9RA 4PHCA 4PZEA 5JO9A 1F2DA 4EB0A 1RJ9A 1EB8A 1W49A 3EC7A 4HEQA 4TSRA 4X1IB 4MW4A 3RV4A 2SCUB 3NKFA 4L28A 3A1EA 2PS0A 3F5MA 3FYUA 2JL1A 2H6EA 3SZLA 3TKYA 1E3IA 3GLQA 5F52A 6REQB 5KMGB 1XNHA 4FPXA 3ROGA 2BZ1A 2NUTA 1K68A 1RM5A 2NYRA 4AP9A 3FNBA 3KSZO 3OIVA 4CMHA 2UYOA 4D9BA 2VCEA 3ORRA 4CLXA 5AKKA 4CODB 4EI7A 4ZOLB 3VOAA 3KOOA 1AXRA 4REMA 3VU1A 3R9KA 1LX6A 4ZQHA 4H7HA 3JAMA 1N8TA 2GPBA 3H4TA 4GE0A 3A2NA 3G1UA 5CTAA 5A1JA 3ESDA 1KL7A 3O7WA 1E7RA 1T36B 1XQ6A 3CZAA 4ZAVA 4XVUA 3AR2A 4W1SA 2XVYA 3WL3A 5JH7B 1FPMA 1A5AB 1CUXA 2VF4X 4Z49A 3H1BA 4K9KA 4YMIA 1ZW1A 1KS2A 1SUDA 2PFGA 2YHAA 4BMNA 3MJDA 1D03A 4FEYA 4CF6A 3T7EA 4BUJA 4J9VA 2P1RA 2C61A 2X0RA 3PRYA 4O4HF 4Z2AA 2I4MA 3G13A 3JALA 1NULA 4WQMA 3NDRA 5CYPA 5KNCH 4ALNA 1U3FA 4HDRA 1L0BA 1IHPA 3UM9A 5LOVA 3TG2A 5TIIA 5BP7A 1BO6A 5CXQA 1YRBA 2Q27A 3UATA 4L08A 1XCLA 1Y6GA 3EVFA 1K5PA 1Z34A 4C30A 3DDCA 2WYVA 2GA9A 2A78A 5D5QA 5IULC 4EF4A 3EDQA 3RV3A 1L4YA 2IL1A 1UT6A 3IAS6 3W5BA 2IGTA 3G5AA 2ZE7A 2XIQA 2JFWA 1O9GA 1CJMA 3NPMA 1H1TA 2XWSA 1IBKB 1MU0A 1C9EA 1N1DA 2IEAA 1ID1A 3FYUB 3NB0A 3PQ3A 4JZKA 4KN8A 4LY6A 4WWHA 3ZXSA 3QY0A 5AW1A 1WDLA 2A0KA 4HGPA 4ZOBA 1IL0A 5DEIA 2CNWD 2C5GA 4YH1A 5KSPA 4XVCA 2I34A 4CLOA 5A3JA 1SOMA 2IC5A 4ALLA 4MB0A 4YAKA 1JWBB 3CH6A 4X44A 3DWIA 3WG9A 4P93A 3PICA 3G8YA 3LKDA 3QVGA 4DB2A 1RYZA 1N5JA 1AVTA 4CMIA 3HV2A 4M9CA 2AMVA 1V9CA 2W37A 2YJTD 3H8WA 1H85A 1LJ8A 2E1RA 1Y1LA 3KLMX 4UU8A 2DERA 3HB4X 3C16C 1U90A 1Z0SA 3WZLA 1FJ2A 5HQ3B 2F3QA 1QHNA 1S6YA 3H9UA 3T7RA 4KN5A 5C7OO 1EBBA 1PVOA 4UC0A 3FHLA 2FB9A 2GNOA 1N2CA 3D5QA 1QS0B 3OT1B 3DBVO 4HNSA 3ESXA 3LNTA 4K03A 3LVQE 2XDQA 4UM5A 1GLGA 4DDKA 4EG5A 5DSXA 1THMA 3GROA 3V2HA 4C0JA 1QO9A 4HWSA 4HFNA 5SYNA 1Q14A 1TCUA 2X13A 4B7AA 1XZ8A 3FTFA 3I2IA 1YQ9A 1V5EA 3N1UA 1UMCA 3L7MA 1P1IA 4PC3A 5TNXA 2ENUA 1BKDR 3ICQB 3B51X 2PWPA 3T61A 3GJ0A 3ORHA 3GGCA 1E77A 2FW7A 1IBRA 4EKNB 1Q3HA 5LVAA 5KEIA 4NARA 1J0BA 4C1BA 3IYLW 5DO9A 5HM8A 3B6JA 3EVBA 3ZNQA 4MDHA 3AUXA 5FLEX 3U5TA 2QUKA 4FMCF 1M75A 2BC9A 5CNMA 5E3HA 5E95A 3WWDA 3A6DA 1JJAA 1S7GA 4KQ1A 3ZV6A 4DSAA 1NNEA 3TW6A 4B74A 4MIYA 1SY7A 1GWNA 1QYXA 1A4RA 2YN2A 4Q3LA 4R8SA 4GFDA 1IHXA 5U4QA 4ARBA 1LC3A 4NIMA 3G02A 2BMFA 4O29A 1KZ9A 4QQRA 2IH5A 4Q9AA 3SQOA 3EWNA 3KOYA 3RJZA 3IR7A 4BCDA 2J0UA 3H5LA 2BISA 2CCKA 4ZPXA 1I8TA 2D7JA 4CLDA 1QSGA 1B1CA 2WUDA 3QVXA 4FCCA 5CU7A 1HL7A 2C20A 2D5IA 5J4HA 2AOVA 2NXJA 4HD8A 5CB4F 4KU4A 2V6BA 3HP7A 2JJ8A 3WGOA 4U2FA 1NT2A 4C4XA 4Z0NA 1MX3A 2QN3A 3JRNA 1P3Y1 4YV1A 1AOXA 1Q1EA 3WQRA 3TXYA 2XHZA 2GPYA 3DXYA 4CKBB 1QGZA 1XTTA 5KYUB 3CH7A 4KFUA 3BH7A 3PCXA 2Z2YA 4AJNA 2PUFA 3C14C 1GU7A 3CKYA 4BX9A 1DX6A 4TM7A 4O3FA 2G25A 4L2IA 2F3UA 4JWTA 3WWYA 1IAQA 3Q3HA 4XAQA 3L4BC 2HUNA 2XXJA 1E6CA 5E9JA 2GN1A 1TVCA 2RMKA 3OIWA 1XLUA 4ZYTA 4RDXA 3ET5A 4GZLA 5H9WA 3WIEA 4WKOA 1XZIA 3K2QA 1JEYA 2X9NA 1PLLA 4I1PA 3D3WB 5AJTA 1CDEA 5DYIA 3HVKA 3UT6A 4IOKA 5E9WA 2QW1A 3WGGA 4TL7A 1VG9B 4C21A 3IH5A 1U0FA 4RPHA 4DE5A 4U6QA 4KTTE 4QGSA 4XYBA 3M3PA 1RAEA 1W8DA 3G8AA 4J6FA 3I5XA 4QNRA 1AKUA 1KDPA 1M8GA 1T6NA 1OWNA 3RTGA 1CY8A 3SMVA 3AZPA 1E89A 1MDBA 3MTBA 2WIKA 5CX1A 1IE3A 4XOIA 4BNTA 1XEXA 2VTVA 1Z0DA 1Z7YA 1KJZA 2V58A 4I8IA 2MIIA 2V4UA 4X7MA 2AUMA 2QT1A 5JCPA 3Q87B 1F12A 4I81A 2YHIA 2BZ0A 3GPBA 3ZHQA 4F1WA 3D02A 1OX4A 3CKLA 3PT9A 3DOFA 3RIGA 5JAQA 1FFEA 1U3DA 2HXGA 3DNFA 3FVRA 5IKXA 4H18A 3X1DA 2BGWA 5EJ9A 1UXGA 3IKTA 2NO9A 3H5TA 5K4GA 3LP6A 2DFPA 1YNOA 3V8NA 4KX5A 2AN4A 3K2BA 4PXYA 1G6Q1 1Z0IA 4S05A 4TXJA 5TSDA 2W8ZA 2LGJA 4BO1A 2F1JA 1MNAA 1LF0A 5JFGA 1WULS 3L0OA 3FOWA 1WU8A 2P2ZA 4C7MA 1R0CA 2WWYA 3H99A 2FPXA 1ORDA 4MS3B 3WRVA 2C78A 2ZVJA 1QOZA 2PO7A 1MRSA 1QHXA 5GPBA 2BF7A 2CL0X 3K4QA 5GMOA 1RTKA 1U3UA 3Q7SA 3WP1B 4R2LA 4CNBA 2ZSBA 3FJ1A 2JBWA 4W5OA 4U7JA 4J07A 5AUOB 3FDIA 1GKKA 1TUIA 4AROA 3VKGA 1QHIA 1ZGCA 1II0A 3DBHB 3LBNA 3I05A 2ISCA 4F7WA 3IBGA 2Y67A 3SFVA 4EYKA 4Q4DA 1TI7A 4QUDA 1P9OA 3JQFC 4CV3A 4JR1A 3BMNA 3K1ZA 2BLNA 4KCGA 4UNIA 2MINA 5AVKA 1O58A 5C1PA 4IDBA 4MR7B 4RL4A 3SM3A 3JQBA 1HFJA 3CGGA 1YU9A 4N3BA 4JI4B 2FE4A 4MIKA 3LVBA 1C2YA 4B82A 3NLLA 1N8SA 2VSOA 3CQ9A 5GAJA 2XUAA 4RL6A 1ZH0A 3U6KA 4H1UA 3TZHA 1HV8A 1M0TA 4G1VA 2EP8A 5JS7A 1EP1B 2PBLA 4PRYA 4IZOA 3AR5A 4IIEA 4YP9A 4NXMB 4JBGA 3O2SB 4GLOA 4QQ8A 2I7TA 4OB7A 1NQTA 4DRXA 3HXQA 1BTOA 5THXA 1B0AA 1PLKA 1BCRA 4D4HA 4Z3KA 1W85B 2PH1A 1GL6A 3VYUB 1N2SA 2UYYA 1VL2A 1QG2A 2CYCA 1AGNA 2D1SA 4MXDA 4WSOA 3WFJA 2ACKA 3NHAA 4URVR 5KC8A 1U4OA 1AZTA 1ONPA 3ZCRA 3LW7A 1IIRA 4ZO9A 5FUWA 1JYSA 1GDDA 2PYIA 3QMVA 1DQZA 4FYXA 4TTRA 3ZY6A 4E3ZA 4RTSA 1HDCA 3MHTA 4HN4B 1JEOA 4OUDB 4R3NA 4HRVA 3A0UA 1XYYA 1TEZA 4B2YA 4DSTA 1V96A 2G1PA 1UOEA 1DEHA 4JCOA 1SOAA 2F8MA 5G0UA 2WUVA 2PG3A 1UODA 5F7OA 5ICGA 1U28A 2C8LA 5FI1B 4YK7A 3R3XA 4P35A 5AJXA 4F8EA 3RRJA 1THGA 2XYHA 1NJ5A 3AH8A 3UAVA 1YZHA 3M89A 4CKWA 2ZQZA 3AEQA 2VI5A 3P0RA 4D44A 3ZJUA 3RHSA 5H1YA 1QAQA 1WQ1R 2JGJA 5F2EA 3EIWA 3UJBA 4EJSC 1E2LA 1E2MA 2CCJA 3ESCA 1WZNA 2ZKLA 4GZ3A 1H4TA 2KHZA 5KCZA 4EMUA 1T2AA 4NQRA 2PSHA 5HDBB 3N75A 1AKWA 1QQ6A 3NDIA 3Q8LA 2O57A 3OZFA 2I2AA 3MCAA 3RF7A 2IHUA 1PGNA 4R3WA 4NH4A 4MLZA 3QLEA 5DSZA 4YRGA 1OOEA 2FFQA 4MARA 4DSZA 2QR3A 1OH5A 4K9RA 4ZDWA 5CGQB 4NEHB 5I47A 4LI3X 1J0DA 4M0DA 3ZI0A 4O63O 3IEKA 5GGYA 3O4JA 4DY6A 3SYRA 3UAYA 5I5GA 2DHRA 4HYQA 4DJAA 1H6DA 4FX5A 1LBQA 2CB0A 2VJKA 3CLKA 5K3FB 3GUZA 3JSXA 4YJFB 4YQEA 1FDIA 2QVCA 4U8HA 5KSOA 3IDSA 3HB7A 2OV4A 3WX0A 4OLBA 1P4HA 1ZRSA 2PGDA 1XZCA 3NALA 3MTIA 1Z18A 4Y67A 4ZJUA 7MHTA 4C6RA 4NBUA 2WHYA 3RVSA 4CLHA 5JQGB 2YHIB 3ZDRA 1AGRA 3HNPA 2XXAA 2Q50A 1NBOA 3CO5A 4EA9A 1EJBA 1YRHA 4PU0A 1MQAA 7REQA 4LOLA 2XOEA 3FGPA 5IHXA 2P3SA 2W2TA 3TS1A 4KR6A 2IKSA 4Q7EA 1P7WA 1AURA 3IODA 3FJYA 1YASA 2CJWB 2R1VA 4OL9A 3RYHB 1JFTA 4LA4A 2OD7A 2FVYA 1I6LA 4QEDA 4LK3A 4RLSA 2IYRA 5DNAA 4JLBA 4CQNA 2ZQ5A 4ZCLA 1B6GA 3BD6A 4HN2A 5JD6A 3FF4A 4TSFD 3VV2A 4HDMB 2CFTA 5I3ZA 1AQNA 2PSJA 1NOKA 3IDFA 2A3RA 1J2RA 2QL6A 3LLUA 1NDUA 2SICE 1ACMA 1U3VA 2C04A 5EVJA 2A86A 3G68A 1K8RA 1KY5A 2PT5A 3ZCSA 3QSYA 4HYTA 1H8HA 3MWJA 1G16A 4OKSA 1V47A 2IEIA 3IO5A 2RAPA 2NIPA 3QELA 4AKHA 3D6AA 3KAQA 1TM7E 1QAOA 1PJ3A 2DPGA 2UYQA 1RLTA 4BBJA 1DG3A 3TOCA 1OA0A 1Q5PA 4FYKA 1WY5A 2J59A 1ST3A 4R83A 3UMJA 4BFLA 1E32A 5FPSA 3ZTWA 1K6XA 2EZ4A 1U9IC 4RKRA 4DILA 3C4VA 4EKDA 4O02B 2P77A 4X7BA 3HXOA 3EOZA 2Z8YM 2ZR8A 3I62A 2F67A 4GMKA 4E11A 1NX6A 5EKTA 1XKXA 2W43A 4EW6A 1EM8B 3CR7A 3O95A 2VC2B 5I7UA 5JQGA 3EOBI 2IZZA 2DUWA 1MGOA 3AHDA 1JA1A 3HLTA 2VH2A 3OFSA 4P31A 5T3UA 2LDBA 2QT0A 3QEMA 5SY6A 4O4LB 1O5IA 3ANNA 3BXXA 2V4ZA 4K6KA 5TQ0B 2ZB7A 5BV0A 2Y27A 2Q9CA 1QYIA 1B7GO 3DB2A 2W6JA 1RMYA 1QO0A 2W2PA 4MWDA 3ZLUA 2EFGA 1O6CA 3GCXA 3KLOA 4PN7A 4EUSA 3VYVA 2FW8A 4WE3A 2H00A 2GUGA 3KK0A 4LGVA 1USUA 2FFHA 1OFIA 3T5TA 1YR1A 1HTTA 3IV7A 4KVGA 5AM1A 1G38A 4WBSA 2FXVA 3RK0A 4YDHB 1E1QA 1PV1A 4KSYA 2UZ4A 3WICA 4YV7A 3MHPA 3T4PA 3F71A 2A14A 1Y8QA 3TM5A 1ECCA 1I9GA 1Q0RA 1WXWA 5EQDA 3U7RA 1D4FA 2RI0A 1G21B 2VHWA 2UV8A 2VYVD 2P27A 2V45A 2H57A 1K0UA 1MC5A 2IYVA 2NLOA 1GILA 3BJRA 3HRIA 4LJKA 3TXXA 3UVEA 1W9MA 1WHTA 3ZXYA 1RQGA 4YPFA 3NHUA 4NP6A 4DA4A 2W00A 4BASA 1KAQA 2FFRA 3A4IA 3EVEA 2RE8A 4F9FA 2EF1A 2HK9A 2Q2WA 1K7SN 2HR1A 4XPZA 1ISIA 4J1SA 3LLSA 2LZ0A 5DNDA 1RS0A 1EG7A 2OOKA 3OTWA 3L6UA 1CULC 3I39X 1AS3A 1JU3A 2LTAA 2VRCD 1A9QA 2MSKA 4OI4A 1IEVA 5LLTA 2I03A 4TV9B 4EY4A 3DMDA 4WCVA 3JQ9A 1ISGA 3AF3A 1H5NA 2COEA 3MFQA 2I8CA 3TQTA 2A7XA 3QIVA 3SSAA 1VRWA 4F9TA 2QGNA 4UZEA 5JSZA 4DLXA 2I4IA 3CZCA 3A25A 2JFFA 4WY5A 5FWYB 2BSQA 1J49A 3VR5A 1MB2A 2X1MA 4NS1A 3P2KA 3W9UA 3ZWBA 2R8EA 3IERA 3MD9A 5JNVA 1DOAA 3IJPA 4YV0A 4BMYA 3UPDA 3VKFA 5KTTA 1C7JA 3LO5A 1D2HA 1E2HA 1V26A 4CR6A 4YRNA 2CUNA 5I4IA 4U6SA 2F55A 5B4VA 2GLUA 5IBQA 4BEVA 4BZXA 4FMPA 1PFKA 2ILVA 3DHVA 4HNHA 5A9SB 3MLAA 1XCJA 2QMUA 4XB1A 4BFUA 4DKJA 1A7JA 2ANCA 3TUIC 3JASB 1UMBA 2X41A 1Z82A 2XOKA 1NW3A 4YRRA 1H94A 1K08A 2H07A 2EJWA 2ZRNA 3EUFA 4RUKA 2AMFA 2PBFA 3A10A 2C7VA 4RXTA 1P6XA 4DIDA 2JAHA 4JT8A 4EI9A 5LIRA 2XQGA 3J81A 1UP6A 3RYIA 4G56A 5CA0B 4TLDA 4F45A 5KYTA 4ZCRA 3A3KA 3L3BA 4LTMA 3SVZA 4B3DA 3Q3IA 4FDMA 4HLDA 4ETWA 3K20A 5T8KC 2W4QA 4DTCA 4JBWA 5T7BA 4UAJA 3N0RA 5ALJA 5EXEA 4X3CA 4EW1A 2HB6A 2COUA 3ZE2B 4FYMA 3FBWA 4NL4H 3C3JA 2NAFA 1VLQA 3CLSC 5DBIA 1Y3HA 3FYTA 5K5EA 2VR1A 3O74A 4P54A 3B3FA 3ZIDA 3V1NA 1R0WA 3LOUA 3K31A 3EPKA 3TRKA 3O8OB 5HJEA 4MW1A 2CMGA 3ZWWA 1SKAA 3QUCA 1GKYA 1QGYA 2RCYA 5I9IA 1GTJ1 4MR9B 1GNQA 4R7ZA 3IE0A 5ULLA 2FWJA 2BSXA 1E1LA 5LZ4A 4QUHA 1GZUA 2F3TA 2QSYA 1GGMA 3CPHA 3GYBA 4X1OA 5TVKA 5KX5F 3B6MA 1ZNYA 1VKJA 3VR1A 2NU7B 3ZE7A 3CLUC 3ROTA 4HWTA 2L42A 3ITEA 3QGMA 1P4JA 2B37A 4L15A 2FG7C 2P4EA 4OXNA 4ZEMA 4MVXA 1KP9A 4PYLA 3DV0A 2HDWA 1NVFA 2FN9A 1G9SA 2FR0A 5FULA 2YFQA 3PXDA 2AEFA 3ZVLA 1BHSA 1A2OA 1MPXA 1T3HA 3EQZA 2A0UA 4E5SA 1DSSG 1DAHA 1P0CA 2I0FA 2I4TA 3WGUA 4QT4A 4A0GA 5AVSA 3D64A 1R6BX 1T2VA 5IT4A 4U7FA 5SYMA 3T15A 4KO2S 1RD4A 2A0FA 1B8UA 1HTWA 3BMNB 2BT4A 1WXIA 3JS5A 3L8CA 3KR9A 4GE3A 4BAUA 1X1AA 3G2QA 4D4LA 4ZHQB 1U8EA 2I78A 3MSXA 1XL1A 1FP6A 1HT1E 5EERA 4B85A 4F3NA 4YPVA 3KQOA 4OBXA 5ESRA 4UNSA 3NHYA 5H02A 4NBWA 4FZVA 2GAAA 3DEIA 1R7RA 3KUUA 5B1DA 2JHFA 2BRUC 2E82A 1LQTA 1E94E 1YZNA 2HLNA 4HH3C 3EIHA 3RK4A 2WU8A 1BMQA 3IOBA 2VAXA 1YVDA 4JEUA 4F46A 2IV7A 1XJQA 2KQUA 2QEQA 1JNXX 4M9RA 3T7JA 1W0KA 3T99A 2AS0A 2ERYA 2VP3A 4BNDB 1KMMA 3OLXA 5J2UF 5E4JA 4BOYA 1CW2B 3SZ3A 4Y9TA 2CHUA 2VTBA 4FOOA 3L43A 2ZJ6A 2PT9A 3NETA 2XR1A 2QV0A 5GINE 1RWKA 2EZ9A 4L5AA 5BRJA 4PZPA 1IWPB 1A5BB 1NI4B 1WR8A 3HJCA 4PQYA 1N6LA 3THRA 2R5NA 4XX1A 1JIIA 1V6AA 3UJ3X 4M86A 4OHWA 5H3HA 1Y6QA 1NKTA 3W1WA 1I6KA 2QYTA 3P5BA 4GC9A 2CBGA 5F2NA 3H75A 4OUDA 2PUJA 4PYQA 1JHYA 2II6A 3L4BA 1IN5A 2LKDA 4DV0B 3ZV4A 1ZIDA 3AYXB 1VIMA 4BYMA 5DK4A 1JALA 3HXLA 3KUDA 3W4KA 4DGSA 2FWRA 1G0OA 4ZK2A 2DQYA 3PDJA 2WJYA 5FEMA 3DMYA 1F9AA 3AWIA 2OCDA 4MIOA 2FWNA 1N0UA 3O9ZA 1NV9A 3AEUB 3GPIA 3ZLJA 4Y9DA 1E9EA 2NUAA 1NBIA 2CLEB 2VDNB 1BWQA 3ANSA 4X5OA 5TT0A 3P5SA 1CS0B 1ZCFA 4HFMA 4KZKA 1SKYB 2CE2X 4QATA 4Y2VA 1AHHA 3L4SO 1J2JA 2OORA 3COYA 1PX0A 2VDOB 4UZFA 5DOZA 1F8UA 1OLUA 4IBOA 4P4UA 5E8RA 2PUGA 2UXDB 3M33A 2BHTA 1TIPA 1IHOA 3QLJA 1ABEA 2ONYA 4J90A 2R1TA 3TD2A 1RCUA 3GHYA 4KDEA 4E4YA 2SECE 3I30X 5I7VA 1KQPA 4GF5A 1HDXA 4YFVA 1J4AA 3GCDA 3LDFA 4N41A 3L1HA 1JIKA 4IJ6A 4QU5A 5IC6A 4KUHA 5CVTA 4REQB 4B1FA 4KRGA 2NSLA 2Z1DA 4LJLA 3L9XA 1ZHHA 4C4OA 3BZBA 1H8EA 1UEXC 3GJ7A 1U31A 2WJ3A 4L16A 3K16A 4W1RA 4ZPJA 4QLAA 1MB3A 3PDWA 5T64A 2AH5A 3UT5A 4BNIA 2BR5A 3SZRA 2GTIA 4O4JA 4ILEA 5JJCA 1ZICA 3IT3A 1XRRA 3OI7A 2YCBA 1IY1A 2BKXA 4UPDA 4XIGS 2NU6A 4CMKA 5FQNA 1KAGA 3AU9A 2O2GA 2WZBA 5BN1A 1ORIA 3ADBA 2QK4A 2QWXA 3K0KA 1J6UA 2HHCA 4RJJA 3P0EA 3HBFA 3DAPA 2QG4A 4D2IA 2Y0PA 4ER0A 2WPDA 4W5WA 2F43A 1KBZA 1PO7A 4RWZA 3KAPA 3DYVA 2C2OA 2VWPA 3I9JA 4MVJP 4UZSA 1CG6A 1N2HA 4ENVA 5HPYB 1U1DA 4XIYA 5KYVA 2JAQA 3HMQA 1XTBA 4D8TA 1PR0A 5ES3A 3K4PA 1C7ZA 2ZRLA 3LCCA 4JT9A 4OQDA 4COKA 2BH9A 3T1TA 2NUAB 5K1ZA 1QGDA 3T3OA 3ZQJA 2GPNA 1K8YB 3MTGA 4P34A 1AUVA 3IAUA 5DMXA 4U7GA 1XZDA 5CB4B 4B6JA 4DQDA 3FHTA 4BJ5A 3NTXA 4Q4CA 3U3KA 4DR4B 3VNUA 1N32B 2IUSA 1XMVA 4YNBA 1UXKA 4HZGA 3A7EA 1LPNA 3F46A 3JWPA 3TZBA 4RVUA 4FNAA 4MULA 1SHLA 3KDPA 2PZJA 1QIIA 1A98A 3T3MB 1TA9A 1YS9A 4YMVA 1T9BA 3DGFC 3A3OA 1IQ0A 4ZC1A 4C7JA 2IQ5A 3NGLA 4L1KA 4GGPA 3GP3A 1CZLA 2H5LA 4BVAA 1OASA 3W5DA 1GVNB 4M1SA 3FTDA 3PIDA 2QRZA 2QTMA 4D5GA 4EA7A 3KKEA 4DA7A 4FFDA 7ABPA 1LDGA 3IBTA 1BRTA 1KORA 2XMBA 2EJCA 1FDWA 3OFND 4MR8A 1WPRA 1H2ZA 4ZHQA 3EH2A 5BUSA 3DAHA 2HMVA 4JKYA 4ZOLA 2JLAA 1XTQA 1EFAA 1WIWA 2XMDA 4NENB 2J09A 3KUCA 4HZUA 3T3DA 2DVMA 1UKBA 1W88B 1BX1A 2AXQA 5HQJA 3RVJA 2H1CA 4ZAFA 4HFJA 3WXMA 4C4SA 4BN4A 3NRJA 2HRDA 2AW3A 1BHO1 1HFKA 2JFGA 3AV0B 2AEMA 1XVLA 4B4DA 5JH7A 2R2AA 2PR2A 5A0VA 5D8DA 5EZYF 4G0WA 1E6KA 3GNSA 1KJQA 4CBVA 2Q3HA 4J6EA 6GPBA 1FMJA 4NFHA 1UBUS 1YULA 2TS1A 4QPZA 5HKLA 1OB5A 5JNSA 3QELB 4G67A 3I5MA 4A27A 4WBNF 1P5JA 1NRWA 1EFVB 2E48A 3GRCA 1DKQA 1PFWA 2C2HA 2I66A 3K0AB 2AI3A 4M37A 3A27A 1X1DA 4QJ4A 3LFUA 1SVKA 2GM9A 1ENOA 2OZEA 2R9VA 4DDVA 2F4NA 1VBMA 3PGVA 5EEGA 5FUYA 2GD1O 3TRIA 2QDKA 2O3TA 2OMKA 4IF4A 1ZM2A 2ZITA 3QU2A 2WD8A 3K2IA 3B5JA 1KP2A 3NT4A 4XUGB 2XWJI 4M8NE 1UFRA 1IXYA 4G07A 4H7DA 4CM8A 1E6WA 1RKBA 1X15A 2UZAA 3QUQA 2CJWA 2B4KA 4G5XA 4KP7A 4UVDA 5ALFA 2VK1A 1W5AA 2GXUA 2G70A 4QHYA 3D8TA 3H2GA 5TQ0A 3ZDAA 2NU8B 4HWPA 1Z47A 2DAPA 4IIFA 5EZSA 2CC2A 2DR0A 1XKQA 3RM3A 1CUCA 3TKAA 1FK8A 1FFHA 3LQ2A 4PRKA 3R75A 2ZR7A 3I83A 1J5EB 2IBTA 2GJ9A 3PIRA 1T2NA 4XUEA 3K9LA 1W88A 1U6KA 1USWA 2AOTB 4NBRA 2IHYA 1TRHA 3TL3A 3RAPR 3QKRB 2JIPA 1NM5A 5DX0A 4BFYA 1JEYB 3N0WA 4BCBA 3ZIAD 1PD1A 2VT3A 2WQZA 3LQ1A 2JIMA 1KMHA 1TUBA 3WRYC 3DT9A 4QXRA 1A7AA 5HF6A 3QFSA 2XDQB 3QKUA 3WI7A 2XVZA 3EDRA 2A9FA 4E2FA 4URZR 1DAGA 1PIWA 2Y93A 4TXNA 2DEUA 1QU2A 1Z4OA 1FIUA 2XE8A 1L5YA 4AUEA 2QJTA 1FS6A 4LC0A 2C58A 3ZQ4A 4BVJA 4YP6A 2WILA 2A0YA 1MF7A 5IDWA 4II3A 2VNAA 4MKHA 4XASA 2YMLA 5T6BA 2QROA 3F74A 1EZ4A 3H1FA 3ICCA 1Z2OX 3MWDA 1B2LA 4M0LA 3RT9A 1Y3BE 4CG2A 3I04M 4X62B 3QOYA 1QRTA 2IRWA 3HCFA 2AIRA 4FS3A 4TV9A 3JU3A 3QVJA 1XNQB 4R31A 1JJBA 5JD5A 2NTEA 3SI7A 4P5EA 4YT2A 5CD9A 1RKVA 1Z68A 5IWAB 2MSDB 2Z5FA 3OLCX 2XJ4A 4LXHA 1QIHA 1UJ5A 1YHYA 3FVTA 4NSNA 3VTZA 3L1IA 2AJDA 3RVPA 2QX8A 4AN1A 4B3IA 1GQFA 3QNWA 4DCCA 4FK8A 4I2NA 2IZ7A 4FYWA 3I32A 1NWHA 2AOWA 1HZZC 1XMXA 4BZZA 2G3YA 1TXGA 3VR6D 2CY0A 1FNCA 1YZTA 1VJDA 1E9BA 1MZVA 1NZFA 1VLLA 5E7IA 1YI8A 3A9CA 4PG6A 1TRKA 1JDJA 2VYQA 3KC2A 5EE9A 5GZ3A 2O5EA 4EPRA 2PEZA 3Q3GE 2DQ4A 1EUCA 4N40A 5D3ZA 1T26A 4EG7A 1HLFA 1L5NA 3KXPA 5MHTA 4M8LA 5A2QA 2NTVA 1RM4A 4DN6A 2BEUA 4BPBA 4W5HA 3MCVA 3HXPA 4YVFA 3V8BA 1KI4A 4F5DA 3UTCA 2O7VA 2AK3A 1VRCA 3IUPA 1XKLA 1FXWF 1KETA 4KIGA 1PG0A 3D3QA 5HG0A 3GRYA 5FTKA 4Z54A 4LWPA 4WJKB 3WS7A 3KL2A 4PHTA 3G0IA 4CEJA 1S01A 3NBMA 2QORA 2FMXA 1DHRA 4HUJA 4WUVA 1ZMBA 4AJJA 1KKUA 5SZKB 4DR5B 5FBRB 1JAYA 2YY5A 3CH4B 4CF5A 3UHPA 4R7GA 1KI6B 3G88A 2CFIA 2XUPA 3CEMA 1V6SA 3CUSA 2D4HA 2RG1A 2YOHA 3O94A 3SF8A 2VSQA 3ZE6A 2YZMA 2ZTHA 4FT4A 4YALA 2O7SA 1LNSA 4B33A 4OGWA 3THXA 1M1UA 4KK4A 1YA8A 3QVMA 1ZYUA 4ZA2A 3ZCQA 2YFHA 1AKRA 1LNQA 4MR9A 1HTBA 3I2GA 4JBNA 5EJMA 3WNZA 2WSSD 4L0QA 1ABBA 2FPPB 4B3MB 3M6VA 2EX0A 5CM9C 1HE1C 5TMBA 4M9UA 4CM3A 1T15A 1XQWA 3QF7A 4IV0A 3AVUA 3OZEA 3ENZA 3ZDXB 2P4QA 5LQKA 4Z4FA 1F7VA 4MYDA 2B78A 3TQOA 1UP4A 1EVEA 2HSZA 4YTEA 1XVUA 1GFIA 1JR2A 4ND8B 1E5DA 1M34E 2WNIA 5ARDA 3KALA 4CTNA 1RCFA 3JQDA 1YFJA 3ITKA 5F73A 2YFYA 3EQ7A 2XF2A 4INJA 4J4HA 4WASA 5AMXA 5LA6F 3W1VA 1OIWA 1TT7A 3BPSA 5EXSA 2PMKA 3STXA 3T7CA 4OYYA 2X0KA 2WDZA 1NE7A 4PAGA 3SQDA 4B75A 4D9FA 3LY7A 3WGLA 3DTTA 3LFHA 5UKDA 1QPBA 4ER6A 4LQ4A 3TDKA 3OQMA 4M1EA 2QP9X 2FDXA 2CJXA 1KI2A 3Q72A 1WNTA 1Y9DA 3PPXA 4P3NA 3KDSE 4EKIA 2Z6QA 3NIGB 3WBJA 1HO3A 4YP5A 4D56A 1PNVA 3S1AA 3QV2A 1NN5A 3ELUA 4ISBA 5FFMA 4DR7B 2CXRA 2MHCA 2BEKA 3ZN2A 3OIDA 5J4VA 1NJ1A 4YRJA 4AZ3B 3T4XA 4QDXA 4MKIA 4V2IA 1T6ZA 3NBFA 3FCCA 2RHLA 4QUKA 2EGGA 3CKKA 3PR3A 3E9YA 4WVLA 1Y34E 3W5VA 4DEYA 2N46A 5L6MB 4YJHA 3QHAA 1XDSA 3W2HA 1AUQA 4QIHA 1JT9A 4PYNA 2KW5A 2GN4A 3GWGA 1WL8A 3RF6A 3UENA 5I5EA 4JA0A 3O1JC 2EIHA 5YASA 1LVGA 1MAAA 3RT1A 3IXLA 1FLAA 3V7FA 4A8HA 4WFIA 2QN1A 3W05A 2P1ZA 4YGXB 2OBXA 5B7NA 3RRZA 4Y1RB 3NI2A 4KQ9A 2UVPB 5CM8B 3UJCA 1WCV1 2G6BA 1JHMA 4TTPA 2IXAA 3M4JA 4FDAA 1PK9A 1KVRA 2YWGA 4CMGA 3F4LA 3C6ZA 1YAJA 4ND6A 4RXUA 4CKBA 1GSHA 1KH1A 2GYYA 5C51B 3R8FA 3UNXA 3P4XA 1T4MA 4IGFA 4KUGA 5KNDH 3TBKA 3L7OA 1QFJA 4PFKA 5K4AA 5DNWA 3S1LA 3HKDB 3NWBA 2V5AA 3H1TA 4F4CA 4IWYA 4EO9A 2LWIA 3SS8A 3IEPA 4O0MA 4I55A 4TUYA 2LV8A 2ZXEA 4BGUA 4DA0A 2WYOA 2OVFA 2XV1A 2E4AA 3OF3A 4M6WA 5C8YA 4LWZA 4AQDA 2HZBA 4DR1B 2Y3IA 3GT4A 1IZ9A 4FR2A 1XRNA 2B4RO 2X1HA 4ZJYA 4TTAA 1VSQA 1D8AA 5FFFA 1K7XB 2GD0A 2CLHB 1KARA 3EGDA 3FPJA 5IVKA 3QE4A 2HRRA 4I46A 5TB5A 3FOAA 3O7MA 5I01A 4K81B 4RULA 1SQ5A 2XQFA 2RHHA 5LMUB 4D0SA 3KYDA 3B8EA 3BMQA 4NHOA 2PL3A 3NBKA 4X8MA 1BWRA 3GP5A 1JQLB 2JA2A 2XEDA 3ZI4A 3MGBA 3LI2A 1XXLA 2B61A 5HQTA 1WKCA 3DL0A 3UC5A 4ZI5A 2E6UX 3K73O 3L6BA 3UJDA 2Q5QA 3JR7A 3RUHA 3VBCA 1CZKA 2I1QA 1ECJA 4JLDA 3KRTA 3AJDA 1Z16A 3DEAA 4IMJB 5KYYA 4C9BA 2ZE5A 5FWNA 4D9CA 4I50F 3ID6C 5A4KA 3QIAA 4PONA 2D2XA 3BC1A 5TQ2B 3VAZA 4I3HA 5LR6A 2ZYSA 4J3FA 4JOQA 3TX6A 2XA9A 1H3FA 4XUCA 5GONF 1D04A 3DWFA 3PITA 4FHCA 4Q47A 3CM0A 2IV3A 2I91A 2D7CA 5CMLA 2H4FA 3ZHOA 1BQEA 1HE4A 2FLVA 4JJZA 4EENA 3UMMA 1ONBA 1JPUA 4IHQA 1DKPA 4H6PA 4G9GA 3W2GA 1HGXA 1KEWA 1AN0A 2Y1FA 3IKVA 1QVVA 4EABA 2DX7A 2IVZA 1VBNA 3GA5A 4O3MA 3IMFA 3F6CA 4WGFA 3CRZA 4YXFA 3LWDA 3PPIA 1EXMA 5EWLA 3ZCVA 3DBHA 4D98A 3Q8WA 4LSWA 4CEIA 1N6KA 3A14A 3IFSA 4P0PB 1FQKA 3IUMA 3TE7A 2GBCA 3TLGB 1G8HA 4MUMA 4UEKA 3FPEA 2K7ZA 2O9JA 5HIIA 1QQBA 4XFKA 3MYYA 3NBAA 3HPQA 3L6CA 4IFEA 2JI6A 1UFQA 2FSIA 4AVYA 1C81A 5F9HA 4D97A 3KYDB 4GDFA 2CV1A 1I6MA 4B3FX 1YBFA 4YAJA 4CGZA 4PX9A 3UCFA 5IBCA 3ZD6A 1SKBA 2XBLA 1K6EA 2GEUA 4C4ZA 2N42A 3NATA 1NBMA 2ADMA 1C8VB 1EP2B 5REQA 2D3TA 4JJIA 4H3KB 2KJQA 3ACCA 1CD5A 1ODJA 3LKVA 4WK2B 4EY3A 1E69A 1ECBA 4QUGA 4JU9A 4V3BA 4WZBE 4YRFA 3HXMA 4IGAA 1VA5A 2CE7A 3RFCA 1NW7A 4PR0A 3O90A 2N75A 3B8HA 1JLMA 1EZ1A 3PNBA 5CIQA 4L5BA 3PGLA 5E6SB 1RZRD 4W7IA 4IY1A 4GLBA 2HIAA 3RRYA 3L01A 3BWBA 1KK0A 4OHYA 3UB4A 4C2AA 1SULA 2AX3A 2H1HA 1T0BA 4IUYA 4Q3DA 4Z8XA 2FG6C 4Q9LA 4EMSA 1Z6YA 3JQ6A 3QVGB 4Y2UA 1EQAA 3P2YA 3HG7A 1VHWA 1Z39A 3EUAA 3K05A 3W78A 4D43A 1FW6A 2GCIA 1L9KA 4GQBA 1M72A 3UWMA 4M8IA 3WHKA 1TB4A 3N8NA 3TQQA 1SXJA 1YFKA 2R7KA 3QXSA 4FFOA 4ZI7B 4L8VA 3A9RA 4FFLA 5EHQA 5H16A 4KPUA 4LBVA 4QC2A 1TMGE 2MDTA 2O2IA 4ZO6A 3JRWA 1RZRA 1EIZA 2O48X 5E4YA 1ORVA 4MYRA 3W8RA 1S89A 5EXPA 3SQWA 3MGGA 4YWJA 3DF7A 1TZKA 1T5BA 1INLA 3LWBA 3LHFA 3DZCA 3B5IA 3FRHA 3W9BA 1U81A 1EVZA 3MT8A 2J9XB 3BSSA 1UKCA 2WRZA 3IIEA 2QTLA 3Q4GA 2O1XA 2WWHA 3NX4A 5ALIA 3A2MA 4P33A 4HB0A 3WJ1A 4A5SA 4ZDJA 4QRHA 1EJ6A 3HKDA 2BFAA 2IPNA 3OP4A 4BVKA 3ZVKA 1GU1A 4N6GA 4EJ6A 3D5EA 5LC1A 3M5WA 3WK6A 3E3MA 2X7JA 3P9QA 1RXIA 2O8FA 1ZX1A 2ZE6A 4N5LA 4BLOA 2PUCA 1XIVA 1RAIA 2X86A 1PS9A 2QE6A 4MPPA 2AG1A 4K7JA 4U8GA 2BUAA 3RGGA 3TCXB 1OXUA 2GF9A 5FJJA 2P30A 3V8MA 3IOCA 3ZWKA 2GZHA 3ZCUA 1WV1A 4WL0A 5DNYB 1A88A 1DQRA 3TW8B 5EUMA 4KQXA 4FTWA 4OVKA 3QPBA 1ILEA 2P41A 2NQTA 3C45A 4AAYA 3COZA 4CUJA 1MR3F 3IB6A 4BZWA 3BTVA 4B17A 2C4NA 2QN8A 2VKQA 4DA9A 1YOVA 4ZYVA 3DFUA 3C5WP 4BRZA 4D9KA 6LDHA 1XK7A 4D3SA 4KJXA 5DBFA 3AL3A 4J0HA 1P1FA 5BMVF 1MG0A 3ENNA 1MDFA 2W2LD 2X76A 1F2TB 1EVLA 1YSCA 3M3HA 3OJEA 2XD9A 5E2BA 4BFCA 5AQ1A 2JIOA 3TB4A 5IM4A 2YOGA 4F6RB 3S8YA 5CP8A 2GEVA 2O6LA 1EE1A 5SZIA 1WS6A 3ND8A 4Q3CA 2Y6UA 3O9MA 4AQ7A 3IO3A 1FEZA 3DJYA 1VC2A 4Y9UA 3WBKA 4O1IA 3OAAA 5KU1A 3F6PA 1KO4A 1Z4LA 4Q1FA 1DMSA 1NNUA 4A2WA 5FNVB 5IAAA 3H1EA 2PGXA 5C5CA 3R0IA 5BWLA 5L3VA 3ZQKA 5J4YA 1JDPA 2BMWA 3HN7A 1M74A 3MYRA 1T0PA 4XGIA 3R7SA 1BHQ1 4MVJH 4YECA 5K3SA 1MHPA 3G17A 2W2VA 4LHVA 3UK6A 1VMAA 1E3JA 2JAWA 3KUXA 3R6TA 1FP2A 4MRNA 3QEKA 4ZVPA 2B2NA 3VFDA 1L5WA 1YC2A 4G81A 2EGUA 3BE6A 3H0EA 1SKYE 4WCFA 1LPPA 4RCZA 3IP8A 1S02A 1XZHA 5CYFA 2GZDA 2AVNA 2BBWA 3I5UA 1YS1X 4DJJA 1RC1A 3GJ3A 4C6HA 1ADGA 3KQSA 5A6VA 3FM9A 3Q12A 5IKEA 5K01A 3FKQA 4B3JA 1U3TA 3BIFA 5HCIA 5JH7F 2GZ2A 1LSOA 2WG0A 3GT3A 4CQMD 3Q0EA 3AM5A 3GVIA 4XUDA 4TLMB 2QZJA 1TVEA 2J32A 4BLPA 4N18A 4QVKA 3C7TA 1UDWA 1OROA 2VO1A 2AWOA 4U7WA 4PLTA 3ZWNA 2CXSA 3U7HB 2R7NA 1ETHA 2HCFA 2H8KA 4JJ6A 4IG4A 3FRJA 4WNAB 2CKMA 5CJPA 2ZT8A 1X7GA 5C3MA 3O1HB 4P81A 5H83A 4HS9A 4I8XA 5CG2A 2DLCX 1DWQA 1PGQA 2REOA 3BHIA 3MJVA 5LDHA 5FI5A 4F9EA 5JYCA 3U44B 2F64A 2W6QA 3LT1A 3HU2A 3X44A 3GIWA 2DT8A 3SJUA 1GQQA 3EPHA 3J80A 4WY2A 5EKUA 5K99A 5AR1A 2WSYB 5KTKA 1YE3A 2PQ0A 4RHTA 5CVUA 1LBSA 2DSNA 2XIJA 4CDMA 1RJGA 2PA3A 4TMXA 3WKDA 2E5FA 1RIIA 4PSDA 3KJXA 3AXSA 2H85A 3HYLA 3MSCA 3O8QA 2OFWA 3OEHA 4M0UA 5FAXA 2ZR9A 5I9TA 3T52A 1L4LA 1GXSB 2FMIA 3AOGA 1BDMA 2BEWA 3PS9A 1NAIA 5CLLA 2WDPA 1OBOA 1RLUA 3OZWA 1BNCA 2YWCA 4OOEA 5E8JA 1RIFA 2I3AA 1P7ZA 2VDJA 1S2MA 1VTKA 3F5DA 2GZMA 2GCPA 3BE5A 4UEOA 3OTHA 4C4TA 4RTPA 4PYRA 4EHIA 1E92A 1E6MA 1P5ZB 1WCIA 1L5HB 4R8RA 3V34A 3ULKA 2YXEA 5E3JA 1DOHA 1RAAA 3BK7A 3I2JA 1NFFA 2QF7A 1QIDA 2QRVA 3LYAA 1P60A 1M73E 2GAIA 1FTYA 2ZLBA 5JT1A 1LY1A 1RI4A 1XEAA 2PA0A 4N0EA 5KKAA 4DZRA 3GOQA 5JJLA 2X4GA 3TGPA 1O6GA 4C22A 4DDUA 1OX4B 4M49A 1F20A 2A2ZA 1PTJA 1M1YA 4I6EA 3N2YA 4NR0A 1UL1X 2RFLA 2FKAA 4WFKA 4ICIA 3DE5X 1IHUA 2WVGA 1JQBA 4LMAA 4NV1A 4CM5A 1DRJA 1JLLB 1G6OA 2M6RA 3K32A 4Q9KA 3DC2A 1OR8A 2IZ1A 2MSNA 3GLFB 1VDMA 3HJUA 3P2EA 2Q3CA 2C0QA 3OIUA 1MJGA 1CWUA 4MQMA 4IX1A 5A4MS 1Q11A 4P7GA 4RSRA 3VR4H 1AA9A 3DL4A 3NORA 4FYIA 2D0PB 3FI0A 1L3CA 2FN8A 2A5LA 2WEKA 5JSYA 5HM6A 1HYHA 1SK8A 2WJIA 4E31A 3DHEA 4BS9A 2XDWA 3QXCA 4ZWNA 5I4BA 2JI9A 4MRVA 5EE3A 3FNGA 3LC0A 5HRUA 2C5HA 5A7FA 4S1TA 3FNIA 2R5WA 3P9ZA 2FVXA 1I51A 2IYOA 2XKKA 1I80A 3KQYA 4L22A 1TZMA 4DFDA 4D3DA 3HACA 3WLKX 3ZXUB 5KNLA 3WIUA 4AN0A 1AZSC 3LQQA 2GCOA 1A27A 3GYGA 4RGBA 3SEZA 1JXQA 1D8TA 2C5BA 3JQ7B 1NVTA 4QPJC 5AM3A 1BVHA 2WA1A 1C80A 1VJ5A 1D2EA 3Q5DA 4XJXA 1MC4A 3STTA 1SA0A 2OY0A 2HC9A 3BL6A 2A92A 4DPLA 2X9GA 1HORA 1NIJA 4URWR 2Z08A 1N8KA 1NFQA 3ZD9A 4YPOA 4UDNA 3PGJA 1OKKD 2FZWA 1RWXA 3EN0A 3RFFA 4K28A 4BZQA 1P5FA 3ADPA 5C35A 1G55A 5AVQA 4M21A 3KZKA 1WZ2A 2WHXA 3P7MA 2O59A 3E84A 2RHCA 3A05A 4X71A 4G4IA 2BMAA 4OOFA 5DHPA 2PX4A 1TPZA 1Y9ZA 4MRPA 3M2TA 4J7CA 1W4ZA 4JITA 4EYGA 4DM3A 3T5BA 3O8DA 1ZIOA 4K40A 3SS7X 1NDHA 2G71A 1N5DA 1DEOA 3R3HA 1O3YA 1PEAA 1SD2A 4KO3S 4COOA 4I55B 4TUYB 4G63A 1GGHA 2GVDC 5K3EA 2O7RA 1YDMA 4HMOA 2Q6VA 3CR3C 5D7NA 2FZVA 1BA2A 1UQUA 4XOUA 4EB6B 3FPAA 6NULA 2PMEA 2D1QA 2HOQA 2WWXA 3UXHA 1IONA 4HYYA 1P91A 2YWDA 3KXKA 3A4NA 2G8LA 4MUHA 2IT1A 2NZYA 3R3JA 4LYFA 4LXUA 1DKMA 4UTVA 2FP4B 2IHBA 1QORA 2X5KO 3HP1A 3LD9A 1RHMA 4LZLA 4PNHA 4X7RA 4YJFA 4ZEXA 4PYJA 2C2GA 3QTTA 4G24A 3VDNB 2GYUA 1B6RA 4LK2A 1YZQA 2P9ZA 2CMFA 4MUJA 3PUXA 4CKZA 5CR9A 1IRIA 1C0PA 3V7WA 2ICAA 1DWPA 4TYPA 4L4SA 1O94D 1TJPB 3STWA 3GCZA 4F3CA 5K8TA 3AVXA 3TZKA 3PI7A 3TFQA 4IVQA 3VH4A 4ZT6A 4BEJA 4PANA 3M6FA 5EJ2A 1TM4E 2WKRA 1VCMA 1YNSA 1I1NA 4Z99A 5CBKA 2FRDC 1RU3A 4LI0A 4UCFA 4YV2A 1NF3A 2WF7A 2ZIFA 1ISRA 1OH6A 3JYQA 2WOOA 1UQTA 2PS9A 5AW4A 1UP7A 3PR2B 4QYWA 4NZMA 3IA7A 1ZWKA 3U3MA 1DOZA 3TUZC 1V1RA 2QM3A 4ZRNA 3ZGVA 4O2AF 4EIWA 2G8NA 2DCUA 3FDFA 4YASA 1YF3A 2DZDA 1KQOA 2BP7B 4GSYA 4J0FA 4B3HA 3IQGX 4C5AA 1BYIA 3DE6X 1AO3A 1PTJC 3GAFA 1Z0KA 3WL6A 4EF6A 1IVNA 3GRFA 3WP0A 4FX2A 1JKXA 4TN5A 3IKJA 5JY6A 5LD2C 5IDXA 1U3WA 2AI1A 4X92A 1Y37A 2G0NA 2R7MA 4IIJA 2WM3A 1GFSA 4BB9A 4RGVA 4JI2B 2WVHA 1LPMA 1I0IA 2QMHA 3AEYA 1OWMA 1V1MA 5ERGB 1IEWA 2B4AA 5LUAA 1XPJA 2NZVG 3ZOKA 3WK8A 1FJXA 2P65A 5B3KA 1OTXA 5J2TB 1U3GA 2GBPA 4MUNA 2Z4RA 4L75A 2HQSA 4N01A 3BD9A 2P2YA 1I3MA 5E6RA 4QUBA 4GT1A 4YRCA 5C4GB 1YCDA 3U31A 1E2NA 4IUDS 1FUYB 1ZD4A 4LF7B 2QUJA 4LNHA 1G4AE 1B41A 1DBIA 2ZGVA 4RQTA 1NV8A 1RQNA 2VHTA 3BB3A 3CUUA 1IOVA 3QWFA 1BD4A 3K5PA 3GDWA 3EVZA 3B85A 3DLTA 1ZS9A 1PGPA 1VKZA 2HW8A 2C9YA 3FNQA 1U2GA 3MERA 1OIXA 1Y98A 1O03A 1NE2A 5E0OA 3ZKWA 5JQGF 1O7JA 3AONB 1NXXA 4LZZA 2JI7A 2MR6A 1Z5OA 2QVXX 3BWCA 5ADVA 4OMDA 1NSFA 1K7CA 3KZNA 2W4MA 5E4FA 2QMYA 2ZIVB 5CFPA 1GA1A 4UU1A 3VO8A 5A4AA 1DAPA 1ORRA 1JV2B 1PSDA 3DCNA 1ML3A 2YYAA 2VUHB 3ZWXA 1GFWA 3SR4A 3T9FA 4MH0R 3VH3A 1KRXA 3AFMA 3SIPA 1M7BA 1DFIA 3PQ5A 2AVDA 5J47A 5HS4A 3IEIA 4CW7A 3RADC 1UPBA 2WQ7A 2ZI7A 3FHOA 4JX9A 1A5SB 5E6UB 2BGJA 5FTMA 1UBSB 1EWRA 3C7DB 2DBVO 1QJCA 2H1SA 5HGJA 2NYVA 5FV7A 1FP1D 1XD2B 2D4AA 4CKXA 1EQUA 3EZ7A 4G5OA 3CLVA 2FQXA 3WR5A 1EFDN 1Z3CA 4HI0E 2ZSAA 3RC1A 3SE0A 1UIMA 4PZAA 5IAKA 3SHVA 5LBIA 3PFIA 1RDFA 3VXKA 1HDZA 4AX8A 4LX0A 3V4FA 2I2XB 1SEPA 2HMSA 2VF5X 2XKJE 1K88A 4FOPA 5H70A 2VDWA 1V41E 1TF7A 2DETA 3ITNA 3CVUA 4CL3A 2P0EA 1ATZA 1DBQA 1RRPA 4PTLA 4MQ4A 2CLSA 2WTAA 3ZCPA 5BN3A 1OLSB 4XARA 3UUGA 5DGDA 2NACA 1RM3A 2WG1A 1C0LA 4A8JA 1I4OA 3HR4A 3O5AA 2Q5LA 5LQDA 2MWMA 2NO6A 2W22A 3GGOA 4RK6A 1B74A 2ZUWA 4X45A 4X20B 5TXGA 1FP7A 1FF9A 1X13A 3JQAB 2WABA 1QTIA 2PD6A 1FUUA 4B32A 1VHDA 1RWNA 2O5RA 2FSSA 5JXWA 2FGJA 2ADOA 4Q01A 521PA 5M04A 5KVCA 1AO0A 5BV1A 4E2WA 3FB1A 5L7TA 4LYYA 4A16A 1MABB 2C1ZA 2ZJYA 4OLHA 4W7HA 2QUZA 5COAA 3GZNA 1EM8A 4B6FA 4G0MA 4BFSA 4ITVA 3WQBA 2OSBA 4G0ZA 2E4VA 2OZLB 4Q9IA 2IA5A 2QBYA 3GVXA 3K0CA 4KAAA 4TTQA 1AF4A 1KH2A 1XJCA 3BRSA 2X22A 3C6MA 3N87A 3EXIB 1AG9A 2HA4A 3JALB 2O5CA 4BO3A 3KEMA 4JBLA 1ENPA 6CHYA 3IMKA 1WDTA 1SXPA 3LK7A 1U0SY 4XGQA 2DPXA 2DPLA 4Z9FA 2F1IA 1BXKA 4ZRMA 5EVCA 5F2OA 5F51A 1HEYA 4C89A 4CT0A 2CHGA 2I4NA 4R1OA 5L3RA 7AT1A 4GH5A 3N2GA 2RHRA 5L3QB 1MC8A 3BA1A 3IULA 4CU2A 3ESRA 4NJOA 3CNQS 2J6CA 5AK3A 3FYHA 1VBKA 1Y4AE 1XSEA 2WIFA 3NASA 5LZ5A 3ZK9A 2IQIA 4C0HA 3GFOA 3O0TA 3P9XA 3H3JA 4B2PA 4BQIA 5C5IA 4ENUA 5JD4A 5LYJB 4CIXA 1HI9A 1RZVA 2G07A 4Q7LA 5JSQA 1X7DA 3MD0A 4RELA 4N48A 3EIFA 4NLLA 2PKXA 1RQPA 3EXFA 1ZJZA 3X1MA 3FTEA 1X3LA 3AG6A 1SC9A 5JXJA 1LRLA 4F91B 4CMBA 2Z9CA 1YL7A 2IXTA 3W4IA 1MG5A 4UQLA 5EUBA 1YB6A 5ABPA 1M1YE 3VPGA 1ZW6A 3I0NA 4FB4A 4JQCA 2UUOA 4NDAA 3O2QB 2HWUA 4ZVUA 1OFGA 5H0IA 5CVVA 5AM0A 1BN7A 2OLKA 3MLBA 2XCRB 3AO0B 4TQ9A 1YJCA 2P8JA 3O8CA 4JI0B 2OUKA 4PFQA 4MQBA 1NXSA 4H6VA 4PBRA 1E1NA 2P9HA 4BX8A 1X94A 4YB8A 1E3LA 3P1JA 1TQHA 1PQ4A 2A9OA 2CUTA 5C1OA 2OYSA 2IYNA 2V74B 3AB7A 5KDDA 4XX0B 5TGZA 2QZPA 1Z5GA 3L49A 3BQ9A 4K1LA 3UHOA 3O8OA 6PFKA 1GR1A 2ZAIA 4KB5A 4JP1A 2IKQA 3BCRA 2XYRA 4H1VA 1ZEMA 2NTJA 4BNXA 3DL2A 1ZOPA 5CEEA 3QFHA 3N0TA 3R7AA 2N9UA 1AMOA 2C2XA 2ZBVA 3KYCB 4L8WB 5AH0A 4NCAA 5AD1A 3VVLA 2ORED 3JPWA 3LT2A 5JDIA 3L7CA 4FSHA 4WKCA 5ALNA 1SMKA 1FMCA 2VTDA 3JQFA 4LZWA 3PVSA 3AM1A 3EULA 2QRHA 3EPJA 2V8BA 4Z9BA 3WADA 3RFUA 3KR0A 4KQEA 1EAYA 3HADA 2RARA 2EARA 2QTHA 4I8DA 4WLOA 2H4WA 2QGFA 3EE6A 5AI0A 2XCLA 3E4CA 4LXXA 2DLNA 5B3AA 3BL8A 2XUDA 4IIGA 4MGZR 2RAUA 2XSZA 3WL5A 5IH7A 1XD2A 1M2JA 4DV4B 2ATXA 1BCSB 3CX8A 2HHJA 5IAJA 4BP1A 5ALKA 1XTUA 2AR7A 3KX2A 3C5HA 2N1BA 3CISA 3PDIB 4RZQA 1ICEA 3VMMA 2PGIA 2X6QA 1WXEA 2QRGA 4E5DA 3PE4A 1EGVB 2M1ZA 3T0IA 5JYBA 4DUZB 3OO1A 1Z6TA 1NJ2A 4ZZIA 3BK2A 4UBKA 4D9EA 4OP2A 3VOBA 2O0HA 3KTFA 1UCFA 3KQHA 2YWRA 3DD5A 1W2WB 3KJIA 4RVOA 2PNFA 1VIDA 2WMDA 2WPDD 4F5EA 3AF4A 2HCBA 3NXKA 1AV7A 5KQRA 3AK4A 1WZIA 4KXUA 2HMTA 3EF0A 2OKCA 1RHQA 2XNDD 4FGUA 4U3JA 2Q6IA 3KOXA 4PYOA 1XTSA 2OBLA 2P2SA 3PQ8A 4M7WA 4JK3A 5FBZA 2ZJ8A 3AFGA 4C7VA 2AA3A 1MZPA 5JV5A 1C7FA 4PSVA 4PZ0A 1RVDA 1D2NA 1Z0ZA 2CZQA 2QTBA 4Q1BA 1JJIA 4QYIB 2C2YA 4GXQA 1IXRC 5ENVA 4TTSA 3VMFA 1Q7BA 1OLOA 2BGRA 3JW8A 1AA6A 4XSHA 3G2PA 2YV2A 3TLMA 4QQFA 4UDYX 2WTBA 3OEED 2J3LA 3SM9A 4DL9A 3KYJB 2GFQA 3RIXA 5AHXA 2FP4A 5J2UB 4ESVA 5BW8A 1USKA 3BDAA 3Q6MA 3CS3A 3HUFA 2G04A 3RU7A 1XGKA 3I1JA 2C00A 1JFSA 2AN1A 2PKEA 2JFHA 3DOUA 3MWFA 3FKJA 4Y2GA 4XI9A 5K0CA 1D5WA 4LVUA 5MDHA 2LR0A 4CJXA 1S3IA 1T6YA 2NSDA 2PMFA 2PXHA 3RASA 1XZQA 2E9SA 5COQA 5HA5A 2RDMA 5EFZA 3ZNNA 7MDHA 3OQ1A 3SQXA 2EFHB 1WXFA 4QOHA 2BVNA 5AKHA 1T3TA 1B15A 2VDRB 2W6PA 3CCFA 1IPEA 1EVJA 3HVHA 1NVEA 2GEDA 4IO0A 1U8ZA 1WLYA 2JLCA 3LY9A 4UEWA 1VKNA 5CLQA 1ZD5A 2CLMB 4CR7A 3NU1A 1P45A 4GM1A 4C20A 2CL7X 4MMZB 2ZJ1A 1GQYA 3N2KB 4I4NA 2W42A 1PYOA 1IK6A 3TE6A 4FUTA <