4YK7A

Crystal structure of s-hydroxynitrile lyase from manihot esculenta (his103leu)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
MVTAHFVLIHTICHGAWIWHKLKPALERAGHKVTALDMAASGIDPRQIEQINSFDEYSEPLLTFLEKLPQGEKVIIVGESCAGLNIAIAADRYVDKIAAGVFLNSLLPDTVHSPSYTVEKLLESFPDWRDTEYFTFTNITGETITTMKLGFVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKIFLPDFQRWQIANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVADAYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords (S)-hydroxynitrile lyase
publication title Crystal structure of S-hydroxynitrile lyase from Manihot esculenta (His103Leu)
rcsb
source organism Manihot esculenta
total genus 95
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yk7A00
4G8CA 3EQ7A 3L1HA 2C0PA 1HKHA 3I6YA 2VTVA 4MEBA 1CUEA 1LPPA 1U8EA 3WKBA 1Y37A 4A23A 4U2DA 4OB6A 4UBIA 5BWCA 5EHQA 4FDMA 3ESCA 4D9JA 1HL7A 3O4IA 1LPOA 1CR6A 3DYIA 2PSFA 4UBLA 3I2JA 2QUAA 2HHAA 4H18A 4LYDA 3WK7A 3HLKA 1CUWA 2YASA 4CCWA 4FBMA 5T4FA 1QIDA 1EK1A 3BF8A 1LPNA 1FFAA 1CQZA 3Q0TA 4Q3LA 3DQZA 5E4TA 4MWTA 4FLMA 1UKBA 3CXUA 5JZ9A 3KSRA 2Z8ZA 1AMNA 2ZYHA 3AFIA 4JYMA 1CUJA 4MWSA 4UFPA 1ZIYA 4DGQA 4Y9SA 1ODCA 1QIIA 2QUBA 2C5GA 2R11A 5AOBA 4DMFA 1CUSA 4C01A 4HTAA 4B0OA 3QZUA 1VXOA 1UKCA 2ES4A 1MAAA 3RARA 1LPAB 4G5XA 4L72A 5EIAA 5HF5A 2QS9A 4ARBA 5ALJA 2OAGA 3AZQA 3IUNA 5EIEA 1O6FA 4GWLA 1BU8A 2XQIA 5K3EA 2ECFA 2OQVA 1TKRA 4JUIA 1R1DA 3FSGD 1X2BA 4PSUA 4Y2RA 2HA4A 5DLPA 5FV4A 2ZSIA 3ZLUA 1R3DA 3STVA 3R40A 3H1BA 2XMGA 5AIBA 2HA2A 4H7HA 1GQSA 1I6WA 1HPLA 1EXWA 4F5ZA 3BDIA 4F60A 1EA5A 5FDFA 2QOEA 2IITA 5CH3A 5LZ7A 3KD2A 3Q8WA 4AX4A 1TRHA 2DFPA 5JAOA 4GXNA 4IO0A 5AK3A 5AKEA 3D0KA 4Q82A 2QXTA 2J4FA 2XB6A 1GPKA 3V1LA 5A7HA 4PW0A 5D3ZA 4G8BA 4EB0A 4FLEA 3U0VA 2G63A 4QWMA 2HADA 4HAIA 2WG2A 3G0DA 2JGLA 2OQIA 1HQDA 1JI3A 3O9MA 1EDEA 3NWOA 4KE8A 2WLSA 4YASA 4B82A 4RE5A 1EINA 1YS2X 1J2EA 4C6HA 4XJVA 1QO7A 5DNWA 3I6MA 1UWCA 2HFKA 2CBGA 3LIPA 4UHDA 3EQ8A 3EQ9A 3MUOA 1XQWA 1L7RA 2PSJA 1ODTC 4DYHA 2WHQA 1EVEA 1P0MA 3WZMA 2WHPA 2C58A 4EY8A 4BAZA 2CJPA 4J0KA 5A71A 4NS4A 2CZQA 1EDBA 3ICWA 2RI6A 2V9ZA 5YASA 3IULA 4EBBA 2XUPA 3AIMA 4KAFA 2RONA 1K63A 3DL7A 5K3BA 1LBTA 3DKRA 4BZWA 5HZGA 3D7RA 1CUGA 4GLBA 4LXHA 1LZKA 1ZI9A 3M82A 4CG2A 1THTA 2WSLA 4KRYA 5FKJA 3G9UA 5CT9A 4MYSA 3BXPA 2WIDA 3I2HA 4LHEA 1EDDA 4X7BA 4OUKX 1CUYA 1IUNA 3CCBA 1DT3A 4RGYA 2W6CX 1P0PA 4EY4A 4KAAA 2XUOA 1C7JA 1VLQA 4WFKA 5JYCA 4WFJA 4M0EA 2WFZA 5LP1A 1XZGA 1CV2A 3ZV7A 1AUOA 4C4ZA 3DDUA 5HF8A 2PBLA 4ZGBA 4W9RA 5DTJA 2RAUA 4YX9A 4KE9A 3FAKA 5ALEA 2O2GA 1TCCA 1BS9A 1XZEA 5AKJA 1UT6A 1MT3A 1DU4A 2BGNA 5J3JA 3TJMA 1EI9A 1SCIA 2HRQA 5F4ZA 2HDWA 5A7FA 5C8XA 4P93A 4X93A 2Z8XA 1AZWA 4X71A 3O4GA 1IUPA 5ALHA 2XUJA 4ZREA 4Y2JA 2D0DA 7YASA 3M81A 3OPMA 1XZBA 2WJ3A 3WLAA 1UK7A 1Q84A 4B0PA 1CUAA 3F96A 4CG3A 5KWJA 4KR0A 2HA6A 3HC7A 4AN1A 1WHTA 4BE9A 5AKXA 2WUEA 2PKYX 2YYSA 4Y2SA 1VOTA 3DOHA 3VVLA 4B84A 1IMJA 3DNMA 3QYJA 3ZLTA 3L1JA 5ALYA 1XRPA 4HVTA 2VAVA 3E0XA 4UHCA 4INZA 2XMRA 5HKBA 4QDXA 2WU4A 4AMZA 2V98A 3QITA 3AJAA 4QLOA 1JJIA 4H35A 5KREA 4KJXA 3V48A 4IHAA 2HFJA 3KXPA 3AZOA 4EY5A 2Q0XA 1DT5A 3C6ZA 2WIGA 1W76A 4Q05A 4KEAA 1JJFA 3NGMA 3IURA 1JFRA 4J0HA 1K6EA 4RNCA 4C88A 5HF9A 5H3HA 5C8VA 2XLBA 3O4HA 1XZDA 2ONCA 4AXBA 1R88A 1QTIA 3WKAA 2GYVA 2J3QA 4LYEA 5ALTA 5CW2A 1DWQA 2EEPA 2OGTA 1VA4A 4MQLA 2C4HA 2D5LA 4QDOA 2XI4A 4EA6A 4OU5A 4N8EA 5DYYA 5KWIA 1K5PA 4MXDA 4I4CA 1JT2A 5ALKA 1EHYA 2WFLA 4J7AA 1XZAA 3V1NA 4AZ0A 4EHBA 5K3AA 3AIOA 2DQZA 3N2ZB 4ZRDA 4M0FA 5ESRA 3PE6A 4L3WA 3IA2A 4CI9A 2ZSHA 4KACA 4W1SA 4BAGA 1YAHA 4DNOA 3STYA 5JALA 3STUA 3C43A 3G7NA 3IVMA 2PUJA 5CURA 3MGAA 4RPCA 5K5EA 2WILA 2ZJFA 1ZD4A 5BOVA 5LLSA 1W1IA 1XRNA 4W1QA 4MQMA 4C87A 4BCBA 5CXXA 4BP8A 1QFMA 3HZOA 4EY7A 1EH5A 3HYSA 5T4EA 1CEXA 3WWOA 4HS9A 1KU0A 3B12A 4J03A 4OCZA 2LIPA 3BIWA 4IH9A 4K2AA 2OCLA 2DSNA 1ZGCA 1XKLA 1FJ2A 4H7JA 1GXSA 1ZD3A 2XLCA 2XMZA 3K2IA 3PF9A 1N5MA 3C8HA 4K6KA 2HA7A 1K4YA 3QMMA 4X3CA 3G0BA 1ZI6A 4GEGA 4HRXA 5AJHA 1DQZA 5CT4A 1WHSA 1QIFA 4G8DA 5CT8A 5AKIA 2WHPB 3QPAA 2O7VA 1JU3A 5C81A 1Q0RA 4MEAA 1HBJA 3I1IA 5JD6A 2XUKA 5EIHA 3N0TA 4U2CA 2DHCA 5HQ3A 3TGLA 3SK0A 5AHXA 1ORWA 3W2TA 5K3FB 3P2MA 5JATA 4GBGA 2CB9A 1QIEA 5I8PA 3NOXA 5K3DA 1JMKC 3BJRA 3G9TA 1AC5A 4PQEA 5JADA 5EGNA 2B20A 3FVRA 4U2EA 4GW3A 4MJ3A 5ALIA 3R0VA 1QE3A 3HJUA 3ZPXA 1Y7IA 1ZD5A 1HLGA 3IDAA 4L9AA 5LZ5A 4TGLA 1ZGBA 2HM7A 2C0QA 3FYUC 2QVBA 5A2GA 3ESBA 3EIOA 2GBCA 3R3ZA 3C6XA 4Y2UA 3FSGA 3C8DA 3GBSA 5FP0A 1N5RA 1G42A 5FPPA 1AGYA 3G02A 2V97A 1DQYA 1YA4A 3H19A 4HRYA 3D3NA 2QKYA 2GYUA 3FYUB 4DSZA 5C8ZA 3I6ZA 4WDRA 5ISMA 4QDUA 4E11A 5I7UA 1Q83A 5JASA 2IIVA 2HU8A 2X76A 1F0NA 1B41A 5AKYA 3RKSA 3PI6A 1FFEA 1K8QA 3RLIA 5LZ4A 1E8MA 2G5TA 4HZGA 5AIAA 4DIUA 4DMHA 5JIBA 4CFSA 3M83A 5AKLA 2PL5A 3X3HA 2XMDA 1J1IA 1ODSA 3H2KA 4WFIA 1XROA 2WM2A 3WIBA 4YPVA 4CCYA 4HXFB 3KWJA 2OAEA 3C6YA 3RK4A 3HRHA 2VEOA 3B5EA 1THGA 1M33A 4WY8A 5HFNA 1P0IA 2PPLA 2BJHA 2OXEA 1WB5A 1HDEA 1FFDA 2E3JA 3KWFA 1QGED 1JKMA 2J4CA 1KEZA 3KDAA 4N8SA 1VXRA 3GFFA 3OURA 4H7IA 3U1TA 2ACKA 3ANTA 5CH5A 1XLUA 5ALQA 5JD4A 2XUQA 3FOBA 5AKGA 1UFOA 3VXKA 4P9NA 3WA7A 3W05A 5FOQA 4UFNA 5AO9A 1RYYA 3JW8A 1E66A 4J0JA 5SYNA 1VE7A 1WPRA 2XMCA 3V9AA 3WYDA 1YAJA 4FWBA 1ZJ4A 1XZFA 2BGRA 2BAGA 1W75A 4UBNA 4EZIA 4DM7A 3FCYA 1CRLA 4Y2VA 3H2GA 4W1RA 2XQJA 4BBZA 2HRRA 3H2IA 5CXUA 4QZVA 4BB0A 1TK3A 2WJ6A 2UZ0A 1NU8A 1XRQA 3R3VA 2XMSA 5DNUA 1WM1A 3F98A 5AK6A 4UUQA 1BCRA 5ALGA 2XE4A 3E3AA 1B6GA 4Q1VA 5LYYA 2B9VA 3V1KA 3TEJA 3I2GA 1JU4A 2WG0A 1F8UA 4ETWA 2JGIA 1AX9A 2QJWA 2VATA 1N1MA 4AO6A 4B9AA 1QOZA 4J0CA 4WJLA 1TQHA 4AZ3A 3V1MA 4QDZA 1X2EA 3AINA 2B4KA 4C4YA 3T52A 4K5QA 1CUIA 3S2ZA 3QMVA 2WUDA 4KYVA 1UK9A 4U2FA 4DLNA 5LZ9A 5LZ2A 4GECA 5ALWA 4Q3OA 4X85A 2G4LA 5JZSA 1VZ2A 2OPHA 4J0IA 2XUIA 2J3DA 5EFZA 3WK5A 4E46A 5ALNA 3I2KA 1XZLA 5CH8A 5JAPA 4QDTA 1TCBA 5E2IA 1R4ZA 1OXMA 4ZWNA 2H7XA 5E4YA 1UXOA 4LIPD 4BVKA 3C45A 2H1IA 2HA3A 1CQWA 2XQGA 1H23A 3R3WA 3DLTA 3R41A 2JGJA 2AJCA 2ZYSA 4KRXA 1MX9A 1W4LA 5FRDA 3FWHA 3WIOA 3HABA 1QIKA 2VF2A 6YASA 1LPMA 1E8NA 4X6UA 1XZJA 2NW6A 2I3DA 4I19A 4QWWA 2AXEA 3W06A 3WKCA 2QT9A 5CBKA 2FJ0A 2GYWA 4FLFA 3D2AA 1QZ3A 2Y1KA 4U2GA 4B85A 1G4HA 4YK7A 3ED1A 5JANA 3AILA 3VJKA 2ZVDA 4BE4A 2I03A 1W52X 5AI0A 4K6GA 5HQ3B 1QO9A 4EUSA 1LNSA 4JH0A 4UHFA 4DNQA 2VT7A 1ETHA 1A8UA 4UBKA 4P08A 3F9CA 4CIBA 1U65A 2PSHA 3IIIA 3IUQA 3O0DA 5DTIA 1LZLA 1Z68A 1UOPA 3HACA 1L7QA 4XIIA 1A7UA 1DWPA 4OU4A 4GI1A 1ISPA 1TCAA 3FCXA 1YS1X 1PJAA 2QZPA 2OGZA 2JEYA 3I2IA 1EB9A 1TIBA 2VJAA 1CUBA 5AK4A 1MX5A 5ALZA 3KOOA 5ALVA 2WTMA 1BN6A 2XMBA 5D3KA 5AM4A 2WFMA 1BRTA 4NVRA 2PU5A 1H22A 5BV7A 2VAXA 1ORVA 1DTEA 3MVEA 3E4DA 4OB7A 1IVYA 4WDQA 1R50A 2Y2UA 3O95A 5T4HA 1XLWA 4CG1A 3R3XA 3STXA 1LLFA 4GDMA 2BUCA 1L7AA 4Y7DA 2BCEA 2HA0A 4OYYA 2EDCA 3DL4A 3PUHA 5AI5A 4WCVA 5A6VA 4V2IA 2Y6UA 1SCQA 2H7CA 3A2MA 1A8SA 1CUZA 2Y6VA 3WMRA 3IUMA 1N8SA 4AB1A 1BCSA 3DKKA 1BE0A 3PFCA 1CPYA 1A88A 4B83A 1QIJA 1UKAA 4K6HA 1IZ8A 3QPCA 3FNBA 5AM5A 3FLBA 3G9XA 4PNZA 1JMYA 2H7YA 3H18A 4W1PA 1FSSA 4DNPA 4G4GA 1FFBA 1UOOA 3L1IA 4BAUA 4N8DA 5AI6A 1SCKA 1YR2A 5CRIA 4ZV7A 1CUXA 4UHBA 4H7FA 4FNMA 1YASA 2I3ZA 3WL6A 1FFCA 1MNAA 4X6YA 2WU3A 2PSDA 1UK8A 1E5TA 2OCIA 4S0XA 1GPNA 2ORYA 5AI4A 4UBMA 1EVQA 5SYMA 3WWPA 3I2FA 2Z3WA 3JWEA 4UHEA 1ZICA 3H2JA 1R9MA 5JAUA 1C7IA 4B9EA 1USWA 2QMQA 4B81A 2DCMA 4AO7A 1MNQA 5CT5A 2ZJ6A 3WK6A 2H9YA 4BVLA 4LKOA 5LKAA 1F6WA 1WPXA 1F0PA 3VKFA 2CUTA 1EB8A 1UOQA 1NU6A 2WKWA 5ALDA 1AKNA 5BWBA 1MU0A 4UFOA 3QVMA 2AJ8A 2HA5A 3A70A 1WB6A 2WQZA 3D2CA 4BYMA 2HIHA 1GKLA 3ICVA 4Y2PA 3G0IA 1DX6A 1XQYA 2PVSA 1E8DA 1QIMA 3A6ZA 3K9BA 4X00A 2XT0A 2WUGA 1RWQA 1U2EA 5AKZA 3OM8A 3UMJA 2GBIA 2OCGA 4M0MA 4Y2QA 3F8SA 3QMWA 3PDCA 5ALMA 3O4JA 3QBJA 1PFQA 3CCCA 4XVCA 2YH2A 5CTAA 2W22A 4X92A 4F21A 2GBFA 3G8YA 1SC9A 1XRMA 4X95A 3H0CA 4I3FA 4AQDA 5IVDA 4AN0A 3PF8A 3AIKA 4NZZA 1XQVA 3G9ZA 3LP5A 2FUKA 1J07A 2WIFA 2JBWA 3C87A 4G4JA 2PUHA 1EX9A 2WTNA 3RM3A 1SFRA 3IB3A 1BEZA 3VJMA 2JEZA 2V96A 2JF0A 5AP9A 1CUUA 1YCDA 4J0GA 4UBOA 3UUFA 4KAJA 3S8YA 4FBLA 1AQLA 4G4IA 2XQKA 3STWA 3SC2A 4Y2TA 5EHZA 3LIIA 3FYTA 3WK8A 4MYDA 4XX1A 1CUCA 1XRRA 4FHZA 4BRSA 2O2HA 1LBSA 4KE7A 5I9IA 1G5FA 1XZKA 4N5HX 4X97A 4ITVA 5AOCA 1XZMA 4RE6A 1CIJA 4BZZA 4DSAA 1GPLA 2GZRA 4Q3KA 3MUNA 1XZHA 4Z49A 1XZCA 5E4JA 1H2WA 2HU7A 1DX4A 2VQ6A 4AMYA 4DNFA 3EF3A 1U4NA 3DCNA 3F67A 2VA9A 3OOSA 4OSEA 2WIKA 3ZI7A 4QEKA 4A5SA 1XFDA 5AI8A 3GA7A 3WZLA 4BDSA 1CLEA 5DYWA 3HXKA 4H77A 2XDWA 2QXUA 2PU7A 3WL5A 3DEAA 3WQHA 4FOLA 1CUDA 4KE6A 4G9GA 4QE3A 4OD0A 4X90A 1ZI8A 1ZD2P 3T4UA 3A2LA 5AI9A 5ALXA 3DD5A 3ESDA 2XUHA 2FX5A 4E15A 2ZJ7A 5ALOA 1CFJA 4OYLA 3H17A 4BDTA 2VJCA 1IUOA 5LKRA 1T2NA 2GZSA 2XUAA 1IZ7A 3F97A 4GHWA 4C89A 3M3DA 3SWWA 4DTCA 1ZOIA 1A8QA 1YSCA 1OILA 2WJ4A 4EY6A 1SOMA 1MPXA 2O7RA 5HK9A 3GELA 3PFBA 1QLWA 3IBTA 3JYHA 3WWEA 2HL6A 1D07A 5AM1A 3QH4A 1LGYA 5A7GA 1QONA 1J06A 5AICA 5KBYA 4PF1A 1XQXA 1YB7A 1VA5A 5ALPA 1MTZA 3WK4A 1GKKA 4U2BA 4BATA 1DINA 5ALFA 3VDXA 3GZJA 2X5XA 2VSQA 5C7YA 3SX4A 2DR0A 2WFLB 5CMLA 4C4XA 3WKDA 4WY5A 5JD5A 4XWGA 2WHRA 5AOAA 4W63A 5K3FA 4ZI5A 5IVKA 2Y2VA 1R9NA 4N5IX 4IQ4A 4BC1A 5EHNA 2OGSA 5FPQA 1XLVA 5DJ5A 1GZ7A 2AJBA 3E1GA 1GT6A 5FUMA 3LCRA 4P92A 2ACEA 3FBWA 5FLKA 3ANSA 3K6KA 3WL8A 3DYVA 5EHXA 2QJRA 3DS8A 3CN7A 1QIGA 3I28A 4BVJA 1QJ4A 5K3CA 4PSCA 4IH4A 1MJ5A 2P8SA 2OG1A 4PSDA 2OCKA 1UZAA 4TPKA 4CIAA 3WA6A 1MO2A 3TRDA 1VKHA 1O6GA 4ARAA 4BTLA 4G9EA 3G0CA 3STTA 2QRUA 3IUJA 2ZYRA 3FYUA 3H1AA 4BCDA 4E14A 4H7DA 5ALSA 4QLAA 4G1FA 5DYTA 2VJBA 4OB8A 3DOIA 5DNVA 1E3QA 1P0QA 3LLCA 4O08A 5HCUA 2G5PA 3BE8A 2EDAA 3OTQA 4J0DA 3GROA 3I1YA 5FXMA 5JAHA 3WI7A 2DHDA 5JZBA 3HEAA 1ZIXA 3W9UA 2AJLI 2XUDA 2CMFA 4DMKA 2GBGA 2BUBA 4LXGA 2ROQA 3C5WP 5ALLA 3D5EA 3H04A 4DMCA 4UBJA 5AKKA 3D4LA 4JNCA 3WJ2A 5CT6A 3ZLVA 1S8OA 3WWCA 1LPBB 3R3YA 3GUUA 1H2YA 2Z5GA 4FTWA 5ALRA 1WCYA 2CKMA 1MX1A 4ZXFA 1C4XA 4FFWA 1MN6A 2O2IA 5EI5A 2XQFA 1QTRA 2VJDA 3R3UA 4FFVA 4JEIA 4H7EA 5LZ8A 1H2XA 3LS2A 1EK2A 1RP1A 3O9VA 2K2QB 1GGVA 4LXIA 5LIPA 3DJYA 3H2HA 4HXEB 2I78A 3YASA 2JGMA 2XMQA 5AH0A 2X8BA 3HI4A 1GQRA 3EBLA 3OC0A 2QM0A 3D2BA 3B3QA 5AM3A 2OLEA 2CEKA 2JIDA 2IX9A 2Z3ZA 5IH7A 1CUVA 1CUHA 3BWXA 3HSSA 1ACLA 1YA8A 2DHEA 3QM1A 1MAHA 1LPSA 2B61A 2WG1A 1Y7HA 5AKHA 2C7BA 4BP9A 4NMWA 1KU6A 3C70A 2QTBA 2RHWA 3FLEA 1PV1A 1VZ3A 4FKBA 1VE6A 4B80A 1UK6A 3UUEA 3BDVA 5HFAA 1VJ5A 3ZWQA 3WWDA 4UPDA 1DWOA 5IVHA 2WUFA 3FLAA 3C6BA 4TVKA 2RGUA 2JGEA 2FJPA 4CCYB 3WYNA 5D6OA 2YXPX 2ZYIA 4B6GA 3FVTA 1CUFA 4Q34A 2PSEA 3NUZA 4X6XA 1BROA 1WB4A 1XRLA 2RHTA 2BFNA 3AUKA 3WK9A 4B7ZA 2PM8A 3OG9A 4BTVA 1H2ZA 1AURA 3C5VA 3PUIA 1ACJA 2RIPA 5AM2A 5IKXA 1BEEA 1NX9A 4FNGA 1G66A 5T4BA 3CN9A 4UHHA 2C5FA 3BJMA 4Y2XA 1WOMA 1T4MA 3VVMA 4FMPA 4BC0A 1QIHA 3W9BA 3D59A 4A16A 3QPDA 4PO3X 5A62A 1OCEA 1XKTA 3W04A 4X94A 1QFSA 3VISA 1E89A 2XUFA 3A2NA 5HK8A 1YB6A 4H7KA 3BIXA 4X91A 4ZV9A 3PICA 4H0CA 4PV7A 2JGFA 5HF6A 5AK5A 1JJBA 3WJ1A 4HXGA 1X70A 1BN7A 3WKEA 1ZJ5A 2PX6A 2DQYA 3ILSA 3BL8A 3ESAA 4AO8A 2XUGA 4J3JA 4Y2YA 4BCCA 5JARA 1W6RA 4OPMA 1CVLA 4IH1A 2QR5A 5AM0A 3BF7A 2VT6A 2BUAA 2JGKA 4BRZA 3AZPA 1TAHA 5D7BA 2R8BA 3WL7A 3VJLA 4JYPA 4ROTA 5DWDA 4QNNA 4QA9A 4F0JA 5ALUA 2AJDA 1Q0ZA 3G0GA 5IVIA 2HU5A 5HKAA 2BKLA 1XZIA 4L0CA 2WIJA
chains in the Genus database with same CATH superfamily
1U81A 4EGCB 5KCZA 3BOSA 5IWAB 4NYMQ 2Y05A 3PQ3A 3ROXA 1FYEA 3QJYA 1MFZA 1B76A 4O4LB 1C8BA 3PXGA 3V6MA 3U49A 1W8IA 3K1TA 4IFIA 2VPPA 3SZRA 3P1JA 4G5RA 1HKHA 3I6YA 4CETA 3SYNA 4R54A 2OILA 3NPAA 3KR0A 2VYND 2RMKA 4CQMD 4UNRA 2OK8A 2IRWA 3HKDA 2HQRA 3WKBA 4BB6A 1DKPA 1M7GA 1Y37A 2NTVA 4Q4LA 4W8GA 4YUVA 1WA5A 4A23A 1PF7E 1L0BA 4C2AA 2F3TA 5IANA 4QG3A 2PT9A 5EHQA 4FDMA 3NDJA 3U7QB 3IDZA 2D5AA 1TK2A 2XF8A 5U1PA 1F2DA 1CWUA 3T94A 3VGJA 1CB7A 3WNCA 4DBLC 1KI6B 1K5HA 1XG5A 5FBWB 5FUWA 5AUOB 3BKWA 3CY6A 3FFXA 3IAS6 2I6XA 3BB1A 1N6PA 4OP2A 1YCGA 2CXXA 2CXPA 2Z6VA 4C4TA 4D9JA 1LI7A 4LFAB 2YWEA 5TQ2A 1GPWB 3O4IA 4ZXPA 1IY0A 1LPOA 3NXKA 3Q0IA 3QIAA 5EE3A 2VNSA 3VFDA 1UODA 2AG1A 1JAYA 3R5KA 4FKMA 4A8HA 1FYWA 3IAHA 1HT2E 3HR4A 9ABPA 2C4MA 3F90A 3JQCA 2D7CA 2UZAA 2ZW9A 4V38A 4XRRA 2XZLA 1YKGA 2R751 5DTRA 2HHAA 2OBFA 4JMLA 4LYDA 3IMEA 3NCTA 3S1AA 3TTYA 4EKIA 4KBYA 3HCPA 3OLCX 4W7HA 1JI0A 1ZKMA 1JXQA 3IMCA 3UB4A 3CUKA 3OT1A 5T4FA 1IFXA 1R0SA 4OQXA 1QIDA 3GMTA 3JVUA 1EK1A 3LDGA 4BVHA 4Z2AA 2JLYA 5MFPA 3BF8A 4LNUB 4NZMA 1LPNA 1QRUA 1NVTA 1ONOA 2OMEA 1M8GA 5DVZA 1RAHA 3HPQA 4B4WA 3IT0A 4BUJA 1SCAA 4IDQA 1XNJA 1FZQA 1SCUB 3AB3A 1UKBA 2J5BA 2O4CA 3RR2A 1UBOS 2CJFA 2EQ5A 3ABRB 2FZLA 3JAWB 3HN6A 3P97A 3C6QA 4J75A 1MORA 1T0HB 4HH4A 3EGXB 3I6IA 3EBOA 3O21A 4CYMA 4DM3A 3IAEA 3EVGA 3ETHA 5K6RA 2FEKA 3AFIA 3KOWA 3L6RA 4Y2GA 2HZ7A 1TIKA 1CUJA 1OKKA 4ND6A 4YAWA 2IYAA 3GDOA 3UWMA 1QKIA 1JFFA 5EIBD 4D43A 4UFPA 1TGVA 5GJBA 2G76A 3AX6A 3HBFA 3MSXA 1JKXA 4PX3A 4Y9SA 5FPSA 3TNDA 1AXGA 4IXWA 2QUBA 2HWUA 3KVRA 4RKQA 1RZRA 3PNLA 3GUVA 2C5GA 3KSZO 2R11A 5E9WA 2H1OA 5K45A 1CUSA 3RSOA 2JFWA 4B0OA 4Q7QA 4AUNA 4G1UC 4C30A 3R7DA 3G49A 3H87A 1W1WA 4LOIA 1HYHA 5EJ2A 2ES4A 3RARA 1LPAB 4MMXB 3I4CA 1JS1X 4GPIB 1H9CA 3U7IA 1ZC4A 4OIMA 4Z4IA 4ARBA 3CT6A 2E4ZA 2LCFA 3K0CC 1NNLA 2WOJA 3AEKA 1RRCA 4G81A 1AQUA 1ZGHA 3MUEA 4PR0A 4KO2S 2R9VA 1PK9A 2UYHA 3ZG6A 2PAAA 4YRRA 4CKWA 5EIEA 1H1LB 3L07A 2E4XA 1O6FA 3R0QA 4GWLA 4NV0A 2RE8A 3E1KA 3LO8A 5F35A 5B5SA 2BFDB 3DAYA 5IYZF 1Z0SA 1ZH2A 3FCEA 3SR4A 4B3BA 1LSJA 3OAAA 3PNOA 2H5IA 5LMUB 1ZKDA 5DLPA 2NO1A 2HA4A 5C5EA 5BQ5A 5IKOA 2C31A 4NYJR 1YB5A 4N0EA 2BR5A 1DKNA 4RSRA 3D8RA 5ECYA 2BE9A 3Q3JB 3A0RB 3LNTA 2V65A 5AIBA 3N2NA 2I8AA 5CM2Z 4D44A 4JBHA 3SF0A 2HRDA 3QNMA 1HPLA 1M6YA 4EJSA 4QOFA 1S2LA 1P5JA 4F60A 3ZZ1A 4TQUS 4I3HA 5FDFA 1YE3A 2GFQA 5LZ7A 1N7HA 2IZ6A 3H0KA 2FWJA 2NO7A 1F3LA 1WS6A 3AHCA 5E4FA 1VDZA 3B2EA 4LSMA 1Y3BE 1KK1A 1PL7A 1PTJC 3K9GA 1CP2A 1U3GA 2QQFA 4AX4A 3ZJVA 1TRHA 2DFPA 4P3OA 2UDPA 2IJGX 8GPBA 2ZBDA 3AUFA 1XD2B 4M1OA 5E6RB 3KJIA 4ZYVA 2J48A 5AK3A 3AF5A 4BLRA 1PFUA 3D0KA 4Q82A 1DAEA 2QXTA 3NAMA 4MJXA 4R9UC 1T5OA 1FXUA 2Q99A 1NUPA 2XB6A 4A2WA 2QJOA 1QF9A 5A7HA 2ZRIA 1Z6ZA 3LVRE 4LOLA 3KJEA 2CW5A 4G8BA 4YJFB 4EB0A 1C7ZA 4QOGA 4J7XA 1KO5A 1QXSA 4CM8B 5D3QA 3GLSA 2D0PB 3NKLA 1O95D 4AKGA 1U63A 3TM5A 3G0DA 1C1XA 1HQDA 1T0UA 2VRNA 4AMBA 1JI3A 2CNWD 2G9ZA 3CG4A 3OFJA 4O4IF 1R0CA 1B93A 2XSZD 5LQAA 4EYGA 3BJZA 5KYWA 4KXQA 4WCDA 3DUFB 2B4YA 3NWOA 3ZV3A 2YXBA 3I01M 2Q2QA 2FMIA 2WLSA 2HV8A 2P4SA 4B82A 4B76A 2B35A 3H2SA 3MZ0A 3RKRA 3R23A 2BM1A 3MELA 1HYBA 1JN0A 4FR0A 1EUYA 5DZSA 3V8QA 4E6EA 3OPQA 2IHUA 5IW8A 4MKZA 2G1JA 3TMKA 1V1JA 1G16A 3IT2A 5F98A 1T10A 3QLVC 1IONA 2ZBQA 1VMIA 3BRSA 1ZU5A 1NBWB 3B7WA 4JJ7A 4YQEA 1E5XA 1DEKA 3ZHSA 4E32A 2BSQA 3BMCA 3I6MA 1VL5A 3ZXXA 5CG2A 5FBVB 1WBDA 3D4IA 3O73A 2K2WA 4WERA 2W2MA 2AW5A 2II6A 4UCWA 4UHDA 3VR5A 3EXEA 1NYRA 2Q1XA 5JCJA 5JD3A 2DP4E 5FO1A 1C2YA 5KQPA 4NCXA 3U44B 4A8JC 1FP4A 1P4SA 4EF4A 1XQWA 2OC4A 2R47A 1MVOA 1ULTA 1XNHA 3U7JA 1H2RS 1N6IA 2OC9A 1R0LA 3HFGA 3MS4A 4B74A 3NXSA 4Z99A 1RYFA 3RROA 4KO4S 1RXEA 1RFGE 4PC2A 1P0MA 4LHXA 3GBVA 3WZMA 5U9CA 2J3EA 4JD5A 3U4GA 4KW7A 5ADVA 4KXWA 1F5NA 3PJGA 5GM2A 3KB8A 5EXSA 2CJPA 5KMGA 2Q1TA 4YLGA 5A71A 4YRBA 2QRZA 1S2DA 3ICWA 5CCEA 4LYYA 3Q40A 3W5AA 2WSSA 4FE4A 5C53B 4AZVA 5A9SA 2EFGA 2VDLB 5HZKA 3U56A 4XSVA 3ME5A 3FAZA 1FJHA 4TZ6A 1D2NA 1EXVA 1G21A 4Q4AA 3THWB 5B58C 1QCDA 4XEUA 1MEJA 2OBLA 3RQSA 2FDCA 2XHEA 1HNNA 1T36B 4HBGA 2XGSA 4MV0A 5UKDA 4AY3A 3V4FA 3DL7A 2GO7A 4AS1A 5K3BA 3CF0A 3BAZA 4G0XA 3IKJA 1IM8A 1VTKA 2YDYA 1IZYA 4UNNA 3WNDA 3DMTC 3D7RA 2G80A 2QD5A 1J8FA 3V7FA 1JPNA 2HMTA 4GLBA 4MWEA 3UXMA 4S12A 1YFZA 1GILA 2FR1A 1NJSA 1TLFA 2A1IA 1QQ5A 1LS6A 4YPFA 2Q8PA 3ZQJA 2OFPA 4FGUA 4UM9B 5DF1A 1ONSA 1IY2A 3RIYA 3EW7A 1MZPA 1A9OA 1CDZA 1ML3A 1UH5A 4CV1A 2C9BA 1OLUA 1PJRA 1YDHA 4KRYA 5DHFA 4BPBA 1Y9EA 5AXBA 1YMQA 2WYUA 3RFXA 1LFAA 2O9JA 2EFDB 1K2WA 1LSUA 1RPJA 2VP3A 3B82A 3ODPA 4OK6A 3K3PA 4P3YA 3AKYA 3OLWA 4MI6A 4R6XA 3ZWOA 4Q3BA 4Y9DA 1WVMA 1GGJA 2BZ0A 1QCZA 1CUYA 3TF5A 5I7HA 4RD3A 1E63A 1IUNA 3LT4A 4RGYA 3V4OA 1PT7A 3RQIA 3VJRA 1CKEA 2PKCA 2V7PA 3A7DA 3DBHA 3I6BA 4XGRA 5GP1A 5LOVB 4NDAA 4QEDA 2QR2A 3ER6A 1P0PA 4PHHA 1E4VA 2W90A 2YVLA 1ZJZA 2P27A 1W93A 1CIPA 2E7ZA 1IBCA 2HDOA 2JAHA 2PFSA 3BXOA 3HKCA 4RF4A 1PJBA 4AURA 4ZYLA 1G4UR 1OR8A 1V7PC 1X74A 3OE5A 3CM0A 3VKHA 4EKEA 4K6FA 2F8LA 1CV2A 1QBGA 3TB6A 1NHGA 3JYOA 1DXYA 3HO6A 1XV5A 4CQJA 2IYRA 4QT0A 2AS0A 1W85A 4ENPA 4HNUA 4ISCA 4NCNA 4W9RA 2OOSA 3ZI4A 1Y0BA 1NPTO 2ATVA 2I33A 1ZD1A 2RAUA 2R0QC 3ND6A 4KE9A 4KLZA 1SUSA 2O2GA 2GEKA 3UB3A 5AKJA 3K9CA 3N8NA 2XDQB 3WV5A 5E3IA 2OCAA 3E5RA 4FIDA 3WQBA 3GX1A 2GJ9A 1LDNA 4DANA 3TJMA 1GCAA 1DKMA 3ZHRA 4ZT5A 1SCIA 1LSSA 4PWZA 3GVPA 3TOVA 5FADA 5AVKA 2QSJA 4WVFA 4QOIA 5B7QA 2ZRCA 3G0OA 2V45A 2W83A 5C8XA 1YUBA 1A4IA 1E4YA 4UU8A 4J1TA 4X93A 3TJRA 2VZ9A 2P65A 2GKOA 2Z8XA 5TF4A 3RD5A 1Z63A 3NRJA 4MMZB 5E8JA 3MXOA 3NT5A 3DVRX 1FDUA 4RCVA 4TL8A 2V8BA 3A1FA 3B1FA 1V8DA 3A28A 3EWNA 3NEJA 3O4GA 4X71A 3Q98A 4M9QA 3KKNA 5E6SB 4Z4FA 3ZK7A 2D0IA 3HN2A 5ALHA 4KOEC 4QTYA 5FHQA 5GM1A 1CNMA 1NIJA 2PFKA 2WMNB 1SXJC 1OYYA 2D0DA 2FGJA 2SECE 5FI5A 7YASA 4B6QA 2C29D 2R84A 2AEEA 1LH0A 2GDZA 3M81A 2PUDA 3SYTA 3OZVA 2R8XA 1SWVA 1JKIA 3DTVA 3QHQA 1ZVJA 3SHQA 4JI4B 5KJEA 1YOBA 5BYKA 1MP0A 2OG2A 1TTHA 2WPDD 3B6ZA 4URVR 2BI8A 4WV3A 1YZGA 4O4IA 1QX4A 1PK7A 3NH6A 4W9NA 1XYVA 3F46A 2ZB8A 3IR6A 3EMVA 1CT9A 1J97A 1E96A 2N47A 3AJ8A 4QYIB 1T9GR 1T9CA 5B1DA 3Q6IA 3ZDYB 2WQ6A 2YHIB 3K15A 1G8YA 3QVSA 1WZUA 2E87A 2WAOA 4IV0A 3LPCA 4N5DA 4G1MB 4F7DA 5AKXA 3R6WA 4FW8A 1WP9A 5AWFC 4E13A 2PTHA 3EIUA 2CCGA 4J4BA 4LXQA 3UATA 3N2GA 2JRLA 3AEQB 3C0KA 1T24A 1W34A 5T7BA 2HWWA 1SOUA 4PZYA 4CRWB 5BV8A 4FX2A 3QOXA 4KQWA 1AGPA 5DHAA 2GPTA 4J16A 1POXA 3TRJA 2YYZA 3VVLA 1P1KA 2PBFA 4NOLA 4KFUA 3GJYA 2ZRPA 3HUFA 4ZK2A 4XD2A 4A36A 1IBSA 3ZLTA 2JIMA 4WTOA 1W36B 2WUVA 1QVAA 2FVYA 2J46A 4DA7A 1XVLA 3KQQA 5ALYA 5GJCA 1VE1A 1XRPA 4O02B 4TYPA 3F2VA 3PXAA 5ABPA 4IMPA 1TO6A 2AFVA 3REQB 1H0SA 4JQZA 3DM9B 2XMRA 3VC2A 4QDXA 4AMZA 3BK7A 4DCSA 1I7NA 1OZFA 1LCIA 3K32A 3O8QB 4QHTA 3OX4A 3P9IA 1KL7A 1AXRA 3LBFA 5K0JA 1X1TA 3OCCA 5TLSA 1BGXT 1K8YB 1KI2A 5J2TB 3SIPA 3AR4A 3GLTA 1F5SA 4OQ4A 3BMNA 1QZUA 2EF0A 1DXHA 2QRHA 2VC2B 1MB9A 2QTLA 1JTEA 3CLSD 5IT4A 2JVKA 4LGMA 3UYKA 4N5MA 2FOIA 1M3SA 4NCJA 3EC2A 3R76A 5KPDA 3DBOB 3G13A 3TW4A 5HS4A 2GCEA 1RIIA 2Q0XA 2WLTA 3Q0EA 4W5JA 4FFRA 1VC2A 1HH4A 1DXQA 4XGQA 4PZUA 5ARCA 2ID9A 4YTEA 4TLLB 4Q05A 1R12A 4KEAA 1JJFA 3NGMA 3IPCA 3IURA 2ERCA 5GWXA 4CM3A 4MSUA 4JXXA 3RF6A 2WDZA 4MIOA 3HB5X 3QQPA 5IABA 1K6EA 2C9MA 3GZNA 2FWNA 5HKKA 2VP6A 1Y98A 5FIUA 3OQMA 1H4TA 5BSFA 4H1WA 4KZPA 2O7QA 4C88A 2OO5C 1JHZA 2PR2A 2ZANA 1WDLA 2ZIFA 1V3TA 3K2BA 3QVJA 5HF9A 2IZ1A 2A59A 4M99A 4DQUA 3GLIB 1QC5A 3P9QA 1T8WA 3IAS1 3TLEA 4BFZA 4LPSA 4UHKA 4EG7A 1M54A 4YLEA 3ZHZA 5FA8A 3ZU6A 5G0WA 2OV8A 2K7ZA 2A5YB 1E6MA 4G5FA 4GPTA 4QKQA 1VI5A 1K7EB 1KEPA 3HCFA 4DLRA 1TFRA 4XTRA 4CT5A 1TA9A 3DCIA 1RRMA 3NUQA 1AV7A 1RYZA 4JNKA 1FFHA 1W6UA 2AIRA 2AQHA 2BCGY 2O1WA 5DK6A 4HWRA 3REGA 1WCXA 5B1YA 2OGTA 1W48A 4RPHA 1U9JA 1VA4A 3OD1A 1U8AA 5EL0A 1OYOA 4L73A 2XI4A 1OV4A 5EJGA 5EYPB 4O1IA 1N77A 4OU5A 4EFKA 4IFEA 2VQ3A 3BK1A 3TIXB 3ZY2A 5DYYA 5T67A 2DYKA 3BIOA 2VCEA 4YP0A 3K70C 1H2FA 4I4CA 2VKTA 2XECA 1JT2A 3DPIA 4ZVTA 2Z57A 1V8ZA 3R77A 5BQPA 3D6TB 2BMEA 4WQMA 4RA9B 1EHYA 4GGOA 1PJZA 3TZHA 4CIXA 5IJ0B 1E2NA 3SIWA 1O89A 5J2TF 1U4OA 4AJPA 1P1RA 2V6MA 4W99A 1RHMA 2OESA 4F2DA 4Z7QB 2Q3EA 4I5GA 5B7NA 3LY8A 3UICA 1YB4A 3GLGB 1E1QD 4MULA 5E0OA 2BDUA 2DR2A 4JVMA 1CVIA 1EQAA 1U0JA 3U5TA 4IDGA 5LWQA 2I3BA 4CKXA 4WZBA 3LC7O 2V1XA 3CSSA 2PCLA 4JT8A 2BEKA 5AVOA 2DQZA 1YI1A 4JDPA 4EG0A 4COKA 1A2QA 2UVPB 3ZNQA 4J0FA 4M0FA 3EASA 5MN5A 3PE6A 1YUNA 4L3WA 3IA2A 1RI4A 1CHNA 1GLGA 3OQIB 1Z3CA 4UDYX 1GM5A 4Y3UA 1YQWA 1PX2A 1X80B 2OORA 2ZSHA 1M6WA 1L5KA 1F1BA 3EIFA 3K16A 5IF3A 4BAGA 2O0JA 1NR5A 1AUVA 3LQQA 2C2BA 4DNOA 2XNDA 3JQ7A 3DEKA 2ZLBA 3BE4A 1SQ5A 2MSNA 2QY9A 2ZVPX 1GEEA 3C7AA 2COKA 3CF2A 4UAVA 4A7PA 2B8NA 1XR3A 3G7NA 4RK4A 4RZUA 2OWEA 2NAPA 2HAEA 1KBOA 3SJBA 1NX6A 2WJYA 3AEUB 1TMYA 4PHGA 4C6RA 2P9CA 5AVWA 3KELA 4Q1EA 4BMPB 5IBCA 4YMSA 1HORA 4P54A 2VRCD 3QKUA 4UMEA 2AXNA 1HDGO 1HE3A 4YDSA 4DA0A 1BGWA 2QA5A 2AMFA 2PRZA 1IWBB 4DAOA 1E7YA 4L8VA 2GM3A 4PC7A 2E4UA 4TKZA 1Z2EA 2F3SA 1DUIA 1XF9A 3R6GA 1DJOA 3CX3A 4G0NA 4QUIA 4WXYB 2B82A 3OEED 3R6LA 1A4RA 1JJVA 3HS3A 3PG5A 3GLFE 5F3WB 3N2YA 4JBYA 4JC8A 4PRLA 3UWDA 3W8EA 3EYAA 3DOCA 3H6GA 3DVAB 3HZOA 2W0SA 4F97A 3HYSA 4GMKA 2HF9A 4QELA 5HG0A 3KV1A 3KR1A 5T4EA 1CEXA 5KOJA 2DY0A 1PWYE 4HYYA 4XLTA 1DDOA 3L8YA 2QNRA 2VHEA 2P9QA 1Q0UA 3A4YA 3QE2A 4IVQA 4I1YA 4EB6B 3B60A 2H2GA 2PIDA 3PFWO 1GNQA 1DIGA 4CT0A 2C7QA 2JLVA 1H42A 1DTWB 2WZQA 1WJGA 3FDJA 1LLCA 3M3HA 4UTZA 4C29A 1O0CA 3WHLA 4ZODA 2XJ9A 4QU8A 1V7ZA 3LUPA 4XX0A 2IX3A 5FFNA 3C7DB 4GE3A 4NE7A 1JU9A 1NAHA 3NUGA 4L4YA 5CVTA 1DEAA 2DSNA 2VLBA 3PGKA 5IC6A 3PTAA 4YV2A 3OU2A 4Q00A 3D3EA 4CIWA 3P27A 3CVUA 1ZD3A 1GG8A 2PV7A 3T3MB 2ILTA 1PWEA 3UMYA 4EHLA 4MYCA 2XLCA 3K2IA 1UJ6A 2NVOA 3CZRA 1GA6A 1N5MA 3ND9A 1U0RA 1O96A 1PSDA 2HA7A 2Q5IA 3E9MA 3P9SA 4X1IA 4ZCIA 2I0FA 4GNKA 4X3CA 3PQ8A 3WIUA 2DBQA 3EZ6A 1JVSA 3D3JA 2J67A 4F6CA 3FOEC 2V6BA 3F7OA 1U0OC 1WF6A 3G6KA 4LRWA 5HJ7A 4HRXA 3ZDEA 1FX0A 2ZT7A 5CT4A 3C1OA 2B1JA 2NUAB 1Q0LA 5B3JC 4KX5A 4UOQA 2C98A 2DXIA 5JAQA 1X0VA 1XMIA 2IKQA 3QPAA 3RFVA 4ECAA 2PXCA 1RVDA 1CJSA 3F0TA 1DAFA 2O20A 5ENVA 4K6OA 4TTQA 5JZMA 1PWXA 5KU1A 2XUKA 5EIHA 1N8KA 1I7PA 2IU3A 1GEGA 4L3VA 2PA0A 3L0OA 5JV5A 1YS7A 1W581 4F92B 1P45A 1NTRA 1U7ZA 3MQFA 4FI3F 3VH2A 3Q12A 2BCJQ 1XEAA 4ZRNA 1VYHA 2YL2A 3AUTA 4QU9A 1W0KA 3VJKA 3RRZA 1YNOA 1JBKA 4BMSA 3JARB 3LGXA 4B4OA 1BEUB 1R5BA 3DDOA 1FX1A 2BKUA 4NBSA 2ZYVX 3O31A 4QBFA 2ZUWA 4X6LA 5HJ2A 8MHTA 3CX4A 1XTIA 3UF0A 5G4KA 1JMKC 2ZWVA 3AU8A 3CYFA 3RVSA 2EFEB 4DV3B 3B9BA 3R3JA 1NN5A 1SUBA 3V97A 3E18A 2YIJA 5M7EA 2VDNB 3EB9A 4J3NA 3H11B 2WWTA 3BL5A 4FGKA 5C37A 3HBLA 2UZ3A 3QU2A 4CGZA 1NZJA 1KDRA 4KQKA 3X1DA 1NM5C 1E2JA 3PT9A 1MQSA 4PIVA 4U2EA 3TX2A 4P6VF 1V2HE 2HF2A 1JQLB 3B2QA 3QF4B 4FINA 4GW3A 4JJEA 4LI3X 3R0VA 4PZ0A 1GTG1 2B5WA 3HJUA 1E92A 1L1EA 3Q7QA 3ZPXA 1XEWY 4EDFA 1BYUA 2HDNB 4GIBA 3TEMA 1K97A 1NP6A 4YRJA 3I62A 3IDAA 1TZBA 5KX5A 2BFWA 4C78A 1U94A 3RK1A 1T9KA 4X44A 1FB5A 2IDZA 3RUPA 4JEMA 2Q1SA 4YACA 4MIYA 5LZ5A 4LGYA 4WZZA 4CKBB 2EOAA 4AY4A 4DCVA 1TZ2A 4IDBA 2ZSBA 3BSYA 3E0QA 4UVGA 4IYJA 1T1IA 2AMJA 2C2WA 3ZIAD 2QVBA 4I50A 2WTEA 1IHOA 3ZVRA 2BGGA 1X8KA 4FYJA 5IZCA 1I3CA 4C9BA 4IRMA 3DA8A 3X1XA 4GAEA 3R3ZA 5CVCA 4K0KB 1X1SA 3LGAA 1UXJA 3JD3A 4XVHA 3TW6A 1CYEA 5B1SA 1M34B 3NPMA 3QEKA 2O8FB 1DFHA 1NBOA 1BGVA 1G42A 3CWQA 1AKMA 4RKFA 1KE1A 1O08A 1TJ3A 2R5NA 1AGYA 3AM5A 2P6NA 2V97A 1IZ9A 2IEBA 5D01A 5AVYA 3LUBA 1EGVB 1L7EA 4FFNA 4UNIA 4DC1A 5CLFA 4IX9A 3INYA 1JSLA 3S40A 1MZVA 1UMDA 2NADA 1PZXA 2C95A 2QLJA 4DVJA 2FZKA 3FYUB 3RS8A 4YI5A 5C8ZA 4RKWA 5J2UB 5C7IO 1T6YA 4MQFB 1C0IA 5JNSA 5CVUA 2NU8B 4KR9A 1T9GS 3BRWD 4QDUA 5EUCA 4G0VA 1Q83A 1T2CA 3RYFB 3EIWA 3PFIA 3NNDA 4WX2B 3L8ZA 2A6PA 4XPIA 3EPJA 2X58A 4KTTE 2BFFA 3PI6A 3KUXA 1GUAA 3RLIA 4JJZA 1DBPA 1E2EA 1H85A 2YW9A 5F52A 5IH3A 1H4QA 2FWAA 1AT1A 1MCZA 2QXYA 3THYA 2QUZA 4FONA 5JOQA 1GR1A 2GXUA 1ND6A 4DCJA 1I1NA 3TR0A 4BWVA 3ANXA 1XCLA 3TLYA 3HBJA 4DIUA 2VH2A 3FD8A 4CFSA 3H5WA 2GDJA 3ONFA 5AKLA 2VAMA 3OQ6A 2Y77A 3K0AA 3M6UA 5A3JA 3DZJA 2PL5A 4KNVA 4NMHA 1KIMA 2ZKLA 4WFIA 5E1DA 5BW4A 3GMDA 4NENA 3RG2A 3H8WA 4QJIA 1RQNA 3E4CA 3NGLA 1EUZA 1C9DB 1DS6A 1UIRA 1U3TA 3HA2A 2D62A 4QQ8A 2MHCA 3C6YA 3IPXA 4S1WA 3JATA 2JAXA 2ZITA 3FY4A 2WYVA 5JDCA 2Y1OA 3GPLA 2ODNA 3DV0B 3R20A 3TZEA 5B4VA 4CMBA 2PPLA 4QFDA 2NO4A 3VX4A 3WGOA 4XM1A 2OXEA 1EZ4A 3TH5A 3RB8A 1L5RA 1B2RA 1IDOA 4EM6A 4W6ZA 1FFDA 2BRUC 2V4MA 3EFOB 4L4RA 1J25A 2AI2A 3BHNA 4R2HA 2QL7A 1PBNA 2Q2NA 3KDAA 1NXQA 2C9DA 1Z0KA 3JQAB 1DAPA 1S3GA 4EJMA 4X8LA 1OU0A 1AKTA 1Q21A 3OURA 3BGDA 4B3IA 1W44A 1WMEA 3VNVA 4CW7A 5JHHB 4D96A 3JWHA 4BV2A 4Q9LA 4O2BA 2RI1A 3DMPA 4UEQA 4ZDWA 4Q15A 2WZBA 4M98A 4UZSA 1JBEA 3C3DA 5JD4A 1V6AA 4TMXA 1O1YA 4FU0A 5AKGA 4POAA 3KP1A 3WGQA 2MINB 4XYBA 3DLIA 4MUFA 1XCBA 4Y18A 4DIFA 2VPXA 5J2UF 1EZZA 3HJGA 4HR7A 2B8TA 1GYPA 3U80A 5FWXB 4RPIA 5FAKA 2UUAB 1JQ5A 4G0YA 5JMOA 2JCBA 2E18A 5JSYA 5AO9A 4DFDA 3ROMA 5CXQA 3C7CB 4C08A 3AESB 3NHLA 1E66A 4J0JA 5A1TA 5KKCA 1F9EA 4E3WA 1S2IA 5EESA 1I6LA 3FHTA 2VP4A 3AV0B 3R6DA 3PQ7A 4YAGA 4HVAA 3W8RA 3BWMA 4N3NA 3DGFC 3V9AA 4HQKA 4CEHA 3LYAA 5JY6A 5FTMA 1PX0A 4CMHA 1S96A 4MPPA 4PYKA 3P9NA 4BU0A 3I39X 4DA4A 3KX2A 2BGRA 3PNSA 4OQZA 2IZOA 4BNJA 5BN3A 5ITZA 4UBNA 3QHAA 3WB0A 2VDMB 4IIVA 3UJ6A 4DM7A 2P35A 1FNCA 4FE3A 1YE5A 2O2ZA 2XQJA 3M6FA 4B6PA 1K7SN 5JS7A 1DO2A 4OKNA 1UBJS 1TK3A 2WJ6A 3JZFA 3LC0A 4OFXA 2AN4A 1XLTC 1KJ9A 3M4YA 3OECA 1NFFA 2B83A 3LF2A 4HRAA 4I9GA 2OV1A 4R9NA 1KAHA 1XRQA 3Q2IA 4L0DA 2ECKA 9GPBA 3RT9A 4YC7A 4ZT6A 2IZ5A 3GWZA 4KIWA 4OK5A 2QSZA 1NVDA 5AXDA 4YPVA 2ZE5A 1CZOA 5DGHA 2J9RA 4LJYA 3MLEA 4UUQA 4Y9RA 2L18A 5ALGA 5T8KA 3DGEC 4KC0A 2WWFA 3BVPA 1JALA 1Z28A 3BFJA 4FYMA 1IN6A 1EAYA 1OIVA 4TZTA 5IEBA 5JZVA 2XZDA 5TB5A 1ZRSA 3UJAA 3MCAA 3PIDA 2WWIA 4IZIA 1HDOA 2OLKA 3S68A 3VYUB 2C2GA 2I65A 2B9VA 4MCJA 4DV1B 3R6TA 3QEOA 4MW7A 2EL7A 5FORA 4D0GA 3IB6A 4YP9A 3UOGA 1CCWA 4H17A 4I14A 3FJYA 1JU4A 5LQSA 4BX3A 3A6FA 4D8VA 4ETWA 1AX9A 4ERXA 1VFNA 4BEVA 1N1MA 2KSQA 1J2TA 3QJ5A 4TMYA 4B9AA 3HUEA 1QOZA 5LDGA 3ZWNA 1FJGB 2JVJA 4HNQA 5G41A 3PJDA 3TZCA 2ZS7A 4B6RA 4J2HA 4QDZA 4R8VA 2OWDA 3LP6A 1R0RE 2GQ0A 3G5LA 1JZQA 2BFCA 3X2SA 1L5VA 4URXR 5L3VA 4LGVA 3WQRA 1CY6A 1G9TA 4PY2A 3O7WA 1O94D 3KB2A 4BX8A 3MM4A 3MK31 3W5SA 1L8QA 1NI3A 4H6XA 2PMEA 1LVGA 3D3KA 4OK3A 4QBKA 4YDRA 2WD9A 1AO3A 3E48A 3VDNB 2SHKA 4ZI7A 2AC4A 4YV1A 4KRFA 2B98A 4BJHB 1DO0A 3CLRD 4HTFA 1T8RA 3COPA 3ZWMA 3KPJA 5LZ9A 1UMBA 3I42A 5ALWA 2ONJA 4ZDIA 1V26A 4G5QA 4YAIA 1QVRA 4BN0A 3JXEA 1P1CA 2OYCA 2X4DA 4AY6A 4OUDA 1KKLA 4PTZA 2OPHA 1PVOA 2IXFA 4M3NA 5CNJA 2J3DA 4HEA1 1D7OA 4MKIA 4QPNA 5EFZA 4H08A 1EGHA 2NZ8A 4S1NA 5AW8A 2B25A 3OE4A 4ON9A 4CHGA 2EJWA 5ALNA 1LDEA 3I2KA 1MKYA 2IU6A 10MHA 1XZLA 1KS9A 3RUCA 1BXGA 4ZQEA 5DEOA 5EJ4A 3E58A 3NV9A 4PS0A 1RHQA 5ICFA 4EA7A 1DIOB 4O2AB 4DUGA 2VJPA 1AF4A 2VQSA 2H1RA 4I5DA 1R4ZA 4K9RA 1KJ8A 1BS2A 2NVUA 1QGOA 3T1TA 3PEUA 3PPIA 4ZWNA 1M0TA 2JHPA 5CR9A 3WDSA 3MJRA 3C97A 3TLMA 1WMDA 3AK4A 1PJSA 1UBHS 4MQEB 1OI7A 2EBFX 4R1SA 2XXAA 2ZXEA 3CLUD 4ESHA 4BQPA 3COZA 5EVJA 4YMLA 4BWFB 1A27A 2XB8A 2L2QA 3B6MA 2JHCA 1XTZA 4UEJA 1KRXA 2H1IA 4EVIA 1Z7WA 3MLAA 4A73A 2XQGA 2NP6A 1H23A 4AKEA 3W90A 3KLOA 2DMRA 2JGJA 2J9FA 4WLOA 4RS4A 4J1QA 3B6JA 3L8HA 4JVLA 4R7TA 4OX9B 4I7EA 2W6JA 2ZAYA 1K5DA 2X1HA 3Q7IA 2JJ1D 4B3MB 3H9CA 2YJ5A 4R2XA 1L5OA 2ZDGA 5FRDA 2IU0A 3RGGA 3UOWA 2CMDA 4KQ9A 1KTIA 1KA9H 3RUFA 1KYWA 3C8ZA 1I3LA 4R51A 4QQFA 3ZVKA 3HABA 4LBZA 4MP3A 4LXTA 4NV1A 4RF3A 2AEJA 2XUZA 2PUBA 1KC1A 3UJBA 2OZVA 4PYLA 1J0DA 4KH1A 4O1HA 2HQ1A 5DGXA 5HTKA 1Z6XA 4CQMB 2FP4A 3WB1A 3EPRA 1CDDA 3PFFA 4UATA 5KOHA 1FCJA 2H29A 3BHIA 3DW1X 4R9VA 2I54A 2XXJA 4GH5A 1SPXA 4X6UA 2Y1EA 5DNCA 1AO0A 1FIUA 3OFSA 3B1YA 5G3ZA 4IS2A 3CVVA 4OHKA 3H1GA 1K4MA 1LBIA 1M2EA 4G25A 1HT1E 3RJZA 2P2SA 2HK6A 1U3FA 2JGDA 3I4LA 3O1IC 4I19A 4P4SB 3JAKA 3W5HA 3L0CA 8OHMA 4CM1A 5KEIA 2YC2C 1MDBA 4HPXB 3CNOA 4R1LA 1Z0DA 5CM8B 3TBKA 4P7BA 1NE7A 4XGIA 4XWOA 2JIZA 3MFYA 1AIPA 1JWLA 3F73A 4M76B 2YY7A 3E8SA 1E2GA 1MO6A 3CZQA 4MA5A 4WT7A 4BVBA 1Z62A 4Z0HO 2NU7B 2A5JA 1RI2A 2WWRA 4KGXA 4PINA 5EOVA 4B4DA 1USIA 3L6CA 2NYVA 4BNXA 5MF6A 3FFBA 1U80A 3W7VA 1TQ2A 1PTKA 5JQGA 3B1VA 1BE1A 4OJYA 1KETA 3PPVA 2AT1A 5CDUA 1L7OA 2VNIA 5FL3A 2OD2A 3JV7A 4PWYA 1XU9A 1T29A 2I03A 4JYCA 4F96A 3KTAA 4QSHA 2AN1A 4KWCA 4OI4A 1OV6A 5E6UA 5AI0A 4K6GA 2Z5FA 3N2KB 2AVNA 2PFGA 3EDCA 2PKQO 2QTRA 4IJVA 2AFRA 2J0SA 4TV8A 1KAQA 1H2EA 1SIUA 1YZLA 3V7NA 2O14A 1L4EA 4EUSA 2R6DA 3C2QA 3COWA 4ZO9A 3C1TA 4DLYA 2YV3A 4E07A 1LB1B 2CHVA 3K9QO 3T15A 1L5MA 4L16A 1UF9A 5IJAA 3U7HB 1A8PA 1I0IA 3W8FA 1ZK1A 4UEWA 4Y7CA 4Q9DA 4B44A 5DTIA 1TADA 4GOXA 4LYJA 1EFDN 2HLNA 4EUNA 4BHTA 2X41A 3FWYA 5EJFA 1M6VB 1Z68A 1K92A 2P7HA 3H3JA 3QF7A 5THKA 2O54A 1UJMA 3LQFA 1AA6A 4EB8A 1UOPA 3HACA 4CFYA 1WE2A 2HJRA 1GG2A 5DSTA 2GTIA 4ENWA 1CVRA 1NLUA 3LJKA 1DWPA 4TM8A 1P9LA 2F64A 4L2IA 1RJGA 1XMPA 3M6AA 1SHTX 4GI1A 4PTYA 4LRYA 1RU3A 3OT4A 4J7CA 4MKRA 1ISPA 4PCAA 4EHAA 2RHHA 3DOJA 3SC4A 2BKAA 5HQJA 5DE3A 4LHWA 1BWRA 4F9TA 2X4LA 3P2YA 4X8MA 3RSZA 4KWHA 3UB2A 1E3IA 3GA0A 3P4UA 1XTPA 5DXFA 1Z22A 1TIBA 2JI9A 4CKCA 4OH7A 2PZEA 5DI3B 3S2EA 4FDUA 1OGJA 1Z7BA 4EVSA 2YHSA 2ZRGA 2GEUA 4YS6A 1NBMA 1YQQA 2FPOA 4Q1DA 3F6CA 1H2BA 5DM70 2MJLA 2FPIA 1G5QA 4NVRA 2PU5A 1PTJA 1ZXLA 3TQOA 5BV7A 4OJNA 4CLXA 5A5DA 2VK2A 3NTXA 4HB4A 4JIMA 3R7SA 2OHXA 3USCS 3SFVA 2P6PA 4WKCA 1LQ2A 4O5OA 2GR9A 3OIVA 5DHSA 4AZWA 1F60A 1YQXA 1X38A 2ZIXB 4J9VA 4JLOA 2QPOA 1I30A 1QF7A 1RJWA 4L5JA 3TIFA 3OT5A 1FDOA 3BE5A 3GARA 1CEQA 3GFTA 3L8GA 4JKYA 4S24A 4LY9A 4HGYA 2Y2UA 2A9OA 3BERA 2J30A 2ZKIA 4J94A 4LZOA 4P8RA 2YN2A 4RW0A 3LPAA 3B5IA 1VIVA 4FW9A 4LK3A 4O4JB 5KSZA 3DF7A 1QNLA 2YMMA 3A3NA 1OX4B 4TLCA 3RVQA 3IKMB 3R3XA 4YAFA 5KNBA 4X7RA 4CXMA 5CGQB 1Z82A 2QRVA 2G40A 5KNDA 1J2UA 2BUCA 1L7AA 4Q93A 2H7VA 1L5FA 2VSNA 4Y7DA 3ZV4A 2PXXA 2FMTA 3F5MA 3WIEA 1J0BA 2C5SA 2ZJ4A 1E4EB 1IPFA 1D8AA 1K7FB 1OT5A 3GW8A 3OUTA 3PYMA 2IYWA 1Z75A 1UEXC 4OM8A 3DL4A 4C76A 5GY7A 4GL2A 3AOEA 1SH7A 1DADA 1PZFA 3V8RA 3Q4GA 1NF9A 1ATIA 1TM5E 4L76A 3VPFA 1QFYA 2FG6C 2Y6UA 3VMFA 2AR9A 3FF4A 2NUPA 4NFSA 3ZK8A 2GLTA 1A8SA 3KVYA 3LLMA 3E7DA 3IQXA 3PUWA 3R3HA 1ZG3A 2Y6VA 1YVEI 3QLVA 3PC2A 4M46A 5A4IS 6CHYA 1A98A 4OBEA 1LFDB 1N2SA 3B1KA 1TJ4A 2NSYA 3EAQA 3KUDA 1U2SA 1C0EA 3KOZA 3SIRA 2AE1A 4U3JA 1PQ4A 2PQ0A 3W6UA 3E82A 4ARZA 4OFZA 4ZMSA 1JEDA 4BVAA 1R0KA 1UKAA 1YIDA 3DOOA 4X20A 2PBRA 4A8JA 3G1TA 1YOVB 1V6SA 3FBGA 4JBXA 2F1RA 2QRPA 3VPCA 3ONVA 2JJMA 2VYFA 3JASA 3QSGA 3FNBA 2L17A 1V1RA 1HC7A 1X15A 4JWTA 1N0HA 3ZIUA 2EHDA 2QP4A 4OAQA 4Z7JA 3NAZA 3ULKA 1GAJA 2B21A 2H7YA 3D8HA 3MTGA 4MPDA 3H18A 5CW1A 3EHEA 5GONA 5TQ0B 3T5DA 4CEIA 3OE7D 4WL0A 3LHKA 4N18A 3FRIA 4LV6A 4Q5IA 3H5AA 1Z5OA 1FYDA 2IZZA 3WLOA 2GJAA 2VQFB 3QWHA 1RMTA 4KSBA 3AUAA 2WY2D 3ZCVA 4E5VA 1MQ9A 3L1IA 1R4AA 4BO3A 3GCDA 1OVGA 1TD9A 1SCKA 2G82A 3N58A 4P80A 5G0VA 2H4FA 5IDYA 3EE6A 3ZWPA 1QS0A 2VDOB 3CVXA 1RPTA 2HHLA 2NXNA 3LUGA 4E5KA 4DJTA 3RNLA 4C0QC 4ZV7A 3R75A 1MX3A 1VG1A 1SQ6A 4OIFA 1BMFD 2OV2A 4IL5A 4LBVA 2WF7A 3FGZA 3MMPA 3N5KA 2JJ2D 1MFPA 2AOVA 2OZKA 2Z3VA 3QRWA 3PFKA 3QEJA 4FE7A 3DMTA 3WMXA 1D0VA 1YASA 2I3ZA 5BWOA 4O4JF 1O57A 4FWTA 3X1KA 1R0WA 2NXJA 2JNWA 3WSWA 1PR5A 3T5BA 5J5AA 3T38A 4BOYA 2Q5EA 2JZOA 1MOPA 1E6KA 5DLQC 3TSOA 2OCIA 4S0XA 1II8A 2FK8A 3SXUA 4ASUA 4TT3A 3LQYA 4UJ3A 3OFND 1CK4A 1Z2AA 2E5FA 2ATCA 4I08A 1DG3A 1R5NA 1Y1RA 2O5VA 3ZBUA 3T5PA 1QQAA 3AVXA 1QPZA 4B4UA 3MMSA 4KXVA 4BQSA 1HTTA 2JFPA 4HFMA 3OZRA 3H16A 2NAFA 2YHUA 2GPSA 4GMDA 2V7WA 1NV8A 4TWJA 1EVQA 3RGWS 4BN4A 2GVZC 2Y8EA 4OHMA 2OB1A 2VDVE 4B09A 4MGZR 4ACBA 4JXZA 4MTCA 1X6VA 3GFRA 4FYXA 3DV2A 4GOOD 4L15A 4GOMD 4C3ZA 1M5RA 3PNVA 3I2FA 3PX3A 5EGSA 2O4UX 1PGNA 1ZICA 4ZVPA 3NHAA 1G8GA 3S1SA 1D5WA 4I6EA 2RK4A 3IS3A 1RSZA 3FWKA 4HQLA 4IMJB 1YRBA 1QV7A 4BUCA 2DCMA 2J33A 4NYJQ 3QKTA 1Z08A 4ME6A 1G291 3QEBZ 3FFTA 3DBIA 1ZVQA 2ZRAA 5AFSA 3F71A 2ZJ6A 1SQGA 5ICCA 5LJLA 1WMSA 3DO6A 3V00A 3ZWBA 4TLEA 1OX6A 3O82A 1BU5A 3URKA 4BMVA 5BPHA 4G1CA 3TD9A 3VKFA 3PIIA 5JCXA 2CUTA 1IK4A 5FWYA 1EB8A 1CIVA 1T34A 1JX6A 2O2DA 1UOQA 3ZV5A 4DPLA 2AG0A 5HGXA 4TMKA 3R7AA 2JLWA 2PRJA 3IP6A 4UW9A 5FYQA 1NN0A 3SNHA 3D6NB 5I7SA 2N0SA 4AD8A 1EJ0A 5ILGA 3SZGA 1AKNA 1QH1B 2A5GA 2QMZA 4JJFA 3H9UA 3ZE7A 4OF4A 5CFNA 3LZCA 5CA1B 1G5IA 2CWWA 3B51X 5EVCA 1QE0A 3GLUA 5BR1A 1ZVVA 3EDRA 4OBXA 4K9OA 4FPXA 4MVXA 1HMYA 4G5OA 1A5AB 2O2SA 4BYMA 1MG0A 4XYMA 4FN4A 2GA8A 1RZ3A 2Z6AA 1BW9A 4GVPA 1VL0A 3RIXA 1Y3AA 1SXJA 4MCAA 5FB3A 1XQYA 4Z4GA 3DVQX 3PDIA 1NQUA 1I3MA 1SWWA 5JH7B 1RAGA 1M83A 1U8FO 2ZBFA 1E8DA 1N9ZA 1QIMA 1TLLA 1TYDE 3G6WA 4DKXA 1TTTA 2QI9F 2GRAA 3K9BA 2I2CA 4US0R 4UASA 4BKQA 5HILA 3LC1O 1WCIB 1IRIA 1WD5A 4L51A 3EZ2A 3OM8A 3PC3A 1Z5ZA 3SS7X 3UMJA 2XGJA 2F8TA 1J8MF 2GBIA 1TT5A 2XCQA 2AUNA 3LWZA 4PQRA 3NEYA 4Y2QA 1DX9A 2OP0A 1A50B 3BMQB 3F8SA 1IRXA 4QTXA 4BNYA 3BZWA 4FMCF 3GHYA 4PPQA 3O4JA 2CE7A 4AT1A 2NXEA 4BWGA 5EFOA 1PFQA 2CVOA 4EDHA 1SUPA 2JATA 5D85A 4XVCA 2ATIA 4Y8VA 1ZU4A 5I8ZA 4P5EA 3RBXA 1NG1A 3GNTA 5HWSA 1PL8A 2IVFA 2W22A 3KT8A 5I9BA 3TM4A 3QKRA 1Q7BA 1U0NA 4JLWA 5K6AC 1YJ8A 3M5DA 3OI7A 3OQBA 1QWOA 4FS8A 4IRXA 4ND2A 5LFAA 1GPMA 1NGSA 5M29A 4Q03A 1L9XA 4I3FA 1A9RA 2DGDA 3Q7PA 3DHEA 3ZVLA 1Y1QA 4BIMA 1R5OA 2XCLA 1Z26A 3DHVA 5F21A 2DFTA 1RYEA 2C94A 4TQ9A 2C04A 3G9ZA 1NW9B 2AR7A 4IKOA 1BXKA 4UZFA 4MNTA 4AYWA 5I5EA 1RVV1 3CX6A 4FCVA 4OXRA 4TVSA 4I4IA 2NUTB 3VDMA 1YJXA 2CJWA 2NGRA 5F3RA 5ER6A 4E88A 5AVSA 4G0WA 1P4HA 1NYQA 1H6BA 2JAQA 2CLIB 4JGBA 4E7PA 2W8BB 3TVYA 4B6SA 4F04A 4MB6A 4PS1A 2CDRA 3DWFA 1QYVA 1V1MB 2EERA 3KYIB 5CA1F 2JEZA 1B6RA 1WBBA 3G85A 3UHAA 2EQBA 2QTVA 2R6AA 2MT9A 3UUFA 4KAJA 4ITRC 4ZCPA 2IV2X 3T12A 5I7OA 1AQLA 4QFMA 5ICEA 1H0RA 1L7XA 3CGWA 1VKNA 4IOJA 2VUTA 4AG6A 1ZCJA 1AUQA 1WSWA 2AMLA 1KZ7B 2ZRLA 1TA0A 1PU2A 2I4RA 3K4PA 3ROTA 3U7FB 3HCEA 5EHZA 2I3GA 2JKVA 4RCZA 1IK6A 2W58A 1BX1A 2PCJA 4MYDA 4E22A 2ZPTX 1J6UA 1Y4DE 1GSIA 2HSZA 3JWIA 4KWTA 1XRRA 4MI1A 4DBVO 1O97D 3QPUA 3VMMA 4NHOA 5FI0B 4BRSA 1FDWA 3WYAA 5CFRA 4PGMA 1KFJB 1LK0A 2FW9A 2G9VA 3OD5A 1XZKA 1MR3F 3T7DA 4AC9A 5JJKA 4KITB 3ET4A 4X97A 1XDBA 5BUSA 1JVBA 4E03A 2XNKA 1F8YA 2OO5A 4IMRA 5AOCA 1DBWA 1XZMA 5LYJF 1CIJA 1WUHS 2M9MA 3H86A 2I8LA 2OQ2A 4ZYYA 4MQUA 2FTKE 3IAXA 2Q2OA 1KK0A 2VWQA 4ZU6X 3MUNA 1WUKS 2QEQA 5DSZA 2O06A 4CIVA 5F9HA 4HLCA 3H75A 1U0BB 1QGUA 2VHTA 4ZFNA 2QAJA 3ETDA 5MGNA 3MAAC 1U1CA 4WKOA 2FUEA 5LD2C 4N6OA 4YREA 4TXHA 1MB3A 4I4LA 4O5AA 5L45A 1TU3A 4OHZA 1DKLA 1KYZA 2HU7A 1DX4A 4X1KB 2UVDA 1QU2A 1ESEA 1WHTB 5JI2E 1FS4A 4DV4B 4A27A 3R5FA 3G7SA 2ZPAA 4R2JA 2B1QA 421PA 4KMMA 1XF1A 2QSUA 3N2IA 1NJ8A 3TQCA 2VWHA 2YFQA 3GVXA 3OEYA 4WESB 4AP5A 1Q7RA 1U99A 2BR3A 1Z29A 4EPYA 4KHPB 3IESA 4BTEA 2WVGA 2VA9A 5K8UA 3LLVA 5JW6A 3HDJA 2I6TA 2P9ZA 3K73O 1T8UA 4QEKA 2NXWA 3U39A 4CJXA 2LKCA 4A5SA 2A0YA 1E3MA 3IPAA 4N9QA 5IJ9A 5HBRA 2ETXA 1K9SA 3AB7A 3AY7A 3SE7A 2ODBA 5LBTA 3WZLA 1ISIA 3OZGA 2OCBA 4H77A 3IDSA 3C5HA 3AR8A 3PRHA 1JAIA 1WDWB 1EBFA 4M1MA 2PU7A 1SB8A 1AQIA 2XAAA 1AMOA 1RAAA 1OHHD 2PGDA 5B6IA 5I7VA 2QVGA 2MCFA 4RD2A 2OV3A 3LP8A 3DE5X 2B8JA 4ZT7A 3T7JA 1RACA 3E3MA 4JBLA 2ZIGA 3B1WA 1WEHA 3CX8A 4X90A 1QBKC 4RESA 3GH3A 1Z0FA 2XD4A 1AS2A 1I1HA 1I5RA 3A2LA 3K53A 3P2IA 4DGSA 3BXHA 4QUGA 1FQKA 1Z6AA 1I2BA 3JQPA 4B8YA 4E15A 3HM9A 2CSUA 2JD0A 3ZR4B 2FE4A 1V9CA 1PFWA 4MS4A 5ALOA 1CFJA 3VPSA 4TTJA 4FGSA 3LRPA 13PKA 1GL9B 3E35A 2TMGA 4OL0A 3VOBA 3H17A 1ISJA 1KKUA 2YOHA 5GGXA 3KQUA 1SQ0A 3CS3A 1HG1A 1MMFB 1T3SA 5LKRA 2MOKA 1E7WA 5DTEA 5HPYB 2GZSA 2XUAA 4IO1A 1M8FA 4C7MA 5KTPA 2R00C 1KEKA 2J4DA 4QHSA 4RO0A 1FVXA 1I4OA 2FPLA 2IW3A 3T0FA 1DAGA 3V4RA 2J6CA 3JWJA 3LUJA 4LV8B 1G63A 2BHRA 2IUSA 3B6IA 2HJVA 4IJWA 1JR3A 2WJ4A 3VU9A 3OJXA 1HE4A 1C1YA 4HQRA 1JLRA 1N32B 3PJRA 5FNVF 4ND8A 2E49A 3GELA 3AB8A 4L85A 4JUDX 4JODA 1V5WA 4NWIA 3ADCA 3NI2A 3TXXA 1DXOA 1O54A 2O2YA 1SN7A 2JLCA 4Y6RA 3I52A 4H7PA 5AW3A 4RPLA 1ST3A 3DPUA 3SN6A 2HMSA 5CVEA 1CE8B 2CFOA 1ZMXA 3QH4A 4FFOA 1P1BA 2AX3A 1NW5A 1QONA 3T3HA 2C4VA 5BN1A 1NJ5A 4DBZA 3K35A 4TWIA 2O0MA 3EEQA 5AICA 3KKKA 2H2AA 3ZDDA 2R25B 4YJGB 2PK3A 5TGZA 1UBSB 1U04A 3BS4A 4MGHA 4TV9B 1ZN7A 1KZ9A 1XQXA 2E21A 1C3OA 1T3LA 5T6MA 1HRKA 1DJPA 1E3WA 2BFPA 3SZUA 4WJZA 2FQQA 4XDHA 4MVJD 1O6BA 1LXCA 1MTZA 1JQ3A 2ZB7A 4HOYA 3WK4A 4A8PA 3ORQA 4U2BA 2IE0A 3L41A 4BMCA 2W70A 4BATA 1C7QA 2FOXA 5DHPA 5SZKB 4RHTA 3KHSA 4QFCA 1KJJA 5ALFA 1Q1NA 1JR4A 5EUQB 1DUVG 2N1BA 2ZU6A 3LK6A 1TA4A 3B9QA 4OFWA 1VECA 5K03A 3CW2A 2QN1A 1WDKA 2HNKA 2XT9A 1EE9A 3SX4A 3O5AA 5C4GB 1Z0UA 2WFLB 3RADC 2EAUA 2OM6A 3EZYA 4G65A 3KQNA 1VKRA 4C4XA 5HQTA 1B14A 1PQYA 4WY5A 3T1OA 3JQ8A 3W3AA 4JDUA 4FGJA 4ID3A 3VKUA 4FHFA 3ZU5A 4AX8A 2OUIA 4PPFA 3K4HA 4MW0A 1KI4A 3PBKA 1QHHA 4MQ4A 5K3FA 4CF5A 3TMAA 5DCLA 1Y82A 4O4LA 4N40A 4N5IX 2V9CA 2AMYA 3DWGA 3T7AA 4NJMB 3F2IA 5B3JA 2DEUA 3E9DA 1KMIY 5FPQA 1XLVA 4IKEA 1G20B 1QOPB 1WMAA 3I04M 3W5JA 2AJBA 3MBKA 4JB2A 2J7PD 3RU3A 2O23A 3VPDA 5JYEA 1JR6A 1K88A 1Y5IA 4F12A 1S5PA 1XJCA 4OJTA 1GNRA 3LVBA 4ZOLB 1Z7EA 4WLVA 3UC9A 1RQ7A 3DFZA 4NH0A 2ACEA 3D0QA 3FBWA 3OX3A 5HE8A 2X4IA 3BH0A 3S7TA 4J49A 2YXDA 1DIAA 2O3JA 3UVEA 1EX1A 2Z95A 2GHQA 4DPMA 5FL7D 4V39A 4RTJA 3T34A 3AM4A 3T9EA 1T0JB 2G36A 4OQDA 4PSVA 1RKBA 4GI5A 2FRXA 3TTWA 2XE8A 3FUCA 4BN5A 4Z4CA 4HUTA 1HK7A 2P9JA 3K6KA 3L9XA 2FRDC 1VG9B 3BIFA 4MV7A 3WL8A 4B1FA 5K8VA 2Q4DA 1XX6A 5CDFA 1KI7A 5EHXA 1OROA 2W2NA 4KLNA 3K09C 1O0BA 3CN7A 4ZOBA 1SXJE 5KC8A 3I28A 3WYCA 1G59A 1M8PA 5FOXA 3GDFA 5H59A 2XX3A 3IV9A 1B42A 3NVAA 3ZWWA 3C4QA 4EG5A 3FMFA 1KJYA 2X6QA 1Y9DA 2O8EB 2DR3A 4NCAA 2PL1A 3PXBA 1M2VB 2ZI6A 3AI7A 1GNLA 4IQ0A 2P8JA 1QO0D 3THXA 1NM5A 3II6X 4IDHA 3NORA 4BO0A 2Z1NA 4X61A 1QZTA 3PGA1 1MJ5A 4IG9A 5LYJA 1T2FA 2QX6A 3SLKA 4PSDA 4YWHA 1W0JD 4LNUA 2VF7A 4OEHA 2MSDB 3C1UA 4JA2A 4MGKR 1IXZA 2HT6A 3L8CA 2WVAA 4DDVA 4CWAA 4WNIA 3LT5A 2WTAA 1VMEA 1SCUA 4MDYA 3CH7A 2Z4RA 1U9CA 1VKHA 3CQ9A 4X8HA 4F2WA 2CWDA 2W5UA 2N3ZA 3C98A 5LDHA 2D1RA 3G0CA 1LF0A 2JAOA 3EGXA 1QVZA 2FFQA 1JHOA 1Y9JA 2ZYRA 3H1AA 2XYHA 3HUTA 1E62A 4FSHA 3T3IA 4DIKA 4H7DA 1SGWA 3HHPA 2EWVA 4IAOA 2IHBA 3TSAA 1XJQA 4Q21A 5A5VA 1WV0A 2VJBA 4UTXA 3T99A 2Y1GA 1O8CA 5DNVA 1E0KA 2XXBA 2RHDA 2Q2VA 3HCNA 2I9PA 1I1OA 1U8ZA 3RRBA 2BMJA 1QYCA 2O0KA 4O08A 3VPBA 1WSDA 1Q7GA 2RBGA 2PKQP 1RNLA 1JIUA 4XVQA 1ONNA 4C0KA 3OTQA 4IJ6A 4J0DA 4ZOLF 4QU5A 5JAHA 1R15A 1NBIA 3LD9A 2JAUA 1VL6A 3N0XA 4LF9B 3OZDA 1PEDA 1RRPA 1ZIXA 5J4KA 2XUDA 5CJPA 4ACAA 2ZCJA 1JT9A 1C7EA 2ZYGA 5HGJA 1XTRA 5AXAA 5ICSA 5C51B 2PS1A 2JDID 3OQJA 1GJRA 3C5WP 1TD1A 4LXGA 5EZ6B 4TLAA 3H04A 5EXXA 4DMCA 1TT7A 5AKKA 1XDGA 3D4LA 5TS2A 2BFDA 5IM4F 4JNCA 3T95A 2Q8NA 5CBPB 2WB2A 3JD4A 1IHPA 4XJTA 4I6JA 2QORA 5FJIA 5HM8A 4C3VA 3MT9A 1S8OA 3OJWA 2WKSA 3R3YA 1C4KA 5A3VA 1DI0A 4KLAA 2P2NA 4XARA 4FTWA 5ALRA 2WE7A 4A0QA 2CKMA 1ANKA 1MX1A 4NU5A 4JLSA 4PZPA 3ONWA 3RVBA 2AV6A 2OD9A 1C3LA 2F17A 2QUHA 1C4XA 3KB1A 3QPVA 4IXDA 4UULA 4ZCSA 4LJ7A 3WMWA 3WLSA 1ILEA 1ZN2A 3AVYA 4MIEA 4D9BA 2XQFA 1EFVB 1QTRA 3IP8A 1BH6A 5JHGB 3IKTA 3R3UA 4RMIA 5FUYA 3KXKA 1P2FA 3L1UA 3PI7A 4H7EA 4C22A 2C9CA 1KKMA 4PQFA 4LHZA 2IYTA 4EPXA 5IFLA 3KVNA 1ZCZA 4YHHB 2F90A 2AUMA 1RP1A 3PNYA 3P9KA 1U3WA 2GN2A 3TZ6A 3KQKA 4KQ2A 2I91A 4ZQCB 4CKEB 4WLUA 3DEHA 1XAIA 1XD2A 3OWHA 3EH1A 1GAWA 1OIWA 1SOVA 4HSEA 1DAHA 5E6RA 1YJQA 5HIMA 2YBEA 1LW7A 2APJA 4OGKA 4QC2A 1SBNE 2JLXA 4PNPA 1DAIA 4Z9XA 5BRNA 3YASA 1D4FA 3HCCA 3ILVA 3ZLJA 4YXWD 1Q3TA 3QVTA 2CFCA 3FZYA 1R9GA 5EIWA 2FOLA 1EM8B 2X8BA 3IHKA 5AH0A 5DYIA 1SO8A 5EIFA 3A6HA 4LZZA 4ZU1X 5FA6A 4DRXB 5JO0A 2CZGA 4CM8A 1NWHA 1A69A 2BDTA 5DHQA 3PLAE 1E64A 3QJGA 4KN6A 3AHIA 2XIJA 1KORA 2PS9A 2QM0A 4RD4A 2B34A 5TGTA 3PD0A 4ZANA 1M1NB 1Z36A 2CEKA 1DKUA 6ABPA 4Z1OA 2CL0X 2H5LA 3NATA 1RWWA 2A14A 4W82A 1C29B 1FYVA 1PKEA 2QW0X 3NYQA 1CUHA 3FE2A 3BWXA 3LYLA 4BV9A 1E60A 1HEUA 3G1UA 1YDWA 2CDBA 3GLHB 2POCA 3OZ7A 3A14A 5MDHA 5KPJA 5F7ZA 4DR3B 2DHEA 3UOAB 4AL4A 2KYRA 1DUSA 1X1RA 5TARA 3WR5A 1MAHA 3ZHTA 5C8YA 4B46A 4DY6A 4QYWA 4KVFA 2WG1A 1OREA 3WP1B 4I2NA 1H05A 1NYLA 3N8HA 4AZTA 1A72A 1L6RA 2JFHA 4I8DA 5BP7A 2QTBA 4NKRA 1FMFA 1DZIA 1JJ7A 2FPGB 3DFKA 3OCZA 3SS8A 5AVRA 4FKBA 4O63O 5JNRA 4BB5A 2WIAA 2HOQA 4A6DA 4ALNA 1NXSA 1Z5PA 2H07A 3NBQA 4L9RA 3T9DA 1VE6A 3SC2B 4MAFA 3KV3O 4JXJA 3A1VA 4M1WA 4FFLA 3PL5A 3VRHA 4MLPA 4S1TA 1NRJB 1IN8A 4MV9A 3AKZA 2DKOA 1SU4A 3UUEA 3LHFA 4F93B 1JFVA 5D5QA 3ZWQA 2YXLA 3D2LA 1ZK4A 2F1KA 3HA3A 1YRHA 3WLEA 2PGNA 2ALJA 3I73A 1O4WA 2DTDA 3ETGA 4GZ5A 1XLTA 4OLJA 1FSZA 2DPMA 2W2PA 4NARA 3M33A 3I8SA 1QYRA 2P79A 2XE6A 4JP2A 3FROA 2I1WA 4CTJA 4KPYA 4COOA 1T9BA 1E9EA 5REQB 2WTBA 5EXTA 2EKPA 4IXMA 3SXJA 4TVKA 1IBRA 4HAVA 2AL7A 4YJ2B 3THWA 3DQPA 3ICOA 3BXEA 4NBUA 4WZAE 3WYNA 1OPRA 2Y67A 1XP8A 2XYGA 4FEEA 2ZAOA 4GT1A 1URPA 2YXPX 4KFTA 4PLCA 3FVTA 3IEVA 5IKPA 4Q34A 3LVQE 2VPYA 5KTKA 3H1FA 1I01A 2NZUG 1JDSA 1KAMA 3FMPB 4N4AA 4WAUA 4RZXA 5B6PA 3U16A 4N7JA 2J5RA 3FKSD 2ZAMA 4HZUB 3D7SA 5IAEA 5GV8A 2C4KA 1PS0A 4MTLA 1DFIA 4ENSA 1C0PA 2BEWB 2LKDA 4WLNA 2JLQA 3ZE9A 2VJMA 1T1JA 3O1HB 1FXSA 3A1TA 2EKQA 2DRIA 2HTEA 5F51A 3HFJA 2VH5R 3TRIA 1FTYA 1ACJA 2DVMA 4YAEA 3WXBA 1E6EA 4YFVA 5EP4A 2Z30A 1GRCA 2VZ0A 2ZJ3A 2OUKA 5LDDC 5F33A 1BJKA 3G2NA 1ULBA 1G2IA 4LCJA 1PLKA 2GEBA 4GVLA 1FUUA 2KS6A 5TPZA 2GVDC 2G1KA 1PG2A 4BXOB 4FNGA 2ISCA 4QUKA 4TKVB 3SDBA 3V2UA 4TTRA 4BQQA 5FR1A 4NL4H 1EWYA 2CVPA 3C41J 2ZRQA 2X0EA 1OTXA 1T4MA 2KI5A 3CRZA 2A9PA 4JI7B 1KI9A 1UIMA 4CODB 1ZUNB 2ECPA 3ZXUB 4FMPA 3SQLA 2AOTA 1X87A 4A16A 3NHRA 1E79A 2QL9A 1UQTA 2FEXA 2VDKB 3RJ5A 3EXFB 3KHKA 3Q5EA 4A0SA 3K0HA 4EA9A 2XOXA 2O5RA 1F48A 3AJEA 5LB4A 4BNIA 1AVTA 5C8DA 5K0ZA 2PWPA