4YK7A

Crystal structure of s-hydroxynitrile lyase from manihot esculenta (his103leu)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
MVTAHFVLIHTICHGAWIWHKLKPALERAGHKVTALDMAASGIDPRQIEQINSFDEYSEPLLTFLEKLPQGEKVIIVGESCAGLNIAIAADRYVDKIAAGVFLNSLLPDTVHSPSYTVEKLLESFPDWRDTEYFTFTNITGETITTMKLGFVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKIFLPDFQRWQIANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVADAYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (S)-hydroxynitrile lyase
publication title Crystal structure of S-hydroxynitrile lyase from Manihot esculenta (His103Leu)
rcsb
source organism Manihot esculenta
molecule tags Lyase
total genus 95
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yk7A00
3F9CA 3DNMA 5C81A 3OM8A 2Z3ZA 1ZD3A 1G5FA 3K6KA 3BF7A 3ILSA 2GBGA 1T2NA 1KU0A 1VXOA 1L7QA 1FFCA 1G42A 3WKAA 5H3HA 1UWCA 2VF2A 3FLEA 4U2GA 2XMBA 5E2IA 1WHTA 4H7FA 3DLTA 3FAKA 4ZXFA 2HA7A 5DNUA 4UUQA 3GELA 3WKEA 5AM4A 3RLIA 2JEZA 3GZJA 5C8XA 4KYVA 4Q3KA 3I28A 3NWOA 3I2HA 2VJBA 1VZ3A 3I2JA 2G5PA 1K63A 1LPMA 3R40A 3KXPA 4C6HA 2Z8XA 4BP8A 4AQDA 4INZA 4W1SA 2W22A 4BDSA 4DSZA 2QRUA 3IBTA 3ZLTA 2RHTA 1MNAA 3G8YA 5AI5A 5AM0A 3VVMA 3CXUA 1B41A 1QZ3A 4NVRA 1MAHA 2QM0A 4H77A 2CZQA 5LZ8A 1PV1A 1JKMA 3DJYA 5YASA 1BS9A 1MNQA 3UMJA 2ZJ7A 3BJRA 5DTJA 2RAUA 1LPBB 1OXMA 5FOQA 5K5EA 5LIPA 1EK1A 5AJHA 1F0NA 3O4JA 1QONA 4KRXA 3ZLUA 4AMYA 2WHRA 2PPLA 4CCYA 5D3KA 4H18A 4ZWNA 1XROA 3G0CA 4ZV9A 1ZOIA 4H7JA 2CJPA 3AILA 4PSCA 2XUIA 4TPKA 4CCYB 3D2AA 1W6RA 5LZ7A 4OYLA 2WU4A 3HRHA 5CTAA 4DMCA 3T4UA 1ZGCA 1CEXA 2Y2VA 3U1TA 4CG2A 2IX9A 4BAZA 4X97A 4J7AA 3QPAA 5EHQA 1AMNA 3F98A 1LBTA 4N5HX 4Q05A 3HLKA 2OGSA 4OSEA 2WIFA 5JADA 3WK6A 5EIEA 3PFCA 1XKLA 5JARA 3ZPXA 4QWWA 1GKKA 3STWA 1CUBA 1JFRA 4QWMA 1VLQA 2GZSA 3H18A 3WIOA 3B12A 1CUFA 3B5EA 4G8DA 1ZD4A 4EY4A 2XB6A 5DJ5A 5A7FA 2PSJA 4Y2SA 3VDXA 1U2EA 2PUHA 1CUEA 1DWOA 1GT6A 1HLGA 2YH2A 4C4YA 4KRYA 2JGJA 5A6VA 1G66A 1XFDA 3WA6A 1CUGA 5KBYA 5AKXA 2D0DA 1R3DA 2OGZA 3G02A 2XMQA 5AI8A 3H17A 4KE7A 2JEYA 3FNBA 4K6KA 3O0DA 4FOLA 2H7CA 1XLUA 4G5XA 2WJ6A 3V1NA 2OG1A 3H1AA 3R41A 5D6OA 5ALNA 5J3JA 5FRDA 1UK7A 1TAHA 1J06A 5AK4A 5FLKA 5EHNA 3A70A 2C0PA 1BN7A 3IUMA 1YR2A 4J0KA 1QIEA 1SOMA 1CUJA 4J0JA 1ZD5A 3G7NA 4FKBA 1K5PA 1CUDA 4FNGA 3LIPA 3H1BA 2HIHA 5CH8A 5HF6A 2BKLA 4EY5A 2QKYA 4P08A 3D59A 1HBJA 3G0DA 1VJ5A 5AP9A 2WM2A 5AKEA 3WWOA 5DWDA 4Y2JA 1DT5A 3ED1A 3PDCA 2VJCA 1QIJA 4W63A 5HCUA 1XQYA 3FLBA 1DQYA 3WKCA 2Z5GA 2YXPX 3PUHA 5EHXA 3L1JA 1A8QA 5AKHA 5ALIA 2BUAA 4XWGA 2OCGA 4P9NA 1SC9A 5K3EA 3DYIA 5LKRA 2G63A 1XLWA 1SCKA 1E8DA 1ISPA 2P8SA 3I2KA 1SCQA 2WKWA 3HXKA 3MUOA 1EA5A 1O6FA 2WG2A 1Y37A 4I3FA 3G0GA 4J0IA 4MEBA 3PE6A 3ZV7A 2PUJA 2PX6A 5AI6A 2QS9A 5A7HA 1Y7IA 5ALQA 4BAUA 1ZIYA 3VISA 2HFKA 4PSUA 4XIIA 1H23A 2OCLA 4BYMA 2I3DA 2XUKA 5CH3A 2PKYX 1USWA 4LKOA 3IDAA 5HKAA 4W1RA 1YSCA 3F67A 1UT6A 2XMZA 2HA2A 2JGIA 5CRIA 3HI4A 2XUGA 1FFDA 3X3HA 1KEZA 4Q34A 2I78A 2VA9A 1PFQA 3HABA 3O4HA 1BRTA 3WK4A 2HRRA 2OCIA 3H0CA 4J03A 1XZJA 2WFLA 4PNZA 4YK7A 1IUPA 5AO9A 2QJRA 1XZAA 4MQLA 1K4YA 4GLBA 4Y9SA 4OB6A 4OPMA 3D2BA 2WFLB 3CCCA 4L0CA 4CIAA 1R9NA 2WHPB 3BDVA 1ZJ4A 1EDEA 5DNVA 2XMRA 1BEZA 2WUGA 5JAHA 1QTIA 4PQEA 4C01A 2Z8ZA 5JASA 4DMHA 2C7BA 4HRXA 5DYTA 2XUJA 4Y2PA 4BTVA 4A16A 4B9EA 4AB1A 4WDRA 5AK6A 2ZJ6A 1YA8A 1GXSA 4DGQA 3V1KA 1ORVA 1QIMA 1TK3A 3ZLVA 1JMYA 4B0PA 2ZSIA 3I2FA 4GEGA 4X3CA 1A8SA 2V98A 5LZ4A 4G9GA 1DWQA 1P0QA 1P0MA 5K3DA 5HF5A 2WSLA 4DNPA 2WQZA 4Q82A 4OU4A 4HVTA 2V9ZA 5JZSA 4CFSA 2GBIA 4M0MA 3WK7A 5ALUA 1R1DA 1ZIXA 2HFJA 3BE8A 3FOBA 1CRLA 2OAEA 2H1IA 1XZBA 2WIJA 4HXEB 1XRMA 4BVJA 1MTZA 4N8EA 4DSAA 2AXEA 5EIAA 3HACA 5C7YA 2XUDA 4F60A 1DX6A 4B85A 4AO8A 1EVQA 1E5TA 5FDFA 3C6XA 1EHYA 2BFNA 1QIKA 3FVTA 5ALZA 2AJBA 3NUZA 3BIWA 3GROA 1EDDA 5IVIA 4EY6A 2ACKA 3KWFA 1U65A 4N8DA 4AXBA 5DYWA 4I19A 3WL5A 1PJAA 2WTMA 5ALSA 1Q0RA 1XRPA 3EBLA 1FFEA 4MJ3A 3BF8A 5IVDA 3N2ZB 1H22A 2XQGA 3SC2A 2O7VA 3WL7A 1H2YA 4UBMA 4EB0A 4K6GA 2QUAA 1CUIA 2CMFA 5ALEA 4C88A 3IUJA 2XUFA 4FLFA 2B61A 5A7GA 3L1HA 4X92A 4BTLA 4BC1A 4KE9A 1OILA 1VA5A 2W6CX 2GZRA 3WK5A 1OCEA 3R0VA 5DNWA 4FNMA 4LYDA 2Y1KA 3R3YA 3UUFA 4B81A 1UKBA 1XRQA 2DHCA 2ONCA 1NX9A 2C0QA 1FFBA 1P0IA 4X00A 4AMZA 3GA7A 3I6YA 2ACEA 4PSDA 3WIBA 5LZ9A 1IZ7A 1AUOA 3OURA 2H9YA 3C6YA 4AZ3A 1DU4A 4G4GA 1UOOA 4B83A 3OC0A 5AM5A 2ZJFA 2VSQA 2WU3A 1MX1A 3FCYA 4BATA 2VTVA 1R50A 4LYEA 3VJMA 5AKKA 2YASA 1XZDA 4CCWA 1MAAA 1IMJA 3A2LA 3F97A 3I2GA 3ESDA 4D9JA 3STTA 2O2HA 1ZI9A 5CXXA 2WHQA 1GPKA 2BGNA 4FLMA 4GWLA 3WYDA 3WYNA 1QLWA 3WZMA 1CUAA 2CEKA 3PI6A 1XZCA 3D3NA 2HA5A 4TVKA 5CT8A 1CV2A 5CT9A 4QEKA 1RP1A 2JF0A 3IULA 1XZKA 4FMPA 5CH5A 1CUWA 5FV4A 5ALHA 1EXWA 2PU7A 5LLSA 1MX9A 3TGLA 2D5LA 1QIIA 1XZIA 2PVSA 3KWJA 3MUNA 1ACLA 1W52X 4BAGA 2OLEA 1N1MA 3IIIA 4ZRDA 4LXHA 1HL7A 1CUHA 5AKZA 4UHEA 3W04A 3EIOA 2XI4A 1CUSA 2HL6A 3A2NA 3OOSA 3BJMA 4J0DA 4BC0A 1QO9A 1EH5A 3G9UA 4H7DA 3STXA 3CN9A 1BROA 1VKHA 1DINA 4CG1A 3W06A 3I6ZA 1H2ZA 4V2IA 1X2BA 3FSGA 4HZGA 1CLEA 4PO3X 4JYMA 4FHZA 4Q1VA 1CUCA 1U4NA 4DM7A 3S8YA 3SX4A 1J2EA 3D5EA 5AK3A 3FYTA 1E8MA 3TJMA 4Y2QA 3H19A 3AZQA 4ITVA 4AZ0A 1TIBA 1BN6A 2WIKA 3I1IA 5AKYA 1QJ4A 5HK8A 2HDWA 1YAHA 1TCCA 2OAGA 4GDMA 4EUSA 5JZ9A 5AOBA 4J0GA 4XVCA 1AX9A 4EBBA 1GPLA 5HKBA 5JATA 4GBGA 5JAOA 3PF8A 1F8UA 4HS9A 5KREA 4GXNA 2QXUA 4DNQA 2WIGA 5K3FA 1FFAA 3VJKA 2C5FA 2AJDA 4AO7A 1WPRA 1EI9A 2XMGA 4NS4A 2B20A 1LZKA 1ODTC 4QLAA 5HF9A 1AGYA 1LPNA 4E14A 1QIGA 1AC5A 4W9RA 4O08A 5K3FB 5K3AA 3V48A 2HA6A 5ALFA 1DQZA 5AOCA 1YASA 3R3ZA 2LIPA 2VQ6A 1QOZA 1J07A 5HK9A 1QE3A 2WJ3A 4BZZA 5C8VA 3AIKA 1Q0ZA 2AJLI 2QOEA 5I7UA 4CIBA 3KDAA 3S2ZA 3Q0TA 2HRQA 4HTAA 5ALMA 1YS1X 1VE6A 2QZPA 1GQRA 5KWIA 1GQSA 4AN1A 2PSDA 5D7BA 2QMQA 2O2GA 1YA4A 2ORYA 1E89A 4OB8A 1VOTA 4NMWA 2VEOA 4C89A 3QBJA 5T4BA 5CXUA 4QLOA 2DCMA 4LXIA 4WCVA 3WI7A 4J3JA 3F8SA 4DYHA 3E0XA 3SK0A 2OQVA 3LP5A 2R8BA 2WUDA 4I4CA 2XQFA 1EDBA 2H7XA 4B6GA 5IVKA 4H35A 3W9UA 3WJ2A 2HA4A 1BU8A 5ALYA 3N0TA 4BVLA 3OPMA 5ALXA 1JJBA 4G4JA 5E4TA 4LHEA 2OQIA 2BUBA 4GW3A 4BE9A 2RONA 3IURA 3K2IA 1CUVA 1TQHA 3DKKA 2HU5A 1IUNA 4H0CA 4UFOA 1ZGBA 3WL6A 5DLPA 2QJWA 2WG1A 6YASA 1ODSA 5HQ3A 3STYA 2DQZA 2QT9A 3M81A 4H7EA 5ALTA 3DEAA 1YS2X 5CT4A 3HYSA 3D0KA 2Y6UA 4Q3OA 4G8BA 3WMRA 2ECFA 2WTNA 5K3BA 1XZEA 1VXRA 3FBWA 2XDWA 5EIHA 2ROQA 5HQ3B 1TRHA 2JGEA 1DTEA 4MWTA 2X5XA 2QXTA 1QFMA 2JGLA 3KOOA 4EY7A 2J4CA 2XUHA 3QYJA 2WUEA 1EVEA 5ALGA 3HZOA 5K3CA 3G9XA 4WDQA 1VZ2A 4KAAA 1THGA 1UFOA 3O9MA 5JAUA 2WUFA 5I8PA 1SFRA 2QR5A 3FYUA 2HM7A 3HJUA 3LIIA 4KEAA 3WWPA 2VAVA 4FFVA 1W76A 1Z68A 2Z3WA 3ESBA 3AUKA 1JJIA 2PU5A 4DIUA 4ZV7A 1R88A 4QNNA 4JNCA 1THTA 1F6WA 3WKDA 4B80A 3E4DA 1QTRA 2IITA 4DNFA 1EK2A 4UBKA 4IH1A 3U0VA 4B84A 4FWBA 1LPAB 1ETHA 1VA4A 3C87A 3ZWQA 5DTIA 4X6XA 3WWCA 4FBMA 2XUPA 1CIJA 1GZ7A 1UK8A 1IUOA 4DTCA 2VAXA 1Y7HA 3P2MA 2JIDA 1BCRA 1R4ZA 1UKAA 5HFNA 4KAJA 5A71A 4A5SA 1WB4A 3QMVA 3AJAA 4RPCA 3LLCA 3O95A 4B0OA 5BWCA 1H2XA 4QE3A 4OB7A 2Y2UA 3HC7A 3IUNA 4JEIA 5ALJA 3K9BA 1NU8A 1CFJA 4YX9A 3I6MA 1XZLA 1UK6A 2HADA 5ALKA 3QPCA 4XJVA 3RK4A 2XMCA 2E3JA 1AURA 3DL7A 2XLCA 4XX1A 5AICA 2XMSA 2AJCA 2GYUA 2PSEA 4Y2UA 3WA7A 2PSFA 1BCSA 3QH4A 3DD5A 2Q0XA 2GBFA 3AIMA 1P0PA 1XZMA 1XKTA 2V97A 4Y2RA 4MQMA 1XZFA 4DLNA 1A7UA 2HHAA 2XMDA 5AM3A 2JGFA 2RIPA 2O2IA 2RI6A 1M33A 2FJ0A 5FKJA 1EX9A 3YASA 1ZJ5A 4UFPA 4Y2XA 1G4HA 1MO2A 3WWEA 1WB5A 1XQXA 4GI1A 5HZGA 1KU6A 4RGYA 5FPPA 4E11A 4QDUA 5A62A 2XQIA 4UBNA 2QTBA 1JMKC 1HDEA 2BCEA 2PL5A 4UHDA 3G0BA 4DNOA 4P93A 4E46A 3DDUA 1ODCA 3KD2A 1L7AA 3Q8WA 1YB6A 4ZGBA 3BL8A 4OYYA 5IH7A 5AIBA 4K2AA 2NW6A 2FUKA 3L1IA 4W1QA 3WJ1A 2XUAA 2ZYRA 4HXGA 1XRLA 5A2GA 5EFZA 1MX5A 3QZUA 2RGUA 3W05A 3C8DA 4KE6A 5CT5A 1ZI8A 1MPXA 2VT6A 5LKAA 2I03A 3CN7A 5AKLA 4G8CA 4BBZA 3I2IA 5JANA 1TCAA 4KR0A 4BB0A 1SCIA 4WJLA 4HAIA 5C8ZA 3IVMA 3QITA 5DYYA 1E66A 4ARBA 5CW2A 5FXMA 2PBLA 4BZWA 4X6UA 4H7KA 4DMKA 3C45A 4Y2YA 2XT0A 4U2EA 5D3ZA 4TGLA 4ARAA 7YASA 2DHDA 5T4EA 1JI3A 3DYVA 4M0EA 5JALA 5AKJA 2VATA 5T4HA 1E8NA 3PF9A 2DR0A 4OD0A 1K6EA 2XE4A 1N5MA 2HA0A 2PM8A 1YCDA 5T4FA 2IIVA 4U2BA 4PW0A 1J1IA 5AOAA 4J0CA 1ORWA 1QFSA 3JWEA 2WIDA 3D7RA 2FX5A 4QDZA 3WZLA 2ES4A 1B6GA 2QUBA 4WY8A 3G9ZA 2V96A 4QDOA 1DT3A 3E3AA 4OUKX 5SYMA 1CVLA 1O6GA 3FWHA 3IUQA 1UKCA 3DOHA 1FJ2A 1A8UA 1EB8A 2WFZA 4HRYA 4Z49A 5AKIA 2WJ4A 3ICVA 3D2CA 2C58A 2DFPA 3G0IA 4L9AA 1QIHA 4FTWA 3BWXA 2FJPA 1MJ5A 4PF1A 4X94A 1Q83A 4U2CA 1LZLA 3WLAA 4BVKA 4RE6A 4CI9A 1JT2A 4GHWA 1L7RA 2BAGA 4FFWA 5AM2A 4EHBA 4WFJA 1WPXA 1TKRA 5JZBA 3A2MA 1K8QA 4IHAA 2CBGA 4KAFA 4E15A 4GECA 2XLBA 2B9VA 3QMWA 5LYYA 2OCKA 3GBSA 5SYNA 3STVA 2CUTA 3HSSA 2HU7A 1AZWA 3EF3A 2BGRA 5JD5A 4P92A 3T52A 1AKNA 3LCRA 2K2QB 3VJLA 2QVBA 2J3QA 1WCYA 4AO6A 4B7ZA 3G9TA 4EA6A 4K5QA 3PICA 1HQDA 5ESRA 1LPOA 1ZI6A 4JH0A 4UBIA 1WB6A 1R9MA 3GFFA 4BE4A 1I6WA 3WQHA 2O7RA 4UBJA 2HU8A 2ZVDA 3C5VA 4KACA 3H2HA 4YPVA 4UHCA 1DX4A 2WFMA 3H2JA 4BP9A 3KSRA 4OCZA 4QDXA 3UUEA 4YASA 3NOXA 1GKLA 1H2WA 4FLEA 5AI4A 2ZYHA 4F21A 1GGVA 1GPNA 3RM3A 4EY8A 5BOVA 3EQ7A 1T4MA 5LZ5A 5CBKA 5CURA 4H7IA 3FCXA 1YB7A 1UOQA 1EINA 3C8HA 3DKRA 5HFAA 2JBWA 5ALPA 2GYVA 3VKFA 1XLVA 3H04A 2EDCA 5JD6A 4Y7DA 1UK9A 3WK8A 3M83A 4ZREA 3H2GA 2XUOA 1CUYA 3QM1A 5IKXA 2H7YA 2X8BA 3WL8A 3AZPA 3QPDA 3RARA 4X71A 4MXDA 3SWWA 5CMLA 1WM1A 4IO0A 3R3UA 2J4FA 3C5WP 3A6ZA 4BDTA 2EDAA 1WHSA 3ICWA 4RNCA 5IVHA 2XQKA 1X70A 4PV7A 5I9IA 3D4LA 1JJFA 2YYSA 3MGAA 1C4XA 4N8SA 4C87A 3LS2A 3EQ9A 3WWDA 1W4LA 3DCNA 4FBLA 3JW8A 3QMMA 3H2IA 5AHXA 5ALOA 3DQZA 2JGMA 2VJAA 5E4YA 5EHZA 2C5GA 1QIFA 4N5IX 4K6HA 4BCCA 2B4KA 1N8SA 3STUA 2WG0A 1JU3A 2ZYSA 5ALDA 1S8OA 4X7BA 4X91A 1LGYA 3V9AA 2CB9A 5AI0A 2AJ8A 3MVEA 4UFNA 4X85A 4IQ4A 4BCDA 2OXEA 2ZYIA 3VXKA 2WILA 4M0FA 1Q84A 3FSGD 4L72A 1QO7A 4S0XA 3R3VA 3R3XA 2DQYA 5BWBA 3M82A 3C6BA 3W2TA 3ANTA 5AK5A 4B9AA 1CUXA 4DMFA 1CUZA 1WOMA 1HPLA 3IB3A 1AQLA 5F4ZA 3PUIA 2VT7A 4UHBA 1ACJA 5ALWA 3O4IA 4UBOA 1ZICA 2CKMA 3O4GA 3C6ZA 4C4XA 5JAPA 4ETWA 1XZGA 5AKGA 5E4JA 3VVLA 5FP0A 3FVRA 4ROTA 4KJXA 1FSSA 3R3WA 1LLFA 5EI5A 1LPSA 3EQ8A 3FLAA 5FPQA 5JD4A 4MEAA 1CR6A 4JUIA 4WFKA 2OGTA 3V1MA 4L3WA 3WKBA 4RE5A 5CT6A 1MT3A 3GUUA 5ALVA 2DSNA 2GYWA 5KWJA 3AFIA 2HA3A 1MN6A 3FYUB 2GBCA 1XRRA 3F96A 4UHHA 5FUMA 2VJDA 1EB9A 2WHPA 4Y2VA 3BXPA 3H2KA 4BRSA 1UXOA 4WY5A 3I1YA 1TCBA 1HKHA 3C70A 1UOPA 3RKSA 1YAJA 1C7JA 1BEEA 5BV7A 4AN0A 4MYDA 1DWPA 5AI9A 2DHEA 3BDIA 3TEJA 4JYPA 1CQWA 3NGMA 4MWSA 1BE0A 2J3DA 4G9EA 1ZD2P 2C4HA 5LZ2A 1LPPA 5LP1A 2G5TA 1VE7A 1QIDA 1E3QA 3JYHA 4LIPD 4X6YA 4G1FA 3V1LA 3WK9A 2X76A 3W9BA 3DOIA 1IZ8A 1C7IA 1D07A 3TRDA 1CPYA 3DL4A 5AIAA 3O9VA 2XQJA 1W75A 1XZHA 1CUUA 4EZIA 4X90A 5HF8A 1CQZA 3QVMA 4W1PA 4WFIA 1X2EA 5AM1A 4U2DA 4KE8A 4ZI5A 3BIXA 2I3ZA 3M3DA 4H7HA 3E1GA 4AX4A 2WLSA 1JU4A 1F0PA 5JIBA 1N5RA 4IH4A 1LBSA 4Y2TA 4F0JA 2OPHA 4X93A 4U2FA 4MYSA 4OU5A 5ISMA 4IH9A 4QDTA 4LXGA 3DS8A 2BUCA 1XRNA 4UBLA 4BRZA 3PFBA 3B3QA 1XQVA 3C43A 1RYYA 2Y6VA 4C4ZA 5ALLA 4BCBA 3AIOA 1U8EA 1NU6A 4A23A 5ALRA 3IA2A 4UHFA 4B82A 1MU0A 2XUQA 1RWQA 3ZI7A 4QA9A 2EEPA 1UZAA 4NZZA 5JYCA 2R11A 3OG9A 1LNSA 2UZ0A 1W1IA 2JGKA 2RHWA 1QGED 3ESCA 4UPDA 4Q3LA 1A88A 2BJHA 4FDMA 4CG3A 1XQWA 3FYUC 4G4IA 4F5ZA 4QZVA 3CCBA 3AZOA 5EGNA 3HEAA 3ESAA 5AH0A 3OTQA 3AINA 1IVYA 4X95A 4J0HA 3ANSA 4HXFB 2G4LA 2ZSHA 2PSHA
chains in the Genus database with same CATH superfamily
5GGYA 2VHZA 3N59A 1YV9A 4DDUA 1V16A 1VJDA 2H1CA 2CXTA 3KVNA 1TZCA 4LJ7A 3CH5A 3PC8A 2YFQA 1GAJA 5KYYB 2GBGA 2VSOA 3KKMA 5DDIP 1KU0A 3ZVNA 3O38A 3DEFA 1D7AA 3PSAA 1H6AA 2ZW9A 3JQ6A 3HU1A 4HEQA 5H3HA 4EPRA 4KXMA 2H5EA 5F33A 4M98A 4U2GA 4CV0A 2XMBA 3OEYA 3X2SA 2C2MA 3RHSA 3QMPA 3CEJA 3M6AA 1WHTA 2QMOA 5E2IA 1V5IA 3H1FA 3ND5A 4TWZA 4GMDA 4P3XA 3TNFA 4QKQA 4J7CA 3OE4A 1OUMA 4ZOBA 5IEBA 1FW6A 3FZNA 3X0DA 3BAFA 1RXIA 3EVDA 4H1UA 1Q0HA 1R4NB 1DFIA 1OBHA 4I6GA 1QRUA 1TYZA 5DKFA 5DHSA 4WKBA 3H05A 4QX6A 2EG5A 4ZAWA 3IBSA 4RJIA 3AUTA 3S1AB 4CQMD 1L6IA 2JVIA 2O07A 2D06A 1BHQ1 4FEGA 1I0IA 2AX4A 5AM4A 3RLIA 5AJZA 5BPHA 4GQAA 4O4LA 4B3IA 1E2QA 1NW5A 4YRFA 4XVUA 2C4MA 5BQ5A 1WUJS 4WKOA 3AL3A 3C85A 1FP6A 4NCJA 5CDUA 2BGGA 4AYXA 1EESA 4JBGA 3GXBA 3LKVA 4DRXB 1CJTC 4URWR 4ZVKA 3NWOA 2QV0A 1MZVA 3IQHX 4KGZA 5F2KA 2RHMA 4MB0A 4P35A 2A94A 1XHLA 2GJKA 1V1MB 2BKVA 4I55A 4CKEB 1VJ0A 5FPYA 4HQKA 4HB0A 4G89A 1IY8A 3PEUA 3JAMA 2IZ5A 3GNQA 4BP8A 2HLDA 4HNSA 1ULZA 4DV3B 1E6LA 4HBGA 2QRLA 3T7SA 3LYLA 3GBVA 3PUYA 4KLNA 2JFGA 3KXLA 1EFLA 5JCPA 1MNAA 4C0KA 5HX7A 4LF4B 3IUPA 3TTUA 4R2WA 3U40A 3R4VA 2ZBVA 4CLRB 5G41A 4OA8A 1QF9A 3WQBA 4II2A 4AJLA 2LCQA 3U7GA 2C4WA 1G3IA 4LN1A 1MOQA 2XZTA 3ILVA 3KBBA 3CXUA 1JEJA 3FRJA 5ABPA 1QZ3A 3BGWA 4NVRA 1Q1ZA 4XWAA 5P21A 1MAHA 4OAQA 4EM6A 4NCBA 1JBKA 2DKFA 4GSLA 3TAUA 1UZUA 2XGJA 3DMRA 2DWUA 5C18A 1E0JA 3B53X 2OV6A 4GSKA 1Y8CA 5ECYA 3PWSA 4KQWA 1PS8A 1GAWA 1SCDA 5HQJA 3TXYA 2BI7A 1SHUX 5DM2A 2D3TA 3AY0A 3R74A 1CQIB 5KYTA 3T3GA 1ZPDA 2QJFA 2QY9A 5G1OA 1LBHA 1ACMA 4MUFA 1FJXA 1FUIA 2XNDD 2OYSA 3LUDA 1Z82A 2VTEA 2WJYA 3W2EA 1W48A 2RGRA 2XQVA 3CFYA 4IVRA 3P4YA 5D7NA 5ER9A 2HLPA 4YC7A 4MGEA 3T5TA 4H3SA 1W96A 5JAIA 2I29A 4OTZA 2DR3A 4RHFA 3ZDZB 4D4JA 1VYUA 3U7RA 5FCDA 3K8YA 2R8EA 3ZGXA 5BN4B 4CLOB 1ABBA 2BM8A 2ZVQX 2HWWA 4FQ8A 5JE8A 3N2EA 1QONA 2RB5A 4XGQA 1VRVA 2QYOA 1U5BA 1KJZA 2OZVA 2GLUA 2DRIA 4MJXA 4OSPA 1JZTA 3L6UA 2NQTA 2WZCA 5L3VA 1RYNA 4X44A 3DM9B 4CTOA 1WZCA 4UM9B 1JVNA 2RHBA 3R5JA 2XDQA 2JRLA 3RQIA 2VO1A 4X84A 2NO6A 1UXKA 5TPZA 4MKIA 3EGDA 2X8AA 1YZHA 3KAJA 2HLHA 5BVHB 1GLGA 4RSRA 121PA 2JFPA 4IAOA 1RI4A 2R1ZA 4L5IA 5JHGB 5GIPE 3BD6A 4OQQA 1M2NA 1VKRA 1JMVA 4UCXA 4OYLA 3KTFA 4M7PA 1IH8A 4MQ5A 5EINA 1T3HA 4JQYA 4M1KA 4GUDA 1ZGCA 2CV0A 2Y2VA 5AVKA 2ZYAA 3DOUA 1UUFA 2VQFB 2OHFA 5IMSA 1P81A 1Q19A 4H3KB 1E2EA 1PRYA 1JFFA 1IYZA 1QO0A 1GZ4A 3QA9A 4NPHA 4RUKA 3WRYA 1I4DD 2HRZA 1AMNA 2HNAA 3EA4A 3CUYA 3RABA 3QENA 2HF7A 4N5HX 5BSUA 4IQ0A 1U02A 2FPMA 5F64A 5L7TA 5G1NA 1SUAA 4GZ5A 4KZPA 2OKCA 1Q1NA 4B3SB 2N3ZA 1TEHA 1JIIA 2OGSA 5JADA 5EKTA 5EIEA 1IPFA 3RU2A 3L93A 3PFCA 1XKLA 1JHYA 2IXAA 1E2PA 4FEEA 3H6KA 1T36A 3L7KA 4BYGA 4NARA 3MMXA 3QBVA 3CNOA 4QWWA 3OF3A 5JZOA 1DGQA 1JS1X 4ER7A 1U2GA 2IHKA 3N39C 1SELA 1B42A 2HMVA 3LOPA 1CUBA 1R0SA 1YCHA 1XA0A 3ZGLA 4I5DA 3SNHA 1ORDA 1NYLA 1QLHA 1NULA 3LK6A 5KSZA 2JRCA 3ETCA 2V59A 1VLQA 1VMDA 2BMEA 4GRDA 4QWMA 3AU8A 2PQ6A 3H18A 5AHRA 3WIOA 4BNWA 1ZUNA 3BWVA 5MFZA 1K98A 1P7ZA 1R16A 1T91A 3DAHA 2DYKA 3QG5A 4EY4A 2BKUA 1JHQA 1W87A 1ZD4A 2A78A 3C5CA 4G2NA 4ZPXA 1Q20A 5KOYA 1QG0A 1TKBA 2HN9A 2XB6A 3I5UA 4HSEA 1KH1A 4JXKA 3ZS8A 1I33A 2QF7A 5KAMA 4TWBA 3BGOS 1XQ9A 3EXFA 3SLRA 2J41A 5KNCA 3K71B 2PUHA 3B6MA 4YRMA 1AJEA 3TZEA 1XL0A 3CKLA 1RPTA 2ILTA 3L84A 5CB4F 4FVTA 1P1CA 3K6SB 1HLGA 2XJ9A 4WKNA 3GRYA 3CG0A 1T0UA 2ZRNA 1G20B 2G80A 1AVTA 3ASZA 2Q2OA 3NHZA 3NX4A 5KCMA 4C4YA 1IQPA 3E7WA 3IUSA 3O3NB 4QYTA 2XTNA 3U17A 3UWKA 1S2IA 5A6VA 2ZCVA 4ND2A 4IYRA 1Z08A 2V7TA 2YWGA 1RU3A 4UU7A 2IYOA 2I4LA 1X9HA 5MGBA 3JAWB 2D0DA 4TQAA 2ECOA 3OX1A 1WD7A 2PGIA 3A26A 4YJ3F 2AUMA 3NTLA 3ZWOA 2XMQA 2OZKA 1QCCA 2JFFA 3H17A 2RK3A 3FNBA 3VSEA 3JQAD 3IMEA 3VR4A 4DBVO 1DS6A 4FPXA 4XIGS 4ZVTA 1L8OA 3O8DA 5CEEA 2C77A 1XI2A 3KT8A 3O0DA 5KNLA 2H7CA 2AV6A 3JQ9C 5AVQA 4M99A 4ZZ1A 1NDHA 1OX5A 1SMKA 2O20A 4YP6A 4BNUA 5ENZA 5KNCH 5FO1A 2BR5A 2G17A 2OXRA 3GOQA 3IAXA 1PL7A 4U4AA 2H1FA 2W9XA 3U3DA 2VPWA 4K9OA 7MDHA 3ROQA 5J3JA 1G9XA 1G5HA 4P58A 4RAQA 4DADA 4FYXA 2C7VA 3B1VA 4RA6B 3EGCA 1A3CA 2GK4A 3WV4A 4DQVA 3C7DB 4LOAA 1MDBA 5A4KA 1BYUA 5AK4A 1PHRA 2BN4A 1GCAA 2HSWA 3OX2A 2FSUA 2OUIA 4I2VA 1AGRA 5FLKA 2P3QA 1SVWA 2ZBRA 4MULA 3A70A 4JJAA 1QS0B 3ZHCA 2R1TB 5ECWA 2QX6A 3CRNA 4J0KA 3VR4H 4FNOA 5IAAA 2HGSA 3JD1A 4J94A 4OO3A 3L4EA 3WS7A 1O97C 4QPJC 1NX6A 3OIVA 3HCEA 3PHCA 4YS6A 1N34B 1X3LA 3QX9A 4FKBA 1K5PA 2BF7A 3EMDA 3SD7A 3LIPA 3RV3A 4UE2A 4P3KA 1UAAA 3N87A 1M0SA 2J31A 1BDIA 3DE5X 4IV8A 1GL6A 2VHXA 1GAQA 3DDHA 4UE3S 4Z0HO 2DUMA 4GT1A 4LCEA 5HF6A 2VRWA 1EP3B 1PWEA 4KC0A 1GDHA 3SDZA 2H2AA 3EMBA 1ECPA 3VYVA 5JD3A 4NV1A 4NBUA 3QKSB 1C81A 4N6GA 5FBLB 4BLTA 1BWSA 1FSGA 1HBJA 2PT7A 5LP6F 4RACA 5JYDA 4B45A 4D45A 1D7OA 3L8CA 1QMPA 3FCOA 1VJ5A 1Q0QA 4QEZA 2JS7A 5E8JA 1NY5A 1SXJA 2OFPA 3LKDA 2Q2NA 3G89A 4LJ5A 1ZCZA 5F7JA 5AP9A 1WDTA 5AKEA 4YN3A 5JDCA 2H48A 3TPZA 2DAPA 1M7HA 2CF6A 3ACCA 2YQZA 5DWDA 2BGUA 3ED1A 4HXYA 3PDCA 2OZPA 2QEQA 4FFPA 4UZSA 5DI9A 2NPFA 4PX5A 2CNWD 4BPBA 2Z4TA 1OIWA 1NN3A 2C5BA 3IKJA 1HT2E 4W6QA 3CXRA 4K86A 4W63A 5GV7A 3ZJ4A 1BVHA 5KTRA 2PYZA 1U0LA 3AG5A 1G2QA 1C0EA 1EVKA 2O3JA 4GR5A 4AKEA 4HMQA 3P32A 3KPYA 3BTUA 1Z0DA 1G1MA 4YP9A 1W88A 1OJ7A 2WUWE 3LDHA 2HNKA 1NR7A 2O06A 2YXPX 4TL8A 3BGIA 3ANMA 4KYTA 2HCTA 5L4LA 2CF5A 4ZDKA 1LF5A 1ZBDA 1ZJJA 4MKZA 4NF2A 5KC9A 3IE2A 2VWPA 3DNFA 5JSHA 2BF4A 4MDHA 1Z0KA 4GKKB 4BB9A 1SC9A 4AUMA 2JLUA 2B4YA 2HR1A 2W8ZA 5LKRA 2HWXA 2H0RA 4GR9A 3ZE7A 1KS2A 1V8FA 1XLWA 2POQX 1SCKA 4G07A 2OOSA 1QF7A 1GR1A 4BLVA 2OLJA 2LGJA 3UMVA 1SOUA 1LDYA 2AF3C 1J2UA 4WBSA 5BV1A 3RVQA 5A6SA 3WL4A 2BSQA 3PBKA 1ZL2A 3TECE 3PV0A 1F60A 2N42A 2P8SA 3I2KA 1CZNA 2BIFA 3AMVA 3JZMA 4J43A 3TK1A 3UMSA 5IM4F 2DJIA 3KPJA 3TBHA 1B8VA 3OZIA 2NQ2C 3WL8A 4LMPA 1GVHA 3HXKA 3AETB 1XJ0A 1D3AA 3P27A 1T9BA 2OCBA 3DAFA 4N47A 1EA5A 1A9XA 5FX2A 4EELA 3QXJA 4RHTA 3W5DA 4A1FA 2EZ4A 1P4AA 2GEDA 2YMQA 3WGJA 1OI7A 1MQ9A 5DRTA 4FHDA 5LR6A 3ENNA 2X77A 4J0IA 1JQJC 1I3OA 2OD7A 4MEBA 2FDXA 3I62A 4YT5A 5E1BA 1TF7A 2F2TA 1PQPA 4US1R 3WLHA 5E2AA 4D2IA 4I1SA 2R7NA 1AKWA 2CL6X 3H4VA 3Q6NA 4B3JA 5E7QA 2W70A 3TCXB 1Y7IA 3TXXA 3C15C 5ALQA 1P33A 1CETA 1U11A 1ZIYA 1F9EA 3I3SR 2Z3VA 4KDFA 4OQYA 3T4PA 4AYWA 2UYCA 1H23A 2OCLA 1CQJB 2RKBA 10MHA 1TCVA 2XUKA 5LYJF 3C5HA 4LKOA 1W1WA 2OZEA 3EZ2A 4NU0A 2YDYA 3RJ5A 3SSNA 2C2GA 2NPIA 3FB4A 4NZMA 4Q7MB 1II8A 2QL7A 1JSCA 2HA2A 2ZAMA 4QELA 3RUPA 3ONNA 2B25A 2XR1A 4F9GA 4TYYA 1CEEA 4URHA 2AFIA 3HCAA 1JKIA 3X1YA 2IF2A 1GCUA 1K5HA 1S96A 5EJ6A 2P6RA 1ZH8A 3HKCB 3GLHE 1J0BA 2P9TA 5JU6A 4Q34A 4AWBA 4DXAA 4F4IA 2ID4A 4NDAA 5E4FA 2I78A 5JLAA 5BV8A 1PFQA 3FSJX 4GQIA 5JXJA 1TJYA 5LP6C 3O4HA 3OQOA 4MVJI 1O5TA 4XLZA 3WK4A 4CIYA 3EVFA 4J03A 1T4DA 3UBTA 2WFLA 4LISA 1LCIA 3BXOA 4YJ2A 1R18A 4B6OA 8ATCA 4GZ3A 1XU4A 3HZRA 1XTVA 4I1OA 4WK6A 3WISA 3WWYA 1YF3A 2FPOA 1MH1A 3M5WA 4LC0A 3EX7C 3TZBA 3R75A 2FLKA 4OLJA 3F5SA 1I4OA 3ONVA 4UD6A 3R7DA 4LAFA 3H3XA 1WU7A 3BH7A 5F7ZA 3S2IA 1C0LA 4OPMA 4MRRA 4OK6A 4WBNF 5KIAA 2OEPA 3RT9A 3ZDDA 5JAMA 3HVKA 5IYZB 1X1SA 2BEUA 3AHHA 4BUJA 2VL7A 4RXUA 3T3EA 3TAHA 3TWOA 1N7HA 2MINA 4Z4GA 4CIAA 4HKTA 1VL6A 2WHPB 4JJ4A 1IPEA 1IZ0A 2JHPA 1T4CB 3BDVA 2PL9A 3FNFA 5C4GB 3BL6A 1EDEA 1W8IA 1QP8A 4JB3A 4TKVA 2XWQA 3U4DA 3ZWBA 1BXGB 1COWA 2DBVO 2H85A 2QGNA 1SVIA 3PQ8A 3UJBA 3OBIA 2X9NA 2RH5A 4IUCS 2WUGA 2BJVA 5JAHA 4AP6A 4EG6A 2PFSA 3H4MA 3GYGA 1F2UA 1Q91A 2OXFA 4IXNA 4EHLA 4DMHA 1OLXB 2C7BA 1B3BA 2JBAA 3O1HB 4GX1A 4RVFA 2ECKA 4O2BF 4WK4B 5EZ5A 5JCOA 4BTVA 1J8VA 1KETA 1P5HA 1TA9A 2KI5A 2L19A 3KAPA 4A16A 4D8XA 5MN6A 1X7DA 2ODPA 1KZHA 5EJMA 3LRPA 3GOHA 2YWCA 1FVXA 1T4GA 1XXHB 3OUTA 7REQA 3ZXXA 1E6MA 3R6GA 3TR6A 4A26A 1WLSA 3I73A 2FPGA 1T9AA 2P9ZA 3SEQA 1AA6A 1QIMA 3HXOA 2A3RA 2Q6TA 2B2CA 2Q3EA 3GFTA 3M1AA 1VPLA 1BXRA 3PUZA 4D79A 5LQRA 3ZHXA 1QRSA 4DEVA 1TEXA 3BFKA 4YDQA 4LRTB 1GFIA 1A4UA 2OC4A 4O2AF 1HY3A 3GJYA 1XYVA 3IPYA 1A8SA 2LRHA 4D44A 4F7WA 4F04A 2R1UA 4DR4B 3EFHA 3WX0A 4ZEVA 5LZ4A 4AJHA 1AQUA 4G9GA 1P0MA 3TLGA 4LXQA 1ND5A 2XADA 4O2LA 3QUCA 2WSLA 1K9SA 3RRYA 4WAUA 1QSGA 1DFHA 1AQIA 2A35A 4ND7A 1KQNA 3JD3A 1IQRA 3OLZA 1FE8A 1EFRA 1GO2A 1E0KA 1ST3A 2VJOA 4HJRA 4DMRA 3T5AA 1X87A 5GM1A 3WB9A 4BNXA 5LB2A 3QHAA 3RYFA 2GBIA 1KF0A 4H60A 2ENUA 1YTLA 3CE9A 4M0MA 4U7JA 3DKPA 5AHWA 4BRWA 4CM7A 1TA0A 4UVGA 1SQ6A 3CVUA 2EV9A 3OWHA 5K4HA 1KHTA 1PT5A 2I9PA 2RGAA 2Q5IA 5IUKC 5E6UB 3TMKA 3ZQUA 5JQGF 3E5MA 5JS6A 1ZIXA 3CEAA 3EPJA 2BMAA 1TGYA 2ZWVA 1E1LA 2O1SA 4F9EA 1RAEA 5HJ7A 1DKLA 3NLLA 5JJKA 1L5SA 1G1AA 1XZBA 2FLWA 1OH8A 1NAHA 3U7HB 5FL7D 3E23A 2PV7A 4JK3A 4E33A 4E70A 2IHJA 3ABIA 3FI9A 4R2JA 4Q4DA 1P2BA 1X15A 5HR5A 4NICA 5J2TF 1DQNA 1QAMA 2PQ0A 2HK8A 1T8PA 2FZ4A 3V1YA 4NR0A 4QRHA 1NBWB 2Q5JA 1E9DA 1NKVA 4Q1FA 1O54A 2AXEA 5F5NA 4DA4A 3SVTA 4PU0A 5DEOA 3PR1A 1J39A 2AEMA 3NYRA 5EWMB 3A32A 5C7YA 4OMUA 5DTRA 3R5XA 4C21A 1ZRHA 1ZMOA 3IDOA 2AQHA 2UXBB 4WNIA 3COJA 3OFVA 3RODA 2XCUA 3B9PA 3HTXA 4ZQFA 1URPA 1VIVA 4MVJE 2X2OA 3TTYA 1E1KA 2B0CA 2V4UA 5EYPA 1XD9A 1EHYA 5AYVA 2ARKA 3V6MA 4QLBA 1QIKA 2Q5LA 3G68A 1G16A 2IU3A 1FQWA 3A4VA 3CM0A 4FYKA 4ZDJA 2AJBA 1E18A 5DVZA 3MGCA 4OXIA 1H4TA 2FZKA 1FYEA 4RMHA 5FNVB 3UV7A 4FB4A 4JC8A 1FX0B 5A5EA 4CL8A 1PDWA 3BIJA 4QPZA 3CWZA 3VR2D 2P69A 3NV7A 3OQBA 3VKGA 5IVIA 4KBYA 2G36A 4Y98A 2ACKA 4REMA 4PYMA 1YS4A 2Q6KA 3AF0A 4R98A 2HMUA 3LQ1A 1XJWA 2X8WA 5EUQB 1U65A 4ZQGA 5KJFA 1RKVA 5M5BA 2EIHA 4N8DA 1VL1A 3TTTA 1A9OA 2OT3B 1YQDA 4PNEA 2O8CA 5BRAA 4RZ2A 6ABPA 4RKQA 1Q0RA 3VKHA 5JXWA 1NVXQ 5ITWA 4YRAA 2WYIA 3P7MA 4UREA 2JD0A 1G63A 5J1TB 5EZYA 3HKDB 3OP4A 2XQGA 3LQYA 2O7VA 3EH1A 1ELOA 2AOWA 4RD3A 1PI3A 1RRPA 1Y4SA 1USKA 4M1OA 4QNMA 4RSGA 1KFBB 3DT6A 5EQFA 5F5XA 3WL7A 5A0TA 1H2YA 2B2NA 2IPLA 4UBMA 3KOWA 4E1VA 1GGNA 1R0XA 3LPNA 3UGQA 3P0FA 1IIRA 1ODIA 1FMTA 4EYGA 1XP5A 5MDHA 3R20A 4Q9KA 2EHJA 2W2QA 1VE9A 2XBLA 3KOYA 1AUQA 3PDIA 4LDPA 4BNNA 4HFMA 1QFXA 2QGFA 4Z1MD 4XWWA 3SC2B 1C30B 2GAIA 5A7GA 3L8MA 3AY6A 4B35A 1JKJA 1L5WA 3OIGA 4X92A 4ZT4A 4KE9A 2H63A 4EYKA 2EAUA 1OILA 1TRKA 2F17A 2GZRA 2YOHA 2XF2A 1HFEL 2IEGA 4AU1A 2PUTA 1UMCA 2Y1KA 1XRQA 3B2NA 2PEYA 4IZIA 1QHYA 4BQFA 3ZOZA 4D4HA 4ZK6A 4D4LA 2C0QA 1LU9A 4CN8A 1P0IA 2P77A 3LLUA 4AMZA 2X6QA 1PLJA 3SR0A 4XTRA 2Q8PA 4RLSA 3GLIE 1Z18A 2I4IA 4PSDA 4WTOA 1QHSA 4N3GA 4FYVA 1L5HA 4R2IA 3SS9X 5DLYA 1AUOA 1KAQA 5H5JA 1IONA 2IYRA 3QJGA 3RIXA 1RYZA 4PRYA 5FLEX 4AZ3A 1DU4A 2GD2A 2ECPA 2WR8A 2WMOB 3HO6A 2LV8A 3CH6A 1T13A 3BHIA 2P9JA 1UOOA 3DL2A 3FFXA 4LQ4A 4F86A 3EH2A 2TYSB 2Y76A 1E6CA 1Y3IA 2BFDB 4YUVA 4HLNA 4DZRA 1WRBA 1Z5VA 1ZK1A 1L7EA 2JARA 2YV3A 3EA5A 1AUPA 4W82A 1IN7A 2ACWA 1Y89A 2D1YA 3H1TA 4LYJA 2GCNA 3RAPR 3EASA 2R8PA 2ASEA 3WYEA 1BA2A 1INLA 1KOJA 2ZSAA 1A9PA 3JQQA 5L45A 1CZKA 2VZEA 3Q1LA 2PRYA 4LYEA 1GGHA 2DC1A 3L6BA 4CCWA 2WB2A 2WWGA 2PV0A 4BNKA 1B8NA 1IMJA 4POAA 5B4VA 1IMOA 1ORHA 3A2LA 1NF3A 3H11B 1N4DA 2H4XA 3HADA 3N07A 2IS2A 5KYWB 2AGVA 3M2PA 3ESDA 1CRQA 5IN5A 5K6AC 3MW8A 1YTUA 2H16A 3M8KA 2I2XB 1ZI9A 3OFSA 2Q41A 2WHQA 1GGEA 3KTOA 3VZQA 2P8JA 1Z7GA 3CEMA 1V5EA 3PU6A 4WFQA 3N8GA 1Q7RA 2FFAA 3VC1A 3W8DA 2NUPB 1A5BB 2OHVA 3GZNB 3N3AC 2DY0A 3RSFA 2LBPA 5E9WA 2WJGA 3VUEA 5I8WA 1NFRA 3WYNA 2AE1A 1BGVA 3WR5A 4ZEXA 2OM2A 2VLBA 1BFUA 4HQLA 3T4EA 2FRDA 1B16A 1CUAA 2GRUA 1F14A 2HDOA 5HE9A 1R8SA 3TUZC 3KQQA 1YQUA 3D3NA 2G1JA 4JI3B 2A9RA 3QLVC 4YWHA 5I45A 3D6TB 4KXNA 2MSCB 1T4BA 2WRZA 1D2RA 5DNAA 2NXCA 3EXHB 4YV2A 2VSXA 1LEHA 5CH5A 3E35A 1N57A 4XM0A 1RPZA 1N6PA 1B00A 3V8MA 3ZHVA 3R7WA 3W2GA 4JEIA 2CXRA 3NHBA 2R8ZA 3EVTA 4YRZA 4FKMA 3JQ8A 2YBEA 3V1TC 1RYHA 2ZI5A 1IXSB 1GUZA 2R751 4FYPA 1U2DA 1WEKA 2YV5A 3WIVA 1ESDA 4FDUA 4B5LA 2AB0A 3MJDA 1WDWB 4BLPA 2HXSA 3KWJA 4QICA 3DTVD 2X3UA 2O5VA 1W52X 1UJBA 4GX2A 1V1RA 2XY4A 4IILA 1XWIA 4B75A 3VPBA 5LWHA 2E4UA 1BYIA 1GCGA 1N1MA 1ZUD1 2IJGX 3G1WA 3IIIA 2DPLA 3L6EA 4YTEA 3TL3A 1HEYA 4Q3AA 1MDFA 4ARUA 1NHWA 4UHEA 4EMSA 2FUG6 1NYTA 4KVGA 1NJ5A 1XALA 1PUIA 2XE8A 2WWRA 1YHNA 4BLOA 3N2KA 4IIFA 2J32A 3DEKA 3OTIA 5EJ2A 4F9FA 4EKYA 5LMUB 3AOGA 3VAAA 2FN8A 3AUFA 2ZBPA 1CUSA 1L7DA 2FAXA 2VKTA 2ZRJA 1Q92A 1U7UA 2ERYA 3S7TA 3LSTA 4J0DA 3QLUC 4UUAA 3ZV5A 4RZIA 3ZH2A 5FR1A 2Q0QA 1XTRA 4B1FA 1QO9A 4EYQA 1EH5A 4D26A 2O0HA 1U3DA 1RI3A 1TKAA 4PYQA 3A9SA 5I9MA 4DLLA 4TWJA 3V4PB 1DIAA 2EHDA 1LWOA 4UEJA 1IY1A 4MRVA 3W78A 4HG2A 3DE2X 3PQFA 1BROA 1R6BX 5LXTF 4CG1A 4DC1A 3IUBA 3D6NB 5INTA 1IZZA 3H9JA 3I6ZA 3IO5A 1OFTA 1AMUA 4Z4HA 4Z9FA 4KWEA 1X2BA 4LHXA 4J1NA 1TT7A 3FSGA 3VPGA 3FDIA 2IVZA 3WLRA 4EENA 1O08A 4JYMA 1U9IC 4CNBA 4OQEA 1Z2NX 3PNLA 2FVXA 5HXAA 3HPQA 1U4NA 3RCBA 1SC1A 1OPRA 4G09A 5E1MA 5DPMA 3I5AA 1TMGE 1M8PA 1X38A 1WPQA 5HSGA 1MIOA 2NVBA 1HZZC 1PFGA 1TTHA 1ZXXA 2BMDA 3F4KA 3MBOA 4Q15A 3HN2A 1I4TD 2QZJA 4DDWA 2A4KA 4UAVA 3OF2A 4ITVA 1JEAA 1SIOA 3PC8C 4D9HA 2OV4A 1TIBA 1XZ8A 3GGOA 3I1IA 1DSSG 2UKDA 3CLUC 3NXSA 4O1IA 4R71A 1J21A 5IAJA 4LNUA 5HK8A 2HDWA 1RZUA 4OF4A 2A9FA 4R1PA 3TLYA 4Y1RB 1CY7A 1AIPA 4CEIA 2Z2ZA 1TCCA 2XPCA 3FWKA 4HGZA 2OXIA 4CTNA 4EUSA 5G40A 1GPUA 3G6KA 2GNPA 2ON6A 5JZ9A 1N6RA 5EJEA 5AOBA 3RBXA 3TZCA 1NBOA 4J07A 3PGLA 3IP9A 4EBBA 1GPLA 4WGGA 5HKBA 2DWPA 5JAOA 3KVRA 3PF8A 2VHCA 1M0TA 4W7HA 3L82B 4TQUS 5CM9C 3VO1A 5KNDA 3DHNA 3NT4A 3GX1A 1F8UA 1K68A 1B6SA 1QGZA 3O73A 2CDNA 1RXVA 4F6CA 2QU7A 2YZMA 1GZHB 1FFAA 2A0UA 3GFVA 4EEKA 2C5FA 2AJDA 2HJGA 1KC1A 3T99A 2WTUA 3LE8A 2PGXA 1E5XA 1JLRA 3D8SA 2XMGA 1NR1A 1W0JD 4EAAA 1MB9A 1HNZB 4PS0A 1GSOA 3PI7A 3JZAA 1ODTC 4QLAA 1A2QA 4Z3DA 4EVSA 4PQFA 2YMMA 2PUWA 1UBEA 3GRUA 2PGAA 5BYAA 2ANBA 4S35A 4HDAA 1L1FA 1BMFD 3LBYA 4IOJA 1G64A 4E14A 5F23A 1Q6ZA 2Q1WA 2I2AA 2EBHX 2FN9A 4CL3A 4KRGA 1TGVA 5K3AA 3H1GA 3ZWXA 1Y8QA 1IWOA 3R76A 4PLVA 1NUPA 2ZZKA 2HA6A 2ZQZA 1DQZA 3LY8A 1SHKA 3L7CA 2MT9A 4IDBA 3VH3A 4H6XA 4FHEA 1KEKA 1ZHOA 2QLBA 2O0JA 3BGDA 3H5WA 1ZZEA 2A5DA 2JIPA 5B3LA 3K70B 4NBRA 4KSBA 4A8HA 4NOLA 2IXGA 3G1UA 1J9GA 3P0IA 5KNDH 1F7VA 4WLFA 1QOZA 2A84A 3PLNA 4JMLA 4MQBA 1Z6YA 3GMDA 2QVLA 4U02A 4YACA 4BZZA 3CVYA 4M7RA 5F1YA 1BFKA 1E94E 2FPSA 2HWUA 2VBCA 5IXYA 2CNLA 1HT3A 2X4DA 4D8WA 5EESA 4E32A 3SKXA 3V2UA 3D5TA 1Y1QA 1C2TA 1FDSA 4ENSA 4ZDIA 2H2IA 1T1GA 2VC2B 2OQ2A 1JPJA 3U56A 4AY5A 2QOEA 1O97D 1IXKA 2W98A 4CIBA 2UV8A 5B4TA 5HOEA 4PQGA 1UQUA 2PO7A 1JXOA 1MQ8B 3TQQA 5IXJA 4MV0A 3LTEA 2JIBA 5ALMA 1W59A 1FVOA 1YS1X 3D0OA 4I08A 1F3LA 4N48A 2BJWA 1VE6A 2QZPA 3C8ZA 3E84A 3E0QA 3VUFA 3R6TA 4RPIA 1UZLA 2Q49A 2WDZA 1JV2B 1GQRA 1B15A 1ZQ1A 4BVBA 2V4ZA 1YVUA 4YJGB 2Q3HA 4AX8A 5D7BA 1DXYA 2QMQA 5BSFA 4BUZA 3HO8A 3GFQA 2G82A 4FQ5A 1H1DA 1YOVA 4Y6PA 4NJOA 1BDBA 2Q28A 3D6FA 3RTCA 2JFUA 3PB3A 4RHXA 1D8TA 4NBTA 5KX5F 3NP9A 4BNJA 5JMOA 1R9GA 2H3HA 1TD9A 3T1YB 3OZEA 1GYQA 4DBZA 3C3CA 4RM2A 4LXIA 4HNAA 4KIJA 4KI0A 4I8XA 1K1EA 4F3YA 5JI2E 5JROA 4WCDA 2GM4A 4E4TA 4XVHA 3JASA 2OQVA 4TXJA 3VNQA 1VHWA 3OD5A 5JY6A 4KWHA 4RGVA 2PKEA 5JG7A 2RGWA 3BWCA 4V0SA 4PAGA 2XQFA 3SKVA 4FZ3A 2Z6UA 3ZWQA 1Z4MA 1ADBA 1JR4A 2X4LA 4H17A 4ZCLA 1Y6GA 3ZHRA 4B6GA 5KSPA 2G7ZA 4IJKA 2AQ8A 2XHEA 3KSZO 4H35A 3QUQA 3VBCA 1OU4A 2F3TA 4K8RB 4F71A 4F12A 2ATEA 5ALYA 3N0TA 4EG4A 5CK5A 4BVLA 4Z6KA 2RAFA 3QE4A 3EAGA 1L5MA 3ZNPA 4MGKR 1KVSA 3QELB 1JJBA 1TEVA 4TYQA 4G4JA 3M1YA 5E4TA 5E7MA 2H29A 4E88A 4X1YA 2EJUA 3JXEA 5IK2A 4I6JA 3RVRA 4TLCA 4OHXA 3DLPX 3E53A 2BUBA 4PFSA 4HCJA 4OHMA 1E5VA 1VJRA 5FB3A 5KU7A 3UGJA 4L6AA 1M75A 1RWOA 3PX3A 1CE8A 4C43A 3U19A 4BE9A 5CDYA 1OWPA 3ISJA 2JFXA 3CURA 3L0OA 4LRUA 1WCV1 1Z7WA 1AXRA 3HYNA 2Z2KA 3HU2A 4CHGA 1ZU5A 1FXWA 4P4GA 5AXBA 1UQTA 5H82A 5F1PA 1U7TA 3LWNA 1DCMA 5HG0A 3LKBA 1R4MA 4GICA 2QDXA 6LDHA 5F51A 1IUNA 2ADOA 2NPOA 1NFQA 1MQAA 4KLAA 1NJ1A 4H0CA 5LQSA 4K28A 5J9FA 1QH1B 4DUGA 3G79A 1FDRA 2HSJA 2AL7A 2YWEA 4OK5A 3EOAI 4PZZA 3RROA 1K5GA 1GNSA 3WL6A 4DDVA 5KOJB 1Z6GA 4NNJA 1E62A 3QF4A 2FOXA 1E64A 2ERXA 1J5PA 1QFYA 3HB7A 2WG1A 4BNMA 2L17A 3JY6A 5JO9A 1U2GC 4PX2A 3HO1A 3B3AA 3COSA 4CMAA 1RLTA 3M81A 5ALTA 4D9FA 4CMJA 4D9CA 2C7RA 1QNLA 3WRWA 1NNUA 1G55A 1U8AA 3P19A 4Q3OA 1CY2A 3RG8A 1QAQA 3T61A 3TCNA 2W8BB 4G8BA 3OAAD 4MH0R 2C2YA 4CKCA 3A14A 1MKYA 4MHTA 4L8WB 3BSSA 5K3BA 4I9NA 5FFNA 1J8QA 3GGDA 1L5FA 3QY0A 1G5TA 5HQ3B 3TLCA 5B5SA 5JPDA 3WGIA 1V4NA 4EW2A 2LXNA 1Q5PA 1T8YA 2ZPUA 3RGWS 3NWBA 4R1UA 2IHUA 4P53A 2CXXA 1C4WA 1JEDA 3TEFA 3RYIB 4YCNA 4RC9A 1IN5A 2CWDA 2WUEA 2VNSA 4JVLA 1QC5B 2DUUA 5ALGA 4NI5A 1M2OA 4ZK2A 2YIJA 2QK4A 3ZY4A 3QF7A 2O14A 4AECA 3BTOA 1JIUA 1N8TA 1ZR2A 2HYDA 5JAUA 3K9LA 2FP4B 1RWMA 3TX6A 5K0JA 4B4DA 4IHJA 2AUNA 2PPVA 2FV8A 2A5LA 2P78A 2QR5A 2WVGA 4OATA 2D2IA 3O8NA 4PLPA 1F2VA 1VCMA 4FWIB 3DP9A 1KY5A 4ZQIA 1N0WA 3IAUA 4IW3B 4P4TA 3RRFA 5B12A 4M6WA 1E60A 1NZFA 4KQXA 4G85A 4RF4A 3U7QB 5B1IA 1G3MA 2WM9B 3D3WA 3G7UA 4LWQA 3VU1A 1T5OA 2BFOA 3OY2A 3UG7A 3J81A 1VKJA 4KXXA 2Y4NA 4FFVA 4JIMA 1UJ2A 3EF0A 1XEWY 4D3ZA 1WMDA 1SRRA 3COZA 3E8MA 3UWDA 2C2ZA 2DTDA 3WMFA 1EVLA 2ZBGA 3QRWA 2H4JA 2XCLA 2IZ7A 3IALA 3I09A 1EVJA 3K1YA 4OKIA 2JIZD 2B8WA 2UZ1B 3T7DA 5BQFA 4V39A 3OI7A 4R1NA 3AF6A 3WKDA 1DCTA 1QTRA 1THMA 4HB4A 4CG0A 4QSMA 3TIFA 1WQ1R 2AFHB 3I0ZA 1EK2A 2V7GA 2AK3A 1JLSA 3FPJA 3KLOA 2W7TA 1CDZA 4MHSA 1A76A 1YB4A 3SQDA 3KQKA 1KWGA 2OBLA 3PXXA 4I81A 4BBJA 1VA4A 3AUAA 2PX0A 5KJEA 1CIVA 1R8YA 1SVMA 2CHUA 2Y1LA 3GVCA 4IDCA 5DXJA 5DTIA 3DBHB 4K88A 2B5OA 2PGJA 3W8EA 3PGKA 4PHCA 2GS9A 1IHYA 4YLYA 4CXMA 4L4ZA 3BB1A 3N7AA 5FQNA 1DL5A 3AJDA 3BXGA 4TTVA 5T3YA 2OKGA 3D6HA 3W7AA 5CU7A 3Q7IA 1GAEO 4UTPA 1J5EB 4OHYA 2YJZA 2BM0A 4RTRA 3FYHA 4EFDA 3ZKAA 3HB4X 4UXJA 2FPIB 1HLDA 3HE3A 5HBRA 3OZGA 1Y7HA 4FGZA 4BNIA 4M36A 1WKCA 1IJEA 5EJ7A 1QOQB 2OGUA 4LV5B 5IJWA 1ZRNA 2RJOA 3PJDA 5AT1A 5IMBA 3QMVA 3TKLA 4WECA 4U5QA 3E9NA 1BMQA 1DTWA 4XW2A 1YVPA 1CJBA 4Q3DA 1JE0A 4P5EA 2C97A 3NATA 2AOUA 3O95A 3R0XA 4R0VA 2PRJA 3TI7A 7ADHA 3BG5A 3GRRA 4I1IA 3I9OA 3ZCSA 1SXJC 4YJ2F 2AC4A 4JYAB 5KTYA 1JR3A 4L51A 4QO7A 4OB7A 1R6DA 2XWSA 3DWFA 3IUNA 2CFIA 1SCAA 2JHAA 1XJQA 2Q3BA 3DMHA 3MINA 4EB6A 1XMPA 4CIVA 1P9OA 1BCRB 4F3NA 2QM3A 4LOLA 1NQWA 2P5YA 3D8NA 4OL0A 4HLUC 1ECFA 1CFJA 1JQAA 1NU8A 2REXB 4KZKA 4PZUA 4OFZA 1JX6A 1W85B 1BFDA 1C8VB 3KKZA 3CZ5A 1UK6A 3R9XB 1SD2A 1ODJA 3GJ5A 5ALKA 1JZSA 4US2R 4XJVA 1HX7A 3G82C 2FG5A 1NT2A 4I50B 1J8YF 3N7TA 1FQOA 2FCRA 1KYIA 2MWMA 2V03A 3IT3A 5CJPA 4EZEA 1N75A 3HVJA 2GJAA 3KSBC 3GFBA 1PJQA 2QSUA 2XMSA 3IBFA 2DP4E 3TINA 2UVQA 1T5LA 3RYCA 1R9JA 4N0PA 4LVOA 4QU0A 1YH3A 1H2HA 4RK7A 4AS3A 1NW4A 2PSFA 4FMDB 4JQOA 4OMDA 2OO7A 1YZNA 3NPAA 4JZYA 2ZJ1A 4L08A 4LZNA 3RHFA 4F8EA 5HS6A 3OM1A 4K6OA 1E69A 2QRHA 3F8TA 4RD2A 4F7DA 4IDGA 1XK7A 2WJPA 3I9JA 3KZCA 4HAXA 3AIMA 5FORA 3ZV4A 4G97A 4R01A 2GEFA 4TTSA 1SH7A 2HQRA 3SEAA 2H8KA 5LVAA 3HY6A 3IAEA 1XZMA 1XKTA 4B2YA 1G291 5F4BA 1G4AE 5I9SA 3HZHA 1VCIA 4Y2RA 3IESA 1M9NA 1M2VA 1N0UA 3GD7A 4MR8A 4MI6A 4PG6A 2GNAA 2HBRA 3S55A 1VHTA 3QE0A 4DLNA 4CEJB 3A4YA 4AKHA 2QGZA 1WMBA 4HNGA 2FZVA 1EFPA 2GKSA 2NAPA 4O4IA 1H94A 4JLOA 4X1IB 4M0KA 5AM3A 2RIPA 4N03A 1FFWA 4CF4A 1RYMA 1QZZA 2RI6A 3CX6A 2V4MA 4AMBA 1QKKA 3AEQB 2CMDA 1TFRA 4JT4A 4X41A 3ZGVA 4IEEA 4AROA 1OZFA 5FKJA 2FSVA 5LCXA 5JV5A 5B1DA 4Z2YA 1NV8A 2EJBA 2XZPA 4BMOB 4RTLA 4CW7A 2XNJA 1WXEA 4Y2XA 3B2QA 1H4VB 2PZLA 4I4LA 1GV0A 2GR9A 1OH6A 1XQXA 3KZVA 3RUEA 3VHXB 5EMMA 3VYRB 1IN6A 1PLLA 1GZ5A 3UY4A 4BZPA 3IEVA 4AICA 2HKIA 5E9JA 3S2GA 4E11A 5SY9A 1SVLA 3SYLA 5DIZA 5CEJA 3PT5A 1P31A 1X8KA 2I6UA 4TV8F 4UBNA 2ZUEA 4FOSA 1JHUA 3OA0A 1N2CB 1RRKA 1Z56C 2MMCA 3DULA 5BW4A 2Q45A 4AJ9A 1OFVA 2AD5A 1EZ1A 2I67A 1KH3A 2QTRA 4RCZA 3S29A 1NRIA 2ZCJA 4ZIRA 3DR5A 3PT9A 4J6EA 3TSYA 3TZLA 3B6KA 3FFAA 1IJFA 4UHDA 5KTSA 1O5IA 2FFQA 4IPTA 3K0AA 1OGJA 3BFVA 4MZDA 3VZPA 2B6HA 5C51B 3ZUPA 2EF1A 2R4TA 1X3SA 2CMGA 5HIAA 2H2GA 3TXAA 4QOHA 2GSWA 5KPDA 1HNWB 1L7AA 2D5IA 3ZX4A 3FUVA 3E5RA 1R0BA 2REBA 1ECLA 1FP4A 1RM4A 2JFQA 4EQ6A 5IH7A 3AF5A 3M4XA 1DWUA 3R3SA 4ALNA 2NW6A 1P6UA 1PR6A 3NWPA 1EXVA 4A0FA 4P7GA 2GRAA 3W5JA 1VL2A 4KODA 1U7OA 2XUAA 4HDMB 4UMEA 1ZVQA 4JBNA 1XAJA 4L5BA 5KYYA 2X2FA 4YGXB 5U4QA 5EWJA 4D96A 4KYUA 4AUEA 1W29A 1VMEA 2VYND 2JCSA 3Q41A 2DXIA 4R8SA 2AKYA 2ZSUA 3QK7A 2RGUA 5J59A 3V4SA 1NXVA 5COAA 4RY0A 2NNLD 1E7MA 4TMXA 3TFOA 5G53C 2GVNA 1I2CA 2QJTA 2R5WA 2BEVB 1KE2A 5LKAA 2PTGA 4EPWA 1UBCA 3SE7A 1XTPA 4P1ZA 1R4NA 5AKLA 3CISA 3LPDA 4LDAA 4F4DA 4CNQA 3MK31 1FDWA 2ZJBA 4IIJF 4BBZA 4E5UA 5BQOA 1AB5A 2CYBA 2DBZA 2ZJOA 3PA8A 4GOND 4FR2A 1L5VA 2C5AA 4GP6A 3E18A 5NLLA 4D4KA 5EAIA 3L8FA 5KHLB 1YE5A 1XELA 2P4SA 2XVMA 3C3BA 2GM5A 1E3WA 1OTXA 2C8VA 1SCIA 3CWQA 2XDAA 3KCNA 3TOVA 5IC5A 2OCDA 4HAIA 3UYLA 3RFUA 4QFBA 3FPSA 2RG7A 3PQ3A 3C7AA 2QXYA 4DRXA 3QITA 4FMCF 1E2LA 5JCOC 4F5YA 1E6WA 2C83A 3LPAA 1KRXA 2UVDA 2UYQA 2IQIA 1A4RA 1A8PA 1P77A 3FIUA 3HUEA 5T3UA 2D0IA 4LJ4A 4CKEA 1WNTA 4ZYXA 5SY6A 2I9KA 4BZWA 2IU4A 3DOOA 2QLLA 3UHPA 3VH2A 1SPXA 3IV7A 1MBZA 3LWBA 4H7KA 3W5UA 1K3TA 2VHWA 4WJKB 1T1IA 1ML3A 4TL7A 5HIKA 4U2EA 4GG1A 4XX0B 4TGLA 4DRYA 1ONSA 2QAGC 3DHYA 2V45A 3FDFA 3PYXA 4ARAA 1NVUQ 2WD8A 3FHTA 1O8BA 3NOVA 4TROA 5T4EA 3GEEA 1YFZA 1POWA 4CLRA 3WC4A 3QOWA 3ZDFA 4QGHA 2B1IA 3DYVA 5JRJA 1VBFA 3WY9A 2ZRPA 1YRAA 3OTOB 3QNUA 3PG5A 1CJUC 4A82A 3H5TA 5L6LB 1I9GA 2EX0A 5ELXA 2DR0A 4HAVA 1G8YA 3I1JA 4YAWA 4WOPA 1WDLA 3PJGA 1NAIA 1XNJA 1YDMA 1DKOA 1PZNA 2PA3A 2WP8J 1JBQA 2ZREA 3B1YA 3MSCA 4JROA 4AP5A 4X7PA 4B4VA 1FSZA 2FKAA 3DVSX 4XI9A 1Z4KA 1N5MA 1ZESA 2AG1A 3D3QA 4RIIA 5JS2A 4PW0A 3NUQA 3MJTA 3LBHA 1CHNA 3EG9B 3ZW8A 2OMKA 3VYUB 5IDYA 1SBHA 1NOJA 4D7AA 5TF0A 1W2GA 1ORWA 4X0EA 4TV9B 3FD8A 4NPAA 1JHDA 2Q2QA 3I8SA 4V0QA 1ATZA 1X1EA 4PXAA 1GNLA 2E6UX 3T5GA 5FPKA 5LJIA 3TGPA 3ETGA 4DMMA 2FVYA 4Q37A 2VXBA 5CAEA 4MQ4A 2BFFB 4XR9A 2QE6A 3HLYA 4RV4A 1OASA 3KLPX 4IXWA 3ROPA 1FZQA 3MXOA 2H0QA 5BN4A 3HJNA 4CLOA 1OHHA 1QVRA 3ZJ5A 4F8YA 2D74A 1D4AA 4YMSA 3NPMA 1JDBB 2GPNA 3FLMA 2GASA 3A8TA 1OLSA 3DHWC 4OUKX 2MR6A 3OF5A 1JBEA 3DO6A 1UKCA 3AGQA 5KTPA 1Y9EA 3TW0A 2IP4A 3MLAA 3V5NA 3UXMA 4RD6A 2XT9A 1FJ2A 4B87A 4EG0A 2JI7A 3MJVA 1Q1AA 1Z38A 4CTMA 1KA9H 2V1XA 4DTIA 4X60A 1SIUA 2V7XA 1F51E 2O2XA 3BHJA 3PTAA 3ON5A 4ZVPA 2GCPA 2HBZA 2WJ4A 2ZXEA 1WS6A 4XQCA 4DIKA 2C58A 5BVHA 2DH6A 1T0JB 1ZINA 4EKGA 4BX9A 3ZVMA 3AF3A 2VHEA 1NVTA 4G1BA 2LE0A 4D5GA 4E4YA 3BWXA 2C2BA 3CF2A 3EZFA 1KGDA 4OHWA 4IKPA 4KQFA 2QI9F 1HMYA 3A1DA 1KDTA 3B48A 4O5AA 4ZCPA 3UB3A 1PYOA 3VMFA 5C9ZA 1QP4A 3PNQA 1KY4A 1H8HA 1AKMA 1EG7A 1DAMA 2R9VA 1LZLA 1XO1A 3O47A 3FI0A 5EXXA 4AJKA 3ISTA 2GEJA 4GHWA 3VA7A 2OFOA 1L7RA 3VNAA 1FC0A 5HZHA 2R97A 1Z6ZA 1EBFA 4IDEA 3ZOKA 4EHBA 3L40A 2V6MA 3OHPA 1QUEA 4OBBA 4WK2B 3PR2B 3TGWA 1HSOA 4NCXA 1XSEA 1EP1B 4RIHA 1OBVA 2G70A 4AG6A 1K8QA 2K6GA 4ZRNA 5BV2P 1UBJS 4O4JB 4KAFA 3JZFA 3F9RA 3IV6A 4GECA 4KXYA 4D6YA 5AVXA 2PJRA 3NV9A 2A86A 5CHYA 4ZZIA 3EIEA 3DMGA 4RPHA 1NMSA 2GCOB 1VM6A 1YR6A 5LYYA 3H9BA 1JIQA 3GBSA 3NFYA 1XHEA 3PQEA 3HBJA 4I4TF 4N40A 4EA9A 1FEZA 2MSDB 1L4EA 3HSSA 3ICPA 2YWFA 1J2RA 3JYPA 3OFKA 4EGSA 5CLJA 3AESB 3HYTA 1GUAA 3WGTA 5DWVA 3LCMA 2QSJA 3PRJA 3P5SA 3CLUD 3EDCA 4YB8A 1KJNA 2O54A 4EG8A 1YMUA 1TQ8A 1ABEA 3TLEA 4D1YA 5JH7B 1P61B 3BJZA 3IXQA 4JWTA 4YRKA 2O2EA 3Q87B 1FS6A 3U5TA 1KK3A 4N0DA 3TLAA 5E3HA 2O5CA 2IYNA 2EBFX 2OOKA 4E3ZA 3KHKA 1HQDA 1RHMA 5ESRA 1PR2A 1ZI6A 5E7IA 5DNDA 4MYUA 5D86A 1TLTA 4MR7B 2Z08A 1EJ0A 2ZATA 5J2UF 1TJ3A 4ZQBA 4FXOA 3ITDA 4ZAZA 5TF4A 1AKEA 1Q7GA 5JISA 3V1NA 2IEZA 2PZ8A 3NOOA 1G20A 1RTTA 2C29D 1L7MA 4BNHA 1NWHA 1ZOPA 1TUEA 2DPHA 1A8HA 1P0FA 1Y33E 2B98A 2E9SA 2NTVA 4X8MA 4ZCQA 2ZIUB 3TVTA 3ZWPA 4Y2GA 2EW1A 1P9RA 2AFHE 1FFYA 3U4QA 3E7XA 1XCOA 1SVKA 2BR3A 3DZGA 3H2HA 2FMKA 5LA6A 1Z4OA 3JAWA 4YPVA 3EVAA 4L73A 4TT8A 4NBLA 4UHCA 1LNZA 2OCPA 3GRAA 2WFMA 1M7GA 3NP7A 1NBAA 1DOHA 3ZJUA 2ZIWB 2ANCA 4OCZA 4MDEA 3L7LA 5ICFA 3SZUA 4BQRA 5C5EA 3INRA 1U7XA 4Y9UA 2I7XA 3AGPA 5DK4A 4EI7A 3KSDO 4YASA 3REQA 2IH2A 2OORC 3PE3A 1GKLA 4CQNA 1ZFNA 2HLDD 4FLEA 2ZYHA 1GGVA 1N1GA 4IUYA 1TYDE 1YI8A 2W2OA 1SUEA 2O8NA 5I4IA 5JMWA 4TM7A 2RC5A 3OLCX 2VTDA 3LC2O 5EXPA 4ADSG 3U3XA 3RKRA 4UARA 1DG1G 1KBZA 5JYEA 3MYYA 1S5PA 1KVRA 3VX3A 2GDZA 3QU5A 5E1DA 4BB0A 1M73E 4H7IA 1YB7A 4LC1A 1CJVC 3N8NA 3HNRA 1YUMA 1WSBA 2ZYUX 4NS1A 4RA6A 5HFAA 3LVQE 5DP1A 3WMWA 2HYIC 4F5DA 3JWJA 3W77A 1KPGA 4EPVA 1XTTA 3AVUA 1H0SA 2YWXA 3R8XA 3U62A 4AJJA 4N12A 1U90A 4MRPA 5ADVA 2C92A 2QRQA 3KIPA 4BFVA 4CV3A 3LUBA 1N6IA 2DULA 4JI2B 2G3YA 1UANA 3QSYA 2GYVA 3VKFA 2AZXA 1SD1A 1HA3A 4FIZA 3TLZA 4AFNA 2PX5A 5CB8A 4TVBA 4C7OA 2QY6A 3IRUA 3GQBB 2B30A 4NDNE 4RMGA 3Q8XB 3BH6A 1QCYA 3IOYA 5B2ZA 5FLXA 1J0AA 1KEWA 5LQJA 1HOXA 2ID8A 2NAFA 3AHGA 2JLCA 2XUOA 4P38A 2PRZA 3RS7A 1IBRA 1SBIA 2X7XA 1ENYA 1ZCFA 2X8BA 1T3ZA 5JNUA 3AZPA 3RS5A 4WLVA 3QPDA 2VSNA 3ZV3A 3TJZA 1BQ3A 3DZ8A 1EGMB 1B76A 5BSWA 1T2EA 2WJIA 1JL3A 4QYWA 4DABA 2BFEB 3R3UA 3QKSA 1L4NA 5ELLA 2QUJA 1VHQA 3GLGB 3E22B 1WY5A 2HZBA 2ZBFA 3MGBA 3THRA 4K1LA 3QEBZ 1QRTA 1H9CA 3ICWA 3MTQA 3SM3A 4W6ZA 4ZALA 1R5BA 1DBQA 2XQKA 1D1TA 3MGGA 4JDUA 3LGXA 2X86A 1CJKC 2XRYA 1U2DC 1C4XA 2I80A 5J63A 3U16A 2J5BA 2NU8B 3MHPA 1Z37A 3E4CA 2JLAA 3A58B 3BH0A 1KEPA 3AC0A 3LS2A 3GLVA 4M22A 4H59A 4LF5B 4PIMA 1U3WA 1W4LA 3LTNC 3DCNA 4FBLA 5A4DA 1CDEA 1SD5A 3CBGA 3RS8A 4B4UA 4QBGB 3ZZUA 3HDGA 1JQLB 4NYMQ 3H2IA 4DW8A 5EJ4A 2PUFA 4JP1A 2F1HA 2VJAA 4Y6GB 1UCFA 2UYOA 3IOEA 4D74A 4L0QA 1M0EA 1Z16A 1CR4A 2I4TA 1RD4A 2NO7A 2B4KA 3QG1A 4IJWA 3T38A 1B0AA 1NPYA 1NW7A 3EDRA 5CYPA 3TRHA 2J0EA 4XCQA 2WG0A 3NBYC 4WZAE 1RM3A 5KVQA 1L4LA 3K31A 4GGPA 1CQPA 2ZOSA 4E31A 3EG5A 4QVKA 2IBSA 3IIKA 2J5QA 4X7BA 1VRCA 4X91A 1YK0A 2F8SA 1LGYA 2JGAA 3R8CA 3K1AA 2CB9A 2CVQA 1OR8A 2ZROA 4CIDA 5AW4A 1XNHA 3LUHA 4KVAA 4BCDA 4R3NA 2VNJA 2JCBA 1IG3A 3SBEA 3S1SA 1S8AA 1E2HA 2QE7A 3OQ6A 2BE9A 3NAZA 4DWVA 4FGSA 2FA9A 4C0XA 5LBTA 4INAA 2KYRA 1WO8A 5EHXA 2GPYA 3ZDXB 1E4VA 3CRRA 2CLMB 4D4MA 3I8XA 5A5DA 3M4YA 3R7BA 2ENWA 1ZNZA 3R3VA 3TTXA 5HUHA 1OZHA 1U6JA 4MLDA 4TTTS 1USGA 5EZ6B 4KN8A 2E6KA 3STHA 2OSVA 4CVNA 2C0CA 3ABZA 1JVSA 1OY1A 1VTKA 3C6BA 2F3PA 1N7JA 1V11A 1Z35A 3NORA 4FI3C 4N6OA 4PS1A 3SEFA 3JWHA 2A59A 4TOIA 1MW8X 4L5JA 5AK5A 5CFMA 1U2TA 4B9AA 3BAZA 3LNCA 4JQCA 4C78A 4DMFA 3FBTA 1YR8A 2AQIA 2KW5A 4DIOA 4UEOA 5FFMA 1LBEA 5KNCD 3MS7A 1M34E 5DHAA 3AUUA 3IB3A 1UODA 1AQLA 1QRRA 1M5UA 5F4ZA 3ZD9A 2VT7A 3HXMA 3U9TA 2A3NA 4PHHA 2X8JA 3NVDA 3IFSA 5B3JA 5BUSA 4FUQA 4DSTA 1UDCA 1C8KA 3RH0A 4M9CA 1ZICA 4ZI2A 3C6ZA 4KV7A 4MGYR 1XEAA 5JAPA 1GTG1 1PFWA 1VPVA 4MUBA 2GHQA 1G7TA 4HMPA 2ZITA 2FEXA 2PEZA 5C1BA 1KS9A 2ZBUA 2JAXA 4RZ3A 2DFDA 1NQAO 1S3FA 4ZCSA 1BH6A 1OVMA 1I5EA 3FVRA 3NCTA 1P2SA 2D7JA 3RUDA 1IM5A 1ZCAA 3K09A 4M49A 2WV7A 1XMIA 2K5UA 4D4IA 4JWKA 3HA5A 1OROA 1CSEE 4KQ1A 5IT5A 3HRIA 1K9VF 2CFRA 4UDYX 1ID8A 1VIAA 1RCUA 1GM5A 3HKCA 3VR4D 4B33A 2DF8A 3P9KA 5KQMA 1CW2B 1UDWA 2B5WA 4HR7A 2OGTA 5CA0A 4O2RA 3BWEA 1MEEA 4OH1A 5FOTA 2JCVA 3TFWA 4LW8A 2CMKA 1G7CA 1DAEA 3GUUA 1TQ2A 1U2PA 2RGNA 2BFCB 4I3GA 2WQ6A 1Z0SA 2DSNA 2WF6A 3S27A 4JJGA 2A9QA 3QFSA 1GQFA 1FCJA 1U3CA 2HA3A 4EO7A 3I37X 4NNPA 4R51A 4GPIB 2AVDA 1B0ZA 3E3NA 4RH1A 1PJBA 3CRZA 3R5KA 2QW0X 3AKYA 2BR4A 2B5VA 3BHMA 3QW2A 3F96A 4A6XA 1BOOA 1I4EB 3CB4A 4KFUA 4MA5A 1Y8RA 2J3HA 4OI2A 4R1TA 5DBEX 2IU0A 5C1PA 3QPVA 3T3DA 2HHLA 3A3PA 1E9RA 2P2LA 5IYZA 4ENTA 2GH1A 1R6TA 2QLFA 1VG8A 2QPTA 3TMYA 2WHPA 1LDNA 3KLBA 3ED5A 3OEHA 3BXPA 2P0AA 2QLJA 2WSBA 3H2KA 4IFBA 4OJMX 4PO8A 4BRSA 5JNVA 2R0QC 3ENQA 3ODGA 1LSJA 5BMVB 1BXGA 1X1TA 5HJ2A 1PFKA 3RGGA 2M6SA 1UOPA 4H16A 1ONOA 2BFPA 4RPKA 4EQZA 1YAJA 3OZTA 3HDQA 4GAEA 3KVYA 4L28A 3RJTA 4IJQA 3AKZA 2PS9A 3NRCA 1GL9B 3L01A 1N6HA 1FU8A 4HYTA 3HB1A 5BV7A 4PTZA 5LNK1 3VBEA 2WOOA 4MYDA 5ESWA 2ODEA 1DLIA 1SG6A 3NYQA 4C0WA 2EP8A 3AQIA 5J43A 2YZKA 3A6KA 2QRMA 4KGXA 2BTEA 1GSIA 1EVYA 1XXHA 2AEFA 1BW9B 1K5DA 4LJKA 3SSMA 3AEKA 5HKLA 4WLOA 5H0IA 5HRAA 2VJYA 1NUQA 1SXJD 1XE3A 4JYPA 2VP2A 3H9QA 3UJ7A 3EVBA 2PT5A 1YKFA 4ND5A 4QC2A 3NGMA 3V1UA 4CT4B 5KHOC 4OLAA 2VOEA 2IZ6A 1KSFX 2ZU0C 2IZ0A 3NIDB 1JI0A 2ZRCA 2I71A 5M3BA 3C6MA 1SBCA 4PZ9A 2RHCA 3LFUA 1UKZA 1ZNWA 3E3LA 3VR6D 1EYZA 4DC9A 4E5NA 2IS6A 5FPHA 1P73A 2HTFA 2NSYA 2X40A 4GRIA 5DE3A 3LDFA 2CY0A 1SVUA 5LP1A 1VE7A 1Z83A 4MR9B 1H2BA 1M6VB 1EK0A 1RBZA 5KQSA 1ULUA 3OPQA 5KVAA 1E3QA 3EEFA 3JYHA 2M32A 1XTKA 5FT9A 4TKZA 1SOWA 2Q7OE 3EGWA 5BR7A 1R27A 1V8OA 2Q9UA 5I7SA 2FW6A 3KV3O 4HJXA 5FL3A 2BMJA 5JOQA 2AQKA 4RTQA 1M10A 3AO0B 1S3GA 4KITB 1PVOA 1PF7E 1PZHA 2G76A 2QHXA 5T6BA 2F3QA 5DNEA 3RNLA 2DOKA 1DIHA 2X1MA 5L40A 1CPYA 3QTTA 4UVIA 2BYTA 3FCEA 1KRWA 3NDRA 2HWKA 5AIAA 3HHEA 3O9VA 4AC9A 1G41A 2XQJA 4FE3A 4L22A 3F2VA 1W75A 1XZHA 2WTAA 2A5YB 1NVEA 3CRQA 4ITRC 4Q4JA 1M2FA 4EZIA 4LRWA 1P2FA 2DWOA 4IZ6A 1HC7A 2J87A 1RAFA 4PQYA 3IIEA 1CQZA 1LY1A 2IPOA 4Q6WA 4X61A 3GGJA 1GL3A 2JAPA 3MJCA 4O8CA 2Z95A 4PPQA 4WFIA 3UJPA 3T54A 3V7UA 4ZO9A 5DGXA 2A5GA 4QUEA 4U2DA 4KE8A 4QXQA 5DFAA 4B8ZA 1SM4A 2W71A 3HJRA 4EABA 1QPZA 2F3RA 4RZHA 1TQ6A 2O50A 2ONZA 4H7HA 1LA2A 4LI0A 1JU4A 3SPXA 3TB6A 2A88A 4FFRA 4IH4A 4Y2TA 3UJ9A 1RBQA 2H8GA 2YN2A 2Y05A 4KG7A 4QTUB 1NP7A 4PFKA 5T5QA 2HZ7A 3PK0A 4MYSA 3EHDA 1K97A 4OAPA 2XSZA 4OU5A 4U2FA 3TNLA 3VR1A 5FUYA 4C0SA 1ORTA 1CY8A 3ZHSA 1BMTA 3K0CA 3BJEA 5EWMA 2D1FA 1JKXA 2I6SA 4WVFA 5LBIA 3RUFA 3I9V6 4LBZA 3CVJA 3H9UA 4M7OA 4YALA 3W6PA 5C8YB 4BRZA 4BGEA 4N6NA 3TSCA 3DGEC 1CJSA 4OP3A 1RHJA 4XQEA 2WA1A 1YU6A 3MCTA 2GGSA 3QYFA 4RLHA 3CZCA 1Z45A 1JIKA 1E2IA 3UJAA 1H9BA 5ALLA 4ZYUA 5CR9A 3B1ZA 2XE7A 4GMKA 3QKTA 1Z6PA 4BNDB 5B7GA 1C2YA 2GJSA 1G8AA 3I9MA 5DX0A 1RRFA 1Y1RA 3VV3A 2B8TA 3CONA 2ZJ4A 2ZB3A 3FOWA 4FINA 3VO2A 4FJ0A 4XGIA 5C37A 2ZTVA 5J1SB 2QT0A 3MZ0A 1NMEA 3CMMA 2DLCX 4HTFB 5ALRA 1E59A 2VBFA 3OFJA 4UHFA 5ILQA 1PSZA 4F97A 2XUQA 4CKBA 1RWQA 5FNVA 1NPDA 4YUZA 3NDJA 1FX0A 4Z54A 2VNHA 1FS5A 4BECA 4E21A 1AA9A 2QTMA 3DC2A 4ES6A 2Q29A 4NZZA 3GI1A 3GPDG 3KSUA 2ZZNA 3UOGA 5TPWB 2JFZA 3PCXA 4ZVQA 2KJ