1B42A

Vaccinia methyltransferase vp39 complexed with m1ade and s-adenosylhomocysteine
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
297
structure length
291
Chain Sequence
MDVVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Methyltransferase
molecule keywords VP39
publication title mRNA cap recognition: dominant role of enhanced stacking interactions between methylated bases and protein aromatic side chains.
pubmed doi rcsb
source organism Vaccinia virus
total genus 98
structure length 291
sequence length 297
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 1999-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1b42A00
3CKKA 2ONYA 2Z6UA 2OZVA 4HGZA 3RIEA 5K0EA 1F3LA 3CC8A 2I7CA 3FRHA 4IKPA 4M7RA 2HR1A 3R6TA 4YUWA 4WXHA 4P7FA 3CGGA 2H00A 1YFLA 2PBFA 4P7KA 1N7JA 2I62A 4QTTB 4C03A 2PXXA 4RTOA 2C7OA 2BZGA 3EMBA 4FSDA 3ER9A 4EKIA 2V7EA 4QPNA 3HVJA 2OB2A 2PWYA 4C05A 4GUAA 4P7JA 4MQ4A 4E31A 1D2HA 1YUBA 4C08A 4KDRA 1KR5A 5DTMA 3WSTA 1SUIA 3IYLW 3B3FA 4PCAA 5E1OA 3H2BA 4RSRA 4YUYA 3FPEA 2ZBPA 4QVKA 4X60A 2IP2A 3UBTA 2XBMA 3CBGA 5DX8A 1NW6A 2OYRA 2PX5A 3BXOA 4X41A 2PXCA 3DP7A 5K0FA 3A25A 3HA5A 3M70A 3FTFA 3NTVA 2BM8A 1D2GA 4H0NA 1JQEA 5ERGB 4ER3A 1RI1A 1FJXA 4PYNA 2ZVJA 1H1DA 1EG2A 3KHKA 3SR4A 3I64A 2Y1XA 3G89A 4ZTBA 3LPMA 3P2EA 4YUZA 5FA8A 1R8XA 1X1AA 3G2MA 4K6MA 4PGHA 5DTQA 5LQJA 5LQCA 1KPIA 4PNEA 5DX0A 3UA4A 1HMYA 2GH1A 2IBTA 4FR0A 2VS1A 3R0QA 5EZQA 3SGLA 1NW8A 3G8BA 1QAOA 3HA7A 3JWJA 3P8ZA 3PFHA 5EOVA 4DQ0A 2G1PA 3PB3A 5ICEA 1AQJA 3UJ8A 4DF3A 5DLYA 4M37A 5FWAA 4AZWA 5EZSA 2HWKA 5CVVA 3DXXA 4BY9E 3LCUA 4A6EA 3FUUA 5GM2A 1L3CA 4POOA 5EKUA 2NP7A 4GC5A 2IDKA 1BC5A 5EHGA 3O7WA 4QVGA 4GOND 3GDHA 3M4XA 1JG3A 5EMKA 4C06A 4DCMA 5HZMA 4YV2A 4FSXA 1ZQ9A 3HVKA 4M36A 1KP9A 3NJRA 1JSZA 3MQ2A 4KVZA 5P8WA 4AX8A 3R24A 3BGIA 2ZTHA 5KVAA 1EIZA 3P9CA 3X0DA 4BLUA 5DRTA 3C0KA 2Z6QA 4AUKA 5DM0A 3HCBA 3TRKA 2G70A 2OKCA 3E23A 5E1DA 3KQSA 3S68A 3DMHA 3LGAA 1RJFA 2XYQA 3OZTA 3BGDA 3DUWA 4WVLA 1NE2A 2ZWVA 1X1BA 3NWEA 1L3IA 2IPXA 1N7IA 3I53A 3TOSA 4RVDA 3OU7A 4DM3A 3FUXA 2ZULA 3HEMA 1XCLA 1JG2A 1VL5A 2NYUA 3QOXA 3PX2A 4Z2YA 1FP1D 4RTMA 3P97A 2ZZMA 3EEOA 4QQKA 4L7VA 4YUXA 1JTFA 1G60A 1WG8A 4V0RA 1PJZA 3LKZA 4AZTA 2NXEA 2O07A 2YXDA 2AN3A 2NXCA 2P7IA 3BUSA 3P71T 4FGZA 3THSA 3AY0A 5E9WA 3E05A 2VDUE 3KQVA 2AOWA 3TLJA 1NBHA 2YR0A 4GEKA 3P2IA 3LDUA 3KQWA 3IV6A 4RVHA 2B3TA 3JWIA 5EG5A 3UJ7A 4BP1A 3OFKA 2BR5A 3KR9A 3BWYA 3NW9A 4KRGA 3P2KA 2PGXA 4P7GA 1T43A 3GRYA 5GIPE 3RODA 3A27A 4RTPA 2UZ4A 2OXTA 2JG3A 1YZ3A 5KQRA 2NNWB 2LD4A 2P41A 2F8LA 3BKXA 3DULA 2P1DA 5DPMA 5EIWA 1WXXA 1FP2A 5HOQA 4ISCA 3DLIA 3FTEA 3CJRA 3MCTA 1VPTA 2BR3A 4RV9A 1RI3A 5EPEA 5E1MA 2YQZA 3SX0A 3OU2A 2G71A 1RI2A 1BKYA 3HNRA 2PVCA 3G2OA 3L8DA 4FZVA 3NWBA 1KXZA 4QDKA 1IY9A 3HCEA 1WS6A 4HH4A 4ATNA 3KR0A 4PYOA 2H1RA 3LSTA 3GU3A 5ICFA 5T6BA 4AZSA 5M5BA 5FADA 2CMHA 3UJBA 2N47A 5FWDA 3D2LA 3G5LA 3IEIA 3FPGA 3UJCA 3EPPA 3ERCA 4QTUB 4CTKA 1ZHFA 1UWVA 5DM4A 4DA4A 4RVGA 3KQTA 3OE4A 4XUDA 3LBFA 3GO4A 2GB4A 2BM9A 3TMAA 1KPGA 1XTPA 3FPFA 3GXOA 5DTRA 5K0JA 1XDUA 4C4AA 5DRYA 2PXAA 5K03A 5CUQA 5DM1A 5K0LA 3B7PA 2GPYA 1ZKDA 3ELDA 4JXJA 4RX1A 5FHQA 3SSOA 3T0IA 1N2XA 4RTLA 2VP3A 2P3OA 4Y2HA 5FCDA 4HC4A 3G2QA 4KWCA 4RTKA 3GNLA 3PTAA 1XDZA 4QDJA 4DKJA 1MJFA 5E8RA 3GRZA 2PY6A 5C9ZA 1NV9A 5HFJA 1YZHA 3LCCA 3OE5A 3VC1A 2C7QA 3GGDA 2PV0A 3DMFA 2P35A 4RTRA 2IIPA 2E5WA 3EVDA 1JQ3A 2HMYB 5KS2A 3GRUA 4P58A 1JSXA 1AQIA 3MTEA 1WXWA 3C6KA 1VIDA 3HVIA 5EC8A 3R3HA 3RW9A 3OU6A 8MHTA 1ZGJA 2ZW9A 3EMDA 5HILA 3SXJA 2R3SA 1KIAA 1VLMA 3EVBA 5DT2A 1O9GA 2IGTA 3KPJA 2ZWAA 3MCZA 4MIKA 3HVHA 4R8SA 4U7PB 5EMJA 5CVDA 5EGSA 4LWOA 2IBSA 4V0QA 2CKDA 3T7SA 3DXZA 3ANXA 4QQNA 1R00A 1R74A 1U2ZA 1KPHA 4BLWA 4C07A 2G72A 5CVEA 3OCJA 3EVGA 3KQQA 1G8SA 1QZZA 2JHAA 3Q87B 4A6DA 3DOUA 2UYQA 2R6ZA 3MGGA 3T7TA 2PJDA 5EMMA 5KYGA 4QPPA 3DLCA 4GBED 1TW3A 3GRRA 2JJQA 3SVZA 5ICCA 4KIFA 4PONA 1TPYA 2OBFA 5JUWA 2PX8A 3HCDA 1VP3A 3Q7EA 2JH8A 3FZGA 5FQOA 3UJDA 4OA5A 3B89A 4PYKA 4FP9A 1YB2A 2O0LA 1QANA 2FYTA 2VDWA 1BOOA 4GF5A 4EQZA 4BP3A 2HNKA 4E2XA 5ICGA 1M0EA 3M33A 2AN5A 2PKWA 3HM2A 4OX9Y 2JHPA 2ZLBA 2AN4A 5HIJA 3EVEA 5DSXA 3G2PA 4RTNA 2Q41A 1R8YA 4OBXA 3THRA 3O31A 2C7PA 3P9NA 3UJ6A 3BWMA 1ORHA 5U4XA 3DH0A 3GIWA 5GIOE 3HTXA 1MHTA 3JWGA 4F86A 5E9JA 5EVJA 2B78A 2AVDA 5EIFA 3LKDA 3ME5A 5K0NA 4RVFA 3EVZA 4Y30A 4EMSA 4PWYA 2VDVE 2NXJA 2FPOA 2ZIFA 3GJYA 3HCAA 4ER5A 5CCBA 5LQAA 4YV0A 1P91A 3P9KA 2AOUB 1RJDA 4E30A 3LX6A 1P39A 3BKWA 3OZRA 5DXJA 2CMGA 1QAQA 3PT9A 2CL5A 5CM2Z 3V97A 4CKEA 5HIKA 1F38A 1NW3A 3LECA 3M6UA 3DTNA 1DUSA 5E2BA 2GS9A 3MB5A 2P3QA 1IXKA 2IDJA 3CJTA 4XCXA 3TR6A 1AV6A 3BZBA 3TQSA 1OR8A 2O06A 4U7TB 2YXEA 2H11A 3CVOA 1VE3A 2XVMA 3KPVA 3B5IA 3EGEA 4FT2A 4M38A 5K0BA 2AOUA 2GAFA 10MHA 2ZZKA 5T67A 3EVCA 4CWAA 4IV0A 5EEGA 2YXLA 2Y1WA 2YVLA 2EJUA 4OQEA 4X1OA 4RTJA 5IKMA 5GINE 2ZSUA 1EQAA 2WA2A 3FUWA 1RI5A 2UYHA 4LG1A 3IHTA 3VC2A 1KYZA 4PIMA 3TKAA 1SKMA 1NKVA 1XXLA 2AOXA 3E8SA 5D1HA 4DCGA 3BGVA 3DXYA 5F2NA 3DR5A 5K01A 3FYDA 2Z6AA 1DL5A 3KQOA 4NECA 4CKBA 3R9XB 1EJ6A 1VP9A 4R6XA 4FT4A 2CWWA 5CD1A 1INLA 4FS8A 2OY0A 5DM2A 2B9EA 4R8RA 4YUVA 2P8JA 2PX4A 2QM3A 4HGYA 4XUEA 3BWBA 1I9GA 2NP6A 2PWPA 5FHRA 3PLAE 7MHTA 3G7UA 4G56A 3UZUA 2GA9A 3NDJA 3VYWA 1B42A 2WA1A 4GOOD 2ZFUA 1KHHA 2ZIEA 5DX1A 5JR3A 2ZCJA 5MHTA 4OA8A 3U81A 4R6WA 4IWNA 1YF3A 3M6XA 2JH9A 3PVCA 4OQDA 5LR6A 3K0BA 4HTFB 3C6MA 5GP1A 4OBWA 1EAMA 1BHJA 4CXMA 2ESRA 5CCXA 3P9IA 2B25A 2OB1A 3B3JA 5EMLA 1NW7A 5BXYA 1G38A 4MTLA 1RI4A 3EGIA 3SSMA 3SSNA 3PS9A 2XYVA 5G02A 9MHTA 1JR4A 2AS0A 3FYCA 5GOZA 2UYCA 1YFJA 2FCAA 2YX1A 4EK9A 4EKGA 4YV1A 4PINA 5K05A 3BT7A 2KW5A 2EG5A 3ELUA 3M6VA 2IH2A 5EQJB 3FUVA 3KQPA 3M6WA 4O29A 3E7PA 3AWIA 4HTFA 5E8JA 1XJ5A 3AXSA 3O4FA 1AF7A 2FRXA 5FUBA 3KPWA 2DPMA 5IH3A 3UFBA 3CJQA 3UJAA 1G55A 3OFJA 2NXNA 1IM8A 1JG1A 3AXTA 3B3GA 3ORHA 4BLVA 1O9HA 4X63A 1L3BA 4UOEA 3CCFA 3KPUA 1JG4A 3JWHA 1HNNA 1SG9A 4AZVA 1WY7A 2QYOA 4LECA 5HIIA 2O05A 3SM3A 3G5TA 3REOA 1RJGA 3MERA 2G8NA 5GM1A 4E32A 3HCFA 2AOVA 4PCLA 3NVMB 1Y8CA 2HTEA 2OPBA 2AZTA 1XVAA 2QRVB 3LDFA 4GOMD 2GLUA 3NDIA 5E9QA 2IH4A 3DMGA 4RWZA 4DZRA 2A14A 5LQNA 5F2OA 1I4WA 5LQUA 2V74B 1I1NA 2EX4A 5D1NA 2AOTB 4MHTA 2ONZA 2AR0A 4KDCA 2I6GA 1D2CA 1R18A 5KQSA 2FHPA 3EVFA 3GWZA 5FTWA 5K8VA 3C3YA 3FRIA 3V8VA 4C04A 5BP7A 2IH5A 2QRVA 2JHCA 2O57A 5H02A 3GRVA 3TKYA 3LL7A 4LWPA 3ELYA 3KQYA 5C0OE 1VBFA 2HV9A 1DCTA 2ZZNA 1XCJA 5B1SA 2AOTA 5EKXA 1UFKA 5K0CA 3I58A 1JTEA 1NW5A 1SQGA 2PT9A 1Z3CA 3LBYA 1P1CA 2IFTA 3G8AA 5E2AA 5FULA 4PYJA 5BW5A 3FUTA 3PFGA 2XYRA 1WZNA 3A4TA 4PGGA 2ORED 3VSEA 1FBNA 4DMGA 3KR2A 4PIPA 3A7DA 4ER7A 5LQKA 2EJTA 4CTJA 1M6EX 2QY6A 2XVAA 3KU1A 2I9KA 1ORIA 2FK8A 5LQRA 1P1BA 5E1BA 4HG2A 4PYQA 3F4KA 4KIGA 2YTZA 3HA3A 3FPHA 3QOWA 2DULA 1SVUA 2B2CA 2ERCA 3ELWA 3LDGA 1ZGAA 4R05A 1NV8A 5EEHA 1V39A 5EHIA 4GC9A 4MWZA 4ER0A 2BR4A 2P3LA 4E33A 1JQDA 4PYLA 5F2KA 5HEKA 2PLWA 3EGVA 1NBIA 4CKCA 3EVAA 3UWPA 3ER8A 4HRAA 1O54A 5FQNA 3KPYA 5CVUA 4E2WA 2EFJA 4E70A 3MHTA 1RJEA 3G88A 2PT6A 5T64A 2AVNA 4E2YA 3UJ9A 1UIRA 3BWCA 2P7HA 3EEYA 1R6AA 3TM4A 3AJDA 3SMQA 4B17A 4F84A 3TM5A 2ADMA 3OZSA 4X61A 3PX3A 5C1IA 5K0GA 2OO3A 2ZBRA 3I9FA 2PSSA 4KW7A 2PX2A 5K09A 1SQFA 3NVKI 1QYRA 5CIYA 1G8AA 4ER6A 5GWXA 3GCZA 1Q0SA 5FA5A 1G6Q1 1SUSA 1M6YA 3UA3A 3HCCA 3FTCA 4IV8A 2K4MA 1XDSA 4GOLD 1L9KA 1FPQA 5CVJA 3TPZA 2YUIA 3I5UA 4PYMA 3KKZA 3KQMA 2ZBQA 2WK1A 4GQBA 3A26A 5BW4A 3C3PA 3A7EA 3LCVB 5DWQA 4YMHA 4PYIA 1VQ1A 3MAGA 4RTQA 1PRYA 3FPJA 3OPNA 1X1CA 1Q0TA 2ZIGA 2QE6A 4HSGA 5DSTA 2UYOA 3HP7A 1X19A 3T7RA 1ZG3A 4EVIA 4RTSA 3QV2A 4F85A 3KR1A 4RYLA 2P40A 3TFWA 4YMGA 2BH2A 1QAMA 4E2ZA 3K6RA 2C7RA 1X1DA 3NMUF 2FK7A 3MTIA 3LHDA 1NT2A 4XUCA 1EJ0A 1TW2A 3FTDA 3ID6C 5HIMA 5LSAA 5DXAA 1L1EA 2VZ9A 1KYWA
chains in the Genus database with same CATH superfamily
3V32A 1NVUQ 5AI9A 5EUQB 3O9MA 4EW3A 3RIEA 1H2YA 2MINB 1CTQA 1GG5A 1V8OA 1N7HA 3UOWA 1QFYA 3K32A 1TA9A 5ECWA 3RM3A 2E1RA 1C0IA 1ODIA 2ZB7A 1I2MA 3HKBB 3KOZA 3TZLA 4F71A 3TBFA 4GZMA 4EY8A 3OZXA 5BUZA 4P22A 2EBHX 3PXBA 1EVJA 1MMFB 3L4BA 3R5HA 2FNAA 4C05A 3NCHA 4ZKDA 4FYWA 3IVRA 2E2WA 4XX0A 1UBFA 4LNUB 3INYA 1PT5A 3ZWDA 5FWXA 3ND8A 3H2BA 4LGCA 1BX0A 4KR6A 1PW7A 3BL6A 5AK3A 4F8YA 5JNSA 1KGDA 1CR6A 5BV2P 2BFBB 3A9WA 4UDYX 3B8EA 3G0OA 5DX8A 4MUHA 1FP4A 1U4OA 2R97A 3LP6A 4U02A 4FMDF 4Q9DA 2IS6A 1JIIA 1MOSA 3D3WA 2PLRA 3BRQA 1AG9A 4V1CA 1ISIA 3NHPA 3SQDA 1W5AA 1M6VB 3CG0A 3N39C 4ZDIA 2Z95A 2Y1XA 2Z2XA 4NTZA 2YBEA 4MUMA 2YHIA 3T3EA 5C3MA 4M1EA 3S5JA 2C4TA 3L0DA 4HB0A 4M3NA 3WGQA 4E5NA 2WTAA 4QSHA 1W5BA 1D2EA 4DC1A 2QTFA 2PT5A 5CCDA 1NNEA 2IBTA 3ZY4A 1GUZA 5IJAA 4LC0A 5FPKA 4IJWA 4INZA 1L5HB 4C6SA 3DHNA 3ND6A 1J39A 1MVLA 2O2JA 1AQJA 2Q46A 1T4BA 4AZWA 1Q91A 3L4EA 1NVGA 3H3JA 4Q0MA 1RAHA 3N3AC 3W05A 4B3HA 4DAOA 1IN1A 3Q9UA 1P0QA 1OZHA 5HGJA 3THRA 3K09A 4POOA 4V0OA 3SDZA 4MR7A 3AUTA 1GZUA 3O7WA 2OILA 2GM4A 4YLYA 3CONA 4QAQA 1D1PA 5AI8A 4X45A 1NVVR 2VA9A 3OOEA 4WBXC 5DBHX 3ZV5A 3BF7A 3OWHA 3BREA 4XYBA 1ZN8A 2J30A 2VDKB 3FHLA 3O0DA 5DBFA 3VSBA 4DOMA 1FB5A 3D81A 3CNOA 2QX7A 1MORA 2JAPA 1DIRA 4GG1A 1J0XO 1BU8A 1SELA 1SK8A 1UC9A 2BTQA 2HBYA 1ZAKA 2HA3A 3E23A 3QVXA 5E1DA 3V1NA 2D5LA 5K3OA 2ZRNA 3PTLA 3LGAA 1RJFA 1EHYA 2XYQA 3L04A 1ZICA 2BI8A 3R3JA 4UTPA 5F7OA 3UCFA 5CB8A 1N2IA 1QK4A 2IU3A 4YDRA 3TW8B 4OI0A 5A9SB 3LPCA 3ZGOA 1MOQA 1V3TA 1KVSA 4DMLA 4RS3A 3VU9A 1XMSA 2A3NA 2EKDA 2AJ8A 4QPZA 3LA8A 4IUYA 1ZNXA 4PFJA 1SOUA 3AVUA 3KJIA 3CKLA 3G49A 1W96A 2ZYDA 1IXZA 3DTTA 1WG8A 1EP9A 3H5OA 3RVSA 2BZ0A 2Z58A 2DFDA 2VJMB 3R7WA 4FGZA 4Z0TA 2GAIA 4CLRB 1D8AA 4IOMA 1N0UA 4EPXA 5AM0A 3TQQA 3LDUA 2Q5JA 1P77A 1XYGA 1UPXA 4BP1A 2JJ2D 4N6NA 3GRAA 4W8OA 4AX4A 3HM9A 3WLKX 4M98A 4U2BA 3P2KA 4G01B 2ATVA 1T35A 1KZ6A 2PGXA 2Q8NA 4M9CA 4F96A 2V1UA 3L40A 4DZTA 1FRVA 1FYXA 2O0HA 3A27A 5DJ5A 5G41A 4PSVA 2OSBA 3ZXUB 1SUCA 2MU1A 2R4UA 3U7GA 1RHJA 5JFTA 2VCEA 3C24A 3CWZA 4NV1A 5H3CA 3UW3A 3SLKA 5IJ9A 4R2LA 5CT9A 3UTDA 3WL7A 3CJRA 3PXGA 4BYMA 4DJDC 3ASYA 4M7WA 2H1WA 3WV5A 1GZ7A 4RDCA 2G71A 3G2OA 1IN8A 1D2RA 1XHFA 4UAVA 2CLEB 4ENQA 1VDMA 3AHDA 5BWCA 1L7QA 3GC6A 1MLDA 1NVFA 1SBIA 5DYWA 3T1HB 4BRZA 4OYYA 4RQTA 4TLAA 2B4RO 3HGTA 4LJ9A 4I2VA 2NUAA 3HP1A 3D2LA 4IDCA 2Q4TA 4MHOA 3T1NA 3DYVA 3BRWA 4I4LA 1J6UA 4M83A 1FNCA 1KI6B 1EBFA 2FRVA 3GGGA 2QLJA 4GGMX 3DLAA 1VHQA 4QBKA 1MN6A 4WBNF 3IL2A 3JZFA 1PJTA 2R6DA 2A0KA 4B47A 3LBFA 1G21B 2UUAB 1R6UA 4B3FX 1VLVA 1H4VB 3D1LA 3G0DA 3M1IA 4ZPXA 1AMNA 1NJ5A 4CZ2A 2JRCA 3CRVA 3UWKA 2H4YA 1ZISA 1V26A 1BJKA 5A7HA 2P68A 2SHKA 3OT5A 1HLPA 1KEZA 1LK7A 4HDRB 1GU7A 2HUNA 3NYIA 1PQ4A 1YDWA 2GPYA 2ROQA 1PJAA 5J2TF 4E5SA 3A2LA 4DIOA 4NJOA 2GD6A 4LYGA 3C85A 1COWD 2NAPA 2PS3A 3GEHA 4G5XA 1U2GA 1M1UA 3D1JA 4H77A 3THYA 1XDZA 3L0SA 5F7ZA 3GRZA 1UMDB 1QIGA 2PMFA 1Y3BE 2J3DA 1KEWA 1P9LA 1Z0IA 5DV9A 4JSRA 2E5WA 4I8XA 5FFNA 3PGMA 2QN8A 2AH5A 2HW8A 3DR3A 4YJKA 3K94A 3CVVA 4X93A 4YJHA 4HAIA 2VPXA 4FYHA 3H6GA 4MGKR 2DEUA 1Y34E 2Y2VA 4UJ5A 1EGHA 4NDZA 2IKSA 1P3DA 3GG9A 3OOSA 1SC3A 2CNWD 3W2TA 1VKJA 1E3EA 1CZKA 4Q37A 4ZK2A 4M87A 1WW8A 3HNPA 4G1UC 2YZNA 3WC4A 2IBSA 1TDJA 2QTBA 3BMCA 2XDAA 2GBFA 3AG5A 1ZRSA 3Q6IA 4JCCA 3WFJA 4WKCA 2OV1A 2R8YA 3OSUA 1P4AA 4LFCB 3ZXYA 3AIOA 5F35A 1U2ZA 4JQOA 3SDBA 4K8RB 2QENA 4YPVA 3BXGA 821PA 2CVHA 3PUZA 2RB5A 3NAMA 3Q87B 4FYKA 5E6SA 2E4YA 2X5XA 1A04A 2JVJA 3ZWYA 5BSVA 1IUPA 1UDBA 1U80A 1L4YA 1FXWA 1U9YA 1NYRA 4PXYA 4DDTA 3HCPA 4EKYA 5M3BA 4ROSA 4CDMA 1QQBA 2AMJA 4C0KA 1K97A 3FFBA 2XTMA 3GL9A 1MR3F 4L6AA 1X39A 2D4AA 3OTWA 4O4JF 4PQFA 3UFXB 1XOIA 3NHFA 1KY3A 5LA6B 1HYBA 2C8JA 1NM5C 2OCYC 1QANA 5KO2A 4L57A 2CDNA 1K9SA 4W9NC 2Z1NA 4GO1A 4HJXA 4EA7A 1M72A 4OXXA 1ZWKA 5G4KB 4UD2A 4EYOA 3SEAA 3CR8A 2C1ZA 2ZU0C 3QUTA 3NV7A 3O94A 3ETNA 4AG6A 2SKCA 4DV5B 3MOGA 3TSCA 4DBLC 1E2EA 4BX9A 3OPXA 4DPLA 2W7TA 3BWMA 3VRHA 5LL6P 1IVYA 2PRJA 3GIWA 1ECFA 8LDHA 5GIOE 5DHSA 5JCOC 2HK9A 3EY9A 1U8XX 2VH2A 2JGIA 3FBWA 3BOSA 3GLFE 2D7CA 2NM0A 2H2IA 4G67A 5K0NA 5KOYA 3CF0A 3WGJA 4EJ6A 2E7ZA 2GN1A 3WDMA 4I8IA 2NU6B 3VTKA 2KBFA 1GL9B 1U9CA 5HR5A 3H2GA 5GQSA 4CLHA 1PHRA 4L0CA 4RQBA 1RYYA 2XPCA 3D6NB 1JDZA 4I3HA 1C7JA 4NZMA 2RCNA 2NO1A 1EUYA 1S2NA 1RXIA 2JB9A 3GD5A 1TO2E 2VK2A 2O59A 3QU5A 4YYZA 1B6RA 3JATA 1KXJA 3OQOA 2X41A 3IIKA 1DXYA 1SD1A 3JR3A 3LECA 3Q5EA 4RGVA 5ECYA 2GS9A 2VDRB 4ZEVA 5J4VA 4Q66C 1D8TA 1VC2A 4JC5A 4CDRA 3ZVLA 3E22B 1Z13A 5LYYA 5SY6A 4U7TB 4F5DA 2H11A 2CD9A 5KKNB 1RBQA 2ZDGA 2DTEA 2C4UA 3PR1A 4RADA 3I6BA 4OP2A 3KBBA 3R0XA 3ZNQA 4J0EA 4B3GA 2B30A 1WNFA 4XB6B 5CNIA 5HXAA 1KEEB 3JAKB 2PLNA 1A72A 5GINE 1Z33A 1RQ7A 2ZSUA 4M60A 3SBOA 4OFWA 1N8TA 5KCMA 3SPXA 3PDIA 4EHIA 4HQNA 1UBEA 4YAIA 3H2IA 1VZ3A 1GAWA 1DQPA 3EMVA 3OE1A 4RZIA 1PWYE 4H7EA 4EI9A 4HWOA 1YBHA 2PRZA 2X9GA 4HY3A 4MPRA 1E0KA 2WV7A 3K9QO 2ZI5A 3AFHA 4O4HA 4EI8A 1JPJA 1Z4IA 1XXLA 3LX8A 4MI6A 4DMRA 5AKLA 2ZJ6A 1VI5A 2YJNA 4FVTA 1R6TA 4Z9XA 3Q8MA 1Z8DA 4KQIA 1ETUA 1KMHA 1PGPA 2CFTA 1K6EA 4OF4A 2WD8A 4W99A 4B5LA 1R15A 4H1TA 4MJXA 3TQOA 1LB1B 4X3CA 2HJWA 4MYRA 5CB6A 1SKYE 2NP6A 3FBGA 3QBEA 4J8PA 2P2SA 2L19A 3G7UA 5GGXA 5E38A 5JBQA 1YRLA 3EXEB 3OMLA 4NENB 2AXEA 4L73A 4WECA 2CL0X 5JR3A 1FTNA 4EJSB 5JEDA 5MHTA 1BJTA 1O8BA 1UBRS 4Y9TA 3QWHA 3FB1A 1J2TA 4MP8A 3H1FA 3M4ZA 5FO1A 1YVRA 3JRXA 3WL8A 4EGSA 2VUSA 5EJ6A 1SD5A 1GITA 1HYGA 1WR8A 1UJ5A 2DLNA 2JH9A 3VTAA 4BVGA 4ZMSA 5L95A 5THKA 3OPMA 4WNCA 3LC1O 4HTAA 5C5CA 5KTYA 3OFNA 3IJRA 1TQDA 4WINA 3V7NA 4ZARA 4UE2A 3C45A 1E7YA 3ZH2A 1WSDA 3V8EA 1KO5A 2AG0A 4XVHA 1FW8A 4IHQA 2REQA 4EK9A 1DBIA 2TECE 2EFDB 2QB5A 2PEYA 1RWNA 3ELUA 3PXUA 1VE9A 3FR7A 2V4UA 2NSYA 1T4CA 4OJMX 1KO7A 1ANKA 1MRZA 4PGFA 5EMHA 5JC8A 2HCBA 1CJBA 2E0IA 4HHEA 4JEMA 1IK6A 2YWFA 4G37A 5FBZA 3RCBA 3UJAA 4BEVA 4IJ5A 2HSJA 3TL6A 2V65A 2WKQA 4R01A 3C3JA 4GMHA 4F3CA 1T1RA 1V6SA 3JWHA 2VAVA 4C6HA 4R68A 1XP5A 4DUPA 1G41A 3TZBA 4EABA 4Q5IA 4IDAA 1CYDA 4PCLA 2ZRAA 2ZU6A 1UDWA 1G8PA 4JLUA 1I5RA 4O2AB 5ALLA 1Z16A 2I65A 1JXMA 3LC0A 3NC4A 5K6AA 2GLUA 4JUCA 2WNSA 3K1TA 2QA5A 4W5WA 2RMKA 4IXWA 1QP0A 3KUCA 2AQKA 2BFDA 3NAZA 3OVMA 4OK6A 2AOTB 3WB1A 5MGNA 1RHRA 1GTG1 3VZCA 3VDXA 1RKUA 4G1FA 3UF0A 2J5XA 4CLOB 3RT9A 5CXSA 3BK7A 3IDFA 3U7QB 5BNFA 1MRSA 3KDPA 1OOEA 6ABPA 3IQGX 3ZCRA 1E1MA 3NHMA 4ZI2A 3D2AA 5IU6A 2FPPA 2XEDA 3BHIA 2ATIA 3ISVA 4B1FA 3QVGA 3V9PA 1SWWA 1KOJA 4HX9A 3AUJB 1V1RB 4E5PA 4A0QA 5B1SA 3H9BA 2YHSA 3A6KA 4CN9A 1OV4A 3HR7A 1HZJA 2PT9A 2PJRA 1GZHB 1Z3CA 1N2SA 2IFTA 4II2A 1KE2A 2W70A 1E18A 1NQXA 3FUTA 4KNWA 2XE6A 2ZRCA 5ENZA 1NUAA 2GRJA 1ID1A 1K7FB 1ODTC 2ONCA 4HAUA 3R74A 1S3FA 2AC4A 4IGAA 2A9PA 4ZZ3A 3W5DA 3UB2A 4J1NA 5DDIP 4WFJA 1HNWB 3USZA 3VR5H 3C8ZA 4CT0A 5E1BA 5K0LA 1O96B 2QW0X 2A1TR 2J85A 5E0KB 2VYND 1JKJB 4U2KA 3SF8A 4MAFA 4KNYA 2PH3A 1Q1ZA 1G9SA 1VKRA 3KHSA 2GI4A 2A30A 4B6FA 3IQDB 3GZ4A 4EDHA 3QX8A 3UWPA 2VWGA 1ILEA 3SVLA 2VNKA 5T64A 3WXBA 4ZVMA 4QELA 2KM1A 3BE8A 1D1SA 3KZNA 2YXPX 3TOXA 3TM5A 5F3WB 4FMCF 2Q0XA 4UHJA 2XLCA 1GAQA 5H9VA 4KOEC 2YYZA 4QXQA 2X5JO 2HY7A 2CWDA 4EYSA 1PR1A 4BMZA 3ZU2A 5K20A 5CIYA 1ECGA 3S7TA 1DJQA 3KJHA 4QATA 3ANYB 1DRKA 1UPBA 3KRTA 2PKEA 1G5HA 1XDSA 4KMSA 1HMPA 3THXB 3ZV3A 3SY8A 4JI0B 3EDCA 5CH8A 3CPJB 4PYMA 4UVEA 1PZFA 3JYOA 4LZJA 3TS1A 1WZEA 5ARDA 1LUAA 5ESXA 1H93A 4I9FA 1RYZA 3MA0A 4NJMB 2GM9A 3OJOA 2ILTA 3W2FA 5GZ3A 5G0TA 5B7QA 1YR6A 1IAQA 3R09A 4RTSA 1E60A 1B15A 3NJ8A 1QDUA 2GVDC 5IN4A 1W59A 1W4CA 5AP9A 4ZCLA 2DF8A 2TMGA 2D4HA 1EKXA 2CF6A 5EFOA 3DAYA 1ZUNA 4A0FA 1BZYA 1NAIA 1NT2A 4XUCA 5EWLA 1PNVA 1TW2A 4E5DA 3VM6A 1ML4A 2QKYA 5FWYA 3DOCA 5LP6B 1IPHA 2V03A 3VUFA 2WZDA 4ZO6A 2JAUA 1F9EA 2ST1A 3CKKA 2D5AA 4HGZA 2HL6A 3T7JA 1NY5A 3UQYS 1V4NA 5AICA 1P7ZA 1FRZA 4P7FA 3BS4A 3UGKA 3W4JA 4A26A 4IYJA 1U4NA 3B9QA 4FS3A 3RV3A 4EEXA 3PQ5A 5JCZA 2DR2A 5B58C 5KIAA 5AQEA 1FPMA 1JWAB 2PXXA 4KWHA 1ZH0A 4OGLA 1LTHR 2RBKA 4L0MA 1LA2A 4PG6A 5AI6A 5L6LB 3ZDYB 4OO3A 1G7RA 1EXWA 4GXQA 4QBFA 4XASA 5WRFA 4LJ4A 4OXYA 3RS2A 2EKBA 4U00A 1HFJA 4KDRA 2UYYA 2C7BA 1TYEB 2L0XA 3CR7A 3HLTA 3WSTA 4LYEA 1GNTA 1SQ5A 2P0AA 1RABA 2Y76A 3B3FA 4YUYA 4D7AA 3NKLA 5JQGF 4KFUA 4X60A 2X9NA 3AHJA 4KFTA 4HVCA 2WJVA 1UDXA 1LKZA 2PX5A 1DTEA 2XF2A 4C3ZA 3G1UA 1J07A 3KLNA 4Q7MB 4FGUA 6Q21A 5DLDA 4QQ8A 5J5VA 3SC3A 4Q1BA 4B6QA 2VBFA 3IT1A 3VGJA 1FYWA 3ED5A 2WLTA 2BN4A 5A4MS 1KDZA 2IYLD 2ZQ5A 3GQVA 3IX7A 3JCZA 5F73A 1OBVA 3IAHA 4AJOA 1KQGA 2O2CA 3A1DA 4XI9A 4PR0A 2JDIA 1UOQA 1QORA 4R98A 3JVDA 1ZC3A 2ZAIA 4DDVA 4TV8B 1PYDA 1QGYA 3ESRA 5FBHA 3KOXA 3QY9A 1QDEA 2ZJ3A 1GTL1 2FEWB 1A7JA 5KQMA 1N1GA 2PZKA 5EZSA 1ZESA 4PLVA 1ZNYA 4CJXA 2B69A 3DXXA 3EXFA 1L7OA 2O1WA 2BFWA 2WI8A 3OCUA 4A6EA 1I5EA 1ONPA 4AJEA 1RWXA 4GQAA 1BMTA 1XROA 2ID8A 1FY2A 1SVMA 4WNAA 3SJAA 3BD7A 3F8WA 3IA7A 3QVSA 1IMOA 2UZ1A 2JGAA 1KGSA 4G41A 1YIDA 1ZC4A 1OH7A 1C1HA 5KZMB 2QI9F 3BGIA 2J9XB 3WWEA 4W9NA 4WE3A 1SUDA 4I6JA 3TTXA 1T9CA 2G9QA 2CLHB 3MS2A 4PRKA 2OT3B 3JVVA 1VJTA 2QTHA 3DB2A 3HBNA 1O08A 1MW9X 3I6MA 3S68A 5KWEA 4BVJA 2XCSB 1V3QE 1L8QA 5IT5A 3DZHA 4DCVA 1CUBA 3BGDA 4RZ2A 1HL3A 1K06A 2XSZD 3O03A 1X1BA 5JROA 4YACA 3H1AA 2FPIA 1Z0SA 1NULA 4QRIA 2RAVA 4B82A 2ZULA 4MKGA 1Q19A 1VL5A 2RGNC 1ZD4A 2GEDA 4NQRA 1OZ0A 1QQ5A 3HDGA 3IOYA 3P97A 4TS9A 4JITA 1WUKS 1KEUA 3E7DA 3JALA 3VHLB 3VV2A 3DW3X 2JGKA 5K7SA 4IGFA 4JEIA 3G6KA 2GJSA 3OWXA 4QOGA 2OV4A 1QHSA 1P4GA 2Z9DA 3JQ9A 3AWDA 3BFVA 3CU5A 3L7KA 5IJ0A 3U44A 2QDKA 1WZ2A 4XD7D 4C0SA 3WRYC 3K6SB 2F1JA 4R3UC 1FSPA 2E4XA 4EF5A 5LXTB 1RXCA 3SCZA 3BDIA 3WDLA 1CS0B 1X70A 1FYVA 2QLTA 2W2KB 1ORDA 2FP4A 3LZCA 7GPBA 1Q0LA 2CLKB 5LU8A 5I7SA 1WUHS 2F4VB 3QXGA 4YRRA 1VHDA 1W35A 1GZSA 2IPLA 2IYQA 3NM4A 5BR7A 5FWNA 4Y1RA 4IXTA 3MILA 4QXRA 2X9QA 3NG1A 4QWWA 5EE9A 2A9OA 1G2QA 4YMVA 1I36A 3D02A 3F1LA 5AR1A 5LOVA 5DCWA 1C9JA 5ELMA 3UJ6A 2IHZA 4NC9A 4OJKA 3NWBA 3WGGA 4OB6A 4GLOA 4HH4A 3W6UA 4AZ3B 2YC2C 2W98A 3PGA1 5AFSA 4UFPA 4B5KA 3EZ6A 3G7SA 4BJ3A 1TADA 1UXJA 2QD2A 2AJTA 3G2LA 4B9AA 3Q1KA 1QJCA 2N47A 3BF8A 3A9UA 2F59A 1QUFA 5B2FA 4URWR 1PTKA 3G5LA 5IRCD 4DLKA 4QFBA 2H4JA 5KNBD 2FFJA 3GARA 2DWUA 1EGQA 3DB1A 1WBJB 3WV4A 3IDAA 1EGMB 4BIIA 1R0KA 1O95D 4KAXA 2HQ1A 3OZUA 3KP1A 3PNMA 3WLTA 3RTBA 1JJAA 3AP1A 5GONA 3G23A 3QV1A 2IEIA 4PN7A 1DTSA 4JP3A 1TYCA 2QRZA 3PNQA 4D0NA 5I4KA 5BRAA 3OEHD 1CF2O 2YYSA 3ELDA 3QLEA 5E7MA 1M3SA 3W1EA 2AXNA 4YP1A 1YWGO 1SCJA 2OAP1 4WKOA 4XPZA 4KLCA 4E1BA 2FMFA 1HBJA 3L8HA 1NHWA 4TXMA 5ADWA 1EESA 4ZVVA 2CZGA 4MUIA 4D9FA 1C81A 1UWLA 2BP7A 4C43A 3FYHA 2VJDA 4FCCA 4ND4A 5AK5A 4Y0VA 4IHKA 2O8NA 3S1AA 4DLUA 1Q0RA 4AJPA 4DMFA 1N5OX 4DNOA 2OP0A 3SS7X 4W5OA 3OM0A 4R51A 2AQHA 2O0MA 2D5IA 3MTEA 4OGFA 2VDNB 2AWNA 1CUHA 1QXSA 2IYXA 2QDXA 3ILXA 1XN4A 2XZTA 3V48A 4EY5A 1HTTA 4NX2A 5B30A 3T12A 5HILA 5EYPA 3RHFA 5COQA 1IPEA 1U04A 2Z6QA 2I4IA 3K4PA 4F6LA 3IBYA 1J06A 2YL2A 3LT4A 4RA6B 2IL1A 3ACCA 3P94A 1QH1B 2OGSA 3RVRA 1PIWA 3ZX5A 2CKDA 5JDCA 1F9AA 3DXZA 3HKDA 2Q7OE 4AY3A 1YK0A 3IALA 4LYJA 1YHNA 4CM1A 1FRNA 1HGXA 2H1LA 4KLAA 4E5UA 4F3KA 1HT3A 1VG8A 4B3XA 4BQPA 2WSMA 4JJKA 3DOUA 1FDOA 1OWPA 1P1FA 3GR6A 3KAKA 5BURA 5C8VA 4I9UA 3DLCA 4GBED 2FEAA 3O84A 4HGQA 4KIFA 5JUWA 2XTNA 2LGJA 3A4VA 3HCDA 1FDVA 4TM7A 5JJCA 2HM7A 2OHXA 2XBLA 3N7AA 2ZSJA 5AXBA 2IS4A 1H22A 4G23A 4LGVA 4P54A 2YICA 1QHGA 1TL7C 2SCUB 3FE2A 5ENVA 3ZEAA 4GF5A 1E5XA 2JCXA 2JFWA 1UMCA 3G2PA 4F60A 1BWSA 1OUMA 3GI1A 2ZSBA 4DWOA 3E3NA 2XV1A 2LVBA 2HJSA 1K75A 3LRPA 4S1VA 4XYMA 3TSOA 5JLJA 5HNKA 2FJ0A 3WSVA 1YMVA 1OLXA 3JWPA 4WKBA 3B1FA 2VUTA 4FOPA 4S1PA 3K53A 4W1SA 2NTJA 1XD9A 4WXPA 4E08A 2R47A 4MQUA 1Y8ZA 2HPZA 3UY4A 1W0JD 4XW2A 1WL8A 3ME5A 2QUHA 4QREA 1D3AA 1HDZA 3JZMA 4GWKA 2VOJA 1FLVA 3E4CA 4Y30A 5AVOA 4L07A 3B1XA 1XPOA 1GR1A 3KKNA 3NGXA 2HJRA 2O20A 2F3QA 2RGCA 3JQQA 1N5MA 3A1EA 4JY7A 3IXMA 1NE7A 1J1UA 3D8HA 1DMSA 2Y1KA 3OKCA 5KTKA 3AK4A 4WNIA 4QXMA 4Z7JA 1DSSG 2BMAA 4MDFA 3D4IA 3DTNA 1WB4A 1AV6A 5E3HA 3PP8A 5A3JA 1KRWA 1AQYA 2O06A 3O1LA 4C7JA 3ZBPA 1X77A 2G6TA 3CVOA 4CETA 2HSEA 2JJ1D 2YS7A 4B3DA 4AQ7A 4XM0A 2Y8EA 2YVKA 3BL5A 5T67A 4D4MA 4G0QA 2HGZA 3IP9A 1ZW6A 2JBHA 4HUQA 5CFMA 2Y1WA 1U8CB 1W581 4WK0B 1N4AA 4RCZA 1PT9A 1UBGA 3S4YA 3KQLA 3G0HA 1WMFA 5C53B 1YE8A 5CX1A 4D5EA 1O5IA 2WILA 3IHTA 1XEWY 5CLGA 1EJ2A 2BV3A 2XVYA 4LX0A 3W5SA 1NKVA 4CLXA 3DBIA 1U1CA 2AOXA 3DV2A 4BLQA 3DR5A 1PDVA 3EGOA 3WQRA 5LYJF 4MUKA 2AJBA 2ZS8A 4Y6LA 2ZSDA 1YHYA 2WG0A 2Z30A 4FFOA 4IIEA 1ISHA 1U8TA 1YZVA 4YAUA 4XE5A 4MV4A 6GPBA 4XUEA 2X0NA 2C9BA 1SVWA 1P1RA 3QF4B 4UNQA 2ACKA 4BKQA 2VTKA 4YGXB 4B0OA 1W36B 2HLDA 1Y3AA 1XRMA 4Q3DA 2ECOA 4NYJQ 4MR8A 3D7LA 3O3MB 3QXHA 1FF9A 1E89A 1REQA 5FOTA 1P2FA 3RIGA 4Z4EA 4CKXA 3DBHA 2VSOA 1AQLA 2ZTVA 4GS5A 1SXIA 2HQOA 3WYBA 2FF5A 1NHGA 1NPYA 3W8EA 4C0AC 2LWIA 2FEXA 4HTFB 3Q7SA 4O0LA 1J9EA 4H3VA 4IL5A 1EAMA 1C0KA 4KR9A 3O4JA 3GLRA 1LS6A 1KFKB 2FGJA 2X0KA 3P9IA 1JT9A 3ESBA 3CVJA 1LLUA 3B3JA 4ALJA 1V5EA 3SSMA 1ZLYA 2GCPA 2Q9UA 2W22A 3JS5A 2IEGA 3OHSX 3PS9A 4BTVA 4D8WA 9MHTA 2QVCA 1I6MA 4B40A 3HXKA 1RLOA 2QX9A 5K51A 4KP7A 4DY4A 1C4XA 1N2HA 1J70A 4YDSA 5BSFA 3RIHA 5C2JB 2IH2A 4DMMA 5AH0A 3JQDA 1PWXA 2EW1A 3P0IA 1TZCA 2ZATA 3ANMA 3AXSA 1XRRA 1CRPA 1UZAA 5A71A 5EJEA 5IFLA 4Q02A 1G20B 1KVRA 3CJQA 3ORFA 3I5AA 1I80A 4IINA 2Q0QA 2WIFA 4BTEA 2A9FA 2I6QA 4MW2A 2FWJA 1HX7A 1TF7A 3KUUA 4C2TA 5DASA 3T94A 1CYEA 1O95C 5HIIA 3N5CA 2OXRA 1YJ8A 2ZSEA 4B79A 2X1LA 2FN3A 3T3DA 2JNWA 3CG4A 1DDIA 4LOHA 4P5EA 4UW9A 1WBBA 1KYYA 1SN7A 1MIOA 3K0AB 3UMBA 1EEXB 4BRWA 2V96A 3NDPA 5I4IA 2JASA 1C41A 2PCLA 3AYXB 4X9XA 5F2OA 4M9ZA 4QYWA 3GYGA 2HRRA 5EKDA 4W63A 2X4LA 5KTSA 1O1YA 3I2HA 3RGGA 1LNSA 3DMNA 3QHAA 1ODCA 3D6TB 1SU8A 3V8RA 2HIHA 3N2IA 3HU1A 4M9XA 4O3FA 3DTVB 3VAYA 1U7DA 2X23A 1JZTA 2JANA 4F4CA 2VNHA 2GARA 1Z2CA 3IEUA 1JA0A 4CKWA 1YKGA 2HO4A 2DUWA 4ZAWA 3ZCVA 1ISJA 1OMOA 4WA7A 2GSWA 4EVSA 2ZZNA 3K2BA 1XAHA 3FGZA 3TX6A 1KK3A 1SQGA 1GZ6A 1HETA 2FUKA 1JBEA 2LPMA 2YN4A 3ZDRA 1CD5A 5BW5A 3NX4A 4JI7B 2AW3A 4PFKA 2BGGA 4FZ3A 5E7QA 4PIPA 1UT8A 1SCUA 1E2NA 1NC3A 3TSAA 3RRXA 1EX6A 3GFBA 4C2BA 1YRBA 4CKCB 5G1OA 5LFAA 3RGWS 1CK4A 4MIEA 4A1OA 4Q3CA 4C4PA 3VX3A 1TKCA 3L8GA 4HG2A 3GP5A 1IB0A 2DULA 4G2NA 3QFHA 3RFCA 4BFLA 3NTOA 5EHIA 1JFRA 2CJWB 3K9CA 1O4VA 3N8NA 4R0MA 2PZLA 1P3JA 4XGRA 2ORIA 1DELA 4DA9A 1TC2A 3EIEA 3QUBA 1RC1A 1KI1A 2GCOB 2JLRA 2O52A 4FW9A 3IT2A 4H7HA 4LKRA 4S0XA 3WIBA 4R16A 2XCRB 1O54A 3U5TA 4UMFA 3RIMA 4DVGA 4F8JA 3HBFA 4KIUA 5L3RA 1DBSA 3EEYA 4DV6B 2BGMA 2O2DA 4Y67A 1CZLA 1S1MA 4UEQA 3EXIA 2ZYIA 1XR3A 4HEHA 3IO5A 4YMWA 3RAJA 1QPZA 5GZ1A 5K09A 1XCGB 4EUFA 3FMFA 1KDPA 2QM0A 1KJQA 3B1VA 4NR0A 1K0FA 1XZMA 1IC6A 2V6GA 3TLYA 4ZJUA 1FX0B 4BNGA 3ILYA 5B2ZA 3N6VA 5J2UF 3NOVA 2DFTA 1E6KA 3PCXA 1T36A 3RAPR 3PR3A 4L5BA 3IR5A 1PK8A 4DIUA 3HCRA 3C3PA 3C8HA 3K4HA 3OZGA 5DWQA 5HZKA 3UGQA 3MAGA 4U7GA 3P0JA 3GJ0A 1CQIA 1G3QA 3AF6A 5MFZA 4ZOEA 3RT7A 1ZGCA 4PTYA 3LT0A 1X19A 3EZYA 4DVJA 6LDHA 1FX1A 1VIYA 1VL8A 2P40A 5HTKA 1R4MA 1AGPA 5KX5B 4XTRA 3V46A 2BONA 2ZROA 1QAMA 2Y67A 2X7XA 2XUAA 3QG5A 4E46A 5HQTA 1KNQA 2PX3A 4OQMA 3SFTA 1EFAA 2NSJA 1YBAA 3PHLA 4BNMA 4TUYA 2NYRA 4F2GA 1CEXA 1J0EA 3DBLB 3MEQA 5CFNA 4I1PA 5IN5A 1NF3A 1OTXA 1L5MA 2FG5A 4K40A 1E7QA 1HUQA 3DMPA 2YMPA 1T0UA 5DM70 1RJ9B 1YT5A 4URFA 1Z0UA 3TGPA 1TU3A 1B6SA 2PL1A 5LLSA 1GPNA 3A14A 4MS3A 3ZTYA 4XQGA 3D6HA 1E2GA 2VK8A 2ZJ5A 3AI2A 4X1YB 1SBHA 6PFKA 2PN1A 1OJLA 1K2WA 1R10A 3H2HA 1WHTB 3NB0A 3P7MA 1Q14A 2VYCA 2EL9A 3JAWB 4QNNA 4ARVA 1DDOA 4IZHA 1CQZA 3HVJA 2XAAA 3QE9Y 2ZE8A 2ZYWX 4KXLA 4N0DA 3EH1A 4AT1A 3U3ZA 1RM3A 1B7GO 2GCNA 2OV3A 3U1VA 2ZUUA 3BXHA 1IOZA 2VRNA 2WQZA 1UANA 3U3OA 1RRPA 5JWHA 2EKZA 3E48A 1GGEA 1C8VB 3CRNA 1YBVA 1N3YA 3OM9A 1J00A 2F1IA 3D31A 2G82A 2W83A 3A25A 3TPFA 1RAEA 3NTVA 4EG1A 3L7DA 3OWOA 4IIGA 1XF9A 1XFDA 4HFMA 5KMGA 3PFWO 3HDTA 4G5QA 2DM6A 2OEPA 3FVQA 4ZAVA 4DS3A 5BQFA 4DCPA 2RCYA 4WY5A 5KWJA 3G89A 2Q9BA 3LPMA 3P2EA 2AJCA 2XDYA 3R0JA 4JR0A 3ZXIA 3WQHA 1WDWB 4J0JA 5I3CA 4TSRA 2BHSA 3O5AA 1HQYE 3PRHA 1R8SA 2BFAA 3A4IA 4WT7A 2PL3A 1DC6A 4LQDA 4ESEA 5BR8B 1QSGA 3HMKA 1U1DA 4NY1A 4XQEA 4DEVA 2QQ0A 3AG6A 1Y6FA 2Z9BA 3HA7A 4KXNA 4LIPD 4R2JA 4RVOA 3TW4A 5HCNA 3STHA 4K9SA 4EI7A 3PVSA 4H3KB 1GV0A 2GJ4A 4YJFA 3DBOB 3ROZA 4CFZA 5KU7A 3E9QA 4KMRA 4DPKA 3A1SA 1U7OA 1XLWA 3KDSE 4EG5A 3T4PA 1Y7PA 4UZSA 1RC8A 3ZBUA 2QAGA 3FUUA 3OP4A 1DAIA 4BNWA 4MUNA 3A6GA 1Y9EA 1PS8A 2UZIR 3OAAA 4AMYA 2WIBA 4PV7A 1E1DA 1EZ1A 2EG9A 2QQFA 3FGOA 4GOND 5LBTA 4DCMA 2CUNA 3WGUA 2XXBA 4JIGA 4M36A 1FEZA 1WCWA 3P9XA 4D4JA 5C4GB 5A0VA 1XTUA 3PPYA 5A3VA 1SA0A 2B83A 4YRBA 2QR3A 3VSDA 3IILA 4D80A 4Z54A 4JNKA 2QQEA 3LQFA 1AF4A 2QVYX 3EH2A 2G70A 2GHIA 4LTNA 2H9YA 4K9RA 2E49A 1UC4B 3HJFA 4BDTA 2C8VA 1UZUA 3NV9A 1G8HA 4D2IA 2F3SA 3RFTA 1E9RA 4OMFG 3B70A 1KOLA 1MH9A 1SU7A 2VYQA 3QENA 2ZBGA 1XJWA 2OFPA 1VE1A 5KHOC 2G28A 5JXWA 1XCLA 1SMKA 1X7ZB 1AM4D 2XRFA 4FMBB 3ZD6A 1G8YA 1R3UA 3VKHA 5JAOA 4YMLA 1B14A 1ICEA 1MXHA 4JVSB 4Y7DA 3DAOA 4DDHA 5ED4A 4KV9A 4YP7A 1SCIA 4Y6GB 2Q6TA 4AKTA 1HDYA 2A7XA 3EFOB 1IZYA 5D5HA 5FLXA 3AY0A 2CXXA 1ENYA 3ZU5A 4O6VA 5LU9A 4CTOA 2V98A 3TLAA 2H5JA 5C35A 3WAKA 2O8BA 4LK3A 3QOFA 3JYQA 5GTDA 3GDGA 1E62A 1QS0A 3RYFB 4RA9B 1V2GA 1KI4A 4DR4B 5D8DA 3C43A 2ZIUB 2YWRA 5AVZA 3Q41A 1A7KA 4WIAA 3PE3A 1AHNA 5IAKA 4X1KA 3HI6A 3DEFA 3N1UA 4AN1A 3H5AA 2QLNA 2ZRGA 2LD4A 3NYQA 4H7IA 4Y1EA 4P2BA 4N54A 3W78A 1ZRHA 3EZ7A 1KYQA 4O4LB 4PPYA 3MFYA 1HURA 3MCTA 4FOLA 5JZSA 1DTWA 1SC4A 5DO9A 1IY2A 1Y6ZA 1TTTA 2G4LA 2DE0X 1T9KA 3GUHA 3NASA 3O38A 4L02A 2G0AA 3NTXA 1SHUX 4KKXB 3NDBB 3L0YA 4NPAA 4JJ6A 1LJLA 5HKKA 2NMVA 4OHBA 4UTVA 4DJEC 2RHCA 2JIDA 4IYRA 4ON9A 5FADA 3IEVA 2QBYA 1DAKA 3PEFA 4FEAA 4CM6A 3TIXB 2ZR9A 2J5KA 3X1WA 3L05A 3MINA 1P1KA 7MDHA 5LP1A 5CLHA 5DM4A 1K7EB 3LX5A 4XFDA 4ZCSA 3W8DA 4GKJB 3KQTA 5TX7A 1B3RA 4L8WB 1PWZA 2I76A 2FN8A 2QMEA 4DT1B 5H80A 4PPFA 3USCS 2ODWA 4XD7A 1BE0A 4MYTA 4AJ4A 5AJYA 3L1KA 4UU1A 4C2AA 4Q1VA 3CUWA 5KWIA 2X19A 1CJTC 1QK3A 3A3NA 4GEGA 5DTRA 3DW1X 3H0CA 5KDDA 1XTKA 4J4BA 5DRYA 2PXAA 4UHDA 2RAFA 2J6CA 3GQBA 1DG3A 2AJLI 5THXA 4XIJA 1H5NA 2B8WA 3TKLA 2W6JA 3F4LA 2YZ7A 2JGNA 4KWCA 5CLLA 3AF2A 1GPUA 2HU2A 3I04A 3HBJA 4XUGB 3UT6A 1L1RA 2OA0A 2PY6A 4DCCA 1TA4A 1EMDA 1WXQA 3N59A 4N5LA 4MEBA 4TN1A 2QVLA 3CZQA 3F74A 4YGYA 5K2MA 1F7UA 2O8FB 2P35A 1ADCA 1XRQA 2NNLD 3I3OA 2WP0A 5F5LA 1XZNA 3I9OA 2XXJA 1HFKA 9ABPA 2YQ5A 1RXYA 3WLPA 1AK9A 3VI3B 1XCBA 2W2LA 4Y2UA 2QMOA 1WDMA 3IFSA 2Y4OA 5IJZA 3U4QB 3AOEC 1A9PA 1OKKA 4GZ6A 1TD9A 1Y63A 3F6SA 3IHKA 2PXHA 4UEKA 4XJSA 5JSFA 4Z49A 4KR7A 4K2AA 2J0QA 1XZGA 2C5EA 1DLIA 2IXDA 2VZEA 3HUDA 1JHUA 1G19A 4FJ0A 4E07A 1E2JA 1GADO 4D9BA 3HO1A 4H7JA 1BD4A 1O95A 2AT1A 2XNSA 4UARA 1B3BA 4V0QA 3BIXA 1DJLA 4K9OA 4ND3A 3GT7A 3DC2A 1L5KA 2FLVA 5FNZA 3DGFC 3SI7A 5IM4A 1QYWA 1XCPA 3BTOA 1JFFB 3PXCX 5CA0A 2C04A 5HMMA 1JNXX 2C42A 1BXGA 2FB9A 2J6BA 3GRRA 3OEHA 4JYMA 4E21A 3P2YA 5ALZA 2B4QA 5J40A 4ENVA 5LA6F 1PR0A 1T2NA 4TSFD 1QU2A 4PZYA 2MDTA 3L02A 3C3CA 3FZGA 1ZZGA 4RHYA 4CEIA 3HLYA 1IHDA 4ETNA 3FLBA 3K2QA 3UGTA 1QIDA 2FYTA 1B6GA 4IIJA 3RAFC 3NUGA 2I4RA 2HNKA 5ICGA 4UNSA 1T2VA 4O2BF 4AF8A 4EH1A 4FM9A 1N1DA 4GZ5A 1W6RA 4ZRNA 4NU5A 3H5TA 5KWVA 4PLCA 4QARA 1ENZA 5CFLA 5H0IA 3VR3A 2Z2IA 4C5BA 2GTHA 1N1EA 2QZZA 4HDMA 2AE1A 1N9GB 3DMTA 3JQGB 5HA5A 2XD9A 5E9JA 5EVJA 2OXCA 3RBZA 1DEOA 1WCYA 3JTEA 1USUA 1WKVA 2HOQA 2A1UB 5HWSA 2HRDA 4QQRA 4DJJA 5IWAB 1EFVB 5LDDC 4ZXFA 3GJXC 4ER5A 3NP9A 1XU4A 5E0OA 1BRTA 2NTVA 1PKXA 2GBIA 1TJ5A 4E30A 4C21A 1XXHA 1K9VF 1LTQA 1QAQA 3L8ZA 1QMPA 1Y33E 1YXMA 3KAPA 4FYIA 4YK7A 2AFVA 3L7JA 3TWOA 4O4IA 1NXSA 4J7UA 2NZ8A 5TT0A 4YAWA 2VQEB 1K6IA 1ND6A 4GQIA 4RZUA 5CB4F 1D4ZA 2FDRA 1GG9A 3ZWQA 3KYDB 1PE0A 3MJTA 1OR8A 3AUAA 1A76A 3PHJA 3C8MA 3EHEA 3KPVA 4P1ZA 4DWJA 5BSGA 5K0BA 4NCIA 2AMVA 2GAFA 3ANNA 4KITB 2HQSA 2ZZKA 2Z4RA 4IX9A 4CKBB 1VPLA 1JEDA 2NX2A 1DUIA 5TIIA 4DUYB 4R9SA 4MROA 4CV0A 3RKUA 4IJ6A 5I9LA 4F21A 4KGXA 1E5DA 4P93A 4HQLA 3FUWA 1IFXA 1RI5A 4B09A 1UDCA 2XUGA 1MJNA 1OTHA 2CEAA 5PNTA 5TVKA 3TNDA 5C5EA 1LNZA 3ND9A 2E89A 1A4IA 1KK2A 4WX2B 3E8SA 3QX9A 4HGPA 3V1LA 3WK4A 3BGVA 1W0JA 1M2EA 2RBEA 3H87A 4KXMA 1PZMA 1WD7A 2W37A 3GELA 3W4KA 4MVYA 3E81A 4Y98A 1F8FA 2WYWA 4KI7A 4QEKA 2QM3A 1L6IA 1I9GA 1NJ1A 4I4IA 2FWIA 3PNPA 4CF4A 4YCDA 5LIPA 2HSGA 4GZLA 5IULC 3BXPA 4DJTA 3F9RA 2WA1A 3ZU6A 4LRTB 1ZWLA 4LDRA 3DBVO 3ECSA 3C87A 5LMCA 3G0BA 5C51B 3R9XA 4M7OA 1JU4A 4QJ5A 2H4ZA 4JR2A 4HNAB 3P4XA 4TYYA 1XTBA 4FFVA 4H4DA 4A6PA 2K7FA 1XWIA 3A31A 1KDTA 1V11A 2VF8A 3CH4B 1WJGA 4UE3S 4BNHA 4BVLA 4CXMA 1X42A 4G0XA 4QM7A 4BZWA 3KYCA 4H0CA 1ZITA 1L7EA 2HGSA 3M3HA 1IUKA 4DNPA 4QZVA 1THTA 4IHJB 2UYCA 1XTZA 1YU6A 4DSTA 4BRUA 4A2PA 2KSQA 3CNEA 1USGA 1GPWB 3LUCA 1A95A 5BSRA 2F2TA 4FFWA 4B80A 4URYR 3SC2A 1LZKA 1W2WB 1CJMA 1G5IA 3Q7RA 5G53C 4N4AA 3IA2A 5FPHA 1FL9A 1VSBA 3C4QA 4KN5A 3IOBA 3STYA 4ZA2A 4R31A 1QV6A 1LBTA 2R60A 3RK0A 1JG1A 4BN0A 1JHPA 2ZRBA 4ABYA 4MVJP 5LZ5A 1SFRA 4MGHA 4JSTA 4S05A 3CVYA 3VSAA 1SG9A 4NCAA 3E1SA 4WXEA 1A2QA 2H48A 5J23A 4KMOA 5HUHA 3REOA 2BBSA 4L4UA 4B44A 4RL4A 2W6ID 1H2HA 2W4MA 2R11A 3BFXA 1LF0A 1ID8A 1N2ZA 3LDFA 4OV6B 2AG5A 4RQUA 2HCTA 5C8XA 2WOJA 3ZH9B 4IGEA 3R2JA 3C70A 2HWXA 4II3A 4L4SA 3ROEA 2ET6A 2PZAA 1YMUA 4ZCRA 1BO6A 5DYIA 1PW5A 3WQBA 3DGEC 3OQVA 2J32A 3RNOA 5CGQB 4GYWA 2IOFK 3BTVA 4F11A 3UWOA 4DR5B 2P6MA 1MXFA 2VHEA 3H5IA 4KL8S 5AW9A 4C04A 3AX6A 5BP7A 2P9FA 1JR3D 5HBGA 3PI7A 3EPJA 2PBRA 3OQJA 1D09A 4X94A 2PS9A 1QHNA 2WF8A 3OZDA 4QGSA 3GG2A 2UZAA 4L9WA 3KCNA 3B3AA 3ZNNA 3OPYA 4AJ9A 4YIHA 1KE1A 3NEJA 4NCNA 2XVXA 4TKVB 3AUUA 4RHEA 1WPGA 3PXAA 2XXAB 2EJTA 3L8EA 2AZMA 2FG6C 3NIWA 4UBLA 1M6EX 1VBNA 5HJ2A 5B6JA 2VPZA 4CUKA 3M0EA 1SUPA 4MKIA 1ZGBA 2IWRA 3I45A 1SM4A 1Y98A 1SHKA 2GRUA 2X6TA 3CX6A 2WJGA 3L93A 1Y3FE 5EEHA 3LUHA 2JCSA 3ZQJA 5L4LA 4IUCS 1FMFA 2NV6A 4CMAA 2GN8A 2JBAB 3GOQA 3JRNA 2JZOA 3Q12A 4LISA 2O9JA 4KE9A 4MKZA 4C7VA 4K88A 3ZU3A 2GZAA 4W6ZA 2IYYA 3EF1A 5JD3A 2RI0A 5C37A 3OIDA 3VYTB 3MHTA 5FBKA 4KKVA 2PT6A 3L9XA 2XE7A 1UIRA 5HFAA 4DV1B 5ALXA 5TVGA 4J2HA 3SAJA 5MN5A 2Q5CA 1HYHA 4JOBA 1K5HA 2HRQA 3H5WA 1JKFA 2D1FA 4KVGA 1QE3A 1O87A 1I94B 1CDEA 3RSFA 3FWPA 5CFRA 3QKIA 4KR3A 2HRBA 1F51E 4TKZA 5DBOA 1C3VA 3MBKA 4NVRA 3W04A 1WW3A 4IV8A 3UHPA 2CBGA 2K4MA 1FFWA 4GYYA 4DSUA 1AH2A 5EUBA 3RJ9A 4OX9B 1AE1A 3ADCA 1DDGA 2ZGVA 3OMWA 2WK1A 4OQFA 1OU0A 3A26A 3D6UA 1XGKA 3R5SA 3IIMA 5JU6A 1Z8FA 2WRZA 2MWMA 5DK6A 4RTQA 4HZUA 2BMFA 3KKOA 1ZI8A 2H08A 1FE8A 2VH5R 2X8JB 3TOVA 2DZDA 2QE6A 3MTAA 3I0ZA 3CISA 2XB6A 3QV2A 4YAEA 4N49A 1CDDA 3W2IA 4BN5A 1P6XA 1O97D 1R5OA 3EN0A 4R81A 5DB4A 4EW6A 2V5UA 2C7RA 1QBKC 3PSAA 3NMUF 2FK7A 1TF2A 3PL5A 5EE0A 4YXFA 2C9DA 5BYAA 3O8RA 4G86A 4G2TA 4DARA 3DC7A 2Q3JA 1IQRA 2HCJB 2YN2A 2ZEJA 3DWGA 3PC4A 4M0PA 2Q7DA 4DPMA 3PPIA 4WJLA 4KSCA 3K9WA 3TQCA 1C7EA 1IXRC 2I99A 3QITA 4QUGA 3UJHA 4Z99A 5IFKA 4YRAA 4JC4A 2RFLA 1DIOB 3PDWA 3SKYA 1QGZA 1P5JA 1KY4A 2HKIA 5EHXA 5G40A 2JC3A 1ZH8A 3AC0A 3G2IA 2Q27A 2H52A 4TT3A 4BU0A 1QOZA 4QPNA 3ESCA 1ZSYA 3NTUA 1ND5A 3RADC 4GUAA 3GP3A 1D2HA 3AQ4A 4PS1A 2OTCA 2XUPA 3ED1A 3LBIA 3WX0A 4Z4IA 3FHTA 2QUJA 1SUIA 2BFFA 3K1AB 1YH3A 4RSRA 3CF2A 3BYZA 4NG5A 3D59A 3ADBA 2ODTX 2VJOA 3A6JA 3H1GA 1VTKA 1BCRA 1C4WA 4Z8YA 4BFCA 4JASB 2ZRKA 1E7SA 1MB0A 1RTTA 1ZMXA 2QZ9A 4Q4JB 3G79A 2CF5A 2GCEA 3QX3A 2GHTA 2WTXA 2WF5A 2C20A 4ZO8A 2NSLA 1JQEA 1IZ7A 2O3SA 4DLTA 2QG9A 3WYFA 1AUQA 2CT8A 4EKNB 1E5QA 1XQYA 3AOEA 3GLIE 4PG7A 3FFXA 4IH4A 1R0YA 3E0XA 4UU0A 2P4SA 4LCJA 3UANA 1UFRA 3EGDB 1W9HA 1XTJA 2DQKA 2VPQA 3I52A 4ZJYA 2CMKA 1KKMA 1I3MA 5EZQA 3ZW9A 4M1TA 5KJ1A 1EVYA 1G5PA 3JWJA 1M34E 2ZUSA 5AJVB 5ICEA 3O2JA 3MWYW 5DLYA 1LRJA 2WJZB 2J07A 1IAVA 1E6UA 1KOFA 3BFPA 5HJ7A 1J0DA 2CHUA 3LCUA 4JYCA 4K1LA 4LRQA 4ROTA 1EDOA 2ZANA 2VZ8A 4NMMA 1AB6A 3HJCA 2JZCA 1CUFA 2Y05A 5BW6B 3U7JA 1RHQA 2JGLA 1U3FA 1CLUA 1PUXA 2UDPA 4H35A 1CUEA 1BCSA 1JSZA 2VEDA 3LFHA 3G5UA 3L4SO 1SCBA 4G89A 3WWOA 3C7CB 1IK4A 2ZE7A 2BDTA 2J67A 2P9BA 4YI3A 3A6PC 1EVEA 4NICA 3CSUA 4E0BA 1YC5A 3C98A 1LPSA 4O25A 3EZFA 5GJBA 4K3VA 3FYUA 4UD6A 4W7SA 1FOEB 4IG4A 2B1JA 5CH5A 4AUMA 1OIXA 1Y42X 2CFSA 1VB5A 2ZWVA 3BB3A 4P98A 3ZGNA 1H0RA 4BKMA 1NMQA 5ALQA 2ZT6A 4B35A 1BHSA 2C5FA 5AXAA 2AX3A 3EXG1 2NYUA 4RTMA 4IPTA 1YQWA 2CJYA 1Y9JA 4PRZA 1HWYA 2HMSA 1H2BA 2QPLA 1YTLA 2VEOA 3HKCA 4K6GA 1L7NA 4V0RA 5F4BA 3LKZA 2YXDA 1E6EA 4AZVA 1V6AA 1FP6A 1BFUA 1GT6A 1GG8A 1M2JA 1VE5A 1Y6RA 2WHRA 2WUVA 5AWFC 5LXTF 3WGZA 4NEHB 2ZB2A 4YECA 3TNLA 1CF4A 2X5OA 1EK1A 1L0BA 3HLKA 3ZKWA 5EG5A 4B87A 3TGWA 1QIMA 1XPUA 2PRYA 1YVDA 4YJDA 3ZLBA 3KB2A 5AYVA 4Y6SA 3OICA 4IXMA 4DLSA 4DR3B 1A9ZA 1EK5A 1NUTA 3BAZA 2D6FA 4Z1MD 2W2XA 5IPFA 2H4XA 4C29A 4MWDA 1UQTA 2BKVA 2E5FA 5KVQA 4XWYA 1C8LA 3T1YB 5FPPA 3H11A 1UKVY 1P7VA 4M4SA 1CUCA 3B1KA 5IZCA 1MAWA 3CW2A 5BPHA 3B53X 1ISGA 3R6WA 1Z38A 2EGHA 3U4AA 1QVAA 6YASA 1DX6A 3UH1A 2Z8YA 3SQWA 2Q4RA 1Z25A 2ZI3A 2TMDA 2FTKE 2GNPA 2WAMA 5GGYA 3FGPA 4AM8A 1I4DD 4OHWA 1OFIA 3DM5A 421PA 5EGNA 3OJWA 1UXGA 2IHBA 1Z68A 4M1MA 3EAGA 3IEIA 1XMPA 3FPGA 3EPPA 3K31A 3QXXA 1TMYA 1WOYA 2IY8A 3JQAB 5TJ9A 5JY1A 5K3AA 4NDNE 5HBRA 4RVGA 1G0NA 5HFNA 4MQFB 3U13A 4DLZA 1G5QA 2N42A 2XDWA 3GAZA 4BKRA 4CI0B 1OWMA 3U3RA 4OHMA 2GB4A 4BXOB 1ZNZA 1IBCA 2C4NA 2D62A 4YJGA 2E37A 3JQFC 2J7PD 3UCEA 4GECA 3G5AA 1TM1E 1MQ9A 1BS9A 1SKAA 3KT6A 3O83A 4CIDA 4F7WA 5K0JA 1QH9A 1XDUA 1XN1A 2H2WA 5KNDH 3PU6A 4E15A 4B7CA 1OXKB 4DB4A 1U2DA 3LDAA 3Q98A 2VP3A 4D4KA 4MTCA 5A3RA 1RWVA 4MYHA 1UMKA 4ZQBA 3MTGA 4JHLA 3V33A 2GPAA 4WBNA 2OHVA 3ZVRA 2C7QA 2O3TA 5EJ8A 2M6KA 3GGDA 3EQ7A 3GGSA 4QHTA 1G4UR 4ARZA 2JCGA 4BB6A 4RTRA 3B36A 1B43A 2QSYA 3GW8A 3INTA 2VKTA 2NW6A 3JV7A 4TWBA 3WYEA 5L3VA 1O97C 3VAZA 5EHZA 4WDRA 5F1YA 2IHYA 1FYDA 1RM4A 3QUQA 3R3HA 3GFGA 2IUFA 4RWEA 4S2EA 4WY2A 1KWGA 4PCVA 3ZX4A 4OIFA 4NATA 4MRSA 3PPXA 3O91A 3O3NB 1K6XA 5CP8A 4ZO4A 2P5UA 1LPNA 2QR5A 2XUIA 5ALTA 1GJRA 1O9GA 1GYPA 1N75A 2ZWAA 1BXZA 5JI3E 1QVWA 2FU5C 2H5LA 3O26A 4PTZA 3DVRX 1G6OA 2DUNA 5KNCH 4RSGA 3NLLA 4WWHA 1RADA 1I30A 2EJCA 3UXEA 1S3IA 4X54A 4FHCA 2ZM6B 1SG6A 4BATA 5AK6A 1AUVA 2QU7A 1HEYA 1X3SA 2R6ZA 1CFZA 5EMMA 1SRRA 3AVYA 2YDYA 3V00A 4AUNA 2XB9A 4FFPA 4QPPA 1TW3A 2NG1A 4GOXA 4JK3A 4PONA 3SLGA 4ARCA 4DDUA 4N7JA 3GCXA 2PUEA 1VP3A 3Q7EA 1IULA 1CSEE 1NKTA 2BFCA 2DMRA 3FTNA 3MYYA 4ICIA 3ND5A 3UJDA 1FBTA 3O8QA 3AJ9A 3COSA 4NS4A 3OKPA 3UYLA 4BZPA 1EAYA 2W4QA 3QFSA 5LB2A 1E5VA 4UMVA 4IJVA 5FPYA 3KVVA 4E2XA 2GXAA 4Q4AB 2CFRA 4WLUA 3OURA 4OX9Y 1V7CA 2P9EA 4BNKA 5DSXA 2P9TA 4H3HB 4NZOA 1C4KA 4JWKA 2P9HA 2O2XA 2VRBA 3EIXA 4N3GA 4RPKA 5TMBA 4WZAA 3ZLTA 3IUEA 5EJAA 2Q3DA 2BDUA 2ODEA 1MPTA 4OIMA 2QX4A 3UMVA 4DA7A 3UQZA 2UUOA 3DH0A 3WYNA 3RBXA 4LBYA 1J90A 4UVGA 3PEYA 2YZ2A 4NE7A 3RYTC 2AN1A 3QUAA 3BMXA 4PSAA 5IUKC 3GWGA 1U2RA 2QI9C 4RVFA 1GDTA 2B99A 4LZAA 2J87A 1QFZA 1JQJC 3Q6NA 3IP7A 4FYYA 4MV0A 5BWMA 3U2QA 4HXFB 4YV0A 3A9SA 4EPTA 2J59A 3L6UA 1P39A 3DE7X 5B3JA 5NULA 4KRFA 2QN1A 3NHKA 4PZ0A 4QOIA 3R7LA 4HYTA 1D2MA 1YOVA 2NUBA 3W9YA 4YJ3A 3P9PA 5AKXA 1TK2A 1KWKA 5EPOA 2UXBB 3NBXX 1GZDA 3W7BA 4D1YA 3SEZA 4C0LA 1JEYB 1CNEA 1UXIA 2IE8A 2O1SA 1GTZA 3X2SA 4BV3A 1AHHA 2F55A 1IXKA 4DLAA 3CJTA 1HRKA 1P7YA 3T95A 3DOJA 4HBGA 3OA0A 4M38A 3T15A 3ZDBA 2V0NA 3A8TA 1SEVA 4FFSA 4IV0A 1E4OA 1GZVA 4HGNA 1X7YB 5EEGA 3DE6X 1FDUA 1S9DA 4URHA 3IO3A 2P4HX 3EQ8A 4RNDB 3CZ4A 1YZNA 5DWVA 1YR8A 1ZCAA 2WA2A 1LLFA 1V8BA 3PKIA 4UAGA 3PNSA 3H8VA 3OX3A 1T6NA 2FR8A 4QJ4A 2W2TA 5EJMA 4PY2A 3JYPA 4CT5A 4QGAA 5IM5A 2QRLA 2CHQA 2XMQA 1ZSNA 1Y4AE 4JDUA 2YOFA 3DMDA 4NK5A 3K0CA 3T5BA 3SYNA 3DL7A 2FR1A 3TGLA 3G82C 3JASA 2P8JA 5EN4A 2B1GA 4BJ1A 3QKRA 1IZ0A 1JMVA 3OEED 4PE5B 5TQJA 1GUDA 4GI1A 4MICA 1B42A 1WXIA 1ECCA 1PEYA 4KAFA 3R3UA 3R6DA 2YXNA 1NNI1 3LUAA 5AW3A 2C82A 2NZJA 5FFMA 2BY4A 3ENNA 5K4AA 5CA1B 3OI7A 3WGVA 1P2GA 4PZUA 3DUFB 4DWWA 5U9CA 5BV7A 1FC0A 3LHFA 5G3ZA 1F2VA 3KWFA 1ZD2P 2FUG1 1KHTA 3WL5A 2DY0A 3B12A 3IV9A 3P96A 2QTRA 3MGBA 2B25A 2ALJA 3H5NA 4M6WB 2EQAA 4MCAA 4ZQHA 1H1LA 1KJ8A 1L4FA 2GN6A 3EGIA 3N87A 3SHQA 1MA3A 3FYCA 4I4TB 4F06A 4XA8A 1E1RD 1I0IA 1QCZA 5I5GA 1M7GA 4S1TA 2JFHA 3BT7A 2EG5A 3I5MA 3M6VA 5J9FA 1F2UA 5AM4A 3W3ZB 4JBNA 3OUZA 4MQMA 4TXHA 2WE8A 1D0IA 3LBAA 3QLJA 5F1OA 3FOEC 3UV6A 2UVDA 1MEOA 1EX1A 4R8MA 3KPWA 2C9OA 2EF1A 4PPQA 4YH1A 1CJVC 5EIXA 1VMKA 2QVZX 2WC1A 4DR1B 4IW3B 3PQ8A 4O5AA 3TX2A 5KQGA 2XOXA 1EBBA 3KQNA 1NOJA 3KUDA 4OXNA 3I83A 4AYXA 1M8FA 3JX9A 1E4EB 4AP5A 1LK5A 1GQRA 1U2PA 1S89A 1Y7IA 2BI7A 2CVPA 2HTEA 4R83A 3UO8B 1JSRA 3A6HA 3RTDA 1SCDA 1XB2A 2HJ9A 1DAGA 2G6BA 3L7MA 3AZPA 3GN2A 3NC0C 4KN6A 4RWZA 4BNXA 5FOXA 4DMUB 2BI4A 3ZZUA 3JARA 1RAGA 1YKFA 1JBQA 2AG1A 1LTKA 3M5DA 3OO1A 5D1NA 3CNBA 2NPOA 4QDTA 2HK8A 3WDSA 2PCJA 3UMCA 1GG2A 2C57A 5C1PA 2OHOA 3W5AA 4IRXA 3K5HA 1EPUA 1ESEA 4F4IA 1BOFA 1WEHA 4B7XA 5B7GA 2IH5A 4TTVA 2QRVA 1PL0A 2O23A 5H02A 5C32A 1ESNA 5LZ9A 3BULA 3F3MA 4OVKA 3CURA 2V54A 1OH6A 3OOYA 1UEIA 2I54A 2BGJA 2Q3LA 4BFZA 2H5IA 1UFKA 4C89A 4D44A 1JPNA 1KK0A 2I7VA 1S8FA 3HKEA 2Z2KA 1RAIA 3G8AA 3RC7A 2ANCA 5IG2A 3AV0B 2B34A 4ER7A 2WLSA 2ODNA 4YREA 5KJCA 5EJGA 3M1AA 4OP1A 5JE8A 2WMDA 3KU1A 4JUIA 5CLQA 3PR2B 1X80B 1ORIA 2J9YB 5C1DA 4YCLA 1DS6A 2RHTA 1WHSB 2NV0A 2V8BA 2PMDA 2W6IA 2XR1A 3M7IA 4DQUA 3C6XA 1NDQA 3TRJA 2NWQA 3AEXA 5AUQA 5B12A 5CVCA 2RHLA 5JSZB 4MARA 4M0FA 1AHIA 1KC1A 1RSZA 1AXEA 2RGYA 3FSJX 3MUEA 3NT5A 3OJLA 4CKZA 4KPEC 4F7DA 1Z2DA 3MOSA 3JZAA 1PSZA 4B45A 3EGVA 2OZLB 5L8VA 5H5JA 2HUPA 3K20A 4AMBA 2VNAA 4KBYA 4KCGA 2C54A 4U9IS 1Z5OA 2XUJA 1RRCA 4MS1B 5TQVA 4WLOA 2JAOA 2O0JA 2HJVA 4LHXA 2IV2X 4OQNA 3VU0A 1G16A 5GV7A 4CM8A 3DYIA 5DI9A 2EHDA 3T0GA 4W5RA 1JDBB 3FB4A 1BDMA 5C8YA 4NULA 1VJCA 3ZK8A 5K0GA 1KKLA 3RK4A 3UGJA 3BA6A 1MOZA 3AR9A 3E9YA 2GD2A 4FEGA 1QYRA 5FL7D 4ER6A 1RVV1 3KU4A 5TGDA 1RQXA 1KAOA 4DW8A 2PSDA 3CX4A 3RVQA 3WAJA 3WLMA 1X8JA 3LP5A 1YBFA 5C8ZA 1JILA 1Z9BA 2P91A 4B4WA 2CNBA 4LKOA 1U8EA 4AY5A 2PRSA 2ZAGA 2WTUA 1BH6A 1V1MB 4R2WA 1AGYA 2PKXA 2WAYA 3GF4A 4Y9RA 1B4DA 5CR9A 4J1TC 3LM8A 4XLLA 2BEKA 2YYAA 1GVHA 4HAXA 5HRUA 1L7MA 1T4DA 5AHXA 2AFHE 5BQPA 1T0IA 5L51A 2RHMA 4MQEA 1KAMA 4YMGA 4Z1OA 1L5ZA 4TYQA 1E2HA 1WEKA 4UOQA 2CMFA 4E12A 5KYNA 2G08A 3BGWA 2H59A 1CS4C 1Y9DA 1PJQA 2BJWA 3C1AA 2RHOA 3NALA 5CXQA 2IF2A 3E1GA 2QROA 2ZJ0A 4D9IA 4ZVQA 3ZU4A 1FS6A 1RHKA 1HEUA 2IYEA 1CR0A 1G18A 3PWTA 4M7RA 1JPVA 1GV1A 1ZUWA 3BJRA 3EAQA 4HDNA 4QDOA 3QHPA 2IS1A 2JATA 2B4AA 1NBOA 2VTDA 1H05A 3ELBA 1FFXA 1AKNA 1PG0A 2BZSA 3RVMA 2VT7A 4HWPA 4RK5A 4XR4A 4GSKA 2PKQP 4KR0A 2QT1A 1V8PA 2D1RA 3AOGA 4HH0A 1RQPA 4LYDA 4Q24A 2HF2A 4PXAA 5B1EA 3FR8A 3SM9A 1ULUA 1YUBA 3PNKA 1E79D 2JD1A 1AKQA 1DX9A 1KR5A 3EFHA 4HWRA 2FUG6 3ZD7A 4OAOA 3ZQKA 1PN3A 3GT3A 1Q6ZA 2IDMA 2PYZA 1E3JA 3A28A 3OZCA 5BWNA 4G4SO 4CMGA 4JYAB 1UJ6A 1FSZA 1W46A 3AF4A 4N3NA 2BM0A 4KHZA 1BMDA 4KQHA 5K0FA 5D5QA 2NT4A 2QP4A 1J21A 3FTFA 1PZGA 1EGAA 1EVKA 4KN9S 2C97A 1ITZA 3EE6A 2ZVJA 3FROA 1SC6A 4F9FA 1QRUA 3NYRA 3KHKA 2FW8A 4ND1A 4MB0A 4RDHA 1TLFA 3MGKA 3E3AA 1JKXA 2QN7A 1TVKB 2WT8A 4FYXA 3RRNA 4B31A 4EG0A 3Q88A 1VJ5A 3I05A 4J2OA 3ZIUA 4CPDA 5BSHA 3WB0A 5HZHA 1PEKE 4KAJA 1RRGA 3E1KA 2LE0A 4F6CA 3EMKA 3OHMA 3ZYCA 5ER6A 1L5QA 5ERXA 2X3UA 1QAOA 3M82A 2X2EA 3PFHA 3X1XA 1GPLA 1U2QA 1DXHA 1R37A 5HTOA 4DF3A 2D0IA 1LDYA 1DCFA 3HBLA 5DNVA 3E9NA 1PZNA 2QT0A 2XWPA 3NM6B 1E64A 3ETGA 4I5GA 4BV2A 1FYEA 4LCBA 1XKTA 2IYAA 3ADKA 1EWVA 1AKRA 4NCJA 1RFGE 2AFIE 3GLUA 3PIIA 5AJTA 4JLPA 3SQLA 2AMLA 4A92A 1KAQA 3ZTWA 1DZIA 1W29A 1ZQ9A 4Y6RA 5ELLA 3I2GA 1Q21A 1C9DB 5HS6A 2IV7A 2ZI4A 5KVAA 2GK7A 5HX7A 3C0KA 1UIMA 4HLQB 5DM0A 4JT2A 1E3DA 1L5WA 2ADFA 5T57A 2BE7A 4XGQA 1WB5A 5MDHA 1IM2A 3OIGA 3W0LB 1P18A 2PU7A 4BX2A 5IT0A 4Z7QB 5I7HA 4PQRA 5AOCA 2O8DA 3LVBA 4G1VA 1KAHA 1NE2A 3ZI0A 2UAGA 4QUDA 2CLDX 2IPXA 5PGMA 3IIJA 4ZYLA 1OFUX 1Z0JA 3GFQA 2VTVA 2X4IA 4L2IA 3EDYA 1X0VA 1L4MA 4DM3A 5IC4A 4NF2A 4G0WA 1GUYA 3QOXA 1NW4A 5BYJA 4KO2S 2VBCA 3LT1A 4B4OA 5L53A 4U7WA 1MEEA 1F1JA 3D6JA 3B20A 1HTWA 2G67A 3N74A 4Q1CA 4EQ6B 3SG0A 3TXXA 3QUCA 1PJZA 1SIUA 3MWEA 2XNDD 2V7VA 4JU9A 5E9WA 5I6DA 2QSUA 2AOWA 3DSRA 4EJFA 3C16C 1DKPA 1PG2A 1XVUA 2FPUA 3A6FA 1AGRA 4EECA 1TM3E 2B3TA 1OX4B 1E9EA 3CX7A 1NDUA 1CXZA 3H3FA 5ESWA 3E3MA 1FSGA 3GGPA 4N3CA 1U2SA 5ED0A 4KB5A 1JLLA 5AJXA 3D3KA 4RVSA 3IP1A 5BMOA 4C7OA 3H13A 1PZEA 3LYLA 2UU9B 3OLVA 1DLJA 1KSHA 1PK7A 1PFUA 1RBMA 2EWWA 5JASA 1A96A 1WXXA 1AN9A 4EUNA 3HYTA 1VMAA 2C83A 3DLIA 3PUWA 2B6NA 3KUKA 1R8JA 4NS1A 3N6RA 4TVKA 4N12A 3T7EA 4BU1A 4LF8B 5KKCA 4GXRA 3RU9A 4ALNA 1DQYA 1WMSA 3OU2A 3L6DA 4W1QA 1KY2A 5IKMA 4KYIB 4YPFA 3RU3A 5K01A 3DJYA 4QBIA 1WS6A 4BHTA 3ZQ4A 4PYOA 1E3QA 2Z3WA 3AM1A 3DNPA 1DHTA 2IELA 3KVYA 1VL1A 3T5CA 5DW3A 3WIVA 1AKTA 2GILA 3RUCA 3T5MA 4WSOA 5KX5A 2IODA 3O4VA 5KTRA 2W2NA 4LYFA 4XJXA 1L5NA 3KOWA 4BNIA 1U1IA 3E2PA 5FWXB 5IDXA 1LPMA 4YRCA 2C3UA 3VO2A 4JMPA 3GO4A 5A4KA 3KTAB 3CEJA 1N6NA 1DRVA 2Y2UA 4PX2A 5K9ZA 2DPGA 4RMHA 3AV3A 4Y1FA 4BP8A 3H6HA 4DDMA 4IKEA 1YRYE 4PICA 2OBBA 4CGYA 3FDZA 3AERB 1KZHA 4LJYA 5TARA 5DM1A 4ABTA 3D3JA 4M9UA 3H8JA 1MX9A 3REGA 3T0FA 4C20A 1XZFA 2BMDA 1P73A 2CDRA 3LXXA 2AWOA 4ENRA 1YVPA 3AH8A 4MV1A 4DLLA 4RTKA 2F43B 3GNLA 3B7WA 1FDIA