1B42A

Vaccinia methyltransferase vp39 complexed with m1ade and s-adenosylhomocysteine
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
297
structure length
291
Chain Sequence
b'MDVVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP39
publication title mRNA cap recognition: dominant role of enhanced stacking interactions between methylated bases and protein aromatic side chains.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Methyltransferase
total genus 98
structure length 291
sequence length 297
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 1999-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1b42A00
3T0IA 4A6EA 3BUSA 3IEIA 4PYJA 3D2LA 2EX4A 1G8AA 4XUDA 1UWVA 5K09A 4PIPA 4RTRA 2QE6A 3FUVA 5DTMA 3TLJA 5K03A 3ELDA 3FPGA 3KQSA 2NXCA 4RSRA 3SR4A 5LQAA 2PVCA 3NDJA 3FYCA 5K01A 3EVAA 2FK8A 3HCAA 3KPUA 5E1BA 2PXXA 4HGZA 2P1DA 3G2QA 5C0OE 3DXXA 2G70A 3CCFA 2BR3A 4OBXA 3TKYA 3KQMA 3THSA 4PYIA 3I64A 1JQ3A 3A26A 5MHTA 1EQAA 3GRYA 1R74A 5K0JA 3GRZA 4UOEA 5FTWA 4E2WA 5LQKA 3ID6C 5LQRA 2BH2A 3ER8A 3R3HA 3G5TA 3DULA 3Q87B 1X1CA 3CVOA 3G2MA 3THRA 5BW4A 2OY0A 4KWCA 1QAOA 1JSZA 2P3QA 4FT2A 2B78A 2K4MA 2AVNA 2AOXA 1Q0TA 2ZLBA 1NV8A 3L8DA 3DLIA 2C7OA 3KPVA 2C7RA 3EVGA 5FULA 2PX4A 4LWOA 1KXZA 2ZVJA 3PX2A 5HIKA 1YZHA 4RV9A 4EKIA 5ICCA 5DX8A 1DUSA 4FP9A 3GRVA 3EVZA 4FSXA 4RX1A 2XBMA 2XYVA 3LBFA 3PS9A 4AZVA 3CBGA 2ZBPA 3BGVA 4E32A 3HCFA 4PIMA 3EVFA 2OXTA 1L3IA 1ZQ9A 2R3SA 3M6WA 5EG5A 5P8WA 3TMAA 1FJXA 3HTXA 3HCCA 4DKJA 5K0CA 2YXLA 4R6WA 1WXXA 3HVHA 4C05A 1YFLA 2UYQA 1ZGAA 4E30A 4FT4A 4GOND 1NBIA 4JXJA 4RTJA 5EMLA 4BLVA 4GBED 4PNEA 5E2BA 1KYZA 3LGAA 5HIIA 4XUCA 4DF3A 3LX6A 4RTPA 5DXAA 5EEGA 5FHRA 3UA4A 2UZ4A 4ATNA 4E31A 2XVAA 4R8SA 1WG8A 2P40A 1KPGA 3KR1A 4HH4A 5EEHA 1HMYA 3HA3A 5EVJA 1VL5A 3SX0A 3UJAA 4YUYA 3BWCA 3PTAA 3KPYA 1WY7A 3FTCA 2EG5A 3A27A 4C03A 5DX0A 3BWYA 3IYLW 4QPPA 1NW3A 1L3CA 3GWZA 3P9CA 4EK9A 1JTFA 4ER3A 3GCZA 5F2NA 4ER0A 3CJRA 3MTEA 5B1SA 5T64A 5K0BA 3K6RA 2G1PA 4DM3A 3DXYA 2FK7A 3VSEA 4C06A 1EG2A 3MB5A 3NVKI 4EMSA 3DH0A 3G7UA 3O7WA 2PT9A 2PBFA 2ZSUA 3DOUA 5DRYA 1AQJA 1NW5A 2ZZKA 3R0QA 3TFWA 3UZUA 1RI1A 3HM2A 2AOVA 3A7DA 5EHIA 3KPJA 3LECA 1EAMA 2O57A 4X41A 1KYWA 1AQIA 1G60A 2I7CA 2XYQA 3KU1A 4ISCA 4PINA 5T6BA 1QAMA 2VZ9A 2AN4A 4HTFA 5BP7A 1Q0SA 3HVKA 3FRHA 1P39A 1UIRA 4KW7A 3SVZA 3PFHA 2G8NA 1NW7A 3GRUA 5EMJA 2ZBQA 2N47A 3SSMA 4BP3A 3R6TA 1BC5A 4YUXA 2C7PA 1BHJA 1VPTA 1TW2A 4FR0A 2BZGA 3G2PA 5CVDA 2AOUB 1V39A 2YQZA 3B89A 1NBHA 4RTQA 3FUWA 3GRRA 5LQJA 3EMDA 1KPHA 3B3FA 3FZGA 5CD1A 2ZULA 2Z6QA 3C0KA 4F85A 5D1NA 4P7FA 3NDIA 3I58A 4GOMD 2PWPA 5CVEA 4WXHA 1YZ3A 3ELUA 3P8ZA 5HIMA 5FQOA 2AN3A 5K8VA 1N2XA 2IIPA 2CL5A 3OZTA 2QM3A 4OX9Y 5EIWA 3VYWA 3KR9A 1MJFA 3NJRA 3G2OA 5DX1A 3T7TA 4DCGA 4Y30A 2I6GA 5FA5A 2OZVA 1O54A 3UBTA 3UA3A 2ZZMA 3AXTA 3PLAE 2ZWVA 2VDWA 3C3YA 1XXLA 4BP1A 4R6XA 3TM4A 1VE3A 2IBSA 3DMGA 4GEKA 1OR8A 4GC9A 4PGHA 2AOTA 3P97A 2VDUE 3B3JA 3A7EA 1JR4A 3EGVA 2OB1A 3UJ6A 1T43A 2ZCJA 3KQQA 5GM1A 3DMFA 4P7KA 2ZIEA 4A6DA 4EQZA 3EEOA 1WXWA 3NTVA 3F4KA 3C6MA 5CVVA 4HTFB 4K6MA 3GXOA 5D1HA 1VBFA 1YB2A 4HRAA 3OE4A 5GWXA 2ADMA 1SUIA 3BXOA 4PYLA 3SSNA 2AOWA 2DULA 5K0NA 1TW3A 2QRVB 4PGGA 3EVEA 1TPYA 3P71T 3SXJA 9MHTA 2EFJA 2JJQA 2BM9A 3B5IA 1VP3A 3GJYA 3EVCA 2IH5A 1PRYA 2R6ZA 2JH9A 1ZGJA 4PYKA 3P9NA 4GF5A 2ZWAA 3M6XA 5HOQA 5E1MA 1G38A 5EPEA 5GINE 4QVGA 1SQGA 2YTZA 2H1RA 4OA8A 1FBNA 3FPEA 5LR6A 1RJGA 3E23A 3NWEA 3GU3A 3LCUA 4QDKA 3SSOA 3AY0A 3UJCA 5DM4A 5FA8A 3OZSA 3GO4A 5LQUA 3BGDA 2I62A 3M4XA 2Z6AA 1BKYA 1N7IA 4RTOA 1X19A 5M5BA 5F2KA 2H00A 2NXEA 4E2YA 1D2CA 3UJBA 4C08A 1JQDA 4E33A 3C3PA 3FUXA 2OYRA 4AZTA 5K0EA 2OPBA 1JG4A 2HV9A 1XDZA 2BR5A 1NW6A 1YFJA 3HA7A 2P7HA 3P2IA 5BXYA 2AOTB 1WZNA 5HILA 4HSGA 5FHQA 4RTLA 4U7TB 2P41A 3G89A 1NT2A 3P2KA 5E1DA 3FTEA 1JG2A 1HNNA 2AOUA 2ORED 2FCAA 2IH4A 4OBWA 4RVFA 3OU7A 3VC2A 4P7GA 1F38A 4P7JA 4O29A 4KIFA 2Y1WA 5LSAA 3I9FA 5FCDA 3TKAA 3UWPA 4CWAA 1XCLA 3T7SA 2YXEA 3LDGA 3R24A 5CUQA 3IV6A 1I9GA 2IP2A 4PYOA 5FWAA 5GM2A 5DM2A 5CVJA 2HWKA 3HEMA 5JR3A 3FTFA 3QV2A 2WA1A 3TQSA 4C4AA 5CCXA 4OQDA 5KYGA 1BOOA 4RYLA 1L1EA 2YUIA 4GQBA 1O9HA 2CKDA 3TOSA 3U81A 2PY6A 4YV2A 4ER7A 4QPNA 5KQSA 3FPJA 1G55A 1RJFA 4H0NA 5GOZA 2UYOA 4X61A 5C9ZA 5DXJA 5FUBA 4HG2A 3OFKA 5ICEA 2KW5A 2JHCA 2VP3A 3MGGA 1M6EX 4FS8A 4QVKA 5DWQA 4PYMA 5ICFA 4IWNA 1AF7A 3MQ2A 2VDVE 3V97A 5EIFA 3B3GA 3MCTA 3UJ8A 2AR0A 5FADA 3KQOA 3PVCA 2YXDA 2WA2A 4AX8A 5DTQA 2HNKA 2GS9A 4PCAA 3DR5A 2ZIGA 3FUUA 3KR2A 1R6AA 5DSXA 1I4WA 5GIOE 1IXKA 2O06A 3O4FA 3PT9A 4E2XA 2PLWA 2QRVA 2G72A 2QY6A 3FUTA 3BWBA 2AVDA 3GDHA 5EOVA 1IM8A 4YMGA 2NXNA 3EVBA 3M6UA 3QOXA 5IKMA 4MHTA 1R8XA 4F86A 3R9XB 1B42A 4R8RA 3UJ7A 1D2HA 3OZRA 4M38A 3E7PA 1JSXA 5E8JA 2ZFUA 3BWMA 3UJ9A 1KIAA 1R8YA 2PKWA 3WSTA 3I53A 1VLMA 4FSDA 4AUKA 3LDFA 3T7RA 4YUWA 2NP6A 2OKCA 4YV1A 5EZSA 5K05A 4M7RA 2IGTA 3ANXA 1G8SA 5G02A 5U4XA 4X1OA 4ER6A 3M70A 4EKGA 3EVDA 1RJEA 3OU6A 5EQJB 4CXMA 3ERCA 3LSTA 2XYRA 2PGXA 3HCEA 2Z6UA 4KDCA 4YUZA 4WVLA 4CKCA 4POOA 3KPWA 4ZTBA 1XJ5A 4BY9E 1JQEA 1UFKA 3AWIA 3CJQA 3M6VA 1KPIA 2PV0A 3RIEA 5DSTA 3C6KA 2PXAA 3SGLA 2PXCA 5ERGB 4MQ4A 2UYHA 5F2OA 3MTIA 5DRTA 4GUAA 2PX5A 2B25A 4RVHA 2GB4A 10MHA 4F84A 5KVAA 2GH1A 4BLWA 4V0QA 3MHTA 2IDKA 5E9WA 3A4TA 4AZWA 3AJDA 1EIZA 1L3BA 1R00A 3LPMA 2A14A 4B17A 3OPNA 5BW5A 1JTEA 1X1DA 3UFBA 3NVMB 1U2ZA 1ORIA 5E1OA 5EZQA 1YF3A 1RI3A 1QZZA 3NMUF 5CCBA 3Q7EA 4LWPA 3KQPA 1R18A 1G6Q1 5E8RA 1AV6A 4C04A 3NWBA 4OQEA 3P2EA 1M6YA 5EKUA 3KQYA 4PYNA 5ICGA 1NW8A 2FYTA 4RTMA 5JUWA 1M0EA 2HTEA 2JHPA 5KS2A 2I9KA 3IHTA 3O31A 4YMHA 1MHTA 3KR0A 3K0BA 8MHTA 4PYQA 3TPZA 2BM8A 4OA5A 4X63A 3DMHA 4QQKA 1XDUA 3ORHA 4HGYA 4Z2YA 1WS6A 1ORHA 2P8JA 1N7JA 1YUBA 4XUEA 5HZMA 4RTKA 5DLYA 2B2CA 1F3LA 5DM1A 2NP7A 3HA5A 3FYDA 2GPYA 4EVIA 3FPHA 3MAGA 1QAQA 3H2BA 4IV0A 2F8LA 5HIJA 1PJZA 1Z3CA 3TR6A 1DCTA 4KVZA 3RW9A 4CTKA 3A25A 2YR0A 3OE5A 4RWZA 4CKEA 2ZZNA 1EJ6A 2XVMA 3EGIA 4AZSA 4PWYA 3OFJA 2O05A 2Q41A 3FPFA 2Y1XA 3FTDA 1XCJA 5DM0A 3HCDA 3HVJA 3G5LA 1KP9A 3E05A 2ZW9A 3HNRA 3DLCA 4M37A 3HVIA 3KHKA 1O9GA 2VS1A 5E9QA 3AXSA 5E9JA 3GGDA 2BR4A 4GOOD 1SG9A 4DCMA 4QTUB 1JG3A 4E70A 3JWJA 3DXZA 4FGZA 3KQTA 2P3LA 3M33A 2YVLA 3JWHA 4MTLA 1VQ1A 4R05A 4YUVA 3P9KA 3LDUA 4KIGA 1NV9A 3MERA 2CWWA 4PCLA 2OBFA 2IH2A 5K0FA 1XDSA 3SM3A 4QTTB 3LKZA 1XVAA 2AS0A 3LKDA 2ESRA 2O07A 3MCZA 4NECA 2YX1A 4PONA 1JG1A 1SUSA 3CKKA 5LQCA 4RTNA 2G71A 3BZBA 4L7VA 4Y2HA 4LECA 2GA9A 3TRKA 3ME5A 1SKMA 4KDRA 2PSSA 3ELWA 1RI4A 5DT2A 4CKBA 1NKVA 4RTSA 1RI5A 1KR5A 3DUWA 3PFGA 1IY9A 3G8BA 5EHGA 2UYCA 1KHHA 2ZTHA 2ONZA 7MHTA 4HC4A 2LD4A 3V8VA 3QOWA 3REOA 3FRIA 1XTPA 3ER9A 2FPOA 5GP1A 1ZG3A 1X1BA 3BKXA 5T67A 3KKZA 2FHPA 5EKXA 1FPQA 3EGEA 2PX2A 3EMBA 2CMGA 3CGGA 2HR1A 1H1DA 3NW9A 3DP7A 4M36A 1ZKDA 5EGSA 3DTNA 2B9EA 4LG1A 5HEKA 5C1IA 1SQFA 4C07A 1ZHFA 4RVGA 3PX3A 3G88A 4FZVA 3I5UA 2C7QA 2HMYB 1QYRA 5K0LA 2OB2A 5IH3A 3KQVA 2ONYA 3UJDA 3TM5A 4GC5A 1L9KA 3OCJA 5FWDA 2WK1A 2JH8A 3BGIA 4KRGA 3HP7A 2P7IA 3BKWA 2JG3A 2OO3A 5KQRA 2IPXA 1I1NA 2AN5A 3CJTA 1D2GA 2AZTA 2ZIFA 1EJ0A 1FP1D 1VIDA 3OU2A 5E2AA 3PB3A 3B7PA 2V7EA 1X1AA 1RJDA 3LCVB 2JHAA 4GOLD 4QQNA 4DQ0A 4DA4A 1FP2A 3EPPA 3VC1A 4BLUA 2B3TA 1RI2A 2H11A 3JWIA 4IKPA 1SVUA 5EC8A 3S68A 4ER5A 5GIPE 4YV0A 3SMQA 4P58A 2EJUA 2P35A 3KQWA 1DL5A 3ELYA 4IV8A 1INLA 4XCXA 5FQNA 3RODA 4DMGA 2PX8A 5EMKA 3LBYA 4E2ZA 2QYOA 5H02A 5K0GA 1P1BA 2DPMA 1NE2A 5CVUA 4MIKA 1P91A 2FRXA 2ERCA 4V0RA 2P3OA 2PT6A 1P1CA 5LQNA 2E5WA 3EEYA 1VP9A 2NYUA 1Y8CA 3CC8A 5EMMA 2NXJA 5DTRA 2O0LA 4RVDA 3LCCA 2GAFA 5CM2Z 3P9IA 1QANA 4QDJA 2CMHA 2EJTA 4G56A 2IBTA 3BT7A 2GLUA 2V74B 3E8SA 3G8AA 3HCBA 4X60A 2PWYA 3GIWA 4U7PB 5DPMA 4CTJA 5CIYA 3GNLA 2ZBRA 2NNWB 3LL7A 3JWGA 4MWZA 3X0DA 4DZRA 2IFTA 5HFJA 2IDJA 3LHDA 2PJDA
chains in the Genus database with same CATH superfamily
1JQLB 3IMKA 2EKPA 2P1ZA 3PT5A 4S1NA 2EX4A 3SJ7A 4R1NA 4G84A 3NVDA 2H57A 2QVBA 5FJJA 2JD0A 3DHNA 4W7HA 3ELDA 4QDTA 5ETJA 5IABA 4ZT2A 5EJIA 4DRZA 1GRVA 3NEPX 2UVQA 5TX7A 3HK2A 1LVGA 1ZJJA 3R0ZA 4XWAA 2GEUA 3ASVA 2CFOA 2ZYUX 3E9CA 4EB6A 1QRAA 2QRGA 5HK9A 1BXRB 2QORA 1I4DD 1XQVA 3AP3A 1OYWA 2W93A 2AMFA 4NU5A 1T91A 1WB6A 2F59A 3H13A 4Q3DA 1E79D 4RY8A 2FW0A 1CJSA 1UK9A 2BE9A 3EG9B 3HNOA 2Q9BA 4L72A 4CM3A 4F4JA 1O8CA 2F3RA 3WFJA 1GL7A 4AZ3A 1JKFA 3EZXA 5MFZA 5AK6A 1MP0A 1ONNA 1C7IA 1VHJA 2IQIA 3OT1B 4UMEA 1FXWF 3OSUA 2E2WA 4P8RA 4YCLA 3I0ZA 5BNFA 2FPPA 3SX2A 3GFPA 1C0KA 2QE7A 5HSGA 4LWOA 2F1RA 4UTRA 1JSLA 2ZSBA 3SZRA 5ICCA 1KVRA 5LUAA 1LS1A 3A4IA 3EVZA 3CM0A 1V4BA 2VF7A 3QXHA 5CG2A 4W9MC 3VR5H 4KFTA 1H8HA 3VZDA 1SU4A 1VCOA 3KSDO 1CJUC 3W7AA 1E2FA 5I7UA 4U6QA 4IJKA 4EWLA 3PNYA 4WKPA 3GEEA 4M0EA 1GKLA 2WKPA 5TS3A 4D98A 1G291 2OC4A 2P2YA 3F3MA 1LF5A 3G2JA 3NBYC 1XRNA 4N3AA 1E1RD 4LJ6A 5E2BA 4N6NA 4R3WA 4FHFA 4PLGA 4Q7JB 4EZBA 4XJSA 3HYNA 3SKVA 3IUSA 2I71A 5P21A 2UZ4A 4J49A 1Z5GA 4R8SA 1E64A 2JAWA 2R6GA 4NZPA 4OHZA 4NBNA 4R98A 1HMYA 1IHPA 1O6ZA 1PJ8A 3HA3A 4Y3UA 4LVUA 1KE2A 3UJAA 4ZJUA 3ZDCA 2BEVA 3LQ1A 4KQFA 5G1NA 1JQKA 4MWBA 1XK6A 4HJRA 1FUUA 3ZKWA 1XRJA 1T4CB 2FW1A 4BWGA 5CB6A 5KINB 3ZWKA 4HNGA 1YQEA 2P6MA 3SKYA 1YKSA 3QLVC 2X8JB 3K16A 3R3XA 3IUBA 4DM3A 3D0OA 1PZEA 1CQIB 4C06A 4GQAA 4C1NA 1ZS9A 1HQDA 4E6PA 3OE7D 1VE7A 5D85A 3DDOA 1SRQA 1OAOC 2I3ZA 1D6JA 4PG5A 2G9RA 2LE0A 2AMLA 2LR0A 2QAGC 4LHSA 5BQ5A 3SIRA 2A0FA 1MX5A 1X77A 1KVTA 3GPLA 2P9QA 3LYUA 4UOQA 2RE8A 5WRFA 3CUSA 3GMDA 4D8XA 1J33A 4OB6A 1IBCA 2DT8A 4TMYA 1VPWA 4AP9A 1E99A 1VPEA 4GT1A 3PIDA 2F17A 5LNK6 1RPZA 2HJVA 4TLLB 1AK2A 4UVGA 2BEKA 1NA5A 1NHGA 3G1WA 4MVJF 1EFAA 4EI7A 3AO0B 4YUXA 2W2LA 1GU7A 1OI4A 2I76A 2HHJA 3K35A 2OD9A 4YP7A 3W9BA 1DRVA 7ADHA 2WNIA 3GUHA 3ZVNA 2H63A 1NI3A 3I6MA 2XDAA 3BCRA 4X8OA 1QGUA 4C7JA 3R5XA 1PGQA 4P7FA 1JXQA 1PTJA 2ODTX 2VJKA 2ZJ0A 2HW8A 1JFLA 1I4LD 3GAZA 1FNMA 3I5MA 3DBLB 4QSMA 1XLVA 2AG5A 5FYQA 1YK1A 2GZHA 2ZVDA 4ONEA 1ND6A 4KCGA 2I4MA 1VSTA 4J2HA 1Z45A 2HIHA 3VYWA 13PKA 4IHJF 4OQQA 1HYHA 1KGDA 2I7DA 2VXCA 2RG7A 1XEAA 4HTAA 1GZ5A 1TF5A 4I1UA 4C2BA 3QLEA 2JKZA 4EY7A 4TVKA 1SOMA 1DZIA 3BXHA 1NNLA 1ODIA 2PAAA 5I51A 1FYWA 4OXKA 4BP1A 4TV8A 2K2WA 2EP8A 2PN1A 1A1SA 2CXOA 3DMGA 4EA7A 5KMGA 1EXMA 3HJGA 1SIBE 2BM0A 1FSGA 2FB9A 3A4LA 2XCIA 5AOAA 4YP5A 4IIXA 3BL5A 1KZ9A 3S5JA 2BKVA 5AK3A 2Q7OE 4QBHA 3AERA 5GM1A 2HSGA 5J5CA 3MUFA 3U9SA 4CHGA 4D8VA 2DQ4A 4GM4A 4NZYA 5IX8A 1ZR4A 2KLHA 3GXOA 3IP9A 4EG5A 3UXEA 1X7WB 4PYLA 5FBKA 1GGKA 4D3SA 2HHAA 3OOEA 2QL9A 2Q45A 1ZK3A 2G9QA 3JVDA 5E6RB 3HFSA 3ZHTA 1QG4A 3TEJA 3GJYA 2DC1A 4FR2A 1NN3A 1TYAE 3E15A 5EHQA 1E3LA 5K3OA 1ID8A 1IG3A 2FFRA 1TQHA 4KRXA 5GMOA 2QTLA 3M6XA 3I28A 3W5IA 3ZXIA 3TQIA 4YP9A 1G38A 1Z2CA 1NRJB 1KO8A 1QHHA 3COWA 2J0VA 4C0SA 4AKSA 4W9RA 3TCNA 3J81A 2CL7X 1HFWA 2BLNA 3CSSA 3HXTA 1KC1A 3A3PA 5DYWA 4DBZA 3LCUA 4I4TB 2FQXA 2IX9A 3BTSA 3SZUA 3K1TA 3NBMA 3WE7A 3RVOA 4LFCB 3ICVA 2XAAA 3P9SA 1D7OA 2H00A 3PNSA 2AYZA 1N4DA 2VP0A 3AESB 5GONB 3RNLA 1TECE 3ACCA 5K0EA 1UMKA 4LISA 4DA7A 5BWLA 2COKA 3HA7A 1R0SA 2CYCA 1DG1G 2AFHB 5LMUB 2K7ZA 1T5LA 2P41A 3B70A 4A7PA 4CIVA 5E1DA 3DEZA 1U5BA 1OFIA 1JDVA 4NJMA 3VZSA 2ZXUA 3DZBA 3VPXA 1QP0A 2CSXA 2FG6C 3R9XA 3G85A 4G0XA 1P4HA 4L8VA 4PS1A 1EK1A 3T9FA 3ZVRA 3FKSD 3ZCUA 3CKMA 3A2KA 4KN8A 3JW8A 1UCFA 1BE0A 3CISA 5FBWB 3CEAA 3S1LA 4GRAA 1UEJA 4M9XA 3UWPA 5I8ZA 1NQTA 1VIYA 4Q9DA 4YJ3F 1GLGA 3B9BA 5K0ZA 1T3HA 2WHPA 4LDQA 5JR3A 4TPKA 4L74A 4WBXC 2XCTB 3HBFA 2VP2A 5FR1A 3WFIA 1P72A 3OQ1A 3SHWA 5C5CA 2FOIA 3U81A 1Z7BA 2HFKA 4MCHA 3SBXA 5ITZB 1PX0A 1NGSA 3WYBA 2R7NA 1WSWA 3IVRA 4ZCRA 3QVUA 4CYMA 4F11A 1UFQA 2WM3A 2RH8A 3IAS1 4KV7A 4CLRB 2MR5A 5B7GA 3MIIA 3G13A 3E3MA 4QATA 3D2CA 4MA5A 4EPWA 5MF6A 1YJBA 1FP7A 1HY3A 3A4YA 1XPRA 2O8DA 2AUMA 2P5SA 2PLFA 4GMHA 1BO6A 2YWGA 4QJ3A 3VR2D 4EUHA 4EKEA 8ABPA 5GIOE 2JGLA 4IR7A 2FG7C 1H93A 4NMWA 2XGOA 1JU9A 2H92A 4ZAYA 2NX2A 4Q4JA 5D51S 1E0KA 2J3HA 3A6DA 1F0YA 4K1LA 3G59A 3RIHA 5CEJA 2VK1A 5F5NA 1H2ZA 1G3QA 1JEOA 1HDGO 1CQWA 4TXNA 4AB1A 1U2QA 2R86A 1GJRA 5HW0A 4J0CA 1Y82A 2F3QA 3AGPA 4KQHA 4QEKA 2ZT7A 3UJ9A 1R8YA 1B1AA 2GEDA 1URPA 1O1YA 3IHKA 1U1GA 1EGVB 3MLEA 4MW7A 5CJJA 4BFCA 4YUWA 3UMYA 2FWNA 1N5OX 4LGYA 2HJSA 2EFYA 1CJTC 1X7ZA 1TM7E 2BFCB 4Q03A 4NAHA 2GYUA 2A0YA 2BCGY 5KEIA 1NDQA 5GY7A 5JWOA 4UD6A 2FUNB 4ZO6A 2XCSB 9LDTA 1EFRA 4BNXA 2NZVG 3ZWNA 3ERCA 4F3RA 1V5GA 5HA5A 5A5GA 2Z6UA 3RBZA 1O6FA 2V7QD 3L0PA 1R6VA 1L7MA 4HQ0A 5FPYA 1DC3A 3D7KA 2VYND 2ACVA 2AI2A 2OKGA 2V03A 3GBVA 3HGMA 3M81A 3N8NA 2X4IA 4NABA 5I7WA 3ABOB 4CMKA 1W88B 1S4QA 3CPJB 1JQJC 3FFXA 4JT8A 3QVJA 4E7PA 3QUSA 1KOFA 5KB3A 3PXEA 3SGLA 5D84A 1LRKA 3GLIB 5K8LA 1BCSB 4RPHA 4OHVA 4EPRA 3WAGA 1TUGA 5B37A 4GUAA 1ADGA 3LT2A 1D04A 3JD3A 4L3OA 2JD2A 1ZITA 3AY6A 4K8OA 3C3JA 4TWIA 1Z68A 3ZZMA 4LI3X 4LYAA 2IKSA 4M1YA 5BOVA 4IIHA 4TTTS 4ZEOA 2WMNB 1R3DA 2PRIA 3D6UA 3H2HA 3UF0A 5BW5A 3IXLA 3PGKA 2PYDA 1VSUA 3WP1B 4DUGD 1M1UA 1KI3A 3NMUF 3OZUA 1N6RA 4M21A 3VR4A 4LW8A 5FBHA 3PCRB 3QXGA 5F9MA 1F60A 3ZG6A 5HNKA 1JN0A 3HBAA 1JIUA 1QIDA 4HGPA 1VKHA 4OYHA 5AR1A 1ISGA 1PT8A 2Q6TA 5AM0A 4BTVA 5HRCA 3IDQA 3UK2A 2FYTA 1EEXB 1FTNA 2I3DA 2LVBA 2JHPA 2OD2A 1U80A 1RHRA 4UTPA 5A4DA 1MENA 2I9KA 2OM2A 5TJHA 2XMDA 1NURA 4PYQA 4UU8A 3TEMA 1K1EA 1K8XB 3S7ZA 2W6CX 4ZHSA 1IB0A 1NVGA 3ORHA 4HGYA 1E3JA 2OSVA 2WR8A 1YUBA 3H1AA 4P33A 1NUTA 2MSEB 2GA8A 1V26A 2QJOA 1HT0A 4IDFA 1XOIA 3CF0A 3NIDB 1L7VC 2BD0A 3OPYI 1SUPA 3CEPB 1NN5A 4GL2A 1KTVA 4ENPA 2A3RA 3GFRA 3H9BA 1L7BA 1XO1A 1QLWA 5LU8A 1MEEA 1YKGA 1EK6A 4R2HA 4TTPA 1AN9A 2HXSA 4RIGA 4YCNA 1A76A 1M1NA 2Y1OA 3AR7A 5IJZA 4FE3A 3W4JA 4Y9TA 1NDUA 3HVJA 5JNSA 1QGZA 1JS1X 4PHCA 1V11B 3NM5A 3QEMA 2NZ8A 1ZJ4A 4QOJA 5BR1A 3GEGA 4AS1A 2AZ4A 1F06A 1WABA 2Q0SA 3GGSA 1ZUIA 3BL6A 3VI4B 5JQGB 3AR9A 3SFTA 4C3ZA 3D3NA 1GQYA 2IS6A 2RI6A 4C76A 1UM9A 4DDMA 3TGLA 2RHHA 4EY5A 3T8YA 1B8PA 4NXMB 1UZUA 1MOPA 2PEZA 1MEJA 1ZU4A 1WB5A 1YKFA 2O1SA 3HBJA 3E2MA 1T8SA 3C3XA 3LO5A 1E79A 2DE0X 4Y6QA 2FW8A 2V0NA 2AK3A 2J6IA 2O07A 3NXSA 5KOHB 2AXNA 3R0IA 1VFPA 1T6YA 2ZJ8A 3JPYA 2H7CA 4G5SA 3UAWA 3D54D 3UGTA 2R8BA 2AR7A 2V96A 1QMGA 1KNXA 1ZMRA 1XN4A 3AKYA 2GYWA 2C3YA 2P5YA 4PZDA 3TRKA 2HF7A 1C14A 1PFKA 4JXXA 3F0TA 4XDGA 4RTSA 3D7SA 1ZHHA 2C2XA 4JI0B 1N5JA 4EHHA 4ND8B 1L5RA 4BGDA 4U63A 1FX0B 1LGYA 3CTMA 1ABBA 2FPOA 1SU8A 2V3CC 3H5LA 3HJRA 2FR0A 3GP3A 5I4CA 2GCGA 1AGRA 4G65A 4Q4DA 3P96A 5TIIA 3F49S 3DBIA 4AZ0A 1DOAA 2LW7A 1GPDG 4NZMA 2ZIUB 3CLUC 4FZVA 4MS1A 5KYYB 2C7QA 1EP1B 4X7MA 1W36C 2IE8A 1GILA 1GPLA 2IZ0A 2QQFA 1MO4A 2NO5A 2DZDA 3EA4A 1E1RA 3KQVA 1MJGM 2GZRA 4R9SA 5AK4A 2W7TA 1NQAO 3ABQB 3MJRA 2XIJA 3MWFA 4M1WA 2Y6VA 5A0FA 2J32A 3P5BA 3UGQA 4EEKA 2BL4A 4A27A 4GBGA 4WOCA 5JAPA 4A2WA 2O3UA 3JRNA 4GXNA 1QG0A 2MINA 4J4HA 4DCOA 4J1TC 1Y8QB 3PEVA 4AUNA 2HBQA 4S2EA 1XZJA 2VSFA 3H11A 5AHWA 2V6GA 3JQCA 3BE8A 4K2AA 3P9XA 1L1FA 5IHPA 5KOJB 2I29A 1AE1A 1DG3A 2P35A 4TN1A 4UEOA 2YY5A 4FYKA 4FHEA 2I55A 1E1DA 3BIXA 3OE7A 3A3KA 5JYBA 1H94A 2J4FA 3IKLA 5FPTA 1P1BA 4C2UA 2QLBA 3WAKA 3LRPA 2DTEA 1EK5A 4RHYA 1MD9A 4Z86A 3U37A 2HOQA 3G0OA 1NIJA 2NYUA 3N07A 5EMMA 5IDYA 3V7NA 2HQ1A 2NXJA 3RLIA 1H2RS 5CM2Z 4AL4A 4EMTA 4MULA 8ADHA 1UR5A 4EB8A 2JASA 1XHLA 5KPJA 3HBLA 3E8SA 3FNBA 3G8AA 3GIWA 2JKVA 2LCQA 2QPOA 3MD0A 2D8MA 3GNLA 4TKVB 2C04A 3TLKA 3JWGA 3ZDZB 3BK2A 1KS2A 3LVRE 3OZ7A 1OXKB 1J5XA 2HZBA 3FG9A 4K03A 3WP0A 2MOKA 3NOOA 2A0UA 1DRKA 2PYZA 3GLQA 4ZI7B 4M1EA 4EJSB 4XUDA 3DEAA 1UWVA 4ND3A 4NZNA 4HAWA 4XTRA 2YY6A 4Q21A 1UPXA 1N0VC 1I1OA 4MUKA 4HNTA 2VPZA 3UK7A 5AW2A 3HJUA 1PL6A 1FUYB 5AP9A 3T34A 4UAGA 4HNAB 1TJNA 1XCGB 2G70A 3QXXA 4UQOA 1KAMA 2FPSA 3BXFA 4QJ5A 4X8MA 5HG0A 5HKBA 5LD2B 1HMPA 4YFYA 3PQDA 2H2HA 3NEAA 2O1XA 1RTKA 2EP5A 4OXYA 5L51A 5LQKA 1WUYA 3IDAA 3ZIUA 4JB8A 3VDRA 1XMOB 4KWCA 1XD2B 4JS0A 5EZ5A 5ED4A 1RLJA 3QI2A 2Q1YA 2ZLBA 3Q2OA 1GTL1 5DASA 3GPDG 3II6X 2BGGA 3AOGA 3EVGA 2QGFA 5JBNA 1XDDA 1AQ6A 4HLNA 3AF5A 5BO5A 5EIAA 2ZVJA 3HL4A 2GTHA 2V97A 5DBGA 5CRIA 2INGX 3AUTA 4L0QA 1J90A 3T1OA 3GRVA 2PH7A 4CFSA 4F21A 2R87A 3CBGA 1ZK4A 2I6FA 2D6FA 4PIMA 3NX4A 1L3IA 5BWBA 4DKJA 1DC6A 1PEAA 4C05A 5AW0A 1Y8RA 3UV7A 2PUBA 2DR0A 1KR2A 2PQ6A 4RKYA 5AKEA 2PMWB 3I3SR 4PSAA 4QNRA 3UK0A 1R6XA 2CFRA 2O8BA 2ORIA 2SKEA 4X20B 5AESA 5TGDA 2YYZA 3QBDA 2IYOA 1ZIPA 5EEGA 4CT0A 1TM5E 3B48A 3BXGA 4U6SA 1HYQA 2ZB4A 4JP3A 5BN4B 2VI5A 4L8YA 3WGHA 3ADOA 4CDGA 2K5UA 4N5IX 3IE1A 5IZCA 2R2AA 4KIWA 1CNFA 1B00A 2PANA 3DQQA 3WG9A 4EW6A 1XZFA 1J07A 2FX2A 3C1UA 4E3WA 2FTKE 5F73A 2C5LA 1FJ2A 4MLDA 3WLOA 3RHZA 3E84A 4R9NA 3TS1A 1TXGA 1ODJA 3K6RA 1GSHA 3I62A 5BN5A 3F8TA 4CQLB 3ZH2A 4CIAA 1JJFA 4MVJI 4B75A 2B8WA 1WXQA 2Z1NA 1FDIA 5LA6B 3O7WA 1JDNA 3R0QA 3OM0A 1BROA 1ELOA 1NBEA 1HWYA 4AW9A 1SQ0A 1AF4A 2GZSA 3FKSA 1F4LA 4HX9A 3NWPA 5HCUA 1FVHA 4NZOA 3VBEA 1LQUA 4H17A 3PDIA 1GYRA 3W2IA 4EHNA 1PGNA 4P5EA 1GSOA 1OE0A 5CTAA 2AHOA 2FSVA 3ILVA 2GF9A 2WQ7A 1YULA 2IWRA 2ZVQX 1HLFA 2QW8A 3TBFA 1GAQA 4N5MA 1EK0A 2R6AA 2YS6A 5AHRA 4CT5A 1NU6A 2B2XA 4CDRA 1VOTA 1YQ9A 1V0JA 1XLWA 3VKUA 1RYEA 3JQGB 9LDBA 3ENZA 4B9AA 4KE8A 4HNVA 2O4CA 4EATA 4DLTA 4MRMA 2H1WA 2SNIE 5BV0A 4DR6B 2AUTA 4OQMA 4KAXA 2PWPA 4H1WA 1EXWA 4A8JB 1A4UA 1C9KA 4MUXA 4TKZA 5CLGA 1GXSB 1FEZA 1KETA 1H4VB 1O9BA 3FGZA 3OTIA 4AG5A 2ZRPA 1UDXA 2AG8A 1UBJS 4P92A 3SC2A 2R96A 1OBVA 1YQQA 4ZRNA 5TQ2A 2MSLA 4DCGA 2J3DA 4Y30A 4LDAA 1P19A 4GBMA 3KJFA 4URFA 1X9GA 3R7BA 5IS2A 3OETA 2P2GA 3D0RA 5FI3A 1N3BA 2BGTA 1RWKA 2XYPA 3VR2A 2DPGA 2XUFA 3B8EA 2V7VA 4PR3A 1ULSA 3IBSA 2H0AA 2YW9A 3TNJA 1MVLA 1I0LA 2EV9A 4GEKA 3GG9A 4PGHA 4O2AF 2ADOA 4NEHB 3CZ4A 1UXOA 3P97A 1KO7A 1TKAA 2A5JA 2JCBA 2VDUE 1XZMA 1B43A 3A7EA 4RULA 4MVJE 2ZJBA 5TLSA 4TVSA 4XD2A 4FBLA 2XEXA 5SV2A 3AVXA 4DMUB 3DM5A 5KO2A 2NTVA 3E18A 2Z1DA 2Y76A 3EDMA 4X8LA 2QRPA 3W6ZA 2JPDA 2WIKA 2GRAA 2JFGA 5GWXA 1Z8NA 5SICE 2V7UA 3KUXA 3MIZA 4HY3A 4F9EA 4DC9A 5J4LA 5LMZA 1KS9A 2QRVB 1SVWA 3H83A 4FCWA 3WFZA 2V5VA 1GKUB 2Y1FA 3TZCA 2Q0QA 2VDLB 4B6JA 1LBIA 2O8EB 3PL5A 3K09C 4ROSA 5BV8A 3CS3A 2XA2A 3R77A 3PQ2A 4GU5A 4N3CA 5LP6C 3B7WA 5EE9A 1LLQA 2W2PA 1PLLA 2QU7A 2V7QA 3FHOA 5JHHB 4IS2A 2IHUA 2VYNA 5KVSA 2XOXA 1HM5A 1U9IA 1YRQA 1QH0A 1ZU5A 4BZPA 1P77A 4NTZA 3RS8A 1G6HA 5E6SA 3A06A 4CL0A 4DSOA 2MDTA 3OZDA 1R8SA 3DJFA 3LZDA 4GPIB 1GCUA 3GU3A 4OM7A 2WU1A 1ODFA 2XHZA 3NLLA 4QYTA 1QK3A 1SCAA 2JRCA 3BSYA 5DKFA 5KYNA 3BGDA 1KL7A 1M2VB 4C4OA 2C9OA 1XBTA 4MVJD 2PRJA 4Y98A 4D0LB 1BXZA 1ZVQA 2V54A 3KRTA 1CRQA 2IIQA 5K9ZA 1PUJA 2YZMA 1LY1A 3QVGA 5CT8A 5EJ9A 1NNUA 5G1PA 3WLSA 1E3MA 3E1GA 4QVIA 4D9KA 1XTZA 3BZUA 1ONSA 1OTHA 1ILWA 1NL3A 3LYLA 3BQ9A 3JALB 4DUGA 2X1MA 5JVDA 3FTEA 1HNNA 2R4UA 3KB1A 3TZBA 1WPGA 4EW1A 3K70C 1RXYA 1MNAA 2I54A 1IVSA 2IYSA 2I7XA 1F38A 1I2ZA 3ZXSA 4YGXB 3L6OO 3L4KA 3I2YX 3E7FA 3MTDA 1KDZA 4A2QA 4EF6A 1BS1A 3SR3A 3EYWA 4DUYB 2OXRA 4XRRA 3UMSA 2O23A 3M82A 5CVCA 1HYBA 1RLMA 2R6R1 3OTGA 5KJ1A 2A0XA 4C4AA 2HA2A 4IH1A 4ZVUA 1HQCA 1Q7BA 2VRBA 1MXHA 1QH1B 1RWWA 4F3KA 2C54A 4HQRA 3NM6B 1FDTA 2QMOA 4LQ4A 1ZMXA 4U4AA 4ER7A 4WW0A 2V7XA 4UXJA 2G9UA 2UUAB 5E3IA 1HF3A 3CW2A 5CDSA 5JH7A 4OI1A 3ZHCA 1RRGA 1KEEA 3LTNC 3B3GA 1C1DB 4XA8A 3TB4A 3RYCA 3CF2A 4US0R 3TB6A 3W1WA 4F1KA 2MT9A 1CZKA 4AT1A 5D7NA 1OB5A 4W5NA 1KI2A 2GS9A 1I6WA 2EWWA 2N1MA 2VPTA 1HLPA 1T36A 3P0FA 1WXIA 5AKKA 4GDFA 4IBOA 1LC0A 3TG2A 1CJBA 2ZJAA 4MXDA 3MLBA 4V1CB 2O06A 5C1PA 3WX0A 1NE7A 4HGQA 1DGQA 4ZT7A 4WZZA 4ON9A 3B6MA 4GI3A 5TEVA 3WSVA 5TSDA 1M72A 2VNAA 2POCA 3P20A 1BDIA 3K0SA 3B36A 3SJCA 7REQA 4Z3OA 2RBGA 3U7EB 2WYOA 1QKKA 3O4VA 1WPXA 1CDZA 3EE6A 4G5HA 4H1HA 4RMNA 4DCVA 1FDWA 2A5DA 4DYDA 2O2ZA 4EM6A 5K05A 2XQFA 4M2LA 4K6KA 1I3CA 5IXJA 1XCBA 2BM1A 3O90A 1JMYA 2HREA 3QE4A 5EE0A 2QLTA 3MMPA 4EKYA 4DUZB 5FPSA 2C78A 3ROTA 2FEMA 2IP1A 4LZWA 4PZ0A 5JJBA 3GP8A 4B2PA 4POOA 4JHXA 3D5TA 4G5YA 1A69A 1SQ5A 3A9UA 2JC3A 3K5WA 3SJBA 3TQQA 1SBQA 1T1IA 3BTOA 3E9QA 3QK7A 3OQHA 3DLHA 1IUPA 4PX2A 3RIYA 4HLQB 4LNUA 1I7LA 1WCIB 4PC6A 4ZDJA 3WGKA 5BUSA 1K88A 1PFGA 1KKMA 1V16B 4TYNA 3M6LA 4ENRA 1ZPDA 3CURA 3BYZA 4QXPA 5CNIA 3CG0A 3GFFA 5AKLA 5DV9A 3TMKA 3Q10A 4NRDA 3V6MA 5LZ9A 3U7FB 5T57A 3AQIA 3IQIX 1G20B 4GLFA 1YJ5A 2A14A 1M67A 4B3SB 3QBJA 1ORIA 1JKIA 2ZPAA 4QNNA 3PJRA 3GZTB 2QZ4A 1V71A 1G6Q1 4PZEA 3GJ3A 1A9ZA 4PPGA 3R9IA 5CK5A 3KJEA 7GPBA 4LFBB 3MNFA 4ACBA 3S99A 3TZHA 1VG0B 3VZRA 1JLLA 2ASVA 3IESA 2HTEA 2C4KA 1D2RA 3H97A 2X9NA 2PZ8A 3JRWA 4EYQA 3D4LA 1FPMA 1RVDA 2R8OA 1RZ3A 4R9VA 4AKHA 1GA6A 3D6FA 4N0EA 3OPYA 3MN1A 1Z0FA 4NFSA 1NOKA 5KX5F 1QF6A 4OQPA 2HJGA 1DIRA 1ZEMA 1Q1NA 2WZQA 1TEHA 3GJTA 3IEUA 2NZJA 5DM1A 4YXWD 1W5SA 3Q3JB 2QRMA 4LS3A 3GFOA 3N2KA 3RQSA 2C7BA 3IB6A 3KKKA 3JTEA 3WKDA 3A25A 5B1YA 1U90A 2GF2A 5BVHB 4M88A 3WMGA 2OFXA 3HLKA 2ZT6A 4XB2A 4TQ9A 1NYQA 1IXSB 2YJNA 1XRPA 4X6UA 5REQA 5HQJA 5EUCA 3EOZA 3L01A 5IKXA 3VJKA 3E05A 4JX8A 1D1PA 1H66A 3UT6A 4BMCA 3AV0B 3QMMA 5E9JA 4OBBA 1NOJA 4GOOD 5HKAA 2EBHX 1JKXA 4JR1A 4DCMA 2QAGB 1JW9B 2BZSA 3FLAA 4QAQA 3MBIA 4EFKA 5F3WB 4R3UC 5AW5A 2ES4A 3IGFA 1OXUA 2GX6A 4OXQA 4FFLA 4X95A 2IV7A 4Z7OB 5D2CA 3DT6A 3T5TA 1RMTA 4KSBA 1HT2E 4RETA 3VO8A 5ECDA 3BMXA 4KQIA 2HU8A 5JRDS 4QTTB 1NF3A 5CM8B 3MHPA 5JV5A 3LPAA 5CH3A 2VQFB 3V7UA 3QTTA 2NUPB 1JA0A 2X41A 4ND5A 1C4KA 3DC7A 3O2JA 5HCIA 3DO8A 3H2JA 1TYBE 3MK31 2VP4A 5JCXA 3WNBA 3TXYA 2QL7A 1PW7A 1ZVVA 3OI7A 3BHNA 4BVJA 1HNWB 1PL7A 1A97A 3WZ2A 2Q3EA 3LI2A 1PZNA 3SQOA 3G8BA 1DFIA 4BMOB 1R4NA 1ULZA 2ZTHA 1KC3A 2YHIB 1O97D 4BASA 4B7CA 3SYLA 1AIPA 4BS9A 2NTNA 2CMGA 4DQUA 1KFCB 3B8HA 1TC1A 2VPIA 1G16A 2AG1A 2XUKA 4M36A 5HEKA 1MN6A 4JD5A 2BFOA 1VI5A 2YN4A 5TVKA 3UAVA 3UY4A 5BNIA 3DM9B 3KFXA 1SC9A 4FWIB 4RGYA 4BBJA 2XKAA 4Z54A 5ELMA 3N9IA 5K0LA 2Q5OA 3VX4A 2XXAA 5BR4A 3I4CA 5LUBA 3BGIA 3EXHC 1F2TB 2P7IA 1EVLA 1IU9A 2VAPA 4UUQA 1Z7GA 2AN5A 3IC5A 1TAGA 4JFRA 5E2AA 3RS5A 4D4MA 1XUOA 4LRXA 1KXJA 1NMXA 1SELA 5EY5B 1ZA1A 2RIRA 4HAXA 2JFWA 3UWMA 1DAIA 1Q2XA 3QHPA 2JIPA 2IYRA 4MVJP 3KUKA 1IZ9A 2ZKIA 1EHIA 4TSFD 1K7SN 1FDRA 1XRSB 2XQKA 3JWIA 4UHFA 2DB3A 3Q85A 1WTAA 3FJOA 3QW4B 4YV0A 4ZOQI 1Y6FA 1EUCA 5HKLA 3MG9A 5F7JA 2VHQA 1OHHD 3MD9A 4DRXA 3AL0C 1W4BA 4AG6A 2ZBDA 1GQ2A 3ORSA 4TL6A 3CU5A 4HH1A 2ZI4A 2A94A 2A9KA 1H3FA 1O57A 2GAJA 2R7LA 5HS4A 1N7GA 4LOJA 1V37A 4V0RA 3ZE0B 1BIFA 4MB0A 2CZCA 3RTAA 3V8MA 3IJPA 1QV9A 1ITZA 1X8XA 1HDRA 1Y8CA 2WM2A 4NP6A 2O0LA 3W2TA 1LNZA 2WM8A 1R64A 3ICCA 2JI9A 3ZWYA 1X13A 1UP7A 2G9ZA 5EFOA 3TZEA 4CTJA 3M89A 3WMFA 1FMFA 2H59A 1L8XA 1K2WA 3LL7A 4U7WA 2IW1A 2ZYAA 3OY2A 4A4DA 4EG7A 2P6RA 1ESZA 3DHVA 1V7ZA 1D03A 3NASA 4O2RA 4ABTA 2GBLC 2NU6A 4MCAA 4FEGA 3IEIA 1I3MA 1FXWA 4W1QA 5CX1A 5IJWA 1U0RA 2GJ9A 5DXFA 4J6EA 3F5SA 4YTEA 5CBPA 1D4ZA 2YMMA 5L3QA 1M8GA 2O5EA 4K9OA 4RM3A 3NDJA 1E9DA 4YRGA 1KOJA 2BVNA 2GO1A 1YDEA 3BE5A 1IN7A 3EVAA 3HPRA 3MPOA 4GH5A 4F7DA 2QM0A 5ENZA 4CIWA 2YICA 1M5UA 2PLAA 3IOEA 4TQGA 5LDGA 4BNIA 2FKAA 1O6GA 4IHAA 1WZCA 3RM3A 3RYIA 4ZVVA 2C5FA 2J85A 1NWHA 2KHZA 3ONNA 1UPAA 3ABRB 3ESDA 5MHTA 1ABFA 3I8SA 1BRTA 3IQXA 1F2DA 3F71A 5H68A 5CTJA 2BFAA 4BU0A 4F4FA 2Y0EA 1Y5LA 2P4SA 2VNIA 3NHKA 4YAWA 2IEIA 3BIWA 5DISB 1GRNA 2XA9A 3JVVA 3A28A 4FYMA 5K2MA 5THKA 3V5NA 3C3DA 4LCJA 4F2PA 2AVNA 4PNZA 5I9SA 1HTTA 1Q0TA 3IR5A 3C7CB 4BFYA 2C7OA 3LCJA 3T4PA 3ZXUB 2QZZA 4YYEA 2BRUA 2F9LA 1R66A 5JI2E 1D9ZA 1N2IA 4HVCA 3GVCA 4EO4A 4MP8A 3VTAA 3OVMA 5TT0A 1DP4A 1NFQA 4RAQA 3PJGA 1ARZA 4WI1A 5EG5A 3MT7A 5B1IA 4G4IA 2JH3A 3G02A 3IOBA 1Q7EA 4Q7LA 2CNDA 2UYQA 1IY0A 1JB9A 3GA7A 4YMWA 3VNUA 1WRBA 2P69A 1O0BA 2C2YA 4L5BA 2V98A 4JJGA 2CWDA 1VFNA 1PK7A 3LGAA 1RRFA 1UT6A 2WKQA 3DONA 4HWRA 4IM7A 1WCV1 1XRQA 1JIQA 2DWOA 2WJ3A 2YCLA 4P22A 5ARCA 5CDFE 1WG8A 1KRXA 3MCAA 4HZUA 1II9A 1VIVA 1VE5A 1VL5A 3MMZA 2A5YB 4D92A 1B23P 1NM5C 1N1DA 1K0FA 1WY7A 3OQVA 2B8NA 3RSHA 1WMBA 2RAUA 2EZ9A 1U7OA 1PJRA 3PXUA 5IVKA 1XELA 1MT3A 4BV8A 1IATA 1N2CE 4HQNA 4LE0A 3D59A 4MVJA 3SJZA 5LP1A 1FBTA 2OBLA 2PUTA 4GVLA 1O95C 2AE2A 3DCJA 3WL7A 3EBLA 2DHQA 2NO0A 3IQEA 3QLUA 3L0IB 3BCHA 1EG2A 3R3ZA 4UATA 3PG5A 3EDRA 3LP5A 3DDNA 2XWSA 3L8YA 4BKPA 2KQUA 4EQ6B 4JSYA 1ISHA 3E2IA 1MAWA 3EDQA 4D9FA 4G2TA 4JLJA 1QQAA 3RUHA 4GLBA 3QU7A 2FUG6 3CIOA 1AQIA 3DOIA 5T6BA 3C8ZA 1ZM9A 3DB1A 5PNTA 3ZHBA 4PNEA 1N1EA 4N0QA 2ZUFA 2PSDA 4FQ7A 1UIRA 4IHJA 3N58A 1PCXA 1UK7A 3GRUA 3P1JA 4OQXA 2BMWA 3EIHA 2FKNA 2WIDA 1H6AA 3QF4A 1DEXA 2HQSA 3VKHA 2P6PA 3KX2A 2QZPA 3AR8A 3OA0A 3FYUC 4MGHA 4QPDA 2QN3A 3BEDA 1K3FA 1TVMA 4ZAFA 3T15A 1EDDA 3ZUPA 1NZJA 2BONA 2CLMB 3K9GA 1UFOA 2PX3A 3WC4A 2FDCA 3HKBB 3PKZA 2A1UB 2I2BA 4XOIA 2MR6A 5DHUA 5FQOA 3AHJA 3CPSA 4AFNA 4E5PA 3PR2B 3WVNA 1EFUA 1Q2UA 4UBLA 4BNHA 2NPFA 2QMUA 1NT4A 1E4OA 3DL2A 3NJRA 3G2OA 3I30X 4GKVA 5EWLB 3ZCPA 1B7GO 5TMBA 5L6LB 2QUKA 4JGIA 1E7RA 3DVLA 3PUJA 3GOHA 3C3YA 2B69A 4UU1A 3VR5D 4B3HA 3ROXA 3TM4A 1QO9A 4HWOA 2Z4RA 4FZ5A 4ITRC 4Y2XA 1CRLA 1ZOOA 1YIAA 2Q3LA 2W00A 4HAZA 3HU2A 1Z6YA 3K4PA 3EFEA 2OK8A 1LTHR 3RBAA 1E1YA 3NTVA 1PSWA 4PXSA 5JPCA 2VSXA 2N9UA 1G2QA 1JSCA 4Y2VA 4KOEC 5DN6D 9GPBA 3F3KA 3L4JA 2HJRA 3SS7X 1CEQA 1SUIA 2BGLA 3IQFA 1U2DA 4LDRA 2HM7A 2B94A 4IWYA 4ZOLB 1TPYA 3P71T 2X4LA 1YO6A 4LYGA 5K3EA 2P75A 1E5DA 3HV0A 4HAUA 5ALYA 5JAOA 3QBTA 3STTA 4NG5A 3OHSX 4L4ZA 4ZCTA 1DKOA 4OREX 2W6MA 4MCJA 4EKNB 1NQ5A 1NMQA 3VAYA 2GTIA 2XF8A 2HBRA 1N5DA 1FLVA 1G20E 3COSA 4Y6OA 5HE9A 2YTZA 4H08A 4LVOA 3FPEA 3VC3A 4HX2A 1KO4A 3DDUA 1ZUNA 2WFLB 1G17A 1X7DA 3AY0A 2FEPA 3GCGA 3F9CA 1RRKA 3FH0A 3OIYA 3OT4A 3RVMA 3C2QA 3AF1A 4LSMA 3CN7A 4ZYTA 3B52X 5CX4A 1O0SA 1H5NA 1T9CA 2NW6A 4TM8A 2KX7A 3TD2A 2E7ZA 4U3JA 5CA1B 4MUYA 4NE2A 4NZZA 5EXDA 3DE4X 4M7OA 4DCCA 2DETA 3KALA 4M6WA 3F7OA 3FJYA 4IOJA 2BR5A 3UTDA 2YV5A 4B5KA 4COKA 3ABSB 3O8OB 4ASUD 1G98A 2MTBA 3T6KA 2PUEA 2ENUA 3BGOS 1KZYC 2H1CA 4Q7KA 3IPYA 3U4HA 3U3OA 3ZLUA 1Z13A 4V0ME 1NVBA 3ZK9A 3KHUA 1AOXA 4Q19A 1GFWA 1RWVA 4O29A 3JAKA 1WW3A 1DAGA 3ORRA 1RMYA 4HV4A 1I01A 4C88A 1IOVA 4OUDA 1XXHB 2BFFA 1L5KA 1ZH0A 1W36B 1Z5OA 3FDXA 1W8DA 2A3NA 3N39C 4PYOA 1EHCA 2DUWA 1U2SA 2VBCA 1KMMA 2VTBA 2HWKA 4CTOA 3AVYA 1Y7IA 4MEJA 3NT4A 3H5WA 2ON6A 5F7ZA 3AKZA 3UWDA 1SUEA 2YUIA 2I22A 2CKDA 3FMVA 1JH8A 4P98A 4YXWA 3TRFA 4QPNA 2XKJE 1QFZA 4QGAA 4L9SA 2X0EA 3OECA 3G2HA 2PJRA 2PT5A 2BAGA 4LGCA 5C9ZA 4RORA 3VMFA 4LC1A 4BQPA 2G5CA 1B0AA 2VP3A 1IEVA 3BWXA 5AKZA 4JVMA 3M7IA 3RTCA 5JD3A 4PTYA 1XRMA 1ZJ6A 3KB8A 4X1YB 5LXTF 3V97A 3IODA 2GFHA 3WMEA 1U98A 3KWFA 5HUHA 4PC2A 4O2BF 3L0OA 2NUAA 3FOBA 3VDNB 2UZ1B 5LBIA 2PD6A 4UM7A 4CEHA 3TLEA 3UMRA 5FD8A 2G76A 2DUMA 4TLCA 4EA8A 4XX0A 1JJAA 2ZIGA 3OA2A 4IINA 1UBOS 3A6EA 1Y9DA 3B1FA 3ZWPA 5CB0A 1L7AA 1C3LA 3BWBA 3FCUB 1QFXA 4U8GA 1C3XA 1IQPA 3K7EA 2XOEA 3WL6A 2J9XB 2ZAIA 4UHDA 3UWOA 4B6SA 4BAZA 3F96A 1F5NA 3IOMA 3FOCA 4RIEA 4MKXA 4LI0A 2JLYA 2YV4A 4AI6A 1E32A 3I53A 5C4GB 4HLUA 3LDFA 4R7TA 4L0DA 2A9QA 3ZDDA 4B3RB 4O4HF 1CP3A 2IGTA 4LE2A 4YBZA 5AD1A 4N0DA 4S1VA 2CHQA 1X7XA 3ANXA 3H8JA 1PNTA 5U4XA 3ZDXB 1P75A 4A23A 1DRWA 1NVFA 1Y3BE 2JKYA 1XZNA 2YINC 3S4YA 3HCEA 4CQNA 1WL8A 2YJ5A 3MWLA 3I8XA 1L4YA 1XU9A 2FP4B 4I2VA 1MW8X 2ZRIA 3DV9A 4RK5A 4Z4EA 4D4JA 1KY4A 1J8VA 1VRCA 1CZRA 4DDTA 1RCFA 1RRPA 1XZCA 4MSUA 4EGJA 2OWDA 1OREA 2PXCA 1Y4UA 2FZEA 5FO0A 1D4OA 1LDNA 1N6LA 1GQSA 3RVJA 2C9ZA 4IJ5A 3A0UA 3V2UA 3L49A 3Q72A 3IO3A 5IUJC 2ZTVA 2ASEA 5KVAA 1EM8B 1DDOA 3ENVA 4GL4A 1DAFA 4BIIA 2Q5EA 4BFVA 2NIPA 4BVEA 6LDHA 5BSVA 1P62B 6AT1A 3HJNA 3WIVA 3LPMA 4IIJF 2HYIC 2QVZX 2XITA 3H5AA 1E5LA 5EZQA 1CY0A 3IP5A 4W6ZA 2VF8A 5GONF 3VISA 4TSFA 4CDNA 1W29A 2BFBB 3KQPA 3T0FA 2W98A 4GSKA 1BQ3A 1F2UA 2J5KA 3FKJA 1GT6A 5HDBB 5B4TA 1JNYA 3RCBA 1U7WA 3VU9B 1OHHA 4L1KA 3KQYA 5ICGA 1QRSA 3D7NA 2LWIA 2QM7A 4PAMA 1Y9JA 2C59A 2CZQA 2EIHA 3OEYA 5JUWA 4YMHA 4C14A 4FQ8A 3WGVA 4B4VA 2QJTA 4HGOA 3F7NA 2G17A 3AEUB 1M2EA 3BMOB 4DJTA 1G9XA 4MB2A 1G6KA 5INTA 1T6ZA 3HH8A 5J47A 3K1AB 2VJDA 2W8BB 2B2CA 3S55A 4DG5A 3HA5A 1ACLA 3FYDA 5F1PA 4EO9A 4WBNF 2Y92A 3SPXA 1J2RA 1IN6A 2FUEA 3MGBA 1PJZA 4H60A 4ALNA 3MBKA 5EXPA 2FFBA 2MSNA 4EP1A 3ICEA 1GPMA 4LDPA 5KCMA 3JWEA 4BX8A 1EJ6A 2D74A 1I6MA 4AJ4A 4DDVA 4OHBA 1DT5A 5G2OA 3JQ8B 1ILEA 2WWFA 4E5NA 2Z04A 3U13A 1KP9A 3OH8A 3OQPA 3PEYA 2ZIWB 2NU9A 5E9QA 4LY6A 4TZTA 4YXFA 3VUFA 3CXRA 7ABPA 3A9VA 1G5RA 4QOHA 2CV0A 4YAKA 2WV7A 4IXDA 2BH9A 4X91A 1QPZA 1W44A 1WDMA 4MDYA 4K26A 2BDEA 2W6QA 3D43A 4OHKA 3DOJA 1PUIA 1U11A 2G67A 3QBEA 4XM1A 3RYHB 4KIGA 2Q4DA 3T9EA 1VI6A 3WS7A 5LLTA 5IAGA 4FFVA 4NDNE 2JGKA 2V0GA 1XKXA 3M83A 4OQ4A 2YX1A 5CLJA 1GNPA 3CKKA 4H1VA 3JVUA 1FYEA 2NWQA 2PL1A 3CNLA 4PIVA 5F76A 2Z83A 1PJ3A 1X1EA 2VZEA 1C7EA 1P5RA 2X6RA 1YS1X 3HFGA 4NCIA 4RPJA 3VH4A 2FVYA 3RC7A 3HVRA 3TOXA 2OFPA 3F5FA 3IRVA 1SUFA 1PNVA 3PXCX 2H51A 4QODA 3RVKA 3ONWA 4WAUA 3B2NA 6REQB 2BEUA 3IEKA 4ZPJA 3IKMB 4TMWA 3DQPA 3L7MA 1T8RA 3TJMA 5BOSA 4CKXA 1GSIA 3FRIA 3FZYA 4H3KB 4L0MA 3WGMA 3DD5A 3MUOA 4POAA 5JLAA 4G8DA 3O1IC 1E6UA 1CYEA 4B6RA 2QRUA 4MV8A 2NSHA 3DTNA 2B9EA 1RPAA 2ZU0C 1WHTB 4CL8A 1W75A 3EPKA 1J1UA 4A36A 1SBTA 5IMBA 2GNOA 5DBEX 2ID9A 5FOQA 4ARSA 3AHHA 3E9RA 1QIFA 1Z0SA 4FGUA 1J2JA 4DT1B 2QTHA 2WFAA 4M0PA 4PZPA 5L7YA 4L08A 1UBTS 1K9SA 4LYEA 4PZYA 4DV5B 2KYRA 2KBFA 1H9CA 3EOAI 3JZFA 1U8XX 1JTVA 3NV9A 1JPJA 4HN2A 1T5TA 4JVNA 2N3ZA 4XLLA 5GGYA 5A6SA 3V9AA 3CEHA 1V6AA 5B6IA 3PB3A 4MS4B 3SLGA 1KQGA 1JWBB 3MILA 1RJDA 2F62A 1GKKA 2ONKA 3CYFA 3MTQA 4XPIA 2BBWA 4GOLD 3D1JA 3N05A 4ZZ2A 3U3JA 2V55B 4DWWA 3EPPA 3VC1A 1H0SA 4S1OA 4NCBA 1JEYB 3FHTA 3BFKA 3NKLA 4ZV7A 3GRPA 3IDFA 3SG0A 4YROA 2GESA 2X2EA 4AWBA 2CL6X 2PJZA 3M2PA 4C6TA 3E48A 3LG2A 4MMXB 4Z0HO 2AK2A 4LRSB 1OAAA 1RE0A 3LC7O 4JI1B 4AY2A 2AFRA 4OJTA 3JQAB 4G67A 5EMNA 1XMXA 3V8QA 4LXUA 3DC2A 3S7TA 3EEYA 3QVOA 3ADPA 4P86A 1EFCA 3HACA 5DULA 1MDFA 5A2GA 3LS2A 4HAYA 1ZKMA 5LOVB 5F98A 3EXAA 4JJKA 3RK0A 1G4AE 1RYDA 2NV2B 1C8VB 3V7FA 4NXNB 1YS6A 2ZYDA 4JELA 3CGWA 3LUPA 5HVNA 3IE0A 3WRYA 5CDFA 3T61A 3NT5A 1MO3A 5EJEA 3IO5A 2IDJA 5HFJA 4DDKA 1Z33A 1JDUA 1T4GA 3BJZA 2M98A 1T3SA 1GUDA 3DDZX 4MR8B 1NASA 3GLSA 1WOYA 1P7CA 1BW9B 3PFBA 3IH5A 4P3XA 4MI6A 3HM9A 4FM9A 2O8FA 5EZYB 2JCVA 4XYLA 2NXCA 3Q9LA 1PR6A 5IAKA 1FFEA 4BN0A 5FNZA 1KERA 2GAIA 5C0OE 1W85B 1C1YA 2NTYC 3V1KA 3ED5A 2GEKA 3RS3A 5CFRA 3HU5A 2J9FB 3HLYA 3PC2A 1FMTA 1TCCA 3JCZA 4Q93A 5AW9A 3H9EO 5JQGF 5AM5A 1R8JA 3GRYA 4HSEA 5FBQB 2BELA 2YHSA 1JXOA 3DSRA 3IUNA 4LF5B 3HO6A 2ZWIA 5KNDH 3OEED 3DTVB 3DULA 4MQ5A 3RWBA 1ZMOA 3VR5A 1I7DA 1L5OA 4IYJA 2EFGA 1CUJA 2DKOA 1JDZA 3N8KA 3UXHA 4FT2A 2B78A 2C3OA 1BMDA 2C2KA 3L0DA 1JE0A 1Q3HA 5EESA 1G66A 3H2ZA 3QMPA 4IRUB 4R71A 1HLGA 5BNWA 1NVVR 4QC2A 2Y77A 1MFZA 2EC5A 4C0JA 3LZCA 1MGOA 1KXZA 1Y6JA 2XXBA 2HU5A 4I4NA 1DUSA 1A8QA 4YIHA 5DN6A 4D6YA 1KZ6A 2XBMA 1K8ZB 2UXDB 5CT6A 4EYOA 2DUJA 1V43A 3I12A 3SXUA 3O03A 3RYTC 3TMAA 4KFCA 2DVMA 2R3SA 3TLZA 5K3CA 1P4GA 3HCCA 2OV8A 4IDHA 2TMKA 1Y1RA 4J03A 4WPGA 2WPNA 5BMVF 4MUNA 3CUTA 2VUTA 5IFKA 2ZRDA 4JXJA 3ZGYA 2ISSD 3ZJ5A 5C46F 1S1MA 4BLVA 1VHLA 4MGIR 1TMOA 2RGDA 4YRIA 4LJSA 5AO9A 4LCBA 4HEA1 1J2UA 2HIAA 2F7SA 1LPMA 4UUBA 2Y1KA 4BJ5A 2GPSA 2OMKA 3PNKA 1KPGA 2P9JA 4UNPA 3GFGA 3EUWA 4FOOA 3IT2A 1IZ7A 4P4SB 1ENYA 3DZIA 2PNJA 1MC8A 5LZ7A 1CXZA 4QE3A 2BP7B 2XT0A 4EPTA 1JFSA 4RHUA 4QU8A 1YI0A 3T7EA 2WVJA 4NQRA 3IYLW 5TPZD 3BAZA 3TGWA 4BGIA 5HR5A 1APBA 1Z37A 3QKSA 4BLQA 3DPIA 1V9SA 1VXOA 2M32A 4JGBA 2HWYA 4QECA 1QRUA 2G63A 1XXHE 4JENA 4D2IA 2PTGA 4OK5A 2EYQA 1ODTC 1PQYA 2R5NA 1XTJA 2ECFA 2V6FA 1L0BA 3TNFA 1LPBB 1XDBA 4XIIA 2M6KA 1RI1A 3K92A 2I2FA 5T3YA 3ZDAA 2JLXA 4QUGA 5EHIA 4YCMA 2PK3A 1NLUA 1AMOA 1QC5A 3OCYA 2O2EA 2QTCA 5AM1A 3EZ9A 2IEGA 4HJXA 4ZDKA 3UJPA 1Z5VA 5FUXA 1AHHA 2ZR8A 5ALZA 2RARA 4E07A 1N3YA 1U28A 2UZ3A 4UZFA 1R0KA 2X5KO 1PR1A 4CM9D 2X8LA 2DECA 1P4JA 4HP8A 2WKWA 1CHDA 4XB6B 2A86A 4ZXPA 1QCYA 1FQJA 4WZAA 3BMCB 1WP9A 1AKRA 3N2GB 3ODPA 2BE7A 1RIIA 1Z0IA 1B74A 2G83A 1JQ5A 2OWEA 2VT6A 4J76A 4UPEA 4O2AA 3NDIA 4MQLA 1JAYA 2YJTD 1V7CA 3FBGA 1L7RA 1E6EA 1OH7A 3X2SA 5ALRA 1M76A 3TVDA 2J33A 3PKJA 2G07A 2NZXA 1SKYB 2OOSA 2AFIB 2OCLA 1N77A 5AKYA 1E5XA 3AEQB 2Z3VA 3WQSB 1NQXA 3KR9A 1MJFA 3BCUA 3WB0A 4HZIA 5G40A 2VRCD 2VDNB 4HUQA 2AB0A 4KGDA 1EMDA 3DUFA 2PKYX 4BO3A 1WBBA 3AM3A 3K0CC 4H3VA 1FFCA 4V0MA 1VYVA 2QTVA 2W71A 4MQFB 5D3KA 3PTZA 2CDNA 3GELA 3LTEA 2Q07A 2FGJA 4PHHA 1K66A 1R10A 3EC1A 4H31A 4O1MA 2DFDA 4RSGA 2WW8A 5COBA 5EXEA 5LL6P 1LZLA 1K5DA 4JBYA 1JHXA 1VG9B 1XCMA 2AOTA 4O08A 3RHFA 1F3OA 1ZSVA 2ZCJA 3KAPA 2ILTA 3W5UA 3PHBE 3N0VA 4QJ4A 2ZM6B 3C3KA 4U7JA 1LNSA 1WUKS 1XQ6A 1QCCA 2HBYA 2ZJ3A 4E46A 3SHFA 1A9SA 3KYDA 2WB2A 4Q6BA 1VBFA 3E7WA 3U2QA 4F46A 1Z7EA 2DULA 1YDHA 4AN0A 1IHXA 5HFAA 4K9SA 16PKA 1NVWQ 4W6QA 5I8PA 2YIDA 3BF7A 1KRWA 1KYYA 1UOQA 1TE2A 3T7IA 2HUPA 3NBFA 2YFKA 3UCEA 1XR3A 2QIPA 4P5PA 5LQDA 2R1VB 1UXJA 5I7AA 4RZQA 4QG3A 3RAEC 2BFDA 3RSLA 4ZYUA 3F6CA 4K6CA 1KO1A 1VMKA 2EHDA 1REQA 4YJHB 1V9LA 2EDAA 2QA5A 4I46A 4U7FA 4UHKA 4DY4A 3W5AA 1XWFA 3MOGA 1TCBA 2WMYA 3VJRA 1C4WA 3WA7A 2NZYA 2FQ1A 4G8BA 3KU4A 1HFJA 1GR1A 5DLEA 4D1YA 2HHCA 4M0LA 3T06B 3ZBTA 1E4VA 4XGKA 4LBWA 5DHSA 5JCOA 1LB1B 4D02A 3SHQA 3UEOA 2JFHA 1YFJA 3FXAA 1SXQA 2Q5HA 2FEWB 4K2HA 2ZAOA 3VH2A 5HILA 3GCWA 4A92A 3WHKA 4BTEA 4CLDA 5JJLA 3RU7A 5JSZA 3AZOA 4OL9A 4OJYA 5FOXA 5I9NA 2PUAA 4Y0NA 1SFRA 1GFZA 1GV1A 4UFPA 5ALMA 4BQFA 2RC6A 5LSAA 3AGQA 2GBCA 4REQA 3ZWBA 5C8XA 5JNLA 5SZJA 4WTOA 4GQIA 4RVNA 3PQ3A 2B20A 2ZIXA 3BE4A 4JLDA 3KXPA 2YXEA 5CUQA 1PR9A 4HOYA 5BT8A 4PLWA 1YQWA 4N03A 3UAZA 2FH5B 1V4NA 1M6VA 1P2VA 2C2BA 2MMGA 3WLRA 5C51B 2XUDA 3E1KA 2NQTA 2WZBA 1L1EA 3LHSA 1S2IA 4EUNA 1KEWA 4R2KA 5EP3A 5BWCA 5LU9A 1CQJB 2EBUA 4HDAA 3I5XA 3OPQA 4J0KA 4OI0A 2CXRA 4J0DA 4R9RA 1ZK1A 2IYTA 5FUBA 2D59A 2F43B 2QVLA 1TJYA 2WFMA 4X97A 3WRXA 4C78A 2AZXA 2DP4E 4FOSA 4JMPA 5HIAA 2PLNA 1TLFA 2VJBA 4OQNA 4FZRA 1BX1A 4G85A 4PG4A 1JJVA 3AIMA 1J56A 2J4DA 2WSBA 3KQOA 4JITA 1ZOIA 3GBPA 4N6OA 5LM3A 4F1WA 3OZFA 4DLPA 5JFTA 4KI7A 4JYCA 4B3FX 2BTEA 1JG6A 1MRZA 2DQYA 4RADA 3UMMA 4JQSA 1DDGA 4LK2A 2QQ0A 4FDAA 3SK0A 4E2XA 5ES4B 1CIVA 1T6NA 2RHDA 3WOHA 4GKJB 3GEDA 1GYQA 3M4NA 3NAGA 2C1ZA 2OR3A 3HBNA 4UTZA 5MGBA 1Z7WA 2Z43A 2FGKA 3DYVA 4QA9A 4D82A 5HJ2A 3P9PA 3COJA 2RI1A 3JYLA 3LXRA 3N0WA 4BFWA 4OP1A 4XDYA 1V8FA 5EI5A 4PC7A 1JPNA 2NP6A 3VVMA 1UF9A 2C84A 1U6JA 4D6XA 4MGKR 1RKVA 1QJ4A 1RTTA 2JFPA 1HDEA 2HU2A 1EWVA 3ODGA 3WLPA 3FMOB 2AGVA 1J49A 1XROA 2GEVA 5LVAA 4MV9A 1G8SA 2CYBA 3L02A 3QHQA 5CG1A 4OSOA 2XMZA 1CDDA 2NSJA 4IL5A 4WESA 2HLNA 4G0VA 3I9MA 1YGPA 2NAFA 4LC9A 5JC1A 1WLYA 4KXMA 2ZBVA 2PGXA 3M3HA 5CLIA 1BVHA 3DWIA 4GPZA 2DEUA 4M86A 4WVLA 2Z5VA 4B79A 2XVXA 2VAWA 5ERYA 4LHZA 4P35A 5A3VA 3GDGA 3HZHA 4ZWNA 3PITA 1JQEA 2VJAA 1KQPA 3PXAA 5CT5A 5G4LA 5C34B 4D5EA 3RIEA 2DPXA 2ZRJA 1UMBB 3DTYA 5ALHA 1L7PA 1BTOA 5A9SB 4ZALA 1D6SA 2EATA 3QVVA 3I1YA 2UYHA 1R0ZA 1A2OA 1D6MA 3KJHA 3QUAA 4JJ8A 1XHFA 2QTZA 2O8VA 5IKOA 2QX4A 1J0BA 2FLWA 5HCNA 3L06A 3MHTA 1NQOA 2YY7A 4V0KA 2IDKA 1H85A 1QFJA 3A4TA 1ZZEA 5GZ1A 2B83A 3QVKA 3BB4A 5CW1A 2X7XA 2TYSB 5AKIA 4JLAA 4MKZA 4BV9A 3SQMA 5KX5A 1ZVKA 2W2MA 3VNRA 1A5TA 3Q7TA 4R51A 3AW9A 3KSRA 1ADCA 2X76A 3CMCO 4TUYF 3TNYA 2MU1A 4BKUA 3AFNA 4LWPA 3G6WA 3ROMA 2MYPA 1PWZA 4AM8A 1WM1A 2QTAA 4L57A 1LQTA 4OQEA 4PU0A 2H1OA 1OWPA 3S2SA 4RKRA 4L16A 4HYTA 4DNPA 2HXYA 3PDCA 1L5HA 2SHKA 5F5XA 2V7PA 1UEXC 3FOFC 1QB7A 4CMAA 2Q29A 2WIAA 1LDGA 1U8YA 2GNAA 2XT6A 3KXDA 4J3FA 4JOBA 1U2GC 1N6NA 3KEOA 3O91A 3VKGA 4BC1A 2BLLA 2C77A 4PF1A 1Q57A 3HCPA 1U3GA 3IQGX 1XWWA 1GZ4A 3WYGA 4ZV9A 1QIHA 5AXBA 1UJ4A 2HI0A 3GUVA 1R9NA 2CXNA 4LBZA 4OYLA 2D0PB 4XGNA 4ZO8A 1KMCA 4FIZA 1LNQA 1E61A 2QXYA 3UV6A 1DCTA 3GJZA 4K8RB 4CEIA 3EQ2A 4H7IA 1VPVA 3TO5A 5KQLA 3S70A 4FC6A 3X1KA 3PUHA 4EJFA 2OG2A 1STOA 4GICA 2ODWA 3BX1A 4L3WA 3DGFC 3MMXA 1YTLA 3FD8A 1SZPA 1X70A 2JFQA 3HCDA 3LM8A 3NORA 1BOFA 1QZUA 3NHZA 4O4JA 3VPAA 4CKZA 2XWPA 1Z5UA 4FW9A 3TLAA 1GL6A 3KHKA 2DQKA 2FN8A 2VS1A 3QKIA 4L22A 2HADA 1JEDA 3RQIA 3W9YA 1P1HA 1U3UA 2R751 4GUDA 3O83A 2W58A 1HQKA 1PTJC 1OXSC 2X0KA 3TIXB 4D0RA 2PH3A 3RGGA 1PSDA 4LFAB 2QB5A 1WSDA 5A9RA 4GI2A 3FCOA 5J4YA 1UJNA 4A16A 4AJKA 4KPGA 4IUCS 4FR5A 1KEUA 5DFAA 2CHVA 3QKRB 3RVSA 4YJ2B 2HA3A 4QHTA 2PS3A 2FWIA 3OEEA 4ZZ0A 5KU7A 2H06A 2IZ7A 3HDHA 4YR9A 5KTTA 3VAZA 2YV2A 2OC9A 4LECA 5BORA 4I81A 2VDMB 1OT3A 1A4XA 1I1HA 2CZGA 5TMPA 1RI4A 2XX3A 4KYTA 3FYUB 3UMVA 3W7BA 5FLYA 3FAKA 5C2JB 2YZNA 3CPEA 3QMVA 1IXZA 4IDPA 1ZIOA 2X9GA 4D4IA 5AM2A 2J9YB 2W83A 5SY6A 3R6GA 3WV4A 4F2WA 1SKAA 3K8YA 4KXWA 5L45A 4CF7A 1MX3A 3MJCA 2Z5LA 1U7UA 3NCTA 2WV9A 3PF8A 4A0SA 4ZK6A 3LUAA 5DU2A 1MDBA 1NJ1A 3I2JA 4MUIA 3LLVA 4QYSA 1US8B 3UMGA 4BO4A 5I3ZA 3JAMA 3ZVKA 4KXVA 2D06A 2J0EA 5IM5A 3EIOA 1FIUA 2HK9A 2E82A 3W4IA 2G1JA 1IFXA 3MMSA 4PBTA 4GZ3A 1T13A 5EYPB 3GQBA 8ATCA 5ESRA 2JG3A 3OWXA 4K9LA 3OBIA 1P1FA 4LRYA 1Y5IA 1ORTA 2QX7A 4F4IA 2ZIFA 3UGJA 3D8UA 4IDAA 3L1VA 4JJAA 4PG7A 3FRJA 5HF8A 3K9FC 4GECA 4L9AA 1X1AA 3IOYA 5F52A 2C5EA 1OLXB 1GGFA 2FN3A 4IIGA 3I9LA 3BREA 4GOXA 3RRFA 3GFBA 5TPZA 4BGVA 2GO7A 4BB5A 1PX2A 4LXTA 1KI6B 2X5NA 3SZGA 1NXWA 4A82A 4KO2S 2C2HA 1PQUA 4YJ2A 3ZE7A 5FTKA 1SHJA 3H2KA 3TPCA 2GJKA 2PUFA 4OVKA 2EGUA 2PKCA 1JIIA 2V9CA 5F1YA 1GLVA 3WR5A 1RRCA 5H02A 3ED1A 1ECLA 5EQFA 4JU9A 2EG9A 3QUQA 1IXRC 3L0CA 1T8PA 1WMDA 3FKQA 3SF8B 4MIYA 4K9NA 3THXB 4JLBA 2J6HA 4WOPA 4RCZA 1LBSA 1EFVA 2LCIA 2C8JA 1U0FA 3JAWB 4B35A 5ALLA 721PA 4YR7A 1DX4A 4Z4IA 1T29A 4DJFC 2Q6IA 2JAUA 4BEVA 2FX5A 3LRTA 1I3KA 3HDJA 2WDPA 3FCXA 1Z38A 2W2KB 4BNYA 4CM9A 4HGRA 1JVSA 2OXIA 1A0OA 4B2YA 4ZK2A 1C9NA 4MP3A 4PTLA 1DIBA 4HQKA 2GERA 2H1FA 3IKVA 2I66A 4MV5A 1UKAA 1NPTO 1Y8ZA 1K5PA 3W8DA 2J3JA 3B3AA 5FYDA 5J4KA 2OHJA 2I2AA 3ZHRA 4NNOA 4PIPA 2HPZA 4R54A 1KI1A 3WGGA 1R1DA 4L4YA 2PLRA 4MZDA 4YMVA 2V65A 3EPHA 2H4YA 1TUBA 2AV6A 1S2GA 1YE5A 1VLVA 3OWOA 2IUFA 3CLSC 4QXQA 5DHTA 2QRZA 4DR7B 1Z82A 2MSCB 1ABEA 2C0CA 3K20A 3ECAA 4H35A 5FTJA 1RZVA 1A8SA 3TJRA 1U9JA 2E4UA 3BIOA 1HV8A 2AQ8A 4OJNA 4D0NA 5FAKA 2VRCA 1YQTA 2RHMA 3KYIB 5EE1A 4E5MA 3R44A 2VBGA 4RACA 3ZHUA 1GN9A 4J9VA 4E5YA 4RJTA 1G7SA 5AIBA 5LQRA 5AQ1A 2J3LA 4NENB 1RLTA 3I34X 3G0GA 5IVPA 4NDAA 3GP5A 2V1XA 4UCXA 2HWWA 4Z4QA 3TXAA 4J1TA 3L8DA 5DIZA 3U40A 2RHGB 1GVNB 2PGDA 3K9WA 3RPEA 5K3SA 1CZUA 4WNIA 5CXSA 4ARAA 5DGDA 4BE7B 1VJ1A 2AEEA 1PN3A 4MLPA 2D62A 3DOEA 4QOEA 1Q0RA 4E6EA 1TUEA 1XYVA 4AQ7A 1AC5A 5EWMB 2FZ5A 2ZUVA 1EX1A 3R6LA 4OU5A 4TRNA 1CQPA 5IW8A 3WNDA 1RJ9A 2LCFA 2RHOA 4BO2A 2GILA 2Q3MA 1CZNA 4C6HA 1YZYA 4OKSA 5AK5A 3Q88A 4DLKA 4GOND 1F48A 5K6RA 2R1UA 2VWGA 1W5EA 1T3ZA 1SCUA 1Y0BA 2ECPA 3D7RA 4IMIB 4QFDA 1J2EA 1QHNA 1KYZA 2GVDC 2H48A 3CLTC 1M7GA 2WJGA 4ITVA 4MQEB 4WDQA 3SFZA 4A5SA 3MAJA 2VAVA 1R9GA 4LJRA 1JR6A 4JR0A 1DRJA 5KCZA 1RABA 2WJPA 3ZGLA 4UTXA 3LSYA 1DJNA 3WYEA 5AM4A 3VQTA 4P53A 3BJRA 4PRYA 2IYUA 2FZLA 4LV5B 1P2BA 1J25A 5TV2A 4ER3A 1UEIA 4KLAA 1GQOA 1W5AA 3BBLA 3C1AA 3B9QA 4Q4HB 4TZKA 4GD3Q 1PNOA 3NU1A 3RFXA 4LMRA 3FDIA 3HYCA 1JXMA 3FTPA 3L0BA 1K7FB 5J4HA 5EL0A 4JB3A 1EVZA 2OAGA 3V8EA 3AP2A 3F3SA 1U0OC 3ZVMA 2Y9PB 4ZQEA 4E3ZA 4B1FA 4CV2A 1CFJA 1V48A 1KQ3A 1F0NA 1ZD9A 2ZU6A 4FZJA 4NAVA 4UVIA 1DJQA 3SN6A 3ZLTA 5A3SA 2NN3C 1YVRA 5AVUA 2Q1UA 4G89A 4QFCA 2UZIR 5TB5A 3SDSA 3KU1A 4PINA 1LD3A 1HSOA 4OY3A 3H99A 1E96A 4HTFA 3STUA 5G3YA 2E4YA 3ZS8A 2VDOB 2WUDA 1HRKA 5CR9A 1ZDMA 2ZSIA 1M2FA 2IY9A 4IUDS 2A1IA 4D5GA 4TTSA 1T9DA 4QEDA 1PJQA 3R6TA 4INAA 4UDOA 5LZ5A 1UT8A 4MIOA 4J0FA 2GM4A 1KI7A 1BDMA 4MYCA 3UCXA 1J39A 1M3SA 3Q5EA 1BXRA 2FF7A 4C22A 4DSNA 3GROA 1TQ8A 3R3UA 3TZ6A 4NBLA 1C7JA 2CE2X 2ZULA 4YAIA 2RC5A 3ZGXA 4BBPA 3EG9A 1Z4JA 3CBQA 5CHYA 3UFXA 1E2LA 4HPXB 1THTA 2JGRA 2CNKA 1NYRA 3NIFB 3TAUA 1N2XA 2MYUA 3E4DA 3UYKA 3QUBA 2VA8A 3A11A 3BJMA 4R1MA 3UHPA 5DX1A 3KZMA 2X1LA 3D4OA 1KZ1A 3DFKA 5DYNA 4L50A 5TR9A 2GPNA 1AD2A 1AQYA 4XM0A 1YR9A 3MJHA 1NVXQ 4UW9A 5DCWA 1QYXA 3T99A 1H2HA 3A4NA 4X62B 1BWQA 4YDQA 2WDZA 1RYHA 3I01A 3ZCSA 2QBYA 3HXOA 1RCUA 1SU6A 3H8VA 1BFKA 4GC9A 5AVTA 4LF8B 1RXEA 2V0CA 2ZRFA 3DZKA 4D9NA 5BSEA 5CFLA 3HABA 3V1YA 2P2LA 3UJ6A 4DFDA 4UUMA 3ZQ6A 2ISCA 3O0DA 2AN1A 3G8CA 3Q8WA 3SZOA 2ZAGA 1S2NA 3LY8A 5ALDA 1B14A 4K6MA 2X22A 3FIJA 4H4CA 3SSNA 5DNDA 1W46A 3SP1A 4QFMA 1UXHA 3ESCA 1RWNA 4I7EA 1KH1A 5GZ6A 3QX3A 4AMZA 9MHTA 2QOEA 1RFLA 3G1TA 4GX5A 1N7HA 4JQYA 5ITVA 1Z2EA 4DLVA 1EUYA 1WDLA 3I0MA 3I1IA 5AKJA 3RFVA 3NOVA 2RK6A 5L4LA 1XQWA 3WNCA 1M2KA 2GXQA 1Q6ZA 2HUNA 5ERXA 3RVBA 3VKVA 3WKCA 4BJ3A 4ZEMA 5A4KA 5IJ0B 2QT1A 5C53B 1XA3A 3RVRA 4BNMA 5I7HA 3T1YB 5GJCA 4E2FA 4P34A 4Y9RA 1QQ6A 2HA5A 4DZZA 5A05A 1JECA 1PUXA 3GJ6A 2P9HA 3WLHA 5GINE 3LVBA 4TS9A 4XR9A 3VGJA 3TD9A 4AJIA 4GSLA 2YWCA 3O74A 4QT0A 3QVSA 1U2TA 3VRHA 4TTQA 3ICPA 2VEOA 4QAJA 4RNDB 3KDAA 5KREA 4DTCA 5KKNB 1E98A 2DJIA 5LMCA 4DV6B 2IXFA 3R5KA 1U0JA 5A4FS 4PR0A 1FS6A 3AVOA 1VM6A 1G64A 1WX1A 2ZDGA 4XWKA 5M5BA 3GEMA 1CB7A 4ZDWA 3C3PA 2YDXA 2OYRA 4B7UA 1DBVO 2BC9A 2OPBA 4RDIA 1MQSA 1NW6A 1CLUA 2PZGA 4NYIQ 1DIOB 4HVTA 2JLUA 3IAS6 1CJCA 3P2KA 3WGYA 4WY2A 1S5PA 2PVPA 4QBKA 5AH0A 5KWVA 3I52A 2YBEA 4CIXA 3TSOA 5M2QA 2VJPA 1CF9A 3LFHA 3AUSA 5F12A 3SYTA 5L95A 3WGTA 1CQXA 2FE1A 4V02A 2ODAA 3B6KA 3W9UA 1X8KA 4QGFA 4N47A 5LXTA 2E18A 4G37A 3RS0A 4F6RB 3C4JA 4JBLA 1N9GB 5MN6A 4O2BA 1EJBA 3DBLA 1IIBA