1B42A

Vaccinia methyltransferase vp39 complexed with m1ade and s-adenosylhomocysteine
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
297
structure length
291
Chain Sequence
MDVVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP39
publication title mRNA cap recognition: dominant role of enhanced stacking interactions between methylated bases and protein aromatic side chains.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Methyltransferase
total genus 98
structure length 291
sequence length 297
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 1999-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1b42A00
1ZGJA 3B89A 5K0NA 2FK8A 3BGDA 3FTEA 3CJQA 1FBNA 2OKCA 2XYQA 1NW8A 4X61A 4FSDA 5FQNA 4E2ZA 2IBTA 5DX1A 3DMGA 3D2LA 5FWAA 3WSTA 5K09A 2AVDA 3B7PA 2N47A 3TFWA 1VP3A 2EJTA 2O05A 1EJ0A 3PT9A 4DM3A 2IH2A 1NW5A 5FCDA 1T43A 3FTCA 3BKXA 1IM8A 1L1EA 3NDJA 3UJAA 3NMUF 3HEMA 5EEHA 3DUWA 4M36A 4Z2YA 3TLJA 2YVLA 4XUCA 3CJRA 2PKWA 3AJDA 4X1OA 1P39A 2ZW9A 2ZVJA 3SSOA 3OU7A 4QPNA 3G89A 5EHIA 3E23A 2ZZKA 3HVIA 5T6BA 2IH4A 2OYRA 3R24A 2P7IA 5K0EA 2PX2A 1INLA 2YQZA 4HGZA 5K0GA 5LQCA 3NWEA 2E5WA 5HOQA 1VL5A 2YX1A 4ISCA 3KPUA 1SKMA 1L3CA 3EGVA 2ZZMA 5FQOA 5DM4A 5EC8A 5M5BA 5ICEA 2OBFA 3UJ9A 2YXEA 2ADMA 3GXOA 3HCFA 4E31A 2ZSUA 5D1NA 5LQRA 3SGLA 5BXYA 4OQDA 2G70A 4CXMA 3HNRA 5KYGA 1NT2A 1RI1A 1WZNA 2AOTB 5DM1A 3RW9A 1XCLA 4C08A 3CBGA 4BLUA 1P1CA 2B78A 3HTXA 2CKDA 4PIMA 7MHTA 4UOEA 3NW9A 5EEGA 5BW5A 2LD4A 3CCFA 1JG2A 3R3HA 2IH5A 4IV8A 1X1AA 1JTFA 5K0LA 1L3IA 2GB4A 4LECA 4PGHA 1VQ1A 5EZQA 4BLWA 3B3JA 4WXHA 3MHTA 3LDFA 2ZIFA 1EIZA 3B5IA 2GLUA 3KPJA 2B25A 3MB5A 3V97A 4BY9E 4FT2A 3G5TA 3P9IA 4OBXA 3CJTA 3R0QA 3SSMA 3HVKA 3LKDA 3RIEA 3UBTA 5CIYA 3KPVA 5FULA 4RTRA 1VBFA 1IXKA 1JQEA 2AVNA 3BXOA 1SG9A 2VDUE 3ANXA 4EVIA 1YFLA 2BH2A 1UIRA 3GIWA 2HMYB 3VSEA 3P9CA 2GS9A 3FPGA 5E1BA 5E1MA 2UZ4A 3LKZA 1D2HA 3JWGA 4CKCA 4ER7A 3DULA 2JH9A 1EJ6A 4FP9A 3EVFA 3FYDA 3LECA 2G8NA 5EGSA 1PRYA 3EMBA 5FADA 3GNLA 3JWHA 3G2PA 4CKEA 1TW2A 5K0FA 3TKAA 2PX4A 4RTPA 3P8ZA 4RTMA 3R9XB 5HIMA 1QAOA 2C7RA 2QRVA 3HM2A 5IH3A 5DLYA 3NVKI 3I9FA 5HFJA 4PYNA 1KXZA 1NW6A 2BR4A 4YV0A 1X19A 5FTWA 2A14A 2AN4A 3NJRA 3BT7A 3LX6A 3PS9A 3PX2A 5E8JA 2GPYA 5K01A 4PGGA 3REOA 2Z6QA 1YB2A 4QDJA 5P8WA 1G8SA 1KYWA 1QZZA 4AZTA 3JWIA 5E9QA 2YTZA 4DQ0A 1NW3A 1HNNA 2QM3A 2WA1A 2ZWAA 3FPEA 5GWXA 3THRA 3X0DA 4PNEA 2C7PA 2JHPA 2BM9A 4KWCA 3LCVB 1YUBA 3V8VA 4CTKA 2PWYA 3F4KA 3TKYA 2G72A 3IV6A 2Y1WA 2IFTA 1D2GA 3FUVA 3HVHA 3KQQA 3PB3A 4AUKA 2UYOA 2P3QA 1JSXA 3OZSA 4V0QA 3UJ6A 1I1NA 2EJUA 3OPNA 5EKXA 1XTPA 3FUUA 5FHQA 3TRKA 3TMAA 4E70A 1RI4A 3A27A 4YV1A 1ZHFA 3DTNA 4C05A 5EOVA 3TPZA 2H11A 2AZTA 4R8SA 4XCXA 2I6GA 4ER6A 2XVMA 5DSXA 2UYHA 4DMGA 5EZSA 1G55A 3OU6A 4XUDA 2B3TA 4RTQA 4DZRA 3P97A 1U2ZA 5F2KA 3FTDA 4P7GA 3P2IA 1F3LA 2R3SA 4XUEA 2OY0A 5K0BA 2PWPA 1KHHA 3HCCA 1JG3A 2OO3A 3MQ2A 3HA7A 3O31A 5F2NA 5K05A 1AQIA 2GA9A 2NNWB 3UJ7A 1KP9A 2YUIA 1H1DA 3RODA 3ELWA 2XVAA 3FTFA 3NWBA 4KDCA 4OA8A 1KPHA 4E32A 1YF3A 1WXWA 1DL5A 3P9KA 5BW4A 1XJ5A 1R6AA 3KQTA 4MTLA 3DH0A 4FSXA 3KQOA 5HILA 4WVLA 5EIFA 3UA3A 5LQJA 3PTAA 1SQFA 1RI3A 3AWIA 1NBIA 3P9NA 4P7KA 2ZULA 4MHTA 3BKWA 3DXXA 1XXLA 3E8SA 4E30A 2P35A 5E9WA 3DMHA 5LQAA 1XVAA 2YXDA 3I5UA 2PT6A 2ZLBA 3PFHA 2AN5A 1EG2A 2DULA 3ELUA 5DWQA 5FWDA 2VP3A 2B9EA 2ZTHA 2OXTA 3KR1A 3KQYA 4G56A 3G8AA 3BGVA 1RJFA 3PVCA 4LG1A 1AV6A 5HIIA 1NV9A 3HP7A 2BM8A 2QRVB 3PX3A 4PCLA 10MHA 4E2WA 5EMKA 3DXYA 4ATNA 3EEYA 5CUQA 1JQDA 2P1DA 3M6XA 4GOOD 4QQKA 5B1SA 4A6EA 3C3PA 2XYRA 3NTVA 3SMQA 4YMHA 4CTJA 5CCXA 4QTUB 5MHTA 5ICFA 1WXXA 1Z3CA 3O7WA 4RVGA 5G02A 3L8DA 2ZBRA 3G88A 4E2XA 4POOA 3FPJA 3M70A 3QOWA 3G2OA 5LQUA 1OR8A 1R8YA 2UYQA 5DXJA 2HWKA 3HCDA 3PFGA 3DLIA 2G71A 3OZRA 2YR0A 3OZTA 1VLMA 2P3OA 1YZ3A 1UFKA 4ER3A 5DM2A 5BP7A 3EEOA 5U4XA 1G38A 4YUVA 4Y30A 4RTJA 2PXAA 4RTNA 1FJXA 4PCAA 2YXLA 2IDKA 3EMDA 4FZVA 2AOXA 5T67A 2C7OA 2K4MA 4KIGA 1NBHA 3OFJA 5DSTA 4YUXA 5FA5A 3QOXA 4DF3A 4EKIA 3HVJA 2CMGA 1L3BA 3U81A 1KPGA 2AS0A 3DR5A 4OX9Y 1BOOA 2G1PA 2R6ZA 2CWWA 3MTEA 2PXCA 8MHTA 4IV0A 4FT4A 4F84A 2AN3A 3LCCA 1NV8A 1NW7A 3BWMA 4GUAA 4EKGA 3QV2A 5D1HA 1F38A 2PBFA 3LBFA 1ORHA 3DP7A 4YUYA 3SXJA 3IHTA 5EHGA 2BR3A 3A26A 1X1BA 5DX8A 4BLVA 1ZGAA 2ERCA 1NE2A 2HR1A 3MAGA 3KHKA 2I7CA 5CVUA 3ERCA 1XDUA 1R74A 2JJQA 5E2AA 3ORHA 5DTMA 2CL5A 4DCGA 5KS2A 1B42A 3EVAA 3LL7A 4FR0A 4K6MA 1R00A 2XYVA 1G6Q1 2ORED 2VS1A 4MIKA 4F86A 5JUWA 4KIFA 4KRGA 4AX8A 5HIKA 2P40A 3GRZA 1SQGA 1AQJA 4R8RA 2ZBQA 2AOVA 5CVJA 1O54A 1MJFA 5K0JA 3LCUA 4KVZA 2P8JA 4L7VA 1VP9A 2GAFA 1V39A 2PLWA 3C3YA 3C6MA 3DMFA 3KR2A 3LBYA 1I4WA 3KQVA 3P2EA 5GOZA 1M0EA 3FUXA 5LR6A 1JTEA 1EQAA 3GWZA 1QAMA 3I58A 3MCTA 3O4FA 4C04A 1QYRA 2NYUA 3ELYA 3EVZA 3M6WA 2NP6A 2Z6AA 4R05A 4E33A 1Q0TA 4OQEA 2JHCA 1G8AA 4B17A 4BP1A 5GIPE 4GC9A 2FK7A 2I62A 1WY7A 3FRHA 3OCJA 4R6XA 1R18A 3GCZA 4RWZA 4C07A 1N2XA 2O0LA 3A25A 4RVHA 2ONZA 5CVDA 4YUZA 4QQNA 3BWBA 4RVDA 5CVVA 4GQBA 5EIWA 3BZBA 1NKVA 3K6RA 3SM3A 3EVDA 4GEKA 4PIPA 2FCAA 1MHTA 2OZVA 2P3LA 1Y8CA 3KU1A 3LSTA 1DUSA 2QY6A 3G2QA 2V74B 2ZBPA 2PY6A 3DLCA 1JG4A 1VE3A 3M33A 1TPYA 2ZIGA 4QTTB 3TOSA 2O06A 2AOUA 2OB1A 3DOUA 4HTFA 3EGIA 3FRIA 3THSA 4HH4A 3H2BA 1UWVA 2EFJA 3A7EA 2DPMA 1YFJA 3VYWA 3ELDA 4GF5A 4IWNA 1FP2A 3OE4A 4PYLA 5DT2A 2QE6A 2VDWA 3C6KA 3CC8A 3UWPA 5EMMA 3T0IA 2PGXA 3AXTA 2PX8A 4AZVA 3BWYA 4OA5A 4QDKA 3ME5A 4QPPA 2UYCA 2XBMA 3LDGA 3UFBA 3EVCA 3EVEA 3M6UA 2ZWVA 4PINA 5E1DA 2VDVE 4PYJA 4P7FA 5JR3A 2H00A 5KVAA 3UJBA 3FZGA 2NXCA 5ICGA 3MTIA 4OBWA 4PYQA 5DX0A 1KIAA 3ER8A 2IBSA 3UJCA 1I9GA 2JG3A 3ER9A 1XDZA 1XCJA 1VIDA 2V7EA 3BUSA 4HRAA 2HNKA 1YZHA 3R6TA 4RYLA 5DRTA 5DTQA 5GINE 3KR9A 4U7TB 1FPQA 5EPEA 4CKBA 2NXJA 3GGDA 5T64A 3FUTA 4RVFA 3GRYA 3TM4A 2IP2A 3TQSA 2C7QA 4FS8A 1JG1A 2IIPA 3C0KA 1P1BA 4MWZA 5HEKA 3VC1A 2P7HA 2WA2A 4GOMD 4E2YA 2HTEA 3GRVA 2QYOA 3KKZA 1KR5A 1RJDA 3LHDA 3Q7EA 3A4TA 2ZIEA 4EQZA 3G5LA 2ZFUA 2B2CA 1PJZA 4P58A 1RJEA 4FGZA 5GIOE 1X1DA 3HA3A 2EG5A 2IPXA 1P91A 2AOWA 4RTOA 5DRYA 5KQSA 2GH1A 3GJYA 5HZMA 1G60A 3SSNA 5DPMA 4RX1A 3S68A 5GM2A 4YV2A 5K8VA 3MGGA 3Q87B 2OB2A 2PSSA 2OPBA 4U7PB 1ZKDA 5GP1A 2Y1XA 3FPHA 3M6VA 1SVUA 2AR0A 1KPIA 3KPWA 4NECA 2PX5A 1XDSA 4RTLA 3CKKA 4HC4A 1SUIA 5ICCA 3I64A 5E1OA 4KW7A 5DTRA 3EGEA 4R6WA 4RSRA 3OU2A 2P41A 4P7JA 2PVCA 4M38A 1JQ3A 4V0RA 1VPTA 2O07A 5EVJA 3EPPA 4MQ4A 4QVKA 3LPMA 4GOND 2Q41A 3CGGA 3GRRA 2Z6UA 3EVBA 1DCTA 2KW5A 4M7RA 2FRXA 4Y2HA 4X60A 4A6DA 4YUWA 2PT9A 1QANA 3E7PA 2ZCJA 2JHAA 3BGIA 3FPFA 3UJ8A 4C06A 5CVEA 4EMSA 4RTKA 2AOUB 3A7DA 3E05A 4HTFB 5FA8A 4CWAA 2PV0A 5EMLA 1BC5A 1RI2A 3G2MA 3PLAE 3UZUA 5K0CA 4GBED 4KDRA 1IY9A 3GRUA 3G7UA 3HCAA 3MCZA 4PYKA 3NVMB 5E8RA 2CMHA 3LDUA 4HGYA 3TM5A 5EMJA 3UJDA 2EX4A 3M4XA 3P71T 3FUWA 1FP1D 4HG2A 4ER5A 5EG5A 2VZ9A 1WG8A 2ONYA 4HSGA 4X41A 5IKMA 3TR6A 5EKUA 3BWCA 1M6EX 1N7JA 3FYCA 3IEIA 2WK1A 3EVGA 3HA5A 2AOTA 1R8XA 3B3FA 4DCMA 2H1RA 2I9KA 2JH8A 4BP3A 4DKJA 3B3GA 5E2BA 9MHTA 2PJDA 4YMGA 1L9KA 1ZG3A 3P2KA 1ZQ9A 3T7TA 4X63A 2FPOA 1O9GA 5CD1A 2FYTA 5DM0A 4PYMA 1M6YA 2ESRA 3KPYA 1QAQA 4RTSA 2NP7A 3OE5A 2IDJA 4O29A 3UA4A 4AZSA 3HCEA 4M37A 4IKPA 4ER0A 3VC2A 3G8BA 4PONA 5GM1A 1EAMA 2IGTA 3KQPA 3HCBA 3GO4A 1AF7A 1HMYA 3GU3A 2HV9A 3ID6C 4PYOA 1ORIA 3KQMA 4PYIA 1RI5A 3DXZA 4RV9A 5LSAA 1N7IA 1JSZA 2NXEA 5ERGB 4PWYA 4ZTBA 4C4AA 5E9JA 3MERA 1Q0SA 3T7RA 3T7SA 3AY0A 3KQWA 3JWJA 5C0OE 2O57A 3SR4A 4H0NA 2F8LA 3SVZA 5DXAA 5FUBA 3OFKA 2PXXA 5LQNA 2BR5A 3CVOA 3LGAA 4JXJA 5FHRA 1WS6A 1X1CA 3GDHA 1O9HA 1RJGA 3KR0A 5C9ZA 4QVGA 3IYLW 5F2OA 4C03A 2ZZNA 4GC5A 1KYZA 1SUSA 4GOLD 1JR4A 1TW3A 2BZGA 5C1IA 3NDIA 3SX0A 1D2CA 4LWOA 3KQSA 1BKYA 4LWPA 5H02A 4F85A 3I53A 5CM2Z 5EQJB 4AZWA 5LQKA 5K03A 3AXSA 5KQRA 5CCBA 4DA4A 2FHPA 5HIJA 4EK9A 2NXNA 3K0BA 1BHJA
chains in the Genus database with same CATH superfamily
4UZEA 1BGXT 5K0NA 1TTPB 3BGDA 3BHJA 5ER9A 5AJVB 2BW0A 3V2HA 4Z4EA 2VDOB 4RANA 3ZDQA 2NVUA 2X40A 2JD1A 1WSDA 1YB7A 1EWYA 2UUAB 1KXJA 3ACBA 1EG7A 3COPA 1NW5A 3FTCA 4K8RB 3EZ2A 4XSGA 2F2TA 5K8TA 5HX7A 1T8WA 1EP9A 1FU7A 4OQPA 4E5UA 1Z0DA 1J6UA 4IJUA 5JFGA 1UEXC 5HF6A 4XGKA 1SCIA 2W6IA 2JBHA 3AV3A 2Z2YA 3SLGA 4AQ7A 4CMHA 3INNA 1E0KA 3UK7A 3EWAA 2PR2A 3L41A 5CB4F 1B2RA 1JLHA 2GKGA 1U8TA 1ND5A 2VNSA 4B79A 3JPYA 2Z95A 4DSOA 3G8CA 4J1QA 4RL4A 5KYKA 1QVZA 2QPTA 3A9CA 3ZH2A 3Q10A 3ZGLA 2DPHA 3IO5A 4FN5A 3B1VA 3C3CA 3T7DA 4ZGWA 3CLRD 2BGTA 3IPRA 4CNBA 5BY2A 2YRXA 5FQOA 1BYIA 1QF9A 3GXOA 4E31A 1PQ4A 1Z22A 1KZ4A 2NQTA 1PEYA 3LNCA 3PDHA 1V2GA 4WOPA 1JN0A 1RD4A 4RGVA 5I8PA 5A4MS 1UAYA 1RI1A 4II2A 1OQAA 1ZI9A 4IUCS 2Q45A 4C08A 2I8LA 3ROGA 4J91A 3FW1A 5JBNA 3TDNA 3FXAA 2O8BB 3R3HA 3KBBA 2XBLA 2CVPA 4Z51A 1QQTA 1C2TA 1L3IA 2HA6A 4D44A 1L5HB 1P0IA 1UH5A 3KPJA 3MB5A 1PBNA 4QUHA 2DBVO 5LZ7A 3ZJ5A 5JQWA 5IARA 1Z4NA 1QHEA 1Z2AA 2Z9DA 1KFBB 4MGEA 5C8XA 3OF3A 2D4HA 3I6BA 1QRAA 2FPSA 3KPVA 4IR7A 2AVNA 1IJKA 1PF7E 4HLNA 4M0LA 1Z6AA 1IQPA 1FVOA 3CG0A 1R7RA 3N74A 4LXYA 2WAXA 3N3AC 3WIVA 1NC1A 1VGQA 5LBIA 1BKDR 2UZ4A 3GMDA 1AKMA 3P9SA 3SYLA 4BO7A 2CDNA 1ISIA 1MX1A 2FW6A 3D1VA 2GVDC 2JHGA 3EG5A 1CP3A 3M8KA 2VUIB 3UB4A 3KTAB 3QITA 4E5MA 3EMBA 2O1XA 2V0CA 1L5YA 1K9VF 1W4RA 1S89A 2JAXA 3I6QA 5DULA 4G5HA 1SXJD 1OROA 1HE1C 2ZDGA 3LYAA 4HCJA 3KK0A 1E1LA 1YU6A 2W2XA 4X84A 2A5FA 3AP2A 3WGGA 4KQCA 1OBFO 4NWIA 1LTKA 1J39A 1XTZA 1JWBB 1SVWA 2XMPA 4FU0A 4WZAE 5CDYA 3SHVA 5AVXA 4P4UA 1KWKA 4W1SA 1O96A 3D64A 3DOOA 1X1SA 1M1NA 2QYHA 2EATA 3G68A 5ALWA 5JSZB 3Q41A 1U0FA 3EOBI 2JKYA 1E32A 3THRA 4H6VA 2IS6A 3PU6A 4R0MA 4RU1A 2J09A 3KVRA 4EBBA 4QU0A 3GRCA 1SD2A 4QQFA 1C29B 1UKAA 3IV6A 1FLNA 1D2GA 2LDXA 2Z3VA 4O3MA 2GM3A 2HT6A 4AY4A 4CDNA 4Z7NB 2ZIXA 4YX9A 4RW0A 1CULC 1I1NA 4PWZA 4LBYA 2FDCA 4D0NA 3HY3A 4RH1A 2O8NA 1KEUA 1ABFA 1ZD2P 1NY5A 1FNSA 3K0SA 4O4HA 1ZXXA 2GM5A 2PKRA 1D4AA 2WUVA 4LRWA 5FO1A 2IDZA 4E6EA 1TM5E 3LUPA 4TV9A 1KRHA 4XCXA 2GCIA 3GZTB 1DXYA 1PD0A 1LX6A 3A1WA 4OBEA 3E3OA 1AURA 4EW6A 3CIOA 3ZXIA 4BDSA 2XWBF 1SKQA 3F2VA 1ZMRA 4F45A 1U2ZA 2P6PA 4XRGA 3CLHA 1G5PA 3ADBA 1LBQA 3ZI0A 3LIPA 3D4BA 3PQEA 3JQ8B 4H7EA 4OGWA 5IVPA 2NP6A 3DCYA 4NU8X 3F46A 3IQXA 1U63A 2JFFA 2MSKA 4NY1A 1L8XA 1M76A 4NNJA 2WDZA 2BKEA 3O83A 3WXMA 3VPXA 2M98A 2Q5EA 1Z6QA 2BSAA 1WPXA 1GFZA 2EFEB 5ETJA 1VSTA 4FX2A 1FQJA 4ZK6A 1TPZA 4J0IA 5ALLA 1U0TA 2QRUA 2CLHB 1NI3A 1DAOA 3H1BA 3SSAA 1TEZA 3ZBUA 1OBHA 1E89A 4YDRA 5DJ5A 2FPGB 4Q24A 4DJFC 3TNYA 1WP4A 2ODBA 4QOHA 2HIHA 4PQGA 4LQLA 1NLUA 3D8TA 3H9EO 3ZWMA 1ZW6A 5JXJA 1S9DA 1JIXA 1IUOA 5HKKD 1VHJA 1GADO 3IXMA 4KO4S 3C3XA 4XPZA 2CZGA 4HQLA 2QQFA 4FB4A 4OI2A 1GEGA 1DCFA 1CS0A 2WAMA 4RYDA 3SBEA 3LX4A 3VPGA 3I9KA 5CA0F 1CQIB 4GWKA 1TX4B 3KR1A 4LJYA 1C50A 4Z9YA 5JG7A 1EWRA 1UJ4A 4MVJG 4DQVA 1HT3A 1JU4A 1IE3A 4OHRA 5JLJA 3GJ4A 1FYVA 1XZLA 3L8ZA 1DDOA 4IH1A 4NXNB 3CA8A 1OIWA 5LU9A 3VDNB 4DCJA 2D54A 1YB4A 2A35A 3VOAA 3KSBC 4TSFD 1JHAA 4KQKA 2Z57A 5EMKA 3X2SA 2VKQA 1Z4MA 1J23A 3M6XA 5KWJA 4F4JA 2FP4A 2A1TR 3OUZA 2CFCA 1C7EA 2XYRA 4JI6B 5IDXA 2X0FA 1S8NA 3KC2A 5MHTA 1F2UA 2Y2UA 2XMDA 2R7AA 2OVBA 5HCNA 4KR6A 3M70A 5LU8A 4G63A 1S8AA 5I7HA 1EDDA 2VR1A 3RRXA 4DRXB 4ODIA 4UBLA 4YRJA 3DLIA 1MQAA 2Z83A 3CE6A 2QX9A 4N5IX 4NFHA 3TR5A 1E5QA 1NJ8A 5BQ5A 1M8PA 3ZC3A 4Y2QA 2FETA 4U2KA 4CN8A 4ER3A 2TMYA 3GEMA 5EJ7A 1UMCA 2O7VA 4UQOA 4NATA 4YECA 1G38A 4FXPA 1QG6A 2VDNB 1IRXA 1QH8A 1FP6A 2XMSA 3ESRA 1O1YA 1I5RA 2ENUA 2IDKA 2WM8A 3M6LA 1ILEA 1C1XA 1KJNA 1PFYA 2IZOA 3S8MA 3VX3A 1Y42X 1VFNA 3BGWA 3ZE8A 5KCMA 4XDGA 1JXQA 3CONA 2C4NA 1ZRNA 4HR7A 3GUUA 4KVGA 1KPGA 3DR5A 1CVRA 3Q0EA 1B23P 1Q1NA 2I6FA 2DWOA 4ZCTA 1PDVA 2V7PA 4IV0A 1X7WA 5FTKA 1EXWA 3TF5A 1X92A 2FFHA 1KETA 4MKRA 4RETA 3K6JA 4QUBA 1S4MA 3AR7A 3P26A 3L7DA 3EXG1 4EKGA 4ASUD 4LFBB 3QV2A 1RXSA 2I71A 3IUYA 1QIFA 3GAFA 4DA0A 4EZEA 4RZUA 1U0SY 4DCTA 1JPNA 2FSSA 3RU7A 5AQ1A 1C4WA 1KK1A 1QZTA 2CW5A 2LR0A 4QNRA 4AUMA 4BATA 2ZRAA 2QBYB 4F7DA 2LXNA 4Z99A 2IZ7A 5G0UA 5JAMA 3OM1A 1TCBA 5JNWA 2RHRA 4N1AA 4B34A 5KS2A 2X3UA 4DIMA 4B82A 3ZE9A 1SOAA 5DBGA 4BV3A 4FWTA 3HO1A 3JAKB 3RTCA 2X6RA 2ZRPA 1IHDA 4PANA 3U9TA 1FVXA 2NXWA 4KWIA 5EXEA 2BBOA 4OQNA 3B53X 4FMDF 1RJ9A 3LCUA 4HH3C 5FTNA 3W77A 4J16A 3L02A 3R77A 4CNQA 3D7LA 5JI2E 3IAEA 4IM7A 3I5MA 3UATA 1UWCA 2RK6A 3AYXB 3G2NA 2VLIA 1U4OA 2GCOB 3O9VA 4IXNA 2VI5A 3HFGA 1BJTA 1RADA 1UQRA 3HZHA 1E9DA 4E51A 1P2DA 4OQEA 4B4VA 3CW2A 1G8AA 2YV1A 4MV5A 2KS6A 1C1YA 3MXTA 4BVJA 4WZBE 3ZD8A 3F0TA 1R18A 3JVUA 1S1MA 3GD7A 4Q9HA 3BDAA 4A9AA 1ZM9A 1O77A 5HRUA 1P9OA 3K96A 1J24A 4LOIA 6ABPA 3RV4A 2B4KA 4LGCA 4FJ0A 1AE1A 3ASYA 3ZIDA 1NKVA 3AUJB 4L3VA 5FJIA 4B9AA 5IABA 3P2OA 2FCAA 3VYUB 1SKBA 2UXDB 3AINA 1GNQA 3I72A 3FTPA 4GPIB 4AJEA 3KQHA 4E5PA 4MPJA 1V48A 1W2GA 1LPBB 2A9OA 4MB0A 1N78A 3DA8A 4FFOA 4EZBA 2PLAA 2DG2A 3BWXA 1TPYA 3F3YA 1DHRA 3A2LA 4L85A 3EGWA 2OESA 2VJYA 4LW8A 1RYZA 4UBKA 5DN6A 1KDZA 4QXRA 3SCZA 3GN1A 4JYAB 1ZISA 3H9UA 4UVDA 2X4DA 2IYUA 4IXMA 4X85A 3BXZA 3RD5A 1IBRA 3PXXA 4KGZA 2FP3A 1GTG1 3H5RA 4QAJA 5F7JA 1JMYA 3ZTYA 3I6IA 3KSRA 1RM3A 5EMMA 3S28A 4ENSA 1GM5A 2HPHA 2MSNA 2PGXA 4HXYA 4B3HA 2LPMA 2FN3A 1NQAO 2GYUA 3I83A 3IMKA 4PSKA 4AECA 2J4DA 3RC2A 4ZI7B 4G5XA 3CLTC 4RFSB 4TRNA 4BX9A 3OETA 3QPUA 5FLYA 4CQMD 1XVVA 3FZGA 1ZUIA 1H2EA 5LDHA 1S5PA 1OYYA 4O6VA 4CKWB 1CY6A 2MU1A 2GVZC 3FR8A 4MI9A 4PXSA 1WUJS 3PUHA 5F9MA 3JD1A 3LAWA 3VDXA 1E0SA 3K5WA 1M6NA 4B32A 4AK9A 2XWSA 3H5WA 3O8RA 1GZ5A 4DIBA 4PLTA 5IAKA 5CYGA 5BOVA 2KWIA 3AIOA 4P8RA 5FL7D 4PGFA 1N1MA 1N8NA 4MLCA 5EIOA 1H1LA 2FEXA 3HGMA 4IKOA 4J03A 4KMMA 3WBJA 4GL4A 1P0MA 3JQDA 4K6FA 2EZUA 2N1BA 1XQYA 5JCJA 2J1LA 2JI6A 2AQIA 4E5DA 4I1IA 5GZ6A 3NB0A 4AUNA 5EN4A 2IPXA 5CA0A 2K7FA 1P91A 2Q3BA 5HS6A 3ZEAA 2PGIA 3IV7A 1HC7A 2UVDA 2QZPA 3GJYA 3G9UA 1N7GA 4WE3A 5DRYA 5EJAA 4D5EA 2EGHA 3RGGA 3T12A 2PANA 2AN9A 1DIRA 2ZYAA 4DMKA 4CT5A 1HE2A 1WA5A 3LPAA 5GP1A 4HDMA 4KYVA 1PK8A 3JATB 1YR2A 3C6BA 5KNDA 2WD8A 1QUEA 5DNUA 1W34A 1PWZA 4X7PA 1YE8A 3PPIA 1X1TA 2I4LA 2QV0A 4DQXA 2P0EA 1OI3A 3U1BA 1RKVA 4L0CA 1LY1A 2GJSA 1W8DA 3RBVA 4R6WA 2RGDA 1U02A 1XEAA 3F90A 1G8YA 3E9QA 4M0KA 4MWSA 1OFGA 3RC8A 3BFXA 1Y8RA 1A7KA 3AM5A 1PQYA 1F51E 2FSHA 1WM1A 3NXKA 4G8JA 1BEEA 2B8NA 5IJZA 3D3NA 3TZ6A 3JX9A 2X0RA 4HQ6A 3LPMA 2OQRA 4KPUA 2QWXA 4LAFA 4MW0A 3PEUA 4U9IS 2B69A 4JJ7A 2M1ZA 2BHTA 3I2IA 5HWSA 2FX3A 5D6OA 5DN9A 2HHHB 5KYUA 3NUZA 3MRXA 1W5FA 2PQ2A 3P5BA 5ULLA 1H2WA 2PYIA 2G88A 1ODSA 2EGGA 1NBEA 2C3YA 4UNIA 1NXPA 2DQSA 1BS9A 1B8VA 2JZNA 2RJOA 1HPLA 3DNPA 2VC2B 2E4WA 2C4TA 3MG9A 1Q12A 2ZSDA 1QQ5A 5K0CA 4LXIA 5KOHB 1JXOA 4RZ2A 2Q46A 3TTVA 4DDUA 4G0XA 1PR5A 3A6EA 5DTJA 1XMJA 4FCVA 1NP6A 5DSZA 4JASB 1JZTA 2BT4A 2AFRA 2DPLA 1ZNQO 4J0GA 1F7VA 3BIOA 1PUIA 3GG9A 4BVFA 5EJIA 2H1OA 4B5LA 2VXYA 1WB6A 1EDOA 1MX5A 2A0FA 3NVDA 4M9UA 4L9WA 1E20A 4ESOA 2NV0A 1AH2A 1YDFA 3RS7A 2IPLA 3HBJA 4ZVQA 3SS9X 4RTPA 3VJRA 2ZB8A 1NSFA 2W2VA 4Q9LA 1ADBA 5I01A 2PUHA 4JFAA 3GUYA 3OE5A 4NIMA 4DT1A 3W04A 1T10A 4JT9A 3LLMA 2E37A 3V7NA 1T0IA 3WLSA 1R0YA 3A6HA 3C74A 3ZLBA 4E6PA 4DREA 1E1MA 1GLNA 1GG2A 1E60A 1XRLA 4UE6A 1LSJA 5JMWA 3ZOKA 2J33A 3DYBA 3HCBA 4MNTA 1KI2A 2HZ7A 3HB9A 4E13A 4N12A 2XRMA 1NPTO 2IDMA 1RI5A 3KQNA 5REQB 3QSYA 2Y99A 5C31A 2AEJA 5E9JA 3U37A 1FX0A 3SIPA 4B80A 4UEJA 3UWOA 2WBLC 3SVZA 1BXRA 3C7TA 5FUBA 4M1WA 1U04A 2XVXA 3OQPA 3RVKA 4DR6B 4DMHA 4BGDA 5JWRA 5BMVB 1V1MB 4F38A 3N5CA 2P6RA 3QENA 4QGAA 3T1YB 3K6KA 2XVYA 1SUSA 3G0OA 1PYOA 4ZQCB 4ZMBA 5L6MB 1TW3A 4R31A 1T15A 3RBZA 3KQSA 5B12A 3MPOA 1RWWA 3VV2A 4I6JA 4XYGA 3G0HA 2Z6VA 1COWD 3GBPA 1ISSA 2GPAA 2FHPA 3C7CB 3QI7A 4TRJA 3TI7A 1OH7A 1S2GA 3NWOA 4AC9A 4DNXA 3T3PB 1OZAA 4IEIA 4LK2A 3O9MA 5E4FA 1SOWA 3EXAA 1QS0A 3VYVA 1HE3A 3U1VA 2QLNA 4MUJA 4DAOA 3B7PA 2N47A 4RPLA 1HYEA 1JA1A 1EJ0A 4WINA 5TJHA 1U0RA 2J30A 3QU2A 3RUPA 1T43A 1EM6A 1NG1A 3PCXA 4I2VA 2OGZA 1BHSA 4JLPA 3WLQA 1CLEA 4LRTB 5KU1A 1O6GA 4TYNA 2A8YA 4ZZIA 2QP4A 3TLEA 2JLQA 1HLFA 2AQHA 2QVLA 2B99A 2ZVQX 1RABA 1P39A 2VNHA 2JFXA 3BJIC 2HQRA 1J5XA 1MNQA 1ORRA 3DEZA 3OU7A 4KQGA 4Q4AB 3T9EA 4BMVA 1ISRA 2XUAA 2EZ8A 4BLQA 1DGQA 1RPAA 1DEAA 1ISGA 2QUBA 4KVAA 3TCNA 1K6JA 3GEPA 2FFJA 5FBQB 5HOQA 3JQFA 2E18A 2ZZMA 3BMQB 1XRNA 1EVEA 2D1FA 2P5YA 4MWDA 4KRFA 1W36C 5T4BA 1LQUA 2EBFX 1WMAA 3M2TA 4MUXA 3J7AC 5JVDA 4CU2A 5DHTA 1G20B 1KU0A 2ECQA 4FHFA 2HRRA 2B4YA 3H75A 4JLDA 2GPNA 2DWUA 1QRDA 3DHWC 4IJVA 5A05A 3W8FA 1ZBDA 3HNRA 4EA7A 3TCKA 3TNFA 3A4LA 3IP1A 4C29A 1QHSA 5JHHB 4EB6A 4NYJR 2QI9F 1Y3DE 3T3OA 3WS7A 2QP3A 3ANNA 3NDRA 3O8QB 5EQDA 1NU6A 4E5NA 5IF9A 2B25A 1N9KA 1X7ZA 3D1JA 4QNNA 3SOPA 4DZTA 3TIVA 4TXLA 1U2PA 1UKBA 3KZKA 1KJ8A 1SBHA 1GKKA 3RIEA 2RGCA 3UBTA 3EFBA 3PUVA 4JUAA 5FULA 4ESEA 2K6GA 4EAAA 1A4RA 3CEAA 4K05A 1UIRA 5BT8A 1GPBA 3E4CA 4KSYA 4R01A 1M72A 4KQMA 4EMBA 1H9CA 1DPFA 1TT7A 1X1RA 3EXFB 3A58B 3W7AA 4AMBA 4HNAB 5EIEA 5DNYB 3FYDA 4H08A 3RYIB 3EFHA 2D74A 4D0SA 1NOKA 4CKEA 3H5OA 4DG8A 3T1NA 3TKAA 4R3NA 1C7IA 2WIKA 2J7KA 4KK3A 4TXMA 5T57A 2XNJA 4HEJA 5K45A 3K1JA 4Q00A 1MORA 3LZ6A 1UK9A 5E0OA 2A57A 3KVOA 4FYYA 3GP3A 5HFJA 5AW9A 3I04A 5AUNB 4HUQB 3VOTA 2XCSB 4ZQEA 4K9LA 1LK0A 1TK9A 1B6RA 2W22A 1XAGA 2O8CA 1Y4DE 3MWEB 3NATA 3ND8A 1HLGA 4NCBA 2CJFA 2JCSA 2GF2A 3ZQ6A 1QV6A 2WVJA 3JWIA 3OJFA 5A7FA 3W6OA 2C7PA 4N5MA 1BA2A 3VSBA 2ZTSA 5BPFA 2G9ZA 2PWYA 3RS2A 2QTHA 4GPD1 4O4LB 2ZUUA 4PLVA 4CM8A 1L8OA 2VBCA 5ECWA 4LNUB 5F76A 4FMBB 1X3SA 5ED4A 2F43B 3KOMA 5A3VA 4M0DA 1K88A 2PD6A 1QORA 4QL3A 5CHYA 3T9DA 3TTTA 5KTOA 3Q8LA 3QF4B 4KCGA 4OKSA 3HKEA 4POAA 4COKA 4DAEA 4O2BF 5CX1B 1KK0A 1UJMA 4ZT6A 2J08A 4C0LA 2AZTA 4ER6A 3D6FA 5KPDA 1QM5A 4L4SA 3N0RA 3L0DA 5TMBA 1R16A 4TTSA 4CFZA 2ZJZA 4Z9BA 4RTQA 1GYQA 2Q3CA 3I61A 3OOWA 2B6HA 2P0AA 3ISVA 2OY0A 4KUHA 2QD2A 2H31A 4JGIA 3AVQA 2BDUA 3CNLA 3E5HA 5FOQA 5LXTA 4R1UA 3DO6A 1MQ8B 1E59A 3C4VA 3TQFA 2H7CA 4TTIA 2ON6A 3UWSA 1AQIA 1LDEA 4QTYA 2I6SA 4S05A 2VUUA 3V00A 2BZ1A 4RL6A 1QPBA 1XD9A 3AL0C 1D2EA 1Z26A 4E32A 4IEFB 2YOHA 1BVHA 3D8SA 1BW9B 3FSGD 3L1JA 1J0BA 4DKXA 1BGWA 4OXRA 3RTEA 3S1AA 3LY7A 1XN4A 4QUIA 5JSUA 3NRBA 1JAXA 5BWCA 4V0LA 3RU3A 1W73A 5LZ5A 1BD3A 3C3KA 3KEGA 1ZVVA 1YOVA 3W5DA 4GWGA 4MRNA 1VMAA 4LVUA 5TF0A 4WJKB 1DXOA 3B6KA 2WFZA 1YUNA 2HT1A 2P2ZA 3DVQX 5T8KC 4MMZB 4LMBA 1KMMA 2AZ4A 2I22A 3MTJA 4OI1A 2OTCA 4BQOA 3PFKA 5JNTA 4OX9B 2HUNA 2NZYA 1ZGGA 1X14A 1A8UA 2G9RA 1EMDA 2HU5A 3IPAA 4Y6PA 3W79A 1RJFA 2R0QC 5DLEA 5HBRA 3KYBA 1T9AA 1E5LA 2G5PA 1XPUA 1T5IA 1Y6ZA 2HIAA 4DA9A 1Q1EA 2QRVB 3HE3A 3O8LA 4CFSA 4WW0A 1LSUA 3E70C 4WGGA 3RRBA 4CF3A 2CXQA 1AK9A 4JP5A 2IEZA 2P1DA 4JLOA 1FDIA 1PGOA 3RI3A 4ZYLA 4UM7A 2PUEA 2R8BA 5DMHA 1ZN8A 3NTVA 1KSGA 3A6DA 3A1UA 3PQ8A 4QTUB 1WXXA 4RXMA 5ICFA 1WLYA 4YA6A 4U7JA 1JT9A 3B1WA 5IX8A 1CBUA 3D7SA 1GARA 4L9AA 1QE0A 4R3WA 2QYSA 1X1QA 1DEXA 4CTMA 2QS9A 2F1OA 1E5VA 1NR7A 3KTOA 3OZTA 4GKKB 3FM9A 2EKDA 4BNTA 4M0CA 4XWYA 3IUJA 5I4IA 4J0KA 1NNEA 2J5QA 5EUMA 2E21A 2FZWA 3AY3A 2GBLA 3AKCA 4AIRA 3DPUA 4YFYA 1ODCA 2GETA 3EUFA 4HF7A 4I8DA 4ND2A 5AOCA 1J9ZA 2RFLA 4JEUA 3SM9A 5JSKA 1RC8A 2YC2C 4KIGA 4XGQA 1X8KA 2O3TA 3WIUA 3OFJA 1MGPA 2CFTA 4LCEA 2C58A 2Y1EA 1A4UA 3S1LA 3S5UA 3RHFA 2CNDA 3ECSA 3WICA 4C6HA 5BYKA 4ZYUA 1IPFA 3IBCA 2P68A 5B2ZA 5KAMA 5JHGB 4BB9A 1GRNA 3PQCA 4NX2A 4O2RA 4YYZA 1CUXA 2X13A 2I5PO 2XOKA 4FMCF 1B2LA 2LKDA 3RV3A 4CEHB 4JOCA 3FMPB 4KE8A 5F7OA 6NULA 4JGBA 1F38A 2P27A 3WQSB 1B3BA 1ORHA 4D7AA 1ZU4A 2DWPA 2Y0DA 2MDTA 2ZJ3A 3CWCA 3H6HA 4WVFA 1UKZA 4NZOA 4YMIA 4OIFA 5FOWA 2NU8B 4XGRA 1C3JA 3Q0TA 1LPSA 1ZY2A 5GADl 3ERCA 3LKVA 4YRCA 3WSWA 2YZ7A 1XDUA 4GU5A 3IIIA 2HJWA 3IPLA 2P5UA 5E2AA 5KUTA 1OAAA 4FR0A 2C3OA 4MLZA 2O5RA 3IDZA 1N2CA 1G6Q1 5EE5B 3OJEA 3UFXA 4BTLA 1RE1A 1YQ9A 3F6PA 4MR7B 2A7XA 2O8VA 4NU0A 5HK8A 3OFVA 4NNOA 3TIFA 5HKKA 1A9XA 4D42A 5AW6A 2V58A 1N33B 1EZ1A 2JEZA 1GCGA 2QTVB 4IG4A 1EXMA 1FXUA 3IHLA 4GI5A 4QODA 4AZ0A 5JJLA 3M9WA 2Q3DA 4W5JA 4N01A 1ZUD1 1IOLA 2FN8A 1VJ5A 2Q21A 3GWZA 3RM3A 3UHPA 4B45A 2QPAA 2VWPA 2P1RA 3NOQA 1CVIA 3KYIB 4PEVA 4PSAA 3TL3A 3TW8B 2C92A 4KK4A 1ZUHA 2KM1A 4RMIA 3W3ZB 3O2SB 4TSFA 3IQDB 3FGPA 4D3XA 2WNHA 5DNWA 1X15A 2VT6A 2FG7C 1OBCA 1W9HA 2P9QA 2VTEA 4HVTA 4OSPA 1A8QA 1DRJA 2RG7A 2XQJA 1H2RS 3HJRA 4OSOA 5THXA 1ZGCA 4XSHA 3T5GA 2RCNA 3PR1A 1BX3A 1SC3A 5HZHA 1S8OA 3C3BA 2BRUA 5TMEA 1Y6JA 3ICOA 4RJLA 5CW2A 2OSBA 2MSCB 2ZBGA 3L0PA 1JFVA 4GEKA 2PJRA 3EQ9A 1TLLA 3ZE7A 4QEZA 1YA6A 1HUQA 4IJWA 3CX7A 3ABQB 1LFAA 1XEXA 2R9VA 1QGAA 1MPTA 1JG4A 1AC5A 1VHTA 2NACA 1BE6A 5AK6A 1C8KA 3MWLA 3MJEA 5D3MB 3VKUA 3SR0A 3TZHA 3H2BA 4JIGA 3KB8A 1MB9A 4Q9AA 1RWVA 2ODPA 1L5GB 4CQLA 1TL7C 4MYUA 2H2FA 4O2BA 2JFBA 3LW8A 2BI7A 5L6LB 4O2AF 3OPYA 4UNSA 3ZNNA 3ADCA 2BFDA 1YS4A 3NONA 2W8BA 4S1WA 1PWHA 2C8KA 4OOEA 5D5PA 5JBQA 1SUWA 2JRCA 5T8KA 1V11B 2BEWA 4LPSA 2NU7B 1XHFA 3BWYA 4AZVA 1UOPA 1N6LA 4RNCA 4E21A 5BYBA 5IPFA 1ZK3A 3DOIA 4B7XA 1VB5A 2I34A 5COAA 4I0WB 1UINA 4D9NA 1PAUA 1VCHA 4ASUA 2DPYA 4WKPA 5BOSA 5DX0A 3T4PA 1T1RA 3H42B 2FI1A 2A9VA 3BUSA 4GHWA 4ZJPA 1Q84A 5JOQA 1GILA 2NAPA 2EIHA 1NF8A 2OBYA 4KN6A 1DXQA 4UC0A 5EPEA 1FVFA 1F0NA 1ZSVA 4NEQA 4RVFA 1NF3A 3CYFA 2VJOA 4M55A 1SUBA 2C7QA 3FDZB 4S1OA 3C0KA 4JXKA 4QIHA 2P7HA 3HBAA 2AX4A 5BV0A 2IHVA 2X5XA 4DJTA 1L4HA 4MH0R 2ZAGA 1IM2A 1N34B 1F8FA 2H06A 3LHDA 3ZTWA 4B0PA 4TV8A 2YZGA 3G5LA 1RQXA 3GGJA 4PX9A 5A9SB 2IU4A 3U4AA 3AESB 3WY9A 1E9SA 2C3MA 1PT7A 4IIJF 4PHHA 2BISA 2H4ZA 3MGKA 3TVTA 4DSAA 4NJEA 3W2IA 3PWTA 5AHWA 1JDTA 2CXXA 1NVEA 2C7GA 2WYOA 3JASA 4S1NA 3S6JA 4C0WA 3JSAA 1GVHA 2H8GA 5DPMA 5HZMA 3VAYA 4R8MA 4UHCA 1LVGA 3K32A 3MGGA 1CB0A 3O3NB 4RV5A 4JL5A 2GT1A 3QWFA 1E99A 3A1TA 3HU3A 4HSEA 1UJBA 3M6MD 3L6OO 5E6UB 2FSFA 2VPIA 4BBAA 5JS2A 5JWOA 5HG0A 3KPWA 2CE7A 3JQGB 2QNBA 1Z16A 6LDHA 4ZVTA 4OI4A 1CCWA 2FOXA 2M6RA 2N42A 3HB5X 3Q1LA 3TSZA 1VRCA 4WCFB 2BP7A 2C54A 1JDZA 4KP7A 1O57A 3D81A 1VPTA 4M60A 3BK1A 5D87A 1H4QA 4CEIA 2CSUA 4TWJA 4YCDA 2IS1A 2X9NA 5DMXA 2GN0A 3DJYA 4OO3A 3C14C 3JSXA 4K87A 5TGDA 4D79A 4DIUA 4EHKA 2V65A 2QZJA 1EUCB 1XU9A 3KFXA 4M7RA 1DV1A 2NU9A 2VP0A 3A4NA 1PZHA 3THYA 2JGLA 4QJ4A 3HO8A 1K06A 2VSXA 3S70A 4AJ1A 2GM4A 4N41A 2W2MA 2PKYX 4EMSA 4RTKA 5FOUA 3W8EA 2FY8A 2AH5A 3NT2A 3V9AA 5A7GA 3KQKA 2FMKA 4L6IA 4R1SA 5C8VA 1CEYA 1BC5A 1D6MA 2ATVA 3BJMA 2COUA 1A27A 1W1WA 2F9LA 3GPDG 3TTXA 4OLBA 4NQRA 3NVMB 5FR1A 4BAGA 5DI3A 3OTHA 4KPGA 2ERYA 2WF9A 1TMYA 2CLOB 4CQMA 4LYAA 3DOHA 1E2IA 1PFKA 3PXDA 3PHCA 4N5LA 3RUHA 3UT5B 3NS7A 4TTJA 3T54A 1TJ4A 4L22A 1XWIA 1IBKB 1QX4A 4CL0A 1BU5A 4M86A 1C3OA 4MI3A 4EX7A 3B3GA 4FYMA 1UXKA 4LC0A 2NU6A 5AKLA 4EHHA 2W2LD 1H0KA 3NEPX 5LMUB 4WK2B 4Q1AA 3OFND 4RH0A 3VBEA 1JT2A 2GI4A 1ECPA 2ZJOA 3K0FB 4RK5A 2ESRA 4I99A 4XFKA 5FL7A 5GGYA 3HY4A 4O29A 2DUNA 4IDDA 5BN3B 2VH2A 3MJ4A 1W2HA 4PONA 1Q95A 3LC7O 2UKDA 2BKLA 2LVBA 4K9NA 3UOAB 4DY4A 5I6DA 4EKNB 3CRMA 1Q44A 2D0OB 1O6BA 4QYTA 3HJNA 1U3WA 5CVTA 1PYGA 2WUFA 4KACA 1UEIA 3DAHA 2OHXA 4HUTA 5TX7A 4R41A 2MMGA 3RRNA 1Q0SA 5AVWA 5JNVA 1RXYA 4ZJUA 4RA9B 1QG4A 3TL6A 2FPXA 3U7EB 2VATA 3EIFA 4AZ3A 3QVGA 3MIIA 2XGMA 3JWPA 3FVVA 1FNMA 2A7QA 3O2QB 4KQFA 5ENDA 1WIWA 3PD7A 5G0WA 2O54A 2XE7A 1MXHA 4GDMA 4TS9A 2FPUA 5AHXA 1E0AA 2LDBA 1JR4A 1ORDA 3GLHA 1M2NA 4LWPA 1VRVA 1X0XA 3IP3A 5DHSA 5IT9A 2AE2A 3IAS6 1QMGA 1Y4SA 1ZW1A 1C9NA 1CZUA 4P31A 5JMTA 3AHFA 1GZVA 1PKEA 4S1VA 4HBZA 2I03A 1PT9A 5FFFA 5JAIA 1T13A 1G17A 2EAUA 4OYYA 5BN5B 4OYHA 4QUJA 3ZUGA 2D5CA 2ZUSA 4IEEA 5DW0A 4EYOA 3FTEA 2J9RA 1NW8A 4R98A 2F3TA 1Y5RA 5IEJA 2ZIZA 5DX1A 2ZJBA 2GLTA 5FTMA 4F04A 5G53C 3NAZA 1VPVA 3HDTA 1E6CA 1GNPA 1XKQA 2AN1A 4JITA 1JVBA 4WBSA 5A9SA 3NHPA 1Z74A 3PEEA 1WE2A 2R00C 1WXDA 2VHYA 3DUWA 1R6UA 2C9YA 1YSCA 4G0PA 4XX0A 1DCMA 2WM3A 3UWMA 2R1TA 4TRRA 2FEWB 3BEOA 1VL2A 2QL5A 4O2AA 4D8UA 4PNPA 2OK8A 2VDQB 1VLJA 3WL3A 5KTNA 1OGJA 5HJ2A 2IH4A 5AMXA 3NM6B 4KPYA 4R1OA 3KOYA 2YQZA 4GI7A 1KC1A 2NSLA 3KYJB 4FHZA 4EY3A 2E5WA 3G5UA 4ENRA 3FB1A 4W9MC 9LDBA 4YJHA 3F9IA 1P3Y1 4YVFA 2EVWX 2PD4A 4RKQA 4TLEA 4GI2A 4JI1B 4C4ZA 1ZN2A 2H0QA 1ZKMA 1JLLA 1XP8A 1A1SA 4XVCA 2AI1A 4CXMA 1NG9A 2W42A 3UH0A 2H1CA 2QF7A 7MHTA 1DQZA 1M2KA 2C61A 5EEGA 1RWBA 2Y6UA 2BFFB 2HV8A 2LD4A 3LQQA 4EDHA 5BW5A 2PPLA 2AE1A 3NORA 4JT2A 4ZV7A 3ACDA 4N6NA 4XDZA 2GB4A 4MUFA 1M6VB 1VQ1A 3BE6A 5B1HA 3NYWA 5JCPA 4C0XA 3F8SA 4MPTA 4ENTA 5BORA 4QC2A 3RKRA 4X9XA 2PO5A 1GU1A 4PTLA 1FXWF 3RSHA 1QH1B 3STVA 4IIJA 5GY7A 3PFFA 1JQEA 1Z0SA 3INGA 4ZAGA 3LHKA 1Z6PA 4MV0A 2HMYB 1YC5A 1T36A 2H4HA 4JGGA 5TLSA 1Z47A 2J3HA 3LKBA 1DZ3A 4KIJA 1TZ2A 1D1TA 1X8JA 1NSYA 1EJ6A 2ZVPX 1PR4A 3DE7X 3Q9NA 1DC7A 1PRYA 3FKSD 2CWDA 1L7NA 2CNBA 2OWDA 1S2MA 1FZQA 3EK2A 3BREA 4HX9A 2JAPA 3QE3A 4HWKA 4WFJA 3VKFA 4D3FA 1R10A 3AY6A 3P5SA 3G59A 4JJFA 1AQ6A 4K2AA 3RIMA 1NDHA 4ZO8A 1AZSC 3BXXA 1FS5A 4OVKA 1JH8A 1HLDA 3WXBA 3H3XA 4P83A 3G7NA 4OMFG 3K70B 1XMOB 1DOZA 1GO2A 3GYBA 1NW6A 1AT1A 2WWIA 1EP3B 3GUZA 4QYWA 4I19A 4KUGA 5ALFA 4CM7A 2QL9A 2QX6A 5KYXB 3H4VA 1U81A 2NUPA 3L7YA 5IHPA 1QO9A 1JA9A 4HGRA 4PGGA 4YCJA 3REOA 5JYBA 4QDJA 2XCTB 4N8DA 4AROA 3N7AA 3N8IA 2WTEA 1A9TA 1TKBA 5AKGA 1J9EA 2PGOA 5K8IA 4FNMA 2OAP1 3EPJA 1LRKA 2MINA 3DFMA 2IOHA 4NC9A 4P0TA 4R71A 3REFA 1YFKA 1M0SA 3HHPA 2FWRA 4A0SA 2QQ5A 4MUNA 3KT0A 1OFUA 2X1HA 2HSJA 3KQQA 5AVJA 4EKDA 1EGMB 2IOQA 3TW6A 5JAPA 2XGOA 3EUEA 4V0QA 3AMVA 2O8DB 4DNOA 2F3QA 4LHEA 5LNK6 1ISJA 3ZKWB 3TMAA 1DT5A 5ITSA 1RI4A 3E8XA 1XLVA 2Q4RA 1EXNA 5JASA 2WFLB 2QUZA 2ZYDA 2PH3A 4HFRA 4I8XA 2HWXA 4CI0B 1W29A 4CL2A 1VL8A 3V33A 4TL9A 1BNCA 2IUTA 5ERXA 3ONEA 4Y67A 5KSPA 5TGTA 1ILWA 3OLZA 3W6PA 3ZHXA 2GGSA 4QICA 4BP9A 3CVYA 2AYYA 5BV7A 4MW9A 3JQ9C 2BL4A 1Z13A 4FE7A 4M1KA 4MS4A 3PNMA 1C8BA 1D6JA 4NFSA 2QTZA 4KR2A 2XUPA 4ZQHA 1KHHA 3LVQE 3RC7A 1Y4ZA 2Q29A 3HXMA 2XMQA 2J6HA 5K05A 2VYQA 3ETCA 3ZXUB 5LKRA 1JHVA 2PWZA 4QRIA 3TSCA 3T9FA 1NYQA 1M2JA 2OHVA 3BFVA 2XVAA 4TKMA 3AZPA 2LTAA 1C9EA 3C1UA 4MGYR 3RVQA 1A98A 4FMPA 4FS3A 2IU0A 3ZXXA 3WFJA 2D13A 2XV1A 2XMGA 1R6AA 3N86A 4FBMA 2PUWA 3TEMA 1HL7A 2R00A 3ZJTA 1Z88A 4I3HA 2HCRA 4AJ9A 3TYXA 4DBVO 2C9BA 4QXPA 1BE8A 2MR6A 2WJZB 4FFBB 2ZULA 4NDNE 4WESA 1XXLA 1DRWA 1DKQA 2BFEA 5E7MA 4KTVE 5F2EA 4RENA 1ULBA 4RS3A 2CKMA 3I5UA 1L7QA 2ZLBA 4WXEA 3A9VA 4BWVA 2XUKA 4OP1A 4EUNA 2BJHA 4CKCB 3OKFA 2UXBB 5C3UA 2IV3A 4PG4A 2O3QA 2VJNA 3PYMA 5HS4A 1Q7RA 4NAVA 4EH1A 1DMRA 1XZEA 1FDWA 4UCXA 3ND6A 2A30A 3IQZA 2CXPA 4B74A 3VO2A 8OHMA 1TA0A 4RF3A 1F2TA 4G41A 1VIMA 4CV3A 3NVAA 4KO3S 4EF5A 1T5BA 5B1SA 1VIAA 2XA2A 1QBGA 1KI6A 4ZOBA 3HC7A 1FFAA 3SYKA 4PLPA 4AO6A 3MJSA 4KNWA 4CT4B 2FMIA 2I2XB 1WEHA 4G1FA 3OT1B 4EO7A 4YRRA 4UBMA 4A3SA 3P0FA 2FUNB 3F8WA 1M2EA 3GHYA 2W11A 3T5AA 2BMFA 3OCWA 1KRXA 2XKJE 1JB9A 4M3NA 3TLKA 2V7TA 2HWUA 4D99A 4U7FA 2IXBA 2L0XA 2QN9A 2CYCA 4R7ZA 4L8VA 3SQMA 4YUVA 3MS7A 3HN6A 4C2BA 5LYJF 4GRIA 4D25A 1XT6A 3HABA 1TDJA 1J0CA 4GS5A 2LKCA 4DIDA 3NIDB 3MWFA 3THOA 3OTGA 4QYSA 1NF2A 4YDHB 3IP9A 1YQQA 4X1KA 5HF5A 3BRQA 4MWBA 1US8B 4QUDA 4KQ6A 1VHLA 1UQUA 4RK1A 1E3SA 4UTXA 3ILHA 4EITA 2IGBA 3S8EA 2RE8A 4YLEA 1EX1A 5TQ2A 1KE1A 5B57C 4IMRA 4QA9A 1MTZA 5KNBD 3PGLA 5JJIA 4CIYA 2Z4TA 3KLBA 4HTAA 1EFPB 1FL9A 1V7QA 1XYYA 4KC0A 2QTCA 2IX9A 4JV5B 1DTWA 4B4OA 1XQ1A 3FFWA 4Q4HA 3DHEA 2H1SA 1NVWQ 2VK2A 3I01M 4EPXA 1XI2A 3S29A 4Y1RA 1ZGAA 1MAHA 2JW5A 1MU0A 1ZD1A 2RGWA 3BZWA 4WACA 5ALRA 1FMCA 2KHZA 1U3TA 3U4MA 5IT5A 5EKSA 5F4ZA 1FEZA 1FXWA 2H4WA 4H9GA 1FSFA 4A0HA 5LJIA 3A0UA 4BNYA 1U90A 4WXMA 2CT8A 3BCSA 1PSZA 3GRAA 4HDSA 5G1NA 5BUQA 4JJKA 1ADJA 7GPBA 1U0JA 3CLSC 4URUR 1RLTA 4YIKA 2XT0A 3F9RA 3L04A 2JLSA 1M5TA 3Q3GE 5AW5A 5F7XA 1DAIA 1NU8A 2GAFA 1V39A 4FHEA 4MA5A 4YUWA 2QLFA 1LDBA 4NBUA 3UVEA 1OF1A 3OHSX 4O02B 4DTCA 1EVZA 1BCRA 3GLIA 1ICEA 1Y9DA 3O4FA 4ZVNA 3ELYA 5B4TA 2Z6AA 2CFRA 4YRBA 3VHXB 4GC9A 2FK7A 2XZDA 2ZDHA 3FIUA 4BKPA 1FTSA 3PC7A 4EHLA 1NRWA 4K8OA 2A9JA 1MX3A 2NNLD 3JQ9A 3K0AA 1ESZA 5KJCA 3PLRA 3VOSA 2BSXA 1NLYA 3H5VA 5L53A 1ZVMA 3VZCA 2RKBA 5BQFA 1AXEA 3OP1A 3ZDXB 4FW8A 2DSTA 5EIAA 2ZYTX 3N7TA 4EY7A 2RAVA 2DJIA 3LSTA 4FJ2A 2J7PA 4WKBA 2QY6A 3VYRB 1GRQA 4J8PA 3TOSA 3KKMA 5DGIA 2AOUA 3ZHVA 4XA8A 1T8UA 1RYBA 3B9PA 3KDSE 2ZXEA 1TQ6A 1K6IA 3RLFA 1MLDA 2EFJA 3GAZA 2DPMA 4M89A 3QLUC 3JQQA 2DPGA 3OESA 2CLCX 4HQOA 4JP2A 1IUNA 3G1TA 4KB5A 4KO8A 4U7GA 4D8XA 3MUFA 1XQXA 3HLKA 2C4HA 2J07A 2J3IA 3CKMA 4I5GA 5C2JB 4QPPA 4LYGA 5BPHA 1V9LA 5K4GA 3H18A 3I5XA 3R9KA 1U99A 1YD7A 3FWZA 2RGNC 3IXQA 2O2YA 5ICGA 1CW2B 4I5IA 1ZQ1A 4F5WA 1XRSB 3A9SA 2GX6A 2F7SA 1EE1A 4LF8B 2PZMA 3CRZA 4KBFA 2BFBB 2V7EA 1PGPA 3AGPA 4J1NA 3R6TA 2B21A 1MV8A 2YASA 3JPWA 3NAQA 4ND3A 4UXHA 2KX7A 4Y0VA 1ZHHA 1U9YA 4W5RA 1MZVA 2A1TS 1MABB 5I8ZA 3CCCA 5T64A 3W9BA 4CKBA 3B13B 1GXSA 4OM7A 1YZYA 3IILA 5A02A 2XXJA 2GHQA 1PN3A 4NMMA 4OFZA 2VK8A 3WVNA 1Z2CA 4RGBA 2IXGA 5HXAA 3OSUA 3JCZA 4P81A 2XKAA 1RFGE 1TVCA 3H2JA 4ALKA 4CCAA 5FPKA 5L40A 4P58A 1U8UA 2Q3JA 3ZWXA 3MA0A 1RJEA 2OOSA 1FYEA 4PZYA 3A9RA 5L51A 1ECBA 1NAIA 4BMYA 2PUJA 4L16A 5SZIA 4AMYA 3EXEB 2YJ6A 4D9IA 3DE6X 4RTOA 3L8EA 3RFFA 2O7NA 3A1VA 4S2UA 1TIBA 3NUQA 2FPPA 4FFPA 3ZS8A 5K8VA 4U8HA 3H83A 5KNDD 3WGMA 1URPA 5FPHA 3TNJA 5AI0A 1CJUC 4NBTA 1GQOA 1KPIA 1LFDB 2B8WA 1N57A 4PXAA 3Q5DA 4K9MA 5BNIA 3RANA 1P0PA 2PA0A 3IEMA 3G1UA 2VJQA 4H7DA 5DEOA 3JZDA 4M8IA 1O97D 4J29A 3ZWYA 1K1EA 1OVGA 3FHJA 1FUEA 4L8YA 4D9CA 4LFAB 4ALLA 3NPAA 1XRJA 2BFCB 3Q15C 2QTWB 1G1MA 3CCBA 3N8HA 4QECA 2B2XA 3SBDA 4MX8A 1EVQA 3HMKA 4UE3S 5KCZA 3DXFA 3UGJA 4CCWA 3CNBA 4ZOCA 1QHFA 1A2BA 4PF1A 1POXA 4Y2HA 4X60A 3U7FB 4Z0HO 4B87A 3E7PA 4MMXB 1NVAA 1DJQA 4I9NA 3BGIA 3FPFA 1DJLA 4JBNA 2OAEA 4OREX 1O94C 2PNFA 5CVEA 3QELB 1ZUNA 5A0FA 5B6PA 1I51A 1T9HA 4ARBA 4DSZA 2ZPAA 5DYNA 3I62A 2IJGX 1DVRA 3AM3A 4MSUA 1G21A 2XUQA 2CMHA 4TMFA 2JFVA 4FKBA 1LQTA 1L8QA 1I7NA 3BOSA 3D8NA 1ZEMA 4UASA 1JKJB 4Y6LA 4MYDA 3UHOA 4DCVA 4DVGA 1IVSA 3ZH9B 3O73A 3ESYA 1XOIA 4XB2A 1JJ7A 3HA5A 3UUFA 4DCMA 1YBAA 1AQUA 1UT8A 3B3FA 4XR4A 1HFJA 3TG2A 1E3EA 1H5UA 2VUSA 2D3TA 3F6CA 1TJ3A 2ZIAA 2CD7A 3G23A 4ACAA 2NQ2C 1UBTS 1GPWB 2KLBA 3DVAB 1V16B 1Y4UA 1BTOA 1WW3A 2ZKLA 3OWHA 4KZKA 4PYMA 4UMFA 1AKQA 5AKXA 3COZA 4LJ9A 1YQTA 1CS4C 3IQEA 3M49A 1PGNA 4A23A 4XWOA 3OIVA 2R84A 2ZJ7A 3GPIA 3N8GA 1T3HA 1RXVA 1M8JA 1NN0A 4JLMA 1HDOA 1LD3A 3N58A 1TD1A 4MYTA 4BNMA 1PR9A 4BFZA 5HCUA 4M9XA 5CH3A 4XB1A 4Q3NA 3LDAA 2VRCD 3FNHA 2ODAA 3SDBA 3NHRA 1YZGA 4PWYA 4EYQA 2FR0A 5AVRA 3B8EA 3ROPA 1YXMA 3QLUA 3KVYA 1FSPA 3HRHA 2QZ9A 4OB6A 1VRWA 3NI2A 4OQMA 4H0NA 4Q3DA 5I51A 4DLLA 5F3WB 3SJCA 3ICQB 5DXAA 2QUIA 4OH7A 4DLAA 1DWOA 1P5ZB 4IIEA 2A4MA 1NFFA 3R0XA 4KI7A 3LMKA 2ZBFA 3CVOA 3WZMA 3HDYA 1TKRA 5I7WA 3IAXA 2GKSA 3CXRA 4IVRA 5F33A 4BXOA 4ZHQF 3SXUA 3AQ4A 1TQ4A 5C1IA 4H0FA 3KOOA 1GGVA 4FB5A 2CNKA 5H3HA 1GZUA 5CM2Z 5JNRA 4BU0A 5LBUA 1DX6A 1XAHA 4DHWA 4DA4A 3R5XA 2QD4A 2Z5GA 1TK3A 3DTVA 4UQPA 5I4BA 2XRYA 3TRFA 2JFOA 5K6TA 1B16A 4J9UE 1I32A 3DPIA 4IHAA 1QGYA 1ND6A 1WXIA 1CFZA 4X61A 2BM0A 4S04A 3VUEA 4E12A 3LFTA 3Q4GA 3D6TB 1U2DC 1ST2A 2CMKA 3DMGA 3V1TC 3TAXA 4CIBA 5LUAA 3C7KA 4DR4B 5CDGA 1EEXB 3L3BA 1MFPA 3IBFA 2AG8A 2HXGA 3F98A 4L4YA 3VZSA 1Z83A 3HI6A 4LTMA 3NMUF 3STWA 3IVRA 3KG2A 3H7AA 4PNZA 4RKEA 3MINB 3V80A 1VE9A 4LZLA 4YPOA 4QSMA 4JFRA 3UAZA 4RGQA 5CT6A 2YHBA 5BMVF 3DV2A 2R2GA 1IB6A 4YMVA 5ITWA 1Q57A 1ENPA 1UBOS 3LWDA 5K0EA 5K0GA 3DLAA 3UCXA 1VI5A 3N8NA 4IS3A 4GP7A 4E94A 1AX9A 5LMZA 4JXXA 3A4IA 2IX3A 4ESVA 3A2MA 2FMUA 4RCYA 4HEA1 4J90A 5EC8A 2DHDA 4X94A 4XOIA 2IY7A 1G5TA 1VBKA 4L02A 3X1YA 2W2LA 1Z9BA 2GKOA 2WTNA 2DE0X 5TNXA 4GXTA 2QMZA 2I4NA 2VYND 1LV8A 3OFNA 4DM4A 3GA5A 1NN5A 4Q47A 4QFBA 4J0EA 2QQGA 1QGUB 2WIFA 4H7PA 4Y18A 1R3DA 1Z62A 2O0JA 2IHBA 1L7BA 5DM1A 4ETMA 2CKDA 3S99A 1RIIA 1UFRA 1YFZA 1ZOOA 1T3LA 1VOTA 3DM5A 1E9BA 3IBYA 3IE2A 4M9SA 4YY3B 1L4UA 2Q5JA 1VGVA 4IMIB 5IUJC 3DBOB 4PGHA 1ZRSA 2OZLA 4QT0A 3B3JA 2AFHA 2WJPA 3LDFA 3QVSA 4Q1FA 2IHKA 2ODEA 4MUAA 3QX7A 3TGWA 2JDID 4BVHA 1WW8A 4QG3A 3AKZA 2C57A 2LCQA 4U6QA 5U1PA 3U7QB 3ZOZA 4W5OA 3SSMA 1X38A 2A1IA 2VLBA 3WNZA 4ACBA 5JSHA 2OA0A 1UMDA 5CIYA 3FOEC 3I05A 1IXKA 1DG3A 2R6JA 2VDUE 3MTBA 7YASA 2Y9PB 4W1PA 2RHTA 1D9ZA 1O94A 1T9DA 2NPOA 1A76A 2X9GA 5HUHA 1KK2A 1RLMA 3ZWDA 4XEUA 4NJMB 5JFTA 2FQWA 3WYNA 1N1EA 5FADA 1IN6A 1RP7A 4Y2GA 2HRZA 4G4SO 1QR2A 1WNTA 3ONNA 3IAFA 5AKEA 3FVWA 3UAWA 3Q7PA 1LLDA 2GJKA 2BEVB 4IOKA 1JH9A 3BQMB 4G0NA 3WZLA 1N6RA 2ZR7A 1C41A 3EEBA 3R1IA 4QE3A 3AIMA 2CHVA 2CXSA 5TEWA 5B64A 3N5KA 2B35A 4L5AA 1X2BA 4LJKA 4EQZA 3GPLA 3LX6A 3K1AA 2W6JA 3PGMA 4RJTA 2R7KA 2Z6QA 4GYKA 4ZPJA 4YAGA 1KYWA 3KAKA 3JD0A 3PUYA 1I9CA 1UFVA 3ANSA 4RTMA 5LWHA 1FYWA 1T2NA 3DAPA 1AOXA 5K3FB 5AVYA 2JVJA 4UATA 4B09A 1M74A 1MAAA 4J75A 4CTKA 1C81A 2EKZA 5BQXA 4TPKA 4MKZA 3AR4A 1CYEA 1IQRA 1GUFA 1D0VA 3TKYA 3O2JA 1T4GA 2B3DA 4AUKA 1L4EA 4TT8A 2QAGA 1JSXA 3DZCA 3OZSA 2YHAA 3WGQA 2QDXA 5EXTA 1MO4A 3ZJ4A 3FUUA 4JS0A 4A0GA 2OOKA 5DHFA 3WRXA 3EOAI 2FB9A 1Q22A 3L7JA 4QBGB 1MVOA 1FXSA 1T1SA 2ZSFA 3WB1A 1ORTA 1VKOA 5GOTA 8ADHA 4BWFB 4NZNA 2ORYA 1I3MA 3ICCA 4BLPA 1Y82A 4I50A 2OC4A 3OD5A 4AY6A 3EGDA 3AJAA 1N5KA 1PTJA 1CQJB 5EZSA 2DTEA 1LI5A 1B6TA 2DUMA 2O2IA 2QU8A 1RMQA 1EA5A 1KYQA 2WU8A 2YWHA 3EZ7A 1C9YA 4XUDA 3QTLA 5HF9A 4MXDA 2C8JA 1TNDA 4ZYWA 2FOLA 4XUEA 5JSYA 1ACJA 2D2EA 2KSQA 2IYZA 3PSHA 1KJJA 3BRCA 2C2YA 2W6QA 4BYMA 5EGNA 1HQYE 5EKTA 2Q1TA 2E4VA 1OOEA 3DGEC 3K8YA 1TO6A 3M6AA 3FLMA 3MQ2A 4LQ4A 4DLPA 5CCEA 3E5RA 4M1EA 3F5FA 4O4LF 1M2OA 3F5SA 4WGFA 3KSDO 4ZU3A 4PQRA 4Y2TA 1U2DA 3KJZA 3SS8A 4WFQA 2XITA 4IXDA 2AEFA 3L18A 1BMTA 3KQTA 1FTGA 4TTTS 3A6ZA 1FFXB 4X0EA 3OTOB 1EUZA 5J1SB 3AR3A 3K1YA 2Q7XA 3SZOA 4ZI3A 1DAGA 5FUMA 3TQHA 3NEJA 3WBFA 1WAMA 2WIJA 2YIVX 4MIOA 1R4ZA 3LP6A 3FKSA 1M2VA 1P0QA 3E8SA 4V03A 2P35A 1ZS9A 5LQAA 1FMTA 2JFQA 3W7VA 1QVRA 3EWSA 3EH2A 2BUCA 4R2KA 2OE2A 4JB3A 1SC6A 2AN5A 4JBYA 1KZ9A 2OP1A 2QM8A 3ELUA 2VP3A 4ZA2A 1SKAA 1N6NA 4ZHQA 1ZLYA 3A1CA 3LO8A 4BIMA 5E3HA 1E2KA 2R87A 5C7OO 1ZOIA 3BGVA 1DFIA 4II7A 4XAQA 4B3TB 1V6AA 3IL2A 4PZ0A 3FOZA 1USKA 2OBNA 3LF2A 4NOLA 2IEDA 1AHHA 3BF7A 3E27A 3TAHA 4FFWA 5EJEA 2X42A 3D8HA 1DKRA 4HZUA 4ZO4A 2DQYA 1FFHA 4F3NA 1ML4A 4J7XA 1MGOA 3HXPA 4HVCA 2VF7A 3TECE 2NVOA 3C5EA 2RGAA 4L7QA 2ZCVA 4GAEA 1Z3CA 1OYOA 2VP5A 3O21A 4LVCA 3UMCA 1T2CA 3ZXYA 1F14A 1MAUA 1P9LA 2GN4A 2GRJA 3COYA 3FPJA 3L1VA 2WTXA 3W7BA 1YVRA 1SIWA 2DUWA 2HWKA 2NSDA 2QRMA 1JECA 3PFGA 5C4IA 1F60A 3QUSA 1N36B 1C0EA 1MUUA 1W88B 4S12A 4UHKA 1CY0A 1WLSA 3ZHRA 2I4IA 5DM2A 2FJPA 3ADDA 4YALA 4YONB 4YXWD 5KOJB 3UKDA 4NMHA 4RTNA 2DBQA 3TCXB 4EFNA 1MEEA 3G5AA 2NSHA 3NBUA 1NIJA 2GPBA 3C3WA 1PJCA 5DSTA 3VH4A 4WCVA 2WSIA 1DJMA 5LQMA 5HIAA 3FKJA 5F1OA 3UB3A 3UF0A 2QLJA 1BQ4A 1SY7A 4RY0A 2R6HA 1II8A 3VKGA 1CUZA 4D56A 1XTBA 3R7BA 1U1EA 2VP9A 2XUGA 2GESA 2VIIA 2Q4EA 1F6BA 4ZMSA 2V4ZA 1F8GA 5EIHA 1CTQA 2OD9A 2CXOA 4XQGA 3DMNA 2YFKA 3L1UA 3BWMA 4R9NA 4ZT2A 2YMQA 2IK8A 3DBRB 1FDTA 2YNMD 4K1LA 1BQ3A 4KGXA 2FPIB 4DNPA 5D3ZA 3IE1A 1LS6A 3JAWB 1R0KA 3PC2A 1RAEA 4GP6A 2WRZA 4QOFA 1LSSA 3K16A 3ZY5A 2HR1A 4QGGA 3KV3O 3OKCA 1P5HA 1G2IA 1GQQA 4HQKA 4I5DA 3DKRA 1YCHA 1KFEB 1HDRA 1RLUA 2REQB 3A3KA 3LL7A 5COQA 2RD2A 1SBZA 2H5JA 2ORED 3H5LA 1A4IA 3HXLA 3IEXA 1J4AA 3R3WA 4LPKA 3PRYA 1P73A 1M10A 1E6UA 1KVTA 2Q07A 1VJDA 3Q6IA 2IU6A 3T4EA 2GF9A 1NLFA 1XU4A 5ALJA 4AXXA 2GD0A 7ADHA 1OPRA 4D3SA 4FLEA 5A0VA 1FYFA 1KK3A 3QPDA 4EHIA 3NTRA 1ADGA 3EQ2A 1TUGA 1VYUA 3C3YA 3QKSA 4AWXA 4Z7QB 3WISA 5GPBA 3F6EX 1X9GA 1WOMA 2ZSKA 1HSOA 1YWGO 2G1AA 2CXHA 1SXGA 2C8LA 2V8OA 2X8JB 4M83A 3GT0A 1JFRA 2X0KA 1O2DA 5F4BA 2PNJA 3UIEA 1XDBA 3FRHA 1WL8A 3PNPA 1YHYA 5AI6A 3TB6A 5L4LA 1XALA 5A6VA 1TZMA 2Y0BA 1V26A 4MHOA 1E9AA 1EP2B 1H22A 3EF1A 1J42A 4DUGD 1GNTA 1GQFA 2GWHA 4REQA 5C3MA 2AA3A 2TMDA 4BS9A 4G0WA 4KO1S 1DQSA 4TMZA 1OLSA 4EEKA 3MEQA 1I2DA 4S0XA 3AUSA 3TGLA 3B6MA 4JP3A 2ZBVA 1QRSA 3L49A 1KIMA 4LE1A 1NNI1 2HYDA 4LZZA 2CXNA 3DC2A 4ZAYA 2AG6A 3DW1X 2K2WA 5K2MA 3WYAA 4NZMA 3M33A 4IFBA 5CDFA 3OM0A 1E9RA 5EYPA 3TLCA 5DU2A 1LPAB 1BRTA 5I7SA 1YL5A 3OEYA 4OQQA 2PIAA 2BBTA 1KO5A 1TUBA 1DBQA 1NQ5A 2C5EA 2XHEA 5BXQC 2WNIA 1DKUA 5CBPA 2FZ4A 5H9WA 4BC0A 1K3UB 2WWRA 3FNBA 3OKPA 1XRQA 1MRNA 2HC9A 5B7QA 7REQB 3A36A 4ZEVA 3L0YA 3ZUPA 1N6OA 9ATCA 1X7DA 5KNBA 1RRMA 2NO9A 4G8BA 4Q3AA 2RBKA 2C2BA 4IHJF 1W35A 3ST7A 3UFBA 3MGAA 5EJ8A 2ZRKA 4LKRA 5BT9A 3SHWA 2W83A 4PINA 4YAKA 4U7DA 2BMJA 2FTKE 1GDHA 1WTCA 1O97C 3KJQA 2VH5R 3N05A 1KIAA 4JC8A 1NI4B 2OVFA 1QC5B 3L1HA 5FP0A 3HB4X 3N7UA 1SEVA 2C5FA 3HJBA 4ZOLB 4YLGA 4A26A 4DNFA 1UM9B 3LK6A 1T5OA 4MQFA 3KALA 4CF5A 4WBNF 1XRMA 1EVJA 3ZI7A 3SAJA 4ND1A 2JJ1D 2QTNA 4G0VA 4ARAA 1TK2A 3N8DA 4K88A 4OHWA 4R1PA 3TLXA 1ZI8A 1Z5VA 3I9V1 4AD8A 1BDHA 4M98A 2ZIEA 3W9YA 1JFTA 4N4AA 2I7TA 1EP1B 4A6PA 5T3YA 1FDRA 1EVIA 4JN6B 1MJGA 2XBUA 3DWFA 1PV1A 4I66A 3Q3CA 4YH1A 5IAEA 2PZJA 2P4EA 4FD3A 3AHEA 4HEHA 3ON5A 1OFTA 2MSEB 3NHSA 2Z3WA 1IHYA 5DYTA 4NRDA 4KR0A 4N47A 4YJ2A 5C5EA 1HFKA 1EDZA 2VBIA 2PSSA 2NSJA 2Y1LA 1WUHS 2YJZA 2ZS7A 3VNQA 2GTIA 2PMDA 4UW9A 1IRIA 2VQ3A 3STHA 1AZTA 2B8JA 2AR0A 5J43A 1PV4A 2O2GA 3TTUA 3ESAA 3ZWBA 3CKKA 1KI4A 3MQ4A 4XPIB 1CB7A 3DBLB 3WOHA 1T0HB 1TJ5A 4C20A 3LBHA 5ICCA 1MT0A 5IKXA 5JPDA 1Z5PA 5CEFA 3H0CA 5JZBA 1NMSA 2Q62A 4UZSA 4W7HA 6PFKA 5EVJA 4UTNA 3B7WA 1GR1A 1TD9A 1U6KA 4MQ4A 3PICA 3KJFA 4QVKA 5DH9A 4KOEC 1J90A 1T3SA 3WLLA 1WDKA 3GDOA 3ONFA 4BNDA 1KOGA 1OXUA 1GG5A 4Y2SA 2FRXA 2VJDA 4HVAA 2VF8A 1CIPA 1XWWA 3NXSA 1PFQA 1P0CA 3UJ8A 1DC5A 2L18A 4YACA 3I6ZA 1ZOLA 3WWYA 2R8EA 1CU1A 3B1KA 1QE3A 4PPQA 4WY2A 3UZUA 2WTBA 1BDJA 2D5LA 2VZ8A 4EHDA 5DE3A 1Y89A 5FPPA 3OCXA 3WO0A 1KOJA 4BFXA 2P30A 4HGYA 1Z4KA 4PC1A 1D1QA 3IIKA 3TM5A 1UT6A 2RAPA 1V1JA 3VAZA 3P71T 4E46A 5HKBA 5IXYA 2XGSA 2XW6A 6REQA 1PS8A 5IBRA 5MN4A 1WG8A 2RKWA 3AF5A 2GEFA 2IZ6A 3JARB 3R3UA 4HDNB 3RS9A 4BQNA 2CLKB 4MLDA 4PZEA 4YMUA 9LDTA 1DC8A 2AOTA 3L4BC 4AKGA 3UGKA 2GEVA 3DQZA 3OUTA 2BFWA 1D09A 2DPXA 4U2CA 1MJGM 3EMVA 4QVIA 3WJ1A 4YMGA 1VKNA 1K66A 5KTMA 2O19A 1NJ1A 1YT5A 4X20B 1F0YA 4CR6A 1DFGA 2JGIA 4MVYA 1ECJA 1OE0A 5IM5A 5TPWB 1LJ8A 3DOFA 4PC3A 1KAMA 3V8MA 5LD2C 5CBKA 4IKPA 1CDZA 3OBIA 2HA4A 4KQ1A 3N75A 4RK6A 5FD8A 1N2IA 1CDOA 3VR6H 4WLOA 3T7JA 1VBMA 1ICIA 1W4CA 3FVQA 1PEKE 3O4GA 4LHWA 4BBPA 1JVSA 2O4UX 3C48A 3VUFA 4IDCA 3BILA 4EW1A 5DK4A 3CVXA 1R4MB 4LYEA 3DHNA 2ZSEA 2CJXA 2DX7A 4XM2A 2OCDA 4K9PA 4JC0A 3KQWA 1WKVA 1V43A 4HXGA 4L73A 4LV8B 4PQFA 1GTZA 3VPFA 3ONDA 5D5HA 1J1IA 3TLMA 4LRYA 3U4GA 1P3JA 4TYWA 4ZC1A 1M34E 5F64A 2Q8PA 5AW3A 4WNYA 1UDAA 1BOFA 5IXJA 1B8NA 2COKA 2B98A 4IWXA 2A0UA 4GC5A 2ZZNA 1BCSA 1ZICA 1ZCJA 2NZWA 2DH5A 2R96A 1AY0A 3K09C 3NASA 3NDIA 4F85A 4JP1A 1NW9B 2OECA 2PRSA 1V8BA 4M9ZA 2VPTA 2XNDD 2FSGA 3AXSA 2FX2A 3VZDA 3VXKA 1F17A 2HLHA 3AHCA 1JDUA 2FPMA 5PGMA 1DTSA 1NLMA 4IO1A 2WMDA 4U0JA 1BHJA 4GX5A 2EYQA 4KN9S 5EWMA 1Y7PA 1DJNA 1OZFA 2FQQA 3OCZA 3TI9A 4L75A 1NQUA 1X7HA 4I4CA 1C7JA 4Q16A 4LK3A 4QQ8A 5FOSA 3O0DA 5HHTA 4TVOA 3AUYA 3MBKA 2F55A 1KDTA 1IN4A 3E18A 1ZA1A 2YXPX 4CN9A 3GFTA 2WU4A 2XTJA 3NANA 1DT3A 3HEMA 3R7DA 4Z3OA 4HH1A 5AHRA 3NU1A 4HS9A 1M5UA 5KNCD 4XUCA 1IU9A 3EAFA 3M3PA 1K92A 1Y80A 4R1QA 1XDWA 3VU9B 3R3SA 3LIIA 5GVRA 3FSJX 3K9WA 1PX0A 4L5IA 3THXA 4R2WA 1MG5A 1I4DD 3R6GA 1JE0A 3LFUA 1ULUA 4C3OB 2NO7A 2CK3A 2Q2OA 4RC9A 3C3DA 5HZGA 1KZHA 4J3NA 4Q4JB 1O7JA 1IQ0A 1LRJA 4IHJA 1YGYA 1VL0A 2XNCA 3RF7A 1XFAA 4DIKA 3UK0A 3EDMA 3VR5H 2ZT6A 3GT4A 4MV3A 4N5NA 5K51A 1U2RA 5GJWC 3WR5A 5D1NA 3UV6A 3WC4A 4KE6A 3U4IA 3WK8A 2IHJA 2MR5A 4FDMA 5DWVA 3SQWA 3RW9A 2JKVA 2VQSA 2V0NA 1XTTA 2V98A 4DDHA 4UOEA 4WBNA 5I7FA 4KREA 3ITKA 4YQYA 3CV3A 2DF8A 2ZT5A 4FC7A 1T5SA 2ZVDA 5C8YF 2D1QA 4V1CB 5HM8A 3KDPA 3HKBB 2HRDA 3PQDA 4KX5A 1UR5A 3ICPA 1ECCA 4I5EA 1QK5A 2VA9A 2ZU0C 3IQHX 4JI7B 3EC1A 1S4QA 2G0AA 2VRCA 5A0TA 4EJ2A 3LKDA 3AEZA 3FX2A 1U11A 1ULZA 2VVTA 2VDJA 3WV5A 1S9HA 1TAHA 2R86A 1V35A 2VFAA 3D6HA 2R7LA 3G13A 3N2ZB 3QBJA 4A10A 4EVIA 1VZ2A 2WJAA 3OE7D 1HORA 2V9PA 4TKUA 1XZHA 2VF2A 3PJFA 4FUQA 1L4YA 2C7VA 3AR9A 4LS3A 2P5TB 2W2TA 3CISA 4L0MA 4MCHA 4FP9A 3MSXA 1GPAA 1MRZA 2HPZA 2G8NA 1DADA 4L76A 3AK4A 4DA8A 2VJAA 2VWQA 3FCOA 2J6BA 1W85B 3LUAA 4EHBA 2CV0A 4P86A 1E9EA 3EXIA 4RDIA 3A3NA 4U5QA 2YOFA 2W2QA 3IB6A 3N70A 3OZAA 2EIXA 2G1KA 5KJ6A 1N92A 4JR2A 2BFOA 3QLJA 2XTZA 1QKIA 3L4BA 5LB4A 2Y8EA 1ZK4A 4QSHA 1LW7A 3PDCA 2BR4A 3QJ5A 5FTWA 5JMPA 3NJRA 3QFRA 4LVNA 4DR3B 2OV2A 1CR0A 5J2TB 1KMQA 1NHWA 4O08A 4FKZA 4HWOA 3WLJA 2UYGA 1N2BA 2C4UA 2WVGA 3EGXB 3KWFA 3CRQA 1JJBA 1NW3A 4IGAA 2GSDA 3O8NA 3JQRA 5GWXA 3X0DA 2O6LA 5G1PA 2OQIA 3AFOA 2ZS9A 3WTCA 5E6SA 4AM8A 2D62A 1KFCB 1P8JA 1YZLA 4XARA 1N4DA 2WHRA 2NVUB 5JQGF 1CRZA 1V96A 3V3TA 3AB7A 1JKMA 3KFLA 2KPOA 2VTDA 4TKVA 5ALDA 4ECAA 5ALNA 2KQUA 3HYTA 2ACKA 2QPOA 1QKJA 1P6QA 2HMVA 2AD5A 3KLNA 4P54A 2WZDA 1LBSA 1L6IA 4F3RA 1ESMA 3TRKA 1RMTA 1W5EA 1EZZA 1UBSB 4OD0A 5D2CA 4GLLA 4LY6A 5FT9A 1TTQB 1ZHFA 3A6LA 1W0JD 5JROA 4OFXA 3VR6A 1MZPA 4H1TA 4XGNA 4JUDX 3RYFA 1K98A 4EA9A 2YMMA 4QDOA 5EL0A 2FUEA 4IQGA 5I7VA 5HUQA 4GZMA 3N53A 4R68A 3EIOA 4Y9TA 1NHGA 4X64B 1JB1A 2V5AA 1H6AA 1NM5C 3P2IA 5TS2A 1F3LA 2R3SA 4PHFA 1YRAA 4LJ4A 4ZALA 2WP0A 5I9BA 4EENA 2Q2VA 1O5OA 5J1TB 2WYWA 3QPWA 2OO3A 5JO0A 3O31A 4ED9A 2AMJA 1JHMA 3L4EA 1H1DA 3H0KA 4C22A 4ALMA 3BA6A 4YDQA 3H2ZA 1UADA 3R8XA