5B7QA

Structures and functional analysis of periplasmic 5-methylthioadenosine/s-adenosylhomocysteine nucleosidase from aeromonas hydrophila
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
249
structure length
249
Chain Sequence
b'ASAPILIQGAMDVEVETLVAALKDKQELTVGSWTYWQGTLSGYPVVVSRTEVGLANAAAATTLAMERFQPRLVINQGTAGGHDPALHRGDIVIGTKSFNMGAYRSDLTPAEQGVDPSKWHNFEVTMRLRDNGKLVEHSSFAGDPELVGRALGMADRYRHGRVVPGIIGTADEWNRQVARINWLHQTYQTAAEEMETSSAALVAEAYKVPFVGIRVLSNTDLHGEEFDPQTAIHCQQFVIDYAKALINGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MTA/SAH nucleosidase
publication title Structural and Functional Analyses of Periplasmic 5'-Methylthioadenosine/S-Adenosylhomocysteine Nucleosidase from Aeromonas hydrophila.
pubmed doi rcsb
source organism Aeromonas hydrophila
molecule tags Hydrolase
total genus 87
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature ec 3.2.2.16: Methylthioadenosine nucleosidase.
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5b7qA00
1Y1QA 3INYA 4WKBA 1M73E 1ODKA 4L6IA 3QPBA 1OTYA 3NM5A 2QSUA 3DP9A 2Q7OE 1ODIA 4KN5A 3BGSA 2PGAA 3UAZA 1RYZA 1U1EA 1T0UA 3OCCA 1Z5NA 1A9OA 4YNBA 3DF9A 4TS9A 2A0YA 2I4TA 1PR4A 1Z37A 1JDTA 1A9TA 1RCTE 1PW7A 4TTAA 2QTGA 2GUWA 5F7OA 1LVUA 2B94A 4TXNA 1QE5A 4NY1A 1TCVA 4D8YA 3NBQA 1A9PA 2BSXA 5DK6A 1Z35A 3KU4A 3OPVA 1V2HE 4D98A 1YQQA 3K8OE 3LBAA 1YR3A 1U1CA 4L5YA 4TYMA 4R2XA 1T8YA 1PBNA 4TXLA 5F76A 3UAXA 1RFGE 1TCUA 3BL6A 1V41E 3MMSA 3FB1A 5FAKA 3UAVA 1YRYE 4MCHA 1JE0A 3KVRA 4F1WA 3MB8A 2XRFA 1V48A 5EUBA 3OZCA 5F73A 4DAEA 1PR0A 2RJ3A 1K3FA 3NM6B 3U40A 1B8OA 2ISCA 2QPLA 1B8NA 1Y1RA 3T94A 1PR2A 1Y1TA 1OTXA 3KVVA 5EPUA 1Q1GA 1Y1SA 4GMHA 3E9ZA 4NSNA 5F7ZA 1Z5PA 1YQUA 4P54A 5ETJA 3GB9A 5CCEA 3EMVA 5I3CA 4L0MA 5KB3A 4ECEA 2OC4A 2OC9A 1ODJA 3OZEA 3GGSA 3P0EA 1Y6QA 1Z34A 4LNHA 3KUKA 4OY3A 1NW4A 3ENZA 4WKNA 4DA8A 1WTAA 5IU6A 1JDSA 1OUMA 1V3QE 1LX7A 1ULBA 4BMZA 4DA0A 5CYFA 1T8RA 2AC7A 4R2WA 2I8AA 4TXMA 1RXYA 1VHJA 1RXUA 1CG6A 5IFKA 1OU4A 1XE3A 4OJTA 3PHBE 4WKPA 1ULAA 1JDUA 1RR6A 1NC1A 3KVYA 4DA7A 4OGLA 4F2WA 2OECA 1OV6A 2HRDA 3O6VA 5CXQA 1U1DA 3UAWA 4OEHA 1K27A 4G8JA 1V45E 3IEXA 4G89A 2AI2A 4EARA 1TD1A 1JDVA 2QTTA 4YJKA 5B7QA 3EUEA 4YMLA 5F7XA 5B7GA 3DPSA 1RT9A 3EEIA 1PWYE 4D8VA 2P4SA 2HWUA 5F78A 1LV8A 3O4VA 4E1VA 5CXSA 3FWPA 4TTIA 1N3IA 1VFNA 5JPCA 1ZL2A 2AI1A 4MCIA 4PNPA 3BJEA 4WKOA 3LA8A 5CYGA 4L5CA 4WKCA 3LGSA 1Z33A 1JP7A 4LZWA 1PR1A 4TTJA 4BMYA 1TGVA 1YBFA 3OF3A 1PKEA 4QASA 1SD1A 3FNQA 1Z38A 4OGKA 1U1GA 4LDNA 4QATA 4F2PA 4R31A 3TL6A 4EB8A 2A0WA 4X24A 3PNSA 4NS1A 4JOSA 1FXUA 3ONVA 2H8GA 5K1ZA 4UC0A 2ON6A 4G41A 1K9SA 1A69A 2HSWA 1C3XA 5C80A 3OOEA 3FOWA 3FAZA 5CCDA 4TS3A 1TGYA 3PNPA 4BMXA 3OZDA 4YO8A 1JPVA 3ODGA 1PR5A 1PK9A 2QDKA 3DDOA 4BN0A 4GLJA 4DANA 2AI3A 2HN9A 3BSFA 3PHCA 1CB0A 1U1FA 4F3KA 3KHSA 4F3CA 3SCZA 1G2OA 4D8XA 3E0QA 1ECPA 4IP0A 4RJ2A 1VHWA 1SD2A 4OF4A 3D1VA 3OOHA 4QAQA 4DAOA 1SQ6A 1Z36A 4L5AA 3C74A 1JDZA 1JYSA 4PR3A 1VMKA 5F7JA 1SJ9A 4DA6A 1RSZA 5EFOA 5F77A 2OXFA 4M7WA 3FUCA 1ODLA 4JWTA 4MARA 2A0XA 1Z39A 3NM4A 4QEZA 3UT6A 4LNAA 1NC3A 4DARA 1ZOSA 3DJFA 4U2KA 4M3NA 1V4NA 4TXHA 2IQ5A 4D9HA 3E9RA 1A9SA 1Y6RA 1PR6A 1Z5OA 1A9QA 4DABA 2A8YA 4GKAA 1RXCA 4FFSA 3IOMA 4I2VA 4JP5A 4QFBA 1T8WA 1PK7A 1OVGA 1T8SA 4M1EA 4K6OA 1A9RA 3OZBA 4TXJA 3UAYA 1JE1A 3F8WA 5B7NA 1PF7E 3P0FA 1I80A 5B7PA 3EUFA 4H1TA 3K8QA 4QARA 4GLFA 4LKRA 1RXSA
chains in the Genus database with same CATH superfamily
4MNTA 2YYAA 5E6SA 1ZA2A 4DLRA 4RIGA 3ZQKA 2UUOA 3DW1X 3QVUA 4WN3A 1NULA 4MGEA 2W11A 3AKCA 1O77A 1N6OA 2PO5A 2PZFA 1V35A 2J08A 2XUGA 1M73E 3O93A 4AQYB 5IT4A 3O3NB 5C5EA 3QPBA 1FZQA 3LRXA 1B15A 2GZAA 2YJGA 1SVUA 4INPA 5AI8A 4X7MA 3ZLBA 4B8ZA 3U9SA 4EZIA 3AG6A 3GWGA 1EXVA 1T1SA 3IT1A 2OBYA 4LRUA 5F64A 3QKTA 4OQ4A 3HCAA 2IVFA 1R6VA 3I2HA 4JEIA 3PR2B 1XRRA 2F48A 4K88A 2D54A 4IGKA 3NJ4A 4M0UA 4W1QA 2A1UB 1XZEA 3M7IA 2M9MA 4YN3A 3ZW9A 4YJ2B 5GADl 5AH0A 3Q6MA 1UWVA 3ZXIA 4HC4A 4M6WA 3WHPA 1NWCA 1WETA 2G9QA 4KAFA 2XBMA 4KTTE 4OI2A 3TW4A 3O8NA 3WBBA 1EK6A 1U0OC 3DSRA 4NBUA 1J8DA 1GU7A 2WY2D 3TNLA 5JJCA 1L7OA 2JKVA 4D43A 3L6CA 3D2LA 2H51A 4L4UA 4N5LA 4R9UC 1UKZA 1PR4A 3GA7A 4QUKA 3SNHA 1SCAA 3V8RA 2ARKA 4QO8A 4IVNA 3HKDB 4MRMB 1KO1A 3IMCA 2P90A 3AI1A 3WDMA 3VSEA 2AN9A 4X6XA 1QG6A 3PG5A 5AHWA 4EAAA 4HG2A 4RHYA 4EHJA 4QE3A 5TNXA 5KQRA 1VPDA 4YT5A 1GITA 1YR9A 2BZ1A 3FNBA 4K9NA 1G5IA 1B2RA 1E6MA 3ZY5A 1T4MA 5HFNA 1KU6A 1RJ9A 2IOQA 3H83A 3HRIA 2V7BA 3GZJA 3K4QA 2IF2A 3ND7A 4GEGA 4LNUB 5CK4A 5ADVA 1ZSVA 5C1IA 4KW7A 3TIIA 2HCJB 3G2NA 1ZR4A 4X65B 4OVKA 3S8EA 3RK1A 4BVAA 3DGFC 1DS6A 2WICA 2QXTA 3HSYA 1EFLA 1MEEA 3CINA 3TEFA 2NUPA 5KTSA 4HVAA 3WNZA 3LQQA 3ZXSA 4HATA 1N2CE 4OIFA 1IOZA 1M6NA 4M8NE 1E2EA 1GYPA 2WABA 3GRVA 5EZYA 1NBHA 2AFHE 1QIEA 4HNSA 4HY3A 1D6MA 2ZJ3A 4PC3A 4B40A 1U1CA 5MGBA 1C9DB 4TM7A 5CNJA 4NHEA 1WIWA 3BH7A 1UAYA 4HK4A 4UVIA 3GFBA 1P0CA 3UHFA 5TQ2B 1VPWA 4PO3X 5F76A 1UZUA 3LUPA 4FEAA 3GLIE 1I94B 3BKWA 3R4VA 4EJ0A 2V8OA 3MWEB 2FB9A 2Y8EA 4U2FA 3BL6A 4H60A 1JFTA 5GZ3A 1SCDA 2VS1A 4C87A 1Q17A 5KUTA 1Z68A 1KIFA 2EJWA 5JSUA 2GYUA 4DJFC 4AX8A 1TXGA 3KOUA 4JY7A 4NAVA 2O8BB 3B3FA 5K8LA 2ORYA 1NT2A 3OY7A 1DKOA 4QGBA 3TX6A 2XUOA 3UANA 2Q2OA 4DLBA 4KQMA 1M6VB 4C4XA 2Y2UA 4RW0A 5E6RB 1WTCA 3GD5A 5IDVA 3U44A 1EEXB 1XZIA 1CSEE 3H5OA 4RF5A 2PZAA 3CX3A 3EIOA 3FROA 2UXCB 3WG9A 4F1WA 4U3JB 1MCZA 1UDCA 4X95A 5ESXA 2D5AA 4TZ0A 1SU4A 4QDJA 2YFHA 2NIPA 2RH9B 3I1FA 3OZCA 5JSFA 1LDGA 2IHKA 2YOGA 1XTQA 5B2FA 1G3RA 1T0HB 3QXSA 3KJXA 5DLDA 1PR0A 4GVLA 4E03A 3RC7A 3IUEA 1H9CA 1UC4B 1G8JA 2HLDD 4BWYA 1A7UA 3L1HA 5AT1A 3H75A 3SE0A 1XKTA 1X70A 1EJ0A 4C20A 5GAJA 5T4BA 1KE2A 4Z3DA 4IX9A 4WY5A 1XGKA 2BV3A 1Y1TA 2ZR7A 4OQLA 4FWIB 3ND8A 5LWHA 1PZMA 3D7SA 4ZVRA 4FB5A 1Z63A 2OORA 2HIMA 4DG5A 5C5CA 3RYTC 4KO1S 2NSDA 3TLAA 1M8GA 2HO4A 4RL4A 3TR5A 2GKSA 8MHTA 4OOFA 4RH1A 3C6KA 1BOFA 1JHVA 2XYGA 3Q3CA 3BCHA 4XZ3A 2A30A 1R0YA 3DXXA 3GB9A 3MT7A 1GTZA 4X6YA 1KJ9A 5CCEA 1TVMA 2I76A 4XGIA 4WBSA 2FRDA 3LKZA 3N1UA 1XIVA 4MQFB 5G0TA 2PUTA 4EELA 2NO5A 4Z49A 1A98A 4TSFA 4MUXA 1IXRC 1JDJA 4ZYLA 2CVOA 2PRSA 2Q3FA 3C8UA 3F9RA 3OZEA 4RKEA 3I5AA 2ZWMA 2BRUA 4V1CA 3LIPA 4ND6A 5ULLA 3ZIDA 1SKQA 4D5EA 5HXAA 3RAEC 1Y6QA 3QSYA 2QVXX 5AVQA 4OJMX 2DYKA 1RJDA 3ML1A 3QUTA 2I33A 1N8NA 4YP6A 3UJAA 3OHPA 2AGVA 1YACA 2XBLA 4QQFA 3X1ZA 3OO0A 4QX6A 4CMIB 3ENZA 5LQDA 1HLPA 2LE0A 2DETA 2NO1A 3MC1A 1DE0A 2V9PA 2ZJ1A 1UM8A 4R0NA 4YYZA 2H85A 1R9NA 1M2EA 2EW2A 2C92A 4HEJA 4IJQA 4KVFA 5AKKA 1KNQA 3M6MD 4KN9S 5B3JA 3WLTA 4AM8A 4CM3A 4CUJA 3CJTA 3H65A 4R2WA 2SCUB 3BFJA 4FJ2A 3M34A 5I9MA 2BMDA 2AEMA 1X74A 4F9EA 4XGRA 2YTZA 3LOUA 2DXIA 3JTEA 4Z1OA 2WWWA 3CBGA 1UADA 4UVHA 2A1IA 1X19A 2WWXA 5THQA 4OXNA 1KI9A 1T15A 2H11A 5A4IS 4N7BA 4ZGGA 2AOUA 2G6BA 3LNTA 4OJTA 3NAZA 4P93A 4FHDA 2PUBA 3C4JA 1D8TA 3FWYA 3B6EA 1YB4A 1AKTA 2YVLA 3AKYA 1JS1X 3Q3IA 2DQ4A 4MVJG 4N6OA 2KE5A 1MAUA 4Z99A 5DYNA 4AURA 5EIXA 3GQBA 4NYJR 1FFBA 2ZTSA 4EG3A 4N47A 5KIAA 2BE7A 4WOCA 4LQLA 5ANRB 3VOBA 1N77A 4KGDA 4QRHA 5AW9A 4H18A 3P27A 1KL7A 3DWEX 1B16A 5K99A 2GVZC 1E2PA 4PBTA 4QPJC 1V45E 3AY3A 1SXGA 2O2ZA 2DE0X 4F92B 4FOPA 5AVSA 4G89A 1SIUA 4WLFA 2RK6A 3UOAB 4AZTA 1ENYA 2ZIUB 1EKXA 2H4YA 1IE3A 2LWIA 1Z0DA 2X4GA 3L8FA 4IH4A 4KR9A 2OHOA 1ADYA 4LDRA 9GPBA 3ELBA 4FYHA 1G19A 5JD3A 3FVQA 1CZNA 4ZFNA 2O8DB 3GLGA 1RBZA 4DLTA 2G83A 4RCZA 4PYQA 3K2EA 3T54A 3X1DA 3L01A 5EE1A 5CIWA 4D8VA 2D0DA 4DY6A 2P4SA 3GPIA 5JISA 3U1VA 4JI4B 1ZU5A 2FUNB 1EVQA 4KDFA 2GH1A 3VPSA 4B87A 3NKFA 4DCOA 2AQHA 2OM2A 4S05A 3HV2A 1P31A 3PC8C 4E1VA 1BQ4A 3EGOA 4TTIA 4YUAA 2P91A 5E7IA 1R0RE 3IDZA 2C4NA 2I6GA 2E18A 1M33A 4JI6B 4F93B 1W9MA 1RWWA 5CURA 4LSMA 1Y9ZA 1A8SA 1C4XA 4PR0A 2C9OA 2G1UA 5C1BA 2CHEA 4RVHA 1KZHA 1EP2B 1IM2A 1XEFA 2WJ4A 1NVVR 3BXHA 3GRAA 4L5CA 2F3UA 3L7YA 3T5DA 4XYBA 4OK6A 1YZUA 3B1YA 2PX8A 3B5JA 3O9MA 4YRQA 4EEZA 2HH9A 4MA0A 1DIGA 4AECA 4JJEA 2PUEA 2JDIA 2D2IA 2HKIA 3E7DA 5CVVA 2W6PA 2JVIA 2YVAA 3NHUA 4RA6B 2GPSA 1FNMA 3AJDA 1KDPA 2GBCA 2P2SA 4I7EA 4RK7A 2VNSA 3L8CA 2HPVA 3OCJA 1VHDA 3F6YA 3PDUA 4AP9A 1ST2A 3QEMB 5M2QA 2W2LD 1YDEA 3LX8A 4QASA 2VHUA 5L4NA 3UMJA 3W5HA 4YBRA 4RE6A 4GGOA 4M8SA 4B35A 2JFGA 2ZIWB 1WZUA 5EJ9A 4UU1A 4DLVA 3ZTWA 5T67A 4BEWA 1G18A 1E2IA 2YXPX 1QGUB 4DRZA 2OZKA 2QQFA 1U02A 1KEKA 2HQRA 3E3OA 4TZ6A 2ZATA 4X41A 2X7XA 4IX1A 2ACWA 4L51A 1E9AA 1NLYA 3ONVA 9ATCA 1JDBC 2Q6IA 3CZ5A 3MK31 2B8WA 4JQSA 4D4MA 3J81k 3FOAA 3HTXA 3F5DA 3G2LA 4U0KA 1KJ8A 1LSUA 4FU0A 4I36A 4X93A 1IU9A 1P5JA 4QU9A 2FU5C 3IUNA 4DJDC 2Q3EA 4PYRA 2BKUA 3FOWA 4XWWA 4UVDA 4YASA 1NLUA 2BGTA 3G85A 1QBGA 4IH9A 5M7EA 2RCNA 4G09A 4DWWA 3GLFA 4AG5A 2QZSA 1WZNA 1ZHHA 4NH0A 1ADCA 1ULZA 2EFCB 2GETA 2EZUA 2IPOA 1N6HA 3O82A 4RPJA 5E6SB 4EHNA 1CY4A 1X87A 3HUDA 3GQVA 4JOCA 1F20A 4S1VA 3T1QA 1P2VA 1T5SA 1VBFA 1JJFA 1UK7A 1WG8A 2HV9A 3HCBA 3IQHX 3ND9A 3R6DA 1RYBA 1YBMA 1XNQB 2FSHA 4RHUA 3OJXA 1FVXA 16PKA 2ZWIA 2V6FA 2H2GA 1S3IA 2RBKA 3ISTA 3OEHD 5IN5A 4DXDA 2QM7A 2O6HA 3RQIA 1X14A 3QEAZ 1CEEA 3BQNB 3G2IA 1QF9A 4MPRA 2NOAA 3DO6A 1Q2XA 2WEKA 4H15A 4AN4A 2YIJA 3I52A 3W3ZB 3MLEA 4EJMA 3UMGA 4L0DA 1PZHA 4LOIA 3DS8A 4FVTA 2PMEA 1AS0A 3R75A 3RUDA 3STVA 4DMCA 1PQYA 1HORA 2JBAA 3MG9A 4OKSA 1L7BA 2Q45A 3O8QA 5T4FA 3H3XA 3N8HA 4M6WB 4CG1A 2NQ2C 1C7FA 3KSZO 1A71A 2ZRQA 3OMLA 1NN3A 4OF4A 4Z3OA 2XXAB 3CFYA 3GHYA 5CITA 1P0QA 3UENA 1V47A 1G38A 1CR1A 4QBTA 1RM0A 3ZW7A 2PA0A 4HWOA 2VQEB 3AIOA 3RARA 3W06A 3MMXA 1NU6A 1SQ6A 3A10A 4YDHB 3FWKA 5HYVA 2D8AA 1X1SA 1R12A 4N4AA 3QFFA 1CEXA 3MWLA 4US0R 2WJWA 1VL6A 4UXHA 1R66A 2X1VA 3H1TA 2QTFA 3KEOA 4EEKA 4R2MA 3Q8MA 1WU7A 2FN8A 2WF6A 5ENDA 1WUJS 2YZ7A 4I81A 2PUAA 4HAZA 1GKUB 3TBKA 1F9AA 3WLFA 3LO5A 3IMKA 2C8LA 2OWDA 4I50A 2O48X 4JP1A 4BY9E 1QH9A 1QRAA 1JPUA 3FPFA 3Q2KA 1RJ9B 4JJGA 3R3UA 3RASA 3IV6A 2FI1A 4P33A 2CJYA 4P32A 3RTGA 2VPIA 3UC5A 5AKXA 4HQFA 5CBPB 4PGHA 3FUCA 1Z07A 3L6BA 1Z0UA 2V6JA 3R7FA 2I1QA 4KFSA 3W5JA 2NUPB 1F14A 1P5HA 3IOCA 3X2EA 4M9ZA 3H9EO 1EM8A 2HK8A 4C21A 3E9YA 4QEZA 2PH1A 2ODNA 2J5RA 5EZYB 4CKZA 1M7GA 1A0OA 4F46A 3LFUA 3RU7A 1P2BA 4BNGA 3OBBA 1LGYA 2DG2A 4RZXA 1HV8A 1HFWA 1OBOA 1GD1O 2OVBA 4PFQA 4UCQA 2B5VA 3QF7A 5BN5B 4KP7A 3SJCA 3T9CA 1JG3A 2I65A 2KQUA 3A1CA 4JCCA 3THSA 4GWLA 3GAZA 2HMSA 4HXYA 5DYWA 3C3XA 4PPYA 2L69A 3RU9A 1XJCA 1Z2PX 3ZR4B 1EFRA 2JFYA 5HKKA 2G04A 4BNVA 2IQ5A 1DDIA 2VT3A 4X63A 2ZIZA 1XWWA 2CVQA 4OQQA 3OQOA 3N2KB 3I61A 1Y6RA 2OMEA 5GZ6A 2DT8A 5JNWA 3NORA 4J2TA 1WCYA 2LVBA 3DAGA 1P1JA 4TSRA 2CXOA 1ZLYA 3RYIA 4JXKA 3TZKA 3QYJA 1L5MA 4BDTA 3G0HA 2WA1A 5JCJA 2WWGA 3PRYA 3LYUA 4KC0A 4P38A 4J43A 1EG7A 2N75A 4DMUB 3U44B 1Q6YA 1NQTA 2J0SA 4KWHA 1Q3KA 2HA4A 1TUBB 2WD9A 3BSSA 4LYGA 1CB7A 4D9KA 5LLTA 1P77A 1QLJA 1R5OA 4IHJF 3DZHA 4NCHA 4NNOA 2FPSA 3MWYW 4JGBA 3RJ9A 3IOMA 3DE2X 1UAGA 3HCRA 2EBWA 3JQAA 4R8SA 4UE2A 4HV4A 5BNWA 1V39A 2F62A 3PC8A 4RK6A 4NE7A 3R7DA 4URUR 4C3ZA 5CFZA 5HRUA 3KPYA 2XQVA 3FZEA 2QTBA 4PSAA 4EWLA 4MA4A 1K66A 3OP4A 2WLSA 1XNGA 2RHBA 5L4SA 5JMOA 1QHHB 1A9RA 2GFIA 3OOYA 3H2YA 1T5OA 2VH5R 2W98A 4M0KA 2RHGB 1BXRA 2SECE 3GUHA 3UA4A 3QM1A 3G5LA 1BN6A 5CD9A 5CVTA 3SQWA 4YALA 2PL1A 1Y48E 5IANA 3WGTA 2V7WA 4LYYA 2H0QA 1XZJA 2GJ4A 2IL1A 1BSVA 4ERNA 3AY7A 1OR8A 1ZK1A 2FKAA 1C9MA 4BWFB 3C7AA 3ZHBA 2X2OA 3TYXA 4BAZA 6AT1A 2DHDA 1KJYA 5HM8A 1SN7A 3I45A 3VH2A 3UMCA 1O4WA 3FYHA 1GPAA 1RMYA 1JQEA 2Z43A 2FEKA 2ONKA 3ZCQA 4XH9B 2NYRA 1GZ7A 2Y92A 4GZ5A 5ALMA 4CKEB 2BKAA 3F8SA 5K8TA 3T1HB 3K5WA 4YONB 4ZK6A 1L9KA 2MYPA 1HRKA 3AV3A 2QN1A 3DM9B 2DFPA 4V1CB 1BWRA 3HDYA 2A5YB 1B6RA 1OJ7A 1VC2A 2XVMA 4D82A 3BAZA 2XB2A 2BCJQ 1UODA 1HYGA 4TPKA 1XZLA 1Z83A 1K0FA 2P1RA 2A3RA 2WJZB 3EZ9A 4EGAA 2D0PB 1NXVA 2P2NA 3BJIC 4G1VA 1X1CA 4O25A 2CB0A 2Y9MB 5GY7A 3ZZ0A 4P2BA 5E0OA 1NQOA 2VTEA 2JKYA 1T35A 3A3OA 3V42A 1AMUA 5FV7A 4YNBA 1HMPA 4EGSA 2UXDB 3OJLA 5NULA 1W1WA 1KJQA 1O0CA 4H6PA 2Q7XA 5TGZA 1UKBA 3IB3A 5A7FA 2I4TA 3VDMA 4PSCA 3U61B 3B3AA 3AI3A 5AI5A 4IR7A 2IWHA 3HGMA 4TV8F 2EYQA 5AKGA 4PGGA 2AN1A 5E1OA 4M0EA 4EY7A 3WL4A 3ESBA 1KQGA 4A2CA 1OBHA 1Y3HA 2RK4A 1WABA 1PW7A 1Z0AA 1E60A 1T9ZA 3V1NA 4YAFA 3H9QA 1PFQA 3BCRA 2XQKA 3H8WA 3EOAI 1NR1A 4C06A 1P8JA 3ZCRA 2Z98A 1DHRA 2FWIA 1O87A 3BBLA 4UJ3A 1FDUA 4CKCA 1JHPA 1TU3A 4CCWA 4D8YA 1TW3A 3KV1A 5DN6D 2QM0A 4C9BA 2WF7A 5BSEA 1U0NA 1JU9A 3V3KA 1TTPB 5C3MA 4ZI7A 4E22A 4R6XA 4YPOA 1KMQA 1XD2A 2BDEA 2CYCA 2DPYA 2WU3A 3ABOB 3KLPX 4ZXPA 4BNHA 3OQPA 5KVSA 1YQQA 2WYIA 5KOIA 1TT7A 2VXCA 1CZLA 2HMTA 1Y8RB 5E0KB 3STYA 1NAHA 2O57A 2IOFA 1EBFA 2HWWA 2BMJA 4FC6A 2OHXA 5C2JB 2PIDA 3SU8A 4D3XA 3FB4A 4DUGA 3NFRA 1Z2CA 2AR7A 1K8ZB 3IE0A 4P83A 1CQIA 2HWXA 1E98A 2I03A 4J7AA 5G0WA 4JYMA 4P3NA 5IG2A 3LP6A 2OWEA 2QR3A 3H84A 4DNFA 3R7SA 1JJAA 4CE6A 2VNIA 2BM9A 3DG9A 2UZAA 3QA3E 3UQZA 4Y2PA 1XAHA 4CEHB 4DSTA 3VOTA 4MV7A 4JUDX 4W5OA 4ZYXA 1RXWA 2FOXA 1L6RA 2EHDA 3JQ9C 4ES6A 1BWQA 1Z4MA 1R50A 3MW8A 2ONJA 3JWGA 4G1CA 4ODIA 1DC6A 1NVDA 3NAGA 4OLHA 1DJOA 2ZRAA 2PV0A 1LI7A 3R41A 1H2EA 1WF3A 4N5NA 1R6AA 4MCHA 4AVYA 3K2IA 3TI7A 5DULA 3KZOA 1SFRA 1HXHA 3OE7A 5EIAA 3WTBA 3KE8A 1CUFA 1SCNE 3AEUA 2VZEA 1S0UA 3EZYA 2ZSHA 2WHYA 1CZKA 1UDRA 2DPLA 3U40A 3V8BA 4OU5A 4FJ1A 5EA2A 1I30A 2VT2A 4B7AA 1R0WA 2IZ7A 5CLIA 2ZYWX 4ZQIA 5LMUB 1JWAB 2A1TR 4HL6A 1AZLA 4CN8A 4TRRA 1M8PA 5DM0A 1Y1RA 3KYDA 5KO2A 3PK0A 2FF7A 3ZC3A 4UAJA 4LUCA 1L5HA 1OI3A 2AW5A 2VWGA 1AB5A 3N87A 3V8PA 4A1FA 1NUSA 2QVYX 1NU8A 2EJCA 1R8JA 3OAAA 4CRWB 2D00A 4NBSA 4X0EA 1XQ1A 4OA5A 4EHAA 2B1JA 1TD9A 4D79A 2DOKA 2GF9A 3BJRA 3BXZA 4DYDA 3RADC 2G09A 1PNOA 2J6CA 4Q4JB 5J2TA 3ZIAD 4GBMA 1F4LA 1GPUA 2K7ZA 4BKQA 3FNIA 3A9VA 3JD3A 5I3CA 2IOHA 3IH5A 3TTUA 2CBZA 2HPZA 1RTTA 4RLFA 3MGCA 1GQRA 4FYXA 1Z6TA 3B85A 3UWOA 2EIHA 1LB1B 3GGSA 3HA3A 2H3HA 4WGGA 4CMBA 2KI5A 2AZDA 2ACKA 5JS1A 3O4RA 3LMKA 1NVXQ 2QHXA 2WHRA 2YCBA 5DHRA 1F48A 2G1KA 2YN2A 1AXEA 3A4YA 4P81A 1CUIA 1P6QA 4DKXA 1CZRA 3DNPA 3PT5A 2VNAA 3O4HA 4KPUA 3C3AA 3ZX5A 1KDRA 2AHOA 4YRIA 1H8ED 5G4LA 1TEZA 1MB3A 2XR1A 5EIWA 1C7JA 2F4NA 4B85A 1GL9B 4AZ3A 3UWDA 1M6YA 2PLAA 2VHJA 4BWVA 3VDQA 2FDRA 4EUFA 1LS6A 4PWZA 2QRMA 3OLQA 3CGGA 5JZSA 1ADFA 3PE3A 5ALTA 3JQPA 5K01A 1E18A 3BF7A 1X0VA 2Q6TA 3CUKA 4F7DA 2NAFA 3ABIA 4B6EA 3T4UA 1U5BA 4N76A 3DKIA 1L7EA 3KZ1E 5HBGA 3B9BA 1VI2A 3HJBA 5LQCA 4E2YA 1HEIA 1J0BA 3MJ4A 3I30X 2DUWA 3E81A 1UIMA 2JBAB 4IJ6A 3Q8XB 2NTEA 3O8QB 4DILA 3KAKA 2A3NA 3DA8A 3OE4A 3F6BX 1G8AA 4OV6B 4MVJF 4B82A 1KH3A 3M4ZA 1DRJA 2BMFA 3OFND 4HMQA 4ALIA 4GKJB 3LCCA 3BWMA 2WMNB 4XGQA 4N39A 1T0IA 4FPXA 5IDYA 3RIMA 3TLJA 1I33A 2GUGA 3CN9A 1Q0ZA 3N5KA 2XWPA 4MWZA 4AY3A 1KBZA 3IEXA 2GFHA 2CLIB 3BILA 1CDOA 5CDTA 3F5FA 1EFDN 5IJ0A 4W6QA 3D54D 4O02B 1E9FA 5BW8A 3FIJA 4HEHA 4Q7LA 5BV7A 2FV8A 5A1TA 4JQOA 4N1AA 1PNVA 2I2WA 5T64A 1HEUA 1FW8A 1PGPA 2AD5A 1NW8A 4JFRA 5DHTA 3A05A 4MMYB 3GCGA 2AJDA 2W6ID 3SYMA 1U2DA 4DC0A 3I6ZA 1YTLA 1K92A 2ZITA 3LD9A 1M8KA 2VPQA 4FE4A 4K03A 4V2UA 1T36A 3I12A 5IVHA 4TRMA 3S0JA 3V8NA 3VR1A 1GAXA 2XMZA 1ARZA 4JVMA 4NENB 4WHMA 4CIWA 2AG6A 4NEGA 1UT6A 1VCHA 5SV2A 2FW6A 4N0PA 2H5JA 4JITA 5JADA 1UXIA 3M9LA 4JMPA 2I62A 3G7UA 5EJ8A 2PU7A 1AQNA 4ARUA 4B2PA 3JYPA 4X97A 3JWHA 1H1TA 1RYFA 3QU5A 3MLAA 3R6GA 1N3IA 3GCXA 1EM8B 1WXGA 4Y2TA 3P2JA 1VRWA 1B8PA 1MXFA 2QE6A 4ZDWA 3SP1A 5DWDA 2C42A 3CSDA 3ER6A 1XK6A 3FCUB 1E6WA 3G8YA 4KMRA 1NJ5A 5T4HA 2VO1A 3W4KA 3K6JA 1L5RA 1QRUA 1V5GA 4A9AA 2RONA 5CLJA 2JBWA 3O90A 3M5DA 4RWEA 3FN4A 4Y2VA 3HXQA 1MH1A 4YXWD 1UEIA 5LMCA 1Y7TA 1CY2A 1PR1A 4LVOA 4COKA 2Q1UA 1KA9H 4NYIR 4R0MA 2ZDGA 5LUAA 5LU8A 4G8BA 3VOSA 1ZICA 5CTJA 1C8BA 2KS6A 5K0SA 4PSUA 4Q15A 4ZCRA 4HFRA 4KXXA 4PG4A 3LOQA 1EGVB 4Q39A 3KEQA 1NW6A 1QCYA 3RYIB 1PKEA 3OX2A 3CW8X 3D0KA 3FKSA 4YAUA 1XQ9A 3THWB 1AT1A 3FNQA 4GZ6A 2BDUA 2RD2A 4HADA 1BC5A 3JS5A 4BLWA 4OGKA 2W2KB 1U1GA 2FR0A 3K1TA 5G4KA 3JQAB 3DR3A 4D7AA 3ERCA 1UKAA 3T1VA 2VPTA 3I4CA 3EB9A 3ELYA 4EHHA 5F98A 2H6EA 1SELA 2E6KA 2JIBA 3Q7TA 1D2RA 5AM4A 2GESA 2VSYA 1UPTA 2A4KA 2GZRA 2RKWA 3DMFA 2QD4A 3HL0A 1E62A 3LK7A 4RK1A 4Y2QA 2CDBA 1SU6A 5DBHX 5E1MA 1B0UA 2JGDA 3N76A 3T5TA 4ABYA 1F8UA 4MSUA 3BA1A 4EPVA 5JD6A 2QBYA 4RPCA 2C1ZA 3DMDA 1WE2A 2CCJA 1IHUA 3H0CA 3NHKA 2V6GA 4AXBA 4D74A 3D5QA 3UWKA 3IIEA 1U7DA 1ZOLA 1V7ZA 1UMCA 2NPIA 3DEFA 4B3TB 2NYAA 2ZIXA 5A9TA 1OD6A 2JLUA 4P6VF 4OQZA 1XXLA 1NNI1 3INNA 1ZM9A 2C78A 2JA1A 1QGAA 4TS3A 3SXJA 1T4BA 1B2LA 3HP4A 3RBZA 1LPOA 1LRJA 1NUPA 1XNHA 2JVKA 3EDQA 3JD0A 3UQYS 5EE9A 3V7FA 4QWWA 3ZNOA 2NVUA 1VYHA 4EATA 3HLKA 4BFYA 2I78A 4C07A 4DXAA 1GZ4A 3GG9A 1FL9A 3BXGA 4XARA 3T1TA 4WZZA 4Q4CA 3TN7A 3ZIAA 4KAAA 4DR7B 5BR8B 1A1VA 1G8GA 2D13A 2TRSB 3K8YA 2WTBA 1Y6JA 3E27A 2V7XA 4GMKA 2X5NA 1P7YA 3ZHCA 2JLBA 3O4FA 2BTQA 3D7NA 3DL2A 2DH6A 1YCDA 3SR4A 3EVGA 5JCPA 3IB6A 1I1OA 4U02A 3F7MA 3IRVA 4XUCA 1M6EX 1NJFA 4LXUA 2OV2A 4GXRA 1EJ2A 3N2NA 1BGWA 4R3UC 5LCXA 4ND8A 2PD6A 3CNHA 2I3ZA 3G0BA 5DLYA 1VRCA 4JKIA 1NE7A 1H3FA 4G0NA 4GYJA 5LZ8A 1SHLA 2PUWA 4Q7JB 3T3GA 2RG7A 3QX3A 1LBHA 1QC5A 1GPYA 2F1HA 1ZITA 2B20A 3SEFA 3O8LA 1JSRA 4PHGA 4UPVA 4CLRA 2G9ZA 4B3IA 3RSLA 4CV1A 1ZRHA 3STWA 1JIKA 1YIOA 2PS0A 2Z2IA 3TB6A 3W8RA 1H2FA 2VYFA 2YNMD 1W9HA 3QMWA 1JSXA 4HZIA 5G41A 3VR2D 4E32A 4ZJUA 3T5MA 2YJ5A 5TT1A 4NR0A 1LV7A 1GPJA 4K6MA 3ENVA 2FMXA 3STTA 3MF4A 1SIBE 5JJBA 5AP9A 4MWDA 5LPNA 4UHDA 1RKBA 3HXTA 2QSZA 2GEJA 2QRZA 3QY0A 3SJBA 1E0KA 3N0TA 2P5YA 4N49A 4P58A 2P2ZA 1I4DD 1RAAA 4HMPA 4IQ8A 5DLEA 4CKCB 1DKRA 5EN4A 3EARA 1W19A 3RH0A 3VI3B 1P91A 2WVJA 4DVJA 4UU8A 4FGJA 4EY3A 3T4PA 4KG7A 4ZI7B 1U11A 1FFWA 4B76A 4BVHA 1KRHA 1ZM7A 2C4MA 2PWYA 4FI3F 4LXIA 4A6PA 5KQSA 3VZRA 4I46A 3PC2A 4MVYA 1RWKA 1T0PA 1XD2B 2JJ2A 3W4IA 1G98A 1W44A 4KAXA 4H1VA 4C0WA 4IS3A 3TK1A 1J2TA 3CUYA 2DHEA 2NXEA 1GCAA 4KQWA 4RYDA 2ZBRA 4KNWA 3U4IA 1PG2A 1R00A 1KI2A 2BGMA 3FMGA 4JOBA 2NPFA 7REQA 1M5RA 3AJEA 1UDWA 1CNFA 2HOQA 3AUJB 2RGAA 2AC4A 2JFNA 1QQ5A 1ZN7A 4IL5A 3FTNA 3WMEA 1U4OA 4JWKA 1XF1A 2XT9A 2H1CA 2I55A 3H4TA 2VBIA 2ZIGA 2V6MA 3KJZA 4QYXA 3VMMA 3F3YA 3MTJA 3K9FC 5I9IA 1WHSA 3MTAA 3HBNA 1T3ZA 1E69A 5TQJA 1HE4A 2VTKA 4CHTA 1OXMA 5I4BA 2YY7A 2G9RA 4WE3A 4B83A 4FCTA 3ZLVA 3GLTA 5L3VA 4OHPA 2ZRIA 5TEWA 3EULA 2LZ0A 1NP3A 1P1KA 2OXTA 5LQKA 4FFSA 1Z4NA 3AU9A 3O3OB 1R8YA 4LSZA 4O2LA 2Q2NA 1NJ1A 1G0NA 1K88A 3OJCA 2DWOA 2EX4A 3K15A 2X0DA 5DTJA 3EAQA 3WGHA 4ER7A 2P4EA 2PKQP 4MO2A 2GJ9A 1EDEA 3WFZA 3PDIA 4RK0A 1EDDA 1ZIXA 4LDAA 3TWOA 1M0SA 5IVKA 1OYWA 3Q6NA 1QIFA 4QU5A 1ADJA 4RTLA 1HDYA 4TT8A 1GYQA 2C77A 1L4NA 3DFMA 4AB1A 1YI8A 2EF1A 5JZMA 1HUQA 1L5HB 4KE6A 1BW9A 4WY8A 5DBOA 4A8HA 5KOJA 5B7PA 5LR6A 2Q5OA 2I6QA 5ILOA 2EFJA 2VDUE 5C1DA 4FM9A 4KTVE 3F7OA 1X80B 3DEHA 3F71A 3FHLA 1L5NA 3N2EA 4DCCA 3V4LA 1UEJA 2B4TO 1D7AA 2BJWA 1PU2A 4UZFA 3VXKA 5KZMB 3C6MA 3I72A 1VYVA 2R84A 1XQ6A 4U7PB 4WKBA 1Z17A 2GB4A 4ALNA 1XYYA 4DB4A 3HBMA 2GPWA 1XC7A 3INTA 4RIHA 1Z0SA 2VJQA 1SXJD 1R6DA 1MRSA 1Y80A 2Q28A 3QIAA 4Y9SA 3W79A 5KJFA 5LQNA 4RDCA 4FTWA 2ODPA 5AJYA 5I45A 3LX4A 3NM5A 4MWEA 3K09C 2J3JA 3RTCA 3IAEA 3DTVA 2J32A 1W6UA 5EJ6A 1MPXA 1ORHA 2QN8A 3GZNA 3WWCA 3COJA 1FP1D 2CFRA 4XKJA 3A2LA 3IJEB 1EJ6A 2IHZA 4JBNA 5DT9A 1I10A 4HEQA 5FBHA 3O95A 2P68A 5B1EA 4JJZA 3C6QA 1FFGA 3IKLA 4EY6A 2HJWA 4CL2A 3KD3A 5CB4F 3V1YA 4YREA 1Z5NA 3CF2A 4KPUB 3S2YA 4BNXA 1OH7A 4KXVA 2JLVA 1YA4A 3KJEA 1YUMA 4NVRA 1P9LA 3VR0A 1E58A 4IJMA 2O3TA 3EXEA 4NRDA 3TAUA 1OXBB 3F1LA 1YNSA 4II2A 4AZ3B 2OXEA 1P4AA 4S1OA 1PJAA 3QJYA 3WQBA 3TJMA 1C7QA 3WP0A 4RKRA 2PS9A 3Q5EA 2H63A 1SVNA 2FZVA 2X40A 1JDTA 1RCTE 1U5BB 1UOPA 2QUJA 4TUYF 5CYPA 4ZCQA 1UFOA 3AUUA 1PIWA 3OIYA 1ZLXA 2PGIA 2R8EA 3FVVA 2KSQA 4I66A 5A5VA 3JTMA 4AO6A 4CEIB 3OIFA 3MRSA 4FE7A 1KI4A 3RU3A 2JRCA 3HO8A 1ZHOA 4DA4A 4HZGA 2B94A 4U6NA 1XVVA 1RWOA 3B12A 3R7LA 3S44A 3IPCA 2G40A 4Q00A 1FC0A 2QQEA 2VAMA 2ZSDA 1MB2A 1KS2A 3VDNB 1Z35A 1UBNA 1A4RA 1J0XO 2NZ8A 4W5TA 1E1LA 3GI1A 3BS4A 2YWJA 1ILWA 2VLBA 2YN4A 1P2UA 4D46A 4E5DA 2UUCB 2IYAA 3IQFA 4N01A 1V11B 1NPDA 4NU6A 4DFDA 5DM70 1RVV1 2TYSB 3GZTB 5E3HA 5DM1A 1CHDA 1HX7A 1KZ6A 2ZLBA 3Q2OA 4MYDA 2ZWVA 4D92A 3WP1B 1SKBA 5F12A 3NHBA 1T36B 1TQ6A 4IYRA 5BMVA 2PKEA 1E3WA 3A3YA 3JALA 3GBPA 3L49A 3LO8A 2AOWA 3RFXA 5HJEA 2HY7A 1QRRA 3B38A 4WAUA 2FUCA 2IP2A 4GSLA 2VBFA 1I7SB 2RJNA 4NG4A 4MQ6A 3QU4A 4WZBA 4QPPA 4HQLA 3PQ2A 3ZWVA 4PN7A 4X1OA 2CJWA 1U3VA 1DO8A 2WINI 1L7VC 1VJRA 1YZQA 3CCBA 3CG4A 1TZBA 3A4VA 3GCWA 1EFHA 2XA2A 3QLVC 4L4YA 4NCKA 4WLOA 4GQIA 4WN9A 3ND6A 2E5FA 2CL6X 3E9MA 4J8PA 2XGGA 3KQHA 1ADBA 1E7QA 1OCEA 3HVIA 3ZHUA 4HN2A 2ZUDA 4BVJA 1AZTA 2AEFA 4K2AA 1UJ2A 3AOGA 1AK2A 2NZUG 4WUTA 1CU1A 3FDZA 5HIIA 1JFRA 2Z8YA 3EMKA 4LG1A 4V0RA 4UBIA 4KWIA 1EBUA 2I8LA 4A0QA 1K3FA 3B78A 3AJRA 3VO1A 3U9LA 4DCSA 3GGPA 1RQ2A 1X7ZA 1DIBA 2OE2A 3DPUA 4M1OA 4KAJA 1LBSA 4XI9A 3BZUA 3N7TA 5G02A 4ZYTA 4ZTUB 2X77A 3HR8A 3QLUC 1P0FA 4ZOLA 2FNAA 1A9XA 5E3JA 4DIEA 1PR2A 4PFKA 1TLFA 3A6LA 3LZDA 2GJ8A 5AM5A 3QWIA 4K6FA 4G5QA 2A0UA 1CUJA 1GT6A 5KNBA 1XLTC 5G4KB 3GDWA 1AKVA 3WNVA 4ZYZA 3V4ZA 3O2NA 2PNJA 3OLWA 4Q1FA 1Z7YA 2NSHA 5EGSA 3E3MA 4GYKA 3BKXA 1U9CA 2QQGA 5L6MB 1RCFA 1UPBA 3KCNA 3Q7RA 5EKXA 5C8XA 1N5MA 5IKXA 2QTLA 2WP0A 4WDQA 2JGDB 2HB6A 3AV0B 2FSPA 3DMNA 1GSOA 3KUXA 2UUBB 2QBYB 1IG3A 3IAS1 3PSHA 5CPFA 3EHDA 3V6LA 2DY0A 4EY5A 5T7BA 4H3KB 1A5TA 2ES4A 1KAEA 1JIJA 3JYLA 2PT7A 3TGPA 1P44A 2Y93A 4U5QA 3USES 3I64A 2NXCA 2Y1KA 3VR6A 2V3CC 1UMCB 1DO2A 2ZIXB 3I9OA 4XWGA 1COWD 2A1TS 5IYZB 5HP4A 2FFRA 2VTBA 1XZMA 2H0RA 1IEVA 1DCFA 4RCYA 4CIXA 4WKNA 1C9KA 4ISCA 5F9FA 1SVWA 1D2CA 2ZTLA 5MN6A 4QZVA 4QUBA 2PJDA 3EZ6A 3CIFA 1JR3A 3WQHA 5A2QA 1ORTA 1C9JA 3C6XA 4RA9A 4YRJA 3W7VA 4MVWA 5I9LA 3RUHA 3IAHA 3JATA 3R3YA 1L8XA 1QIKA 4PONA 2KLHA 4D9MA 4TYYA 4NC9A 2CCGA 1KVRA 5TVKA 4QUHA 1ISGA 4AYXA 3X3HA 3PCRB 2NYVA 3R0VA 4J0EA 1KXZA 3HJRA 3CNQS 4AKTA 1PJTA 2A57A 1GUZA 1OAOC 3IAUA 1E66A 3JR7A 2BTQB 3W7AA 3WFJA 4B34A 5FUQA 5GTDA 1JDUA 2HF2A 1NC1A 1SC4A 4C3VA 4CM9A 2HJHA 2B99A 3IE2A 3Q7SA 3L8EA 1ZQ1A 3C48A 4HT3B 4BU0A 3RVBA 3K9WA 3TTXA 1R5NA 1KNXA 3CKYA 4ND8B 3TFQA 2EQ5A 1QGOA 3C5HA 1WCV1 1Z82A 2GRJA 3L7LA 1OFHA 2V7QA 3F49S 4X44A 2G80A 4RU1A 1H8HD 1QC5B 4PBSA 3KJIA 3STHA 2Q29A 3GGCA 2XTAA 3L1VA 4YUVA 4CLRB 1XEWY 3O7WA 4IVQA 3X44A 2XOEA 4IO1A 1CQJA 3SDBA 3RVPA 3VBEA 4FDMA 2GNPA 5KNCH 4XLLA 4Q02A 5SY6A 4RM3A 1YXMA 1XL0A 5CFPA 3V32A 1O5IA 5C8VA 4WASA 4OHWA 4ZVKA 1NSFA 3I01M 3DPSA 2LKCA 2PLRA 1WXEA 1RT9A 3HN7A 3EXAA 5TJHA 3ZD8A 3FY4A 4HGPA 3T1YB 4RKYA 2QN6A 3QPCA 4JJ7A 1VP3A 4QU8A 1DAGA 4DQUA 5JFGA 5AXDA 3QOYA 5JV5A 2IBTA 5HTKA 3LGXA 1DKLA 3C87A 2YV5A 3SIRA 4ZAXA 4NOLA 2WM2A 3AC0A 3MTEA 5AKLA 5HDBB 5DP1A 2QLJA 2Y1EA 1LU9A 1TZCA 1DWUA 3A1SA 4QFDA 3HBFA 3VAYA 3GGJA 2NZJA 3ITDA 4LC9A 4NI5A 2GMWA 3CUVA 2GNAA 4GGMX 1IULA 1JFVA 1X1DA 4UE6A 4WKOA 3OQNA 1O94C 3MJVA 1DTSA 3YASA 5FI1B 4LBZA 4QNMA 2M32A 3LPLA 2H2AA 2ZVQX 3WC4A 2C7RA 4FZVA 2J5XA 4E5VA 3D6HA 2XNCA 3EXHC 3M3PA 2A5DA 3EG9A 3R3JA 4Z2AA 1KJIA 1M34E 3OESA 4WK6A 3HYTA 3RKSA 3RUAA 1O8BA 4E4RA 2J7PD 3AFGA 3SSAA 3MRTA 4F5YA 2XA1A 1UC5B 4RXMA 3GVCA 4IZHA 4DV0B 2C5EA 4NK4A 4P8RA 3ZHYA 3PBKA 2WF8A 4OKNA 3WGNA 2W0SA 1MG5A 1S2NA 3FGPA 4E11A 3OZXA 3GGDA 4CNQA 4KLZA 3ICVA 1EK1A 3LI2A 1RQGA 1E8MA 3AVTA 1Z75A 4L75A 5H5JA 1CY8A 2CZCA 1UXKA 3H87A 2ZM5A 1W0KA 3ISJA 1JIUA 3UA3A 4D44A 4A2WA 2ODTX 3TZ6A 3Q8KA 1ZC4A 5F52A 5M04A 1RLUA 3AF5A 3IXLA 2RI0A 1QP7A 4NQRA 2C9CA 3NAQA 3EASA 4EJSC 1OILA 5GONB 1SCBA 5LA6F 3SD7A 2IGTA 3ANLA 3PDIB 4J3NA 2R47A 2ZB2A 1NYLA 5H82A 3VKUA 4BX0A 5A06A 4ATNA 1F3LA 1X1EA 1TO2E 4KCGA 1SUFA 4ZICA 1C5KA 4K3VA 4L7QA 4HNVA 3ZZMA 3U4GA 4DMGA 3G2JA 3CE6A 1NVGA 3H4IA 5KOJB 2Z6QA 3X1JA 1SBHA 2GT1A 2GK6A 4L8WB 5K3AA 3KT3A 1UOOA 2DUJA 4LFAB 1UINA 4A5OA 3GMDA 1PZEA 5CCDA 1OZFA 5FNVF 3X1MA 2Q99A 1GG5A 4M37A 4JK3A 2QVCA 2ZAIA 4ZIRA 5EIEA 4KV7A 3RSSA 3ZH9B 4LDPA 3QLUA 3TXAA 4QEKA 1PDWA 3FUWA 1NWHA 4H4DA 3OX4A 1TKCA 1XTIA 1Y7IA 2FZEA 1NUTA 2M98A 2OMKA 4OMDA 3IMGA 4QWMA 5JNSA 3THXA 4REMA 4DWJA 1XLTA 2GYYA 1T43A 2D62A 1D6JA 5HF8A 5C18A 3PHCA 3U4AA 2E89A 1QO0A 2X22A 1U1FA 3ZOKA 2EJUA 3R9IA 3DTVB 4QYTA 3QMMA 3GZNB 1W1IA 2HL6A 3CEPB 3NIBA 4QSHA 3GV0A 4KQ1A 3PUKA 3W1EA 4BNTA 5JRDS 3IKMB 1CFJA 1QRSA 3JQBC 2XYHA 4IP0A 1GFWA 1A8IA 3ZDDA 4B4UA 4F4FA 3C3DA 3KXDA 3PJDA 3WS7A 3U09A 2H8KA 3VISA 1WMAA 1XSEA 4XVRA 2BHRA 2FMKA 4FBLA 3T3PB 1XVAA 4E6PA 2EF0A 4I1OA 4CDGA 1PQPA 2C99A 2SKDA 2WE7A 5FOVA 4UM9B 4R16A 2IYWA 5DWQA 1GGEA 4NDNE 4CLXA 1Z22A 1I3CA 5A0TA 4ZN6A 3BZBA 2W2QA 1O03A 1B14A 4WLNA 2NO4A 2IEYA 4CPDA 5JFTA 2XZDA 2HRBA 3RF7A 4W5HA 3TOXA 3GEIA 4WINA 2GPBA 2ZRJA 2BFAA 3M4YA 3VO2A 4J7UA 4UEKA 1X77A 5JAQA 3SVTA 1S8OA 2RAPA 2B61A 3FRJA 2YQ4A 2QVZX 2RHCA 2H9YA 3SFTA 3R74A 3TIVA 4BO7A 2IPXA 721PA 1QIDA 2IZ0A 3DLPX 2MINB 2G1JA 1VZ2A 2ZPAA 1PNTA 4XUDA 1PDOA 4FXOA 4TT3A 5JS2A 2JCYA 4JP2A 5D1HA 2QRKA 1R4MA 4EJFA 5CU7A 2IH5A 1E3TA 1VIDA 5IAAA 2ESRA 4LHVA 2O0LA 4MS3A 3IBFA 5DGHA 3WYCA 4YY3B 4RD1A 4BO8A 1OAOA 3B48A 1GCUA 3ESYA 1M2JA 3PEEA 5AKEA 2WSYB 4B7CA 4ZVUA 5K0LA 3C7DB 2JAOA 4ALMA 4YT4A 3GJQA 3S2SA 1V43A 3SK0A 4WJLA 2IYLD 2II6A 1J9ZA 2P9TA 1JI3A 1D9ZA 3K2BA 1IUOA 1ENOA 3U5ZB 4BASA 1P7VA 2N46A 5JFOA 6PFKA 1SZCA 1OAAA 2P6UA 3CJQA 3DEJA 2IHJA 4LGYA 1SRRA 4WBNF 1NF3A 2AJLI 1EWKA 2OTCA 3JALB 4K0RA 5BMVB 3I9JA 1CRQA 1T29A 4TV9A 5DHPA 1T3SA 1EZ1A 2M2IA 1GGMA 3P5SA 1JEYB 1SUPA 4JROA 3EEBA 1L1QA 4LHZA 1KMCA 5H0IA 1K6EA 1CRZA 4FYYA 4D9HA 3JYOA 4EL5A 2NM0A 1KRXA 4XDZA 1LLFA 1LY1A 2P6OA 3IUMA 1ISSA 1U99A 4WOBA 2P78A 4CCAA 3LY5A 4H08A 4EVIA 3PKZA 4X1YA 5FO0A 3KT0A 2ZZNA 1RWVA 1XA0A 3L9WA 3GG2A 3PX2A 1W7AA 2J9GA 2NX2A 3FBGA 1PJCA 1U0SY 1HYHA 3A06A 4NCBA 2OXCA 4G3XA 3QI2A 2VNHA 3JVEA 1DRKA 4FFWA 3BC1A 4MH0R 4MR7A 4ZO6A 5JI2E 3IUQA 1GTSA 1Z12A 4IIGA 1QWOA 1NVWQ 3R5HA 5KQPA 2WV7A 3DLTA 3NWBA 2BEWB 2LIVA 3H0EA 5T6BA 2IUEA 3EZGA 3CWQA 2Y0CA 4NJMA 3ONDA 3SOPA 3TPCA 2R6CA 4CFYA 1ITZA 3NEPX 4FIDA 4TYPA 1SXQA 5IJ9B 1I7QB 2WSBA 5BN4A 1NTOA 3NNSA 4JHLA 1ZK4A 2UVDA 3OZRA 3UAYA 2NU7A 3HUTA 1C7ZA 1A9XB 1WV1A 3DEAA 3IIKA 4FGLA 4FYKA 4XM2A 3NC4A 1IY0A 1A1SA 1KKMA 1S4MA 3AP2A 4P4NA 3LY9A 5EMMA 1LXCA 1Y89A 4M0PA 4S2EA 2V0GA 3GJSA 4L2IB 1MW9X 1YR6A 5IDXA 4MKRA 1KP2A 4W1PA 3ZCSA 3A04A 3BDIA 3FDXA 4FT4A 4OM7A 3WYNA 4JLKA 1KZGB 2VP5A 1RPAA 3PC7A 5CBKA 1LK0A 2GLXA 2IEDA 2VDLB 2C9BA 3A26A 4ZYYA 3MVEA 3I8SA 3EGCA 3WWOA 2BFDA 4DDUA 2XEXA 1H6DA 2PMFA 4O4JA 5KWJA 2BGLA 3T7KA 3V4OA 1PT9A 1N6KA 3JAWA 3IR6A 3D7RA 2V4MA 4D99A 5EYPB 3GD7A 2Q7OE 4M21A 1SKMA 4GOXA 4CXMA 4WFQA 3NNDA 5EOVA 5KS2A 2H7XA 2VTBB 4BZZA 3KKEA 2VHEA 4PY2A 5KHLB 1QDLB 3B9QA 1SG9A 3OQHA 3CZCA 1XLWA 3PGLA 4FMDF 2FMHA 2UYCA 1A9OA 4RA9B 2ADOA 1L8QA 2PIAA 3DD5A 4BVBA 3JATB 1FLVA 1TZKA 5EESA 4B9EA 2Q1SA 4WQMA 2H1SA 2XECA 2WBLC 4KZPA 4NBRA 4RK5A 2Z2JA 1GZ6A 3K0CC 3GRRA 1GGNA 1V6CA 3FVRA 3BRWA 3LX6A 3V7NA 1T5BA 4BZXA 4OHMA 5L6LB 3JQ8A 2VYCA 4E5SA 2YMLA 3KZVA 5CB6A 2PNFA 1GZHB 1I6KA 4AG6A 5DCLA 4UM5A 6REQB 1R4AA 2ZUTA 4GMDA 2QTGA 3BRCA 1FP6A 2XADA 4IOJA 2IPLA 1TJPB 2Q3JA 3RG8A 2PWAA 5FWDA 3DDSA 4MW9A 1BVHA 1TQHA 3N9IA 4IHJA 3AFNA 4LJAA 2LNDA 3ON5A 4N8SA 4KVGA 3GVIA 5ERGB 3QKIA 2OSVA 3KE9A 1BD4A 4YAOA 2ZRBA 2H2HA 1CQJB 1QE3A 4LE2A 3DO8A 4X91A 1TCCA 3P2OA 3JQBA 3RLFA 1UBCA 2FUG6 4F11A 1K08A 3NANA 3V4FA 1XPUA 5DEOA 2WNIA 4IF4A 4GKKB 2HA0A 2V7VA 3E82A 4MKGA 4R3WA 1E2MA 3MD9A 4HUQA 4NOKA 1OC2A 3AVWA 1MX5A 1Y5RA 3A3NA 3FIUA 2EKQA 1YRBA 3DQZA 3Q3EA 3FF1A 4UBMA 2QIPA 2WYHA 1GZUA 1ZIDA 1P62B 1YQTA 4EFMA 4XPZA 4OHOA 1I3MA 5JS7A 1TQDA 4NS4A 4URYR 1FQJA 2C7GA 2IYUA 3FETA 4LCEA 5DW3A 3VNSA 2CMHA 2QQ0A 3G8DA 1EFVA 3F47A 4W5NA 2V6BA 1JILA 3A9CA 3DV9A 5IAJA 1P39A 5LC1A 2FXVA 3DV0A 4JELA 4KRYA 1H1DA 1W94A 4PGFA 3MUNA 2C8JA 2YJ6A 3CMCO 1J5XA 4QYWA 4JENA 4U6QA 1SPXA 3SZGA 5K6RA 4AQ7A 5IF9A 1XMSA 1TT5A 5JAOA 3WKEA 3TUJC 3TZHA 4DLYA 5AI9A 5IKOA 4C0KA 1TAQA 5EMLA 1EXDA 2E37A 3T06B 3EG9B 4GEKA 3LUGA 4HGOA 5TIIA 1HKUA 9MHTA 4POAA 1GQQA 2G8LA 5BYAA 2VYQA 4YDQA 1GPH1 1E4EA 3L7JA 4RGQA 4UTVA 2AWNA 1FDIA 3K3PA 1N2SA 2CE2X 2X3UA 1IY8A 4P53A 1AK1A 2RDMA 2NU6B 2Z2YA 2Z8YM 1Q5PA 2O23A 3L1JA 4G26A 3IURA 1FDOA 3TDKA 1KJJA 2RSLA 3GEGA 1BE8A 3U4HA 1OXVA 1U8CB 2Q0HA 2NLOA 4NU8X 2XMGA 3CLRC 2B7BA 1ZJ6A 2JAWA 5HCNA 3TKLA 3TVTA 4B4VA 1IBSA 4EITA 3KDPA 3IX7A 4EG0A 1E9VA 2H59A 4RTMA 1HURA 3D3WA 1YJXA 2EW8A 3WE7A 3KAJA 2R6JA 4YDSA 3EHEA 4Z7OB 1QVAA 4PFSA 3IFSA 4KDEA 1L4LA 5IH7A 2O06A 2WQZA 4BPBA 3OD5A 2QX6A 1Y6GA 4DBVO 1WP4A 3LVFO 3VC7A 1GCGA 4XASA 1R0ZA 1VE1A 4N7JA 3B7PA 3TQRA 4QREA 3KM0A 1IN8A 1Q3TA 2FQQA 5K4AA 3TSWA 4W7IA 4G1BA 3V2GA 5LN1A 4EG1A 1GNPA 4FBMA 1P5ZB 3DMGA 2JBHA 4P0TA 4OMUA 4DJTA 2NGRA 1KARA 5KJ6A 5KYWA 1MOQA 4P31A 2M6SA 2OB1A 4YXFA 3V97A 1YU9A 3G2PA 3JASA 2WT9A 2JAHA 4MV9A 4HNTA 3DL7A 1MABA 4RORA 1E5LA 1XQXA 2QAGA 4QPNA 2ZUVA 4ZIRB 4BLSA 3M5WA 4RZIA 4GPTA 2VT6A 3FX2A 4EG8A 2JFOA 4GFDA 4YC7A 4MQEA 1PL6A 4BQSA 1NPTO 1WDTA 3IAM6 2H1WA 3LT0A 1ULBA 4DA0A 4U2GA 5F5NA 1DFHA 1KS9A 5BSKA 2C31A 4KKXB 1SOVA 3N6RA 2BBTA 3THXB 1Y8AA 4R1SA 2I67A 2I4RA 1Z18A 1TVCA 5B3KA 3W2EA 2YJ3A 1CG6A 1SVOA 2X0JA 3DEZA 4PAQA 2X3YA 4Y1GA 3H3JA 3W7BA 3D5TA 5K05A 2IV3A 2AMVA 3G0OA 2ZRDA 4YHHB 1T1IA 3DB1A 4YYEA 2YRFA 4YWHA 3WB2A 4DEYA 5IJ9A 2RGCA 2ILTA 4I4IA 4KBGA 2OCLA 3E4CA 5H4HA 1VSVA 2DF8A 5FOUA 2QX9A 1FUYB 1IB0A 1SH7A 2IS4A 4EHKA 1EE9A 2P9CA 1V3TA 4OGLA 1DLIA 2IIVA 1ZWKA 5REQA 3K4PA 5CX1A 4Z7JA 4ZO4A 5A6SA 5JW6A 5AK5A 1NF9A 4Y18A 2JGNA 4Z7NB 2ETXA 1HM5A 2YWDA 3W2HA 4BQNA 3UAWA 1RZRA 4J94A 1O97C 4TVSA 1ZKMA 1WXDA 4YJDA 2IIBA 1Q1AA 2HJVA 2M6RA 3L40A 3L43A 4DWVA 4EHDA 2YV1A 1AKYA 3BAFA 3PXXA 2GJSA 4X5OA 4EARA 1D4FA 1S3GA 4RV9A 3U7IA 4NEHB 4H31A 3SQOA 2OL4A 5F4BA 4EYKA 1K3UB 3OO1A 4R9VA 3NP7A 2XKBA 2HDOA 1XRJA 4LHXA 4B6PA 3ZZNA 5DM60 4BUCA 4O5OA 5AVYA 3I8OA 3LZCA 4G8DA 4ZAGA 4JYZA 3FTEA 2FSIA 1OIWA 1IUPA 2H4XA 3AFOA 1PL7A 5JVDF 1H22A 3RBXA 1H66A 3EBOA 3QH4A 1IRIA 5F23A 2I7VA 2VBCA 1T2UA 1R4MB 1EVJA 4DJ5X 3K0CA 3KTOA 3F6PA 4L9SA 4MS3B 2VK4A 3ILHA 2O2SA 3NU1A 1L5ZA 1IN4A 2VF2A 1G5RA 2FVXA 3DF7A 3FVTA 3PRHA 5EMNA 1M1XB 5EG5A 4IIJA 2DBQA 2PXHA 3E1SA 5TEVA 1XPRA 2OG2A 3VR3D 2OHFA 4W63A 4DEXA 4ZP1A 3EC7A 3D7MA 1D2HA 4YAIA 2OLJA 3CW9A 5JPCA 1H2XA 1PTJC 3DDHA 2VA8A 1IY9A 3WHKA 3GN2A 4JKOA 4O4HF 2OHVA 3GOHA 1UJNA 1UQTA 1XKLA 3LYLA 4I5IA 5FHRA 1OYOA 4HOYA 1FDTA 4P3KA 3S2IA 4KH1A 1Z74A 2WC1A 2W8ZA 2Y05A 1BX0A 3RWBA 3DJYA 4EJ2A 2CV1A 1ODTC 1T4CA 3PPIA 2O14A 1IZZA 5TY0A 5FQOA 1DQSA 2Z6AA 5FOWA 2I9KA 2O3RA 1IB6A 3Q6IA 3O2SB 2RHWA 4FR2A 5EGNA 3L8DA 4B4DA 1VYUA 2X2FA 3DZFA 2CKDA 1LI5A 3OF3A 4TZTA 4B45A 4W9MC 1V5FA 1HDCA 3QVJA 2CV2A 2ZYAA 4IDNA 3JQ7A 3WA6A 2XLCA 2A9PA 3FCOA 2SICE 1E99A 4X1YB 4XD7A 1YC2A 3FGNA 5JYBA 2EARA 5CLQA 5B3LA 1Z13A 2FLKA 2Q5CA 5HIJA 4MR7B 4UEOA 2ZDQA 4DE5A 3DLBA 1QMPA 4HBGA 4YRDA 4EPYA 4QGSA 1U0BB 3TL6A 5K9ZA 2JIZA 3HVJA 2VPXA 3HZZA 1K63A 1Q7TA 1WA5A 3OCVA 4FS3A 1IQRA 4MLPA 1OASA 5IAEA 2E21A 2IYFA 1R6TA 4HLCA 1SZJG 1E96A 4F5EA 3STUA 2NUBA 4WESA 1FXUA 2GXUA 2QEQA 2XVXA 5JY1A 5CVUA 3LSYA 1VYTA 4YPFA 3TS1A 3WGOA 4RLQA 2VL7A 3M5CA 1F60A 3TIXB 4PO8A 4U7DA 4CGZA 1LLUA 1U8AA 1D8AA 2FPRA 2VDKB 3QOXA 3UXMA 4DXHA 3JZFA 1SBTA 1FPMA 1KU0A 1MDFA 2B1GA 3FCEA 4L27A 4U63A 5F3RA 4Z0NA 3V4PB 3V80A 3WVNA 4D9NA 2NP6A 5DP2A 4UD6A 1OWOA 1T2FA 2O8CA 1Q1NA 4LS3A 1I2DA 2D1SA 1B3RA 1JKJA 1V9SA 3VHXA 1BH6A 1KI1A 1QQTA 3N86A 4HGRA 5FPQA 4UATA 1TIBA 4JOQA 4ZI2A 2H57A 2QD1A 1DBSA 3VKWA 1N1DA 1OZ0A 4DHEA 2UXBB 3A6KA 4DM7A 4F45A 4X3PA 4HWKA 4D3DA 4A4DA 2DUUA 2BFDB 1SY7A 2IYEA 3F96A 5BWOA 4O4JB 1YJ8A 3CT4A 1P72A 5D51S 1Q2UA 5ITZA 2X86A 2Y0BA 2VHVA 3JAWB 3LC0A 3E1KA 4MICA 1NSTA 2BGGA 1F0PA 5T3UA 3SM3A 1EA7A 2ZSKA 3IIJA 5JBQA 1Y34E 1J0DA 1PI3A 1W581 2FH5B 3AUFA 3OF5A 2EVWX 3ETHA 4AJ4A 1Q1EA 4ROTA 3R7WA 5I5EA 3PYMA 2P11A 3JZMA 3RTDA 2JGAA 4CQMA 4RJ2A 4FFLA 1E1MA 4HS9A 4E15A 3G6KA 4JJAA 1M0EA 2QRUA 4RM2A 2BMVA 1XP5A 1UBFA 3PF8A 2B35A 4RC9A 1QR2A 1UUFA 2IDKA 4DR1B 3WK8A 4JL5A 4HQOA 1N2GA 1X9HA 1BQ3A 1EVKA 2O50A 4YHBA 2A9KA 5IVPA 1YR2A 2W4QA 1FFXA 5KC9A 3GUZA 3MIZA 2OXIA 3ELWA 3EVNA 4LVNA 4QAQA 3SE7A 4AT1A 1SC1A 3MS2A 3O9ZA 4Q9DA 4DAOA 5CLLA 1JAIA 2RJOA 3BTSA 2J9FA 4MW0A 4YJGA 1LKZA 2FPXA 4GWKA 5B1SA 3M6IA 4DDHA 1T5TA 1TVEA 3JQ8B 3LUJA 3R0ZA 4M1QA 4S0XA 3LUAA 2RIRA 3KB6A 4QRDA 5C37A 1WO8A 1K89A 2XTNA 3C4QA 1BCSA 1BMDA 3HWX1 1I01A 1OMOA 1SPBS 3LH5A 4PIPA 4FHGA 4RHCA 5IXYA 2Q2QA 3K20A 4YVFA 1L5OA 3WK7A 1RRKA 1PT6A 1VXRA 1YO6A 2VP9A 3E7PA 4LDQA 3KJHA 3U4DA 1QONA 4E46A 4YRFA 1GHTA 4IHJB 3FHOA 4UCWA 4X7BA 1EXMA 1EWYA 5FF9A 3EC2A 3KHUA 1JAXA 3WIVA 1NBMD 1USIA 3QXJA 1SOAA 4KK4A 3ROKA 1GSAA 3LP8A 3LNCA 1E1QD 4LRTB 4Q47A 1YKFA 4JWTA 2ZXEA 1SG0A 4AUEA 1FW6A 4EI9A 2OZPA 3D31A 4H3SA 4INZA 4CQNA 2GK4A 4LNAA 3OWXA 1GUYA 1W5BA 1MC4A 1CTQA 3EVEA 2CXNA 3NRCA 3QVLA 3QWAA 4HFJA 1M1NB 4HUQB 4OQXA 3L0SA 1CY0A 1NVUQ 3WISA 3SIXA 3RRJA 3HNRA 1OLSB 4A27A 3D0RA 1OYVA 1TZ2A 4RIEA 5E7MA 1KFEB 3RVJA 1JB9A 1PK8A 3ZTTA 4C6SA 4EL0A 3CURA 3LFTA 4C01A 1QHYA 2AV6A 4YH1A 2FVYA 2WKRA 2ZJZA 1W29A 3CE9A 2JFXA 3I92A 1A96A 3ZDQA 2XKJE 1DC8A 4BJ1A 5KTPA 2EJVA 3UJDA 4UTOA 5AW3A 4Z4EA 2NYUA 1EFVB 3KRTA 1V8DA 2I6UA 2BD0A 4G4SP 1N0VC 3LPNA 4M1MA 2W6NA 3CV3A 3DV0B 2BHTA 4F97A 5ER9A 3PVZA 1HYEA 2L0XA 1IQ0A 2FPPA 5HIMA 3UB2A 4Z7QB 4N9WA 5KX5F 4LMPA 4BBZA 3WICA 1ESNA 4BNFA 3HU3A 3WOHA 3FRIA 4R6WA 5C53B 4I8XA 2CMKA 1ZJJA 4IV5A 3OJEA 1RRMA 2Z8XA 3NG1A 3UW1A 1G2PA 1G1MA 1KZYC 3FPAA 3MQ2A 4ZJZA 1S1MA 2DSNA 3CWZA 1QVRA 1HE2A 3I6BA 1Q50A 2DGDA 1W96A 4JIMA 1VFPA 2GBLA 1CZHA 1FTGA 4JU9A 3ST7A 3TECE 1Z5WA 4O8CA 1XXHE 3C1OA 4I8DA 3EMDA 4N8DA 2QRJA 1G20A 4IILA 1PTJA 3SFVA 1XN4A 4B3BA 1YHYA 5L3ZA 2YJNA 3LPDA 3MCWA 4CV0A 2WF5A 4LXGA 1BMFA 2OZEA 1QJCA 1ANKA 1KAQA 3VTFA 5F2NA 4HQNA 3DBVO 2CY0A 3F8WA 2CD7A 3W1WA 1QYWA 1ZK2A 3EUFA 3KQKA 1GRNA 4CLOA 4PZAA 1W4RA 1DOZA 3JY6A 3UMSA 1NQVA 3VI4B 4NH4A 1PJLA 3D3WB 3IIIA 3AM4A 4X71A 2CK3D 4RZQA 5KNBD 3SVZA 2P4QA 2BSQA 1ZJWA 3TCNA 2HPHA 1W34A 4JNKA 2LD4A 5JPDA 4YJ3F 1E7WA 4Y2GA 4GL2A 3UK0A 1UKCA 3EE6A 4GSKA 1NF8A 3FMOB 4G0OA 2PGLA 2QZJA 1W5AA 2HQBA 1DMRA 4HH3C 5CXUA 1WMDA 4G9GA 2WKPA 3NBAA 4B4OA 3KJQA 3HH8A 4K7JA 1BEUB 3TOCA 4NPAA 2ZPTX 3GP5A 1E1RD 4F4CA 3OLYA 1VRVA 3WRYA 1T9BA 3O92A 4E70A 5F1OA 3SF0A 2R6FA 2WFZA 3N28A 4N03A 1CQWA 3JASB 2XT6A 2GQ0A 4XQ0A 5HQJA 1MABB 3I04A 3FTDA 1IIBA 1MAVA 2QAGB 2HU7A 1U9IC 3PD0A 4IHKA 3WY9A 4EW1A 3IBYA 3OCCA 4Z0TA 3VR4D 4H6XA 2MMGA 3LXXA 4BVKA 4MQEB 1RI5A 2H29A 1Y6ZA 4PVCA 2IVZA 3A6FA 1GU1A 2YC2C 2QI9C 3N59A 4PTLA 1X1RA 5FPHA 1X13A 1J9EA 5FTMA 1JWBB 4IJWA 1FTNA 4GM4A 1MDBA 3RS7A 5EQFA 1WBJB 4KXQA 3TLKA 2QOEA 1NIJA 3NATA 1EQAA 1CZUA 5DGIA 1QZ3A 1S6YA 2OFWA 4EJ6A 1BVYF 3C6BA 3P97A 4EVQA 1JFFB 5AJUA 3O4GA 3QF4B 2D59A 4X61A 1DWOA 4DLKA 4RADA 1K3TA 3PUWA 4EH1A 2JFHA 1TM3E 1IYZA 5K0TA 3PQCA 1M67A 1E3SA 3AVVA 2BBOA 5DSZA 3OX1A 8ATCA 4H59A 2ZCUA 1NI4A 3D8SA 3GH1A 3H5VA 1SHTX 4QBIA 5REQB 2RE8A 3GLRA 4KFTA 5CX1B 5A6SB 4XDYA 3LIIA 4XQ9A 3I1YA 5AVVA 4EG4A 3G8AA 4FD2A 3D02A 2H3EA 1P6UA 3TNFA 5DI9A 5DK6A 4JT4A 1V5IA 2V98A 3KU4A 2HW8A 3NXSA 5ALDA 5ICCA 4OOEA 2VJCA 1OX5A 2MJLA 2FWAA 3OJWA 1BHJA 4G25A 2YYZA 3OICA 4FFDA 1JHQA 2ATCA 2PZGA 4NP6A 3E9EA 1T10A 2ZYHA 3HADA 4L3VA 4EB6A 3OTOB 1E4YA 1Q22A 3GYBA 3W5IA 2BL4A 2YRWA 3P9NA 2FE1A 3ZGNA 5AWFC 1V7QA 2W90A 3G2HA 3QUQA 2J4DA 2R5WA 1ZO8A 4IHQA 5ALXA 1T8YA 1XU4A 2BFEB 3LK6A 4DIBA 3AUAA 3CR7A 3IQDB 4RABA 4J4BA 3K9QO 2HFKA 2HT6A 1QIMA 3ITNA 1RFGE 3KP1A 4OHKA 3WKAA 4BEJA 4CCSA 1VSBA 4L8GA 4N3CA 3FHCB 4ALJA 2ID8A 2FPGA 4BNUA 1AH2A 4X84A 1JJIA 3TZLA 4IIJB 1OPXA 5D3QA 1LH0A 1U28C 5L3SA 2PVSA 4ZAFA 1GDHA 3X1WA 3KU1A 3UGJA 3KLMX 1BRMA 3CXRA 2VFAA 3ZNQA 2IU0A 1E92A 7MHTA 4WCVA 4ME6A 5A3RA 5LXTA 3HK2A 2I4MA 2J5BA 4Q03A 4GE0A 3IOEA 5BW4A 4AI6A 2W0MA 2BTOA 2CLCX 1KGSA 2CHUA 4ER3A 2F1JA 1AKQA 1P61B 2GK7A 1RD4A 1T4CB 2CL0X 3E9DA 5C1PA 4M87A 1U2RA 4OLFA 3H19A 3W1VA 1RHKA 5KPJA 4FN4A 1FX0B 1E4OA 5BY2A 2M6KA 4XVCA 2DCUA 3VZDA 3L6RA 3I5UA 1DAKA 3Q2IA 5BOSA 2ALJA 4JT8A 2FJUA 3U7JA 3M1AA 1QHXA 2VIIA 4D4HA 5CB4A 5KNDH 2W2VA 5KOHA 4WEQA 3WAGA 2JW5A 4O2BF 1TMGE 2D1RA 1GA4A 1Q95A 1SCQA 1VMEA 1LDBA 2UYQA 3JRWA 4MB6A 4NEQA 1RLJA 2IJGX 4KSYA 1GGJA 4HDQB 2J85A 3R40A 3OOWA 1PZFA 3AEQA 2BHNA 4N5HX 4XPIB 5E1DA 4AULA 5FBQB 4QECA 1CRPA 4YS6A 5HILA 1LFAA 3KPVA 1EG2A 4GX0A 4QULA 3LYHA 4UM8B 4DIUA 3H2KA 1IOVA 1S9DA 3LPAA 1Z5PA 4XFDA 3DLAA 4C4SA 4EKYA 3QBTA 1XTUA 3OX3A 4E5MA 2A9RA 3IULA 4RSHA 4ZRNA 4WESB 1WJGA 3HLYA 3KZKA 5LOVA 2AJBA 4I08A 3UPUA 1JX6A 1KR5A 1OU0A 4C5AA 1AGXA 1C3VA 3Q0IA 4FDTA 4GQBA 4M46A 1XTSA 5AK3A 2JCGA 2FZ4A 3DCJA 3B52X 3T5AA 4QLOA 1FTSA 2NMVA 5AW1A 2W6QA 3DZGA 4TKMA 3W3AD 1SB8A 4PCAA 2O8CB 1NV8A 1I5RA 4NICA 4RF3A 4LNHA 1JTFA 2IIPA 5KAPA 1Z25A 4DSUA 3RHTA 3NBZC 3A4NA 3WIOA 1JHRA 5EJFA 3W9BA 1AA6A 4DR2B 4JDPA 3RQSA 2H31A 5FLEX 3TLGA 2WD7A 4L4RA 1HDZA 4DRXA 1QAQA 4TN5A 1G60A 3KOOA 3N8DA 3HFSA 1WBDA 1EFPA 2B0JA 1KMNA 4LMAA 1MEOA 1I4EB 1JIQA 4OATA 2CF6A 4GP6A 3HM9A 1GDDA 5ESRA 1Q0HA 4EW3A 3H1PA 4NE2A 4R54A 1WDMA 3CZQA 2A9QA 1G4AE 2YXEA 3NBUA 3ZGOA 1G55A 1SXJE 1VKJA 4HGZA 4NHOA 5HMLA 2C7PA 4A1OA 3UJ9A 3OZIA 3V48A 1CJMA 1K75A 1P18A 3GUCA 4O4IF 4D97A 1IXKA 1WY7A 4M89A 3R7WB 1NPYA 2IHTA 4WY2A 2C3PA 4YDRA 1QU3A 4CQMB 4CMKA 1B8UA 1VBKA 4ARZA 1OHHA 2DTXA 1GFIA 3PQ5A 3W9SA 2XUAA 5H70A 2WSMA 3VPGA 1YRWA 4QQ8A 3DOFA 2FMIA 2H1IA 3IO3A 4OYHA 4XB2A 2YV3A 5IC6A 5IKPA 3G02A 4RUKA 5HF5A 2EHJA 1I4TD 1SQ5A 3L4BA 5BPFA 2RGRA 1EAMA 5DHUA 3W5SA 3AVUA 5PGMA 4V03A 1ZAKA 1Z29A 2IOFK 4OLJA 4D3ZA 4WXMA 3AY6A 3KUCA 4GD3Q 4OGWA 4A0GA 1JDVA 4FWTA 1CR4A 1FIUA 2R8YA 1NYQA 2XCLA 3EPRA 3LE8A 1E7MA 4NFHA 2JGKA 4GKVA 5E2IA 5EP1A 3SYLA 3DYIA 1MMFB 3AW8A 3DLCA 2KBEA 2PKWA 2GTHA 2PX3A 1BCSB 3N0XA 4GYWA 4IV8A 4HYTA 4BGEA 1FY2A 3SPXA 1OV4A 3A4MA 4K9DA 1QFZA 2P0AA 2OP0A 3NT5A 3OCZA 5F7XA 3Q40A 4HWRA 1K8YB 2JI8A 5EKDA 1WMBA 5E2BA 4Y6SA 4FZ3A 4TTQA 3CVVA 1Y8ZA 4UBJA 4HH4A 1U7PA 5LYJA 3F3MA 2HQ1A 3C24A 3QV1A 2ZAOA 4BMOB 5K2OA 4PSDA 1HLFA 4OQYA 2ISSD 2H4ZA 3DAYA 4QQRA 1MHPA 1CPYA 4ARAA 1H85A 4M0DA 2R44A 2HXSA 1B76A 2ABWA 5IARA 4N3NA 4NARA 4HDMA 5BSRA 3K6SA 2BEUB 4P4SA 4FT2A 1R6BX 3IQEA 2VZ8A 3VKHA 3D2AA 3T3EA 3ZUGA 2FFHA 2ZREA 1Z88A 3QX9A 4MUHA 4Q1CA 3BMNA 3U56A 3AHEA 3T9DA 1JEJA 2WJGA 1MT0A 1NR5A 2PH3A 3LA8A 4BBPA 4C0QC 2AVNA 2ZS9A 3JD2A 5EFZA 4QPCA 4FFNA 2OGTA 2IF0A 1XTTA 3U3XA 2QWXA 1KIMA 4LBWA 1E3DA 1V25A 1JEAA 2C4VA 3CB2A 3FNGA 3U0BA 4BMYA 1DTEA 2YR0A 4DLWA 2XQGA 5AXCA 2WAYA 4YV2A 1N6IA 3LXUX 2X8JA 4G0ZA 4TL8A 5FJIA 2FPPB 4E4TA 2P30A 1WSAA 3TOSA 1QG4A 1SQSA 4GRAA 3MUOA 2VF5X 5F3WB 2L19A 4DSZA 2JGJA 2ZUBA 5AVUA 4I1UA 1BRTA 1Z8DA 3A6ZA 2Q07A 1I5EA 3ESZA 3COYA 2VOEA 3QXHA 5JPIA 3PHHA 1V7CA 2PS1A 4BMSA 1JN0A 1VECA 4PXAA 4B6JA 3K92A 4R31A 3CLUC 2B30A 2LP4Y 2PL5A 5G2OA 2CZQA 4BP3A 3MTGA 3PNVA 4FCWA 2ZRFA 3GNLA 3BXXA 4POOA 5BR1A 1HNZB 4Y2JA 3ER8A 3PNOA 4MUEA 1RE1A 2GDZA 4PSKA 3FPBA 4NS1A 5FD8A 4YT2A 2XWSA 1SA0B 2H1HA 4G4JA 5DCYA 1UBEA 4OSOA 1L7PA 2ZE5A 4E1BA 2O2YA 4BMDA 3T5BA 2Z4RA 4NBWA 1PWXA 3E61A 3FWHA 3GFSA 4AY5A 3DZDA 5C8YA 5GOTA 1ZGCA 1A7AA 4DPLA 4RK4A 3MTQA 2Z3WA 4MVJM 1EM6A 1U0JA 1JZQA 4RY0A 1V6AA 5ALVA 4CLOB 1XZPA 2HRRA 1YL6A 5IWCA 1MV5A 1AQIA 1UZAA 1Z62A 2Q9BA 1QYIA 4I55A 1LDNA 4MZXA 3EDYA 4P5DA 1GUFA 2HC9A 1I2BA 1NW7A 2YW9A 1LDMA 3OUZA 4K6HA 1T6ZA 4RY9A 2XIJA 2WNHA 4UHJA 2JK1A 2H5LA 1T2NA 4MITA 4F6RB 1PR5A 1R2QA 3DDOA 4MGZR 4GLJA 2QT1A 5KYGA 4BFCA 3UOWA 2O3QA 1REQA 1IBLB 3A36A 1H23A 3K6RA 4LFCB 3QVXA 5FWAA 5I8ZA 3CU5A 1ZMXA 1ACLA 2EP5A 3KJNA 1XJ5A 5MFPA 1KOLA 5DB4A 3FFXA 1K6XA 3TUZC 2RBGA 3IEKA 5J63A 4D8WA 3SCZA 3LLCA 4QUGA 5DCWA 3WV5A 3GLGE 5EJMA 3FF4A 4ONEA 4DCNA 2ICAA 1JI0A 2VK2A 1TUIA 2X58A 1XTKA 5JATA 3Q9UA 1Q16A 1VMAA 1XZKA 1MFZA 5KNLA 4DNOA 4MRAA 4U2DA 3UH1A 3B1XA 4L9WA 2HV8A 3PTLA 6YASA 2HRZA 3RFFA 2AB0A 4HQKA 2X1LA 3CUEF 3VR5A 1GOTA 2J9YB 4JI0B 4NMHA 1W0CA 2B1QA 1FU4A 2VYVD 3NVAA 4P3PA 2W22A 3QWHA 3NIWA 1W5FA 5CDFE 5FOTA 1DCTA 2NNLD 3GFFA 3ZNNA 4C03A 3OBIA 5GGYA 4PG5A 1EDZA 1S2MA 1XL1A 2OV6A 3LLSA 3ME5A 4DA6A 1H0SA 2WTAA 5EFOA 4P0QB 1M3SA 2G70A 3HB9A 1NI4B 3ECCA 2HHJA 4ISBA 2QJRA 3IXMA 3KC2A 2EFHB 2XQIA 1O94D 4OD0A 5NLLA 2VP0A 3U4MA 1Q7BA 4ZYVA 2IPNA 3C1AA 3MM4A 3G2OA 1CUEA 5INTA 4UDOA 1N7HA 1MVLA 1N3LA 1CEQA 1TMOA 2ADMA 5BR7A 5BO5A 4KZKA 3NFYA 1KK3A 4M49A 3V1KA 3EOBI 3NPAA 1DELA 2O4UX 3NRBA 2XJ9A 4S24A 1QCDA 4U9UA 2C83A 2X0EA 5L7YA 1MXHA 1XROA 1ZP6A 5CP8A 5LA6A 3DXFA 2QRGA 4C4YA 4GYYA 4JC0A 4XVUA 5KJ1A 1NYTA 4FMBB 5EI5A 2WJYA 3IAM1 1NI3A 4V0MA 2DFNA 3TKYA 3KT8A 4YWJA 2K4MA 3MYYA 4XW2A 1PV4A 4MIOA 4P98A 5IH3A 3X1YA 6CHYA 1SCKA 2PUVA 2ZQ5A 1OY1A 4YCCA 4BO2A 1KWKA 1O9BA 4MP8A 1KPHA 1V4NA 4J75A 1R4NA 1R0CA 3M4JA 3CMMA 3NYIA 4IZOA 2PMDA 1A04A 1X0XA 2PFKA 5JAMA 2P7IA 3DCNA 3BZWA 1PL8A 3HFGA 4GR4A 1FUIA 3D8UA 4LJ4A 4PZYA 4TXHA 4EDHA 5JNTA 4JJIA 3SC3A 2ZT8A 1TAHA 2JASA 2YDXA 4HYYA 3WGIA 1NNSA 5B2EA 2YMQA 4F4UA 4CL8A 4JLDA 5H02A 5L3SB 3ZNPA 3MD0A 3OOJA 4TMXA 2CDRA 1Z5OA 4FGZA 3VZCA 5DOVA 3NVMB 1DQPA 4CDRA 3O1HB 5TR9A 3ZZ1A 2WG1A 3CSUA 2IT1A 3CF6R 1ZJ5A 4XIJA 3TMKA 1Z8NA 4ZVQA 3DE5X 5AYVA 4EUSA 5CEJA 3GLFE 2WUWE 2GZ3A 4R1TA 4TWBA 3EYAA 3RVMA 3SDSA 3NQ41 4P7GA 5D5PA 4MJLA 5BYJA 1R0SA 2DECA 1E64A 3EIWA 3MA0A 3PDCA 3EA0A 3L1IA 3PPVA 3C45A 2HUNA 3D81A 4K1XA 1KDOA 3V7YA 5BOSB 1LBEA 3VUFA 2YZ2A 1SOWA 2EFEB 2HZ7A 3DVAA 3NEYA 3S2GA 3SMQA 5CB4B 1GTL1 3ZJUA 1E2LA 2I2CA 3F98A 3WI7A 5KOHB 5CA0A 3P9XA 3SICE 1HQDA 4CG3A 4E2FA 4FR5A 4NBTA 2R00C 3A58B 1Y8CA 3I6IA 5TS2A 3WO0A 2QD3A 2FMFA 4PG8A 5DNCA 2ZBDA 3BE5A 2X5KO 4UVGA 3CO0S 4LWZA 4PE5B 1USVA 8LDHA 1A76A 2I2DA 3AUTA 3HEMA