5B7QA

Structures and functional analysis of periplasmic 5-methylthioadenosine/s-adenosylhomocysteine nucleosidase from aeromonas hydrophila
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
249
structure length
249
Chain Sequence
ASAPILIQGAMDVEVETLVAALKDKQELTVGSWTYWQGTLSGYPVVVSRTEVGLANAAAATTLAMERFQPRLVINQGTAGGHDPALHRGDIVIGTKSFNMGAYRSDLTPAEQGVDPSKWHNFEVTMRLRDNGKLVEHSSFAGDPELVGRALGMADRYRHGRVVPGIIGTADEWNRQVARINWLHQTYQTAAEEMETSSAALVAEAYKVPFVGIRVLSNTDLHGEEFDPQTAIHCQQFVIDYAKALINGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MTA/SAH nucleosidase
publication title Structural and Functional Analyses of Periplasmic 5'-Methylthioadenosine/S-Adenosylhomocysteine Nucleosidase from Aeromonas hydrophila.
pubmed doi rcsb
source organism Aeromonas hydrophila
molecule tags Hydrolase
total genus 87
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature ec 3.2.2.16: Methylthioadenosine nucleosidase.
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5b7qA00
1RXYA 1JYSA 3QPBA 3T94A 3MMSA 4GMHA 4OJTA 1LX7A 3LA8A 1V4NA 1CG6A 1OVGA 4G8JA 1PR6A 4H1TA 4QARA 4TTIA 2B94A 1ZOSA 4RJ2A 1B8NA 1Z36A 4E1VA 4EARA 4M3NA 1V2HE 4F1WA 3OZBA 4YNBA 3E0QA 5CYFA 1QE5A 3SCZA 1YBFA 1OTYA 4L5YA 1SD2A 1A9SA 3KVYA 1VFNA 3BSFA 4YO8A 5IFKA 1RXUA 1TGYA 4OGLA 1ULBA 3D1VA 1PBNA 1VHWA 1ULAA 4L6IA 1VHJA 1T8RA 3NM5A 4QASA 2OC4A 1NW4A 1OUMA 2A0YA 4L0MA 4OGKA 4ECEA 3OZCA 1JDSA 1SJ9A 1SD1A 4KN5A 1JPVA 2AI2A 4GLFA 3UAWA 3ENZA 2GUWA 4M7WA 3BL6A 2A0WA 4TXNA 4TS9A 3IOMA 1U1GA 1PW7A 4BMXA 5F78A 1YQQA 4QAQA 3OZDA 3OPVA 4GKAA 1RSZA 5B7GA 4DA8A 3MB8A 3K8QA 1U1DA 1JE0A 4D9HA 5B7PA 3OOHA 3NM6B 1OU4A 5F7XA 3E9ZA 1Y6QA 4I2VA 1ODLA 1PR5A 2I8AA 2OXFA 3KVRA 4F2WA 1Z33A 1JDUA 3BGSA 1ECPA 1NC3A 4OEHA 1FXUA 1C3XA 1A9RA 3UAZA 5B7NA 3DJFA 3OCCA 4JP5A 4BMYA 5F77A 4NSNA 1XE3A 1U1FA 3FAZA 1YQUA 2XRFA 2BSXA 2P4SA 4TTJA 2QDKA 1V45E 4TXLA 4PR3A 4QFBA 1RXCA 4R2XA 4JOSA 2AI1A 2OECA 5EUBA 4YJKA 4U2KA 2H8GA 2IQ5A 3PNSA 1V41E 1Y6RA 1RCTE 5C80A 4R2WA 2QSUA 3ODGA 4F3KA 2A8YA 1T8WA 5CCDA 3FOWA 3O4VA 5I3CA 3UT6A 4GLJA 1A9QA 4WKNA 4TTAA 1NC1A 3IEXA 4DA0A 1PKEA 1T0UA 1Z38A 1V3QE 4L5CA 1G2OA 4BMZA 4DARA 3K8OE 4TXJA 3C74A 4DANA 4R31A 5B7QA 3O6VA 4DAOA 1SQ6A 2HN9A 3F8WA 2AC7A 4QATA 2I4TA 4K6OA 3KU4A 1Z35A 1N3IA 3P0FA 4TYMA 1JP7A 1PWYE 4DA7A 4WKBA 1A9TA 3DPSA 1RFGE 4JWTA 4TXMA 1K27A 2A0XA 3ONVA 4G89A 2Q7OE 5F7OA 5K1ZA 4MARA 1CB0A 4NY1A 4F2PA 5EPUA 4TS3A 1Z5NA 1I80A 1K9SA 4D8YA 1T8SA 1PF7E 3PNPA 1Q1GA 1OTXA 2PGAA 3KUKA 3E9RA 5F76A 2RJ3A 1Z5PA 3KHSA 4D98A 4DA6A 1JDTA 3UAYA 1TCUA 4LNHA 3PHBE 1TD1A 1RT9A 5F73A 3UAVA 1PR1A 1ZL2A 3FNQA 5DK6A 3GB9A 3BJEA 5CYGA 1K3FA 3DP9A 3EUEA 1Y1QA 4FFSA 1WTAA 1PK7A 3FB1A 4EB8A 1ODKA 4X24A 1A9OA 1PR4A 1YRYE 4MCIA 2QTTA 3EEIA 4L5AA 2HWUA 5ETJA 3P0EA 3OOEA 4P54A 1RXSA 2QTGA 1JDVA 1LVUA 2HSWA 3GGSA 2ON6A 4YMLA 1Y1RA 1LV8A 1Z5OA 4D8XA 3FWPA 2OC9A 5IU6A 1RR6A 2ISCA 1ODIA 1U1EA 5CXQA 1PR2A 1JE1A 4UC0A 1RYZA 4DAEA 3NBQA 3NM4A 1Z34A 4OF4A 4DABA 4QEZA 3OF3A 3LGSA 4G41A 3KVVA 4M1EA 5CCEA 4WKCA 2HRDA 1PK9A 4WKOA 1Y1TA 4D8VA 1OV6A 2AI3A 3UAXA 3U40A 1VMKA 3EUFA 1ODJA 1U1CA 4BN0A 5F7ZA 4WKPA 3LBAA 3DF9A 1M73E 4LZWA 4IP0A 5KB3A 3PHCA 5CXSA 1V48A 3FUCA 1Z39A 1PR0A 4PNPA 1TCVA 4LDNA 4LNAA 1T8YA 5FAKA 4TXHA 1A9PA 4F3CA 5JPCA 1TGVA 1Y1SA 4LKRA 5EFOA 4NS1A 1Z37A 2QPLA 3EMVA 1YR3A 5F7JA 3DDOA 1B8OA 4MCHA 4OY3A 3TL6A 1JDZA 3INYA 3OZEA 1A69A
chains in the Genus database with same CATH superfamily
1VFPA 4L9RA 3BEDA 3SXJA 1SURA 4HN9A 1NULA 4AROA 3HS3A 4WA8A 4MS3A 1Z6TA 3DBIA 2P78A 3QNWA 1DO8A 2V7GA 5KVCA 5JCJD 2ZAGA 3QBJA 2Z56A 4G97A 4MV6A 2I4RA 1QVAA 1XAHA 2PA0A 3U48A 4BUCA 2BHLA 4M9RA 4BRSA 3B70A 3VR5D 4V1CI 2OAP1 1E9RA 3MA0A 4J6FA 3ZWAA 9MHTA 1FNNA 1SN7A 1BJKA 1RKQA 3OEED 5H8WA 1FFHA 3I1JA 4LHYA 3NDBB 2FR0A 1AT1A 1SU7A 2VHXA 1SXJB 1TJ4A 1BVUA 1YS6A 1L4YA 3I9OA 2J31A 2UUCB 4EP1A 3QFFA 2WOOA 5A3RA 1W36D 2V55B 3QVJA 1KWGA 3MOGA 3GMSA 1SBQA 1YS9A 4MQBA 2VJBA 3HDYA 3AR7A 2FN7A 1PZGA 5CFQA 1FA9A 1N6HA 1N8SA 1X7WA 3KZMA 1G2QA 5T6MA 2R2GA 4MRMB 1XJ0A 4J2HA 1YHZA 5BSRA 3V32A 3WJ2A 2H00A 4XI9A 1GQRA 3PFIA 4OMDA 5FWXA 1EK2A 4FN5A 1DEXA 3MGAA 5DNUA 4CUZA 3CH4B 3WDSA 1WCV1 1Q0TA 4LTDA 1ULBA 1KNQA 2AJCA 4NYJR 5H81A 4D4IA 3OKCA 3ICOA 3BD7A 2IYSA 2WF9A 3T4PA 3R7AA 4DYDA 4TLCA 5FPKA 5JH7A 5M34A 2CNNA 4XGQA 9LDTA 4ZQHA 3RS8A 3NEJA 3R74A 1IXYA 3QEMA 4UXIA 1XRPA 4MQLA 3CGWA 4C21A 3DZIA 1O6GA 2Z57A 3LLSA 1KZ7B 4IDOA 4K9KA 4TLBA 1HYBA 3E5RA 4CF6A 2Y2UA 2WY2D 3ZPXA 1N78A 1K92A 1JIIA 3B60A 1WF3A 4MUNA 5HCUA 1EFAA 2DQZA 2QGNA 3AERB 1UP4A 4N1AA 1SKQA 1A4RA 5ARCA 3T3HA 1QVVA 1E94E 3L6EA 1LK0A 1Q74A 3O4GA 4Y2QA 2I2XB 4D41A 4UJ5A 1VXRA 5KMGA 1E2PA 1YRQA 2HXYA 4TYPA 3AR8A 3LRTA 3ZR4B 1HTBA 1KEEA 4URXR 1UQTA 1AUPA 3GPCA 3L8DA 5JVDA 5C1IA 3EG9A 5JZBA 2K87A 4HEA1 4Q3OA 5AHXA 5DV9A 6Q21A 2FW6A 2PO7A 4EW1A 4GOKA 2PU7A 3HKDB 3R7LA 1NNSA 3OCUA 4PYNA 1FQJA 1U1GA 2E3JA 3MTEA 4HTFA 1IBMB 2OO3A 5BN4A 3G8CA 1VYTA 4PXAA 4MR7B 1KDTA 2BBOA 4ND7A 4MB0A 4PX5A 2L82A 4G5SA 3HXTA 3WSWA 4R1UA 3X44A 5IXSA 3AUTA 4LF5B 1KGDA 1F2DA 4POOA 3OQVA 4HZIA 4ND2A 5EXXA 3AYZB 2FFAA 2PRJA 1Y9ZA 1QDEA 1KORA 2PSEA 4MQEB 4C05A 1EGHA 4MXDA 3RYCB 4E07A 2ZRPA 2GMWA 3HCWA 1QONA 3RIXA 10MHA 3O47A 2IOFA 2NX2A 2XUAA 1OH6A 3VJRA 4Q3KA 4PGHA 1DC4A 4MYRA 3HJFA 5KWEA 2CCKA 5ICGA 4ZICA 4YRLA 2XT0A 2W2XA 4IDNA 2NSHA 1OOEA 2C77A 1MLDA 4OQYA 5K0BA 4R1TA 4JV5B 3W9SA 1RE0A 3TW6A 4JVLA 3X43A 1H69A 3AXTA 1DTWA 2GF9A 3HYLA 1KE2A 3RT7A 2P4UA 2RONA 2QUAA 3KHUA 5KU1A 2D59A 2Z4SA 4FN4A 2C1XA 1YIOA 2VRCA 4FYIA 1RKUA 2I6FA 1E4YA 4WN9A 1KIFA 1FYDA 3OOWA 1BXKA 3VXKA 3CH7A 4F2GA 3A6PC 4LYGA 2QVXX 2P7IA 3BORA 4LXYA 5A05A 5KOYA 2EDAA 2V3WA 3FF4A 4HWGA 4OQZA 4UMEA 4DKXA 4XYLA 1WY5A 5CDGA 4J16C 1JS1X 2CMGA 1N5KA 3PI7A 4F3RA 1LA2A 4L8LA 4LVUA 4NOKA 1A7KA 3E81A 1XE3A 3TR6A 2Z83A 3OJCA 1XU4A 4JJIA 2TMDA 3D4OA 4OLFA 3SXUA 1X0VA 1T24A 2OSVA 2VWQA 2X13A 3H9CA 3BJRA 4X71A 1B00A 2EARA 4XLTA 1TAHA 5J63A 3DMNA 4CM4B 1Q7CA 1RYFA 3UHOA 1D2GA 2JHGA 2WG1A 1MA0A 4LQ4A 2WSBA 1XZEA 3C3KA 1R9MA 1V45E 1ZC4A 2F67A 3L1KA 4L8FA 4QIHA 4E7PA 1K6IA 2PH7A 3O38A 4TTSA 2WW8A 1FS6A 3L3BA 3HCEA 4AXXA 1EGMB 1DKRA 1M6VB 1GPAA 3GJQA 4CVNA 1UQRA 2QYTA 1RLOA 4RAQA 1KZ6A 2P6MA 3AEQA 4B3JA 1S3IA 4IIFA 4ZQEA 4R9VA 1UBGA 3H04A 3IQWA 5DRTA 3M70A 1XZGA 3W8NA 4AY4A 1E2LA 4ER5A 2AEEA 5I5EA 2R751 3T3PB 1KYWA 3W04A 3C6BA 1J24A 1XL0A 1G5HA 2DTDA 1I13A 4JENA 3NIWA 4F5ZA 2Z1DA 5FYQA 1E96A 1C8KA 3ZGOA 5FLXA 1U3DA 5C5DA 3MRSA 5CPBA 1HNXB 3FFXA 2BL4A 5SYMA 2XOKA 3V7YA 4EX6A 2ODEA 4M9CA 4ZOLA 1N6RA 5AJTA 5JEEA 2AEFA 2NZWA 4QVKA 5CA1A 2WZBA 3KDPA 3WMGA 3ZY2A 3FBGA 1F0YA 4RIEA 1MAUA 5BWCA 2IOFK 2VQ6A 3CUYA 1KQGA 3FROA 1JG4A 1N0IA 3ROPA 2Z98A 3WYFA 4X20A 3AQIA 2NO4A 3GRYA 1EFKA 1PI3A 3WA6A 1NPTO 2JBAB 1GZ4A 2XHEA 1FUKA 4AJLA 1AN0A 3HR8A 5JCXA 2F90A 1NLFA 2PXHA 2WTXA 4RGBA 3L9XA 4OHFA 4H1HA 2ATEA 1BNCA 3H0CA 1D8TA 4FKBA 4RGYA 1PG0A 3GH1A 4PO1A 4AC9A 1SUSA 2DECA 3HYCA 2EEPA 4G67A 4XPIB 2MJLA 3JQQA 3V1KA 3DCNA 3KJFA 4FNGA 3T99A 4B4WA 2FR8A 3P5BA 3MK31 2QW1A 2JIZD 4LXUA 2MSLA 4U8GA 2PU5A 1VZ2A 4CCSA 3NVAA 2ODBA 2Q46A 4DANA 4ZYTA 2C0PA 4Q3AA 3UUEA 4AKSA 5LR6A 1LSJA 1C1XB 2JIRA 3T5BA 3VYTB 5ITZA 2H7YA 2BMVA 3GLTA 2BFBB 3MYRA 4DAOA 4ZCTA 3MUNA 2R7NA 4ISBA 2LUOA 4QFDA 3SE7A 3MJTA 5KWIA 2QSJA 2FA9A 1S3SA 1KEWA 4P4SB 5E7JA 1U3UA 2DUUA 2PTHA 3H2JA 2JLBA 3L8HA 4Q7KA 4OA8A 1R8SA 2WT4A 3IUPA 1BH2A 1CJBA 4HNAA 2IODA 2WA2A 3CZCA 4M21A 4MITA 4LGYA 4DSTA 4RPCA 4Y9TA 4AM8A 3TW0A 3W05A 5D1NA 4F5DA 4DKJA 4FYHA 3E1GA 1K2VN 2OYCA 5K0ZA 3ZWCA 4FZRA 4QREA 2BEJA 3IDAA 3I32A 2BYTA 1B41A 1HF3A 5CRIA 2CFRA 2C92A 3D4BA 3IAHA 1MB9A 1QYWA 5JAZA 5K05A 2CNWD 3AVOA 3IO3A 3CLTC 2RMKA 4MQFB 3ZNOA 1W5FA 3DZHA 2DPMA 4JBLA 3KKLA 2GOYA 1PVVA 2PRKA 2VYNA 2V96A 3BPSA 3TZ6A 1J07A 3VO1A 5F7OA 3VPSA 1RAHA 1Y1PA 3EYWA 4L0QA 1P60A 1P9WA 1LXCA 3LY8A 1N57A 4NY1A 1V39A 2BF4A 4ZAWA 2J9FA 1MPTA 4MLPA 5K4AA 4Q1VA 3CRVA 2FWPA 1KYTA 1RZVA 2PKCA 3BHIA 1XRRA 3P4UA 4QJIA 1VC2A 2FQYA 1IU9A 4DRXB 1CETA 3UNXA 1NURA 1JGTA 1U6JA 1XP5A 2ZJ2A 5ALEA 1UADA 3TLJA 4MSUA 1SH7A 3ACDA 2WK1A 2OCKA 3IKVA 3QUQA 1H9CA 2ZIEA 2QL6A 4QGBA 5JAPA 1QO9A 5I7AA 1KY3A 2H2AA 3A1TA 3UO8B 3CX4A 4D42A 5HZHA 1C1HA 1Z5PA 4DW8A 1EESA 3ROFA 4WXHA 5FPSA 3GMDA 4G25A 4C6TB 3VMFA 4GLOA 1YKGA 4IXWA 1TCUA 3T34A 4LYYA 1YKSA 3BFPA 4A6DA 2VF5X 5ARDA 2OBMA 2DYKA 2BEWA 3PUJA 3DZCA 1MH9A 5A4MS 3QRWA 4JR0A 4RTMA 4LJ7A 2NOAA 2JFOA 2O4UX 3NNSA 4LJAA 3RTDA 1DFIA 4KHPB 1I33A 2XSZD 3MOSA 5KAPA 3ZCVA 5BYAA 1ORRA 3NEYA 4TSRA 1VL1A 2PBRA 3OLWA 2J6CA 4CIAA 5KSWB 1LQ2A 3QXSA 4Q66C 2PMCA 2ECPA 2ZSDA 5CCXA 4RHCA 1L7DA 4E5KA 1HYQA 2HD4A 4EFDA 2Z2JA 5LLSA 1I4TD 4O59O 2J59A 4IF4A 3AY3A 3KYJB 3U4HA 1P0MA 4JI7B 1YBVA 1E1LA 1UM9B 2IXEA 4O4LB 3T4EA 1RAEA 2RHGB 2YRFA 3FB1A 4FDTA 5G4KA 1KVQA 3C2QA 4CV3A 1FJHA 3GU3A 6AT1A 5A3QA 2FSHA 4IOMA 3DO6A 6GPBA 3W3AD 1T4CB 5JNUA 1SKYE 3D7SA 2JKYA 1WS6A 1X74A 3F4KA 4GGMX 3JRNA 3EQ9A 2P2GA 4MGYR 3SK0A 3EW7A 2WHEA 4PSAA 4PSUA 1ZNWA 3M5WA 3EXIA 4GI5A 3QLEA 3KT3A 4IIJA 1GPH1 1N1MA 2OAGA 1YDEA 4O5OA 5GJVC 4CM8B 3TLBA 3E9QA 2IEYA 3OOEA 2VYVA 3FI0A 1WE2A 3VU9B 4RK6A 1TLLA 5HF9A 2ZUCA 1D7AA 1SVLA 4KAXA 1I2CA 1RQRA 4D1YA 1DEAA 2EL7A 2C03A 3CBGA 3QLJA 2JH3A 821PA 4BNKA 2BGKA 1E3LA 4I99A 2PKXA 2WE7A 4NR0A 4YASA 3T7TA 1ODIA 2GPTA 5AHOA 4YPVA 4H1WA 4GMKA 3MJVA 4ZT4A 4LMPA 2H5EA 2UUPA 1U0LA 2AFHE 3P71T 1E3MA 4UC0A 2GJ8A 3OHPA 3V8VA 1XQYA 2FH5B 2FGJA 4M7PA 2HMTA 4LSZA 3NBFA 1CUZA 1NVEA 3ITKA 3G5UA 4RESA 1V37A 2FEWB 3ZXSA 3ITNA 3VPHA 1G8GA 2AZDA 2CE7A 2IT1A 3GOQA 5BWMA 4WOJA 4BQPA 3Q8XB 5K6TA 5CU7A 3NM4A 4HMPA 5KNDH 1H4VB 3HWWA 2IY7A 2BTQB 5C52B 3QVUA 5ALZA 1TIPA 1U3WA 4B3HA 3QJYA 4B76A 1DKNA 1A5BB 2ZXEA 2V58A 3WA7A 1ZISA 4OYRA 5K01A 2OCLA 1NJ8A 1GN8A 2FN4A 5JOQA 1S5PA 3CG4A 3RAEC 4ZT6A 1KYQA 1EDDA 1RHUA 2BFPA 1XQ1A 1J1IA 3DLPX 5KDLA 4AZ3A 5FOQA 1C7JA 5IP5A 5AKIA 4G86A 1ID8A 2H5LA 4WCDA 1M5RA 5IK2A 1R10A 1MFZA 2C7BA 3OF5A 3B9PA 3PTLA 4RV9A 4YJ3A 1V35A 2ZI7A 4U8HA 4BS9A 3UFXA 5DN6D 1NUTA 4J4BA 4NWIA 4DEYA 3LG2A 3PRYA 3E5HA 1J0BA 2CDBA 2ZAOA 4LEIA 5A7HA 1VJ1A 3B38A 1Y1LA 2XGGA 1ZQ1A 5IMBA 3DMHA 3DD1A 1TU3A 2FXIA 5B55A 1TJPB 5HKLA 3DR3A 3TLGA 2DOKA 4M2LA 3VTFA 1HE5A 1S2IA 2ATXA 5AVOA 1RM0A 4HDMA 3ETJA 4JC5A 1CE8A 3S55A 4WECA 3DWGA 3STVA 1AO0A 4TMWA 1PNOA 1WXGA 2HLDA 2IS2A 3T12A 4JKOA 3HVUA 1OVMA 4XD2A 3K9HA 4O1IA 3NRJA 2O2GA 3DMGA 4BV8A 2VZLA 1KVRA 1JEJA 4FE4A 3QOFA 4Y1RA 5F4BA 1TM3E 4E70A 2WUGA 1ADCA 1UJMA 1VGQA 1XEXB 2CUTA 3C85A 3CLRC 1SR8A 2R84A 4KXNA 2ZB8A 4Y2RA 1G8SA 2JIBA 2Q4RA 4DJDC 1XMVA 4LE2A 5KWSA 1QG6A 2GZ3A 3AKDA 2JDIA 2VJQA 3ILSA 2FZ5A 3O9MA 3ZS9A 2YBDA 2FETA 5M04A 4RKFA 3DOUA 3KQUA 4D82A 1G5RA 4ENSA 1H1LB 1JG7A 2XZOA 1VGRA 1YCFA 2ZWMA 3MFQA 3ONWA 3Q3IA 3P20A 2AOTB 2VHJA 3G5MA 4HH0A 4I3FA 4X91A 4N5NA 5E2IA 2Y2VA 3LWBA 3NASA 1F06A 4FC6A 2EBHX 3CM0A 3NCTA 1A8UA 4ZD6A 2XVYA 2W2LA 4K1XA 2FFRA 3JCZA 5J2UF 2ZI6A 3NGLA 4N8EA 5F1OA 3N2IA 4YBRA 3GEMA 3NXSA 2Q1SA 4GT1A 2YICA 1SCKA 4G0MA 4W9MC 4MWOA 3N6XA 5EZYB 1M8PA 1DO2A 3INYA 1U80A 3AHIA 1QR6A 1UPTA 3L7CA 1FTWA 4D0RA 1SVSA 2CHEA 3SC2A 5AFSA 4E22A 3EJ6A 2F9FA 5ICMA 3IS3A 1LK7A 4AZVA 5F2EA 5BSKA 5DYNA 3M6XA 3RBXA 1ND6A 1UXHA 2I3AA 4MZDA 3V8QA 2Q5LA 2AN3A 1V3TA 3P9SA 3R7NA 3KSDO 1G7SA 1PTJC 3A3OA 5LU8A 1I5EA 3FTEA 3DYIA 2G9QA 4RELA 4H1TA 4XDHA 3SF8B 3V33A 4D9FA 4F38A 5BW6B 4MVJE 3JS5A 1FMTA 1VPDA 1NR7A 3JAWB 4UDYX 2NSJA 1Y3BE 1KKLA 1BHQ1 3P2MA 5ALSA 3P19A 4EARA 1Q0QA 1IBCA 5EESA 4JASB 5C2JB 5LQMA 2QE7A 3C8DA 2RJOA 3CJQA 1Z6GA 2WZDA 3G02A 4W63A 4ZAZA 2XD9A 1IPHA 1N2ZA 3H5RA 4MMXB 5BRJA 3P9IA 1IBKB 1LBSA 4EY6A 2OYRA 2FG6C 4WIAA 2QVGA 2EZ9A 1U8EA 4B4OA 3F5QA 4EEKA 1DAGA 2EYUA 1ZA1A 2IXGA 2LWIA 1ATIA 3IP7A 3SZLA 3IPXA 2WNSA 3VI3B 3HJHA 1YQ9A 4PCUA 2XJ4A 2JGFA 3BL8A 1SG9A 3CU5A 4GM1A 4PZAA 4WWHA 2PD6A 4XRRA 2EQBA 3BMCA 3M1IA 1JLMA 4R6WA 2IF0A 1Y98A 2RBKA 5TT1A 1ZQ9A 4PR0A 2AG1A 5EE9A 4DM4A 3FNGA 1LS1A 4LHZA 2CVPA 3IJPA 5KNLA 3M7IA 5ALGA 1OHHD 3DHWC 1K98A 3KT8A 3KSRA 4RTRA 1GQ2A 1DZ3A 2PPLA 1GNLA 1RXEA 1E99A 3HU1A 1LF0A 3PC8C 4RPJA 2EQ5A 4S24A 3QIAA 4RA6A 2FKAA 1E3WB 2D7CA 2O5CA 4MQ5A 2AOXA 4PBRA 4DADA 3OEHA 1T29A 1WUYA 4N6GA 1LSSA 5E6RB 3PQ5A 4QPPA 1SUWA 3DDUA 3UWPA 3F5MA 5K3AA 2HK8A 3A6GA 3M5PA 1GZ6A 1JPVA 4CU5A 1UMCA 4TLMB 2COKA 4LI3X 3VH1A 5A3JA 2VZEA 2Y1GA 3K1JA 1IZZA 4AUEA 1B7GO 2GUWA 2OV1A 2QZZA 4FTWA 1S2LA 4KMOA 5K2OA 4R8SA 1BC5A 2HMSA 3JYLA 3KM0A 2J9RA 3CJTA 3TLAA 4TS9A 1KZ1A 1MJ5A 3BMNB 3CZ4A 1GAEO 1B15A 5LP6B 1J20A 4NNPA 5EYPA 4XB1A 4YUVA 4CGYA 2I9KA 2MTBA 1GRNA 3A2MA 4BMXA 1H6DA 3L77A 1ZSNA 4LWQA 4YWHA 4CF3A 4B7ZA 3VOSA 4HVAA 2WWRA 4QPZA 4ZN6A 4MKRA 2P2DA 3IB6A 1MB2A 3SIRA 4B4DA 5CT5A 3KSBC 4X61A 1QQTA 1BJRE 2JNWA 2VXBA 1TYBE 3ESCA 3HCPA 5T4EA 4UZFA 4MA0A 3UH0A 4C0HA 2QLBA 1JU3A 1RI3A 4HGRA 3R0XA 2VDOB 2XB8A 2YV1A 3KHTA 5LWHA 1U3TA 5IT0A 2P2CA 2BPOA 2OSBA 4UBKA 4R71A 1IYZA 3KT0A 1DI0A 1U3GA 2XYHA 3G7SA 4PC7A 2AUMA 1NXPA 4WNAB 1M54A 1TVEA 5K0NA 1E62A 5B7PA 2AZ4A 3LBNA 1R0LA 3UG7A 4MV4A 2GASA 1IHXA 2O2JA 2M9MA 5DCWA 1XQWA 1FVXA 5ADHA 2CJPA 1OFIA 1JNXX 1EFLA 2GXUA 2JFVA 2LVBA 3FSGA 4Q3LA 2BWJA 1ZX1A 4UVDA 2B6NA 2CMFA 2JZCA 4IUDS 4JZKA 4P5DA 2WF6A 4RKEA 1MG5A 2VT6A 4Y30A 3ZV3A 1YF3A 1OV4A 1U1IA 4N41A 3FPAA 5JCJA 3MHTA 2VYFA 2YOHA 4FD3A 4CR6A 2H11A 2OB1A 4KYTA 4BV9A 3P0RA 4O8CA 1S2OA 3HCRA 3L79A 4XDZA 4BLTA 2B35A 3GK3A 2I54A 4DLXA 4F93B 3DB1A 3R4CA 5JZMA 1PGJA 2YW2A 5HUHA 4ASUD 3CURA 3VR5A 1E61A 1RW4A 2CLSA 3HJGA 1ZGZA 4KYIB 3OEEA 1WOMA 1EPUA 1J6UA 3EZFA 3INRA 4E12A 3NKVA 3A7EA 4AKIA 3D8NA 1F4PA 3ESAA 3VBCA 1XEWY 2EFDB 3BWEA 3QH4A 3LP6A 2GI4A 5JBIA 4NQRA 1LF5A 4KQCA 3K15A 4PONA 1IJEA 1CUVA 1XNJA 5IAGA 1JLLA 4TX1A 4AL4A 2ZJOA 2EYQA 4A1OA 5I8PA 1FRVA 1MZVA 2MR6A 4OO3A 2WABA 3P9XA 1JV2B 4WW0A 1S3GA 4NONA 2XR1A 4NG4A 2WWIA 3KPJA 4IF6A 4UHHA 2DY1A 3FF1A 5AM4A 5I7HA 4PZCA 2QRPA 3V4SA 4A0QA 1Z8NA 1KAEA 2PLWA 3ZU3A 3H1EA 3LP8A 3AUJB 4HEJA 1JSXA 3A9SA 3IDSA 5IC4A 5KYWA 3E35A 4OHCA 1BCSA 3Q98A 1X92A 1PK8A 1Z74A 1ZOPA 3QWFA 1R4AA 1E1NA 4E5UA 4KQMA 3KJIA 3P45A 4CIXA 2AOUA 2HMUA 2QY6A 4AN4A 2FG7C 2HU8A 3NI2A 4CR8A 3I2KA 1DBPA 1HQCA 2YIDA 4IUBS 3P32A 4BMCA 5ISMA 2BMEA 4N03A 2PH3A 5IYZA 5JPCA 4YT5A 2EBUA 2WIFA 2XEXA 4ZCLA 3V97A 1BN6A 4IS2A 3VISA 1ISPA 1J5XA 2Q8NA 3AEZA 4CG0A 4DC1A 2PZBA 5AKHA 4I0WB 1KVTA 4ARIA 1Z5GA 3EDQA 1K66A 3UT5A 3G2LA 4CN8A 4WK4B 4DDHA 3HMKA 5IVHA 4AYXA 3I5AA 1GL7A 2GZAA 3BAFA 4J94A 4Q12A 4NU6A 3L8GA 1WEKA 3THYA 1SVWA 1ATZA 1F0PA 3T0IA 5U1PA 2ZBVA 3X1KA 2R1VB 3O95A 1QGUB 3VYUB 2HW8A 1MX9A 5CH3A 2X9LA 1VMIA 3IB3A 2PLRA 1VBNA 3MD0A 1RI4A 3AHDA 4OB8A 3NH6A 5EZYF 4QBHA 2AB0A 2M2IA 2UZ0A 3B3QA 3T38A 3UBMA 3AB8A 5LXTA 2QLJA 3GJ4A 1DRJA 2A1UA 2AC2A 2J3DA 3UEOA 4F3TA 5FPHA 3L1HA 3KV3O 1GZSA 1LB1B 1UEJA 4MAAA 3VZDA 1ENPA 5ICSA 2WPNA 3PL1A 5CHYA 3RRNA 4QG3A 2H92A 3DTYA 2AS0A 2AV6A 4EITA 4BFYA 4QQ8A 5A2GA 3K6SA 4IKPA 2IYEA 4AZ0B 1C4KA 3VHXB 1ONBA 2R8PA 2ZGVA 1GAXA 5F9HA 3KAJA 4BVKA 4DXAA 2FPMA 4YUYA 3QU4A 5BMVB 3EF1A 5G53C 2BHTA 4DNQA 3DPSA 3MGBA 1OGIA 1H9AA 3D81A 3LLMA 4KV9A 4II2A 5TQVA 4D96A 4EOGA 4K03A 1EVEA 1ZU5A 4GE3A 4RACA 3TG2A 2XUFA 5I45A 1ST3A 4GZ6A 2VSYA 4E32A 1KJ8A 1OJLA 1P1JA 2HWWA 1C41A 5JAHA 2JGMA 1OJ7A 1CB0A 3RARA 3SJ7A 1LPMA 1LTQA 2CNBA 1VI5A 2FLKA 2XUZA 4EY8A 3ELYA 4KUHA 1QKJA 1OX6A 4OA5A 1QU2A 3LL7A 5FIUA 4BJ3A 2ZRAA 3BSWA 3QIVA 1XRSB 2XGOA 3KWJA 4ZV4A 5JT1A 2VH2A 2HEGA 4UTZA 1KC1A 2IP4A 3JYNA 4FE7A 2GWHA 3F6RA 1DSSG 3TX6A 3Q15C 1IVSA 2GAOA 4YCNA 1CEXA 3FHLA 4V0SA 3UPUA 3CLUD 1WCIB 1BQ3A 3WIDA 1AGPA 3WWPA 3R7WB 1FLDA 3IA2A 3FDJA 2C61A 3I52A 3MUFA 3UAYA 4DA6A 2FHPA 4JAVC 4WZBB 2H1HA 3QSYA 2VZ0A 3F7OA 1ZA2A 2C83A 1NVTA 2CVFA 3COZA 4UAVA 1NVFA 2OVBA 1H0HA 1OC4A 4YFYA 5DBFA 2DT8A 4RPIA 2OWEA 1U0RA 4QGGA 4WFKA 1ZVVA 5HF8A 2Q5QA 3PJEA 2WAXA 5TQ2A 4JLJA 1L8QA 2X6TA 4ID9A 1SQGA 3ASUA 1C30B 1HR0B 1EVJA 2C3PA 3ZLTA 5CYGA 5JZ9A 1XVLA 2NO9A 4CWAA 2B82A 521PA 3OZAA 2XOXA 4OB7A 4DVGA 5F23A 3OQOA 1OH5A 1D03A 4G8CA 3A8TA 3DHYA 1N2CE 1VE6A 1WB4A 1XKXA 1QHEA 4WBSA 2M1ZA 5JSKA 5FFNA 1B6RA 2I8CA 1X7YB 5DNCA 1DXOA 1O5IA 1PE0A 4M76B 5HKKA 4BFLA 1H9BA 4X24A 3R5FA 4GU5A 4UATA 1KP3A 3IULA 4K6FA 3B52X 4NJEA 1EBFA 1IUKA 1T8UA 1W4ZA 1LQUA 1ZD9A 2V4MA 4H7KA 5HCNA 5TQJA 1L1FA 3WMRA 3NV9A 3DMYA 4U02A 4HAZA 2ZBPA 3FOAA 4NX2A 3QV1A 1LD3A 1YT5A 3GQBB 1X2BA 1A76A 2Y1OA 1QH9A 3DKVA 3HO6A 3U62A 4B45A 4RZ3A 3EK2A 1I9GA 1TU4A 1USVA 5CBKA 3ZD7A 4F84A 4B9EA 4C14A 1YNOA 2UV8A 1ENYA 2XXAB 3AETA 2JIZA 4QRDA 1P2VA 5EMHA 4YCDA 2V7QD 3THXA 3AOGA 3R1IA 4I55B 4CEJB 3DFFA 3EEYA 3FKJA 1W52X 4PO3X 1U0SY 1Z2DA 1PR2A 2WSLA 3EVBA 1OREA 2O59A 3D3JA 4UEQA 1QIKA 1OLXB 1RYZA 3DG9A 2DUJA 3ICPA 3L6CA 3TTVA 1M2OA 3NBQA 1NLZA 2XBMA 5CFNA 4RKRA 4NQZA 2R5WA 3IESA 4OP2A 2XNCA 3S40A 1R6AA 3IKLA 3NYQA 3GQVA 4YQZA 1NVBA 1RPTA 4IGEA 3TSAA 4W5NA 2Q0QA 2BKEA 4FS3A 3NFRA 3IUMA 4B81A 4FNAA 1DP4A 4U2EA 2WU8A 3KWLA 3DLTA 3QMPA 4DF3A 4XB2A 5CFLA 2V7VA 4DLRA 4PHCA 1FK8A 1QG2A 3WKBA 4F5EA 4K86A 2D7JA 2W6CX 5AQ1A 1YFKA 2Z5VA 3LGSA 3QZUA 3K1TA 1WNFA 1DG9A 1WXQA 2J4DA 4DG8A 3GA0A 3WO0A 4M0MA 1QYCA 4KXVA 3VPCA 4M7OA 3UGJA 1L5LA 2ZT8A 3SYRA 4ZAGA 3PFFA 5IS2A 2QHXA 4OFWA 1L7QA 3G5AA 1IHDA 2F1OA 1XPRA 2XAUA 2PEYA 3OH8A 1L5OA 7GPBA 2O0HA 2X0IA 3E3LA 3P7MA 4UD2A 4BGDA 2DR2A 3K09C 2C9DA 4TQUS 5A9SA 3C6ZA 5C0OE 1Y7IA 1DG3A 5EZ6B 2C5FA 1ZIYA 3LUCA 3QE4A 3R9KA 4UARA 2ZZMA 1N9ZA 3MERA 4HDQB 1WVMA 4CM5A 3H97A 4CIYA 1H5QA 1LUAA 1O8BA 1ODJA 2FNAA 4XIGS 5KKCA 3RAGA 5HJ2A 4TUYB 1VHLA 1D2MA 1K3UB 4C6SA 2A6PA 1XLWA 3OHMA 4EGFA 3W8FA 5HQ3B 3LPDA 1QC5B 2FP4A 2QIPA 3VMMA 1VYVA 4KX3A 1SZJG 1P18A 3RKSA 4AMGA 1Z9BA 4B3XA 2X77A 3E9MA 4BE9A 2P6OA 1GAJA 1C7IA 3H8VA 3JQ9A 1FYEA 1P33A 5DT9A 2BW0A 3CY6A 1XZKA 2QVYX 3N0RA 3N70A 3OUUA 4JX9A 4Z0TA 4JLNA 1HL3A 1QV7A 3I4LA 8GPBA 5DGCA 2FYTA 1KVUA 1T36B 1XV5A 2EKPA 1KAQA 2I4IA 2P68A 2XSZA 3F9RA 4LJ9A 4Z0PA 2BISA 3PSAA 4C4OA 4F72A 3LOPA 5KTMA 1DE0A 4BUJA 4BPRA 2OBFA 2IK8A 5CNJA 4WLVA 4PXYA 4BBAA 3WAGA 1XTQA 2ZT6A 1IY2A 4F3CA 2FUCA 3U0BA 1SKMA 1EINA 3PPIA 3O5AA 4JGIA 3VOBA 3WHIA 4C3UA 2QT1A 2Q6KA 4OL0A 1VL5A 1IZ9A 2XF8A 4X6UA 4JI8B 2VDRB 5SYAA 1EDBA 3NYRA 1I14A 3PEFA 2I1QA 3EBLA 2LPMA 1KS2A 5TMEA 3UB4A 4KXWA 1SBTA 3A9VA 3T3EA 1D6JA 2NPIA 2K6GA 1QH8A 3K2BA 3W3AA 4DEXA 4FXOA 1TO2E 3F3YA 1GKUB 1TTHA 1F2UA 3OX1A 5F7JA 1QF6A 2RHWA 4I8DA 4NCIA 5EERA 3TJZA 4O2LA 1K5HA 4BNLA 4BXOB 4BRWA 3PXCX 3HDQA 1RVV1 4YJDA 4CF4A 1Z4MA 3D5QA 4LVNA 2QYOA 5L3SB 4MW0A 1CVIA 2R5NA 1NXQA 3OZEA 1TTTA 2EJWA 2NN3C 1U9IC 4S1OA 3IV7A 4B43A 2L18A 4M4SA 3KEOA 2OPHA 4OBEA 3ZHSA 1AGNA 4C3ZA 2MYTA 4C08A 2ZJ6A 2WQ6A 1IY1A 1JHRA 1NI5A 2Z2IA 4RHUA 3L1IA 4DQVA 2ATVA 1JSLA 4PYRA 1W9HA 1SELA 5THQA 2P2YA 2VXYA 1CG6A 4BWFB 5DI9A 4ZI5A 5DYIA 4FT2A 1GQQA 3V4LA 4ZTUB 2PMDA 2CYBA 5BMVF 3FHCB 2W2KA 1E7SA 4GPBA 3CMMA 3MUOA 1XCLA 1E8NA 2YR0A 4OU4A 5JWRA 1Z13A 4G5QA 4P80A 3OIWA 4YECA 2QM7A 2QEQA 4M9ZA 3Q6IA 1VPWA 2QZ9A 4K40A 4HQRA 4M1KA 2FMIA 5DTRA 1ULZA 1A1SA 4J0FA 2FFJA 3B2EA 3C39A 3K6JA 4I3GA 4PLFA 4ZVLA 5KU7A 4ARVA 1GOTA 2Y0CA 4HWPA 3B1KA 2E6UX 3FCUB 3W5VA 4QRHA 2NU9B 1FB5A 1Q95A 1U11A 3DEIA 3IMGA 3PDHA 1DJPA 4K0KB 1X7ZB 1A9SA 1L1RA 1CT9A 5TGZA 4DE5A 3LBFA 1NI4B 1M2HA 2VUTA 2JARA 4V03A 2Y1DA 4L72A 3QMWA 4HRVA 4N3GA 3TZHA 4JVNA 4NYMQ 2SBTA 2Z43A 4YXWD 1TO1E 1CR6A 1AS0A 1J5PA 2V54A 3MJRA 1IOZA 5IDXA 1D0IA 3KL2A 3B1ZA 2RE8A 1PBNA 3D8RA 4M9QA 2D2FA 1WEHA 5DN6A 3K1ZA 3FPLA 5EYPB 4KGXA 5LZ9A 2C4VA 4WSOA 2QZPA 3PEWA 2OFXA 2NP6A 5EJ8A 4OHZA 3H5TA 4I9HA 4M0PA 4CKBB 5F3RA 1MR3F 4BN4A 4CMEC 4DDUA 4QASA 5EMNA 3BXXA 4EQZA 2B37A 5HZMA 3O1HB 2GFHA 4A0FA 3EDOA 3L1VA 2FAXA 2WJ4A 2D06A 5J4HA 2AE2A 4KN5A 4OQNA 1ZD8A 4Q4HB 4O2BA 5KBYA 2YFHA 3B12A 1O1YA 2FP3A 3CKYA 3LS2A 2OXRA 2PS1A 5JAUA 3OWHA 3U60B 1M2KA 5ESDA 3QVLA 3L93A 4TXNA 2VTDA 1MEEA 2Q1XA 2R6JA 2ZTHA 3QLUC 3EA5A 4FKMA 1K5PA 4G0UA 1BXGB 1DRWA 1T8PA 3LUAA 4PZYA 4YRTA 4A4DA 2QU8A 2ODAA 2PN1A 3TSCA 1HLDA 1SOVA 2IYWA 5JJIA 4Q3NA 3C41J 3U7FB 5L4NA 1EUCA 3GDWA 3KUUA 3RUHA 3TKAA 4TMTA 4MKZA 2CXOA 1B43A 1V8FA 4G36A 5C1PA 3K8YA 3EZ2A 4CEIA 1BGXT 1LLQA 2ZRHA 4L4UA 1X14A 1NMQA 4HGYA 4MRAA 4PX9A 5DI3A 3ZOKA 4EJSA 2K7FA 4YPFA 4F4FA 2E85A 2NTEA 3S2SA 1HOTA 2VLIA 5H4HA 2PFKA 3SDBA 4FR5A 2BGTA 1Q91A 2A88A 1O9HA 1KI4A 1Y63A 3KUDA 4PLHA 4Z9FA 1E3QA 3UYLA 4EG6A 3SWWA 1L7PA 2QTMA 2V9ZA 1PIWA 4QU8A 4Z4FA 2O4CA 2XWBF 2N75A 1W1IA 3C70A 2XWQA 4I55F 1DGQA 1TMGE 2G0NA 5GOZA 1S3FA 4DV4B 4BMYA 3NHUA 4MVWA 3ZH9B 3RJZA 1RAAA 3IPAA 4QELA 4E2WA 1MEOA 3UT0A 4BNXA 1DPFA 2ISSD 4Q6BA 2W83A 4YMIA 1CQJB 3KO8A 3Q88A 3L5KA 1RBQA 5JBQA 3O8QB 4EF4A 2WNHA 3HXKA 4QWWA 5JMPA 5SICE 3AC0A 3BTUA 1RACA 1Y9DA 5F3DA 2O1XA 5HVNA 1EP1B 1KY2A 5GV7A 4DBVO 2D3TA 3BMXA 1R9GA 2FQQA 1T8TA 1PT5A 1N5LA 2AF3C 1F4LA 1COWD 1D4AA 2OWDA 2Q3DA 2YIVX 3CZ5A 3H42B 1O96B 2HNAA 1JN0A 2ZWAA 1P44A 3DL7A 4M1OA 3U7GA 3IBCA 1AUOA 1L4NA 5TIIA 5EWLB 1MXHA 4G1BA 3VKWA 1F7UA 2LXNA 4GBGA 4GPAA 1E59A 221PA 4FJ0A 3DR5A 1AC5A 1ZCAA 2I7CA 2Q5FA 2ANCA 2PTGA 3C43A 3K0CC 3N2KB 4TTJA 5CDTA 5AJXA 5EXTA 3QPUA 4JJ7A 4M60A 4YR9A 4BO8A 4HK4A 2OZLA 1E9VA 2PYIA 2VJMA 2XTMA 3O1LA 4PR3A 4XEUA 2AQKA 3I0ZA 2ZJ8A 2QD2A 4UM5A 3J7AC 4U4AA 1VE9A 5AI6A 3GRAA 2HQBA 4A8PA 3T5AA 3O03A 5JSZA 4HO1X 2J3MA 2OECA 1UFRA 3MJFA 1UDRA 4O33A 4U2CA 1Q16A 3SG0A 1MO3A 4YVFA 2O07A 3DMDA 3RVDA 4UD6A 3Q0TA 4JI4B 3AFOA 1ZVMA 4FFBA 1UMDA 4TLAA 3GLUA 3LBHA 3N8GA 2B21A 5GJCA 3SJAA 1CJCA 2C5SA 4TUYF 5KTTA 2NZ8A 3HNOA 1OHHA 4NRDA 3NHYA 3IUBA 4JQOA 4LOAA 3AIKA 3Q3JB 2R87A 1AF4A 5CXUA 3JATA 4BV2A 1KQFA 1VG0B 5FBHA 2VHZA 5A9TA 1LWNA 3NBKA 1DUSA 4R8VA 2CT8A 3ZDBA 1Z7WA 3C3YA 1J90A 2V5VA 3ILYA 4QDOA 5ALQA 3VYSB 1Z0DA 1IUOA 2PH5A 3U9TA 4I4TA 4PAGA 3WGUA 1H65A 3OIGA 1MP0A 4LNUB 2OHFA 4OAOA 4EGJA 4R9RA 1ORIA 4WOBA 4D4JA 2AEJA 3IQEA 1WHSB 1US8A 3WIUA 4A92A 5TPZD 1J70A 2BSQA 3VSBA 1WBDA 1G7TA 1QJ4A 3WWZA 5EHQA 1I2BA 1A9QA 1XTBA 2XDYA 4WV3A 4DTIA 3D1LA 5E9WA 3HBFA 3OQPA 5FWYA 3AY0A 4UCXA 3BZUA 1NXWA 1KXJA 2EBWA 1PW5A 2GS9A 2JI9A 4G0YA 1G2OA 3ZZMA 1BVHA 1Z4JA 3KJHA 2O5RA 1UOEA 4C3VA 2QTVA 4DDKA 3A6LA 4G37A 4MP6A 3CTPA 1GUYA 3KFXA 4L73A 1YR8A 3KZNA 4PIPA 3P4XA 4FDLA 3UXYA 4J6EA 1H1TA 1VCHA 2G80A 4LQLA 1RXWA 3GPIA 3OP1A 3ETEA 3W2FA 2XQKA 5MN6A 3ZLJA 3QU7A 1H93A 2QN6A 4Z0HO 3B6EA 1FL9A 3QU2A 4KWIA 3ZK9A 3JQAB 3SX4A 1JHOA 1RC8A 4C7BA 1JEQB 5DXAA 3A4YA 4EFKA 5B7QA 3FOEC 3O6VA 3GAFA 4OMUA 3K32A 3PQ6A 4J07A 5PGMA 3ZD8A 1QF7A 2H7XA 1JHQA 1TA0A 1V16A 2B4QA 1FTQA 2VUIB 1WUKS 3CLSD 3CWQA 3KLOA 5KOJA 3F67A 4HWSA 1QUEA 2GWRA 4R1LA 4DCOA 3DLCA 3REOA 2Y0EA 1HFKA 2AC7A 3MB5A 3VO8A 2UYGA 3PE6A 4HQ6A 1KPIA 4QATA 4HAVA 2JI8A 3QF4B 4I5GA 3NYWA 1I7NA 1X87A 2BUAA 3U1BA 5LA6B 1CNMA 1VXOA 1YK0A 2FSFA 3P0FA 5BOVA 4I50F 4GF5A 1KY4A 2RHRA 4DILA 3U3ZA 1KJQA 2XYPA 5DFAA 1KYVA 4MJ7A 2EJBA 4V38A 1FCJA 2FPIA 3WYAA 4GH5A 1R3DA 3DWEX 1EP3B 3BMOB 3S27A 4YK7A 5HXAA 2DPXA 1Q7TA 4I9UA 2PGOA 2IIVA 1JHUA 5B6JA 2NU6A 2FJUA 1YUBA 1LDBA 4FQ7A 5EHZA 3ZZTA 4MW2A 4UNRA 3WC4A 5AVYA 4ZYXA 2A9FA 4QO8A 1YI0A 4IDQA 4B17A 1H2EA 2O6HA 3NW9A 3H5VA 2FLVA 3UCXA 4ZVQA 3LTNC 1EXDA 1T6ZA 2VHYA 3X2FA 4ASUA 1E5DA 2ZSEA 5ESWA 1GR0A 3FPBA 1XZDA 3E03A 5FBZA 4R3NA 5HZGA 3G68A 3BJMA 4YXFA 1LGYA 5EE1A 3D0RA 2QWXA 2FUG1 2H63A 2VPYA 1BKSB 3CX7A 3CVYA 4ER6A 2BM0A 2RGNA 3OZTA 2H1CA 5LQDA 1WCYA 1O97C 1NSYA 2PGAA 2W2MA 2D2XA 2CCJA 5F76A 2Q8QA 4EX7A 1A95A 2C5AA 4QBIA 5CVVA 5ALRA 1NN0A 2C7PA 2Z4RA 1NNI1 2C1EA 2IEBA 2R11A 4G1VA 1VJTA 4H27A 4WQMA 1GFSA 1EVZA 2UYQA 4H0CA 2WTEA 2QGZA 1XPUA 3L07A 4HWTA 4UVHA 1KO8A 1OZFA 2DR3A 2ZQZA 4ZXPA 4YRCA 4AQDA 1G0OA 3CSSA 4XDYA 4CKEB 4X9XA 4XGIA 1L5HA 5F64A 1MAAA 3TBKA 1NYTA 2WQZA 2BM8A 5KI6A 1K3FA 4PPFA 3OIVA 5G0UA 1HZJA 3DP9A 1W94A 1XL1A 3V4ZA 5BW8A 3AI2A 5BY2A 3AB3A 4FMCB 2Q1WA 4J1TC 3H5IA 5BNWA 2VN8A 1JALA 1WV0A 3FOZA 4MV9A 4YCLA 4ZEWA 5J4KA 3A1EA 1W9MA 3WTBA 2OB2A 3DZKA 2XMPA 4BFXA 4EG4A 2D74A 2AG5A 1GUDA 3DBHB 3ZQJA 7MDHA 1ADBA 3EFHA 3AP1A 4B3RB 1EVKA 4PYQA 3QFCA 4A8JC 1MJFA 4WY5A 1QVRA 3HEMA 2QQGA 1B8VA 1Y37A 2O1WA 5SYNA 2X0RA 3L7NA 1IG0A 4F4JA 1LJUA 4HFRA 3CNHA 1VSTA 4UUQA 2BFNA 5FOVA 3EF3A 3ZDZB 1B23P 1JEAA 2XHZA 4KVAA 2CNLA 3U3KA 3EFOB 1C1YA 1E9FA 1XCMA 5M29A 2EJUA 2B8NA 2YHIB 3H1FA 3VDXA 5BQFA 1L7XA 4WFQA 2NV2B 1AB5A 1P8JA 1W44A 3B82A 2ON6A 3CTMA 4YMWA 1W88A 5ALWA 3RTGA 1U0EA 2JCXA 2HHLA 1Y1RA 1GV1A 5AJUA 3WB0A 4ROTA 1LFAA 2R00C 3KTDA 2HSDA 3K4PA 5A1TA 3CCBA 2ISCA 3JR3A 1AX9A 1MIOB 4FC7A 4C9BA 4QTYA 4LGMA 5A4FS 3HB1A 3IEMA 4TL8A 4OLJA 2QRLA 4DAEA 5EKXA 2WKQA 3OT4A 2QP4A 3ZUGA 4ZJYA 2UVPA 1R74A 2MYUA 1NNUA 2FMXA 2GHIA 4IQGA 5AW8A 2WU3A 4KIFA 4L22A 3CZAA 2JHPA 1E0AA 1I7DA 2C07A 2DQSA 4EW2A 2DM6A 5EIBD 1XXLA 2YHUA 1COZA 2ORWA 5L7TA 1Y1KE 4MULA 4QT0A 3MQ2A 2BFDA 1G6OA 3DXYA 4YAFA 4LQCA 4CV1A 2O2ZA 4XFDA 5J2TA 2GGSA 4UCQA 1XBTA 3HCNA 3R3JA 5EP1A 1L8AA 4F2DA 3G2PA 3Q8LA 3BD8A 4OQPA 2HYDA 4D3DA 3M2PA 3OESA 1FVFA 4IGFA 3HCFA 5J5VA 4G4GA 3TPFA 3F5FA 4D5EA 4YPOA 5A0VA 5BQ3A 3H5LA 1HZZC 4NMHA 3F6PA 1C7EA 2CJWB 3GYBA 3Q5GA 4Y7DA 3A14A 3NVKI 5JJBA 2CXNA 2QP9X 5F9FA 3STWA 1YZUA 3EH2A 1DDOA 2XXBA 3PEUA 5AK0A 2P2LA 3P0JA 3U40A 3UAXA 2IS4A 2OCGA 3TQHA 3K9QO 5FP0A 3FOFC 5DJ5A 4Z6KA 6REQB 2BD0A 3DT9A 3BK1A 3BQMB 3F7TA 4MVJA 3TXYA 3GVPA 2OD2A 5C7YA 4E3WA 1I6WA 1WD7A 1RKVA 4NF2A 3A26A 1ZD5A 2QUJA 1MV8A 2FPOA 3S7ZA 4M83A 3B9BA 3G2MA 2FSPA 4ZK6A 5ADVA 1H8ED 1YB6A 5JDCC 3L0BA 3V8EA 5C1BA 3TH5A 1DQNA 1M33A 2GCGA 3IJ5A 4H3KB 4M9SA 4BFUA 4J0CA 3ZCSA 1U4SA 3W8DA 1UKYA 1PD1A 1KZGB 3W5AA 3AVTA 1KYZA 4JDPA 1UBKS 4O29A 4FW9A 2FMTA 5FOXA 2I3DA 1EVQA 5THXA 3PE3A 2AK2A 3Q10A 3SHVA 5REQB 2VQ3A 2NZYA 4KGVA 2YMLA 1CZHA 4NJMB 4TXHA 1K6MA 2VDKB 3AJAA 3SHTA 2HU7A 4R40A 4QFCA 2AMJA 2XLBA 1JR6A 2OO5C 3DBRA 1GL3A 5B4TA 1Y3CE 2QJWA 2R6GA 2I65A 1KHTA 4K9QA 2ZTVA 3BFVA 4EG1A 4F2HA 5KZMB 4FCVA 1V7QA 3CS3A 4LSMA 1TNDA 4IUCS 4DMKA 2Z4TA 1U3FA 2ZIXA 1Y5RA 2UZ1A 4NS1A 2AR0A 1N0WA 1KGSA 2QPLA 4EQ6A 3EVEA 4R5MA 2GEDA 1LPSA 3NEPX 3RUDA 1X1CA 3JQBC 5LKRA 3BWMA 1ABFA 1GP2A 4Q7MB 3LVRE 3RNOA 1EM8B 1JVBA 1GDHA 2NU7A 5I7VA 5T6BA 3A4VA 4E94A 1A69A 1P9NA 2ISQA 2GUGA 1KFJB 4I08A 4O4IB 2J1LA 4AN0A 5JR3A 2UXCB 2O8DA 3QHAA 4N7BA 1JHXA 4QGHA 3SZMA 1CIJA 3PKZA 4NK5A 2BMDA 1VCMA 4LISA 4D26A 2Q07A 3AI3A 4JLDA 4MS3B 1ZAYA 2WDPA 5SZHB 2FZ4A 2V7QA 5LA6F 5AM1A 3LA8A 3EAGA 1TCCA 4EFLA 5BYBA 3ANLA 3FZEA 3V2UA 1RPNA 1XZCA 1Q1BA 4PGFA 3V4RA 3L7BA 5CNIA 4UPVA 3SPXA 1NN3A 5HP4A 1QV9A 4O8ZA 2YWXA 2ZKLA 3FM9A 4PN3A 2EWVA 1E58A 1ZMXA 3W6UA 3DAFA 3E4DA 3HG7A 4EO4A 4Q1EA 4OQQA 3EAQA 4A0GA 4J7AA 4ZI7B 4NENA 1VBMA 4MGHA 4ETIA 1DT3A 2IVZA 4RJKA 4ZO8A 4QXOA 1A82A 3WYGA 1THTA 4OGFA 2ZRNA 3EDCA 3GJYA 3JR7A 2JGRA 3KEGA 1T1RA 4MV1A 4S35A 4EZIA 3JQEA 5IDWA 3THOA 5IDVA 1OTYA 5F1KA 4BFWA 4ROSA 2JD2A 2PZKA 1NM5A 3RBZA 1ZYUA 3LF1A 1T5SA 2GN0A 1UKAA 4LBWA 1X7WB 4R1NA 2ZWIA 2M6KA 3GG2A 3BCHA 2OORA 3GRPA 2F9MA 4RQBA 2HV9A 3K0SA 1RXUA 3L2OB 2C2BA 3O1IC 5FWXB 2ZUWA 2AFVA 1BROA 2YXNA 3SD7A 1EXVA 3H83A 4CETA 5E9JA 4KRFA 3C8UA 1JMKC 1JQLB 4JROA 3IGFA 2VHEA 4Q9JA 1ECJA 3AUAA 1P17A 2GCIA 3KYBA 5F33A 4YV2A 1Y4ZA 4HFMA 3ZD9A 1NJGA 5DWDA 4MMYB 3ZE7A 5JH7B 3L8CA 1U0NA 2ZVDA 2ZIVB 1TF7A 3TLEA 4EB0A 2R48A 2WYOA 2XY4A 4K88A 4LY0A 3PT9A 3QEMB 4MI6A 4XXHA 5C8YA 3U17A 4EYOA 2XCQA 3ESXA 2IRWA 3R0VA 5D51S 1DPGA 2EV9A 1M6YA 4F1KA 4Q4LA 4HQFA 1SOUA 1PJZA 2PXCA 2YW9A 1C0LA 2GK7A 3KFVA 3TEJA 3GFTA 1DEHA 1VSVA 2Z8XA 1U2EA 3I4CA 4D2IA 4DDMA 1YASA 3KZCA 4CE6A 2I03A 1YDGA 1KEEB 1SK9A 4Q24A 5JVDB 3JQ7A 2J7PD 3EG9B 4BKOA 4EHFA 3L8YA 2V5UA 2REBA 1Z18A 1RI5A 4DS3A 4I8IA 1XYGA 1WP9A 5LDDC 4KJZA 1XZMA 2LKDA 4NZOA 4HTFB 3U7RA 5BN4B 1WZNA 4DMGA 2B20A 2D2IA 3QKUA 5A6SA 3IXQA 2VZ9A 4QUJA 1VKOA 4QJBA 4V02A 1NIJA 4QM7A 4QUIA 4TKVA 4ENUA 2AZTA 3HJRA 4H08A 1UT6A 4PQGA 4UHDA 3VSDA 5L7WA 3KKNA 5FTWA 3WYNA 1ANKA 3TUJC 4MKHA 2OHGA 5G02A 1CZNA 1CR0A 5CFZA 1PNVA 3IRVA 4MRVA 5HGXA 4NMWA 3ZTWA 1XCJA 2CLIB 3ICWA 3I6IA 1NPYA 4PC6A 1WMBA 1PEYA 1PG2A 3DMFA 3F96A 4V0RA 4AP6A 1TD9A 4CQMA 3D6FA 2QQ0A 1ZLXA 1V7ZA 1UINA 2ZPUA 3IEIA 2C9MA 3QQ5A 4AZTA 2C7QA 1E2QA 1E7RA 1NU6A 1HQYE 2GBLA 4LQDA 1GSIA 1P7PA 4N40A 1CRQA 1DTWB 3C6XA 3IBTA 4GQBA 4WA7A 3BFKA 1G9TA 3DMTC 1Y3AA 2DSTA 3GLKA 3RT1A 2QTRA 3A3KA 5TS2A 2LE0A 5GIPE 3BF7A 4US0R 4WN9B 2F6RA 1M2FA 2QB5A 3E7XA 4NKRA 5AHKA 3UJ9A 1DAHA 2C3YA 4M89A 4RIIA 3R7BA 4D0NA 5B7NA 4DYVA 3A0UA 3KQTA 1GILA 1WPXA 4G5OA 4L0CA 1KO1A 5I8WA 4ZA2A 3OCXA 3OJFA 3DNFA 5AXCA 4EUEA 1DX4A 2YVQA 1X70A 2F43A 3I3OA 2I91A 3K30A 4Y3UA 1M10A 4QYIA 2ZDQA 3FAZA 4BFVA 4C0BA 1QYDA 5KNBD 4J0KA 4QUGA 3T52A 3SXUB 1GNSA 3M2TA 1PQYA 4EMTA 2JGAA 4KWHA 1Y0BA 2GVDC 5E4YA 4V0NA 5EJFA 1U9JA 1UCFA 2Q4DA 1KO5A 1QRRA 3BWXA 4Q4CA 2GZRA 5C5CA 2CD9A 2LKCA 4OHMA 4BVFA 4QXMA 3AGQA 5CB8A 1QLWA 4WJLA 1FSSA 3KT6A 3KOMA 3UBTA 4QHSA 1TW2A 3GRVA 2JW5A 4ER3A 1JQEA 1A0OA 1IXZA 1UPXA 2IPMA 2R1UA 1MDFA 1ZK4A 3R7SA 5DB4A 3PQ2A 4N5LA 4CJXA 3BH7A 2RH5A 3AEQB 3CXUA 3RSQA 5FBLB 1G20E 4PWZA 4Y1FA 1G16A 3RF7A 4YXWA 4ABYA 5G1PA 2V45A 5INTA 1QF9A 4CMIA 3RHFA 2C0QA 1SUAA 1P39A 2VBCA 1JI3A 3LWZA 3F6EX 3N5CA 3F6BX 3V8BA 4E30A 5KJ1A 2ECFA 2ID9A 1UBUS 2V7EA 5I3ZA 3C3DA 1QH1A 3ODGA 4M6WA 1GCIA 2EW1A 3IHLA 3GIDA 4ZOLB 5LYJA 3GP5A 3AIOA 1E6EA 5CA1B 3DXXA 3SSOA 1H2YA 1YOVA 1FDWA 1W7AA 5BN3A 4AICA 3HP4A 1XTKA 2W2PA 3NU1A 1U6IA 4MO2A 2ZDHA 4U6NA 1ZCZA 1ZK3A 1GEGA 3EOZA 4B0OA 1G7CA 3NAZA 4PW0A 1CUHA 4X20B 4TTAA 3WIBA 1XZPA 3IEXA 4F21A 3BK2A 1IG3A 4LVCA 5TXGA 4EUHA 3BRWD 1DQSA 3DE1X 1ZGCA 3LUHA 3NTOA 1GUFA 2NQ2C 2I62A 2VA9A 2ZRBA 1W46A 1EFUA 4BMZA 3IKTA 1ZGHA 1RWNA 3D3EA 3WYBA 4XVRA 5KQGA 2M6SA 3CUSA 5K4GA 1BJTA 4QSMA 5IWAB 1NUHA 3NRCA 5EIEA 2GPAA 3PEYA 1SQ5A 1G9SA 3VFDA 4IV5A 2P5TB 2HMYB 3MAGA 3WXMA 2EATA 3I37X 1T5IA 2JJYA 2OUKA 4LMBA 4UPEA 3CSUA 4B85A 3ONFA 2RHCA 5ITZB 2G4VA 3LL4A 4PE5B 2PFGA 4AAYA 2A5GA 5CT8A 1K4MA 1LX6A 1OFUX 3L0CA 4D9MA 2XCUA 1I01A 1N2CA 3QPWA 4Q9AA 4FSHA 1QR2A 4TV9A 5K4HA 4HNAB 1WUIS 2JCSA 1FW8A 2GD2A 2P4QA 4BYMA 2JGLA 1E5XA 1FUIA 3IDZA 1FFWA 3G5LA 4DUGD 2WUWE 3C16C 5EQDA 3H19A 4AQYB 2FUKA 2CDNA 1EVIA 2A9VA 2YWGA 2W2QA 4E11A 3FSRA 3MQFA 3AFMA 4IJWA 2A35A 4RSMA 3CLVA 2GPYA 4I19A 3LUDA 3JVDA 3L0ZA 5FL7D 4ZI7F 5DH9A 3CEPB 1MC1A 3L6RA 1OYWA 2FWRA 3T1QA 1GEEA 1XDWA 3DOIA 4MWEA 5FUMA 1S1MA 1YUNA 4US2R 5DNYB 4NE2A 1COWA 1DC7A 2TRSB 3VOAA 3A36A 1R8JA 1NVDA 1IEWA 4GC9A 2J9FB 2XPCA 3F6YA 4JYMA 4RVHA 1SGWA 5HDBB 1GPUA 4UUPA 2WTUA 1JAIA 3GRUA 4CV2A 4C03A 3MXOA 4DV0B 1T8SA 2X0KA 4TTQA 4DV3B 2B98A 4NIMA 4DJTA 5ELXA 5KEIA 5DEIA 1GGHA 4JB0A 4QM6A 1KI6A 1R50A 3KG2A 2QTHA 3VC3A 2ZBGA 1P0FA 3G7UA 2RJ3A 4PAWA 3BXEA 1DB3A 2HRBA 3BSYA 3FPFA 1TA9A 3D6VA 2J07A 4RK7A 2WJ6A 2IUSA 2YHBA 5JH7F 2EZ4A 4LNHA 4KPEC 3BD9A 3MS7A 3OCYA 2HJSA 3KQNA 3PHBE 1GPNA 2JD1A 3PC3A 3FPEA 2AMVA 1XP8A 1RBZA 1U7HA 2BEWB 1JXAA 2ZBRA 3BCRA 1WDWB 1R37A 1ONNA 4WEOA 1JG2A 4R3UC 1MD9A 2W98A 4TQ9A 3LNTA 5EKDA 4DY4A 4EELA 4GUAA 5I9TA 2DLNA 3TTSA 1BVRA 3FNEA 3DVAA 5ALPA 5DX1A 1BMTA 1G8MA 3IEPA 1H6AA 1Y1QA 3DFUA 3VVBA 4DIMA 3M6FA 5JASA 2ZJ5A 2GZ1A 1WA5A 1VDMA 5DCYA 2JIOA 4M98A 4PY2A 3WHLA 3E70C 5CG2A 1WTAA 4ARCA 2NO5A 4JMLA 2F8SA 1Z4NA 3K6RA 3GPBA 5DIZA 5TPZA 1E2JA 4Z7OB 5DHRA 2LW7A 5G4KB 4ZYUA 5EXDA 2C2YA 1H8HA 1PGOA 2B1IA 4MWBA 5E38A 3PLAE 5A62A 4K28A 3AHGA 1XX6A 1LVGA 3RHZA 3WNCA 5JNSA 5KSOA 1FP4A 2FOLA 3FCCA 2WF7A 3EEIA 2I4OA 3L40A 4GYJA 1OI7A 3VI4B 3EXIB 3AV0B 4IIJB 1RXSA 2J33A 2AK3A 4XUCA 2J48A 5GZ6A 3NS7A 1CDZA 3UOAB 3CZ9A 1QP8A 1CRWG 2YY6A 3PFHA 4O1MA 4Q16A 5AK4A 3SLKA 3UMGA 1OLUA 1HDZA 3L7JA 3U3RA 3FKSD 4IG4A 2GBCA 1C14A 1JU9A 2AN4A 2YZ7A 3HGMA 4KRGA 4S1NA 2VTKA 4GZLA 4AMBA 5LQKA 3AK4A 2EX1A 1Q7EA 1ETUA 1I32A 3BWYA 4LDPA 1E2HA 4RMIA 1WQ3A 3NBMA 3AHHA 4JL8A 4EG5A 1JFFB 1PFUA 3WADA 1J42A 4LRSB 4Z0NA 5LNK6 1NA5A 1YRWA 2DKNA 3MJEA 5FA5A 2BFCA 3PBKA 5T3YA 4AZSA 3AYXB 4JC8A 3NATA 3ON5A 2MIIA 2KB0A 4RZIA 3RVSA 1KYIA 5HUJA 2BI8A 3PPWA 1VIVA 3GFPA 1Y4DE 4UUAA 5CVCA 5C37A 4BNJA 3NX4A 4DL9A 4I14A 2HNKA 3OMXA 5KAMA 4HUQA 2P4HX 5DE3A 1CHDA 3IAFA 1GNVA 4JJKA 4FUQA 4BNMA 3PUZA 2MSCB 3UM9A 1GPMA 3LHDA 1CUDA 3W06A 2EHDA 2VLBA 5I9MA 3MVEA 2BAGA 1R0KA 3M5DA 2HPHA 2IS6A 1I7LA 4AZ3B 4F56A 4KXQA 1JEEA 1SKBA 3PGA1 3FPGA 3B8EA 5LBUA 2XX3A 3DFMA 1RC0A 3ANTA 3RYHA 3LK6A 1Z17A 3JQFC 4YJ3B 1OXKB 4BOYA 3HKEA 4E08A 1JAHA 2FRDC 3UFXB 3G0DA 2PUVA 3CISA 1OXSC 3QWIA 3CT4A 2HHHB 4KFCA 1E2BA 2P9TA 3SBDA 5SY9A 1NUUA 4KDEA 4O2AF 3SQDA 3W7BA 1DAOA 1RRPA 2JFFA 1T2DA 4RIFA 4RA9A 3INTA 4ME6A 1I0LA 1FJ2A 2YJZA 3S68A 3TLGB 4BU0A 1QK3A 5I4IA 4LXIA 2QRVA 1Z8DA 1TT5A 3QJ5A 4JD5A 3UMYA 5F3WB 3BBPA 3IVCA 3HXQA 1CE8B 1UK6A 2IYPA 3A9CA 3WHPA 1J0CA 1W5SA 4QVGA 1V3VA 1OGJA 5KTKA 3DO8A 1QE3A 13PKA 3JTMA 4QEDA 1J33A 4OHRA 3NTVA 2ZRMA 4KKXB 2ZT7A 4U7PB 4ZOLF 4PYJA 3ZD6A 2RH4A 4U7JA 5CA1F 3LTEA 1J97A 1ZC3A 4Y1RB 4Z4GA 3MWYW 4QODA 4YMSA 1NJ6A 3EH1A 4E5SA 2PSJA 7AT1A 1T9BA 4C29A 1CHNA 1DKMA 2A4KA 3VDQA 4KNYA 3R5TA 3SHOA 3GI1A 1UR5A 621PA 4Q3CA 1NBOA 4RLHA 2QX9A 2GSWA 1EE9A 2H1VA 3LT4A 4AWAA 4IDBA 4EW3A 2EXXA 4RTPA 4DMUB 2NXCA 5DW3A 4D3XA 4B7CA 1LK5A 1PAUA 3GF4A 2AJ8A 2PGIA 2WIAA 2ZYGA 1TAQA 2XGMA 1LWOA 1GA1A 1OZ0A 3BILA 3H1PA 1Z37A 4RD6A 1XEAA 3RWBA 1HDOA 2X3FA 1M2EA 5BYJA 3TXXA 3BGVA 3K73O 1MC5A 4RKQA 4D0SA 3D2CA 2OBLA 8ATCA 5IX8A 5AI5A 3Q8KA 5BYKA 2IBSA 4N0PA 1X1SA 1Z75A 3U1TA 2MINA 4ZIRB 4R01A 3JVVA 3ZHOA 4X65B 2WTNA 2ORYA 3K70B 2VHUA 4RIGA 4W8HA 1C7QA 4R0NA 2JI4A 2G0AA 2NQTA 4EG0A 5CTAA 4YI5A 3FBTA 1U8YA 3P2EA 421PA 4IRXA 2Z08A 1V6CA 2DBRA 1QQBA 2IJGX 4G5RA 4PLZA 5H5JA 1W4CA 1VJ5A 3FHOA 3HA2A 4DCMA 3MG9A 1MT3A 5EQTA 1YGPA 3QLVA 1ZD4A 4PINA 1M2VB 4BVLA 4CDRA 2FW0A 2YN2A 5JJ5A 1X9HA 3CZPA 2J0QA 2CYCA 4YIHA 1NVVR 3AVXA 1YA6A 3L9WA 5TDHA 3DONA 1VTKA 1G38A 3LBIA 3UWMA 1XVIA 1BU5A 2HPVA 3AR9A 3OURA 5CYFA 3E22A 1AU9A 4PSKA 2GA9A 3AZPA 3OP4A 3CH5A 1OWPA 1QO7A 4A15A 4PLWA 3A3PA 3G6WA 4ZJUA 3GT4A 4ZVUA 4CKWB 1PQUA 4HEQA 4NOJA 3LCMA 1TB4A 2OZEA 3IT0A 4I1OA 3M3DA 1NV8A 2GO1A 4P82A 1U90A 4NHEA 4JP1A 4IFBA 4RDCA 2QRGA 4M1SA 1JG6A 1VLMA 1X6VA 5BT9A 4D45A 2H2IA 3E27A 3PFWO 3NWEA 3HUFA 2UAGA 3PYXA 1BOFA 4X8HA 1S2DA 2K4MA 3BMCB 3KPUA 3QTBA 4JI6B 2YBEA 4QKQA 1A9XA 4OVKA 5EJ5A 3WWCA 4HRXA 3GRZA 1F51E 1Y4UA 2HBRA 4Q9LA 3PLNA 4LC9A 1A4IA 4ENRA 5JS6A 2DQKA 2PUTA 2E49A 5DF1A 1Y9JA 3SOZA 4A5SA 5HS4A 1T4GA 1T2AA 3OSZA 4UXJA 2CXSA 3ZS8A 4V2UA 1KH2A 2ASVA 1SWWA 1TZCA 3EA4A 1LZLA 1W0JD 1X1DA 3I9LA 3PNBA 1P0CA 2VHQA 3FLMA 5BQOA 3SJCA 4L3WA 3MMNA 3AX6A 1L8OA 2QTFA 3MCAA 3V2IA 2IH5A 2H1FA 4RA6B 1KO7A 1C9NA 3CF6R 4REOA 5F9MA 3ETGA 1DQYA 3RNLA 4CI9A 3PUXA 4DC0A 5KIAA 4KXMA 2ID4A 2OE2A 1ZKDA 1D9XA 1P7ZA 4QPNA 2B99A 2M32A 4S1WA 3SDZA 1NJ1A 3C24A 1KVSA 1J39A 3QEKA 3QY0A 3ZIDA 5FTLA 2P1DA 1UMCB 2PSHA 1UBSB 2G1JA 1G18A 3C1AA 3JYOA 4GFDA 2IHNA 3ETDA 3C7KA 5JPIA 4NXMB 3N2NA 1DNPA 2RC5A 4MUKA 1QQAA 3ZK8A 1ZIDA 1P3Y1 1LPAB 2H1LA 4H6XA 1IEVA 2ZRGA 4ZI3A 1HNZB 5JFTA 5CH8A 4I9FA 3CT6A 4C0LA 1YE3A 5DWQA 5DYYA 5HZKA 4QU0A 4LPKA 5HPYB 3BQ9A 1R4MA 2EIXA 4K9NA 1XZAA 1J21A 1UWCA 2GEUA 1GGKA 3M49A 4CQMD 1T2UA 3C4VA 4AO7A 5HCIA 1W93A 4G23A 4PLPA 5HS6A 3R9IA 3GBPA 5FYDA 3SSAA 3CEMA 3EQ8A 1EWTA 3B2QA 2FQWA 3H99A 4GMDA 4FFOA 4BB5A 1HDEA 4URVR 1R5NA 1NMEA 2EBFX 3OPVA 1F17A 1Q2XA 2PZFA 3A6DA 3ZHYA 2PL3A 3ZOZA 4BNFA 5BORA 4GP6A 4QICA 4BAGA 1KFCB 1KMMA 1Z07A 2QJOA 3IPCA 1KDZA 2N47A 4FYKA 3AM4A 1LNSA 2IS1A 5KCMA 2R79A 4L9SA 4MWGA 2VP5A 2OCDA 4LRUA 4OGGA 1RYYA 4CTNA 4CIBA 3RUAA 3NTQA 1X1RA 2LP4Y 4MPJA 5GZ1A 3NJRA 1EB9A 2V98A 4NBRA 3AP2A 3KKEA 3W79A 4EG7A 3MS2A 3SICE 1ODLA 2WLTA 4EI9A 4AY3A 5CVUA 1Z45A 4LXTA 2QUZA 3LCJA 1NVWQ 3OY7A 1JIVA 1T0IA 3KLPX 4NL4H 5HRAA 1E32A 3FWZA 3FY4A 3SMQA 1II9A 2DWQA 3SQMA 2OQIA 4ZPXA 4O3MA 4RVCA 3BGSA 2GYYA 2VXCA 4CQNA 4N6OA 4OJKA 4W7HA 1IE3A 2VTVA 4BWYA 4IS3A 1AJEA 4IVNA 3JTEA 4F60A 3D1JA 5LOVA 1L4KA 1FYFA 1LBTA 1CTQA 2DBZA 5B3KA 5FWNA 3HVJA 2ZR8A 3HN6A 5SZIA 1RMQA 4C22A 1BAPA 2BLNA 5IKMA 2BKVA 2P5YA 3AEKA 1MAWA 2Q9UA 2VP2A 3UKDA 3BCSA 5AM5A 1H3NA 3LUBA 2R1TA 2B4YA 2PKEA 3WK4A 2XRFA 2QM3A 4J0GA 5AH0A 1X1AA 3DEJA 1FE8A 2J45A 1AM4D 2I1WA 3HPQA 2MCFA 3T5GA 4AULA 5IAOA 1NZDA 3GA5A 1HDGO 3AI1A 2PJZA 3LLVA 5TJ9A 3HTXA 3UOGA 4BGVA 1W1WA 5K09A 3ME5A 1SKUA 4B7XA 5JSQA 1JLLB 1QIEA 3Q0IA 2DLDA 3I6QA 3P9YA 4RFSA 1Q0HA 4RGVA 5K8IA 4BLPA 5GZ3A 3RQIA 4LW8A 4GR5A 4YJ3F 3NTLA 3TM4A 1P9RA 4L3OA 3WK9A 3PUVA 4XOIA 4P58A 3BWVA 1Y5MA 4DHWA 1AGRA 1OWMA 1EFVA 4YLGA 3KTAA 1GO2A 1YZGA 2V6GA 3B6MA 1AZWA 1NHGA 1HEIA 2BFOA 2V1UA 4IDHA 1XHFA 4GRAA 3VYVA 4RMHA 1X77A 2VOJA 2A7QA 1OXUA 4UNNA 3R23A 4Z99A 5DTIA 3TFOA 1ENZA 2KW5A 1XMIA 4JIMA 5FT9A 3EZLA 4ENWA 4FHGA 7MHTA 1JKXA 3A05A 3KX2A 1Y82A 2Z3ZA 5CLQA 2H0AA 2I4LA 1O6ZA 4YX9A 5JISA 1HYEA 5KQLA 5LMNB 4K9LA 3KELA 3FYUA 2VP3A 2IU6A 4G9BA 4P5PA 2FEAA 1Z7YA 4CDMA 4CKZA 1KSHA 2KBFA 3PGLA 4LOJA 4X64B 4YDRA 3VTZA 1Q14A 5FOSA 4W5OA 4JJFA 3ZGNA 2P5UA 2XNSA 4YQFA 4F86A 4U3JA 3EPHA 3FFBA 5IYZB 5K0SA 4MX8A 1KYYA 3GLIE 2VF7A 4YRJA 1WV1A 5ALFA 5F2KA 4LWPA 3C5HA 3IEUA 2GH1A 1UKCA 3WQQA 3UT5B 1T2FA 1WSBA 2WKWA 3MD9A 3R4VA 3WLSA 5D5PA 3BUSA 3DP7A 4UNPA 1R6UA 1QE0A 1UJNA 2J7PA 3GEBA 3WZ2A 1BGWA 3HJNA 2R96A 5FLYA 3THYB 5ELMA 3RJ9A 2DJIA 3BE6A 5DBOA 4QOJA 2JLCA 2V6FA 2VR1A 3A1CA 5E1OA 2AT1A 4LDQA 1RCFA 4L8WB 4Z5XA 5IAJA 1NVMB 4G5GA 4EVQA 5AVWA 4KR7A 3HCCA 2GTHA 3ZU4A 5AW3A 3AHEA 4IM7A 2EL9A 5LXTB 3FMIA 4M86A 4XGRA 2V9PA 4MPDA 2DPLA 5C34B 3LKDA 1ECBA 3VPBA 1KJYA 2A1UB 2SCUA 2WMDA 3A11A 4P34A 4XM1A 2ST1A 3PD0A 1VJGA 4Q5IA 2GEFA 1WDKA 9ATCA 1GADO 2B2CA 3T7CA 2R6HA 1FSGA 4JA0A 4K9DA 4NP6A 3ZCXA 5JWOA 1SA0A 5DMXA 3DLHA 3BA1A 3BL5A 1LRJA 3K6SB 1SVKA 1SG6A 1P1CA 3DOEA 3D7LA 4MUAA 5LJIA 1KH3A 1RMYA 1VI2A 3W0LB 1TE2A 1U28A 5E9QA 5BWNA 4QVIA 4KQEA 1YR2A 5AKYA 4I4NA 1M0SA 4FOOA 3M83A 3ITDA 4OSEA 3MT8A 3RS2A 3SYKA 1U63A 2A58A 3WGNA 3WBBA 4F4IA 3SQNA 3PPYA 4KZKA 4S0XA 1JR3D 4DM7A 5JBNA 4TLLB 1DAPA 5KNDD 3ESZA 1SUBA 5KC8A 5EPUA 3WNQA 1U98A 1A7JA 2GJ4A 4OXNA 2XMQA 5DT2A 3CVVA 3RB8A 1KEUA 3ELUA 5KNBA 3GLFE 3FDFA 1GG5A 2ACWA 4A16A 2DG2A 3WI7A 3CVWA 5DOZA 5CJ2A 4PS1A 2O8FA 2H29A 1V5EA 1B2LA 3QE0A 2WP0A 4KG7A 5IXJA 1UMBA 3ZDFA 5AKXA 1ZH0A 2VKTA 3KHKA 3L0DA 4C06A 4S1PA 2R62A 2KX7A 2QPOA 2BSAA 2AW3A 3RUCA 1FJXA 1G60A 3R44A 4KWCA 3DL0A 1SPBS 4KLNA 2WTMA 3HSKA 5CGQB 4D92A 5IUJC 2VRNA 5FNVA 5CD9A 2QX6A 5CFRA 4HAUA 4MH0R 3W34A 2ODTX 4GXQA 2GR9A 1VE7A 1QZXA 3TNDA 3HA5A 1H2HA 2LV8A 5MFPA 1XAGA 2FI1A 1XCGB 1LDMA 5ICFA 4C2UA 1Z2OX 3N75A 4WJZA 3KAPA 1HDRA 4X7RA 2AG6A 2JLSA 4OFXA 2AC4A 3DH0A 1R6DA 5A3SA 3MBIA 3UJHA 1QKKA 2QRJA 1Z16A 3UUWA 5TQ2B 1VIMA 4CL2A 4LF6B 4YRFA 1TJNA 4HBGA 2XDAA 2PUAA 1IUNA 3DZFA 1JI0A 1ZESA 4WCFA 4Y6OA 4B0PA 4FQ5A 1EJ6A 4KC0A 4BMPB 4URFA 2BF7A 2PXAA 2QTLA 4PLVA 1ZCFA 2XUIA 3SBXA 3REGA 4JR2A 1N9GA 5LD2B 2P9GA 2R7AA 1YHNA 2A0UA 4Q1CA 1NONA 3NXKA 2XKKA 3CLTD 4PC2A 5JG7A 4RDHA 3LLCA 4W6ZA 3M9XA 2CV0A 3UK2A 3UJPA 4DIUA 3L7KA 4HLCA 1ENOA 3BRWA 3DULA 2BMJA 4O4HA 3ABIA 3A9WA 4NJEB 1QSGA 2Q2QA 1ZUNA 2QTTA 2X5XA 1T43A 4N4AA 2X5OA 1CUBA 3OIFA 1GY8A 5KX5F 4E0BA 1RMTA 3R7FA 1HT0A 4NZNA 4V0ME 2G17A 3CNOA 4AJ1A 4C0QC 2HSWA 3O93A 1Q0LA 3FCOA 1NE2A 2VK4A 4D02A 3VNVA 3ICEA 4NZZA 2C8VA 4QUKA 4UTNA 4XWKA 3I39X 2XUGA 4NBUA 4TS4A 4Q3EA 3WBFA 3RLFA 1KEZA 1SY7A 1ZK1A 4FCWA 3JD3A 2P67A 2ZTUA 1U2DA 1G5FA 3AETB 1XRJA 3I92A 1Z2PX 4KL8S 3D3QA 4II3A 4RZHA 4RD0A 1U1EA 3DKPA 1PX2A 2UYYA 4FBMA 2BEVA 4KO3S 3KJGA 4RD1A 4YJGA 1BDIA 2V3CC 3ACBA 2V59A 3ND5A 2FMFA 3ZWWA 1M2OB 3ICVA 2I6SA 2R0QC 3N2EA 1FUUA 1HXHA 1RYMA 1W2WB 1RWBA 5FPQA 3UPDA 1OI2A 3R0IA 3GMTA 5DSZA 5EMKA 3HZZA 1XMSA 1NVUQ 4HDAA 3QKSA 1UAGA 2JD0A 4HPJB 1BWRA 4LYHA 1MMFB 4R4JA 5DHPA 4CLEA 2J0SA 4D6XA 2C3UA 1XLVA 2DMRA 4RZXA 4N8DA 4A2WA 4DUGA 4CKCB 4YONB 3ZI0A 2P2NA 2NIPA 2DCUA 1U5CA 3TAXA 1B0ZA 1Y8RA 2WHYA 3CR7A 3W2TA 5AVVA 3WNDA 5FL7A 3T7SA 1IN8A 3KVVA 3LFUA 3ABZA 1UDXA 1J0EA 2PH1A 3JWHA 2WTBA 5B57C 2BR3A 4PGAA 3RADC 1AVTA 2HRDA 1U9ZA 1BXZA 4Z3OA 1ZBDA 4WLNA 3G8AA 4IH9A 3DEZA 2O20A 1O54A 3MWEB 3ZYZA 3SJZA 3PD7A 1YR1A 2KLHA 2YCBA 4BGEA 1DHRA 5TRTA 4G1EB 2QV7A 2OAQ1 2C9BA 2HRQA 5M5BA 1HLFA 2I55A 3I04A 1A4UA 3Q1KA 4H35A 1APBA 1N34B 2JRLA 1NQAO 2QYHA 3C7TA 2G1AA 3N0TA 3KXKA 3K70C 2EJTA 5EJAA 2BFAA 4LZWA 3PWZA 1N4DA 3O0DA 2FP4B 2H5JA 1IJKA 1LC0A 2FPSA 1ZMBA 3IELA 3U5TA 5AI9A 5CIWA 5B37A 1CJTC 3OSUA 4XDGA 4LGCA 1ULHA 1ECGA 2Q5IA 4YAEA 1A97A 2B9VA 2CSUA 3VO2A 5LQUA 3L8MA 2F8MA 2G04A 2IUTA 4DLLA 4Z7JA 2OBNA 4K26A 4BO6A 3HWRA 2IY8A 1ORTA 3U3XA 4FHFA 4ARZA 3GDGA 5G3ZA 1D4FA 4UQLA 1A9PA 2QAJA 4KR3A 4IV8A 1TPYA 2BHSA 3ABQB 2W58A 3Q11A 3HLTA 1WU7A 2A5YB 1DUVG 2B78A 3A1UA 3TW8A 2WYWA 4II7A 4UOZA 2O7SA 2JIQA 1AK2A 2NYUA 5T8KC 1RADA 4IO0A 2XOEA 5FA8A 3CN7A 1B2RA 1Y3IA 3OJXA 5DHQA 2PMFA 2DUMA 2DUWA 5DX0A 3D8SA 3SKXA 4RTLA 1KOGA 1W1UA 1MQ8B 1L4BA 1YR3A 2X8JA 3UWKA 1QH8B 4ZALA 3V4FA 2OV3A 1B16A 1P4HA 1RI1A 3FVQA 3NP7A 3WX0A 4BVGA 1TQHA 1K6XA 2HI0A 1PWZA 2BFFA 2PKYX 5TY0A 2HSJA 4BLVA 2XYGA 5L9AA 5BVHA 2ANBA 5LXTF 1EE2A 1CXZA 1JYSA 3QVKA 3PZBA 1HQKA 1NKVA 2ALJA 1JFVA 4XX0A 2HL6A 4KXYA 1T10A 1SC6A 2QAGA 1GQYA 1AUXA 2C82A 2DH5A 3DAGA 4HQ0A 1W0CA 2VOEA 3FKSA 1ZZGA 2PJRA 2PZJA 3IR5A 2YOGA 3IJEB 4JEMA 2MWMA 2Q49A 1GKLA 3HACA 5BV7A 5IBCA 3JQ6A 4NAUA 3UJ6A 1RPJA 4RDIA 4AF8A 5CBPA 2NVBA 3KUXA 3T3NA 1QFYA 1Z62A 1B8NA 3HUUA 1QIJA 4EHLA 2PGXA 1GUAA 1NOKA 2O7VA 1HLGA 4OQLA 3MCTA 4IICA 4PRYA 2P3LA 3OZBA 4YNBA 1CV2A 2FR1A 2EG5A 1CCWA 1I2MA 1MQSA 1U0JA 5HRCA 3EGVA 3HI6A 4ON9A 1R0XA 4RO0A 1J5EB 2BM9A 3K2QA 1D5WA 1GT91 1R2QA 1V11A 2F3RA 2WFAA 3GFBA 4JQCA 4XQ0A 3VU0A 4YRKA 4BHTA 2AHOA 2O8BA 1B4DA 1IHYA 2ZUSA 5EJ2A 4YWJA 3ROMA 4E5VA