5B7QA

Structures and functional analysis of periplasmic 5-methylthioadenosine/s-adenosylhomocysteine nucleosidase from aeromonas hydrophila
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
249
structure length
249
Chain Sequence
ASAPILIQGAMDVEVETLVAALKDKQELTVGSWTYWQGTLSGYPVVVSRTEVGLANAAAATTLAMERFQPRLVINQGTAGGHDPALHRGDIVIGTKSFNMGAYRSDLTPAEQGVDPSKWHNFEVTMRLRDNGKLVEHSSFAGDPELVGRALGMADRYRHGRVVPGIIGTADEWNRQVARINWLHQTYQTAAEEMETSSAALVAEAYKVPFVGIRVLSNTDLHGEEFDPQTAIHCQQFVIDYAKALINGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MTA/SAH nucleosidase
publication title Structural and Functional Analyses of Periplasmic 5'-Methylthioadenosine/S-Adenosylhomocysteine Nucleosidase from Aeromonas hydrophila.
pubmed doi rcsb
source organism Aeromonas hydrophila
total genus 87
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature ec 3.2.2.16: Methylthioadenosine nucleosidase.
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5b7qA00
4F3KA 2A0YA 3KU4A 3KVVA 1Y1TA 3INYA 1OVGA 1JE1A 3OZEA 4LNHA 4TS9A 3NM6B 4DANA 1OV6A 2H8GA 4TXLA 1OU4A 1Z5NA 1PWYE 4DA7A 3GB9A 3DPSA 1K27A 1RXSA 4F3CA 5F7ZA 4LZWA 4E1VA 1A9TA 4QASA 4OGKA 5ETJA 4BMXA 5CCEA 1ECPA 1TCVA 1Q1GA 1PR6A 2A8YA 1JYSA 1U1DA 4R2WA 1Z5OA 2I4TA 3BSFA 3E9ZA 4L5YA 4QARA 1Z33A 1OUMA 4M7WA 4NY1A 1CG6A 1OTYA 3FUCA 4YO8A 3T94A 1T0UA 3TL6A 4F1WA 1SD1A 1PKEA 3EMVA 1JE0A 1CB0A 5B7QA 3BL6A 1JDUA 5DK6A 1PF7E 3O6VA 2QDKA 4PR3A 3K8QA 4TXHA 4FFSA 1PK7A 3KHSA 1LVUA 4L0MA 1T8WA 1ULBA 2B94A 1NW4A 1Z35A 2AI3A 1RXUA 1OTXA 2AI1A 5F73A 2Q7OE 1PW7A 3UAYA 1YQUA 4L5AA 1XE3A 3UAWA 4F2PA 3C74A 4DABA 1G2OA 4LDNA 1PR0A 4GLFA 1A9OA 4JWTA 5CXQA 4UC0A 1JDSA 1U1GA 3EEIA 1Y6QA 4DA0A 1V4NA 1VHJA 4M1EA 3UAVA 1PR4A 1WTAA 4BN0A 4PNPA 1ODIA 4MARA 4L5CA 2OC9A 1B8OA 2P4SA 4TXNA 1JDZA 4TXJA 3KVYA 1RR6A 1B8NA 4DA6A 1Z38A 1JP7A 4F2WA 1NC1A 2IQ5A 4YJKA 4YNBA 3P0EA 3FB1A 4D98A 3PHBE 2A0XA 3E9RA 3OOHA 1TGVA 5CXSA 1PR2A 1Z39A 1I80A 1NC3A 1YRYE 1QE5A 4MCIA 1RXYA 4OY3A 3KUKA 2HN9A 3E0QA 3F8WA 5F7XA 3EUFA 4QAQA 5F77A 3PNSA 3ENZA 1A9QA 3UT6A 1V3QE 4U2KA 1JPVA 4OEHA 4G8JA 4WKBA 4QATA 4DAEA 4D8YA 3DJFA 3LBAA 1A9PA 1C3XA 4WKOA 5FAKA 3UAXA 1TD1A 2ON6A 1LX7A 2HSWA 3OZCA 3UAZA 4EB8A 1V45E 1PK9A 4GLJA 2I8AA 4D8XA 3ONVA 3LA8A 1FXUA 1RFGE 4DAOA 4TTIA 4KN5A 1YBFA 2OECA 4K6OA 2OC4A 1LV8A 5EFOA 4H1TA 3OCCA 4I2VA 4G89A 1Y1RA 2QSUA 3NM5A 3KVRA 3QPBA 5IU6A 3FOWA 1PR1A 4DA8A 4QFBA 5F78A 1U1EA 3IOMA 2A0WA 1A69A 4OGLA 1V2HE 3OZBA 3DDOA 1SQ6A 1T8RA 4TYMA 3IEXA 1TGYA 2ISCA 4WKPA 4MCHA 3ODGA 2HWUA 1U1FA 3PHCA 4L6IA 4X24A 3GGSA 1SJ9A 4R2XA 2GUWA 3PNPA 1N3IA 1JDVA 4NSNA 4TTJA 4TTAA 1Z36A 2AC7A 1RXCA 1RYZA 1ODKA 3OOEA 2BSXA 4BMZA 1Y1SA 3U40A 1M73E 4TS3A 1V48A 1Z5PA 1JDTA 1SD2A 4IP0A 5K1ZA 5CYGA 2QPLA 1RCTE 3K8OE 4WKNA 3NBQA 1A9SA 5B7NA 4LNAA 3D1VA 1Z37A 5F76A 1K9SA 1ZL2A 3OZDA 5F7OA 5CYFA 1YR3A 5I3CA 1T8YA 2AI2A 5EPUA 3FNQA 4P54A 4G41A 4OF4A 1RT9A 5B7PA 4R31A 1VHWA 1Z34A 5EUBA 1K3FA 3BGSA 3DF9A 1ODLA 3LGSA 3DP9A 3MB8A 4GKAA 1PR5A 5IFKA 2PGAA 4QEZA 4WKCA 4D9HA 3MMSA 4D8VA 4JOSA 5B7GA 3FAZA 2OXFA 3NM4A 3OPVA 4YMLA 4JP5A 1Y1QA 3BJEA 4RJ2A 5CCDA 1YQQA 1Y6RA 2HRDA 2QTTA 3FWPA 3O4VA 3P0FA 2RJ3A 3OF3A 4DARA 1VMKA 1VFNA 1ULAA 1U1CA 1ODJA 1TCUA 4LKRA 4TXMA 2XRFA 1ZOSA 1T8SA 1A9RA 3SCZA 5JPCA 1V41E 1PBNA 5C80A 4ECEA 1RSZA 2QTGA 5KB3A 3EUEA 5F7JA 4BMYA 4GMHA 4M3NA 4OJTA 4EARA 4NS1A
chains in the Genus database with same CATH superfamily
1RYFA 3CY6A 4R0NA 5AFSA 1X7XA 3OPMA 3W7AA 4F3KA 3EBLA 4IFTA 2X8JB 2XVAA 5AICA 3TAXA 1G5FA 3HKEA 3THYA 2NU9A 2ET6A 2GZDA 1JDNA 1NN5A 2PYZA 2HCTA 4MZDA 1FFDA 1E6CA 2H65A 3HJTA 1OIVA 4FIDA 1AZTA 2D8MA 3EUWA 3H2ZA 3DTVA 5ALVA 1LPBB 1YZVA 2CVHA 1IVNA 5CGZA 4BLSA 4DANA 2B1GA 4EKNB 2AMVA 1TM5E 2P78A 3HCCA 1Q7BA 3AW8A 2VA9A 2VQDA 2DY1A 2XKBA 3UK2A 4BFVA 3OAAA 2BZ1A 5T4EA 3ZBTA 4B80A 2WKQA 1YZHA 1E4OA 3EQ7A 4R2JA 1YR9A 2YWDA 3AYZB 4I4TB 4A1OA 1GZVA 2QMYA 4XX1A 2FZVA 3U48A 2EF1A 3R20A 4OXYA 4P4UA 2O2EA 1GDHA 2D8AA 3ZQUA 2PUHA 3KQHA 3HCWA 1J4AA 4W8HA 3QUTA 2W7TA 1XZNA 2GBLC 2BC9A 3LC1O 3P9QA 2QQ0A 4X20B 2F3PA 3L7IA 4LJLA 3M5WA 4OHZA 3DEFA 5MFPA 1IE3A 4UEWA 3W7VA 2H00A 2BFCB 3D6JA 1Q1GA 2HHAA 2J7PD 2JHFA 3HB1A 5E2BA 5CDFE 1FPMA 5IZ4A 4CW7A 3GJ7A 3IFSA 2CT8A 2JLVA 1TC1A 2IXGA 4H15A 2VOEA 4EPRA 1H2XA 2O14A 1B4DA 1PG0A 1Y3CE 3BSFA 3H7IA 4H4DA 4WCFA 3A36A 4UNIA 4EL5A 3DXYA 2PLWA 3OKAA 4D4GA 1Q14A 4XUCA 5DM4A 4IH9A 5J1TB 2K5UA 4IXMA 4FI3C 2O7NA 3N2ZB 3REQA 2PGNA 4CEJB 5HOEA 1N0HA 1TIPA 3KYBA 4D99A 1OLXB 2YINC 4M7WA 1N2ZA 1RYBA 1OT3A 3MSXA 3RFTA 1Z4MA 3TDKA 2ZIXA 3FUCA 1W36C 4Q12A 2I66A 4A2CA 4MUXA 2GF9A 5JT1A 5BW6B 4QL3A 1P6QA 3JRWA 4FKBA 4UPEA 3IYLW 1TYCA 1EGHA 3SJZA 1Z4KA 4WJKB 1BHO1 3MRSA 4C2TA 2BUBA 2IHNA 1IPHA 3LY9A 1SUFA 4K81B 2HTEA 3BCHA 2DLCX 3MLEA 3NC0C 4J0FA 4DLKA 5LNK6 2GB4A 3G5AA 3QUCA 3GG9A 5KU7A 4BWFB 5I6DA 4RTPA 4B3TB 2X4IA 4E5DA 3N6VA 1UT6A 3MTIA 4HNAB 1SC4A 4NCJA 2ID7A 3AOEA 1L7OA 4A0SA 4PX9A 3R24A 4D3YA 4EZIA 3TW6A 1JAIA 1A8IA 1CIJA 3CKKA 3PXCX 3GRZA 1O7JA 1XZLA 4XTCS 4B3GA 4BNUA 5LXTB 4DJFC 2QN8A 1GGEA 2AG6A 4J6FA 4Y67A 3HXOA 2D7CA 2Z43A 4O29A 2UVPB 4ZU3A 4ZEMA 1SG9A 4RJLA 4A8PA 1EVJA 1FNBA 1QLJA 1UZLA 3D3WA 3O74A 1HDYA 4MJ3A 1QIEA 4YRTA 5CA0B 1L4KA 2CMKA 3A1DA 3LVBA 3ZXSA 3GLFE 4NBTA 5JSZA 2ACEA 2AZXA 3JVVA 4LX0A 1OYWA 3FWNA 2H1LA 2PRZA 4I3FA 4IDAA 1A4UA 3TGPA 1T9HA 1Y82A 4L6AA 1CUIA 1JT9A 3OJCA 5HQJA 4U7DA 3DMYA 2XITA 1DFHA 2OCLA 3KJHA 3B2NA 1M66A 2QSJA 4ZQEA 1X70A 1KI9A 2REOA 3RYFA 4DIBA 2Q0SA 4EJMA 4W5TA 3AVPA 4BRWA 2QZ4A 2YMLA 1JALA 1V71A 1P9RA 3W4KA 1TMGE 3QOFA 3I4LA 1F8FA 3PCXA 4NK4A 4QZVA 1THZA 4RETA 1X87A 5SY6A 3KETA 4DG5A 1YHNA 4ZT2A 1PR0A 4O33A 2XF2A 2ZS8A 2I1WA 3MMNA 1F06A 1FVHA 3QU5A 3NG1A 4IJQA 2FEMA 1QCZA 4YDQA 5I7OA 4DIUA 1KDTA 3ETCA 5KQPA 3HDJA 1M34E 4P5EA 2C5GA 4WXEA 3U3DA 2LGJA 3MHPA 5FIUA 3I12A 4IIDA 4IDGA 3DMNA 3MJDA 3ZZTA 5B1EA 3KLBA 1OFGA 1II9A 2CXXA 2K2WA 3K9HA 2ZSEA 1CRZA 3DWFA 3O7MA 5DM1A 5BUCA 1A5ZA 4KITB 1SBHA 4GZMA 1K8RA 4CM4B 4G0UA 1X3SA 1PZEA 2BDTA 1XRNA 1PJ2A 4YALA 4DZZA 2SKEA 5IM4A 2IU3A 1VKOA 2GZ3A 5DHSA 2E7ZA 3O8BA 5TS2A 2FZGA 4WY5A 4BO5A 4NJEA 2IOFA 3KB2A 2ZS9A 1C1DB 4LJKA 3E23A 4YI5A 3NOVA 1SUAA 2PEZA 4XYMA 3BXFA 2ZRNA 3QVTA 4AUMA 1BVHA 2C0PA 4QUJA 1H9CA 2BGNA 2OZPA 1IFXA 2QENA 3INNA 4HDKA 4PG7A 3SDBA 1QVZA 3UO8B 1DX4A 5JDCA 4LXYA 1FS6A 1CZOA 2PH1A 1M8JA 4D9MA 2QB5A 1U8FO 4V38A 3II6X 2N9UA 3TS1A 4BGVA 3O90A 2O3QA 3LNCA 4QYTA 4AJ4A 4N0MA 4NAVA 4NR0A 3IP7A 1U63A 4G0XA 4S35A 2E4XA 3H0EA 3T7CA 1FLAA 4BZWA 4DSNA 4HGZA 4ALJA 3GLFA 5HTOA 5IWAB 4OJMX 1BQEA 2CJXA 2COKA 1QHYA 3I83A 3OZ7A 4QRIA 3WE7A 1TGVA 1B1AA 1NY5A 1KYTA 1RLJA 1WUHS 3TG8A 2R96A 5JECA 3OM9A 4LQLA 4P93A 2GPSA 2A86A 2R6AA 3A9WA 3CJRA 3FM9A 4M49A 4BQPA 2D2FA 4J7XA 4PRKA 5IS2A 3ZJVA 1OBHA 1DQYA 1XNHA 3VR5H 1HLPA 3AP2A 2NZWA 4Q05A 3AHEA 3VVBA 5AVOA 3ZY6A 3I1IA 3U7QA 4EG4A 7AT1A 4BGUA 1KHTA 1OWLA 1NQVA 4RVDA 3VSBA 3K0BA 5AI9A 2PUFA 4JV5B 2PBFA 1R6XA 5E9QA 4CKYA 1ZIPA 1C3VA 1GSAA 1LI7A 2GDZA 5K01A 3FCYA 4N8SA 1BE6A 4M1SA 1QBKC 1PZHA 3SKVA 3X3HA 5FBQB 1LPPA 1WETA 2IBTA 4EOGA 4P33A 3EIQA 1PD0A 2PBLA 3KKNA 2VZEA 3P2IA 3M3DA 5EAIA 2R6HA 3E58A 3HP4A 4ZJUA 1MZPA 2NU6B 1E1RA 4NESA 3I5YA 5ALHA 4NEHB 1E5LA 2XGOA 1TUEA 1Y9DA 1E1CB 3ZD8A 1NZDA 3EARA 3TLMA 1XD8A 1SVUA 3DFUA 2CJFA 2HJRA 2F48A 1TKAA 1RWXA 5IN5A 4YQZA 5KYGA 1XCLA 3M9XA 5M04A 3HWX1 4HAZA 4TT8A 1GAXA 2R4UA 1VZ3A 4DLZA 4B7AA 3RTBA 3FWZA 3K32A 2YXNA 3UHJA 5JWHA 1ORIA 1L5HA 2NO9A 1DEOA 2QP9X 3IQIX 1ZS9A 4O25A 1YQTA 3F3MA 2SHKA 1FLNA 4BNNA 4G5HA 5SZKB 3IMCA 2HSWA 4FX5A 4XM0A 1BU8A 3FFWA 3EWNA 4QICA 3PUVA 1ZXBA 3PXBA 4UTRA 3ZY5A 1LK0A 1MT3A 1JFLA 1ZY2A 1VHLA 3C6KA 5A71A 2PO5A 3J7TA 3UBMA 1X1BA 1KIFA 2QRVB 5EIFA 2EQAA 1PG2A 1E8DA 1II8A 3FUWA 1ZUNB 3K5PA 4X5OA 4GAEA 4XWWA 2I71A 2W4QA 5GOZA 1SXJB 1UP4A 4HEJA 3O8CA 1J20A 1TQDA 3AXTA 3T3IA 3F6EX 4IIEA 4XVCA 3W5CA 2GJKA 3KZ1E 4WA7A 1XZEA 4C4SA 2PKEA 4EY7A 2WKSA 1LI4A 1T8PA 2JFGA 1SUSA 4H1TA 1KSHA 3EQ2A 4PHFA 5E7MA 2CUKA 3MWDA 4XB2A 2XCSB 1JAXA 2ZCUA 4PC7A 3HMKA 4CQMA 2WD7B 3ORSA 1WW2A 4C78A 1PX2A 3E5RA 3NOQA 2NWQA 1IZZA 2YZNA 3QVLA 4ZALA 4DA8A 2F55A 2XA2A 4QFBA 2V8OA 4ZODA 1BCSB 2RGUA 1GXSB 1SKQA 1CP2A 1N5OX 1RHUA 4E2WA 4DG8A 3HLYA 3TN7A 3U4GA 4KR9A 3COVA 2AW5A 1HGXA 1D5CA 4N41A 1OLUB 2OYRA 4KRFA 3HZZA 2PJUA 2H06A 3KNZA 5H02A 3OQMA 3VZDA 2JB9A 2WM9B 1LQTA 3RIXA 2V1UA 1R6DA 2C2WA 2QZJA 4AJOA 3HPRA 3IULA 4UATA 3ZCUA 1XEXA 4JYMA 4MV0A 3VDMA 1N5LA 3ZU3A 2ISCA 4G25A 2GBIA 2Z5FA 1REQB 4TT3A 4TZKA 3L8EA 5HFJA 4NXNB 3OTGA 4MGHA 2H31A 1IULA 2BMWA 3B1KA 3ML1A 2EZ4A 2DWUA 2O8EA 4IJVA 3GGSA 4M6WB 4V0KA 2FMUA 1DAGA 1TX4B 2BY4A 3EOAI 5E9AA 1RBQA 3E7WA 1IOZA 4JXJA 4ZRMA 4EY5A 1ZLYA 1UJ6A 1EXWA 1ZXLA 2WFLA 4YDHB 1KDZA 2C4NA 1IQ0A 2EX1A 2HNBA 2QM8A 3NHRA 3QXCA 4RF5A 5DU2A 2NACA 5HBRA 2R8ZA 4QGBA 1SKYB 5CA1A 3BIJA 4HB4A 3IR6A 3W8FA 2IXAA 1A98A 3I4CA 2W2LA 1KOFA 4EHHA 4M9QA 1MMFB 1HFWA 4QUIA 2NTYC 4KR3A 4HRXA 1FP2A 1PKXA 4GKVA 4PRYA 3HNRA 3GBVA 2IKSA 1KYIA 4NKRA 3IQGX 4YJHB 3A04A 3HJRA 3WLAA 4FB5A 4UE3S 5A2GA 1G7TA 2P35A 2VF5X 5H3HA 1RKBA 5BVGB 2GM4A 2WVJA 3LY7A 1G18A 4M36A 5KU1A 3ZD7A 4F8EA 2XECA 1MH1A 4Q9AA 1G64A 4FNMA 4KQ9A 3C7AA 2JLQA 2XCUA 4GMGA 5ALOA 5C1PA 4G1BA 1ONSA 3TTTA 1F8XA 3A4YA 3BRSA 1IN7A 1D2RA 2ZB3A 4QA9A 5KKAA 2X23A 1U0RA 4RGYA 4X94A 5C52B 2ZXUA 1SOMA 1Y8QB 2BD0A 2WFMA 1EHYA 1TD9A 4I2NA 5L3SA 1XRQA 2W58A 3PNBA 1UC9A 2FW8A 4JVSB 4V0LA 2Z8ZA 3VUFA 3C3EA 3EWIA 1E2PA 3OPXA 2N75A 5DXJA 3H8VA 4B3SB 1I4OA 1HK7A 3RH0A 2O8CA 4LUCA 1GPDG 2JKYA 1SVOA 3A10A 5DWQA 5EE1A 1M2NA 1D2GA 3WLEA 1U8EA 4RGQA 2OBYA 2V1XA 5LR6A 3EJWA 4JLSA 2P2DA 1OB2A 2B2CA 1P2VA 4J1TC 4YLGA 1TIBA 1VYHA 3PJGA 4FKZA 3ZIAD 1ZVQA 5IVHA 1UADA 3JAWB 3TSCA 2GLUA 4WXRA 5BMVA 3QW4B 3TNYA 5D3MA 4YUAA 2FLKA 1XVVA 2ZVQX 1P31A 3FNIA 4KAJA 4F6CA 3W8RA 5DHRA 4ZYXA 1ZK4A 2CMDA 3FW1A 3A28A 1EX1A 3PEVA 3DP9A 1C9KA 1GL9B 4G56A 4AYXA 5MN4A 2QLLA 3KQVA 4JL6A 4Q7JB 4XPIA 4C0QC 2AQ8A 4ZVUA 1D8AA 2EATA 4IFIA 1WOMA 5E8RA 4TTSA 3VO8A 2A3NA 1K68A 1NBME 2O5VA 3OIGA 4W8GA 5EWLB 3A05A 3PFFA 3K0FB 1L7PA 5J58A 3IIJA 4QBFA 2JG3A 1R10A 1KJQA 1U4NA 4M8IA 3KQMA 3DD5A 2DP4E 2G77B 3PXEA 2HBYA 3HDGA 5IYZF 4DV6B 3CH6A 3P8ZA 1Y6RA 2VDJA 5I8ZA 1R0XA 2VA8A 1R3DA 3L8YA 2AXNA 1PEDA 5I9SA 3TB4A 3U37A 1K7EB 1S8OA 1L1QA 3AG5A 3H6HA 3TFOA 3O3MB 4B43A 2WVHA 4U8HA 3HJCA 4D9CA 1U6KA 3VDXA 1QLWA 1C9MA 1K75A 2HOQA 4Z86A 4FZ5A 4IFEA 2H1VA 4JLVA 2FN7A 1QVAA 1T4DA 3P4XA 4HAUA 3G2KA 4PQYA 4QEKA 2JAWA 4GUDA 3RGGA 1JU9A 4CHTA 1FFXB 4E12A 5EIEA 2FZEA 1RM5A 2JD1A 4A8JC 4I81A 3IURA 1UM9A 4KN8A 2R84A 4Z0NA 3U3ZA 4CLEA 3FYCA 1ZPDA 2HEGA 1CEQA 2W6NA 2PE5A 3SE7A 3OT1A 5LIPA 3QVVA 5HKBA 1E4VA 3SLKA 3KDAA 4P0PB 3A0RB 3JD3A 1AGXA 4TQ9A 3C5WP 1JJBA 4AMVA 2D4HA 1XB2A 4PGHA 3SR4A 4J0GA 2V9ZA 4C14A 4HGRA 2AQHA 4NU8X 4CMKA 1Z13A 2D3TA 4HQFA 3QELB 5BQOA 3ZY2A 4AWBA 3OTWA 5AUQA 5K4AA 4F7DA 5C80A 4XVQA 3UPUA 4WESA 3ZWAA 1FDOA 1C3OA 2P6PA 2P77A 1WZ2A 3ELDA 3H2BA 1ZGCA 5L3SB 4I6JA 1U7UA 1M10A 1O94C 4AJEA 1CS0A 3MRVA 5BRJA 1BCRB 3U9LA 2FG6C 4K9PA 4QC2A 2BISA 1YQWA 4LISA 4QUDA 4X71A 2XB2A 5F7JA 1V7CA 1Y7HA 3C70A 521PA 1E3TA 2WJPA 1M0EA 3COPA 2BM0A 1TU4A 3DMFA 1XMXA 1PTJA 2AA3A 3DVSX 3N7UA 3OZXA 1TAHA 3ECSA 4QREA 1T6ZA 4ZFNA 1UOQA 2JJYA 3X43A 4FDUA 1TQ4A 3ZBUA 1K0UA 4RE6A 1E92A 5ENVA 4BUJA 4OUDB 4BX9A 4S1WA 5ED0A 3OX1A 4F1KA 3WHKA 3SS8A 3BG5A 3NMUF 1CC1S 5HWSA 1N7HA 1EP3B 4JBIA 3EXFA 3FCAA 3GARA 4LNHA 1EVQA 2WU0A 4MK4A 3NM6B 3UG7A 2JA2A 4YWJA 3OE1A 4QLAA 4MMXB 2HJWA 1T9BA 3C3BA 3T4XA 1ZSVA 3TSZA 1QGOA 4QJBA 1Z2NX 4XIFA 3CW8X 4NYJR 1UJMA 4F5ZA 3FCXA 1UPFA 5J59A 3HU3A 3LOQA 3K70D 3GB9A 1PHPA 1NVEA 2JANA 1C0PA 2FPSA 2Q5QA 4JBNA 5C1DA 3NHPA 1WMSA 1FP4B 1DNPA 1UXIA 4KQMA 3QY9A 4JU9A 5FI5A 1UFQA 4M60A 1KGSA 2G09A 4CODB 2XA9A 1T36B 1EWTA 2ECOA 2P2ZA 5KKCA 2R85A 1YR6A 4E14A 4DR4B 1YIDA 3W5UA 1IY0A 5GV8A 4F8YA 1MC4A 1UBCA 3ADOA 4GFDA 3T5CA 4DDVA 2HNKA 4H4EA 4AURA 5AP9A 1PR6A 3OQVA 1U2ZA 1EUCB 4QUAA 3P27A 1WZNA 1PDOA 3E3NA 3TLEA 1NKTA 3BN3A 3GBSA 4C0BA 4DHWA 3LUPA 1JR4A 3B9RA 5FFNA 2ZSJA 2M32A 2IYQA 2B1JA 5JG7A 1U65A 1ULZA 3LK7A 3VM6A 2FK7A 3EG5A 1LNSA 1IHUA 4JLAA 2IA5A 2IF0A 4DMCA 4HMQA 3FMFA 2EJTA 3D3NA 3JQFC 4L0CA 5A3RA 3E0XA 5B2ZA 1LF0A 2M6RA 4NY1A 4WKGA 3Q7IA 4D3XA 4YMHA 1HEYA 1V9SA 2H4ZA 4L5IA 5AJXA 2QTVB 1ZUHA 4XM2A 3GZNB 4TMYA 5TF0A 1HDIA 1ULTA 2PSSA 1QP8A 3MXOA 4GI1A 5GJCA 3T4EA 3TL6A 3IKMB 3U3KA 4F6RA 2VWQA 1C30B 3I37X 3ONWA 3EXIB 4D6PA 3K4PA 5K8CA 4LYDA 4L0QA 4KUEA 3VFDA 2C58A 2FA9A 1NVGA 1QIGA 3CJQA 4IQFA 3RFCA 3L6OO 3MB5A 1HDEA 4XIGS 1U4OA 3NDPA 1U3VA 2Z57A 4YMUA 2HU7A 4UHHA 1U0NA 3W2GA 1OAAA 4TLCA 3ABZA 2GCOA 3Q3HA 1AE1A 2B9VA 4IJ5A 2J4DA 3TM4A 1Q17A 2YWEA 2HV9A 3FOCA 3IUSA 3H5TA 4PX5A 3RSQA 3WMEA 5FA5A 1F9AA 2FX3A 3AIIA 1CJKC 2WZCA 3PHIA 3IP8A 3NORA 4F3RA 3RJMA 4OHPA 4MVJP 3UV6A 1XQXA 2IT1A 3R75A 4PZDA 4CTJA 2VF7A 2PU7A 1TDJA 3BDVA 1TE2A 4JJFA 2GMWA 2O1EA 1ONOA 3AZQA 3DBLA 4IGAA 4OGFA 4IIFA 1TADA 3PD0A 4WDRA 1QIMA 2JRLA 1Z29A 2C3UA 2Q3DA 2AUMA 3FSJX 4TMTA 5AKZA 4DJAA 2XKAA 1GQFA 2YYAA 3IUYA 4KODA 1E0AA 2PZMA 1M7GA 4BNGA 1CIVA 1H0RA 2ST1A 3RBZA 3QUBA 2OGSA 3RYHB 2VJPA 2JC3A 1VIMA 5L4LA 1R4NA 1WO8A 1R8JA 1VPVA 3BILA 3DBVO 3EF0A 3IAXA 3OJFA 3SI7A 5F9HA 1H65A 4L6CA 2AJBA 3L4BA 3ZNQA 3UFBA 2KW5A 4KWTA 1Y4UA 3GX1A 4FFBA 4I8XA 4US1R 3G7NA 1KF0A 3GZ4A 1TZMA 4CKWB 5BYBA 2EFEB 1FMCA 1G2OA 4HK4A 3I2GA 2JHCA 3STUA 3ANXA 1CDDA 3V1YA 2I3ZA 3FHLA 4ND4A 1JDPA 2QN9A 2Z95A 3M6XA 1UK8A 3DDSA 4WTOA 1LPOA 2LUOA 3OMWA 1XF1A 4X1YB 1U2SA 3RK4A 1WM1A 3L84A 1T9CA 5E1OA 1KMQA 5IYZB 1J0CA 1YJAA 1M8PA 2OSVA 3QU2A 1O5OA 1XRPA 2DUJA 3AHHA 2AZ4A 5T4HA 5TLSA 4B3RB 2AFVA 3QLVA 4FDVA 1YL7A 2JEZA 3Q6NA 3FYUA 5TDHA 1EJ6A 3NHYA 4N0PA 5EJIA 2BELA 3VPXA 1CQIA 4BBZA 3IA2A 2PH3A 1BE1A 1RAEA 4MARA 5DP1A 4DMFA 2C57A 5E7JA 4XCVA 3I2KA 3ORRA 4D97A 2ZM6B 3UJ9A 2VPXA 2NMVA 3AF2A 3RVLA 5DGDA 1VRVA 1AA6A 5K0FA 1AS0A 2R65A 4N5HX 1I7SB 3NEPX 1E2GA 1L5VA 1E94E 1CY8A 1R8QA 4ZGBA 1SC3A 4TSRA 5DASA 3MEQA 3LL4A 4CF3A 2FVXA 3ILVA 1K98A 5LOVA 4R51A 2R8PA 3QFRA 4JKYA 4B32A 3RADC 5E3IA 2XWPA 4WLEA 2DTDA 3GL9A 5CAEB 2R1ZA 5DW3A 4MUIA 1SU7A 2F9FA 2OV1A 3FGZA 3JW8A 3MBOA 4GYKA 5TSDA 5L3RA 4MI9A 2IV2X 2VDNB 2YV4A 2XVXA 4HC4A 3P0EA 3TCXB 4L9SA 1DBIA 3T5GA 1LS1A 2X19A 4PSDA 4OQPA 3LY5A 1X1RA 4FDLA 2NO4A 5FWAA 4ZI7A 2ERXA 5AW1A 2XDAA 1K5GA 4BATA 3N2KA 3LCUA 1QHGA 1ZVKA 2KBFA 4WEOA 1DKMA 3VNSA 3LKBA 4K9OA 3UPTA 3BKWA 2W4IA 3WTBA 4AMYA 1KK3A 1H23A 2LIVA 2VXOA 2GBPA 1Z39A 3VO1A 4NENA 4KMRA 2NO0A 1HYBA 4O4HA 1U2DC 1LJLA 3U4AA 4IUDS 3R5XA 4C6TB 4U7HA 2XUDA 1P29A 2XXBA 4ZGWA 2PO7A 2Q2NA 3QEKA 4HSGA 2BTQB 1RXYA 4UPDA 5DXFA 3J81k 4E4RA 1Z17A 5AUPB 3CVOA 4A0GA 4AX8A 3ILXA 2BMVA 4U63A 4UUBA 3FROA 1NULA 4G2TA 2XOKD 1GTL1 3K0AB 4J4TA 5KC9A 4QU9A 1CF4A 5IKPA 5DM2A 2XCTB 4JVLA 4Q37A 1L7RA 4QXQA 3KZXA 3SHWA 5UKDA 2E48A 2R2GA 1DRKA 4D3FA 1WXQA 2ZUWA 1YU6A 4U2KA 3HCPA 3CWCA 3S44A 1Z47A 2ZRAA 3CH7A 3QYFA 3HB4X 5HM8A 3TZHA 2NLOA 2YL2A 1ZN2A 4NBRA 2QM0A 4K05A 2YQZA 2HNAA 5CFMA 3CVJA 1P7VA 4HLCA 3A1EA 4WKBA 1NKVA 3AZPA 4DAEA 5EP3A 4OMUA 3HUUA 1W85A 1P9OA 4FI3F 3HBFA 3AB8A 4H6XA 2JDID 4MYDA 3QRWA 1JBQA 1NN3A 2HQ1A 3IE0A 3S99A 1PS8A 1YQXA 1KZ9A 2HMSA 2JH9A 4RPKA 3F46A 3GDFA 1HTTA 1G8KA 3ICVA 3OIYA 4M1ZA 5FAXA 1BYUA 2P1RA 3IMEA 3VZBA 2I5PO 3LHIA 4CMCA 2YVQA 4ND5A 4ZAVA 3T6KA 5HDQA 2AK3A 3R5HA 4G0MA 2FR1A 1NQWA 3W9UA 3T3NA 1S2IA 5BV2P 4OI1A 5JO0A 4ER5A 1JX6A 4GPZA 3ZVNA 4PLTA 2J0VA 2QXTA 2VPTA 1P9WA 5CW1A 4QGSA 1T91A 2GHQA 3QUQA 5L45A 2ZRLA 1E3DA 1I0ZA 1QR6A 3IPRA 3ADPA 1IN6A 2JKVA 4BQSA 1U7OA 2GTPA 2Q62A 5FKJA 4BU0A 3L5OA 1B0UA 4PZLA 1Q7TA 4XUGB 2ES4A 3H5RA 1DXQA 1U8UA 2GFIA 4H31A 3ZG6A 2R0QC 3I3OA 3H16A 3Q7TA 1RBYA 3ICPA 3BSYA 4QRHA 3GLIA 2YZGA 1R0YA 2F1HA 4PNZA 2HQOA 3ZHCA 1AX9A 3NATA 1NZFA 5M3BA 3RO7A 2A5LA 4L4SA 2V9PA 3LO8A 1HRKA 2QRZA 1TECE 1Z6AA 3UF0A 4F5YA 2WHQA 2JFHA 3B6MA 4MQ5A 1Z88A 2CGEA 4YHBA 2ADMA 3VO2A 4EHJA 4K88A 3PQ2A 5SY9A 3H2KA 1CERA 2IITA 3FFBA 4KQGA 3FR8A 3H97A 4X0EA 5IT4A 2Y1EA 1TKRA 3IL2A 3BORA 1F17A 3J80A 3NVAA 3V4RA 2BEUB 4P3YA 1GCUA 2VO1A 3Q3IA 2EW1A 4JJ4A 3DDOA 2PRJA 2P9TA 3C8MA 5JS1A 3JALA 5B55A 3IILA 1EP2B 3V7WA 2ZPUA 3M5PA 3OSUA 1XMIA 1B2RA 3LH5A 3NIFB 1WZIA 1MC1A 1XJ5A 4D0NA 5C5IA 4UHKA 4MCHA 3OZVA 4D4IA 2XT9A 2VHZA 4AIRA 2HWWA 2MIIA 4MTCA 4Z0HO 2IOQA 2I2WA 4LCBA 4UDNA 1XQ9A 2J5KA 4KW7A 3CZ5A 4HNHA 4I1OA 4PICA 3GLHB 4KDRA 4YP9A 1BS1A 2HTFA 4XJSA 2BM9A 1JHYA 2REQB 3BWCA 5EJAA 2ZAYA 2HCRA 1LB1B 4RIHA 3SXPA 2J09A 2D3WA 1N3IA 1LSSA 3ORYA 4NCHA 4NSNA 4C0WA 2G80A 5F1PA 4EH1A 2DERA 2QVBA 3EC7A 5DHPA 3LHDA 4HAVA 2ZU6A 1XZKA 1Y8RA 2HIGA 1RABA 3E4CA 4UEKA 2PX6A 1JLLA 2CXQA 1F3LA 3OKFA 2Q07A 3I92A 4G07A 4D6XA 1JHZA 1Q19A 2WD9A 3D43A 1X9IA 2C7GA 3OHPA 4GVXA 2XWBF 1SHKA 2G88A 5JZMA 1R12A 4F5WA 2RHMA 3Q15C 1SOVA 4EB3A 1PJSA 4MIKA 5BSGA 2X77A 1U2PA 2PX4A 3K30A 1QK3A 1QAMA 3E9MA 2FSHA 2AE1A 3MZ0A 3K09C 2BHNA 5AK3A 4IHKA 4KBGA 3SOPA 4AXBA 3CE9A 2ZDHA 3ZWNA 1E8NA 3IDFA 4FMBB 1E32A 8GPBA 1QXSA 4U5QA 3W1EA 1I3CA 2GXAA 3PEWA 1KH3A 5F76A 3LBIA 2WOJA 4G2NA 2B4RO 3G0BA 4QPPA 5FOUA 4CLRB 5CEFA 3BWYA 3HGTA 2NXCA 3AR8A 1DDIA 2ZJ2A 4GM0A 3T3EA 1HL7A 3TVYA 1O94D 4LRYA 2ONJA 4FEEA 4LXTA 1XD2B 2QAGB 1NVDA 1CY2A 2QDXA 1TUGA 5CEJA 1EM8B 7MDHA 2AJTA 4R1QA 5JLJA 4MQEA 4JQZA 3TLGB 1BE0A 1USGA 1OYVA 2YZMA 3IHLA 4WUTA 4JELA 4EW2A 4YRNA 5IVKA 1F2UA 4LMRA 3CVVA 4WNYA 2PUEA 2ZPAA 4P83A 3IQDB 2AKAB 3LLVA 1VPEA 3T5TA 2YC4C 2KMLA 1XCOA 4BO9A 3HJAA 2JBAA 2GYYA 3THXA 1UZNA 2BKUA 1JB1A 3UB3A 3JVUA 1B3RA 4J2OA 3LQ4A 5AOCA 4JVNA 1BJRE 3U4DA 1MGPA 4KK3A 3H19A 5LWQA 2WILA 1TK9A 4ENSA 2F4VB 4BQIA 1JIVA 1HTWA 2GPBA 2RKOA 4H7IA 1HT1E 4O2AF 4RDIA 4R1MA 1XLTA 2EARA 1GQRA 5T3UA 3FLBA 1NVUQ 2V3CC 3ABSB 3UBTA 5SZHB 3G1TA 2V6FA 4F2HA 1BDHA 1E9VA 1XTQA 3IOCA 5DBOA 3IQXA 2VJYA 3P7MA 5AOAA 4B6FA 2YJTD 1NTRA 4KDEA 1WXHA 4AIIA 2M98A 4ZDKA 2ZJOA 4Q7QA 5E2AA 3TIVA 1QE3A 2OXFA 5JCXA 5JMWA 3KOUA 3R44A 4CTNA 3BJEA 2HIHA 2EZ9A 1U0LA 1YQQA 2FWJA 3VTKA 5K5EA 6ABPA 4RVOA 5AESA 4ZV7A 4HV4A 3ED5A 4FUQA 4QPZA 4WGGA 3SS7X 2Y6UA 1W5AA 4RTRA 3UKJA 3UJ3X 4EUKA 4FE7A 3HKDB 4RE5A 4GL4A 1RS0A 5T57A 1JN0A 3HADA 3NASA 3K53A 3PTLA 1Q1EA 3VRHA 4DCCA 3E3LA 4HLNA 3SZLA 2GD6A 4L4ZA 2QEQA 3DAGA 3RU7A 3GF4A 3PC8A 2ZS7A 1URPA 4KXXA 4BWVA 1NVAA 1JDBC 1RQLA 1T1EA 1B3BA 3OMXA 3BMNA 4IIBA 4N65A 4BJHB 4RKYA 3KKOA 3CMCO 3FTPA 3H1TA 4DEYA 1ODJA 1F1JA 1L3CA 1FFCA 5EE5B 1RI1A 1ZN7A 4XRGA 4YPVA 1E3WA 2GM5A 3C6YA 3IBGA 2Z58A 1OI4A 4L07A 3DV0A 2BW0A 3SIRA 2HREA 2WPDD 3LX4A 5F1KA 3EDCA 1TFUA 4YO7A 1V5WA 1A04A 2B2XA 5EZYF 1ZGAA 2CEAA 3KXKA 1PO7A 3GEGA 3WDSA 1Y33E 4WADA 3LPMA 2B0JA 2GN4A 3THSA 1PBNA 1L5WA 4IJMA 3AQIA 3DULA 3QV2A 2YXDA 3TQTA 1EVKA 3BGWA 1E79D 2Q5EA 3CRNA 2X4DA 5A7FA 4NULA 4LY0A 5DN6A 1O0CA 3ESDA 4OAQA 4MIEA 4Q9NA 2DUUA 2IY9A 1T3TA 4U1RA 1W44A 2X9VA 4HTFA 5BSFA 3Q10A 1RHJA 1N8TA 2FF5A 3WRYC 4AB1A 2IYXA 1WUIS 4R54A 5BN5B 2Y4NA 5K8VA 2ZWIA 3HUTA 3DYBA 3AI7A 3R7WA 3VTZA 2B2NA 2ODNA 1AOXA 2I4NA 2ID9A 3G5MA 3PZBA 4B3BA 4QEDA 4RESA 3WC4A 1N33B 1OVGA 2H0QA 2OL4A 3L4SO 4PC6A 5DYTA 3R3YA 1G41A 2Z3VA 5REQB 4YEDA 3J7AC 1PQUA 4YMWA 4KV7A 3E2MA 1P17A 1FUEA 4FOTA 1QRAA 2FWNA 1WDTA 4N6GA 2H2GA 1YOBA 1JUDA 2XVMA 4XDGA 1FFGA 3RS3A 1PWYE 2UV8A 3UGJA 1IWPB 2CXHA 2YNMA 4I5GA 4NFYA 4RDHA 5BMOA 3GCZA 4TYNA 1XNRB 2YXBA 3OCYA 3PQFA 3ENWA 3B1JA 4X41A 3SBOA 2JLZA 2JVKA 4RS3A 1RXVA 3ODPA 1I9GA 4GRDA 5U1PA 4DBVO 3N0WA 4BMXA 2H2IA 1GIAA 4UOQA 4CKEB 2WYIA 5K3FA 1JHUA 5EHQA 3K9GA 5M2QA 1AU9A 1BE8A 3MUEA 3WQRA 3GEHA 5LDGA 4PC2A 2PRIA 2ZKIA 4U7TB 2VUUA 4DSUA 1OMOA 2WSSD 4RZ3A 1GSIA 1LSUA 1Y4DE 1ZLXA 3JQEA 3Q7EA 4KLRA 5DBFA 1FTWA 5DKFA 2XWJI 4IQ0A 4UREA 3UG6A 4M7OA 3JQAD 3AP3A 4UCFA 5A3SA 4BCDA 2WW8A 1P81A 3SGLA 5DMXA 4FBGA 8OHMA 1O0BA 3JZDA 4ZOEA 2X0NA 1AD2A 5KNBA 2AN3A 2CUNA 3FGPA 1ZBDA 1NOJA 2J6HA 2WJ4A 3HYRA 4L5YA 5JYEA 1RVDA 3F3KA 7REQB 1KZ1A 2CFCA 5JZVA 1U28C 3OZFA 2X0RA 1WPQA 3RARA 4HB3A 1N32B 5A0TA 3OETA 4HWSA 4K9DA 5IWCA 1RQ2A 2CL5A 5DM70 1M1YB 4IMIB 4ISCA 4TS1A 3HWRA 3GVXA 1WV1A 4EBFA 5B12A 3T94A 1T0UA 1XXLA 4LI3X 4GL2A 3MMXA 2C54A 3RSCA 3MWJA 5KOHA 1EXDA 1C4WA 4K1LA 1EUDB 2NXWA 3S2GA 3LDFA 2XMSA 1GSOA 4H6WA 2A92A 3BGIA 3UMRA 1KRWA 3UATA 1VDMA 1JE0A 3AVXA 3QNUA 4ODIA 1NNEA 4PLCA 1SELA 4JODA 3FOZA 4GP6A 2RHDA 1PF7E 4MR9A 5KOJB 5H70A 3C4VA 3NANA 3A2MA 4GGPA 4MLDA 2V7WA 3K15A 1GTVA 3DHVA 2QBYB 2BFFA 5F12A 4PHTA 5EJ4A 4B31A 3T9BA 5EHGA 3NX4A 1GA4A 2PMDA 2QL6A 3CMMA 1C9DB 2II6A 2AN9A 1CRLA 2GF0A 3JVDA 2QVCA 2DEUA 1SH7A 2J07A 2Z09A 3EGIA 3CRZA 2OUIA 1J42A 5A02A 1H6DA 1KMIY 4A91A 2JI9A 3BF8A 2RD2A 2A7XA 1A95A 2Q3EA 2ZT5A 4NOJA 4E4YA 1JIUA 1UCFA 4FFPA 2K4MA 3LX8A 3HJHA 4HY3A 4U6NA 3WB9A 4Y1EA 3GN2A 2BBOA 5DXAA 2W2KB 3WQSB 4DZRA 3W5AA 5EGNA 2Y71A 3WP1B 1A4IA 3LC0A 3HZRA 3EZYA 4O2AB 1XE3A 2PFKA 2ISQA 3MUFA 2IX3A 4KIUA 3VR5D 2VYNA 3F9IA 3HU2A 3GHYA 3ZE0B 3KUUA 2NTJA 1MPTA 3H4TA 3UK0A 3C2QA 1KOJA 5LU8A 2XWQA 3IUPA 3ZVKA 4TLLB 3OQHA 5CIWA 2XNCA 2FP4B 3I1FA 3SZMA 4D46A 4HB0A 3UWKA 4CU5A 1GLGA 1G5TA 2NPOA 2O2GA 2CLDX 3BGDA 5CHYA 1W2HA 3H8JA 1QS0B 2NVUB 4CF5A 4PG5A 2G9RA 1GNQA 2OLKA 1YI0A 4AZTA 1W25A 2RI0A 3C3PA 3E8XA 4YP5A 4DA0A 4X60A 1WW3A 1C8LA 1ISMA 2VK4A 2WG1A 4D4LA 2I67A 3WWPA 4WOCA 5I7AA 3CUKA 2V7QD 4LEIA 2HQRA 4M0MA 4QNRA 5BSRA 3V2HA 3FDZB 5D3KA 4JC4A 1SBQA 1TTTA 5J2UA 4BO2A 1E2UA 1MIOB 3ETDA 3OQ6A 1U4SA 1ODIA 2XSZA 2VAVA 3KQTA 3GELA 2VHQA 4MV5A 4XGKA 5FWYA 4PR0A 4OFZA 2IODA 3U7FB 1DUVG 1H2RS 3G5TA 5DNWA 1GPAA 3T7SA 4BB6A 4MQFB 3ER6A 2NU8B 3P2YA 2FWBA 1ZM7A 2QQ5A 2CB9A 1BXRB 1RE1A 4O8ZA 3ER9A 1CQPA 2DPYA 2VDLB 3MF4A 1SRRA 1G21B 2OBBA 2ODTX 4IDDA 3TW0A 3EDMA 1B8VA 5GV7A 2EU8A 1RAFA 3KFVA 4PLZA 3CUVA 4RM3A 3H0KA 5GM2A 2JD2A 5EZYB 3O0TA 5ALEA 1DWOA 4WGFA 4NMHA 1LRLA 2CD9A 4PIVA 1ZD9A 3CX4A 5T6MA 1Z7YA 2C9ZA 2HYIC 1AQNA 1MH9A 3EG9A 4FFLA 1ZH8A 4BTVA 2WG0A 1AUQA 1EE1A 2RHTA 2AWOA 4J1SA 1JWAB 3QFHA 4K9QA 3B52X 4MGZR 1QGZA 2QN7A 4XGIA 2HIAA 4MLPA 3RBXA 4ME6A 5JW6A 2QTLA 2VJMB 4RL6A 4XARA 2C7PA 2YN0A 3E22B 4QGAA 4ZYUA 1Y5MA 2JJ1A 4KE8A 1YGPA 2FGJA 5CFNA 1OWMA 1U3DA 1BNCA 4FE4A 3T99A 2XIQA 3CN9A 1FDWA 4YAOA 3UMBA 4BO6A 1A27A 3QE9Y 1NURA 1U02A 4A15A 1Q3KA 1XYVA 3D7RA 4IX1A 2QR2A 2YTZA 4FC6A 4MCIA 3VH2A 2YICA 2GF2A 4OY3A 3FNBA 1O08A 2V7XA 3KUKA 3GN1A 2WUVA 3DVQX 2C83A 1FXSA 3I01M 3MGGA 1VB3A 4FW9A 4KQEA 4V0SA 5BUQA 3IEMA 2XBMA 2PV0A 5JUWA 5CPFA 1EFPB 5CNKA 1A3CA 4O08A 4V2IA 5KNCH 4BEVA 3GMSA 4NE9A 1NX9A 3DBIA 3B3GA 3LK6A 3TINA 5GVRA 1YS7A 3ZE2B 1KSGA 4XB1A 2BEWB 1YCHA 4G63A 5JVDF 1YZYA 1JPVA 4R01A 4YIKA 4TZ6A 5F51A 2WBLC 3VO9A 2QSYA 1QV6A 4ISBA 4HNVA 4UU8A 1E1MA 3E6AA 2QP4A 2YHUA 1MQ8B 4ML3A 1GARA 1X74A 5ESXA 4XWAA 2IOFK 3JASB 2Q99A 2SBTA 3AM4A 3DKRA 2MSKA 2YUTA 3EFBA 3BZWA 2BV3A 4N1AA 5JCOC 5K03A 5BV1A 3WQHA 5JH7F 4IXWA 1KC1A 1EWQA 1DZIA 4HN9A 1MBZA 2H16A 3CEHA 1KBOA 4YCJA 4BYMA 1IPFA 1OH8A 4EW1A 2BUAA 3PHHA 1ANKA 1NVVR 2Y9PB 3IAFA 4L2IB 1PR9A 4OP3A 2UYYA 1FDIA 4FFOA 1RWNA 2QLNA 4GLJA 1HZJA 1DIRA 1MG0A 2QRNA 3IPYA 1H69A 5DRTA 4BVKA 3ONVA 4LZLA 3PXUA 4Q24A 1FXUA 2IU4A 1D2HA 1RFGE 4KGXA 4RV4A 1B76A 1E1QD 1E5QA 1NV8A 2NUAA 2J6BA 2PQMA 3ESXA 3N9IA 4L8GA 4LWOA 4PYMA 4UARA 4WK4B 2VYVA 1G6HA 1PFGA 2B37A 3NFRA 4TLDA 4OG2A 4TTTS 1SCAA 4BMCA 5A9RA 1ULHA 2EZ8A 3GFPA 3S2FA 1VOTA 1ZSYA 2YIVX 4QYIA 4MAFA 3OG9A 4K46A 2R44A 2R4TA 3C1TA 1VCOA 3DTVD 4KJZA 1M54A 1L4UA 3TSAA 1ADBA 3KB8A 4TV9A 3DO5A 4FKMA 2ZSHA 1Y1RA 4Z4FA 3JATB 2W8BB 3MSCA 1YKFA 4YYEA 2DJIA 5LIRA 3A1NA 3PDIA 4D9FA 4P4LA 3S3TA 1EFDN 2FMIA 1TJ4A 1X7HA 5HQTA 2WTMA 1U80A 3R1IA 3TLJA 3IVCA 3IOMA 2GFQA 1QO7A 2IVZA 3VMFA 1IQPA 1NA5A 1RP1A 4RCYA 3RU3A 3WLIA 4EX7A 5AUNB 1IU9A 1LD3A 3RHTA 4EY4A 3AR2A 3KQWA 1NKSA 2I6FA 3LIIA 2IYWA 3OZBA 4ASUA 1EJ0A 3MLAA 3QKSB 3RC9A 1FQJA 1GL7A 1I3LA 1RTTA 2O4UX 3KZVA 2UZ1B 5KMGA 2YWXA 3IQWA 2BONA 1AKNA 2I1LA 4O8CA 5KWEA 1IXZA 2O59A 1QG4A 2J3HA 3G02A 2NV2B 3O4RA 3PIDA 3AX6A 2E5FA 1GPH1 2WJYA 4R9SA 3W79A 1UODA 5JPIA 1PS0A 1DG1G 2SECE 3VPAA 2W0SA 1OA0A 3WB1A 2NZXA 3DDCA 3SXUA 3LO5A 1C7FA 1H94A 1VLVA 4GICA 4R05A 5FYQA 2ENWA 4OHRA 1Z8HA 4FFVA 4DNXA 1DBWA 3BQ9A 4Z1MA 2K2QB 3PNPA 5DM60 5C7LO 1MNAA 3GWGA 1K6JA 4FSXA 1XTBA 2WJZB 3I30X 1Y81A 3DUFA 1SG0A 2CCGA 2Q1XA 5JAQA 1E60A 2AC7A 3OOJA 4B9AA 3AEXA 4EUNA 2CSUA 1WCYA 2GEFA 4QQRA 2AOUB 4K26A 4X92A 5HP4A 2LV8A 4AKGA 2HK6A 3ROEA 2DHQA 2EX0A 4RY2A 1AS2A 2C8VA 3INRA 1L5ZA 3L1KA 4Q18A 3HNPA 4AU1A 4PYIA 2D2VA 2PG3A 2PHZA 2ROQA 3CLSD 4OQXA 4CDMA 1JG3A 1M5RA 4OBXA 4CL2A 4JFAA 3E8SA 2APJA 4MCJA 5CYGA 2QPLA 3GY0A 3OECA 3AK4A 3DQZA 4R6WA 2P62A 1YHYA 2O8FB 5I9IA 2RBEA 1J33A 2P6OA 2WF7A 5ESRA 3DW3X 1VBNA 1ZDMA 3VR3D 4HEQA 3D8RA 1XTKA 4AP5A 1N2GA 2HJVA 4CV1A 1WL8A 3ZXUB 3ROQA 1IOVA 1BEEA 1FDUA 5EE0A 3OE7D 3LUKA 1WCIB 4Q7MB 4W4TA 1QAOA 2P27A 2I2BA 3CNOA 5L3QB 5J1SB 5HKAA 5EYPA 5GGXA 1CETA 1YUNA 3WYEA 3C85A 3VNUA 3OEYA 3QKIA 1ZGGA 3K9LA 16PKA 1FDRA 2C61A 2F7SA 3WGHA 3C24A 4EB6A 3W8NA 4JBYA 1PL7A 3CUEF 3N2GA 4DMRA 1F2TA 3GLSA 3V1UA 5M5BA 1W4ZA 2G1AA 4CM7A 3DC2A 2BWJA 3Q8XB 3NBAA 3QP9A 5FUMA 2PMBA 3G0HA 1YJ8A 4Q4HB 4YN3A 4D43A 3V7YA 1FFAA 1YHZA 4Y9SA 5FEUA 1JILA 4X65B 2OOSA 1DHTA 1H1LA 3ISVA 1NVWQ 2IPXA 1N9KA 4U2EA 1UMBA 4WOBA 5LZ4A 3VOAA 1ETUA 1RQPA 1XDGA 4I50A 1QANA 3NWEA 3CH5A 1SZCA 4YMIA 1JEOA 1ZO8A 5L8VA 5AW8A 3V1TC 3T38A 3O5AA 4S2UA 1SBYA 5HCNA 3WDMA 4AN1A 5ALFA 1JEYA 1FMTA 4QXMA 2ASEA 4PAGA 3RT9A 5CBKA 3DAFA 4RD4A 4WKCA 4QXAA 3VSDA 2CNWA 3L01A 5C3UA 4BNHA 1HXHA 3MINB 4MV3A 3MJ4A 1S4MA 4IDOA 4JOSA 3AZOA 1I4TD 3B9BA 1HV8A 2VHTA 3RV3A 4QFCA 3R9WA 4ZCLA 1GTG1 2W6JD 3AF4A 4RPLA 2MJLA 5AHRA 2NP6A 3KLOA 1Y3FE 2NU7B 4UHEA 3X1KA 3ZKAA 4A0FA 1P2FA 5C53B 3T34A 1YBAA 1W29A 2HRDA 2PNJA 5A7GA 4B44A 3BXXA 5IAGA 4XDZA 1L1FA 3EH1A 5H7XA 4PSUA 1EIZA 2DFVA 2JBWA 3FWPA 1OXBB 1XQ6A 5L3ZA 9MHTA 1TZ2A 2OGTA 3K2EA 1FU4A 1H1TA 3DHYA 3T3MB 2OBXA 2F8MA 3TXAA 2UZAA 5H8WA 4MUEA 4C7XA 1H2BA 5CCBA 4IMJB 1L4BA 4G1UC 3N2IA 5HNKA 4DR6B 3TUJC 4ITRC 1GL3A 5AJUA 5IVDA 1UPAA 2CLHB 4Y6OA 5D8DA 5IANA 1VFNA 1WDLA 3R9KA 5JH7B 3BK2A 4G81A 3V8RA 3D4LA 1DUIA 4MWSA 2IU0A 1KJ9A 1JG6A 2AYZA 2UVQA 1BRMA 3HDTA 4L1KA 4PCAA 4WLOA 4AVYA 4FBLA 3DB2A 5EE9A 1ZD1A 4DW8A 1YIOA 1ZCJA 2E37A 2KE5A 1ZOSA 1ZN9A 2O2XA 3F47A 4FCVA 3O92A 3KZCA 2ZJ7A 4C4TA 1G5QA 1NI4A 2D1FA 3DSRA 3SMVA 3AR7A 2NSHA 1MN6A 3Q85A 3WMXA 1E2LA 2JIDA 3KU1A 3L82B 4PLPA 2EHDA 1JG1A 3SSMA 3JZAA 3MS7A 3MBKA 5D3QA 3KM0A 5KB3A 1MDFA 1XO1A 2F3SA 4P7GA 2QP3A 1KFKB 1AA9A 3JTMA 1KY5A 4H7PA 3HG7A 2W70A 4DDKA 5B30A 1Y8AA 2VHCA 4P34A 5DNEA 4QDTA 3FOEC 4M1WA 3R8XA 4ZA2A 1WF6A 1X80B 3GUYA 1ILEA 1F8UA 1UOEA 1ABEA 2ZTHA 1OJ7A 1JFVA 3D8BA 3E35A 3FPBA 4YP0A 1PWXA 3KC2A 3S29A 3V3TA 3VHXB 5D1NA 1VIVA 1THGA 3OQIA 5A05A 2YWCA 3W78A 4B85A 1SR8A 4AF8A 2QM7A 2C97A 3F97A 1VXOA 4OQNA 3TEJA 2EJCA 2R7NA 2OCKA 4IS2A 3M83A 3MWEB 1JWBB 1VL0A 4IWXA 5K4HA 1M6YA 3AV3A 1X19A 2PSJA 4IVQA 3KZMA 4EHIA 2RHWA 1NR1A 2A0UA 2O7RA 3LRTA 4BP8A 1TO2E 2JIBA 4Z2YA 2PD3A 2XVYA 4YAKA 1QHNA 1OU4A 3FFTA 1EQ2A 2ZJ1A 1TQ2A 3JWGA 4LA4A 4M0CA 4OK6A 3LC7O 4RD2A 5EE3A 1U7ZA 3TMYA 3ZHYA 4BUZA 2WP0A 3LRPA 3KKQA 4DA7A 1AKMA 1K27A 5K0SA 3U4QB 3LF1A 3S8MA 1EB8A 3GP8A 3LDGA 2P4QA 4BRZA 1X1EA 2PBZA 2PBRA 4JT4A 4PVCA 2GBGA 4RWEA 1FXWA 1RHKA 4R8MA 3WGTA 5C51B 5LB4A 3TPFA 2P0EA 4HDOB 1D7AA 1WD7A 2ZYRA 3T7RA 1DJLA 1A9XB 2W00A 4EL0A 1BOOA 2RJOA 2VSYA 4NMLA 1I7LA 3ER8A 3O4FA 4Y2RA 1L5GB 1QU2A 3C0KA 3PDHA 2RIPA 4G1CA 2BMDA 3JQAB 1JHAA 2HA4A 4HFJA 2E18A 3ICCA 4HADA 3VR6H 2Z2JA 4Y2JA 1CLUA 1JYSA 3D0QA 3AUFA 4R16A 4ZPJA 4GS5A 2D00A 1Z5OA 5AKXA 1A1VA 1USKA 3E9ZA 3PB3A 4F04A 3ILSA 3CISA 3K2QA 4MI3A 4XTRA 2HHLA 4ZOAA 1ZNZA 3OU2A 4S0ZA 2JFVA 2PLNA 4JI2B 5FOVA 1YMVA 3X1ZA 1E2QA 1KY3A 2I2XB 2J30A 4OIFA 2RHRA 3FOBA 3B78A 3KL2A 3I28A 1MABA 2WT8A 1NUSA 4S12A 3MTJA 4BMVA 2Q2QA 4MRPA 1LPNA 2IS4A 4L3VA 3EISA 3C7KA 1V4VA 3UCXA 1MPXA 5EA2A 2F3QA 1P2BA 2X8JA 3DZIA 1OWPA 4JY7A 5G0TA 4KNVA 1L5LA 4DDTA 2FOXA 3DHWC 4QU5A 1KEKA 4BNMA 5G53C 1SZJG 5CLQA 1I2ZA 1EWKA 3EAQA 3EH2A 3AJ9A 3QG5A 4EFMA 4TWAA 3R9XB 4PONA 2BM8A 2P4HX 1U3WA 2PWPA 2OCXA 3PQ7A 4G0NA 4C03A 2ZUBA 1Z0SA 3NV7A 1XPJA 1G291 3VH3A 3D6UA 4EPVA 4A6PA 3WB2A 5KYXB 5LJLA 3D6FA 2V7TA 3TKAA 1ORRA 5INTA 1L5RA 2I76A 4Z0TA 3K8QA 3RHZA 1XSEA 4P2GA 2PPLA 4I4TA 1P2GA 3O9MA 2Q3LA 3P9IA 4KI7A 2M6LA 3VA7A 2IZ1A 2OD2A 5IDYA 4YONB 2OHHA 3EC1A 4CV3A 2AIRA 4EPYA 2DPLA 4FN4A 3OEED 1ZIYA 1EZ1A 4RL4A 4CXMA 1KQOA 1P5ZB 5JTTA 4DYHA 2VSNA 7ADHA 1RYDA 3EE6A 2PZFA 4DIEA 5EJEA 2I6UA 3ME5A 1CUXA 1L7QA 1RM0A 3CW9A 4UCXA 3GEMA 4FEYA 4LECA 4FZRA 4X20A 2JK1A 2BFCA 4IHQA 4QNNA 4A0RA 5G02A 3LM8A 4HEA1 2PWZA 4YRLA 2Q7OE 4YUXA 1G63A 1N75A 2ZWAA 4FX2A 4ZWNA 3DB1A 2XB6A 6CHYA 3PYXA 4OSPA 2AF3C 1PNQA 1E6KA 1QFJA 3NIGB 3H1FA 1BD4A 1S01A 3EMDA 3P0RA 4L28A 4XH9B 5K3DA 3ZDFA 3OIDA 3PX3A 2XW6A 1AF4A 2Y9MB 3LCRA 4JROA 3HJUA 3ONFA 4RMHA 2YBEA 5ELMA 4CEJA 2H18A 1E5VA 2OE2A 5AM2A 1OLXA 2Z5GA 1GFZA 1UL1X 3EVBA 4PINA 5F4BA 2FPLA 3I64A 4HVCA 1KJYA 5JPDA 1O8BA 2O3JA 3RREA 3RS9A 2G9QA 3ZDDA 3UIEA 1T5BA 1VHJA 5JEEA 2DFKB 3W6UA 1L5YA 2GZAA 2IL1A 3OZGA 2AT1A 2I0FA 4OTZA 3DEKA 3ZKWB 1T0JB 1GUYA 4MKHA 4O0MA 4G36A 4C21A 4GLLA 2PUAA 3GU3A 4QUKA 2R8YA 1T6XA 1M67A 1PJTA 2X9NA 4J2TA 1TIKA 4Q3DA 4J3NA 5E3JA 5DSTA 5H83A 5A5FA 3D7LA 3OMLA 2UYQA 3T7JA 2Q49A 3FSGD 3GMIA 2DKNA 1U3FA 1UC8A 4Q82A 3UUEA 3VXKA 2WF8A 3P2EA 4IUBS 2Q2VA 1OWOA 2ZBUA 1S02A 4HZIA 3L0YA 4JNCA 2JCXA 4HNAA 3B1WA 4IWYA 1L5NA 1TVEA 1NF2A 1V8BA 3OCXA 1WSBA 1RR6A 3TE6A 1U9IC 1BD3A 2C5EA 2HX1A 1YI1A 4MDHA 5JCJA 3OOSA 3W1VA 4DA6A 1Z0UA 4FK8A 5JTUA 3Q3JB 3V6MA 2HWXA 1JP7A 4B7CA 1Z0JA 5LXTA 3V8BA 3MELA 1DWQA 1NC1A 2ZE8A 2UVPA 1GP2A 3AMVA 4UZEA 4CMBA 1BWPA 2ZETA 5KVAA 5FNVB 5CA0A 4CETA 1HOTA 3FB1A 3KVNA 3IT3A 3O9ZA 3LSYA 1KO4A 2FN9A 1PGNA 4Y6SA 2RGRA 5HYVA 2OAQ1 2EW2A 1TYBE 1TT7A 1V11B 4H3VA 3VI4B 3MT7A 3BEDA 2Y99A 3VPSA 3I6YA 4AC9A 1FSZA 4EPXA 4TKMA 2VUIB 4AY5A 1LPAB 2F62A 3RAEC 1JMYA 1QJ4A 3D2BA 1T25A 2QY6A 1EAYA 2QRQA 3KKPA 4XD7A 4ARSA 3VKGA 2X7XA 4QYSA 1GR0A 3QKWA 3A3KA 4JJ8A 3RJTA 3UMCA 2O07A 3FMGA 3MS2A 1KYYA 3Q40A 4E21A 2QQEA 1KEEB 3E0QA 1RWKA 2B25A 1Y5LA 2Y3IA 3ET5A 1NYTA 1F48A 2L0XA 1V35A 3EVNA 4R2HA 1X42A 5MN5A 1E77A 2QGZA 1RRVA 3H1AA 3MD9A 4AQDA 1P9NA 2VF2A 1D6SA 4QAQA 2RE8A 2CXRA 3BA1A 2Z2ZA 4R3WA 2O0JA 4C6SA 3PG5A 4XRRA 3UT6A 5GPBA 4CM4A 3DE4X 4DXDA 2FUEA 2FR8A 2HF7A 2FWAA 2P9FA 3HM2A 5T5QA 3WOHA 3WLHA 1TLTA 2ZOSA 3FYSA 3HS3A 4YUVA 1UP6A 3IBYA 3HY4A 2H57A 3N2EA 1V6AA 3HKBB 1C1DA 3KSMA 2D2IA 2R8BA 1A5BB 4DCTA 1GLNA 4M55A 2O1XA 4OU5A 4KXMA 2NAFA 3OQ1A 4JP8A 3RSLA 2ASVA 4MV9A 4ZV9A 1L7DA 3ZGVA 4FTWA 4H59A 3CQ9A 1SWVA 4BOYA 5HTKA 3VV2A 2C5FA 1OXMA 1DRWA 1KJWA 2CJYA 1XT6A 1N5DA 3DT8A 1EI9A 1VLMA 1VKNA 2GYUA 5CLLA 5G0WA 3IHTA 1IDN1 1A77A 4C0SA 5BSEA 4YH1A 1GN8A 5TX7A 3B1XA 3OVMA 5LD2C 2AUNA 4LMAA 3UT5B 1OB5A 3VDQA 1NM5C 2H52A 4CIWA 4R1SA 3ZJYA 3N59A 1DRUA 3F6BX 5H3LA 1G9SA 2R87A 4YBZA 4DUPA 1U7HA 1YO6A 2ZIGA 4YRJA 2ZRKA 4CTMA 1ZAYA 2BMAA 5EFOA 3OLWA 4C29A 1A8SA 5CNMA 1GAEO 3TNFA 4DR5B 2I6XA 3SF0A 5H4GA 1YFZA 2AEFA 4IILA 3U26A 3UH0A 1CQWA 3CLRD 3PPYA 4FZ3A 4F91B 2HZBA 3QWIA 3HDQA 3VJLA 2I1QA 4RKFA 2ZI6A 4O02B 1P7YA 2R7LA 1WS6A 2MSCB 2X2PA 5C5CA 1WF3A 5TNXA 2VH5R 4WNCA 2ZWVA 1R3UA 1BRTA 3I53A 1PEKE 2FEOA 5F33A 3D59A 3W3ZB 2IU6A 1U1EA 3SVZA 2GARA 4M9XA 1IN4A 5HM6A 1KAMA 4HS4A 4NECA 4TWIA 5BXYA 1L7NA 2XYPA 2YH2A 3AF0A 4NBKA 4K9LA 3SM9A 3GRVA 4ENVA 5DP2A 1HLDA 1YA4A 2WF9A 1D6MA 2R48A 2Y1XA 2NU6A 3NEYA 1ZGZA 3LTEA 5ALWA 1T3HA 5CTJA 4DJ5X 1BKDR 1S2OA 5FQOA 5JNSA 3GLGB 1BA3A 2X1LA 1E1CA 4CM5A 2RHBA 1ZU5A 1M2OB 2FW1A 5E4JA 5K3OA 3T0GA 1T1GA 4IS3A 5LLTA 1J7KA 5E0OA 1QQ5A 1BW9B 3EZ2A 4BRUA 7MHTA 3LZCA 1S1CA 5BN3B 3CM0A 4HOYA 6YASA 1UQTA 4G8BA 5F21A 4RV9A 4ZKDA 1D4ZA 1KARA 2NYUA 2YWRA 3N74A 1N2EA 3NH6A 4NARA 4PS0A 4EMBA 1XMVA 3KEMA 1RCUA 1N7JA 4DFDA 1W5SA 3OP1A 4PANA 5ALMA 3ZLJA 2PH5A 3LLSA 4YXWA 1MEOA 4YQYA 4Q4AB 2QRVA 4MKFA 4EO7A 2QJOA 2VDQB 4BMZA 2C94A 5CXUA 1ZUNA 2HXYA 4RQAA 2A67A 1OC2A 4DPMA 1R64A 4M99A 1SXJA 3L07A 4PIMA 5DTIA 4BLPA 3DTTA 1P0PA 5J4HA 2WQ7A 3PI6A 1JDBB 1ZJZA 2IF2A 2EYQA 2JGEA 2WSYB 3M70A 1E3SA 2O2DA 3RR2A 2R62A 1RBZA 2RHHA 4UUAA 4U2CA 4ZVTA 4KRYA 4CGYA 4ARVA 3ND5A 1IM5A 4K5QA 3MJRA 1JJAA 4WKNA 3JY6A 3LGAA 2GO7A 2WD7A 3I1YA 4R83A 2NUBA 1OPRA 1FX1A 5MHTA 5IXSA 1OH6A 2C1ZA 2VTVA 1BCSA 3I6IA 3I73A 1GXSA 3OH8A 1TO1E 5BQFA 4B2IA 4NJMB 5BWCA 3L46A 1SIOA 3NZEA 1OLUA 1JEJA 2YZ7A 5ELXA 1N0IA 2G7MC 4MJXA 2IIQA 4URXR 2H63A 2BE7A 3WMRA 2P6MA 421PA 5JSFA 3FHJA 4F38A 5JY6A 2XNKA 4HO1X 3GW8A 3WIUA 1XR3A 4FT2A 1N6PA 2PVSA 1Y7IA 3Q7PA 1P0CA 3RVRA 2EJBA 2OZKA 1REQA 3O2QB 4OFWA 3W0LB 3W9YA 1G8YA 5JI3E 3W2IA 5MDHA 1KPHA 1Z2CA 4NVRA 3SZ3A 3AEKB 4ZGGA 2DOKA 1RACA 2ZE7A 3EODA 5K8TA 4M6WA 3WJ1A 5JNRA 2ZYWX 4D0LB 3VAZA 4B7ZA 4DWWA 5JRDS 3SE0A 1Z63A 3HO1A 3JARB 1KDRA 4HPJB 1P77A 3TEFA 1DQNA 3AIOA 3KOXA 1G8FA 4MO9A 1ODLA 2RGNA 5LA6F 2IEZA 4YRRA 3MD0A 4TMZA 4BXOA 1NYLA 4AJIA 5B4UA 1AB5A 7YASA 1XG5A 2ODAA 4FDTA 3AEQB 4EJFA 3WBBA 3FPHA 3I09A 4GZ3A 5C4GB 1I6WA 4OH7A 2P0YA 1D8TA 1H3EA 1QQTA 2VP6A 1GYPA 5C8YF 4UUMA 3H18A 3NB0A 4YPOA 2H11A 4ZVMA 4YJHA 1WW8A 4TZTA 4QG3A 1D1QA 1DSSG 5KSZA 4P5DA 5BVGA 1MV5A 2AV6A 4JI4B 4NCNA 2DYKA 2JI8A 5FL3A 3PITA 4A1FA 4AO7A 5ADWA 5FEMA 1EUQA 2Q29A 2WYVA 3HV2A 2VZLA 2WK1A 2OM6A 4MLZA 4QGGA 5CVEA 5BOSB 1Y7PA 2R1VB 3SOZA 1O6BA 1CS4C 2UZ0A 2FPOA 4TWBA 3K1ZA 3RTCA 2J0QA 1Y8QA 2ZB4A 1NQOA 4YRQA 3Q0EA 3B48A 2ZJ0A 4MWEA 4X8OA 5DHUA 5BNIA 1B8PA 1IHDA 1S2GA 3RAPR 5DT9A 4CBVA 2D13A 4KJXA 5CNJA 1BS9A 1THTA 3OWHA 4BPBA 4Q7EA 4RZQA 3ANMA 1K06A 4FVTA 5ABPA 3C6XA 3NPAA 2JARA 2Z1DA 1T2NA 1YE8A 4W99A 5FO1A 1H93A 3LJKA 1NT4A 3L41A 4F3TA 3DKKA 3UJNA 3A2KA 1OZ0A 3O3NB 3IKVA 2AQIA 3MJVA 4KZKA 1IN8A 2O7SA 3RF6A 3JYNA 2GCGA 4B47A 3JAWA 4MMYB 5BP7A 4L76A 1DPFA 3PGLA 3D3JA 4IIXA 1YS1X 1B6RA 4KSCA 3HVRA 2D1SA 1ZN8A 1CY7A 1DDGA 2FEAA 3LUBA 2ODQA 4ND6A 1ZH6A 3DCYA 1GPJA 2VDWB 2Q6OA 4PGFA 1YZ3A 3G1WA 4RA9B 5JDIC 4F72A 5JD5A 5TR9A 3VNBA 3NCTA 1OZFA 1JIKA 4GHWA 2O23A 1DAOA 1HYEA 3E9EA 4H3SA 1TQHA 2RFLA 3AERB 3E05A 4PO9A 4PZ9A 2C3PA 1AG9A 4FD3A 4EHAA 3TQOA 4E5MA 2YZKA 2ZROA 3H9UA 4LSMA 4ZVLA 2QVZX 4CIDA 3EVDA 1F7UA 4QTXA 4Y9TA 2FY8A 2D0PB 1H8HD 2P75A 3FUVA 4OJTA 2PNFA 2FDCA 4IHJF 4JENA 5EWLA 2I9KA 5JE8A 4IV0A 3STWA 2ZBFA 3K0FA 4OHYA 3UXHA 1Q0TA 4I1UA 2I80A 3HYSA 3DM5A 3QVWA 3LT1A 2QL7A 3O3OB 1VLHA 1X7WB 3OZSA 4M83A 1AQUA 1E6WA 2FQYA 2R2AA 4FOPA 4KHZA 4LYGA 1XKTA 4DR7B 4JI8B 4DCMA 1P91A 1L5FA 2IYLD 4RH3A 1ZD2P 2FPIB 3ND8A 3QVJA 1DCKA 3IO3A 1JG2A 4QGFA 1SOWA 3PUIA 4TXLA 1ICIA 4JC8A 3IS3A 1UC4B 4L5BA 2P9YA 2JGJA 1L5MA 4HH1A 1V6SA 2TS1A 3IPCA 5CVCA 5E6RB 4UOZA 3LPDA 4J0EA 4PZEA 2G07A 1V7ZA 4BX2A 4C3VA 2DHCA 2JW5A 3AUXA 4F3CA 3DCJA 1FFXA 1HORA 3IEKA 2A30A 3LBHA 4O4IF 1QOPB 4K2AA 1R5OA 4QYWA 5ALLA 2JZOA 1PG5A 2JFFA 2ZBVA 3NTLA 4OGKA 5ETJA 3GH3A 3UH1A 3COJA 3PVCA 1QHEA 4YAWA 1WCV1 3MCUA 4NE7A 1PV2A 3NBUA 1KDPA 5K2MA 1HWYA 3LA6A 4ACBA 1TZCA 2QVXX 1VMDA 4P6VF 3GJSA 4A82A 1KZ6A 3ESYA 4LCEA 2IHZA 1V1RB 5KTMA 1MX3A 4J0HA 2XDWA 2QW1A 4UFOA 3GOQA 1AKYA 3S2UA 4Z4CA 5J47A 1PFVA 3A9TA 4RGVA 2Y92A 3D8TA 3QELA 5FL7A 2RH8A 4B7XA 2ATCA 1E63A 1GVNB 1I9CA 1NWHA 1R4ZA 2HC9A 3N3BC 4PYNA 3SR0A 4BVHA 3URKA 3ZJTA 3I32A 2CZQA 3KWLA 3AP1A 4MYTA 1BTOA 2EL7A 1KFBB 1GNLA 3A6DA 3PGKA 4HEA6 4TL9A 5JQGF 1SCJA 1BCRA 1E7SA 5H9VA 4XA8A 4BE4A 4ECAA 1FJXA 2XHEA 3N8NA 1N8SA 4W7HA 1IK4A 4KXLA 2WJAA 4M9CA 4HYYA 1Z7WA 1LUAA 4DN6A 4IIJF 2TMKA 3WAKA 2XTJA 1XMOB 1I13A 2FW6A 1XQYA 1E4EB 1DPGA 5ICFA 4OUDA 1TJPB 3G8BA 2W2MA 2C4UA 2AMLA 3HPQA 3KKLA 4Y8VA 2ZTSA 3UXMA 5AKEA 1KS9A 4KU4A 4KDFA 4ZDJA 3FBTA 4PPNA 2I7DA 1NL3A 5TC4A 3R77A 1O8CA 1QPBA 1JDUA 1S9HA 3LX6A 4JAVC 4WVFA 1P5RA 4PPYA 3B1YA 1E9FA 1W4BA 4BKOA 3G7UA 3NW9A 5HDBB 1P3Y1 1GZHB 3MILA 4NV0A 4XR4A 1J2TA 2X6RA 3HHEA 5FR1A 2JAXA 3SYKA 4JXXA 4DQXA 1SU4A 2P5YA 5DTQA 2JS7A 3BK1A 1FP4A 2H1CA 3CEAA 3DBRB 3E9NA 3F5SA 3K94A 4UTPA 2CFIA 1LTHR 1JMKC 2FN4A 2OV3A 3D7NA 3QZUA 3ZY3A 2BGWA 1MB4A 1UZMA 1T36A 5BW8A 4F84A 4I4LA 2J7PA 4L85A 5ARCA 1M2EA 1W2GA 2CUTA 2IYFA 1GGJA 1RQGA 2EAUA 5M7EA 4AT1A 1QZZA 2VDPB 1FJ2A 1L4EA 1XCGB 2A9PA 2AI1A 2OUKA 3WK8A 3B53X 3ZWPA 1ZC4A 5I4IA 5IABA 1N36B 1EUCA 5LA6B 1GPBA 3TG2A 1SXHA 3GFOA 3PZRA 4UEJA 2IPAB 1I3OA 3HJNA 4JLPA 5ILQA 3U0BA 2QKYA 2QTNA 3CCCA 4PM4A 3W1WA 5CDTA 3TOVA 2E4ZA 5TXGA 2C04A 3WK4A 4RTMA 2JFBA 2O48X 3NAZA 5ALNA 4N8DA 3QBVA 1J23A 1XQ1A 5C8YB 2VNKA 5DHAA 5KNDD 2AG5A 4NH4A 3Q12A 3ELYA 1OI3A 3T9FA 1PJQA 3QWBA 5HJ5A 4CEHA 2LW7A 2I2CA 2IUUA 5KNCD 1T5SA 3L1VA 2HU5A 2XOEA 2QTVA 4NFSA 3UJCA 4D0GA 1YA8A 3GZNA 3UAVA 4CMEA 4GZ6A 1J7JA 3FD8A 4MGKR 3AESB 1PDVA 5I51A 3DTYA 1C30A 2DWPA 3GRCA 3EXIA 3HH8A 3LUDA 3EXG1 5EJ2A 3UV7A 1J2RA 3B38A 3LVFO 1DG3A 4E15A 4TYPA 1WTAA 2HIMA 2QN1A 3V1MA 4YCSA 2JJ8A 4TSKA 4JP1A 3DOIA 4KBYA 4YLEA 3H87A 3CF0A 3TE7A 1OGYA 3TPCA 4UKDA 2VR1A 5ALDA 3TWOA 3SIWA 4F86A 1S0UA 2IUTA 2J3QA 3SQNA 3WLSA 3ABQB 1FW6A 2V0NA 3GQVA 4IH1A 1Y6JA 4QVKA 4TLEA 5BR4A 1ZK3A 5H81A 1UAAA 2GH1A 1AV6A 3L0PA 3NT5A 4EF6A 4UQPA 2ZRBA 3KVYA 1NVMB 4F85A 5FL7D 3S55A 3QPWA 1MA0A 4BB0A 4B83A 2XD9A 1PVDA 1OGIA 2X7HA 4JBWA 4RXTA 4KG7A 5K6AA 1U6IA 4CMJA 1ADGA 1NU6A 1U7XA 5BYJA 1N0WA 4MVJE 4OP2A 5AKYA 2VHXA 1SEVA 3Q4GA 3IDOA 1JBEA 3GH1A 5LB2A 4BFYA 3MAAC 2QL9A 5E38A 2WMNB 1ZONA 3RYHA 4RHTA 1I6LA 1UDWA 1W59A 3PI7A 4GSYA 4JZYA 2UXCB 3LQYA 5ANRB 1EG7A 4HXEB 4BV2A 3FJOA 1H4QA 1ZXXA 4A4DA 3C7CB 2QE6A 1SURA 5A4AA 2Q4TA 4JZKA 2VTKA 3F6CA 1Q3TA 3IJ5A 3QKRB 5CD1A 4CKWA 4DCOA 4OHMA 2M6SA 1X1AA 1NW8A 2IELA 5TQVA 3K71B 3HNOA 4IHJB 4EO9A 1MJFA 1V96A 4HAOA 1QKKA 1J9GA 2BTEA 3JQ9C 4NDNE 1G8PA 4PYRA 4R81A 4WBXC 4OYRA 5EQFA 4LVUA 1TJ3A 4PQEA 1EIWA 2Z3ZA 1HDOA 4X1YA 4DGQA 4Q9JA 1H2FA 3NBKA 4LDAA 3VU1A 3QIAA 5IYZA 2VPZA 2YW9A 2YUIA 3U62A 5J40A 1QF9A 4X1OA 1L5KA 3WMFA 4Z4QA 4ZMRA 4ROTA 3UK1A 2BJVA 3ILHA 4E3ZA 2Y0BA 3TAHA 4A0HA 1NDHA 2G67A 4YT5A 4RPGA 4CKXA 3ZW8A 1HO3A 4ZEVA 2WB2A 3NYIA 2VRWA 5ALJA 4ZVVA 4US0R 3O2JA 1M0TA 2ZRGA 3UV3A 4DEXA 5JFTA 2HBZA 1IRXA 3OCWA 1DO0A 3O8DA 4O4IB 4TTVA 3WGVA 4EB0A 2NUPB 1D07A 2C2XA 2QYOA 1X8KA 4M8SA 2BRUA 2HMVA 2IEGA 2C42A 3RK0A 4GEKA 2P68A 3ELWA 1L2TA 2FN3A 5CAEA 3HBJA 3VH4A 1C9YA 3N2LA 4PX3A 2X0JA 4MI1A 8ATCA 3BB1A 3AW9A 1RLUA 3BIFA 4MS4B 4IRUB 1PT5A 4FGWA 3A11A 3RS4A 1GZSA 2BCGY 2ON6A 3AL0C 3P5BA 1AHHA 4P82A 2J5BA 2YKGA 2FUCA 1K8YB 2Z9DA 2AK2A 3G3EA 2PX2A 5IDVA 3KLMX 3S2IA 2VBIA 1JYEA 3CF6R 3CRMA 4OQDA 1VL5A 3ZX5A 5JQGB 4B2YA 5LQRA 1FYWA 3EFOB 4RIGA 2WUGA 3ORHA 2CCKA 1MAHA 1DV2A 4YPFA 1QFYA 2EKBA 2W2XA 4TZ0A 3A6GA 4FMDF 2IYNA 3LYLA 2UUPA 4BWGA 3O4GA 4S1VA 4E07A 4HVTA 1D1PA 4PC1A 4C6TA 1ISIA 4IIJB 2JAPA 3DBOB 2Q5LA 1FNMA 1MB2A 4U3JB 4N82A 3AOEC 2E89A 5EKXA 1O5TA 1I8TA 2BTQA 4PIPA 4E46A 1SN7A 3EY9A 1BDJA 1L8LA 3HEBA 5DV9A 3FRIA 4BMSA 2G0TA 3BE6A 4F5DA 1QVWA 1X0VA 3LUCA 1ISHA 4LFAB 1GN9A 1DAEA 1KY4A 1A50B 2BH9A 3K0AA 4TTPA 1YDFA 5KHOC 2KM1A 4K8OA 5KPJA 3U09A 1K5PA 4WFQA 1C4KA 3M2TA 1Z0FA 1TKBA 2A0WA 2V6JA 2I7TA 2X1HA 5JATA 4NYMQ 3DOJA 3QKTA 4M89A 3HFGA 4KMOA 4ZAGA 3RJ9A 1UOPA 5HIAA 1ATZA 4FOOA 5ECDA 4F06A 3S2EA 1VPDA 3CTMA 4JUDX 1XTIA 1T8RA 2RGCA 4NAUA 3ZDEA 4E30A 3MTBA 1DJOA 1OFIA 3K6KA 4WK2B 3V1KA 2VAMA 3MXTA 3IIEA 6GPBA 1T2EA 3ZHZA 3AVWA 3K92A 1E7MA 1BA2A 3ESZA 2BEJA 3CLTC 3NQ41 3W5HA 1FRFS 1P3JA 4GEGA 2GJSA 1IBCA 2X13A 3DOFA 4D5GA 4HNTA 4OA5A 4G65A 2G83A 1JU4A 2FSFA 5FTJA 2IYVA 1ESEA 3BXGA 3LUFA 3B8HA 3MTGA 1NNUA 2CN1A 5TT0A 1G38A 3RABA 4RYLA 5C3MA 3PC7A 1NBOA 4JUIA 3NKFA 2IYSA 3ICQB 2ZSDA 2JHAA 1HE1C 2CJPA 3IX7A 4ZQFA 5LQSA 1RJGA 4D4MA 4CTKA 4DQVA 1WKBA 1J2YA 4EGFA 2HPHA 5A9SB 2F43B 1M73E 1Y8CA 4DYVA 1GNSA 3PYMA 1ORTA 2I6GA 1V3TA 2B5VA 1BWQA 1QIDA 1G5IA 2I8CA 2CV0A 4LRQA 3SU8A 2YCBA 2ZSFA 3SP1A 2PXHA 3FETA 5IUJC 3NIWA 1NUAA 4M37A 2O20A 1XCMA 3K8ZA 4OXXA 4QM7A 4URFA 1TYAE 2C3OA 1ABBA 1PL6A 1ZK1A 2OV8A 3A31A 4F71A 3NYRA 1V5GA 3BF7A 1P1KA 4FGKA 1XKXA 2DBYA 4BLTA 3QTLA 1J56A 4DS3A 4WECA 4C5AA 1FNNA 2WM2A 4QOIA 3NP9A 4WCDA 2BEUA 5HMMA 2VRNA 1HQDA 1IY9A 2EBFX 2RGGA 5BYKA 5AHWA 4O3MA 4HGOA 4PGGA 4E5VA 1I0IA 1JFRA 4IVNA 2J8ZA 3DR3A 3O38A 2ZJ4A 1UMCA 3FYTA 2D06A 2BFPA 2R6FA 3DXZA 1WNTA 4CQLB 1HUQA 4GLOA 4DCPA 3B9PA 2AFHB 5IDQA 3V4OA 1JJ7A 3RNOA 2CXOA 1GCOA 2QLMA 2GUGA 2N46A 1IXSB 2EJWA 3WADA 4COKA 1UAGA 2C03A 1ZZGA 4NNJA 4JBLA 2IEDA 1E9AA 4G84A 1M6WA 4U7PB 4CIBA 1QPZA 3GLHA 3TI7A 2G1KA 2REQA 4OYHA 5LQJA 5DCYA 1N8KA 2QX6A 2WYHA 1QYWA 1SK9A 1TTPB 1V9CA 2VJOA 2XYQA 3DF9A 4YLYA 2XMBA 3HXPA 2KYRA 1JR3D 2A5YB 3BTVA 4Q4LA 4X95A 2HWYA 4M1YA 4HQ0A 3M6FA 2QV0A 3MCWA 5IKMA 3QPDA 3WMWA 3PWTA 2BHRA 3RSOA 2GJAA 5EZ6B 1YT5A 3KPVA 1VGQA 3THWB 3GEBA 4FB4A 2V0GA 2BKVA 3ED1A 2WHYA 1CUEA 2P3SA 2ZRFA 3ZZUA 2YFQA 3OJLA 5HZHA 3DQQA 3KUDA 4QYXA 3WZLA 2A59A 4JP5A 4JJEA 1Y1QA 1ZJ4A 4MOWA 4IVRA 5IC5A 3TLYA 1G4HA 4MHSA 2SKCA 3U44B 3HFSA 3ZW9A 3HRKA 13PKA 2QJTA 3Q9NA 1JYFA 4EPWA 2ADFA 1NU8A 4U6SA 4C2AA 3A3NA 2I22A 3RVNA 4M86A 1G6KA 3EIEA 4G8CA 2OB2A 4PY2A 4B6RA 1QGDA 1NQ5A 3OF3A 2WJWA 3B13B 4XGQA 4CLRA 3R6LA 3K6RA 1GY8A 1RRMA 2DBRA 5AOVA 1EWVA 1F2VA 2VWGA 1SB8A 3BH6A 3VNQA 2PGOA 2RB5A 4JA2A 4B71A 2XRZA 1XD2A 1U94A 2QAGA 1AQ6A 1OIXA 2JEYA 1EM8A 1P39A 1TCUA 2D2XA 1N7GA 2GN8A 2PQ6A 2B8JA 2QAIA 3LBFA 3VR6D 1X3LA 4XOIA 3ZIAA 1IL0A 1LVGA 3TLGA 3CPEA 5ALGA 1NJSA 3MPUA 1HEUA 2H1IA 5FPKA 4QG7A 1N5MA 4YREA 2WWYA 1CNFA 4KGDA 3D31A 1XRLA 4JHLA 3R5KA 5KYYB 4HDKB 4DMHA 3U61B 4EYEA 3EIWA 2J41A 4KO2S 3FJ1A 1RRGA 2OOKA 4UDYX 2GILA 2H2HA 4BNVA 1RSZA 1F8GA 2BCJQ 3JQRA 1ULSA 2JFXA