3PHCA

Crystal structure of plasmodium falciparum purine nucleoside phosphorylase in complex with dadme-immg
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
243
structure length
243
Chain Sequence
NLLRHLKISKEQITPVVLVVGDPGRVDKIKVVCDSYVDLAYNREYKSVECHYKGQKFLCVSHGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHLLIHGDFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMYYPNKIIPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKLATKYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Crystal Structure of Plasmodium falciparum purine nucleoside phosphorylase in complex with DADMe-ImmG
rcsb
source organism Plasmodium falciparum
molecule tags Transferase/transferase inhibitor
total genus 82
structure length 243
sequence length 243
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2010-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3phcA00
1U1GA 3P0FA 4NY1A 1TCUA 4LNAA 3EMVA 4DA7A 4ECEA 2QDKA 1V2HE 4G8JA 2HWUA 1V4NA 1QE5A 1SD1A 5EUBA 4QAQA 1OTXA 1ODJA 4X24A 1T0UA 5EFOA 4FFSA 4OY3A 3PNPA 1RSZA 1PF7E 2AC7A 4TYMA 3KUKA 4WKOA 3DP9A 1K27A 1RYZA 4D8VA 1Y1QA 4OF4A 1YBFA 3UAWA 3FNQA 2HSWA 3T94A 3IEXA 1JE1A 3SCZA 1C3XA 3KVRA 4R2XA 5B7NA 4G89A 4LKRA 5CCEA 3KVYA 4M1EA 3DJFA 4TS3A 3E9RA 3QPBA 4GMHA 3OZBA 1U1DA 1Y6QA 4TXHA 1CB0A 3O4VA 1PR0A 1VHWA 3KU4A 1FXUA 4DA8A 4WKCA 4TTJA 5F7ZA 1VFNA 1A9OA 4K6OA 3ONVA 4JP5A 4D8YA 2B94A 3BGSA 4P54A 4M3NA 2AI2A 1A9TA 3DF9A 1JDTA 2P4SA 5F7JA 4LNHA 2ISCA 1PWYE 4TXLA 3NM6B 1PKEA 2ON6A 4L0MA 1N3IA 5CYGA 3FB1A 4BMXA 1LX7A 1VMKA 1TD1A 3EUEA 4BMZA 4KN5A 3P0EA 1RXUA 4R2WA 3PHBE 1B8NA 5B7GA 1SJ9A 3MB8A 1YRYE 4GLFA 4QFBA 4YO8A 1OVGA 1A9PA 1T8WA 1Z36A 3D1VA 1NC3A 1NC1A 1I80A 3F8WA 3GB9A 4DARA 4DANA 4F2WA 3K8OE 4DABA 1OTYA 1A9SA 3UT6A 3EEIA 3FAZA 3GGSA 2AI1A 2XRFA 3K8QA 3OOHA 1Z5NA 2IQ5A 1TCVA 1A69A 4F3CA 2RJ3A 1JDUA 4MARA 5ETJA 4TS9A 2I4TA 4L5CA 5CCDA 5CXSA 5B7PA 2OECA 4TXNA 2QTGA 1SQ6A 5F76A 1XE3A 1ODIA 1A9QA 2A0XA 4PR3A 1NW4A 3UAYA 1V45E 3BJEA 3E0QA 4H1TA 4U2KA 1U1CA 5CXQA 5IU6A 5DK6A 4OJTA 4F3KA 4D8XA 4IP0A 1JDVA 1PR6A 1Y1RA 4DAOA 3DDOA 1JDZA 1RFGE 4QASA 3FUCA 4EARA 3KVVA 4YJKA 5K1ZA 2QTTA 3LGSA 1OV6A 1Z34A 4GKAA 1B8OA 3C74A 4QEZA 5B7QA 4E1VA 1Y1TA 5F77A 3EUFA 3INYA 1RCTE 1Z37A 3PHCA 4QARA 1SD2A 2H8GA 4DA6A 5EPUA 1RR6A 1JPVA 4JWTA 4QATA 1Y6RA 3E9ZA 4TXMA 3OZDA 4NS1A 2QPLA 1U1FA 1YR3A 4TTAA 3PNSA 1VHJA 2AI3A 4LDNA 4BMYA 3OZCA 3LA8A 3OOEA 1YQUA 4D9HA 3ODGA 5F7OA 1V3QE 3FOWA 4JOSA 5JPCA 3DPSA 4F2PA 4WKBA 3TL6A 1U1EA 1T8SA 1CG6A 1LVUA 1ODLA 4GLJA 1T8RA 1JE0A 3MMSA 1ODKA 4M7WA 4D98A 3OF3A 1Z38A 4DAEA 5C80A 3UAZA 4OEHA 2PGAA 1PK7A 4YMLA 1M73E 3FWPA 1PR1A 3UAVA 5F7XA 5F73A 4EB8A 4F1WA 1Z39A 4G41A 2OC4A 4L6IA 4OGLA 1Z5OA 1A9RA 1PBNA 4L5AA 2Q7OE 1RXYA 1PR2A 2A8YA 3LBAA 2HN9A 3BL6A 1T8YA 4DA0A 2QSUA 1Y1SA 4OGKA 1PW7A 3ENZA 2A0WA 1G2OA 1ZOSA 5I3CA 1ZL2A 4TTIA 4MCHA 2HRDA 1RXCA 3KHSA 1OUMA 5CYFA 1K3FA 1YQQA 3OPVA 1LV8A 3NBQA 3BSFA 5FAKA 4R31A 3NM4A 1TGYA 5F78A 1Z5PA 1V41E 1OU4A 2OC9A 5KB3A 1Q1GA 1TGVA 2BSXA 1ULAA 4NSNA 3O6VA 2OXFA 1V48A 5IFKA 1JYSA 1PR5A 3NM5A 3IOMA 1PK9A 2I8AA 1RT9A 1ECPA 4L5YA 3OCCA 1PR4A 2GUWA 4I2VA 1ULBA 1RXSA 4TXJA 2A0YA 1K9SA 4PNPA 1JDSA 3U40A 4LZWA 4WKPA 1Z33A 4MCIA 3OZEA 4YNBA 4BN0A 3UAXA 4RJ2A 1WTAA 4WKNA 1Z35A 4UC0A 1JP7A
chains in the Genus database with same CATH superfamily
1U1GA 2C8KA 3UC5A 2OLKA 1Z4PX 2JKVA 3GVXA 2WG1A 3L6BA 3G2QA 4UDNA 4UM8B 2J48A 2VP2A 4B6QA 1FIUA 4XB2A 1CUVA 4DWVA 2QL6A 4HFMA 4X92A 3OM0A 2VI5A 2YDXA 3QXHA 3DMHA 3NPMA 4ON9A 3TOSA 2GN6A 1RQXA 3QX8A 3O0DA 3UMCA 1GU7A 2W2OA 2NUPB 3QEMB 1QO9A 2ACEA 2JIZA 3HHPA 4FSHA 3SZRA 4DSTA 3R9XB 3H5AA 3A28A 3PHHA 2Q5FA 5DB4A 3DL7A 2EF0A 1W48A 2NV6A 1N2CB 5KYVA 2PK3A 3FD8A 4G24A 4NVRA 3JTMA 2Q2QA 1HF3A 4HUQB 3A7EA 2J3DA 2LUOA 3R7NA 1U9IC 1CNMA 2HCTA 2V45A 1XYYA 3IO5A 5HBGA 5IULC 5IX8A 1Q83A 3KQHA 1M0EA 2J3HA 4TWZA 3UHOA 3WWZA 4HDCA 4AJEA 4LG1A 1FX1A 1KMIY 4Q4HB 3OOJA 3OBIA 4YJFB 3BE5A 4OA8A 3E58A 5TXGA 1ARZA 3KTAB 3T54A 4EBBA 3K6SA 1K8YB 1QYXA 3R6TA 1ZKMA 2IEBA 1JAXA 2QUJA 1ZONA 3DM5A 1MIOA 3KQNA 4R41A 2X13A 3OJLA 2R1VB 2GZ3A 3G5TA 3KVRA 2VHWA 3ABSB 4Q7KA 1ECJA 2W2TA 1LK0A 1KVRA 1ANKA 1OLOA 2HLDA 2M1XA 2QRMA 2ZPTX 3A2MA 2A30A 3P2OA 5ECDA 3A9WA 3HB9A 4EB0A 2ZVJA 2EC5A 3AUSA 3F90A 1YT5A 3DZGA 3WLHA 4OH7A 4DPLA 3AKZA 3ZVKA 4RHCA 4PZCA 2DWCA 4BVHA 4CLRB 1JQ5A 3I12A 4IIJB 4DZRA 4BFLA 1MJHA 1MAHA 2ZSEA 4FINA 4YRFA 2I55A 4P3KA 4RZUA 5DZSA 4UZFA 5K8JB 1R64A 3M70A 3ZYCA 3U1VA 1BMFD 5HF8A 1XMXA 1ZZGA 1WP9A 2JGAA 1EFTA 3OOYA 3G7NA 5ALZA 3RIHA 2AD1A 3CG4A 3Q7QA 3RW9A 4X7RA 3TRKA 4AJLA 1RW4A 2RGXA 1EHIA 2OLJA 4XFKA 1OBHA 3BMNB 1CERA 4B7UA 4JROA 1OKKA 4DCTA 4B46A 4V0KA 1AXEA 4GUAA 3TGPA 1P7PA 2GZMA 1RADA 3E3OA 3GJ8A 3U2QA 3VZDA 2XE4A 2ZTVA 1DC3A 2PH7A 4R5MA 5KYWB 3ICVA 3ONVA 3BHIA 4QPZA 3DZIA 3QEJA 3G7UA 4PBRA 5J40A 2RI6A 4UCXA 3UAOA 1H4VB 5EL0A 5KUTA 4UCWA 4KGZA 4BRSA 4CT4B 5FTWA 5CA0B 1Y8QA 3IBYA 1OH8A 3WQRA 3F97A 4BE7B 1TX4B 3TM5A 2BM9A 2VRCA 3A4TA 3CB4A 4GKBA 4XKJA 3CRW1 1T1IA 3HU5A 2IX3A 4LTMA 2GEKA 5AW4A 1I2AA 3I5XA 1H4TA 4JVLA 2IXEA 2HJSA 3GDOA 3L8ZA 1WB4A 3D0RA 3M9LA 4N7BA 5G4KA 3TI7A 3HVJA 4IEIA 4J8PA 1GV1A 1EVYA 5BW4A 1RJ9B 2G83A 2RGYA 4LYEA 2DECA 3ZHUA 1ZY2A 2XA9A 2CHEA 4DDUA 3D5TA 4I50A 1F48A 5CYPA 1ABFA 3GD5A 2KE5A 3LX5A 4YJHB 5TR9A 2WJGA 3LYUA 3R5XA 2VOJA 4WZAB 2XQKA 1IOWA 4N0PA 5AOCA 5EGSA 1ZLYA 2IPOA 5CVEA 3SZ3A 4FQ7A 3TLZA 2OVFA 3FYUC 1CR0A 4I6JA 4EFDA 4ABTA 4MWDA 1WBJB 3K09A 4OJMX 2F4NA 3PTLA 2IPXA 4GX0A 1NGSA 4Y6GB 1EX7A 5ICFA 1E6WA 1FYDA 2PZBA 4IS2A 4WCFC 3STHA 3U44A 3NO4A 1M2OA 3LUPA 3BVPA 4RH3A 1ONNA 2BDTA 3MB8A 1WXGA 2XA2A 1IN6A 4FCCA 3IDAA 3OIGA 3GAAA 1SCIA 1TW3A 2FPUA 4AUKA 4EAAA 4LPKA 3EC2A 3H5IA 4W5JA 3JD1A 1GDHA 2I8CA 2WAOA 3SYNA 3LO5A 4HHEA 1AD2A 4JBHA 3SEQA 3SHWA 3MCUA 3IVXA 3GFQA 2W6JD 5AW6A 2WHRA 3TW8A 1NXPA 1I80A 4IG4A 1W4BA 1EVQA 3HDYA 4MVJE 3EGDB 5FI3A 3ZU2A 2PX2A 4BNUA 4MQ5A 4NBNA 2QW0X 2ZFUA 5FLXA 4BO9A 3COVA 1GL6A 3UG7A 1FP7A 3T7AA 5FUWA 4CEJA 1D6JA 1PFUA 1A9SA 1XWFA 3FF1A 3IAM6 1ACJA 1CZLA 2B3TA 1VKJA 1EVKA 4EMTA 1IB0A 5FUVA 2VHXA 1V3UA 2X8LA 4TPKA 1CYDA 1CP3A 2CNOA 4MR9A 1L5WA 4UAGA 5E3IA 1ONOA 1T9GR 2EV9A 4MJ7A 4LF9B 4EBFA 2QUHA 4B43A 4JLVA 4YV0A 2E55A 2WP8J 1TDJA 3KWLA 1YZTA 3IV7A 2IQ5A 4FS8A 1Y7TA 1VJDA 1IEXA 1X42A 2ZCVA 5JVDB 4O0LA 2RG1A 1HFJA 3VYTB 1V11A 3T34A 2FQ1A 3RK0A 5LKAA 3DKRA 1T5SA 5LMCA 4I3GA 3OCJA 3VNSA 3G02A 3LOPA 2H11A 3HDGA 3GGOA 1KC1A 1ACLA 2G80A 1FW8A 1XF1A 1YZHA 4A4DA 2GO1A 4YB8A 5T5QA 5F2OA 4URWR 4PQEA 1FP4A 1CRWG 3N2IA 1GTMA 1L7DA 3LUJA 2OD7A 4PR3A 1O5TA 3HCFA 5AOAA 1E3SA 1GA4A 1H93A 4I5EA 4OQZA 1S2DA 4URFA 4ZI3A 4HQ6A 2BRUC 1B74A 2X8AA 2J0SA 1NX6A 1Y37A 3L8HA 4DBZA 2B92A 3WMWA 4RORA 4H4DA 4ESEA 4D8XA 4OBEA 3B6JA 3FYUA 1KMCA 4FMCB 5KOJB 1G18A 2QEQA 4MNTA 3TGLA 1N2IA 1DARA 4IX9A 1WNFA 2DY1A 5EEGA 2OGZA 2ZR8A 2E5WA 4ND3A 4OYHA 3CLTC 4QDZA 2ES4A 4RGQA 4BNLA 5JHHB 1MQSA 5K5EA 4BX8A 4GXRA 4KAJA 3RTEA 5ALMA 5KX5A 3GLGB 2JFNA 3S7TA 4JBNA 3DLTA 4FI3C 4MAMA 4X8LA 2EJCA 3MUFA 4L0QA 4BV9A 1N5RA 1YR9A 4TT3D 5D2CA 1W25A 3PPYA 3QI2A 4L27A 2X9QA 1ZK4A 4BRUA 5C1PA 4B85A 4BVKA 3N2NA 5IJ9A 5HJEA 1R7RA 5JWHA 4RU1A 4ENWA 4KXXA 3A37A 2KB0A 4L4RA 1VE9A 2XHZA 3ESDA 1Z7GA 4A27A 3GDWA 2YFQA 1LI7A 1W1IA 1E2GA 5U1PA 5K0TA 2YWDA 1PYGA 4MDYA 4I4TB 4JJIA 5KVSA 2X4DA 3H9EO 1EWRA 1LPPA 4GZMA 1KVTA 2VA9A 4AVYA 1P4HA 3IPXA 5IT0A 4RTOA 2BKXA 3MJFA 1TYDE 1P1CA 4E51A 3OQNA 1YA6A 3TKAA 1A9XA 3OQIA 1HT1E 1DKRA 3HBFA 3NVDA 2YN0A 3ZVMA 1TUBA 3MYYA 3RSCA 1ZMOA 1XEAA 4F5WA 4TMXA 3NKLA 4F93B 1OHHD 2MJLA 4E5UA 2VHUA 3JWGA 2J9GA 2NIPA 1JDBC 2J7PA 1ZD8A 2XJ9A 5EZYB 5JNSA 4BECA 1XMQB 6LDHA 2BE9A 3NPAA 4DV0B 1EIZA 5H4GA 1RCFA 1AV6A 1EK5A 2R1ZA 4Y7DA 3T4UA 1NYTA 2R6AA 2GWHA 4GLLA 3V80A 2BFMA 1LZKA 2KSQA 5TS3A 1KAOA 1ZIXA 2H9IA 2SKEA 1Q95A 1IHUA 4HDMA 2DFLA 1CVLA 1Z5WA 3H2ZA 1S9HA 3PJFA 3BICA 2BKVA 3PG5A 1G3IA 2IOHA 4KNYA 5TQ0B 1JZTA 4CDNA 4N65A 3UM9A 3KC2A 1MJ5A 1NLUA 4UE3S 5KOIA 1WDLA 2FZWA 2QPLA 1XU4A 2X6QA 3IAAA 4HGQA 4E6EA 1DQPA 2CYAA 3MCAA 4LNUA 1HE1C 2H18A 1Y3AA 3PQEA 4ZIRA 4G1VA 2Q99A 4PIMA 4WDRA 3RVQA 1WWKA 1YCGA 1Z2EA 3GRZA 2PUDA 1XX6A 3PDHA 3FPCA 2VZ8A 3QG1A 1OI7A 1G2IA 2YJTD 1W44A 2OXRA 3IBFA 3F78A 4QOFA 5TS2A 2BRUA 4IDHA 5JAPA 4YP1A 2BKLA 3BQ9A 5EP1A 4MLZA 4LBWA 4MQ4A 3O5AA 4PQYA 5ESDA 1RYBA 1V5IA 4XGNA 4IVRA 5DGHA 4FOTA 4C4XA 1NLFA 4QGHA 2WSBA 1LY1A 1XRPA 2UZIR 3LIIA 3G0GA 4FDAA 3RRFA 4EPRA 1H6CA 4YUXA 4XOIA 5G0TA 3WIOA 4IDCA 1Z4JA 3WYCA 2AHRA 2AJDA 3A04A 3VDMA 3GRCA 2FLVA 5CLFA 4GLJA 1VBNA 1JQ3A 1SXGA 1KBOA 4FPXA 3AETB 1G66A 1DUSA 2AT1A 3U7RA 2ZPAA 3I8SA 3V4OA 2XXAA 1D9ZA 2BUAA 1FQWA 1W581 3BERA 3RT7A 3LLCA 5J58A 4LCEA 4U00A 4Q9LA 6ADHA 2WB4A 4G5GA 2WOOA 1B3BA 3KJZA 4CL0A 4DRXA 1VCIA 3IPCA 2ZE8A 4U7GA 1JG7A 5L3QB 1SCJA 3I73A 3K8YA 2QJFA 4BB0A 5A1TA 2PR2A 1L7AA 3KLNA 1YACA 3PK0A 4FGZA 3DV9A 4F92B 2MINA 5AJZA 2V3CC 2P0EA 1DTSA 2JANA 3ETJA 1XTBA 3G49A 4NU0A 4PQRA 3AEKB 4UQLA 5JC1A 2O7VA 4ZCRA 1BNCA 2BR3A 2ZJ0A 4QOHA 2B5VA 4NV1A 1O8BA 1M73E 4IAOA 4Z54A 1WUIS 4F6RB 4IIJF 1P0IA 1SU7A 2ODBA 2WHPB 4EB8A 2TECE 2UUPA 4GVXA 2NZJA 4JXKA 2VO1A 3RLFA 1LC0A 3PV0A 1USGA 1ZITA 5ES3A 1DDGA 2GDJA 5MN6A 2A5JA 3FSJX 2JGFA 4TV9B 2Z9DA 3OIFA 3LHSA 1PK8A 3TBHA 2GYUA 1F9AA 2CNLA 3FSEA 1PR2A 3LC1O 4D0RA 1BDBA 3LGAA 1DUIA 3L6CA 4PICA 2EWWA 3OX1A 3HDHA 5CTJA 5KNDD 2E87A 3MXTA 2EFJA 3N59A 1MBZA 1E0JA 3O3OB 4OYYA 2FFHA 3CEHA 4Z9YA 4GNRA 4ARVA 2ZXUA 2O0HA 1Y1SA 3NASA 3OD1A 1PS0A 4I5GA 4QUJA 4OGKA 4YMHA 5REQB 3EC1A 4YI5A 2ZR0A 3WDLA 2BC9A 2IH4A 2J5QA 3E03A 1D0IA 5A4FS 2P6RA 1EVLA 4WUVA 3V2GA 2ZJ2A 3D1LA 1IIBA 4AS2A 1EXVA 4UTXA 4EY8A 5EEHA 3E81A 4XR9A 1F3OA 3WRVA 2GXSA 3CH6A 2O8BA 1XTSA 1Y6FA 2AZMA 3OE7A 4HNAB 1DT3A 4AD8A 5LSAA 3PTAA 4DMGA 1U94A 1U6JA 3ZD9A 5K0GA 4NU5A 3GLIE 1L5ZA 1XRQA 4RK5A 5CK5A 3QWFA 4RM3A 3MLEA 1Y8ZA 4PGAA 2OORA 3O90A 1GT91 1Q5PA 2FQWA 3K0AA 5KQGA 2BZSA 5LMNB 5EJAA 4NHOA 1OFHA 1K5HA 3BJZA 4HGNA 1YDFA 4R0NA 3ZE6A 3FF4A 1UBKS 3BSFA 4ARUA 1F8XA 3MFYA 1Z0DA 2P77A 3PGVA 3SC3A 5I7AA 2CVQA 2JC3A 2R87A 3GOQA 1D2MA 3U3DA 4EHLA 2C4NA 1N2HA 4IUBS 2W0MA 2XCUA 4Q9HA 5HGJA 2FZEA 3DWEX 1VBKA 4OHKA 1OU4A 2WKSA 4JC5A 4QDJA 2PA3A 1J0AA 1QM5A 2WFLA 4NAUA 3WAJA 4DXHA 3K0EA 1Y5IA 1UQUA 1Z3CA 1DJOA 4DIOA 3U60B 3PEWA 3QITA 3CINA 1QGYA 2FW9A 3G2MA 4CMEA 3CEAA 1BVUA 2QV0A 2OXFA 2XE7A 2O2XA 1PG2A 1A5SB 1AZTA 1PR5A 3TE7A 4YPOA 3WLIA 1ZA1A 4Y6PA 1YVUA 3NHKA 3ZDDA 2IHJA 1K63A 2IOQA 4MUJA 4X7PA 4Y2TA 3FBGA 1I5EA 3OQBA 2ID8A 3QY9A 2M6KA 4ASUD 1K6IA 3R3VA 2OHFA 4DN6A 3ISJA 2GUWA 3NYRA 4H3HB 4I2VA 3S1LA 1T43A 4K6KA 2OHOA 4P7GA 1WUKS 4BQPA 3TQIA 2PKQO 2X5XA 1ZD3A 3CO5A 3CV3A 4X85A 1KRWA 3GJRA 4A36A 1O87A 1KOFA 1OBOA 2JEYA 2GJKA 4HDKB 3CEJA 4X6YA 3LNTA 3KAPA 1UJ6A 4FYPA 1WS6A 2HA4A 4P5DA 2ADMA 2A57A 1YCDA 2E2WA 2P9ZA 3O38A 1WTAA 4JLPA 3VTKA 3GLHE 4XD2A 2GK4A 1PFWA 3NBXX 2RD2A 1AQYA 2HBZA 1ZSVA 2O3UA 5IYZA 2AUMA 4QOIA 3FDZA 2ZBGA 3M81A 1LFAA 5FLYA 2YFHA 4KQIA 1MC1A 3L84A 3MJ4A 5HS4A 5KQLA 3GFOA 1ZGCA 4PHHA 3DULA 5FPQA 3TD2A 2O8EA 3QKRA 3ZHBA 2DRIA 3R6DA 4L4XA 5EJ5A 5HQ3A 1JEEA 2H1IA 3O31A 3UJ6A 2O5VA 4Q03A 2JBWA 4AULA 1TK3A 2HQOA 4G0ZA 4HQFA 2IUSA 2DQZA 2P4QA 1NXWA 3EZYA 3DMGA 1SVSA 4MRAA 1I2MA 3SSOA 3LY7A 2C9MA 2HJVA 2JHFA 2HK6A 3N2EA 4LJ4A 5FOWA 5IDYA 3UMYA 5EIAA 3T3DA 2RIRA 4ZTZB 2EP7A 2C5LA 3QTLA 1RDFA 4WSOA 1BX0A 1U3VA 1X14A 1ZU5A 1DEHA 5HMMA 1JFLA 1DZ3A 1L5HA 3UEOA 1SPXA 3CNEA 2IS2A 3F8SA 1C7RA 1XCLA 4Q9DA 3DLCA 3EJ6A 1LXCA 3NCTA 1IUPA 2X8BA 1R12A 2ZBUA 3DOJA 4FHDA 2QQGA 4Q0MA 4N5MA 3A8TA 1BE0A 4IXDA 5I4BA 1DOAA 1U2GA 3QV1A 4S2UA 4D8VA 1PG0A 3RK1A 2AQKA 5GVRA 4ALKA 3L92A 3DOCA 1X80A 3MQ4A 5I9NA 1CD5A 2QT1A 2W58A 3Q8XB 3NV9A 4FMCF 3TQQA 3EVFA 1RAGA 1LDYA 2D3TA 3THXA 1JE1A 3N8NA 4XCQA 4JIGA 4TKVA 3T3NA 1LUAA 4BGIA 4YAUA 3MJEA 4ZAYA 4M86A 5DVZA 2F3QA 1KZ7B 2EDCA 2IHYA 2JFVA 4C89A 4F38A 4W5HA 3BDVA 4KQ9A 3KVYA 2QPTA 4S1OA 2AMVA 4M1EA 4D9KA 4EKNB 5KYGA 3NHJA 3KZVA 4UFOA 1P0MA 4QVKA 2APJA 3GFTA 2C20A 4BJ6A 5HQTA 4AIIA 2O7NA 5C7YA 4RSHA 5FPTA 4DR6B 4WERA 1QBGA 2QXUA 4B8ZA 3I5MA 4H7HA 4I3HA 3ZOKA 5IUJC 3WMXA 5K0ZA 2CFTA 2XUQA 4MTLA 3M4ZA 4H7IA 4N03A 1G7TA 1FYFA 4FE4A 4I4TF 3JZAA 2GM4A 3X2FA 1V96A 5DNEA 4AZ0B 4DLBA 4IIVA 4P5EA 4R8LA 3G0OA 3R9KA 3PR2B 3NW9A 2C97A 2ZUFA 5EZQA 3RG2A 1M2JA 4RTSA 1Q0UA 3AZOA 3HC7A 2DF8A 3OFVA 3AG5A 4MP6A 3CEPB 2NX2A 4TTJA 5DBHX 2OKCA 4A6XA 3O0TA 4RHXA 4KE6A 3SF8B 4BO2A 4UMFA 3MC1A 1L5SA 4LE1A 5EZYF 2IPMA 1ND5A 1X2BA 2GN2A 3NKFA 4MS4A 2Q4DA 2DFVA 2FHPA 2V6GA 4O2RA 4OGGA 1N0IA 3RG8A 2JLAA 2ODTX 2NZXA 4MVJA 2NNWB 3LW7A 3EW9A 4CIVA 1AG9A 4KXMA 2Q1TA 2VWQA 4FZ3A 2FZVA 3WVNA 1U0EA 3B13B 3GZ4A 1ZJZA 2P4SA 2WI8A 2XUZA 1RC0A 3W5IA 1JZSA 1A8QA 3HJCA 3EVBA 2Y77A 4ZO6A 3DE4X 1UPAA 1PWYE 1Y81A 1WZ2A 3ZC3A 1Z2OX 2C2KA 3GRAA 2Z8YA 3FRJA 2ACVA 1D2GA 2BBOA 4CF7A 2UZ4A 2J4DA 2E5LB 2NP7A 3RRZA 3ZK9A 4P3YA 3RYFA 5FTLA 1C1YA 2VFAA 3IAM1 1SKBA 2GBCA 4NZOA 4JNCA 3W8EA 4DUYB 4HB3A 3C4JA 3U56A 1RQLA 3HSYA 5DSZA 4L8GA 3KHKA 5TGTA 1X7XA 1Z6ZA 1QFXA 1W9HA 4JC0A 1BROA 2KW5A 3PX7A 2HM7A 4R83A 3P97A 3NGLA 1Z8DA 1Y8CA 5JDCC 3I9FA 4JLBA 2QD3A 4Q34A 4A73A 3WLNA 2R00C 1Q7EA 1ISRA 4KXVA 1XTRA 2W71A 4QEKA 2R6HA 4UHCA 1QCDA 2JATA 3ZDRA 3P71T 2FP4A 3AI2A 2OMEA 4PN3A 1E79A 1KARA 5LD2B 5TARA 3EFOA 2CMGA 3O92A 4EAQA 3IBCA 3PA6A 4Z8XA 5A5EA 5B6PA 1TTQB 4AG5A 5HFJA 5TPWA 4YR9A 2DFNA 3N86A 5ILGA 5JYBA 3ZCPA 4PCUA 3IYLW 5DLQC 1TM5E 2IXGA 2QZ4A 3AX6A 3HKDA 3GUYA 1N6PA 4ZN6A 2B1RA 2P1ZA 1ZBDA 3GLKA 5HE9A 2XBLA 5LKRA 4WN3A 3B6EA 3OSUA 2CEAA 13PKA 3ABQB 4X95A 2YIJA 4DCSA 1J00A 2QD2A 2GZHA 2CE2X 4MUFA 1EA5A 4UDYX 3R7WA 2NXNA 2E4ZA 2HL6A 3N8KA 2OE2A 3EEQA 4NF2A 3SR3A 3W1EA 2LBPA 4G2TA 421PA 4GI2A 2X7JA 2V59A 1SULA 2P65A 4DV1B 4A0RA 4QSMA 1WU8A 4QFMA 7ABPA 2PSEA 5F1YA 2ZI4A 1SQGA 4BBPA 4EUFA 4RD6A 1WXDA 4PQGA 1RAIA 3F98A 2ZAOA 5BSRA 3FH0A 4G01B 3QTTA 2V5VA 4UHJA 1Z5UA 5ALUA 3TTSA 1J23A 5TF4A 4E11A 1U0BB 1OLSB 1LLDA 4MW0A 3P9CA 4NH4A 4XWTA 2ZG6A 1M2FA 1QYCA 2CXNA 3B1VA 3CY6A 5FHRA 4Q3AA 1WCV1 4MARA 3UXYA 1L2TA 1ADGA 1P1IA 2JI9A 2OUIA 1GGHA 4L5CA 4ZAVA 4BAUA 4DDTA 5CXSA 5EMNA 5JMTA 4I9NA 3ZEAA 1QTQA 1GUFA 3F2IA 4C21A 3UXEA 2BP7A 5ALQA 4HKTA 1PHRA 2OZVA 3M8KA 1BQEA 4MYHA 4PLYA 4WA7A 3KTOA 5KBYA 3PX3A 1HLDA 1LJ8A 2EOAA 4CHGA 5EE9A 5F4BA 1VC2A 1GNRA 3UKOA 3NYQA 1Y1KE 5TE9A 1W8IA 3I2HA 4OH1A 2HLHA 3E5RA 1P1KA 4OPMA 4WPGA 5DO9A 3UT5B 2Q5JA 3C3BA 3IV9A 2QI9C 5BN5B 1AIPA 1GNSA 1V45E 4YACA 5EWJB 4IX1A 1K2VN 2P6OA 1QHIA 1WL8A 1BYIA 2LP4Y 2WFZA 4YJGB 5U4QA 1N2SA 1WXQA 1ORTA 1FYWA 3DD1A 3LPCA 4DY4A 1YSCA 3GLTA 3AHCA 1L7VC 2Y92A 3K73O 4EX6A 1LBIA 1ZBQA 4ZCQA 2GN0A 3A31A 3QVWA 4EUHA 4J1QA 4KGDA 2F1JA 5IM5A 3MEQA 1NPTO 3RFCA 3ASYA 1WKBA 2O9JA 5JISA 1F9EA 3JYHA 5JCPA 5JMOA 5KSOA 1JEQA 2R00A 1U2SA 4H7JA 4MUGA 4M8NE 5D1NA 1TTTA 5D6OA 1VRVA 2A5YB 4MR7B 4LF8B 2F62A 1XZAA 4OXKA 3OZXA 3AB3A 3KLPX 3ETHA 4LXXA 1ZUIA 2Q29A 4EWLA 1X1QA 2GCNA 1LF0A 2HY7A 4UTOA 5ICGA 2JZOA 1A2OA 2PS9A 2GDZA 2QTTA 3Q3VA 5CPBA 1PJLA 3EB9A 3OJXA 4AP6A 2GPWA 2D0IA 1CVRA 4L95C 5FA6A 3CF0A 2VJYA 3EVDA 5C0OE 3ZCSA 4BJ1A 1EK0A 2JIMA 2OCPA 5B4UA 4A5OA 4D5EA 1HTWA 4HAOA 3EF0A 3H5VA 4XIJA 4IIBA 1RPAA 4AXXA 3G1TA 3DVSX 2VTEA 2IF2A 1H2XA 3I4FA 5BRJA 4YQEA 1JBQA 4WGFA 4WD3A 5ALIA 1RCTE 5TC4A 1XJQA 1E2IA 2OUKA 2O59A 3IILA 5JEDA 1A5TA 3PNQA 5ALNA 1OPXA 3HXTA 2A86A 2CJFA 2H8GA 1GKUB 1JR2A 2QN7A 1ADCA 4DA6A 4OKIA 3EGEA 3ZZ0A 3V8RA 1HDRA 4DLNA 4EELA 5IH7A 5IS2A 2HAEA 1EFVA 1Z3IX 3DO6A 3R5TA 4KFTA 5EXPA 2TMDA 3T7RA 2EGUA 3WSVA 3UJAA 4PYNA 5TGZA 1FTGA 3G23A 2IOFA 1I4EB 3GJTA 4HZIA 2GXUA 4LWPA 4EMBA 1CWUA 2YHIA 3BD9A 3SS9X 4Z5XA 3GXBA 3MWFA 1JLLA 3Q9LA 4KRXA 5BWOA 1ZN2A 4ZKDA 2O8FA 1M0TA 3GR6A 4HN9A 4JUCA 4KIFA 4O5OA 3VUFA 1E9VA 3F67A 5JY1A 2J4CA 5JSUA 4FN5A 4TTAA 3A1FA 1NJ6A 1FYVA 4XTCS 3DHEA 5EHQA 1P5JA 2IUFA 4KN9S 2WG0A 1XJWA 3DAOA 3Q41A 5LQSA 4XRGA 4IIDA 4AKGA 4BVBA 2WIKA 4P58A 2V7VA 2LCFA 4YAWA 1XPUA 4N3CA 4OJQA 2P3OA 2OK8A 2JFGA 4O4JA 3LUAA 1RWWA 4GZ3A 3DVAA 5JSHA 2V9CA 1V3QE 2BTQA 3ITEA 3RKRA 4C7BA 5BNWA 2YZ7A 1KYZA 3A4VA 3VPSA 4B7XA 5A4DA 3UWMA 2FPLA 4LXTA 2P2NA 1R6TA 4LRUA 1X70A 2IUYA 5AESA 2B2NA 1ODLA 5BSWA 3FZQA 3EZ6A 3WL4A 1OYVA 4RSMA 1E8MA 1C41A 1JE0A 2RKBA 1KYIA 1NZJA 1RWVA 1V5FA 2BBTA 4O1MA 4XQCA 1J1UA 1E4VA 3IERA 1AUVA 1LZLA 3QKSA 2Q6OA 3RE1A 5AW7A 5B55A 5JQWA 4YUYA 2Q6TA 1QB7A 1D4FA 2BZ0A 4OMFG 2ZBPA 3UMBA 4W5NA 4LHVA 1G55A 1EK1A 2C78A 3ZIAD 4L8YA 1LDEA 2RH5A 4DLLA 2WPDA 4W1PA 4ZVPA 1IVSA 4E14A 5D5QA 2FGKA 2YKGA 4AO7A 2FRDC 4DMKA 1H42A 4R7ZA 1WJGA 2PKCA 2WAYA 1SBHA 1XVAA 3H1FA 2C7OA 4Q7MB 4TWRA 1ZISA 4YO7A 3VV2A 2MYNA 4AF6A 3CN9A 1ZN9A 3DKVA 2PN1A 3KJGA 3UGKA 5ALPA 1RKUA 3C48A 3CX7A 1J2EA 4O29A 3LV8A 1SELA 1KY2A 2FCRA 2PZFA 3VNBA 1VJCA 2QVCA 5LYJB 2YS7A 2BFNA 1OB5A 4IUDS 2E5FA 1RWKA 2RDMA 5BYBA 2BFDA 3KQWA 2REQB 5IBCA 2M6RA 5KREA 1UFKA 1R9GA 4I1RA 4LK2A 3TYXA 5I45A 3L82B 4Q16A 4Z7JA 4DSAA 3C70A 2PANA 3VM6A 4GQAA 3FSGA 4M0LA 4H6WA 4BMVA 4W6QA 3L0OA 5K0SA 4C88A 1SUWA 1P9RA 4FEAA 3G9TA 5M2QA 1M1XB 8OHMA 1TZKA 4KX3A 3T61A 1PCXA 3L18A 3QU2A 5F35A 3E2IA 1FMTA 1V1RB 1V9CA 2E89A 2GAOA 2HV9A 2R5WA 3QMWA 4PTLA 2VOEA 4UBLA 5I3CA 3C4QA 4N7MA 5DJ5A 3AI7A 3K2EA 5H16A 1SXJD 2VSNA 4TYWA 4YRTA 3VPXA 3KWFA 2WFAA 2VVTA 2F8MA 4HDQB 4AXBA 2PLFA 2V3WA 5FLEX 1FJXA 2X0FA 1RXCA 3SQDA 4NH0A 1QR2A 1MR3F 1VA5A 4ZZ3A 5FI0B 5C46F 1W7AA 5LBTA 1V7ZA 1XPOA 1PNOA 4E6PA 4E3ZA 5AK5A 1TQ8A 2BF7A 2BHTA 2PLRA 4LZNA 5HZMA 2WIFA 3T5PA 1K7YA 1MFPA 2NVOA 4JI4B 2QTNA 2IGTA 3VR4A 4C4AA 1UM9A 1FOEB 1I9GA 3B1KA 3NM4A 4AC9A 3WGUA 4BQSA 1I9CA 2RCNA 1XDDA 2AW3A 2H4YA 1C3OA 2YHSA 2WWYA 2ASVA 2VJBA 3L8YA 4JI6B 3BWBA 4EJMA 2VTBA 4PYJA 2DQYA 4XVUA 2I5PO 1B14A 4ZWNA 1FF9A 3RU3A 2GM5A 1YFLA 4WZ6A 2FEMA 4LDJA 2VSFA 5FFNA 2BOVA 4OQDA 1L5VA 5FH9A 1B0UA 1Q0ZA 1QG2A 1XZGA 1RPZA 3N7TA 4XGKA 3UANA 2BLNA 4H7KA 4A0QA 3I39X 3HBMA 1Y7HA 5A4MS 4WY2A 2ZCUA 5AVZA 3RADC 1NLZA 2GM9A 1II0A 1VL1A 4Z2AA 2FXIA 4REQB 3TW0A 1GCAA 3VU8A 2D62A 1JFFB 1RT9A 3FMGA 4BBZA 4MVJM 3GMDA 3N2LA 5LQNA 1IY1A 1LU9A 3CZ4A 3ONFA 5DMHA 2G9VA 2AZXA 4QOEA 1FXSA 1K9SA 2FOXA 3I32A 2PKEA 2ID7A 1YVDA 4IV8A 5TPZA 2LDXA 3AOGA 3IOEA 4O3FA 4DLZA 1MAAA 2F8TA 3MB5A 1JHAA 4YMVA 1CQPA 4C2BA 3ZKWA 2C2ZA 2OO5A 1G98A 1NVGA 2AXPA 2W6CX 3W5SA 4C9BA 4IYJA 5AK0A 4JQSA 1ZFNA 4NEQA 1ECBA 1MW9X 2NADA 1YZVA 1Q20A 1NM5A 4A8PA 1U90A 4QVGA 3LTNC 5JD6A 2QP4A 2XF2A 1Z06A 3CF4G 5B7QA 1YB1A 1L1EA 4HH1A 3TNJA 5HIAA 4RIHA 1ETUA 1BQ4A 1COWA 2WYVA 4I1VA 3JQ9C 4JUIA 1UC9A 4PAMA 5T4FA 1G7RA 3GG9A 4DA7A 3MSXA 3PP8A 3H6HA 1T9BA 1XT6A 4PZPA 4YWJA 5KYUA 4ECEA 1L3IA 1PDWA 2QDKA 2V7UA 4HNHA 4J3FA 2BN4A 3K0HA 4TUYB 1UMCB 1JG6A 3A6JA 4GX5A 4RVFA 1M2VB 2XUKA 3B5IA 2I6TA 3BFVA 2AOWA 3JWHA 2G72A 2ZKLA 5CT5A 4Z51A 4Z7NB 3L02A 2B7BA 4X24A 4C20A 1PG5A 1JFRA 2OZPA 3CNOA 1IMJA 1EEHA 2HO4A 3TJZA 5JNWA 4RMHA 3RUIA 3P5SA 4B0PA 5KSPA 2W6NA 3GK3A 4HNTA 1HMPA 4ZYZA 1E2PA 1P2TA 1AN9A 1YVRA 2NP6A 3VNAA 4BE9A 2PT9A 3JTEA 2W6IA 3FGNA 3KUKA 4Y2PA 2B8TA 3L79A 1XWIA 2P67A 4D26A 2HCRA 1UBSB 3NIDB 2RBKA 4PV7A 4BE4A 2PNFA 4BQRA 3UMGA 2PL1A 4LYFA 3BHNA 4RE6A 5IMBA 2J0EA 5I3ZA 5ISMA 3RWOA 2OL4A 1L8XA 2PWBA 2WABA 3V4PB 1IULA 3E9YA 5KU1A 2A4MA 2ZITA 4RBNA 2RGUA 4L5JA 1S4QA 4UBOA 1Z7BA 3F3KA 2YC4C 4DIFA 1ZICA 2C95A 1N0VC 4M9CA 2NYUA 3D3NA 4PS1A 5HZKA 1XRMA 2OZLA 5LOVB 1NMSA 3LKDA 4UHBA 5TJHA 2O5CA 4RMNA 5B7NA 2B69A 2JCXA 3ORRA 4KK3A 4OQFA 4X00A 2DSTA 1N3YA 1OLUB 3F3MA 4IIGA 1ZVQA 3I9NA 4N8SA 4UEOA 2Z8ZA 1NVAA 2IRWA 4F45A 1W47A 1XOIA 2J9ZB 5DTMA 2BH9A 3QBEA 4RK1A 4Z7OB 2COKA 4DLSA 1M6EX 3R3WA 4NBWA 4PR0A 4NMMA 1E1LA 3H1GA 4S05A 4G0XA 3AEQA 1GQRA 4X20B 4YRAA 1QLJA 2QAJA 5LXTF 4K0KB 5CVVA 2BIFA 3GEEA 3AVTA 4NOJA 5CIWA 1VMDA 2C2HA 4YP0A 5H81A 5CAEA 1UKCA 2EAUA 4BNGA 2G4CA 1T9GS 5KWJA 4G26A 2DP4E 1DTEA 3AQ4A 4AROA 1T4DA 2R6CA 4HDOB 3ILYA 2JI8A 2RGCA 1RKVA 2ONCA 1KWKA 3ZTTA 3I45A 2SHKA 4J91A 4PG6A 1VG1A 2BR5A 3OCUA 1N25A 3JQ9A 1ZAKA 3L1VA 3I1YA 2B94A 3KKOA 3OPXA 4HQNA 4P54A 4F11A 2EWVA 2JJQA 3JATA 4B6OA 1CUEA 3BMQA 1N7JA 1WDKA 1XAGA 5BQ5A 2W43A 1TU0A 3OU6A 1HR0B 3B9PA 3Q0IA 4LJSA 2AMFA 2CLHB 1RQGA 1EFLA 1PKEA 1TLFA 2AFIB 1PS9A 2ON6A 4HG2A 2R8EA 1TVMA 4UM5A 1X15A 3FNGA 3GC6A 4GOND 1SCQA 4B2LA 3K1TA 2H7VA 1ZK3A 3BTUA 3VR2A 1S7CA 4F2GA 5EWJA 2HA0A 3EXIA 2PFSA 3JR7A 2ZRJA 3RSGA 2AN5A 4HWOA 3RFTA 3ZDZB 3C5WP 4HDNB 4KFRA 3W04A 2RAUA 5G53C 1M1YA 1Y42X 2WAAA 1E3MA 2WNIA 3VKGA 4A7PA 4MS1B 3OMXA 4QLOA 4QO7A 3TXYA 1ORVA 3L8DA 2FOIA 4J1TA 4R9VA 3Q88A 2JFYA 1PU2A 1T0HB 3H9JA 5TVGA 5HUJA 1GQ2A 1PGNA 1IN5A 1U7OA 1W4LA 3BMCA 4QBHA 3FW1A 4R71A 2J9YB 3LT4A 4ISCA 3B78A 1WZNA 3E0XA 5D3KA 4B34A 1OVGA 4OU5A 4TROA 3H16A 1AM4D 2Y71A 3RYCB 1GNVA 4QM6A 3M1IA 3RSSA 1Q77A 2DU8A 4FGLA 5D87A 1Z36A 1TLTA 3HE3A 2QVGA 3O2NA 4P6VF 3E7XA 2Z6AA 3P9NA 4E13A 3CTMA 1L9XA 3RFVA 7REQA 2Q07A 4Q00A 4PXYA 1F8YA 5E8JA 5F9HA 1MX5A 3SQNA 3RIGA 4LDAA 1DBVO 2VDWA 3GB9A 5ULLA 2IUUA 4AS1A 1IEQA 1ZJ4A 3HVIA 3MNFA 4JODA 4X1YB 3W8FA 2O8NA 2WQ7A 3ESBA 4U3JB 3TX6A 4DJTA 4W1QA 3PCTA 4J3JA 5AOVA 4GLBA 4ZDJA 4IH9A 3E9CA 4WESA 1SGWA 5AQEA 1TB4A 3D7NA 2PGDA 3ZV6A 5BT8A 5CB8A 2QSJA 1E9DA 3X1DA 4KYVA 2Z09A 3RC1A 2XRFA 2O06A 4W8HA 3ZLBA 4A8JB 4P9NA 4LAFA 4AG6A 1H4QA 3AR8A 3IP9A 3T1YB 2HMAA 2BFFB 2VXYA 2XX3A 1T26A 1KFBB 1R6VA 4UHEA 5GV7A 5KYYB 5HBRA 3PD1A 1BCSA 2ZP1A 4KQHA 3PQ8A 3SDBA 1GCUA 3DE0X 1W36B 5FBVB 3UA4A 1F8UA 1KSJA 3TGWA 4QZVA 3TRFA 4MJ3A 5DN6D 4MKIA 2XE8A 3P0IA 2B8JA 1DMRA 4G5OA 4JGGA 2P27A 5DF1A 4PX9A 1V47A 2WU3A 4Q93A 4Q12A 3BWCA 4OK3A 2DWPA 3ZH2A 1TEZA 2ZIUB 1RTTA 1NURA 4LYAA 5BSGA 4KFSA 4Q1CA 4BCCA 2O8CB 4POOA 1M8FA 4ZT4A 5I7EA 1E5DA 2XQJA 4R51A 3RS0A 3UAYA 5I7HA 3EG9B 4MR8B 1EZ4A 3H3FA 5FTMA 2V03A 2NXJA 2YV5A 4KREA 2BEUB 3L0CA 1WHTB 2B4KA 5JC8A 1BH6A 3FVVA 2PT5A 4FOPA 4NYIR 5LDDC 3CJTA 1NR1A 2FGJA 1C29B 1L7OA 5KTMA 5LP6B 1ZYUA 3PDIB 4UU1A 2BUBA 2XZPA 3IMFA 4P0TA 1IPEA 2XQGA 4AJOA 2H31A 2IELA 2MR6A 2M1ZA 3SLKA 3V8PA 2RHCA 1MAUA 3LM8A 1P60A 3ODPA 2EJVA 1ESNA 3OM8A 4PRYA 3C6KA 5AXDA 4DCPA 5KNBA 2FZCA 4QASA 3FUCA 2AX3A 3MRXA 4HO1X 4XVQA 2P68A 3CLUD 4XX1A 1UOEA 4F96A 1SKQA 2J6CA 1KY5A 4U7PB 1FRVA 1UBMS 2EJUA 2CDRA 2GPJA 5E1DA 1E62A 2Y9MB 1R6UA 1JWLA 3HO6A 1T35A 4KR3A 4FSXA 4J0FA 4JK3A 2YYSA 3LGSA 4C30A 4LDRA 3GVCA 1FRQA 3C8UA 5MDHA 2QS9A 4OSOA 4V1CI 3CLUC 4EQ6B 4YMGA 1SVNA 1V8ZA 4FMPA 1M9NA 4ROSA 3DXFA 4MV4A 2ZWAA 2H1OA 3EQZA 1UFOA 3C3DA 3S2FA 1OAOC 1R0KA 3QSGA 2IE0A 3N53A 5AI6A 1KFCB 3QA3E 4QEZA 1JL3A 5H7XA 2C9CA 3RUDA 1IN7A 4EUNA 2FN7A 4PE5B 3HCOA 4C7OB 4MYDA 1UK8A 3MCTA 1L8QA 2JH3A 2VQDA 3DR5A 3ROGA 1LNQA 1WV1A 1R6DA 1R50A 1F0YA 1GUZA 4XVRA 2GBIA 2VDKB 3DBLA 3QSYA 2KQUA 3OEEA 3R7BA 3A0RB 4P4UA 3OUUA 4L7VA 4ZQIA 2B0CA 4DCGA 1CS0B 2FMHA 1UBRS 5B30A 2AQ8A 2VDVE 2AWNA 2H1SA 4JHXA 4OMDA 4EA7A 5HTOA 2PQ2A 3B6MA 2QV7A 2RGDA 2VF8A 1XK7A 3BEOA 3WKAA 1I1HA 2CFOA 2WU0A 4FN4A 4JH0A 2CV1A 1Y6RA 4Q37A 4TXMA 3UB3A 1VA4A 1QHHA 4G9GA 1G0OA 2J85A 2Q49A 2EBFX 3QNMA 3WKEA 2IOYA 3SQMA 4DQKA 3G1UA 3HVKA 5HKKD 1V3VA 3K16A 4CVNA 4B17A 2VC2B 1LPMA 1V16B 4AN4A 4LDNA 1JXQA 1QZ3A 1ZXLA 2HPZA 4ZI7B 5IZCA 3I05A 1GZ7A 7AT1A 5LDHA 3IHKA 3M6XA 3PNKA 3TIXB 1L5GB 4FT4A 1RRMA 2YQ5A 4KRYA 4TUYF 5F33A 4BP8A 1EFCA 1IEWA 1PEKE 2PH1A 5HKOA 5ERYA 4Q4CA 3A9VA 4WZBE 3KDAA 3NTRA 1WX1A 3AF2A 4F4HA 1EK2A 2QTVB 1A7UA 1UBOS 1XJCA 2DH5A 3KR0A 4DSZA 2CZQA 4U2FA 4PTYA 4RJJA 1UOPA 2DMRA 1JILA 4JOSA 4QXAA 1FPMA 3COYA 4F06A 3SKVA 5JALA 4KWEA 1EDZA 2HUNA 5BSMA 3D4PA 3UIEA 4M1YA 1BU5A 1ZGHA 1XVVA 2ADOA 5J5VA 1YZLA 3F7OA 3VU9B 1LVUA 1EK6A 2Q5HA 2QIOA 2WWHA 5KYTA 1ZW6A 3EQ6A 1E6UA 1MCZA 1YS6A 1N1GA 4RF5A 4CV1A 4ZICA 3MMSA 1ODKA 4IDOA 4PLVA 4X1OA 1WCIB 4R84A 4IFEA 4BP3A 1J0EA 2GHRA 3VVBA 4DR4B 5YASA 3SGLA 4C0LA 1NRXA 1CRQA 4XI9A 3SHVA 5EUMA 1YNOA 2VF5X 5F1OA 1YJ8A 2WTAA 2BGGA 3GEDA 4KLCA 2Q2VA 4FYYA 4R8RA 3H13A 5J3JA 3V8NA 2AIRA 2B4YA 3JALB 2R1TB 5BR7A 4DMRA 4JB2A 5T6MA 5LOVF 2YVQA 3I28A 2OOKA 2NV2B 1X1RA 3QUQA 4LY0A 1OAOA 1SN7A 4PLTA 5KWEA 5GTDA 1B1CA 5LIPA 2JH8A 1GPKA 4GFDA 3RIMA 2D2XA 1W35A 3OE4A 3RYIB 5F73A 4F1WA 3UWPA 3CURA 4RH1A 3BFXA 1L4MA 2EDAA 1DJQA 4WLFA 2XZLA 3LQYA 2HNAA 1QHEA 1NATA 4E2XA 1QFMA 3RC3A 3I53A 3TQCA 4R8SA 5MGBA 1XPRA 1PBNA 2H48A 2XF8A 4TLEA 4BL5A 2HREA 2I2AA 5DBGA 1EHYA 4E03A 1OWMA 3RFFA 4DA0A 3V4RA 1KZ9A 1ORWA 4NECA 1F20A 4R8KA 3D64A 1TECE 4FR2A 4E30A 1WV0A 4FKZA 1L1FA 3H9BA 4P31A 2C92A 1P8AA 3NHAA 3MTGA 1URPA 2XYGA 4JL8A 1N8TA 2HU5A 1QZTA 3OIWA 3QFRA 2G7MC 2F6RA 3B1FA 2A0WA 2I6QA 2PX3A 3HYRA 3RROA 1T9DA 1O77A 1G2OA 4OQYA 2JCGA 4E70A 2G07A 3K96A 2GFIA 1H8ED 4TRMA 3ND7A 5KTYA 1Z6GA 1WR8A 3A2KA 1BEEA 2WWXA 1HG0A 4TTIA 4QYIA 1U0NA 1BXZA 3IA2A 4WXRA 2E37A 3OC6A 2A58A 4Q18A 3TAXA 2QTWB 1WDWB 4MW7A 3SQXA 1H23A 4ERXA 2P8SA 1ZK1A 2WWVD 1XNHA 4H7EA 5TEWA 5CB4B 1DC7A 1JXMA 2FA9A 3EUAA 2YJ5A 3PDJA 1CUFA 4NZNA 521PA 5I7OA 1NKSA 3LUHA 1VIMA 3ROXA 1TEHA 3KZOA 2H00A 1KIAA 2K7FA 3C98A 2R68A 2XNJA 3O2QB 4Y30A 4M83A 3TJRA 3C3AA 4I8DA 4BASA 1DS6A 4ALNA 2PAAA 4AICA 4XIIA 1U99A 2BFEB 4ID9A 3EX7C 5SY4A 3RVBA 1O89A 1PWHA 3QVGB 4PBTA 3VXKA 3WFIA 4BB6A 4RD1A 1J21A 4HX5A 4X8OA 2P5UA 3PSAA 4KG7A 1Q1GA 4N6OA 1TGVA 1N9GB 2V74B 1HKUA 1FCJA 3A1DA 5D3MA 4Y6RA 5TLSA 5CGZA 5K3OA 1CUAA 2GF9A 3QKTA 1IAVA 5CFMA 4M89A 4INAA 1M8GA 1M0WA 3WMEA 4AX4A 4N9WA 3B7PA 2ZAIA 2RC5A 3P9RA 4E5YA 4OLJA 2TMYA 2IZ0A 2YWJA 5DNYB 1JV2B 2WVHA 2XIQA 3ABZA 2FOLA 4KBFA 4MH0R 4P4LA 1UEJA 4TTVA 3RRYA 1D5CA 2VYND 3OIUA 2PUWA 4PC1A 2DHDA 3LC0A 4YMUA 3M3DA 4AJ2A 1AB5A 1NFQA 3PPWA 3PLRA 3OPYA 2CLOB 3RM3A 3UCXA 5HOQA 3S44A 1O4VA 1NBAA 4HH4A 1M76A 1T5BA 3DHNA 2V6BA 4JKIA 4MCIA 3OZEA 3U17A 4XA8A 3N6VA 1IQ0A 2XMGA 1NNSA 2D5BA 5B58T 1JQDA 4ENUA 1W5EA 4QG7A 2GEFA 2HMWA 5BYJA 2V7QD 5JAUA 1KJJA 3HFRA 3D7MA 3UAXA 2ZVDA 4HQ0A 1AK2A 2KLHA 4S0XA 3DUFB 3DT8A 2PSDA 2XRMA 1B6GA 4P82A 4UFPA 3EXFB 3LRXA 5TMBA 2SBTA 4O4HB 1C2TA 3IVCA 2OHHA 3BAZA 5K0LA 4MI9A 3ZV3A 3DEFA 1GZSA 1QH1B 4EX7A 2HWYA 1X8XA 3ZNQA 3AHEA 2YWEA 1S7GA 4B3FX 3DBRB 2JFHA 4OXIA 3IQGX 3ZXIA 1HDIA 3CVOA 4R69A 1CDEA 1TI7A 2HWUA 2XMPA 2MSCB 1RVV1 4JJ6A 3BWEA 3OQJA 5CNJA 2HO5A 3OTIA 3QUSA 4Y1GA 3I9OA 3ZBPA 2YR0A 1G2PA 1AGYA 4C03A 2QRHA 3RYHB 4KPFC 3T7TA 4EENA 2FNAA 3SYLA 3TIGA 3B3QA 3SE0A 2IY9A 3SG0A 1XKQA 3NC0C 1X86B 5JZ9A 2CLLB 4WOKA 1EIWA 2FJPA 1RI4A 1H8HA 3KJIA 3SQOA 4DG9A 2V5AA 5JYEA 2DTDA 2ZRCA 3ZE1B 4X94A 2WM2A 3NTVA 2VJCA 2OWDA 1KVSA 3HJNA 3NCHA 2J9RA 1WCYA 2R79A 4NZYA 4Q24A 3RU2A 3G5AA 4RLSA 1LPSA 5LP6F 2QRQA 2D7CA 1P2VA 2FRVA 2ZRBA 5LNK6 2Q4TA 1I0IA 2Q1YA 2Y66A 3AY3A 3HSSA 3OQ6A 2CFCA 1QGDA 1U0SY 1W29A 1YTLA 1FDIA 2GJ4A 2IJGX 2VPIA 4G5YA 4MKFA 4UU7A 4XLLA 3NONA 5KYNA 4OO3A 1YVPA 2ZJ4A 1YR7A 1M10A 3M83A 4CKCA 4BO8A 1QNFA 3I37X 4KC0A 4AJ9A 3UO8B 1VGQA 3QX9A 4C2UA 1GM5A 4IMIB 3SC2A 1M6VA 1YGPA 2D5LA 1TUIA 3A6LA 3AFOA 3FKQA 3M5WA 5DW0A 2G5PA 2HPAA 4GPAA 2OPHA 3GEBA 2VCEA 3GG2A 3BJIC 5FPPA 3HJUA 2QM7A 1OH7A 2NO7A 1PDOA 2YXEA 2FPIA 3K1AA 1WXWA 3C3XA 2ONYA 3DOOA 1NP6A 3W7VA 4GPTA 3ZHCA 4B80A 3BZUA 3T9EA 1D7AA 4C29A 5BQFA 1UDXA 4BX9A 2PRYA 3QM1A 2ZDGA 3R74A 1LBEA 1JIIA 3RRNA 4J0CA 4X64B 4IRXA 4EB6A 3UJNA 2W48A 4PX2A 3B51X 2K7ZA 2YZGA 2VNIA 1QH8A 2QUIA 2CD9A 1KDOA 2VAXA 3BF7A 4RULA 5LPNA 2REBA 4HMQA 2M9MA 2D2IA 4ADSG 1O6ZA 3KLBA 3GRRA 4CG0A 3UUGA 4WADA 1ULUA 2OXTA 1TU4A 1XHFA 5H82A 4D9CA 4GDFA 3IDQA 3ASUA 3DE2X 5GVSA 1THZA 2W6QA 2QU7A 2N3ZA 2PCJA 2JGDB 5C37A 1ZUWA 4EO7A 4LWOA 4PG7A 1XQWA 4PXSA 1IOZA 1CY6A 1Y6JA 5CA1B 1YJCA 1YHNA 3SX0A 2A67A 2EVWX 4BNJA 2OGWA 3BJMA 1PFGA 2IEIA 1YB5A 4YJ2A 4UOEA 2B4AA 1E1DA 1ZP6A 1ZQ9A 3NTLA 2VH1A 4KWTA 4JASB 3GDGA 2BDEA 4D1YA 3M1AA 3S2GA 4L0MA 4YRIA 3M5PA 1B4DA 3SR4A 4DJJA 5CFPA 1KI7A 5CYGA 3FCEA 1AUQA 2CVZA 1MAWA 1NXVA 2D54A 2XNSA 3NORA 4ZI7F 5JH7A 2XAAA 2OGUA 3P0HA 4GM1A 1QVAA 3WBFA 4QTXA 4EMSA 4QICA 3RV3A 3A1NA 3HL0A 4IKEA 2C58A 3VR3D 5FWXA 1US8A 1XN4A 4IW3B 2R6DA 4ZO7A 1I1NA 1AS2A 4XPZA 4ZXPA 4BNNA 2XBMA 5FRDA 4ZEWA 2VXBA 4V03A 1VIDA 2D1FA 3HGTA 4BAGA 1FLAA 4YY3B 3U4QA 1FS5A 3P32A 3Q85A 1HL3A 1JR3E 4EATA 1RC8A 5T41A 5ALYA 1JHXA 1YHZA 3H1TA 1E2MA 1AKRA 2CKMA 4B84A 4NABA 5G0WA 1INLA 2BAGA 3TQFA 3KEOA 4QTZA 2PRSA 2DUMA 3ZHOA 4F6LA 3WA7A 4GL2A 5E6RA 4DC1A 3LKZA 4I4NA 5IW8A 4BNIA 2MOKA 5LZ9A 3M6WA 3LG2A 2NYAA 3ZE7A 4X6LA 3MA0A 4GGMX 4A91A 1E1RD 1LBSA 3UWOA 5MHTA 3NS7A 3RR2A 5JW6A 3Q7RA 2C77A 3PXUA 4EFLA 1F2VA 3IKJA 3F6BX 3OMLA 1IQPA 2B9VA 2NO5A 3F5SA 1YOVA 2FWMX 4DARA 4U7JA 3TRJA 5DOVA 1QIMA 2VZLA 2V7XA 2OV3A 4RESA 4D9NA 4HZGA 1A1SA 3LE8A 3NVMB 1IVYA 1CIJA 3FTNA 4K88A 5DYGA 1YRQA 2GPAA 4EDHA 2QX6A 3BL8A 5E9WA 3BXXA 4MWSA 3KPJA 2X42A 1ZXBA 3GZNA 3QKUA 3FTDA 3GMSA 1Z5NA 4YAFA 1XD2B 1TCVA 3CVVA 1W52X 1G8KA 2PS3A 2QSZA 2FX2A 2FSVA 1KOGA 3NGXA 5SZKB 3MJRA 1PLKA 2IEGA 3IULA 4H1WA 3BPSA 5K3EA 3HM9A 3IAXA 1DBIA 3MAJA 4HBGA 1XZEA 2PPLA 1MB3A 3B52X 4CLOA 3K6KA 1R0BA 4LN1A 1CFJA 3ZUPA 1RKQA 2NUAB 3DTVB 4WEQA 2Y99A 3GI1A 1OWNA 1OZGA 1BOOA 2EBWA 2KM1A 3IB3A 4W5QA 1HQYE 4GR9A 5F76A 2ORVA 1FTSA 3I2KA 1KXJA 1N6KA 3KKPA 4N76A 3ZDBA 2PJUA 3OEHD 4LHWA 1J2YA 3IV6A 1D6SA 1A5ZA 1XTZA 3LLSA 4II3A 3WNZA 3CJRA 1UXKA 2H92A 3DAYA 1NA5A 2AN9A 1QV9A 3TDKA 1B2RA 2FMKA 2J0UB 3MJDA 4B3BA 2VUHB 3LUDA 5IASA 3HJHA 4GI3A 4NCKA 5EHNA 4HX2A 3SXUA 3B6KA 1T24A 3KAJA 1ZM4A 4RZIA 1QK4A 4II2A 2QGNA 4J4TA 1IPFA 1YRAA 2Q2NA 4HK4A 3T1NA 3MT0A 4DSUA 3BORA 4RCVA 4DT1B 1MABB 1Y1RA 2Y0BA 2IUTA 1ECCA 5CB4F 4WOPA 1ISPA 1N7GA 3IUYA 4MUHA 4OATA 4YRCA 4ETMA 2Z98A 3B1WA 2QL5A 1Z0ZA 3ES9A 5EP2A 4BTVA 3OFJA 4R2LA 3LNCA 3BB1A 3JYPA 3NOQA 2IH5A 2AXQA 2E1PA 4TRRA 2I6GA 4D0NA 2DVMA 3ZHZA 4ZCSA 4MVCA 1S2LA 2P1DA 4UEQA 3H9QA 4L02A 3KL4A 1N2BA 2QVBA 4ZP1A 1XZPA 3X1XA 3ZX5A 1EXNA 1V4VA 2Z30A 2RG7A 3GJ0A 1X38A 1XZMA 1DX9A 4PPYA 4Y2GA 3ZHTA 3P2KA 3VPDA 4ZOQI 3OF5A 4WZBA 4DJ5X 5T7BA 4JP2A 2BEJA 2EJWA 1KEVA 3HCCA 5HCIA 3CNLA 4AI6A 1N33B 3GJZA 4FXPA 5FL7A 3DFIA 4ABYA 1Q2UA 4XE5A 4LJ7A 2XQVA 4L2IA 2NNLD 1JN0A 2CXUA 2PY6A 2VQ6A 1QG0A 3INYA 4L07A 4MYUA 5FBHA 3RQSA 1RPJA 5DBOA 1QPBA 4LCJA 1WLSA 1MH9A 1AUPA 2A1UA 3CONA 1G8YA 3Q3EA 4OLAA 2Z4TA 3R2JA 3GRUA 4TLDA 1XU9A 1FMFA 3C1OA 2AYXA 3CCBA 1HORA 2VZEA 4ARIA 5FL3A 1YBHA 4JBWA 4ND8A 1JAIA 2B99A 2W2PA 2X1HA 3L4KA 4K26A 1VI2A 4W7HA 5JATA 2QVYX 1A98A 1LJLA 1IFXA 3AXTA 3LQRA 3PRHA 1ZNWA 2CY0A 4TMYA 1QP0A 4N01A 4O4HF 1YJAA 5B1SA 3RV4A 1ZOIA 1NP7A 4H08A 5A04A 1N36B 1B43A 6NULA 1QDEA 2VYVA 4W1SA 2P0YA 5TB5A 3SYMA 3FOFC 2P1RA 2FF5A 4RH0A 4UTVA 2Q28A 3N2KA 1CW2B 1XTVA 4ZK6A 4YAIA 3I1FA 4KXFB 1GTRA 3ZV5A 3HY6A 3ZU3A 4LJ8A 1I0ZA 1KY4A 1MTOA 1OA0A 1Q7TA 1YXMA 2FFAA 2VAPA 1JQJC 3L7LA 2W70A 1ZEJA 1E5LA 3ZWVA 5EMJA 5K0EA 1AZSC 3RSZA 4HTFB 2CXXA 3TNYA 1TU3A 3WLMA 3TQOA 1JGTA 5J2UB 1GUYA 5B57C 3V8BA 3OT1B 1B73A 3NP9A 5HILA 3DPSA 2JD1A 4YUVA 1S9DA 2QNIA 4Q7EA 2DH6A 1Q0LA 1Y9AA 1RWOA 4NE2A 2AS0A 1Q17A 1MGOA 2GSWA 3M4XA 3D0QA 1QVWA 3GZTB 2GBLC 4RMGA 4CMIA 1VL5A 2GVNA 1EI9A 3AZPA 3BWYA 1FNSA 3NEAA 4GWKA 5IARA 4LF5B 5DNVA 2Z5VA 3V7FA 2C7QA 2ZDQA 3N0VA 5ALWA 1GUBA 2JKZA 3MN1A 2YHAA 1JX6A 1RABA 1FEZA 3D3KA 2I4NA 3FPBA 2ZM6B 4KQKA 2EG9A 3V42A 2W4MA 1DQSA 1RRVA 4LV8B 1DO0A 3OA0A 1E92A 3EMKA 2OBLA 1A7JA 4AP9A 1AS0A 1CJCA 4EA9A 3E6AA 4WGGA 4BNVA 4Z4HA 2PKRA 1ZGJA 2FU5C 3PUKA 4L28A 3E9MA 1L5NA 3UGTA 5K0JA 5K3SA 3ADBA 5GGXA 2FDXA 5C5EA 1AHIA 4Y6QA 3UW3A 1AQJA 1DIRA 1JBEA 1HRDA 1UJCA 3AR5A 4JN6B 2B34A 1J8FA 1KEUA 3O9VA 1UIMA 3VFDA 2RH9B 3EZ2A 1R10A 3OX4A 3GFRA 3QF7A 4GM0A 3FFTA 4HLQB 2EZTA 4I1IA 4NXMB 3B5EA 1KMNA 4G0QA 3VI4B 3JASA 2EKBA 3S81A 3RNLA 2G1UA 5DLEA 2YRFA 1P9LA 3CPHA 3IFSA 1NVTA 2GEVA 2QRKA 4PHTA 3HEAA 3LF1A 1AU9A 1A7KA 1DPFA 2WEKA 1QRRA 5FBRB 4NOKA 5BXQC 2HA2A 5I9IA 3CF2A 2ZPUA 3K6SB 4M76B 1ZM3A 4P80A 1OD6A 3HJRA 4N3AA 4ZVSA 3RUCA 4DNOA 1EFUA 1L6RA 2VK4A 2HCFA 1MIOB 5AVYA 4KSBA 3GT7A 3TSAA 1NVWQ 4BO0A 1C3EA 1G42A 4CRWB 3BN3A 4CIWA 1D1QA 2VP3A 2X4IA 4PHFA 2ZKIA 3BXGA 1CR1A 4U5XA 4R6WA 1FS6A 2FMXA 1ZJJA 5HFNA 5TT0A 3I01A 2JLWA 2ZAGA 3PQDA 5GONA 1JWAB 1XIVA 5FNVA 1DTWA 1UF9A 2RGNC 2W9XA 2JKYA 4JT2A 4DLPA 2R84A 3JYNA 5CA1F 4I4LA 4M22A 3LYLA 3QH4A 2HW8A 2H5EA 4RV4A 1R8YA 1VXOA 2IH2A 3DNPA 2QE7A 3FWKA 3X2EA 1J0XO 2J59A 1PWEA 1TAUA 2JASA 5DHSA 2ZXEA 3DMFA 5IVDA 3H0KA 1CUBA 1I4LD 1VI6A 4A26A 4F1KA 4PG8A 821PA 4EHFA 5CMLA 4B33A 2CCJA 1D9XA 1YZFA 2VR1A 2WJYA 3CPJB 2P91A 2VWGA 5FAKA 4D3SA 4RHUA 2GD1O 2UVPA 3KTDA 2GBLA 4JUBA 5T4BA 4COOA 5HDQA 1PIWA 5FNZA 1N4AA 5EHZA 1GSAA 2C00A 2VBGA 2CB0A 2HF8A 1J56A 2FLWA 1N2JA 2B3DA 3GNTA 4NMWA 4DVGA 4TKLA 4IO0A 4DLTA 1PW5A 2JBAA 3ELWA 4KP7A 4B1FA 2ZWOA 3I5AA 1Y8QB 2ZUWA 2NYVA 2XYHA 3AEXA 4QYWA 4TZKA 5AW5A 4DUPA 3TZEA 4I6GA 4C0AC 5LWQA 3VPAA 2WSYB 4TS1A 5EAIA 1W4AA 3WB0A 1PT8A 2ISSD 4KK4A 1TIPA 2FPSA 4Z3DA 4RADA 4HT3B 4OI0A 2P69A 3PPXA 1XAJA 2O7QA 3AWDA 1IDOA 2AR0A 4D79A 1AA6A 2HC9A 3W2EA 5G4KB 1UQRA 1KJ9A 1GAWA 1JR3D 2OFOA 3DV2A 1BFUA 1PR4A 3ETLA 1RXSA 2H4FA 4PO9A 1H4SA 1OYOA 4I50B 1GAXA 2Y0DA 3TLBA 1E18A 5AM3A 4MWCA 3CGWA 3SXPA 1KY3A 4B4WA 1J49A 3W3AD 1Z33A 4R9RA 5F98A 3E4DA 4C7KA 2V7BA 1KI9A 4AWBA 4IICA 2Q2WA 2ZUVA 4XQEA 1ESDA 1H9AA 1NV9A 1KE2A 3VC1A 4F56A 3UMSA 1PJ2A 4HPXB 2Z9CA 4EFNA 4O2BA 1P3Y1 2YBEA 1RCUA 3DNMA 4JKYA 3ZHVA 1ZD2P 4FKBA 4G3XA 3CE6A 4BNFA 1T5IA 1RP7A 2IHVA 5LNK1 1M2OB 4DW8A 2LZ0A 3D6UA 4NBKA 1C0EA 1VJGA 2QP9X 1UR5A 1ZG3A 2WT8A 4JQOA 1BKSB 3CO0S 3LHIA 4J2HA 5BUZA 2HGSA 5I9MA 1ESZA 1PJQA 1MMFB 1XMPA 2FTKE 3KL2A 4B4KA 3EMVA 4H59A 1SIWA 4TLMB 4JI2B 5K45A 3CWZA 1ZRSA 1O6BA 1Q6YA 1U0TA 4WFJA 5KHOC 1E2QA 3M6AA 4N0EA 1RM5A 2RGNA 3FMVA 3U0BA 4EY6A 3W6UA 3DEKA 3MBKA 2HX1A 5DCUA 4UEJA 4DM7A 1QE5A 3D6TB 4E15A 4GM4A 1PJRA 4KE7A 1CJSA 1U2EA 3ORYA 5C32A 2DXIA 1KAQA 4OVKA 3OUZA 4OIMA 2BEKA 3DMRA 1OV4A 3EPJA 2B7LA 3X1JA 4CCYA 2Q3HA 2PRZA 5CX4A 4GEKA 1P61B 2LXNA 1SBTA 2QWXA 4MR9B 4RF2A 4YVFA 1U7HA 1JAYA 3C3EA 5I7FA 2HMTA 1CDZA 4MI3A 4QTTB 3EIEA 4W99A 1RRGA 1Z15A 3OPYI 1G38A 2Q5IA 1OT5A 1Y89A 2R4QA 3FCUB 1X0VA 1AHPA 1VG9B 3EIUA 2A1TR 4WK4B 2ZRPA 5EJ2A 4C6HA 1FBTA 2PXAA 1GADO 1DBRA 1Q2XA 1CK4A 2WJHA 4Z8YA 2GA9A 3VZPA 2KBFA 2D2EA 2AK3A 1M1ZA 1RC1A 1I7PA 4IEFB 3TN7A 3VTZA 1V11B 4Z2YA 2OA0A 3LVRE 1IBCA 2GB4A 5EJIA 5AJVB 3VISA 4CFZA 1VCNA 2NZWA 9GPBA 2Z04A 5EIFA 5D86A 3I09A 1FTQA 3D6JA 1ZNZA 1SBNE 2Z9BA 5CVTA 2P40A 4B5KA 4BC0A 4B6SA 3G9UA 2YCLA 3SJZA 1MEJA 4JC8A 2Y1KA 3MWGA 4LY6A 2I99A 2QR3A 4QSHA 2B82A 3ICOA 1G3MA 2HWKA 3FPAA 1HH4A 2ZB3A 3EULA 4ZC1A 3PI6A 5IMSA 3HKEB 5C7LO 1L1RA 2MYPA 2ZS9A 5LBIA 1VLJA 2GD0A 1Y6QA 3B6IA 4XM1A 3ROKA 5BVHA 1DG9A 4FYXA 4O2LA 2QMOA 1TIBA 1EFHA 4GXNA 3H42B 1QZUA 1MX9A 2I3GA 1D2RA 2O8VA 3L43A 4IDQA 3KU4A 4KZKA 4HI0E 4UHHA 2O20A 4ZPXA 4XDZA 4Q66C 3V8QA 3TTVA 4WH0A 3ZDFA 3GJ3A 5EQTA 4DVJA 4LZZA 4E5PA 5INTA 2A9PA 4XX0A 2QLBA 3O1LA 2GM3A 4P3XA 2PZMA 2DT5A 3ADDA 1GKLA 2GESA 1ZO8A 3HB4X 2YVUA 2VH2A 2VPTA 2OK7A 1ODTC 1YB7A 5KX5B 3RD5A 4YX9A 5DT2A 3ADOA 1CLUA 2PZ8A 1U7ZA 4YRZA 1C9KA 2DUWA 2DWUA 2QT9A 4RAQA 4OHUA 4M3NA 1GGFA 3O75A 1WSWA 4ESVA 3U7JA 5DIFA 4C0HA 2PX5A 5F7JA 3DZKA 4JENA 5IJ9B 3R0VA 5CLIA 4C3OB 2V4MA 3G85A 3L6OO 3QJ5A 1A76A 3O8LA 4IQ0A 3WP0A 3R0QA 4C1BA 3K2BA 1ZI6A 2NU9B 3EDRA 1IQUA 2PSFA 1G20E 5J4VA 5IM4F 3TR5A 3HMQA 1GZUA 2HFJA 1R16A 2AV6A 1A9XB 3OQIB 5AJHA 2FYTA 3OZWA 1H5QA 1E2KA 1TUBB 1SUBA 3VA7A 1VLHA 3FKSA 3L04A 3S2YA 3GAFA 5FWYA 2J41A 4G5FA 4LE0A 4P32A 2WJAA 5CPFA 1PUXA 1W73A 3GUHA 5AJTA 5KYKA 3T9AA 4NJMA 2H2FA 1GY8A 1GILA 4X91A 4YXWA 3GEPA 2DPHA 4ZVTA 1CU1A 1FVFA 1LPOA 3MHPA 3CNHA 6AT1A 1SA0A 2QBYA 4EKGA 1VHLA 2Y1LA 2Q7DA 3F6PA 1PL6A 1ISIA 3C7DB 3NT4A 3PHBE 4HDMB 1P2FA 3ZHQA 3GROA 3STTA 2BFWA 2I66A 4CMGA 3O21A 4YPVA 1L3BA 5EXTA 3WXBA 4EQZA 5F64A 4EF6A 3ZJYA 3GLQA 5HJ2A 3EEFA 4C06A 3IIMA 4XWYA 2QAIA 1LNSA 3HGQA 4KNVA 5BSFA 1MRNA 1SC3A 2KWIA 1OLXA 2FPPA 4W7SA 1BVHA 1G16A 4KL8S 4LNUB 5FTKA 3WRWA 3DR3A 4MROA 3KELA 2CNWD 2H51A 4ZIRB 1C4WA 5FR1A 3I04A 4LGCA 4RTRA 4BLRA 1U9CA 3DZHA 4Z0HO 3SOPA 4BQIA 2BGUA 3A14A 1TYAE 1E3WA 2CLEB 4MYTA 4PLGA 1X9IA 1T3TA 4EKIA 5IHXA 3DKPA 2NO6A 3L5KA 3UPTA 3OZGA 4C7JA 4Z4CA 4Q3EA 4JQYA 3LCMA 1MO4A 4NE9A 1DXYA 4XWKA 1OXBB 1ZJ5A 3KX2A 5DFAA 1P5ZB 1WF3A 2E3JA 2Q3BA 4FFWA 1TTHA 2SKCA 4BX3A 2OOSA 1Q1NA 5ILOA 3GRKA 1K7XB 1SRQA 1E1NA 3AF4A 4ZODA 5E7IA 4HPJB 1MHPA 1ST2A 3MUNA 1UC4B 1NVBA 2J9XB 2JLQA 4HOYA 3C87A 3WGMA 2XXAB 1E89A 1K1EA 4MUKA 5AD1A 2IYWA 5JARA 1DEAA 4BNXA 2H2IA 3L1HA 2BE7A 2VDMB 3AKYA 3ENWA 3PCRB 4I9UA 3TINA 3ZLTA 4DRXB 2KLBA 3NB0A 2VNJA 3EDCA 1XTIA 1LTHR 2Q45A 4ND2A 3W6PA 3GA5A 2C7GA 3JRNA 4XTRA 4BO7A 1SQ6A 3W05A 3W06A 5A5FA 1BC5A 1XE3A 2MINB 1ODIA 3BSSA 5FJIA 3E1SA 2DC1A 4PPNA 1KFJB 4EZIA 3Q8MA 3PC3A 5JSFA 3EXG2 1PD1A 3HFJA 2C94A 1RU3A 3FR7A 4Q15A 4EJ0A 2HMVA 3PT9A 1BE6A 4BFXA 3KR1A 3DL0A 3HWWA 4ONEA 5J23A 1DINA 5ANRB 4PVCA 3IQHX 1PFQA 4UPDA 5T8KC 3WA6A 3DF7A 5DK6A 3DOIA 2CF6A 3U3XA 4ZV4A 3H11B 1AQUA 3O93A 2G6TA 3W5BA 2GEUA 3VR5D 3JQQA 1RYDA 5B64A 2IYSA 3R7DA 1TM2A 1G7CA 2PUVA 3ETGA 3ONDA 4CQMA 4QJ3A 5FWNA 1U63A 3QXJA 3IIIA 2B35A 3IDFA 1O3YA 4KUGA 1ULZA 4P81A 4RJIA 4MWTA 2FK8A 5BOSA 3EGVA 3EFEA 4GO1A 3RDPA 3FVWA 1RFGE 1VM6A 1XB2A 3BXEA 4MAFA 5UKDA 3GBVA 4F3RA 5A1JA 5I7RA 5E95A 1PNQA 5KO2A 4XH9B 4E09A 3HJFA 1UBUS 4PYMA 2ZE5A 1KSFX 2IYPA 1DIOB 1HG1A 3A6HA 3CH7A 3FY4A 4HWPA 5B3KA 2VAVA 3MWKA 1M2KA 2HJ9A 1Q19A 1OX5A 4CKYA 4CJXA 3KLMX 3HA3A 2FJUA 2P6PA 3AW8A 4LYYA 1BYUA 1BEUB 2D4HA 2Q4OA 5DEOA 4CF3A 3GELA 3RODA 1XMOB 1L5MA 1VLMA 1Q74A 4ZANA 1OV6A 2BEVA 3QU4A 3HA2A 2ATXA 3MPUA 4N7JA 1KQPA 1EP2B 4OHFA 4Y9RA 1T9AA 3GQVA 2B78A 4ERNA 2O8BB 3SVLA 4GKAA 3HU1A 1B8OA 3KQSA 4YAJA 5A2GA 5I4KA 2HIGA 1CJUC 1J7KA 2QTAA 4AS3A 3BE4A 4D42A 3VRHA 2PWYA 2XGSA 3QW4B 1Z56C 1AKMA 3WKBA 4ZTBA 2A9JA 1NI5A 3GLGA 3NDBB 1WD5A 4MQBA 1E3EA 1XXHA 3K0AB 1L4LA 3EXHC 1GNQA 1VE1A 4ZHSA 1HDGO 4ENVA 3B7GA 4LGVA 4DCCA 2D2FA 2YOFA 4MMXB 3G2JA 4CM5A 3RH0A 2VJMB 4I50F 4Y2RA 5CLJA 1HEIA 4TSRA 2PVPA 1UBEA 1UPTA 1JA1A 1QU2A 2H7YA 1Z0AA 3PI7A 2ANCA 4EI8A 2HK7A 3GJQA 2BZGA 3M6IA 4N82A 5KSWB 4YMWA 1YBAA 3V6LA 3PQCA 3CLKA 4D8WA 3DGFC 2XUOA 4B44A 4JJ4A 1QRUA 1J8DA 2WFLB 3WL3A 3HMKA 1SOAA 4UUPA 4MQFA 4DE5A 3I6ZA 4M88A 1PV2A 5ADHA 1ZD5A 4UU0A 5K0BA 1SXIA 3BILA 4BFTA 2ZUCA 2H4WA 1GSHA 1ABEA 3OURA 1TF5A 1E7MA 4HXGA 4MUAA 5IN5A 2JJ1A 5IKPA 1NULA 3CRQA 3TFOA 3LX6A 4PX5A 1VHTA 3PQ3A 4MB6A 4AFNA 1T5OA 1QS0A 5KTRA 2XUIA 5G1NA 2B2XA 3ZQUA 5ICSA 3BD6A 4CETA 2FSUA 2Z56A 1XLVA 3H5OA 2QSYA 2PUGA 3BH7A 1A04A 1TM7E 1II8A 3FTFA 3IOBA 3OIYA 1E5TA 1H22A 1SKYE 2QGFA 3LYHA 1X9HA 1X7HA 5T8KA 1VOTA 4BNTA 4KH0A 1XTKA 2W2XA 3PPVA 4O8ZA 5JCXA 1J9GA 2MSKA 1NW9B 4X3PA 1CS4C 3I6MA 5A0FA 2RAPA 2QYTA 3LTEA 3UWKA 5JPCA 2V8BA 5JBNA 3MTBA 4RQBA 2HJHA 1I36A 2I1QA 3IO3A 4DZZA 1A4IA 1G8GA 3TL6A 4Q6WA 2XKBA 4HYQA 3U4AA 3BTOA 2Q3MA 1RYMA 1CY1A 2AEMA 4Y2VA 2G25A 2QLLA 3TR0A 5IYZB 4BHTA 4MO2A 3FDZB 3GT3A 3HUDA 3P2IA 1RPNA 1KPHA 1N5DA 2JGEA 2C3PA 4RLQA 1KK0A 4KQXA 1T5HX 1ZW1A 2BL4A 1NV8A 2NVUA 3MWLA 4PYOA 5IK2A 2AFHA 4DQXA 2O8EB 4CM1A 2PMBA 1SHLA 2H1RA 2VDLB 2QRPA 3UAZA 4JI0B 2PGAA 2H57A 4LZPA 3OQHA 5JLAA 4WNYA 3HDTA 4E12A 4LVCA 1W30A 2GAJA 2PJDA 4LGYA 1H85A 4XB6B 5HHTA 2FMTA 1H2BA 2CKDA 2WD7A 3C16C 4ZPJA 2CYCA 3SDSA 3K1YA 2PUEA 5U4XA 3FWPA 4PVDA 5EE3A 2UXBB 1SURA 4QQFA 1KP9A 3RVNA 1Z82A 1QQAA 1YIOA 2NO4A 3SXJA 3UBMA 4EFMA 3FWYA 3RC2A 1L5HB 3KQVA 5AUOB 4FM9A 2WYIA 1K66A 4J9UE 1DCFA 1UXGA 4QXPA 2X0JA 4PSVA 4DTIA 5GINE 1NVUQ 1T3ZA 4BZXA 5I9LA 2QR2A 2FWRA 5B1YA 1YV9A 1Y48E 4KQWA 1RXYA 4G1EB 1YL5A 4G1MB 1HA3A 1EWQA 1X80B 2X5KO 4R40A 5C7OO 5FFFA 1O9BA 4RVHA 7MDHA 3HSKA 1QJ4A 2OV1A 2XYRA 5K2MA 3THXB 3JPWA 4TKVB 1Z5GA 2AZ4A 1JNXX 2ID4A 3OEYA 4MS3A 4RVSA 3ZXSA 4AKTA 3RC9A 2HEGA 2R751 1XMSA 3HZOA 1M5TA 2GN1A 3HDJA 1EB9A 1SUIA 3ADCA 4UXHA 3WLEA 5KX5F 1N8SA 5ARBA 1C30A 4EVRA 5GPBA 1GQFA 2Q6IA 4C4RA 2W2NA 4A6PA 1CJTC 1JJIA 4BO6A 5FTJA 4INZA 1S3IA 2O23A 2X8JA 1KDZA 2IVFA 1E5QA 5C8DA 1BWRA 2XNKA 4G8DA 3DE3X 5KSYA 5BV0A 2DQKA 1DGQA 1H5NA 3IR6A 4I08A 5AQ1A 1O5OA 4P7FA 5ITSA 3NJ4A 1BVRA 2IYXA 1FS4A 3IUNA 4H6VA 4N47A 4V2UA 3H19A 3QOFA 4BKRA 2IYNA 4YGYA 5J1TB 2ZB8A 3SI7A 4FNMA 3H1AA 2G17A 2G3YA 1U1IA 3FMFA 2WTUA 3Q9UA 2UUCB 4KTTE 1OWLA 4ARZB 4M1SA 1YI8A 2GYWA 1J39A 1ZK0A 2C99A 1J1ZA 2QRGA 3FVQA 3R7AA 3RTBA 2XMBA 1RACA 5BWCA 1Z5VA 2OYSA 2X8WA 2XKJE 3OZTA 4KIUA 4L74A 2VZ9A 4MS4B 5EGNA 4EVIA 2OC9A 3HTXA 3UTDA 1JALA 1Z0KA 3DKKA 5A3QA 2CHFA 1C9DB 2NPIA 2IY8A 2QM0A 4D4IA 4NK5A 2C98A 4EGJA 1SCUA 3IJPA 3V3KA 5JLJA 1T5LA 1MD9A 1TMOA 2F00A 1Z7YA 4Z9BA 1RXIA 2WK1A 2NN3C 4ZAXA 5GJWC 3ZV4A 5IFKA 1VCHA 3Q9SA 5L3SB 2JEOA 1C4XA 3O3NB 1K2WA 4CIAA 1T6YA 2YWGA 4US2R 4ZQEA 5LZ8A 2C2WA 1EJBA 1O5IA 2ALJA 1ECPA 3E35A 1ISJA 2JI4A 2IEAA 3FJ1A 5FOXA 3RYFB 2Z5GA 1Q57A 1UJMA 1XR3A 2K6GA 2CF5A 2OP0A 2WIGA 2AYZA 3D8SA 4V02A 4KI7A 5AVOA 2NUTA 4DLAA 5JCJD 4IIXA 2YIVX 1JDSA 1X8KA 4RVGA 1X13A 4OI4A 5E4FA 3U40A 3UF0A 6PFKA 4M0CA 5KVAA 3JQAD 3HCNA 1X7XB 3T0IA 3SX4A 4MJXA 1I2BA 4AKSA 5LU8A 1JYFA 2IW3A 3QENA 4H16A 2VP9A 2VTDA 5IUNC 3VJKA 2H85A 1K7SN 5JZOA 1M34A 2H54A 3LCCA 3WB2A 4B3MB 1AE1A 3HYLA 4GF5A 2DULA 4NAVA 3WWEA 4KNWA 1BFKA 1C7QA 4ILKA 4J0HA 3W8NA 3R3XA 4JUDX 1Z0SA 2FP4B 4Q3CA 1HETA 3EWIA 1W5FA 4LRSB 3AHFA 4XRRA 1NAIA 3U81A 1Z29A 3EFOB 3VSBA 4L16A 1WO8A 2EW1A 1HLGA 3HCPA 3U4IA 4ZOBA 5TPWB 1GG9A 3M6UA 3NUGA 3A9SA 4FI3F 4YPFA 3W78A 1QRSA 2HWXA 3VNQA 4P3NA 4O02B 3S3TA 4DDKA 2LWIA 3RAFC 3BIWA 5H59A 3HKDB 3K05A 4ZYWA 2ATVA 3AESA 4YJ3F 1M3SA 3T4EA 2X2FA 1J1IA 4JP1A 1BN6A 3V34A 2EGHA 1RVDA 4QAQA 1YB4A 5KHLB 5KCMA 4NG4A 1AKVA 1K3UB 3UHPA 4GR5A 1XCGB 2QVXX 3HV2A