3PHCA

Crystal structure of plasmodium falciparum purine nucleoside phosphorylase in complex with dadme-immg
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
243
structure length
243
Chain Sequence
b'NLLRHLKISKEQITPVVLVVGDPGRVDKIKVVCDSYVDLAYNREYKSVECHYKGQKFLCVSHGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHLLIHGDFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMYYPNKIIPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKLATKYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Crystal Structure of Plasmodium falciparum purine nucleoside phosphorylase in complex with DADMe-ImmG
rcsb
source organism Plasmodium falciparum
molecule tags Transferase/transferase inhibitor
total genus 82
structure length 243
sequence length 243
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2010-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3phcA00
3DDOA 4R2XA 4DAEA 5F7XA 4TXLA 3C74A 3QPBA 4F2WA 3BGSA 3TL6A 1Z34A 2A8YA 1A9TA 4BMYA 1ULBA 4D98A 1K27A 4LNAA 1NC1A 4QARA 5F76A 4MCIA 1I80A 3OOEA 3FB1A 4TS3A 1OVGA 1RXUA 4DA7A 3IOMA 1T0UA 4TTIA 3OOHA 5I3CA 5FAKA 4D9HA 2A0YA 1PR5A 3K8QA 1SQ6A 4GMHA 1PKEA 2HSWA 3DP9A 1ODJA 4DA0A 4PNPA 4DARA 1PR6A 4QASA 1T8YA 3P0FA 1VMKA 1OTXA 1M73E 4M1EA 4ECEA 3KVVA 1VHWA 1PR4A 4TXNA 4G8JA 3EUEA 4D8VA 3KUKA 3OZEA 5EPUA 4G41A 2OXFA 4UC0A 5F7JA 4GLFA 1A9OA 1Z5OA 4P54A 1Y1TA 3K8OE 3FAZA 2B94A 2IQ5A 4DA8A 4TXMA 4WKNA 2ISCA 3NM6B 1RXSA 3ODGA 1JDVA 2I8AA 4WKCA 2GUWA 4E1VA 4WKOA 3BJEA 3E0QA 2AI3A 1A9PA 4OF4A 3PHBE 2XRFA 3FOWA 3UT6A 3KVYA 1WTAA 5CCEA 1Z35A 1PWYE 1TGVA 3UAZA 1JYSA 5DK6A 4X24A 4QAQA 4TXHA 3UAVA 1PW7A 3UAXA 4K6OA 1NC3A 1YR3A 5CYGA 4YO8A 1YBFA 4DABA 5CXSA 4JWTA 4TXJA 1Q1GA 4OY3A 1OU4A 1PK9A 4TTAA 1FXUA 5B7QA 4YMLA 1K3FA 5KB3A 1LX7A 2A0XA 5EUBA 3NBQA 4H1TA 5C80A 2HRDA 5F73A 4QATA 1Y6RA 5F78A 1JDSA 2RJ3A 4BN0A 4DANA 5CXQA 1PR0A 3FUCA 1Y1QA 4M7WA 2OC4A 4R31A 1JP7A 1PR2A 1RFGE 1RYZA 1RXYA 3KU4A 1G2OA 2BSXA 1RXCA 5JPCA 2OECA 3F8WA 1Z37A 3OCCA 1LV8A 3NM4A 2PGAA 1JE1A 2A0WA 1OUMA 1QE5A 1YRYE 3DJFA 1T8SA 3OPVA 4FFSA 1U1FA 4GKAA 3SCZA 4TS9A 1Y1RA 4WKPA 4M3NA 3O4VA 2AI2A 3MMSA 4LDNA 3P0EA 1PK7A 4L6IA 4OJTA 1ZL2A 1RCTE 2QPLA 3E9ZA 4QFBA 4GLJA 2QDKA 1XE3A 4LKRA 3EUFA 1TCVA 1VHJA 1YQQA 4I2VA 1TGYA 3KHSA 1T8WA 1V48A 2I4TA 5CCDA 4OEHA 5B7PA 1SJ9A 4IP0A 3PHCA 1B8NA 1CG6A 2HN9A 3PNPA 3NM5A 4OGKA 5EFOA 4JP5A 1A9QA 3EMVA 3EEIA 1ODKA 1U1EA 1Z5NA 1U1DA 2AI1A 5ETJA 1RSZA 1TCUA 2OC9A 2QSUA 3FNQA 2HWUA 3UAYA 1K9SA 5F7ZA 4JOSA 1Z5PA 3FWPA 1Z39A 2QTTA 1PF7E 3OF3A 1JE0A 1JDZA 4U2KA 1U1CA 3OZBA 5B7GA 3INYA 1SD2A 1N3IA 4KN5A 4PR3A 4G89A 1PBNA 4YNBA 3D1VA 1LVUA 4TYMA 3ENZA 1RT9A 3LA8A 1NW4A 3E9RA 4D8YA 3IEXA 4F2PA 3MB8A 3LGSA 4WKBA 3ONVA 4RJ2A 4NS1A 1Y1SA 1RR6A 1Y6QA 1B8OA 1A9SA 5CYFA 3DPSA 4EB8A 1V45E 1JDTA 1ZOSA 5F7OA 2H8GA 4BMZA 1C3XA 1T8RA 3PNSA 4MCHA 5B7NA 2Q7OE 1Z33A 4TTJA 4LNHA 3OZDA 3OZCA 3DF9A 3O6VA 4MARA 3BL6A 4QEZA 5F77A 4DA6A 5IFKA 4D8XA 1ODLA 1OTYA 1ULAA 4L5YA 4L0MA 5K1ZA 1Z38A 2QTGA 1JPVA 5IU6A 1Z36A 1A69A 1ECPA 3GB9A 1OV6A 3BSFA 4NY1A 1ODIA 3T94A 1PR1A 3KVRA 2ON6A 4EARA 1SD1A 4F3CA 4R2WA 4NSNA 1JDUA 4F1WA 1YQUA 3LBAA 4BMXA 4DAOA 1V3QE 1VFNA 3GGSA 4F3KA 4L5CA 4LZWA 2AC7A 1V2HE 1V41E 1TD1A 1V4NA 4L5AA 3UAWA 1CB0A 2P4SA 1U1GA 4YJKA 4OGLA 3U40A 1A9RA
chains in the Genus database with same CATH superfamily
1TL7C 3PD0A 1OVMA 3F73A 2RBGA 1YO6A 3BGVA 3N59A 3GEEA 4XEHA 2OGZA 1YJ8A 2QMQA 4HWPA 1TQ6A 1KYIA 4J0GA 4CIXA 5I6DA 1E6UA 4TSFA 3LVBA 1GQYA 2Z2KA 4ZQBA 4LMRA 2JI7A 5AK4A 2JZOA 1H3EA 2QP3A 4E2YA 3TEFA 1WW3A 3BHJA 3CTMA 2OP0A 5I8WA 2YZGA 1Z88A 1I7LA 3HPQA 5BSMA 1Y8CA 4CKCB 2CV2A 3PRHA 1S9DA 3EBPA 3ROXA 4RCYA 3VTAA 2YFKA 3LCVB 3RIGA 3VO9A 4BMYA 1HNWB 4JY7A 4UAGA 1E2UA 2YJ5A 5EZ5A 4AKHA 4DZZA 1C4KA 3QE4A 2P9HA 5L3SA 4WKGA 3Q7QA 4BRSA 2VCYA 3WK7A 3LY8A 2X0RA 5A9SA 2P75A 1GZDA 5E3HA 2IYYA 4IMPA 4HEJA 5K8IA 4TTIA 1XTUA 1Y3FE 3JVUA 5EMLA 4CLRA 1SOAA 3NHWA 5DHRA 4PRLA 1M2KA 3ASYA 1OKKD 3V97A 5F5NA 2UZ0A 2DQSA 4DIMA 5A04A 2K6GA 2VBFA 2PD4A 1AA6A 2DWQA 1XCPA 3H7AA 2WJJA 4OHRA 2WAAA 4M46A 2OMEA 2BTQA 1KRHA 4MS4A 5BORA 3GGPA 3LGXA 2AEJA 4B7UA 2O8DA 3WP0A 2AG0A 1JHQA 1I5EA 4FUQA 1SVOA 4D0SA 1ARZA 3PRKE 2NZVG 2PJDA 3NC4A 1A8SA 3N3BC 4B80A 1QWSA 5FCDA 2EJCA 4AZ0B 1HMYA 1UXIA 2I9PA 4H7DA 1UM8A 3DYVA 2CZCA 5EESA 2OZEA 3EZLA 1IXYA 1QIMA 4K3VA 4EEZA 2HCTA 1U7DA 1WNTA 1ZC4A 2AMVA 3T99A 5F9HA 3DL0A 1DBVO 3A9SA 2N1MA 4O2AF 2W4MA 4X71A 2IZOA 1RU3A 3DW1X 3REQB 3I5XA 5TE9A 3JTEA 1F2UA 2BFBA 3HUDA 2JKVA 4AYXA 4Q6BA 2V7EA 4HJXA 4MKRA 4M99A 2WHPB 2JLBA 2XQKA 3AW9A 4OREX 3HTXA 2XYHA 1ZEJA 2HMSA 2C4KA 5AJYA 4UTOA 4EY4A 3B1JA 4P0PB 5KSZA 3THYB 2H7VA 1E9DA 3HS3A 1N6PA 2B99A 4KFUA 4OXNA 1F14A 1VIYA 1P18A 3JQ8A 2ZI3A 4QXOA 4XIFA 3GJQA 2B94A 2OVBA 3GZNB 3ULKA 3GDGA 1X94A 1ONNA 3FIJA 2DTDA 3M5PA 4CE6A 1OLUB 4ZZ0A 2YDYA 1WLYA 1USKA 4PCAA 4FSHA 4GQAA 2DOKA 3H7IA 5DVZA 1MJHA 5A5EA 5DCYA 4DTIA 2OXRA 2YZ7A 3W3AA 2Z5LA 4S1WA 2EX0A 1KY4A 1H1LB 5GZ6A 3TSWA 1L6RA 3Q11A 2BMFA 3TWOA 3U4HA 2DETA 2BFWA 3NW9A 2VT7A 5CM8B 4MRVA 3H19A 1Z6XA 2WP8J 2WIFA 4WOKA 5A05A 1L4EA 3NMUF 1GT6A 1TKAA 2O0MA 3FNIA 3PJDA 2DB3A 1Y3IA 1DNPA 1XZJA 3MBIA 3OQIB 4D92A 1QV6A 1KERA 1NSTA 1W0JD 4ZAFA 1ZH2A 4NKRA 1HDCA 1PV4A 2E4VA 2OT3B 3FOWA 2ZUEA 1P2VA 2HF7A 2JIDA 3AO0B 4PHCA 3SFVA 2IS6A 1OHHD 3EVZA 3LHIA 4JKIA 2V4UA 1GAWA 4B0PA 4NK5A 5DNAA 7GPBA 1UPXA 1MTOA 3LRXA 1X1RA 2PKQP 4MDEA 2AFHE 3QIVA 2DLDA 2IY7A 1JYSA 1MABA 5EXTA 1H5UA 3KJEA 3N8KA 3L7KA 4N3BA 2DM6A 5DCUA 2ZBVA 3I9FA 4BX2A 3KD3A 1XK6A 3EW9A 5EXDA 1MGPA 4L16A 3OZSA 2FWJA 4FKZA 1LDMA 5EXEA 3ZWYA 3KT8A 4MEJA 4CEJB 3IAS6 3VNSA 3FPBA 4MA0A 2PR2A 2JJQA 1M7BA 4V3CA 2CFTA 4HN9A 5E8JA 3RHSA 1XVLA 3WRVA 1AQLA 3F1KA 3MAGA 2BR4A 1JFFB 3EA0A 1DDGA 5IDVA 1FNSA 2I7XA 2NUAB 3UH1A 5HMMA 3U3MA 2X1MA 5GTDA 3STTA 1U0JA 3DHYA 4NDAA 3AEZA 1K3FA 2AE1A 3C5HA 3ENQA 2C20A 2L2QA 5KB3A 5BUQA 5AOCA 1REQB 2UV8A 4W5NA 4F9TA 3ZXSA 5JDCC 2QLLA 3A9VA 2JFPA 4EDHA 1SHLA 5AJZA 4D0GA 3VNQA 3C8ZA 4NEQA 2ONZA 2EFCB 2OLEA 3EIUA 3U7RA 1HX7A 1AK9A 2DPXA 1CQJA 4D4MA 1NMYA 1XCGB 3N0VA 2B9VA 4MCAA 2ZK7A 2PS1A 5HVNA 2WJHA 2EJVA 4ZVTA 1AQ6A 2BUAA 4RFVA 2JGIA 4FKBA 2FRXA 4RLSA 2DUMA 2Q5OA 5K6AA 3A6PC 1XFDA 2DPHA 4ND6A 1MAAA 1Q15A 2RCYA 4PFKA 1QRUA 4D1YA 1E3SA 3L8FA 4OP2A 4ZT4A 4RK4A 4MWSA 1FDWA 4V38A 1QX3A 1H8ED 4EYOA 2P7HA 3AERB 1CUZA 5MGNA 3UOWA 2GBCA 1YMQA 3RBVA 5BW8A 2EP5A 4XIGS 2R2GA 3RWBA 4YCJA 2N1BA 4CKZA 2F9FA 4ZMSA 1OZAA 3IQFA 4IEEA 1A76A 4WESA 3WLIA 1Z0DA 2E4YA 3B1ZA 3H6KA 5JXJA 1UKVY 3QEOA 4YRSA 5KTOA 2DULA 1T3TA 4HVTA 1SC1A 3S2ZA 3UFXB 3DMDA 5HZHA 2QW1A 2NNWB 5IKXA 4OAQA 1M2VB 4M9ZA 4QDUA 3EDRA 4R2JA 4BNDA 5BMVA 5H9WA 3G5MA 2Q9CA 3WAGA 3PIDA 3SMQA 1M6YA 3LPCA 4H6WA 3GLFA 3E3MA 4GLLA 4I50B 3HYRA 3NRBA 2X0JA 3VVLA 1WB9A 1CQZA 3ORHA 3QPAA 5JVDF 2PGNA 2NSYA 1U5BB 3QVLA 5JS1A 1P2UA 1P1HA 1PD0A 4F2HA 4PYQA 4ZVOA 2RH4A 2NO1A 3TRKA 3GOHA 3VR6A 3CV3A 2ZBUA 2ZJ2A 1NXPA 3MTQA 4RFSA 1FLAA 1T9DA 1VLMA 2YJ4A 3OBBA 4R8KA 3ZDYB 2WF8A 2QY6A 4PLFA 1Y1LA 3LHDA 2IXEA 4XUEA 4E5UA 1PJLA 1J21A 2CLIB 3DAYA 3FUUA 3SICE 3TSYA 1WF3A 4MP6A 4CMBA 5T3YA 1PQYA 1G59A 3ZJ5A 1RACA 1FQKA 2GCGA 1DGQA 3YASA 4MW5A 1J22A 1ZK3A 3WQHA 1T43A 1G17A 4LG1A 4OQPA 3BA1A 1QXSA 3BXFA 4FVTA 4MMXB 4UPVA 4S2EA 2ZUCA 4Y9RA 2WF5A 3KKNA 3SE0A 2H2AA 1Z8DA 1Z16A 1QTIA 2PBZA 4QYSA 2XVZA 1BFDA 1BCRA 1I1OA 1YDGA 1YA6A 3KBOA 3IP8A 1TCCA 1WMFA 2O2YA 4NECA 2ZVJA 3GJ3A 4J9UE 4TTRA 5HK8A 5HUHA 3KQVA 4F3YA 5I4BA 2YYSA 3FDZB 3SBOA 1UFQA 2HWWA 4EJSC 2DE0X 4OTZA 1ULHA 1B76A 4PX9A 1MR3F 3N2LA 3O2NA 3D64A 3QOFA 4JEHA 1E8MA 4DR1B 3LECA 1QLWA 3HB5X 3UJCA 1JR6A 1XAGA 5EN4A 1Z8HA 2I22A 4FJ0A 2VCHA 5KKAA 1ECLA 4TQAA 1SJ9A 2RK4A 4H7FA 3VHQA 3MTBA 1SEPA 3L40A 4OJNA 4CKCA 2JJMA 3MK31 3ZUPA 4PQYA 5EJ8A 4OBXA 1PFQA 5C32A 1VP3A 4BKPA 1VJTA 1AKUA 2VVTA 3BWYA 4DBLC 5CLQA 5KNDH 1FYFA 1SIOA 2XE7A 5D3QA 1LW6E 2W71A 3KZVA 1ZXXA 3DHNA 2FZGA 3NZEA 2X77A 1JA1A 3K9QO 3Q8WA 4OX9Y 2CDCA 3RVOA 4UTVA 4IR7A 3FMIA 4AAYA 4DSAA 2WKWA 3JASB 4Q6WA 2OV3A 3UAYA 1E9CA 1LLQA 3QUBA 4JOSA 4FN5A 4BO5A 4CEJA 3OWOA 5C53B 3BORA 1SFRA 4I0WB 5K3SA 4AY4A 2GK7A 4IAOA 3SJUA 3DT9A 3BICA 4REMA 3QNMA 5H82A 1W93A 4F6CA 3IO5A 5M7EA 1RXEA 4CT5A 4RVSA 5J59A 3LF2A 2JH3A 5TF4A 1GPWB 2ACWA 3KHKA 5EFZA 3RWMB 2Q6IA 1U8EA 1ANKA 2IYRA 2EQBA 4IJKA 4BWGA 4KI0A 1KVTA 3JVDA 5IF3A 3PFKA 4DDUA 4ZXFA 5A9RA 1JXOA 2WWXA 1K5HA 4EFNA 3PCXA 3FOCA 2A5LA 3MIIA 2ZOSA 4A8JC 1EJBA 4KI7A 3WLAA 5E6SB 3SP1A 5CVDA 3INYA 1MF7A 2IYWA 5J4VA 1UBKS 4UVDA 1UC4B 3PPYA 2DQYA 2OB2A 3USZA 3FTEA 1PVOA 2C54A 4ESVA 1PBNA 2ZR9A 5IUJC 5KTMA 3RG2A 5FB3A 3FPFA 1BHQ1 2PGXA 1HO3A 3IUNA 3OPNA 4FFNA 2IUTA 1KSJA 1E7YA 2XAUA 4FHZA 3PXDA 2LPMA 1UBOS 4J8PA 1IEQA 4RYDA 2R65A 2J3DA 3TOXA 4ARZB 4XUCA 2NQ8A 2WHPA 3G7SA 4HFRA 5E4YA 4EUEA 2GHQA 4MO2A 3DUFB 4FDTA 1E1MA 3D2AA 3FB4A 3W1VA 2C4TA 3I3OA 4FMDB 3TTTA 2B4TO 1AZSC 1EA5A 2ZRDA 3D0KA 3DEYX 3LJKA 3MGKA 5AHRA 1X39A 5AI8A 4TZ6A 3GJ6A 3JD3A 4URXR 5J4YA 3GZNA 1Y0BA 2D1TA 3G2KA 3TAXA 3GFPA 3ZJTA 4LWQA 1H1TA 4GRAA 4L7VA 1WZ2A 4RV9A 4ALIA 4BLWA 1RI1A 1NUQA 5GVRA 5K0GA 3ECSA 1KEWA 3BHMA 3LKZA 2XUDA 4E09A 1KK2A 1DC7A 4LOIA 1H1LA 1Y6QA 2G71A 3FD8A 3O4JA 3PGMA 4AFNA 4CCWA 3H1TA 3O74A 3I2JA 2OCAA 2VYVD 5AESA 2VZ9A 1SXPA 3WIDA 2V7WA 4P0QB 2VS1A 3SF8A 4G0MA 1HZJA 4NF2A 4R2IA 1X74A 3OQIA 4J29A 3ZWQA 5GAJA 5K0ZA 3DDZX 3QEMB 2WT4A 1TYDE 5KDDA 3AR8A 4MCHA 1MOPA 1F2DA 4WTOA 2XVXA 1SUAA 4D9IA 2JD2A 2Q7OE 2VIIA 2X7HA 2YHSA 1KGDA 1C3OA 2FXIA 2Q5QA 5L40A 3R77A 3UWDA 3NVMB 1QF6A 3ESXA 4EGCB 4LBYA 1D1TA 5JQGF 4ZPJA 1T6ZA 3KE8A 4P8RA 5EIWA 3GELA 1NN1A 3FMFA 1PG5A 2WV9A 4GM0A 4O5AA 3SR4A 3LQYA 3AL2A 1QYXA 3O6VA 2O7NA 3W0LB 2GYYA 2VSQA 5AVJA 2H63A 5DHUA 4QEZA 1P9WA 2HO5A 5ALOA 3N28A 1Z7BA 4LK3A 1GZHB 1M2JA 4HX9A 1G6KA 1B74A 5C4IA 2AF3C 2MSCB 4KO8A 1RZRA 3LK6A 3NR2A 4LA4A 4L0MA 3SSMA 3QBTA 1YGPA 5SICE 1JFFA 3IKMB 2FR1A 3DVLA 2NUAA 3K7EA 2IX9A 4LWZA 4WADA 5ANRB 3JR3A 1V5WA 5K2MA 4ZDJA 1ZIOA 1NQTA 2I67A 2DBYA 3UKJA 1CFZA 2ARKA 2E87A 4XYGA 1ZKDA 4KBFA 4QPZA 4W5JA 3EPKA 1REQA 4GUAA 5BOSB 2X1HA 5A4DA 3M5CA 2FSSA 2DKNA 4LJ7A 1A96A 3G9ZA 2UDPA 1N75A 5CFOA 1V7QA 2TMGA 3L0SA 3ESCA 3BXZA 4MQFB 3HCPA 5KNCD 2A58A 1OB5A 3K4PA 5AUPB 3DTVD 1SC9A 3N2GA 1UBTS 1U4SA 2WABA 3TW4A 3DE2X 1WU8A 2HIAA 3PHGA 2ZIWB 4KQFA 3KZMA 3WK6A 2C97A 2X2PA 2VP0A 3C24A 3LBAA 2OCPA 4G37A 5FWAA 3MW8A 5AVWA 3D8HA 4L0CA 3RYFB 3T35A 3IPLA 3S8EA 3LUPA 1V5FA 4PC7A 1QZXA 1MB0A 4G2TA 1MJ5A 4KUEA 4F3KA 5JZ9A 3D8SA 4FHDA 4L5CA 1G8GA 2AC7A 2RHCA 3EN0A 3X44A 1CUWA 1F0PA 4HEA1 2DT5A 3AERA 1MJFA 5AI9A 2WM8A 3TBHA 3CH4B 5LNK1 4ZQEA 3BTSA 2K7FA 4KR7A 1C7QA 2WWIA 1FW8A 3KJXA 1V1MB 4V0ME 4U3JB 4CF4A 4W4TA 4S04A 2ZTHA 2IZ0A 1EDDA 4ZOAA 1AE1A 1HV8A 3PE3A 4X1KB 3WLFA 4F4FA 3H5VA 5FHRA 2J9GA 3U6BA 2JLUA 3FVVA 2YXBA 2PSJA 4KXMA 4EHBA 1LPBB 2EGUA 2WMOB 3W9SA 1Z08A 2WHRA 3HY3A 3VUEA 3I9V6 1BH2A 3OEHD 4QBTA 4L72A 3JZIA 3SZMA 2VYCA 4JJGA 4CQLB 4BZQA 4NCNA 4JT8A 4TXLA 4WXHA 3KM0A 1EEXB 1JIJA 4I50A 1IONA 2FPOA 4LVCA 4WDRA 4BX9A 5BSVA 2VJAA 3P2KA 1T9AA 2QAIA 1Z82A 4MS1A 1R3UA 1U5BA 1XJ5A 3LUJA 1U98A 4UHEA 1PQWA 3D59A 2Y1OA 3LDAA 1NBAA 1H4TA 2C99A 2IW1A 3SQLA 3SKVA 3QYAA 3L8GA 3GVHA 1PV2A 2GBFA 3F6EX 1EI9A 1ADYA 1EXMA 1JSZA 3MJDA 4IGAA 4G5XA 3B53X 2HQSA 4DL9A 4JIMA 4OAOA 1FSSA 4MUFA 2VF2A 5LZ5A 5CTJA 2X4IA 5HDBB 2XWPA 1LK5A 2EJUA 5CJ2A 4ZCPA 3OOEA 1CR0A 3QRWA 4IZIA 3TG2A 1QHNA 2M6LA 3K9LA 2RGAA 2VXBA 2RH5A 1J5PA 2VP4A 5GMOA 4DA7A 1LF5A 4QVGA 5IAEA 3PR1A 4GGOA 1ZRSA 4KLAA 1Y34E 1JJVA 3RV3A 3KP1A 1CZOA 1R4AA 2G1UA 5DLPA 2MR5A 4I5GA 2P27A 4PZDA 1SUPA 4RD1A 5ALUA 1E1DA 3OG9A 1EDEA 3ZCPA 4GPTA 1JZQA 2HU8A 5TIIA 3ADPA 2QMHA 3HB1A 4OXYA 3FDZA 1Y7IA 4JI6B 4ZQHA 1SQ5A 2XDYA 1GSAA 2OHHA 4JN6B 3EXEA 4MAFA 2HSWA 3HA3A 5ICFA 3ZJVA 3WWPA 3IAUA 4G81A 1JEQA 4C5AA 4ENWA 1W9MA 5A0TA 1WMDA 1O97C 5T3UA 3RLFA 4GDFA 3P71T 2QJOA 3S2YA 1BDBA 1T4GA 3VPSA 4EGQA 4F4CA 2QSZA 5IWAB 1K2VN 5AJXA 1NQVA 4IGEA 1XF1A 4O4JB 1A7JA 4O63O 5BSUA 5K0BA 5TEVA 4QQ8A 4G8JA 4NJMA 1OXSC 3H2SA 4WD3A 4FB4A 1TKBA 2VBGA 2JFBA 2ZRAA 5IS2A 3OZEA 3SSOA 2X0NA 3ZWCA 3EGDB 2PMCA 3CZ4A 4JVLA 2OXFA 4C5BA 2F43B 4X41A 5B2ZA 1PS0A 3EMKA 1G18A 3TZKA 2Z56A 1Q6YA 3JASA 4FM9A 2AK3A 3KLPX 2ZTVA 3NH6A 5KAPA 5AWFC 3UOGA 4NFSA 3JQBC 3ZBTA 3OBIA 3BWEA 1P29A 4CGZA 1P7ZA 2ZQ5A 3BOSA 4YRFA 3WKEA 2BTEA 5IT5A 5JH7A 2QXYA 1FJXA 2GBGA 1ZJ4A 3AIKA 1TVKB 4IKOA 4OFBA 1KQFA 2HEIA 2BEUA 1DLIA 4IXMA 3G23A 3ODGA 3WNCA 4CV2A 2QLTA 3OX1A 3HCFA 5FLXA 4YN3A 2XNSA 3A3KA 1NHWA 1BFUA 2R7NA 1II9A 3PE6A 1JTFA 2H7XA 2Y93A 3LW8A 4M8IA 1QCYA 1KWGA 1PEAA 3ED1A 5HYVA 1WZCA 3KYCB 5E6SA 4WKOA 2R6GA 5FP0A 3FUWA 2ZIAA 4YAFA 1VSVA 5E2IA 3EYWA 3HP7A 3GMDA 2RKOA 3PITA 2WINI 4BX8A 4BX0A 2H1OA 2CJYA 5HFAA 1ZGAA 2BMVA 2UUPA 3B5JA 4YT8A 1YC5A 1TLLA 4PS1A 5CVTA 2DPMA 1U28A 3D4OA 1U9IA 2I3ZA 2P8JA 3QBEA 1Z35A 1EE9A 4P58A 4AK9A 5JXWA 4UZSA 1GUZA 2HB6A 1XFAA 5BVHB 3ESQA 3WLEA 1EA7A 3ZHVA 1VKNA 2OZVA 1MB2A 2FWBA 3DUFA 3LBNA 2G08A 1U0EA 5HKOA 4NJOA 1WKCA 3O1JC 5FTLA 2ZS7A 1I2DA 4AMUA 1H0SA 2OBXA 3ZY2A 5AW1A 4BFCA 4FWTA 3E3OA 1N2CB 4UBOA 1D5CA 1ZUWA 5E4JA 4CKBB 1FTNA 1PJAA 3WFZA 3OCJA 3PYXA 4EF5A 3DCIA 3OFJA 3QSGA 1AF4A 3QVOA 4MVJD 3ZPXA 1BVYF 4OK3A 2AUTA 2IH4A 5K8TA 3U3RA 2R47A 1P7CA 4FCTA 2FWPA 4IIVA 4E7OA 4E70A 2JBAA 2IP2A 1YL5A 4N0QA 4X61A 5E95A 5LXTA 2NN3C 3E8MA 3L7CA 4KMMA 1N1EA 2NO6A 2FHPA 3A3PA 3EC2A 4H15A 4QUJA 3RNOA 4DVGA 5K0TA 1JUDA 2AQIA 4HC4A 1QMGA 4FGKA 3QEMA 2DPLA 2VN8A 1FBNA 4PZ9A 4NV0A 2YHUA 1YJCA 2D0DA 2HA2A 1Z6YA 5KO2A 4IRXA 1YD7A 3IE0A 2DTEA 1PEYA 1QG6A 1UQUA 2QRJA 1VJ0A 4JLDA 2V9CA 2BKUA 5LIRA 3JSAA 2HQ1A 1H85A 3SYMA 2Q5IA 4UHFA 5ALTA 1G6Q1 1W88B 2I03A 5ES3A 3SX0A 3MQ2A 3SZRA 3WMXA 4Q1EA 2QZ4A 2PANA 2WM2A 3NBUA 4MV7A 4D4IA 3AHEA 4J0FA 4EBBA 4S05A 2C78A 4RD4A 2OQRA 3TDNA 4NOMA 1V1JA 3K73O 3H6HA 5COQA 1WU7A 1RBMA 4FILA 5K8CA 5HUJA 1OLSB 1MC4A 1LZKA 2BBTA 2GESA 3OZXA 1ZA1A 4AU1A 1XYVA 1XTIA 3HXMA 4QLAA 5L3RA 3CVXA 2PLRA 1MOSA 2RGYA 5FQOA 3GY0A 1PDVA 2YHBA 2J0VA 2YXNA 3DE5X 3H99A 4BP1A 1M34A 1PL0A 1DAKA 3C3PA 2AMLA 4IDEA 1RXYA 3E05A 4RVCA 5LVAA 5AI5A 3AK4A 2WIJA 3D7MA 4RVNA 3RJ5A 2GBLC 2I78A 1WMEA 1TX4B 5BOSA 1EAYA 2FLKA 5C8DA 1OYWA 4FZRA 4IYRA 3THWA 1QS0B 3LFUA 3OZFA 4EA7A 1LI7A 1ORIA 4RTQA 2D06A 1C4WA 3QX7A 1STOA 2P35A 1G7RA 2FN9A 4MQFA 3ESDA 4AKSA 3NDBB 5LSAA 4B4OA 2ZCUA 2D3TA 5JPDA 1VE6A 2WJPA 3I83A 3ST7A 1R0CA 4OHKA 4IHKA 1WB5A 5IVDA 4QVIA 1RIFA 2B8NA 1P0PA 2X23A 2E85A 3RVJA 1MC8A 3VSAA 3ZGNA 5GJBA 1XQWA 1GAJA 2A35A 3IJEB 3NDIA 3KZCA 1E9SA 3KOXA 3ZWMA 2YIMA 1LPSA 2PA3A 4ZVKA 4TL9A 4UEOA 2Q21A 3CQ9A 5T8KA 5B3LA 5BNZA 1AGYA 1W1WA 2C4NA 3UAOA 1JLMA 3O3NB 4FD2A 4Q9AA 3ZZ1A 4QQNA 1P1CA 4CLOB 2W42A 4V3BA 4Y2JA 4M0PA 2IP1A 4RPIA 4EVIA 1V1MA 5LZ2A 4U3JA 2ZXUA 1TUEA 4TTPA 3R7SA 1G8SA 3A04A 1YHNA 1L7DA 4MGZR 4WA7A 3JRXA 2AFIE 2R6JA 1LK7A 2VUSA 2ZU0C 4HG2A 2GNOA 4JJ4A 4UMDA 1GCUA 4X1KA 5C35A 1IY9A 2AJLI 4CV1A 3EVDA 3G88A 2R5WA 2FN8A 1NVTA 1FXWA 3KHSA 2B36A 2BUBA 1QIIA 1WEHA 2H92A 3PUHA 4ESOA 5JQWA 2Z2ZA 4CQLA 4PX3A 2UZ4A 1C30B 1RWQA 2E4UA 3I4CA 1MCZA 4NCKA 4DR2B 3ENNA 1JKFA 1GQRA 2IEAA 2Q3FA 3V33A 1BWSA 4C6TA 1IPHA 3ZWWA 1QHFA 4JB2A 3HMKA 3S44A 2PMBA 5LMZA 1Y7TA 3GP8A 5TPWB 2P6RA 1Z0UA 3PHCA 3TDKA 1YFZA 2GKGA 4QEKA 5I51A 1VE9A 1NYQA 1HBJA 2QX6A 1R18A 1NQ5A 2PT7A 2V4MA 4U2DA 4ZVMA 4LNUB 3TQTA 1U2RA 2O2JA 5EP3A 3ZS9A 4U39A 3EZNA 3GGOA 4MUBA 4KIFA 4L4XA 3OUZA 2R48A 5EFOA 5LQNA 3ZDRA 1H23A 1SVMA 4JP5A 1A9QA 4QGAA 5CA0F 3VNBA 1NF8A 4LUCA 4D02A 2HCJB 2QU8A 3HR4A 3CLUC 4W9NC 2PLWA 2Z8YM 1RKVA 3G2HA 3VR6D 5J58A 1P6UA 1MH9A 2XSZA 1JV2B 1L4HA 4LXYA 3H86A 5AKZA 1K7SN 1Z62A 2B61A 2OE2A 3RR2A 1JEJA 4ZYZA 3PXAA 1NUHA 5DN9A 3I34X 1O9HA 4UEKA 1KDZA 3W5UA 1W4RA 2PWBA 3KTOA 1TAHA 4M0KA 3A2LA 3TQCA 3HDJA 1CRPA 3ROKA 1FBTA 2ZJ4A 3A1CA 3BRQA 3A6DA 3DFUA 5A4FS 3MTDA 4KZKA 3IUMA 1U9JA 2FRVA 4WVLA 2VZEA 3URKA 4D5EA 2VO1A 1SCAA 2B0JA 1BWQA 2M6SA 3QU4A 3WMRA 1LPPA 4BUCA 5ITVA 1EBUA 1QO0D 1IUKA 1XOIA 3AUYA 3ZHQA 1P7PA 5TARA 4F5YA 3LX4A 1CZRA 3CPJB 2Y68A 4XVRA 4P32A 3GLHB 1PGNA 4BTEA 1XDGA 3L0DA 5JNUA 2Q7XA 1ZFNA 2WUFA 2ZAMA 3DO5A 4WZBE 4G89A 4Z0HO 4O4JA 5KOJA 1I10A 5FBVB 3IQHX 1GRCA 2B98A 3DT6A 2WYOA 4CR6A 3NOOA 5LD2C 1CJSA 1C41A 5C7YA 3UAGA 3G9TA 1HZZC 1YCDA 2BMWA 2KSQA 4IH9A 1Y6FA 1U3CA 1M2NA 5B6IA 2W83A 5MDHA 2XMDA 4O33A 5IULC 2IIPA 3L7YA 2QTHA 4GKVA 3BB3A 2ZI9A 1CNFA 4N8DA 3MB8A 3COPA 4O4HF 5AI6A 5C18A 5BQXA 2JAQA 3SQXA 1MD9A 4CM4B 2ZT6A 4K05A 1ZM2A 1CUYA 1UPFA 3LXXA 1WZEA 3ONVA 1KDPA 4HH1A 4NQZA 2EKPA 2EZUA 2Q4BA 5EJ6A 1CF4A 5KOHA 4OPMA 1DIRA 1Y81A 3UBTA 2GZDA 3T0IA 4ERXA 3DV9A 3I45A 1X70A 1UKZA 1HT1E 1SB9A 2FPRA 3CUEF 1ADCA 2WUWE 5K4GA 1BTOA 1TVCA 4KXXA 3KSDO 2D54A 3TLXA 1IEWA 2ZPTX 2W2TA 3P5SA 3KYCA 3OP1A 3V8NA 2Y9MB 2ZIXA 3C7KA 2HBYA 1RQXA 1G5FA 3BJZA 4UPDA 5EY5B 3U4GA 1HNNA 5BXQC 3G8BA 2OYCA 5M34A 4N0PA 5EIOA 1XTZA 1Q0LA 4U6QA 4YROA 3IDAA 2A9QA 2XNDD 1YMUA 2Z9DA 4IH1A 5IKOA 2JGJA 4HB2A 4L57A 3WRWA 4LZPA 3ELYA 4RX1A 4Z4FA 5EGSA 1GL6A 2IYZA 4DBZA 3ZQUA 1JDNA 4Y2VA 2O7RA 1ZY2A 4QU8A 5BVHA 4RETA 1GUBA 4TTJA 5IK2D 1FDSA 2H31A 1G7TA 1N0HA 2FFBA 3PHLA 3PWSA 4G0XA 4R9UC 1Z13A 3GVCA 1AGPA 4V0QA 3JWJA 5BV7A 5DNUA 5BSHA 2IYXA 2HNKA 3HGTA 5EMHA 1IVSA 3NEYA 1N2CA 2PAFA 1J0BA 4CKBA 2Z0MA 1ZAYA 1EX9A 2GYWA 2BGLA 2GPSA 1ULAA 2YN2A 1FPQA 2HX1A 2Q5HA 4XA8A 4EJMA 4YXWA 1CUVA 3I8OA 1FB5A 4NG4A 2ZB2A 3UJPA 4CUZA 4ZHQF 4X84A 5IP5A 3ZY4A 4A2CA 1DAPA 2JJ8A 2EKBA 1UDAA 3OLYA 1A69A 2BEJA 3MS4A 2P4QA 4YV2A 4U7TB 3FPJA 3SY8A 3L05A 4Y2YA 1RFLA 1YIAA 2HBZA 1R6BX 2WZQA 4MR9B 2J6IA 1HDIA 3F3MA 1B43A 1K63A 2ANBA 1LXCA 4BO1A 3JV7A 4WASA 1TQ2A 2BFNA 4CT4B 1WJGA 2J3EA 5BSWA 3KVRA 2I4NA 3QWBA 3EDOA 3JWEA 2Q2WA 3QUSA 4JNCA 4RVDA 1SD1A 2HJVA 3WB9A 5LQMA 3VKUA 4GC5A 4Q9JA 5FOSA 2PV0A 5GADl 2PZMA 4XYMA 3MTAA 4CMIB 5EI5A 3CEMA 3ETGA 2XT9A 1YS9A 4J3JA 5JCJD 4HAIA 2NZ2A 4W63A 1D8TA 1W88A 1X80A 1M6EX 2J3MA 2FZ4A 4PFQA 5EKDA 3ZWOA 5FT9A 5IJ0B 2E48A 1YI1A 1CEYA 5JAIA 4IILA 1WKVA 4G1UC 4WIAA 4HDKB 5HK9A 2PO7A 3GLIB 3WOHA 4KXUA 2PIAA 3HUEA 4UNPA 5FORA 5LUBA 2OKGA 1XEFA 4GOND 4C76A 1OLSA 1XJCA 2ORWA 1UCFA 4X20A 1KMQA 2G40A 2WM3A 3T7EA 4QU9A 1KZ1A 1Q7TA 5KWJA 1AN9A 2TRSB 3VYUB 1KOFA 4K88A 3LHFA 3TM5A 3EH1A 4DV4B 1PFUA 2CUZA 4R8VA 4YJKA 4P98A 4NMLA 2IZ7A 2UZIR 3RTDA 3DZBA 1N9KA 2IDZA 1OC4A 3IT0A 2P5TB 4CCSA 4Y1RA 1AQNA 4G5HA 1X92A 4OLAA 1Z0FA 3OUTA 1AU9A 3E7XA 3K0CC 5D84A 1XRJA 3PFNA 4GPIB 4BVGA 4OV6B 4X3CA 5B3JA 2XJ9A 3FPHA 4FHGA 3VV2A 1GKYA 3W2IA 3TRDA 4URHA 3B1VA 5AMXA 4CM7A 1EXVA 2GRAA 3AF1A 3X2SA 1N5DA 1ZR2A 4ZYVA 4UATA 1VKHA 1U4OA 1UJ4A 3B6IA 1NTRA 1PT5A 2H54A 4MQBA 4A0RA 4V0NA 3VXKA 4HDMA 1A9TA 3E1KA 3O03A 1G41A 1KZYC 3PEYA 4LNAA 4NVRA 3KCQA 4MAMA 2GUGA 4ZODA 3N7AA 1N6IA 2CWWA 2OZPA 5E1DA 1ACLA 1P1JA 2AGVA 2XNJA 1E2PA 2RIRA 2EFHB 3FZGA 4WZAA 4CLOA 2P6MA 2EEZA 4LXGA 3DS8A 5SY6A 1RXUA 4BIMA 4RH0A 3JZMA 3IOMA 1YR8A 5JSFA 1GGJA 3ZX5A 5EZ6B 3SQNA 1KMIY 4LY9A 4AJ1A 3U61B 1N2BA 4ZU3A 1X9IA 1J5EB 4OKNA 3NT4A 4C4RA 1T9BA 4MV1A 1LJ8A 1CRLA 1O6FA 5FAKA 4XYLA 2ADFA 2JGLA 5IJ9B 2BEWA 3ZY6A 3KQQA 3DONA 1AT1A 1ABBA 3BD7A 4B1FA 1FJ2A 3AZOA 1ZJWA 1TAUA 4U7DA 1PKEA 3PI7A 5BR4A 1Z8NA 1YT5A 2QL9A 4Y6SA 1JIIA 2OPBA 4FEGA 2VZ0A 1GGHA 1JU9A 1UUFA 3NT2A 3BE4A 2LNDA 3N05A 4JL6A 4G25A 4MROA 5FAXA 5CLFA 2R1TA 1P7WA 2IIBA 4BFVA 1VHTA 3DBHB 3HMQA 3HABA 1E64A 2D1YA 4A27A 4GF5A 1HMPA 2AOUA 3QG1A 1KQGA 3M6AA 3L0IB 3U7JA 3OU6A 2WLTA 1KYQA 4RTJA 1O5TA 1WDWB 2XUZA 3OY7A 4G9EA 1KJYA 1J07A 5JATA 3WG9A 1GWNA 4M0DA 2QRGA 3DOUA 3BFVA 5B58T 3U7QB 1KK1A 1OWLA 4EPVA 1TD9A 3Q9SA 1JKJA 3QI2A 4GLFA 2PRZA 3ZE7A 5JAMA 1VKJA 4N6GA 3KYIB 3I04A 3OC6A 2QT0A 4Z7NB 1Q1EA 1AZTA 2NP7A 4HO1X 1VQ1A 1H2HA 2HR1A 3ISVA 1GCGA 1E2JA 2P1ZA 5FBHA 4NIMA 3EGCA 4O4HB 5FA8A 3RS2A 4RSMA 4K9MA 2ZRIA 1R9JA 3AXSA 4BDTA 4FBGA 2E1PA 3P2JA 1Y1PA 1YB1A 4LVNA 2N47A 1CKEA 2R8OA 4PZCA 3GW8A 4YWJA 1RD4A 5CDSA 4MDFA 1XI2A 3H84A 1JLKA 5I9BA 4UTZA 3UJ9A 3IKTA 1KI7A 3R1IA 4LOLA 1CUSA 1OFTA 2GWRA 2E6UX 2IPLA 2JFFA 4XKJA 1JMVA 4RHYA 2NYVA 3ESZA 4B7XA 1BQ3A 1V8ZA 4CM9A 4G3XA 1TIPA 4H3VA 4KXWA 2ZYUX 1GOTA 3GLHA 2IS4A 2VNSA 2H85A 3OT1A 2QLNA 3PHBE 1NFRA 4XJVA 4DZTA 1QBGA 4I4TB 2IHJA 4KLNA 4MUAA 5T6BA 1PD1A 2O2IA 3TLBA 2ZRCA 4OHBA 4QGSA 2XV1A 4FGSA 2B2XA 2O0KA 1RAEA 2DQZA 3SHFA 3GJZA 4X7PA 3C3KA 2X8AA 2V0NA 3AY7A 4XD7A 1P3DA 2JA2A 2ZWPA 5CDHA 1MJGA 2SECE 2FTKE 3MPUA 5BSGA 3HDGA 1GIAA 2LCQA 3H5OA 4TXHA 4UKDA 1NUTA 4LRUA 4W7HA 2VK8A 4WGFA 1O6BA 4KO4S 4Q7EA 4X90A 3RU2A 4CM4A 5C8YF 3A1VA 2WQZA 4MVJE 3RAGA 1EGQA 3ILSA 2PWPA 4H3HB 2R44A 3AOEA 4GR5A 1K8RA 5A4MS 4DV3B 1TF5A 3VR3D 4ND3A 4NU0A 3CE6A 5JOQA 1P19A 1AHHA 2JDIA 4TXJA 4MVCA 2ZR7A 2AKYA 1PJZA 3V3KA 4EW3A 5I47A 1E8DA 3M2PA 3MLAA 3ZEAA 3IV9A 4RKQA 1UAGA 2FUG6 4DILA 2IHKA 3QFSA 2EAUA 5CVUA 4M88A 5DHQA 1DKUA 2XWSA 5ESWA 4C4TA 2G5PA 4JQZA 3QEJA 3OMXA 4CGYA 2C57A 2VHTA 1SOMA 2VSNA 4Z3KA 1I7DA 4I55B 3GJ8A 1SXJC 3SIWA 3V2HA 1V5EA 4V24A 4ASUA 3E61A 1ZINA 5AK5A 3S1AB 3FVQA 1A1VA 4E15A 1R5OA 1RI2A 3AR6A 3G1TA 3BCUA 4URWR 2BGIA 1NXQA 2I29A 2UVPA 3BK7A 3JATB 3UN1A 3NBQA 1JLLA 3K0BA 3IALA 1V8PA 1WWKA 3QPCA 4FS8A 1LU9A 2HJ9A 3RB8A 4N18A 1XXHE 4ONEA 2UYHA 3HCWA 4B3TB 1GQSA 3RC8A 2F90A 2J4CA 3I6BA 2L17A 4QATA 4ZVRA 3E1SA 1DCKA 2ZWMA 1Y6RA 3KTFA 3QGMA 1E89A 6REQA 5AVYA 3WGHA 3JU3A 4ZT6A 5JNWA 2R62A 5AJTA 4ZCIA 1O1YA 1PR9A 5FA6A 3AETB 3BDVA 4PZUA 3CKMA 3EXHC 3FUCA 4AP5A 5TMEA 5LP6F 5KJ6A 2G36A 2YXEA 4BO6A 4TMZA 1AKEA 4Q7MB 5ENZA 3T5MA 3H11B 2O5RA 1CT9A 1B15A 2YCLA 1FX1A 1P75A 2P62A 1TQDA 1L5NA 5KTNA 4PYJA 3QTBA 3PNBA 4GP7A 3P0JA 3P20A 3SDBA 2QX7A 4ZT5A 2OECA 3BKWA 2JGDA 3CUTA 3KQTA 4OQYA 4R5HA 3B60A 4MR9A 3VU9B 4D9KA 1Z37A 2BI4A 2WHYA 1C9JA 3E6AA 2R4UA 2Y3IA 3E2PA 2VPXA 1VI6A 5JMPA 1JHYA 4A1FA 1E0AA 1SM4A 4XTRA 4HD8A 1ZKMA 3NV9A 3EEBA 3RS3A 3AG6A 4HQFA 3ADBA 4QJ3A 1P8AA 4ZD6A 1DL5A 1OX4B 2V65A 5KCZA 1ADFA 1PJCA 1MQSA 3WFIA 1KYZA 1YRYE 3QG5A 5DGTA 2Z5FA 4RYLA 4CMIA 2JIZA 1EFVB 1USVA 5D86A 3OKCA 3WP1B 2J3QA 3A9CA 1Z5GA 3E7PA 3IAS1 2X0FA 1O2DA 3O1HB 4MW0A 3ZZTA 1ZZGA 3OE5A 5IJ0A 1BE6A 1FFGA 3OZGA 4FYXA 4R1LA 4L3VA 4NBTA 4U2GA 5HF6A 4UAVA 3RQSA 3GLIA 1Y3AA 3LLVA 1KYWA 3AP2A 4GBMA 4R9SA 4WXMA 5GOZA 2IEGA 3ETNA 5GQSA 3AJRA 3OO1A 4DCPA 4AWAA 3EE6A 2C3OA 1W85A 1ZIYA 2LW7A 1W25A 1EM8B 4BWVA 3E5HA 4M8SA 4RDXA 5KYGA 1DO2A 3DHVA 1A50B 1RWBA 2J0QA 4C0KA 4UEJA 1LVGA 1EP9A 4HWRA 3JW8A 5ALFA 1FFWA 4JI4B 2HH9A 4GXRA 3PLAE 1O3YA 2PTHA 2IUFA 5FLYA 1IK6A 3DZGA 3PJFA 6YASA 3EDMA 1AB6A 4U2EA 2FMKA 1K9VF 4EMTA 1M5TA 3NNNA 4Q9DA 2OKCA 5IUNC 2WDZA 4FGZA 4OQNA 3WL6A 1TIBA 4OHXA 1R12A 3P9SA 4FC6A 4RVHA 4MV6A 1KJJA 4ND7A 1K1EA 4PHHA 5FPQA 5LN1A 3FYCA 3WIUA 2IXTA 4XCQA 3TLYA 1QVVA 2HIMA 2VWQA 2FW9A 4HATA 2WMYA 4F4JA 4CL0A 3SM9A 1IHDA 4PN7A 3PFBA 1TO1E 2NU8A 4D9MA 4R54A 3RF6A 3UEOA 3VTKA 2LBPA 4JVOA 4NBWA 2BM0A 1AUQA 1P2FA 2HN9A 3GX1A 4U6NA 1ATZA 2D0IA 3EXHB 1AKMA 1UZLA 1VE5A 1K66A 2CZQA 4P80A 1T10A 3ESRA 1JQKA 3HUFA 4HUQB 3VBEA 2BGTA 3EEIA 2OV2A 4N6NA 2OO3A 2Z1DA 4MB0A 1U1DA 2XVMA 5EZQA 1CW2B 1AV6A 4JU9A 4F3TA 3OQVA 1SUBA 2W2NA 1SR8A 5EHQA 2GJ9A 3HEAA 5EQJB 4WY2A 3MOGA 1LTKA 4AZSA 4S1OA 4C3UA 4LV5B 2G9ZA 2D5BA 2B37A 3ROFA 5BQ3A 1ZR4A 1ZDMA 1QNLA 3SD7A 4JS0A 1EFRA 2BTOA 4E2ZA 2XWJI 1KWKA 2BD0A 5IJ9A 4E3WA 3R0JA 2W6JA 1G2IA 3QYPA 1WW2A 2GD0A 2XGOA 4IIDA 2WIDA 3TTSA 2GEBA 2V7VA 5ELMA 2NU6B 2YV2A 1U7WA 3EASA 4FDMA 1YFJA 2GLUA 5LU9A 3KDAA 3OZBA 3OFND 1FDIA 2Z5VA 3PWTA 3DBHA 2IUUA 2FMHA 5CDYA 1Q77A 3GCWA 1LK0A 3M83A 4TGLA 2JFHA 2OO5A 3OM8A 2VPTA 1H2RS 2VSYA 4DJDC 4W1SA 3MIZA 2JA1A 5ADVA 4AZ3A 2KLHA 5EIHA 3LOUA 2W98A 2PUCA 1LVUA 5D51S 1R4NB 2JIQA 4ZJYA 4EZIA 3BL5A 3TLEA 1MAHA 3HCCA 4GX1A 4Z4GA 2L42A 3MELA 1CP2A 3HJHA 3TH5A 1UFRA 1ZBQA 1CNEA 2ATXA 4LJ6A 1NUSA 4WBNF 1K6MA 3DEHA 5H1YA 4XM0A 1QO9A 2NVOA 1THTA 2CFRA 3DC2A 1RQ2A 3QMMA 1KL7A 3VZRA 5HIMA 1M1YA 4UM5A 4LF7B 1ZL0A 3AFHA 3G59A 3VI3B 4HBGA 4Y7CA 4RL6A 4GE0A 4I46A 1KC3A 3KPJA 3HR7A 4NBVA 5CLHA 4Q3CA 2GDJA 5ED0A 1KRWA 1RYFA 3IELA 2CEKA 3SC2B 2BDUA 4G0UA 3KAQA 4IBOA 1GVNB 4E4TA 1RJFA 5BV1A 1AMUA 4BEJA 1J2UA 3OMLA 4FOSA 4IG9A 4NPAA 4GP6A 5AT1A 1FQWA 1V9LA 1VJDA 4NCJA 4WOPA 2WJYA 3VPFA 2X9LA 4Q4AB 5KQGA 4EO4A 3K9FC 1P5RA 3ICQB 1R0RE 1ZD8A 1E0KA 2H8GA 3QKIA 4ZA2A 3FETA 2WB2A 1G21B 1Z5ZA 2VJBA 2Q0QA 3H1GA 3QVTA 4GGPA 4P92A 4Y1EA 2E21A 1D6JA 1O0CA 2QVZX 4YFYA 1T8RA 5BWNA 4LF8B 4I4TA 5FBLB 2FZCA 5GOTA 4G5GA 1PW5A 2HHCA 3PENA 1GXSA 3A9WA 1E1QD 1R0YA 4CODB 3ZH2A 2VRCA 5HE9A 2HSZA 2MSEB 3PDHA 2AXPA 1DBRA 1CIPA 4TSRA 5I7WA 4BO9A 1GN8A 1XK7A 2IH2A 4FGUA 2JGNA 2JVJA 2PLFA 1MB4A 4QNMA 3AB8A 3D3WA 1J90A 2DJIA 4P08A 4XGQA 4WN9B 1JPNA 3CPSA 1B6SA 3LPDA 4MARA 5CK4A 3NLLA 5JLJA 3CH5A 1KVSA 1T6BY 2PU5A 4H9GA 2WEKA 4XVQA 4GOLD 2WA1A 2FUKA 1JHVA 5AW0A 1GV1A 2ZE6A 1JG4A 1XKLA 1YDFA 1G8AA 2V6IA 3E8XA 3GEDA 2PH3A 4NZOA 1PBTA 3PHIA 3HJRA 2P5YA 4K40A 4UXHA 4XCVA 5LQUA 3HCBA 4MWOA 3TAHA 2JIBA 2RHHA 1GPUA 3NGLA 1GYPA 4MV9A 5DDIP 1ZISA 2YJNA 3RKUA 3GFSA 1ISRA 2JCSA 4DUGD 5KPDA 1O0BA 2NT4A 4Q7JB 3X1DA 4CXMA 2I2BA 3PIIA 1BJRE 4I55A 1GQFA 2B92A 1BGWA 3DR3A 3EISA 4B2PA 1ZHHA 1MAVA 3S1AA 3LPLA 3PL5A 3R5JA 4LWPA 4PG7A 2IT1A 5BQFA 5AVQA 3VJLA 1P45A 1W581 1F51E 3JATA 5FI1B 3NCTA 2B0CA 5C31A 2IYAA 1K6XA 1Z06A 4PZ0A 5ALKA 3DFZA 2CHQA 2ZUFA 4BVEA 1JNXX 5B6JA 2DKFA 1XQYA 3H42B 4L85A 2G0NA 2IVZA 2V59A 3DHWC 3RS9A 3LUBA 3GEBA 1ND5A 2UAGA 1UT8A 2CMKA 3C8HA 3OPMA 4RBNA 5A4AA 4H16A 3AHGA 4YUWA 4ENVA 1T9GR 2PVPA 4YJ3B 5FWYA 3TW0A 1APBA 1ND6A 3DAGA 5JY1A 1WY7A 4RA6B 1XVUA 2OXIA 3T7KA 4LZWA 3OF5A 1XDUA 4X62B 3V4SA 4YRBA 3VPXA 3WJAA 4XOIA 5EMMA 4BBAA 3H11A 4D9EA 1V41E 4KQ2A 4FWBA 2P4UA 4AS3A 1YUBA 2P9BA 3CZQA 1LTQA 5IJXA 4L5AA 1C7RA 3NDRA 2CNBA 1J9ZA 3U9LA 3SFTA 3X2FA 1Z5UA 2W5UA 4F7DA 3Q9LA 2DFLA 5F1KA 4RF3A 4WT7A 4YXWD 2A9RA 4Y30A 4OGLA 2C7PA 3E27A 1MZVA 2G5GX 5JDIA 3FHLA 1II0A 1ISSA 1DX9A 1A9ZA 1L1EA 1IOWA 1DADA 1RYHA 1K68A 1U31A 4O2BB 1M8JA 2WWVD 1NNSA 1UBJS 4OU4A 4N01A 4ON9A 4DWWA 1SUDA 4HDSB 4GL4A 1VDZA 4C1NA 1NJGA 1C0PA 4QTXA 2H1RA 2C31A 3AKZA 4RF4A 4TRRA 1JBKA 2BFCA 1P7YA 4XDGA 3ZBQA 1P2DA 1EFVA 1MQ8B 3HUTA 5DOVA 4BGDA 5JS8A 5LYJF 5TLSA 3AFGA 2WFMA 2C9MA 1BS2A 3TL6A 3V2IA 4PGAA 3VDMA 1GNPA 3IP6A 4UQLA 4DUPA 2VYQA 1KDVA 4AMZA 3F7MA 3IQZA 2OHGA 2XGSA 4CG1A 1VIDA 3PNKA 3FZYA 1NC1A 2P6UA 2XKAA 5CURA 1I80A 1DTSA 1WXXA 2H7YA 3M9XA 5BURA 1ZIPA 3L93A 3VDNB 5LQDA 1U63A 1IEXA 2YMPA 3SK0A 4HDQB 2PM8A 3HJUA 3NBKA 1GG2A 2CCGA 1KR2A 3GH3A 4JBWA 1PLJA 3NFRA 4HDNB 1L6IA 2RAVA 1B2RA 4K3UA 4PV7A 2A9JA 4BVLA 5JJCA 3MXTA 1CBUA 1LSOA 2HM7A 3EFBA 4O5OA 5B1DA 3WGUA 4MLDA 2HSDA 5HCIA 2JCBA 1I3KA 2A0YA 3KT0A 3VTZA 2FDXA 1KTVA 4QUEA 4I5DA 4QLBA 2YMMA 1J49A 4KVGA 1FYDA 4ZTUB 3MD9A 2X8JB 1Z4QA 5E1BA 1DC8A 4FEYA 4O02B 2WU8A 1P39A 3C4QA 1DWQA 1Q1NA 4QSHA 2YJTD 1Q50A 3GQVA 1GKLA 1ZBDA 4YAJA 1NU8A 1H9CA 4MYCA 3EHDA 2WU3A 4D8VA 4EIWA 1KEZA 2AEMA 3P9KA 3V46A 3HDQA 2CKMA 3OO0A 4LTNA 4GW3A 5AKLA 4KITB 5J4KA 2XCSB 4HUQA 4IQ0A 2C84A 1DEHA 3CUUA 4MPTA 4RV5A 1XTJA 4N7MA 4OYHA 5TPZD 1KS9A 4H7EA 5D3MB 4JJAA 4FHEA 4Q34A 3MOSA 1VL8A 1NTOA 4I1OA 4JC5A 4XD2A 4ENTA 1WBBA 1WX1A 2W6IA 5GJWC 4JI8B 1JZSA 4GE3A 1N5JA 4RMHA 5DXJA 2AN3A 2O7SA 2WSMA 4HSEA 4NAVA 3L1IA 4RQAA 4A8TA 5FOQA 1JU3A 3I9V1 2B1JA 4YP1A 3GFBA 2VHQA 1J33A 2ZB7A 5EJ9A 1NATA 3O75A 4WBSA 1HC7A 3UMGA 3ZH9B 4DLKA 4MQEB 3IUQA 3HB9A 1L5QA 1PLLA 1GUYA 2J0EA 5CUQA 4EKYA 2WWYA 3ELUA 2VSFA 4NEGA 4DNFA 4KUHA 1JQBA 1GADO 1PQPA 2MYUA 4X1IB 5FOTA 3U9SA 2EW1A 2NU6A 3KFLA 3OIGA 3IVXA 2NV2B 3MUEA 2ZBQA 1JSXA 2PZGA 5D87A 4A5OA 4BLSA 4NH4A 2M9MA 1Q7CA 1JXAA 1WPRA 2C04A 2QU7A 3HA5A 4Q48A 5FD8A 1BZYA 5CPFA 1R37A 1V8FA 4REQB 2SCUB 1M1XB 3GLGE 3F5QA 5EPEA 3IILA 3P0HA 4JHXA 3VSBA 4A1OA 1P6XA 4KGXA 4JQYA 4LRWA 4R40A 5F1PA 1N2EA 3FVRA 1ZVMA 3GPIA 4F2GA 3MTEA 5JNTA 2O8BB 4MEAA 4ZYXA 4UOEA 1T5TA 3KB2A 4A4DA 3Q6NA 3PDIB 1UR5A 3G82C 3OJ0A 1SCBA 2CNWA 2XDQB 2FLWA 2PRSA 4ZVQA 2P1DA 2AV6A 4BWYA 1RWWA 4L76A 2OYRA 1KA9H 5AW6A 4URVR 2JH8A 4G0PA 4D3XA 4P9NA 5KSPA 3O3MB 3UAVA 3I2GA 3QX8A 3NATA 2BISA 3HFRA 4J9VA 4MVYA 3TW8B 3VPBA 1J7KA 1X3LA 4AECA 5HF5A 4MICA 2WFAA 3I9LA 3ZR4B 2ZAOA 5JS2A 4A8PA 4TM7A 3Q7PA 4P5PA 5EAIA 1PZFA 3TO5A 2B6HA 2I87A 1SUIA 2JASA 3NO4A 1D0SA 3F78A 3SC2A 5JBNA 1M10A 3PJEA 1EVEA 4GOOD 1B3RA 3PJGA 2ZRBA 4E3ZA 3DWGA 1YQEA 2C4VA 2X86A 4HF7A 4HRYA 4R01A 1PK9A 3RABA 1V43A 1UOOA 3MWGA 3UZUA 4BBZA 4EKGA 3AY6A 5IT4A 2Y4NA 1F2VA 2SNIE 3DWIA 1U99A 1CHDA 2IXGA 2X5KO 3FF1A 4HL6A 4MMZB 2ONJA 1I6MA 3EAQA 2V6GA 3C3JA 3S1LA 4PLYA 4B7CA 4BFZA 4P3NA 4YQFA 2V0CA 4RJKA 5CDUA 2M1ZA 5AHKA 1XEXA 5E2BA 2G9RA 3IXMA 1RXIA 1ZQ9A 3UJNA 5LJLA 1ZK0A 5EUBA 1ESNA 3W2EA 2GM4A 3RVRA 4H6XA 2W4QA 3VA7A 2V98A 3NKFA 2O3SA 1QOZA 2AJBA 4AJHA 5IVKA 3W5VA 1JAYA 3HZRA 5KTRA 4GYYA 1JQLB 4PTYA 2I4RA 1WUHS 5FHQA 2H5LA 2V0GA 3LKDA 2GN4A 3C7AA 3IKVA 3Q72A 4HI0E 3N2EA 4UM8B 1UBUS 1G19A 1YK1A 2HWKA 2JJYA 3LC2O 5ICEA 4PS0A 4BVJA 1A5AB 1IQUA 2PU7A 3I9OA 7MHTA 1FUEA 1RRMA 3I92A 1ST2A 1YU9A 5FH9A 4LJ4A 2O1XA 5JMOA 3A6LA 3JYLA 4G2NA 2FHSA 4RHEA 1SY7A 5AUQA 3TPFA 4IDPA 4EKDA 2ZAIA 2OV8A 1VBMA 3B89A 2CNDA 4L51A 3CH6A 4MV3A 5ARDA 4IIJB 2ODPA 2I6GA 2W6MA 3O4FA 1DAGA 3QFCA 1Y6JA 4AN0A 3PVSA 1GG9A 3E81A 3E5MA 3JPYA 4DJFC 3UJ8A 2DMRA 3I32A 3TXAA 4ZV9A 4OHCA 2WZCA 3DCNA 4AUKA 1KHTA 3S0JA 4RIHA 3SPXA 1AH2A 4C4SA 4KFRA 2OMKA 1KI6A 2ZRLA 1JEYB 2JDID 4KXQA 2JIPA 4TVBA 5AXAA 4NV1A 4TQ9A 2CXXA 2VJMB 2CVZA 2IPAB 1I5OA 9ATCA 4GQBA 5EIEA 3OFSA 2RHRA 3EG5A 4Q0MA 2IYLD 1CSEE 3ZD8A 2J7KA 4OHMA 4DDKA 5F2NA 1D2EA 4BNXA 1E96A 1L7QA 1Z18A 2X1VA 3WIVA 2YTZA 1X7YB 2KBFA 1OPXA 4KIWA 1F9EA 1FVOA 3T7DA 4U4AA 2DC1A 4QOIA 3I9KA 4QQFA 3I3SR 1IN6A 1NPTO 4PVDA 1T6NA 2PH5A 1T9HA 1OYOA 3LYUA 1XL0A 4YJ3A 4ZREA 2WYWA 4ARUA 1HDYA 4HZGA 1Z4PX 1M2GA 4ODIA 2YL2A 3EAGA 5TMDA 3HWX1 4NAUA 2FEOA 4RA6A 2VT6A 3I05A 3SXUA 2LD4A 2SKCA 4BNTA 5NLLA 1XRLA 1QFXA 4AUEA 3QMPA 1XYYA 1N3BA 4LGMA 3EIOA 5JAZA 5AHWA 1FP7A 1N92A 1LSUA 3IO3A 3ZYCA 5BN1A 5GP1A 1T8UA 2WQ6A 1QP0A 2DHDA 3H2IA 1B0AA 1QWOA 5C1BA 1M2FA 1JAHA 3KAPA 1EDOA 3NWBA 4EY8A 3WWOA 3IUPA 4KYIB 4UM9D 1YJXA 2QDKA 2F8LA 3EUFA 1S01A 1Y4UA 1X7XB 2HL6A 4OGWA 4UUOA 5EL0A 1K92A 1P31A 1PCXA 5LA6A 1PL6A 1I2BA 2QRQA 3RODA 4DYHA 4B3IA 1J23A 3O4GA 4I2VA 2LP4Y 1ZM9A 3HR8A 4L74A 5KEIA 4O2BA 1Y8RA 1Z8FA 1T8WA 5LBUA 5HF9A 3WYFA 4B82A 1XZNA 2R8RA 3ENVA 5PGMA 3TQSA 4E08A 1QR6A 3GZJA 4GWGA 3PKZA 3B38A 4FQ7A 1JAXA 4PO1A 4P7KA 4MI6A 4QE3A 3NBXX 2OG2A 3F5MA 4IIHA 5LBTA 3HYLA 3PXCX 4XSVA 4JIGA 3ORFA 2DSTA 1U0FA 4P22A 2ENWA 1R9GA 4E2FA 1KPGA 2H6EA 1UANA 1EHCA 2UZ3A 2W6ZA 1UL1X 3D4LA 3JARB 1O7JA 4YRGA 1E99A 2YY6A 1RVV1 1WMSA 2WUDA 4S1TA 4TWJA 5FFMA 4DR4B 5GIOE 1ZUHA 2Y05A 3EMVA 5HCUA 3CIFA 4OFXA 4TMTA 4UPEA 3K8YA 4CNBA 4RKFA 2Q9BA 1QGYA 3RIMA 1NW7A 1W59A 1WW8A 1XEAA 1YNOA 2LUOA 2C5AA 2VI5A 1NLUA 3C97A 3FAKA 3QLUA 4HDNA 4B31A 4JVNA 4MKGA 1Z39A 2YYZA 4MUGA 2FPKA 3VH3A 5EVCA 2QM3A 2QPAA 4N4AA 3G49A 3PC4A 1E6LA 3QXSA 3Q3IA 1SIBE 4MKZA 4N5HX 3W5SA 5ITSA 3H2JA 5E9AA 1E79A 3AF6A 1XMSA 3TX2A 3KXDA 5GM2A 1O95D 1R16A 4H4DA 1IZ0A 3DFKA 3SEZA 4DWVA 1Q83A 3K70B 1QANA 2HWYA 4O3MA 4KEAA 1QHIA 3F9IA 3AESB 5C37A 2ORYA 2W6CX 4AM8A 3QOWA 4BX3A 5LOVA 1SHJA 4PX2A 2NTJA 3GEIA 4XR9A 3DFFA 2B4AA 3CUYA 2RGWA 3X1YA 3II6X 4QT0A 5DF1A 1ONBA 3TN7A 1TFUA 3JAWB 3MWYW 5B55A 2B5VA 2XODA 2XI4A 2ORIA 4G24A 4HB3A 4AJ9A 1PQ4A 621PA 1J1IA 1T91A 2XADA 2VC2B 5AM3A 4LJKA 4M9XA 5H02A 4WOBA 1K8QA 1WCV1 2M98A 3INTA 1FTQA 3P4XA 4KAAA 4RGBA 3ZDZB 3ZGXA 4G5OA 3RVBA 2FOIA 5D3MA 2A30A 2A4KA 2HDWA 1T1SA 4IFTA 3ZNNA 5F51A 1KAQA 3V8EA 4PZPA 2ZPUA 4Z0TA 5H68A 5BN4A 5TC4A 3U31A 4CDGA 1EX1A 2KJQA 4RQUA 3Q5DA 1MXHA 3O9ZA 4I7EA 1EFCA 4RZUA 4Z99A 3SYNA 4YAWA 3JQAB 1Z7YA 3LGSA 4DNPA 3DLBA 2W2KB 2WICA 1D9XA 3TVTA 2D2XA 4MQEA 1Y1SA 3CNOA 4KL8S 3RFTA 1V7PC 1ZGGA 3C43A 3KQSA 3RFXA 1OC2A 2H9AA 2WYIA 3CCBA 4DDTA 4C7OB 5DTRA 4X1IA 3Q5EA 4WX2B 3STXA 1ESCA 4AX4A 1O6GA 2YOGA 3B1YA 1R66A 1YDEA 1ZI8A 2G0AA 2HZBA 3LUDA 3IEKA 2ZJFA 4HN2A 4J0JA 3AV3A 3Q9UA 2W6JD 4XYBA 4PHTA 2C9CA 4D79A 4B75A 3LUKA 4KQIA 1L4UA 4G0NA 1PZGA 3HO1A 1R6DA 5JXHA 2O06A 3UMMA 1UBNA 2OILA 5AKIA 1EVZA 3OCUA 3IQWA 4MWCA 3IHLA 2PX2A 4BL5A 3K53A 4IJ5A 2EKQA 1RLOA 4UVEA 4L73A 5DYWA 4ZI7F 2I65A 2PJUA 3BE6A 3FXAA 4TOIA 3UCXA 3VOAA 3ZZ0A 1IHYA 4CHGA 1V11A 3M33A 3ANLA 3LW7A 1DDIA 1X7GA 2B20A 3I01A 3NGMA 4GI3A 4U0KA 2GZAA 4ZAYA 5IVIA 1RQGA 3DF9A 2OBLA 3RIHA 2CLMB 5CBPB 1T13A 2XWBF 2C5LA 5D7NA 1ENZA 3N9IA 2CE2X 3OPXA 4BAGA 1B0ZA 4V2IA 1ODLA 2FY8A 1I0ZA 1JTEA 3BSSA 3F6YA 1XNRB 1I3MA 4OOFA 5AHXA 3V1KA 3WLJA 5K0JA 3QMVA 1J39A 2C83A 1TF7A 3S8MA 1AGNA 4E6EA 2ROQA 4CETA 1AO3A 2G4VA 3EVCA 4UTNA 1E2NA 1A9YA 1QOQB 1X7DA 1K0UA 2BHSA 2XZPA 1IMJA 3QXJA 4FHFA 4RA9B 3BX1A 3G2LA 4DLBA 5AKEA 1TPYA 4Z3OA 4MW1A 5JRDS 5KYYA 3B3GA 1HG0A 2WP0A 3SZGA 5G02A 1B6GA 1YE3A 4YACA 5K3AA 3U3KA 1HY3A 2LVBA 3FMOB 5A7GA 3ERCA 3E03A 4DRXB 2ZT8A 3P0IA 3FCUB 1OGJA 3NIFB 4LMPA 3T94A 2D5CA 1NW6A 2DH6A 4Y6GB 1N1DA 2ATVA 2DUWA 4UFPA 3FMVA 2N0SA 1E32A 2J6BA 4FR5A 4XOUA 1DC5A 3L6UA 4N3AA 1OV4A 4XWGA 3CKLA 4MGEA 3DNPA 3VU3A 4DJEC 4Q19A 5HGJA 1NX6A 4HFMA 2RDMA 1RLIA 4BMXA 4KH1A 3GUUA 5DB4A 1LQTA 3HXTA 4URYR 2FQQA 3MCTA 5AM4A 1PFVA 2F1JA 3R4CA 3F96A 4EFDA 5KQSA 2FSGA 2V5VA 5DN6A 1EGAA 1RVDA 3SZUA 2A0FA 3I30X 1TU3A 4OYLA 1NQUA 1UXGA 5CYOA 4BC1A 2JLWA 4LXIA 3ZNOA 3WX0A 1DXYA 1KI8A 1IU9A 3JQCA 2NZWA 4IFBA 4JEIA 4IIJA 1LBTA 1Z6AA 1IBRA 4A6PA 4HGYA 4C04A 1RHUA 4C9BA 3SVTA 3FW1A 3WS7A 2O2EA 3MWLA 1DAMA 1D6MA 3HE3A 4HJRA 2QP4A 3UWOA 4ETMA 1LQUA 1HURA 3K9BA 1QKKA 4BAUA 1WXIA 1YBHA 1W87A 1NLMA 1Z07A 3EIEA 5EWJB 3IDOA 3U40A 1PGPA 1OWOA 4PSDA 2XT0A 1ZNWA 5C52B 2JLCA 1JEYA 3CINA 3DEAA 1E4VA 4EPTA 5K0EA 2B6NA 4BVBA 2D0OB 1UJMA 3RUAA 3GYGA 5CT9A 3M5DA 4R8SA 3SVLA 3BFXA 4A8HA 3HN6A 3TZQA 3ZKWA 2QE7D 3VSCA 3ETDA 1X1CA 2F8SA 4WZZA 1FRZA 1TNDA 3GNLA 3AKEA 2F3SA 5FYQA 2BKLA 4FNGA 1M76A 2FPMA 2Y0DA 3C85A 2OPHA 2OZLB 5I7UA 2R0QC 4UMEA 4BMOB 4ER5A 1GARA 3GJ0A 3EGVA 5EE3A 2B83A 1OA0A 4YPVA 4OHZA 3A3OA 1YZFA 2FSFA 1XXLA 2L82A 3T61A 4YWHA 3FCCA 1RQRA 3TXXA 2BFAA 3WTBA 3AWDA 4MZXA 4CLXA 3ADCA 3RRFA 2V45A 3MMNA 3PSAA 4A8JA 4PCLA 3PUKA 2ZFUA 2XXBA 1Q95A 1CF9A 1VA5A 3G5AA 1C8BA 1URPA 2B4YA 2ODBA 1T2VA 2ZYDA 3CNHA 3MWDA 1YL7A 4TS3A 5BR8B 1HT2E 3T1HB 4GYJA 3F8TA 3SS7X 5JYCA 2Q1TA 3PA6A 3MGCA 1KEEB 4AZ3B 1JG7A 4EJ0A 4F4IA 2ZJ7A 1HQYE 2ZUTA 3C8MA 3ASUA 4MRAA 4LFBB 3OX3A 1NW3A 1XTSA 1RJWA 3GRPA 3K96A 1T8TA 3K8QA 1GU7A 4Y98A 5JVDA 1U90A 3O93A 2I7CA 5CX4A 3JYOA 6ADHA 2DY0A 3QQ5A 2VHZA 1T6XA 4BV3A 3R0VA 2XIQA 4LV8B 1VE7A 3TJZA 4KE9A 4JBXA 1X0VA 1EM6A 1MRNA 3MTIA 2W2LD 4K0RA 4AURA 2PUBA 3U80A 1DPGA 1Y3BE 4KXYA 4B71A 3DW3X 1GZVA 1RPAA 2Q0SA 2QN3A 3GPCA 2MSKA 4KR2A 2FX2A 2CN1A 3NP9A 3F5DA 1B0UA 4RULA 4EVRA 1T4DA 3T06B 4QPJC 4BUJA 4TXNA 5EWLB 2LCIA 1CZLA 3JARA 5DMXA 3VAZA 4C0JA 1VE1A 1WXQA 4EELA 4F9EA 1J99A 3L0ZA 5B37A 4LV6A 3NBFA 1PFYA 2GEKA 4G09A 1RC8A 2WY2D 4Y2TA 3DGFC 1DXOA 2J8ZA 3H83A 2JEZA 1ZD3A 3GNQA 1JS1X 4QHYA 3CH7A 1YFKA 1NI4B 3KLOA 4XIYA 2CSUA 4CIYA 4HP8A 5B3AA 1N0IA 2HW8A 4GXQA 3K8OE 4LDAA 4PG4A 4WK4B 1N6RA 1ZSVA 1J24A 2W58A 3CX7A 3REOA 5G41A 3FPGA 3QW2A 1G3RA 1JPUA 3DZIA 3HCDA 4R7TA 1I3LA 3N1UA 3CRRA 3WJ7A 3BBLA 4OBBA 4EOGA 4IIBA 1E18A 3MMPA 1FP2A 1DFIA 4C7JA 3K09A 3TFQA 8GPBA 1ZJYA 3UPDA 1TCAA 4DUYB 3IP7A 1JDVA 2NZJA 3EXIB 4D97A 2QYOA 1Q7BA 1ACJA 1RWXA 1C4OA 1KIFA 1F2TA 3L41A 3OETA 1J2JA 4KE8A 3IQIX 2I66A 3AESA 1CY8A 2WK1A 3RTEA 2GUWA 3ZJ4A 4PZZA 1A2QA 4WNCA 2ZU6A 4YJHA 3BJEA 4L9AA 2XXAB 5BMOA 2ODNA 4XM2A 4KVZA 4N3CA 4AJPA 3VR2D 1KDRA 3A05A 3JAWA 1SCDA 1Y9DA 4KQMA 3LXRA 3S3TA 3FKSD 1T15A 1ECFA 2V97A 2WVAA 2RI1A 4I99A 4Q18A 3QA3E 4C14A 4IIEA 1LSSA 3DT8A 1CVLA 5LC1A 4ENSA 4GWLA 2C7OA 2XUAA 4NPCA 2IHUA 1HG1A 2GBIA 4ZO6A 4UU0A 4KYUA 1S89A 3C6BA 2VJNA 5JJBA 3LD9A 5DM1A 3PCRB 3UMJA 2WKRA 4ARBA 1GR0A 3CIOA 4RM2A 3VC7A 2C3YA 3AYXB 3D6TB 1TMYA 3K15A 3FSEA 2JIOA 4CMGA 3IULA 3JQAA 1JA9A 2W2KA 4DF3A 3RSOA 2BOVA 3ZQ4A 3K2QA 3TKAA 2Y67A 2DXIA 3DL7A 4A3SA 3CZMA 4TTSA 1WSBA 3TI7A 3VDRA 3I76A 2IELA 4TN5A 1NX9A 2AZTA 2JI4A 1LS6A 1Z0KA 2NXCA 3BVPA 5MFPA 1ODSA 1EK6A 1R9MA 1SVIA 1V37A 3HO8A 2C9BA 1VKZA 3CRMA 3UWMA 3QEBZ 1ISMA 2BLLA 2I3AA 4ZOBA 3CN9A 4HYYA 3IMGA 5DYYA 4KHZA 1Z5WA 1M2OA 2QMEA 4DCNA 5KSWB 2RMKA 3OOYA 3KELA 5C2JB 4BEWA 4GXTA 9ABPA 4D8WA 2QG9A 3CA8A 3GT0A 3T7SA 3X43A 1RPZA 1T36B 3DVAB 1XLVA 2JHCA 3FJ1A 2XOKD 2IH5A 1KP2A 2FF7A 2XCLA 4GECA 3TTYA 2BSAA 4AKIA 2B25A 5EJ4A 4ITRC 1YB6A 1VB3A 1ENOA 2IYEA 1S6YA 4Z4CA 4HR7A 1L5HB 1JDSA 2XOEA 1DJPA 3CPEA 3DDCA 3FNRA 2QYTA 3HP4A 4KXVA 4OP1A 3WK4A 4BN0A 4EHLA 1Z7EA 5CBPA 3NHMA 1WIWA 3IEUA 4IPTA 821PA 5HX7A 3FSGA 1IY8A 2HHHB 2UXBB 1VJGA 2O6HA 2RFLA 5JWOA 1NNEA 4Y9TA 3O21A 1EXDA 1Y4DE 3G85A 1WTCA 2GN0A 1ULTA 3HY4A 2ECFA 3L1JA 2FPUA 1ZGCA 1RZUA 1T1GA 4HQRA 1F8YA 4Z4IA 5CDGA 1CPYA 1WOMA 2F3PA 3Q7SA 4OL9A 1F3LA 3C1TA 3PFFA 1R6AA 3QPWA 4PAGA 3FCSB 4NYMR 4PRZA 1RYZA 4IYJA 5AD1A 1L8XA 4MWZA 1FDRA 2Q49A 5DX1A 2NXWA 3VGPA 3U6KA 4IHJB 3U09A 5KTKA 5B4TA 1JWAB 3WDLA 1ONPA 4D3YA 4G26A 1Y8AA 3KIPA 4BCCA 1Z2AA 5JCPA 3GA5A 3KQPA 5AJVB 1ISHA 4D7AA 3ZLVA 4DRXA 1PO7A 4UEQA 3T12A 4L95C 3PSHA 3T9CA 5CTAA 3WQRA 2QYHA 2AS0A 3BMOB 4FGWA 4G8DA 4CDRA 1JR3D 1RJ9B 5K8JB 3FGZA 1G4AE 5DTEA 4G0ZA 5AW2A 2H4ZA 2F1IA 2RHOA 4FR2A 3GCXA 5BV2P 3RSQA 3PNQA 5E2AA 2AF4C 5ALDA 1NVGA 4LYYA 3QVWA 3GT7A 4P31A 1KVUA 1N8KA 1SRQA 1SAYA 2FSVC 1ESMA 2XA2A 3IAXA 4TLLB 4UHDA 2HF9A 2VNJA 1ZCJA 2H48A 2ZRJA 2GBPA 1TAGA 3I0ZA 5JLAA 3PTAA 2GZHA 5CHEA 1JJFA 5L53A 3LE8A 4ZTZB 4L3OA 4ZDIA 1H05A 2XB9A 1MW8X 3SJ7A 2ZKIA 3IERA 1W34A 1YU6A 5L7WA 2VJPA 2ZSAA 1OXMA 2FUG1 2X6QA 4OJTA 3TAUA 4I9HA 3NALA 2QZ9A 4JLWA 4FFBB 4OUDB 4PSUA 4QECA 4WAUA 5C1OA 3X2EA 1G8YA 2ZJ8A 1GQOA 1Z6GA 4JLKA 2OY0A 3VR4H 3EXFB 2Z2YA 1LTHR 3B9QA 3G2MA 3GLQA 3OAAA 3VYWA 2EL9A 3QVMA 5EWJA 1XZQA 2I3DA 5CDTA 1AO0A 4ZT7A 2AHOA 1BX0A 5EHZA 3E9EA 4S2UA 3LP5A 1RLUA 2MHCA 1MPTA 2BKAA 3A36A 1MHTA 1OASA 3NHFA 4XWYA 3L49A 3C3AA 3RYIA 1IN7A 1MIOA 2ZDHA 1D5WA 3WXMA 4YMVA 5DYTA 3WGOA 3T5PA 2IGBA 4BNFA 5B7PA 5KTYA 1WHTA 2QTVA 2COKA 4PYOA 1AY0A 3U13A 2ZB8A 4DM4A 2OZLA 4DZRA 2H1WA 2WF7A 3C5WP 2K2QB 5KOIA 4RHXA 3FYUC 1YQGA 3B82A 3WZ2A 1U7UA 4MRSA 1RM4A 2SKDA 4FIZA 4IIXA 5FR2A 1SZPA 1SQGA 4I1IA 2WIGA 2QTLA 3U26A 1SEVA 1NNUA 4Z1MD 2BZGA 2FFRA 2G0TA 4BLUA 1YHZA 2X2OA 4YMIA 3RS0A 1U1EA 4I08A 4WH0A 5HRAA 4YCMA 1XTPA 3SX4A 2YICA 3F7TA 1RSZA 3N2NA 4P84A 3BF7A 3ZDQA 2REBA 1K9SA 3KZKA 5KQLA 4BB0A 4XASA 5BYAA 4HQNA 1R4ZA 3EG9A 2ZRFA 5CVEA 3GUCA 4A5SA 4P81A 4Q1VA 4RS4A 2HK6A 3HYCA 4YVFA 4YQEA 4YAIA 2O4CA 3NFYA 3U4IA 5J4LA 4H7PA 3SDSA 4IDOA 2O07A 4N7RA 3D1JA 3ND5A 1JWLA 5EKTA 3K6SA 1P1FA 3OIVA 4KTVE 1P72A 2PRIA 1K5PA 1LA2A 1Q14A 4POAA 2FW7A 4WDQA 3R7BA 2GTPA 4JT4A 3FNBA 2QZJA 2KE5A 4TRJA 4HKTA 3SNKA 3QVJA 4W5HA 1U1CA 1ZD4A 3GZTB 5JW6A 2MT9A 5FPSA 1VRCA 2BI8A 2CCKA 2IXBA 5C51B 1XYGA 1Q0QA 2HTEA 3UCEA 1JVSA 4IQGA 5EMKA 1X1SA 4GNKA 2ZI5A 3D0QA 4RPLA 3GI1A 2RK6A 3UUEA 4MS3B 1VGRA 4XB1A 2B7LA 2WTNA 3H9BA 3PQFA 2J31A 3OZWA 4ACAA 1HWYA 1R5BA 4QD3A 1YKGA 5ENVA 5ER9A 5KWSA 1M5RA 4Q3NA 4L4YA 3L1HA 1DCFA 1PEDA 5CHYA 2E4AA 3DDHA 5E7JA 4BOYA 4ZI3A 2VR1A 1B7GO 3AR3A 3DL4A 4CKEA 3H5RA 4KVFA 3ITKA 1G3IA 2C0QA 4RADA 4HUTA 4TMKA 1NI4A 4WFKA 1LUAA 1IOLA 2OCYC 4KOAA 4RWZA 1V6SA 3CO0S 1W6UA 1QLHA 4DEYA 3G8DA 2C5SA 2E0IA 3DEKA 2FEPA 3F5FA 3HLTA 2H3HA 4UVGA 4IZHA 5ABPA 1RAAA 1ZC3A 3PQ6A 2OBNA 4MLPA 4MV0A 4P6VF 5JXIA 4MW9A 1ID1A 5DTMA 1DC4A 1K5DA 4G5QA 4LSMA 2EQ5A 4TLBA 4WVFA 3ZCQA 3RHTA 5C7IO 3KB1A 2G06A 3DMTC 2PJRA 1IM5A 4H1UA 4K26A 1Z47A 4P3KA 4RD6A 4AG3A 1N32B 3EXIA 2JGAA 2W0SA 1SZJG 5TVGA 4X63A 1W76A 1YV9A 2PN1A 4MR8B 4OMUA 3TPZA 3M6IA 5IAAA 1LJUA 3UUFA 2R1VB 3ZG6A 1AXRA 5CYFA 1GG8A 2FGJA 3AU9A 3CCCA 4A16A 5A5DA 5C7OO 3WKCA 1RKXA 1FS5A 1HDZA 2F3QA 1QO7A 2ZYAA 1Y7HA 3CSDA 1L3BA 1Y48E 1U3GA 3EVBA 3IC5A 4I9FA 4KDFA 4NK4A 4RSGA 2Q9UA 2VWPA 5E7IA 5EJAA 5K51A 3TCNA 3PC7A 4GYWA 3VHXA 1MA0A 3UFBA 1MJNA 1E69A 5SZHB 3V6LA 4EYSA 4I1UA 5B7NA 2QBYB 2A0KA 2RGDA 3ZGZA 4GLOA 1P2TA 2R8XA 3RJMA 4ZN6A 3ETLA 4NZZA 1KIMA 1ZGHA 3Q85A 1P7VA 3NTRA 3W5HA 3NI2A 3PX2A 1Z6ZA 1BNCA 2GBLA 3IOYA 3M6FA 3DZKA 1U8TA 1UBEA 2AFHA 2VHCA 1O58A 5HKLA 4M1SA 3C3CA 3DP7A 4F8YA 3CT4A 4L4RA 2AZXA 5IFKA 1N7HA 2RJOA 4YCDA 1MX3A 5HPYB 5JNSA 1KZ6A 2WG2A 3B5EA 4GMDA 4ALNA 5CB6A 8AT1A 1LJLA 4HAYA 4DIBA 3L3BA 2YJ3A 3M82A 3PLRA 4X5OA 2PYIA 4D42A 3HI4A 2I71A 3ZHOA 1G64A 1JSRA 1EFKA 2XMZA 3G7NA 2C1EA 3H97A 3BEDA 1W49A 4IMJB 4CFYA 3DBOB 3IAM6 5B1EA 5IU6A 2KBEA 1CUGA 1K7YA 1CQXA 5FPHA 1DP4A 3UIEA 4CR7A 4B46A 3AILA 1RQPA 2WM9B 4HZUB 4AJJA 4JBIA 1RMTA 2CJWA 3GWGA 2B7BA 3IT2A 2IZ6A 4G4JA 3T5TA 6AT1A 3TIIA 3CFYA 4PC6A 3OM0A 2DU8A 4KTTE 3IYLW 3T9DA 4YJDA 1YR7A 4NY1A 1NVUQ 1M8FA 3FFXA 3RS4A 4CMAA 3T7TA 4PBRA 2QLMA 4HB0A 1XTTA 3LF1A 4B6EA 5LMCA 2EKZA 1U3UA 3DVAA 4IRUB 4K7JA 3BA6A 4CG3A 1WBJB 4PZYA 3GYBA 4QQKA 3DFMA 8LDHA 1J1UA 2YWHA 1QH1A 4UVHA 1NIJA 1YQUA 2R11A 3ZK8A 1I3OA 1SH7A 3CLRC 2AOTA 3ET5A 2XB4A 1AKQA 4M1OA 4O59O 1L5HA 1NBOA 3NHZA 2FV8A 4F1JA 1PR3A 3T52A 2VK1A 1CUEA 1UJ6A 1I4DD 4NL4H 2E82A 4CIVA 4P83A 4D3FA 1QGOA 3AJ8A 2ZI4A 1V8DA 3GAAA 1BA3A 4Q1DA 4ZALA 3T3NA 3TI9A 2OA0A 1KU0A 2XYGA 1M7GA 5ICSA 2QAGB 3KQNA 3QE9Y 1T4CA 2I34A 4IOKA 3IB3A 2Z2IA 4Y6OA 4R8MA 4TRMA 3V7FA 5J1TB 5I9TA 3MINB 1U8AA 3NHUA 4U7JA 1H2ZA 4QRIA 3SEFA 5KMGB 4FSXA 5A03A 4BKRA 1ETHA 4UUPA 3WLRA 3GJ7A 3JVIA 1E2IA 4IF6A 4QUAA 1G291 5BYBA 4JDPA 4YCBA 1NOJA 1XDDA 4B4VA 1MO4A 4RXTA