3PHCA

Crystal structure of plasmodium falciparum purine nucleoside phosphorylase in complex with dadme-immg
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
243
structure length
243
Chain Sequence
NLLRHLKISKEQITPVVLVVGDPGRVDKIKVVCDSYVDLAYNREYKSVECHYKGQKFLCVSHGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHLLIHGDFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMYYPNKIIPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKLATKYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Purine nucleoside phosphorylase
publication title Crystal Structure of Plasmodium falciparum purine nucleoside phosphorylase in complex with DADMe-ImmG
rcsb
source organism Plasmodium falciparum
total genus 82
structure length 243
sequence length 243
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2010-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3phcA00
1YRYE 3O6VA 4LNAA 1LVUA 1JYSA 4KN5A 4P54A 3MB8A 3DJFA 4R2XA 1SD2A 5F7ZA 1OTYA 3IEXA 1V45E 2AI1A 5FAKA 1QE5A 4D9HA 4L5AA 1CB0A 1PR6A 1LV8A 4OGKA 3FNQA 1PK7A 1JE1A 4M3NA 4DAOA 1VHWA 4OY3A 2QTTA 4I2VA 1ZOSA 3EEIA 3KU4A 4WKNA 1ULAA 3PHCA 4YMLA 4BN0A 3BSFA 4F3KA 4FFSA 4EB8A 4TTJA 2XRFA 4G41A 4TXJA 4NY1A 1V4NA 3NM5A 2RJ3A 5C80A 4F2PA 4TS3A 1Y1QA 2AI2A 3OF3A 1OU4A 1U1EA 4MCHA 5IFKA 3KVVA 4OJTA 1T8RA 4LZWA 3PNPA 1YQQA 5CYFA 1Z35A 1RXUA 1RFGE 1A9OA 4QASA 4NSNA 1Q1GA 4DA7A 1JP7A 4PR3A 1NC3A 4PNPA 4JP5A 3FOWA 4D98A 3PNSA 3NM4A 1SQ6A 1TCUA 1WTAA 1FXUA 4M1EA 1RSZA 4YNBA 1K3FA 4TTAA 1Z37A 5K1ZA 1B8OA 1TGYA 4U2KA 1JDUA 3ONVA 1ODIA 4TTIA 4GLJA 4TS9A 3P0EA 2A0XA 1PR0A 1V48A 4TXHA 1OUMA 4F2WA 5IU6A 1RXCA 2B94A 4TXLA 4QATA 4L6IA 1NC1A 1PR4A 2HN9A 2AC7A 1VFNA 1U1GA 4WKBA 1PR2A 1Z5OA 4LNHA 1TGVA 1PR1A 1Z33A 1V41E 3UAVA 1Y1TA 1TD1A 1U1FA 1A9SA 1PK9A 4DARA 1OTXA 1OV6A 5CXQA 3BJEA 2P4SA 3U40A 4QARA 1K9SA 3PHBE 5EFOA 3ENZA 4MARA 4R2WA 3EMVA 4UC0A 1T8SA 2HWUA 1V3QE 1Y6RA 1VMKA 2ON6A 3GGSA 1ODKA 4IP0A 4QAQA 4BMZA 1LX7A 2A8YA 4WKCA 1ECPA 3O4VA 3OZEA 3KVYA 2PGAA 3FB1A 4G89A 4WKPA 4JWTA 4YO8A 4QEZA 4DA8A 3FUCA 3FWPA 3GB9A 3OPVA 1Z39A 1OVGA 1YR3A 5DK6A 4GLFA 2HRDA 4L0MA 1ODLA 4DA6A 1RXYA 1N3IA 3UAXA 1YQUA 3DDOA 1A9QA 1B8NA 5CXSA 3E9RA 1Z36A 1M73E 3TL6A 1SD1A 2GUWA 4E1VA 3LGSA 1NW4A 3OCCA 4F3CA 1C3XA 3ODGA 3MMSA 4LDNA 5EUBA 3KVRA 4OGLA 4LKRA 1G2OA 1XE3A 1T0UA 3KUKA 1PBNA 4L5CA 4L5YA 4D8XA 1U1CA 4OF4A 4YJKA 1Y1SA 3LBAA 1PF7E 3UAYA 4ECEA 1K27A 4RJ2A 4DA0A 1PR5A 3DP9A 3KHSA 1CG6A 3D1VA 3UAWA 4MCIA 1A9TA 3K8QA 3OZBA 3DF9A 3INYA 1Y6QA 4K6OA 1RXSA 1JE0A 2ISCA 2OXFA 2QPLA 3NBQA 2OC9A 2I8AA 1U1DA 3F8WA 5F73A 1YBFA 4BMYA 1RCTE 3K8OE 2OC4A 1ODJA 3EUFA 5F7JA 1Z34A 5EPUA 5F7XA 4D8VA 5B7PA 5F78A 4G8JA 3BGSA 2QTGA 3OZDA 1JDSA 3OOEA 1ZL2A 4F1WA 4TXNA 4X24A 3NM6B 3C74A 1Z38A 4WKOA 1RYZA 4JOSA 5ETJA 3SCZA 3T94A 2QSUA 3P0FA 5CCEA 1I80A 5B7QA 5F77A 1TCVA 4DANA 1RR6A 2HSWA 2QDKA 3BL6A 4OEHA 2AI3A 2H8GA 5JPCA 3FAZA 2Q7OE 1RT9A 1PKEA 3UAZA 1SJ9A 3OOHA 1A9PA 5F7OA 4BMXA 1ULBA 3UT6A 4EARA 4GMHA 1T8YA 1PWYE 1A9RA 3IOMA 3LA8A 3QPBA 4TYMA 1V2HE 4DAEA 5I3CA 1JDZA 1Z5PA 1T8WA 4GKAA 5KB3A 2OECA 5CCDA 1Y1RA 2IQ5A 5B7GA 1PW7A 5B7NA 1VHJA 2I4TA 4DABA 3DPSA 3EUEA 4D8YA 3E0QA 3E9ZA 1A69A 3OZCA 2A0YA 2A0WA 1JPVA 4QFBA 4NS1A 5CYGA 4H1TA 5F76A 2BSXA 4M7WA 1JDTA 1JDVA 4TXMA 4R31A 1Z5NA
chains in the Genus database with same CATH superfamily
4HGNA 4JLOA 1E2DA 1Z0DA 3KJFA 1XCPA 4UDOA 4DV4B 1UADA 1FTNA 1PFWA 2GEVA 3DQZA 5CA1A 3SBOA 3NH9A 3AXTA 3D7KA 1ZO8A 2VUIB 1XLVA 4BWYA 2JLQA 3ZWXA 2D1QA 5ARDA 3IQFA 2J7KA 4EA9A 5JROA 3OT1A 2FSFA 1DJMA 2R7MA 4KO2S 5D5HA 3WYEA 3I05A 3P71T 4TL8A 2GAOA 3AUUA 4FWBA 5EINA 3R23A 5KDLA 4DJDC 3VXKA 2CVZA 3P2OA 3QFRA 1RLOA 4KAFA 3ER8A 4K1LA 2AVDA 2CBGA 2HMWA 2J0VA 2UXBB 2OUIA 2RGNA 1KZ6A 2E5WA 4X45A 3HFJA 2ZU0C 3O84A 1OZFA 3SS8A 3E0XA 1JH8A 3H9UA 1ADFA 1WVIA 3P52A 3F8SA 3PHIA 2PFSA 4URUR 4J0GA 3MK31 1YHZA 1EFKA 2XUPA 2YN0A 4ZOAA 2P62A 4ZT7A 1KI2A 3GLHE 4IMJB 4W5HA 5DHSA 1KMCA 1JJFA 3CCFA 3NT5A 2QTFA 1JTFA 3NDRA 1FL9A 3R7AA 4F71A 5KYNA 3A10A 1THMA 4LVCA 4YONB 3V4ZA 3T9FA 4DWJA 3L1IA 3AH8A 4WBNB 4PU0A 3CG4A 3R8XA 5IMSA 4M99A 4I9FA 4AB1A 4A8PA 2BGRA 3UXEA 4V03A 4I4NA 3USZA 2O3TA 2PL9A 3BSFA 1LX6A 2B5WA 2C58A 1KQNA 3SOPA 4O4LA 3RBAA 4BVAA 4BECA 4OU4A 3UXHA 1A82A 1Z4OA 4MSUA 4ONEA 1J8QA 4JLNA 3CINA 3Q9UA 4TUYB 4DKJA 3PIIA 3KYCB 4P3OA 3A6ZA 1D2EA 5DSXA 3IE2A 5EXTA 1V3TA 2HK8A 3A70A 4LV5B 4JBXA 2HJGA 1SXGA 2Z30A 4R2HA 1M34E 3MFQA 1JHRA 3BGDA 4G81A 3QVVA 1HUQA 4REMA 3Q7PA 1OXVA 1L4UA 3HXTA 5FFMA 4U00A 3U19A 2VVTA 2Q6VA 3FGNA 3K09C 3OA2A 3LZDA 4MRSA 2XXBA 3O8RA 2PGDA 4HH3C 3IKVA 2C2KA 3VNBA 1C0KA 3K0AB 3GAZA 4CN8A 3WIUA 1XMIA 4H1UA 4BX2A 3X0DA 1CIJA 4L8YA 1E92A 5AVOA 5IARA 2V4UA 1HE4A 1VMIA 4BKUA 3OIYA 4B3JA 4TKLA 4QUAA 2ZREA 5KNBH 1E1QA 3TO5A 5KYKA 4WKGA 2W6MA 5J47A 3HB4X 3WS7A 1HE1C 4DQ0A 1KP9A 3NWBA 3PICA 1RXUA 2LIVA 4ML3A 2XNKA 4EENA 2WNSA 1KI8A 3BGWA 1XZIA 3LQQA 1MC4A 5AI8A 2B0JA 4Y18A 3SZOA 2QTVA 1LC3A 1K3UB 3FHTA 1DAPA 1PQWA 1EK2A 3E48A 4ALKA 3B36A 1XRSB 1R3DA 4ED9A 1HWYA 2EQ5A 4OG2A 4F86A 5AVSA 4JZKA 3VSEA 1N9GA 4IQ8A 4AO7A 4LC0A 2CNOA 1I4TD 1A7AA 1T5TA 2FHSA 2WSMA 3CUYA 3NTUA 1KI6A 1XLWA 1JQEA 1N3BA 3JQDA 5EZYA 1UINA 2ZJ2A 4UBIA 4K8RB 1O0BA 2IUSA 3P2IA 1P5JA 1Q7GA 1X7ZA 8ADHA 1NHWA 2QVGA 2J0EA 1S2GA 3OECA 2XTZA 4C0AC 4BQIA 5HMLA 5KOIA 4C07A 1U7PA 2ATIA 5CB4A 4HBGA 4ZD6A 4LRYA 4QU0A 4TTAA 4NESA 3AEKA 2C82A 1QZXA 2GBLC 1LZLA 2DPXA 2G28A 3HBLA 3LT4A 3I2JA 2Y1FA 2WJWA 5J63A 1OQAA 3WP0A 2OV6A 5DZSA 4F9GA 5A62A 4X85A 5HGXA 3ONVA 1GTVA 1CDEA 4PPQA 3QEAZ 2HSEA 4PYNA 3L0SA 4TLCA 2A0XA 2WOOA 2XYGA 1SXJE 2IHBA 2YXDA 5GJBA 2J31A 2UU9B 1N2EA 5K05A 1GA6A 2RBEA 4KH0A 2VJPA 3WK8A 4GXQA 1PV2A 3EXHC 3OQ1A 4EHIA 3E3LA 2ZRHA 5DGHA 4G0OA 3NDJA 3ZHRA 1LEHA 3DKVA 3TEFA 4MAFA 3W04A 1RXWA 3EVBA 1REQA 2QUBA 4MMXB 3PBKA 2BZ1A 3PRHA 4P0TA 4FI3F 3CPEA 2ZUTA 2P35A 3TX6A 2G5GX 1GZUA 2J5XA 3I8SA 3JQAA 3JQFC 4CF5A 5J2TF 4LSWA 4MYHA 3WLSA 4JGBA 1WEHA 3UC5A 1V1MA 3N8GA 5JPDA 2PZAA 3GV0A 1V1JA 3LT2A 4NFSA 2GZMA 5EZYB 4MKFA 4DAOA 3BIWA 5CDFA 3HKCB 4OHCA 2VSFA 3I6QA 2COEA 2C2WA 3WADA 1QNLA 2QNIA 1BMTA 1EGHA 3ONNA 4LQCA 4ZN6A 4NG5A 4EBFA 1H1LA 1B6SA 3HA7A 3RWOA 1B41A 1T9HA 4HVAA 3L92A 3LLMA 4L4SA 4XD7D 4BNDA 1RXVA 3GJ6A 1G5IA 3AEKB 3V9PA 3EGVA 1RHUA 4EHNA 3COJA 4I6GA 1CLEA 2AF3C 4D4MA 2AB0A 2PUHA 3VJKA 5BURA 4AJ4A 4EG1A 2AKEA 2XCRB 3A6PC 1NPYA 2QN3A 1AUQA 4C89A 2JLYA 4JZYA 3EC7A 3ZY6A 2O8VA 3RU9A 3ZXYA 1EAYA 4BNTA 1L5VA 1EHIA 3IT1A 3NOOA 5F1OA 2KJQA 5LQDA 2C59A 3K2QA 1QX4A 4U7GA 3UNXA 2VT6A 4WXMA 3RS7A 1XYVA 4F9TA 5EMHA 2IYRA 1KWGA 5HCIA 3ZQUA 1J7KA 4AVYA 5C3UA 3EOZA 1K7SN 1YUMA 2J41A 3ZK7A 1T6BY 3FMGA 4LE1A 4XZ3A 1VBNA 2PD4A 2R8EA 3K94A 4IHJF 3MCZA 4L4XA 3VDXA 2R65A 1BGWA 2WLTA 1SXJC 3W90A 3HHPA 5DX0A 3TZEA 4CLXA 1W52X 3U81A 2OENG 1UP4A 3I83A 4E0BA 5CD1A 2P9EA 3QIAA 4R1OA 1K89A 1BW9B 3HM9A 2FMKA 1SKMA 2JARA 2ZYIA 1NF8A 3DDSA 3WJ1A 2PUGA 4Y1EA 3T3IA 1NDQA 2FR1A 3KSBC 4JSTA 1I6KA 4P7JA 3CZCA 2XA1A 4Y2PA 1H1LB 1VECA 4OA5A 3WHPA 2Y1OA 2WTBA 4IGAA 3IEVA 3ZHZA 2YOGA 1VI6A 1S7GA 2HRDA 5EIAA 1Y48E 3VTZA 3EDQA 4OJQA 2F3UA 2PXCA 1RQLA 2JKYA 3T1TA 4O4HA 1YQ9A 4BFCA 3G89A 4HDKA 4K0RA 3DL2A 1BS2A 2I1QA 4IG4A 2JIZA 2DG2A 1Y9AA 4JJGA 1UEIA 1PJZA 2QUJA 4HLUA 4S35A 3DB1A 4ZARA 1KP2A 1T5LA 3NHAA 3NRCA 3UAXA 5LU9A 2PSHA 4DR6B 1L7AA 1X7YB 2VFAA 2RC5A 3JY6A 4L5JA 4RVNA 3WYNA 1P5HA 1H1DA 3ORSA 1CUUA 1ND6A 2PX6A 3ASUA 4LV6A 1QKIA 2ZGVA 3D5QA 1OAOA 4R0NA 1S2DA 4MUAA 3T95A 5BNZA 4DR3B 2CNNA 2VOJA 3WLKX 1RMYA 1XJWA 2W2LD 5KYYA 3LDGA 4M9XA 1ZW6A 1HDRA 2VDLB 2WU4A 2ZI7A 2ZWIA 3M81A 1IZ8A 2OLEA 3MGKA 4M0KA 3IUBA 3TFWA 2H4HA 2N75A 3WLLA 2BI8A 5KYGA 1G38A 4XVQA 5EKSA 3GP8A 1N6NA 3LX4A 4LMPA 1X87A 3NBYC 1M0SA 1SG9A 1Q21A 3A26A 5WRFA 3WFZA 4HB3A 3REQA 1AK1A 1EVQA 1U7DA 3KPJA 4O3FA 3QG5A 4UHKA 5DHTA 4TYWA 4XWTA 1EM8B 5C5CA 1HEYA 1RAHA 2IXTA 5MHTA 3ZCTA 2ZRGA 2E48A 3L7DA 3MCWA 3N75A 3DMYA 4KNWA 1D2AA 4P1ZA 3TKYA 4XRGA 2R1UA 4Q4HB 1P4RA 3DBOB 2BKUA 4CM4B 3TRKA 5IWCA 2NTYC 4RYLA 2O8DA 4QOSA 3JV7A 2P4EA 5HX7A 1P1IA 5JZ9A 3BKXA 5DNEA 5LJIA 4IL5A 3TTXA 1K2WA 3FNIA 3MTAA 4PEVA 2JIDA 4D9GA 2CHGA 1KAMA 1P2DA 3KKMA 1OWMA 2JA2A 2W98A 5E9QA 3GP3A 2C5HA 4P82A 5B1IA 4DMHA 5LDHA 3QU4A 5DRYA 4D4IA 4HDSA 1RM4A 2OM6A 4LHWA 1DLJA 3IBFA 2WHRA 1RKUA 3VO8A 5F35A 1U2SA 4RV5A 3WGUA 4B45A 1IN8A 2Q4RA 1OTHA 3BCSA 1M8GA 3KQTA 1G4AE 3PVCA 4XI9A 1W0KA 1DG1G 4EAQA 3ESQA 3Q10A 3VR4A 6ADHA 3TLYA 3A4VA 4R5HA 4DCUA 3KHSA 4XE5A 4B3XA 2VXBA 4N0QA 5C4GB 4AJ9A 5K2OA 5AKJA 1Z62A 3H7IA 4YI3A 1QF9A 1WCIB 3HPRA 3LP5A 5CVVA 1FZTA 1T1EA 4J16A 4DQUA 4GG1A 3OCVA 3ZZNA 5JYEA 2OFFA 4N7RA 1FFWA 4ND7A 3T6KA 3V3KA 1OX5A 1X7DA 4BNJA 5KYYB 3PE6A 5G02A 3QK7A 1XGKA 1V4VA 4LG1A 2VRCA 1ULTA 2GJSA 3MILA 4TYQA 2REQB 1DV2A 5DM4A 2JGRA 2QLTA 2FPWA 5DM1A 4IXNA 3AVXA 1HE3A 1YZQA 2N0SA 3OY7A 3F8WA 3A8TA 3QVGB 4P22A 5AJHA 5E8JA 4RULA 2VHWA 1R1DA 2Z98A 2GZSA 1ZCJA 1IY9A 2WFZA 1IY0A 3ICOA 1D4ZA 1IWOA 3UKDA 3G2JA 4OH1A 5C51B 3PS9A 2E9SA 3Q1KA 3SS7X 3QUTA 1UMDB 3CKKA 3PDIB 2O8DB 1SU8A 3K8OE 1H94A 3S2EA 1XD9A 1JEDA 2B1QA 1Y3IA 1Y8QB 3HJUA 3UPUA 2O7SA 4JV5B 5LPNA 2AK2A 1GNRA 2YZKA 5ADWA 3AVTA 3QSGA 5AK4A 1G8JA 5TPWA 2JAHA 2F17A 1HT2E 1Z08A 2Q9UA 3CURA 4UXIA 3GFOA 1I3CA 2REXB 4JJ8A 4P36A 2EFDB 3WIOA 2VBIA 4IIBA 1ORHA 2IWHA 3SJCA 2A5JA 5B1YA 3UXMA 4DT1B 2EYUA 3RVDA 3PNYA 2FOIA 2IPNA 2MOKA 4DRYA 5IVIA 4AM8A 2G36A 2NVWA 2PDAA 4GBED 1SUBA 5MDHA 4Y8VA 1IMJA 3IEUA 4HQFA 4L3WA 4EB3A 2EKDA 3TR6A 3FDXA 1DAMA 3G1TA 1WXHA 4ZVOA 3S8MA 2PJUA 4H7HA 4J0EA 4TZ6A 4WXPA 5JZMA 1RYZA 1E6LA 1JR3E 1XXLA 2GJ4A 1E66A 1O6ZA 2QL5A 2YJ3A 2G70A 1J8MF 3S55A 3R5JA 1LDEA 1ZZEA 4FILA 5BR4A 1S89A 5AI9A 2QTZA 3WK4A 2D5BA 3Q7QA 1MFPA 5L3QA 5FOQA 4FDAA 3AJ9A 4Z3OA 1YOVB 3L82B 3ZVMA 5T8KC 2JD2A 1UM9B 2NSDA 4QJBA 1E62A 1P1RA 3HSYA 3X1KA 5H80A 1T9CA 4R7TA 5TQJA 2XOKD 4IV0A 5JNUA 1CU1A 4LYGA 1NV8A 1KK0A 1PU2A 5FOVA 5BQXA 3AR4A 1UJMA 2HA6A 1E96A 2WE7A 1P8JA 5G0WA 4JXJA 3HCEA 4W4TA 2Y66A 3C3AA 2Q5JA 3PUKA 4ZT4A 3SOZA 2J6IA 5C1PA 5CFPA 1ULBA 3QV1A 4C0SA 1J99A 3FJ1A 3L4BC 3T5PA 2GPBA 2YY5A 4PQYA 4ITRC 4ZICA 4ISCA 1SELA 4WINA 1X15A 3DHNA 2YNMD 3HJHA 4Y7DA 1SGWA 1FTYA 3QPVA 3SDSA 3NGXA 3TW4A 3T3OA 5KNCD 1TMYA 3BH0A 3QPWA 2GAAA 2DUWA 3DFFA 2HCFA 4OLJA 4FFDA 3RJMA 5BWOA 3L84A 4C7KA 1RJFA 3FWYA 1P1JA 1SIUA 1DBQA 4QFDA 3O1IC 4PZ9A 4LYDA 4TMKA 4WX2B 3VO2A 1I36A 1Z8FA 4A26A 4HWTA 1W19A 1ZD9A 1AS0A 1MOSA 2C2ZA 1N5MA 2GD6A 1G8PA 1ZI9A 2HA4A 3IT2A 5FJJA 5HOQA 2OL4A 3ONFA 1PNVA 1TKAA 4X91A 1F20A 2RFLA 3N74A 1FVOA 4Y9SA 1I4EB 3IESA 2NTNA 2AKAB 3ZV3A 4MWBA 3ZCUA 5TB5A 3T7SA 4BJHB 3I8XA 3WTCA 3NTQA 1OPXA 3ZU2A 1SUWA 5CFMA 2WVAA 4Z8YA 1NGSA 3ZH2A 3KEQA 3TOXA 4MKIA 4KDRA 3FOBA 5H68A 2XB4A 3WBFA 4F2HA 1PJRA 5HXAA 3ZS9A 1AQJA 1TNDA 4OQZA 1AUXA 3I0ZA 2BOVA 2RE8A 1P4GA 5AW9A 1YIAA 2VXOA 4PSVA 3O8DA 3QLEA 4HZIA 3I73A 2QTNA 3EGWA 2W0MA 3ZI4A 4IXDA 3NLLA 4YEDA 1XNRB 3BMOB 5HF6A 4FFWA 4EW2A 4YIHA 1SBCA 2H8KA 4NYMQ 3FIUA 4ES6A 5EJ5A 3GGCA 2NO4A 2XYRA 4M7WA 4QU5A 4W9NC 4W6QA 5TLSA 2R6FA 3EG9A 1FE8A 3BWEA 3FCAA 4DB2A 5CT6A 4RQAA 2QN1A 3CLUC 3BDIA 3RGWS 2JFXA 1M1ZA 1PJTA 2HMAA 2HK7A 4UEQA 1RWXA 1L5MA 4HXGA 4O29A 1EP3B 4UHHA 3UCEA 4KN5A 1XX6A 2J3MA 2YIVX 1FQWA 3A04A 3GRUA 3NBKA 4OJYA 1BHO1 1UPCA 4R2XA 4TMXA 2B1IA 4J3NA 1LSOA 5K0FA 1OTYA 3EZ7A 2P5YA 3R09A 4RVHA 3NOQA 4JYAB 2J46A 1V45E 2VQ6A 4IIXA 2AI1A 4WOKA 1C9DB 5ITWA 3QMMA 4DSZA 3LD9A 2FMHA 3NT2A 4O3MA 3R0IA 1C3OA 4RJKA 4LZAA 1PVOA 3A9VA 5H5JA 2N42A 4HAZA 3VOBA 5KJ1A 1JFSA 1D2HA 1GD1O 1U31A 1T0BA 3FPAA 3AVVA 3BIXA 3FHCB 1PK7A 1L7PA 1KJJA 3ESZA 3JSXA 1RLTA 2J7PD 4FD2A 2FN4A 2O07A 2VJOA 2H6EA 2BP7B 5BSMA 3A3NA 1RIFA 1WB6A 3FH0A 3RC2A 2B1JA 3G88A 4KXQA 1MAHA 2DCMA 4MUMA 4AIRA 1XYYA 1JHYA 1XVAA 2H1HA 1P2GA 4QGBA 3EGEA 3DZGA 3BXZA 4IOJA 3K0SA 4XGIA 1F6DA 2Z9BA 5IANA 1J9GA 1PUJA 5CTAA 1J0EA 1PTKA 2GA9A 4UREA 1P7ZA 4YRLA 3MWGA 4B7XA 3UF0A 4WDQA 4JJ7A 4KR7A 4BEWA 3TTVA 7MDHA 1QGED 2FWIA 3ZDXB 4CM8A 5HUJA 2F8SA 4KFUA 1NXTA 1J23A 3EE6A 2J5RA 3EIXA 3EOAI 5A1JA 2AEEA 2OT3B 5HPYB 1MVOA 1OBCA 4M8NE 4MWTA 1MC1A 2LVBA 5EI5A 3HDJA 4HVTA 3T1YB 3CNQS 3TIVA 1SVLA 3DEHA 3I1YA 2EV9A 3LPAA 2R85A 4HEA1 5IK2D 2RHCA 4S2EA 5CEFA 3RK0A 1T9AA 1UQTA 3U3OA 1L7RA 3GUYA 1ZUNA 2EGHA 5LYYA 4RSMA 2NNWB 1R8JA 1XCBA 4R6WA 4RZXA 4E94A 5IT4A 1RC0A 1TFRA 3RUFA 4ESEA 5IH7A 1U1EA 1KI4A 2XUKA 3DTYA 5EIFA 4LF9B 1XKTA 4K9OA 2DVMA 4KR0A 2ETXA 2O20A 4INAA 1MX5A 1EP9A 1R37A 3AFGA 3T99A 1LI7A 2VJBA 5GM2A 3RJ9A 5HQTA 1VHDA 2P6UA 4F2DA 3IDFA 2XUIA 4PPFA 4GNRA 1E32A 1JQJC 2YXLA 4UUBA 3FNBA 4AG6A 5A9RA 5IUNC 5IVHA 3EK2A 2Q27A 5A7HA 3WJ7A 4Q6WA 2B4KA 2QIPA 1Q84A 1MQSA 3BIFA 3KB2A 3LY7A 1WHSA 1MEOA 4M38A 1VC2A 2WU8A 3ON5A 3DE6X 4OOFA 4PYRA 1V5WA 5ALKA 1T3TA 3IP9A 5BN5A 4DA7A 1U5BB 3BBLA 5EHQA 2V03A 3WGVA 1FP6A 1SZPA 1ND5A 2OG1A 2O5EA 3LL7A 3ES9A 3JAMA 4FONA 4MA5A 4KLCA 2G82A 2C4UA 2Y05A 1HH4A 4DLSA 4UQLA 2SKDA 2PUCA 4DG9A 4G0ZA 1U0TA 3DTTA 4IDOA 1AQ6A 2D1TA 4N8SA 1WUIS 3F73A 1LTQA 4GBGA 2X14A 4M7PA 1OBVA 1YFKA 1DQPA 1L4MA 2X6RA 4FX5A 5DN9A 2IYNA 2GN0A 5EIBD 2GBGA 1IHPA 2F1RA 1CEEA 2YZNA 3I5YA 3N86A 1HDOA 4V1CI 2EDAA 5TNXA 3JWEA 4B80A 4DCPA 5KNCH 1YULA 3ETLA 3T7TA 5FNVF 4DJFC 3AR6A 4DJJA 3K71B 1ZUNB 4JX8A 4J1TC 4D4JA 4EKGA 1KAHA 3RRZA 2UYCA 2HT1A 4L74A 1VRCA 2NMVA 5CVTA 3KWJA 3DAFA 4CCSA 4XYBA 1D4OA 3ZGYA 1DRUA 1RYYA 4L1KA 3LKBA 3HBAA 2WU3A 2Y0PA 2BN4A 3MHTA 1TW3A 3D1LA 1IZ0A 1LBSA 4YLEA 5G0SA 3B3QA 1MGPA 1V48A 3CX6A 3EDOA 4RHTA 2WWVD 1MC8A 3T3HA 5AW2A 1EUQA 1TAUA 2Q2OA 2QTLA 3IMEA 1RQNA 4K6CA 3IMGA 4MQFA 2IYVA 5JAQA 4U9UA 1G1MA 1QCCA 3BE5A 3KQPA 4HXEB 3H1TA 2C7OA 1DQRA 4RPIA 3DMRA 2D74A 3TLEA 2GN1A 5HA5A 1ZXXA 4QHSA 1G6HA 1WHSB 2OXIA 3RWMB 2Q45A 4U2FA 2WA2A 4LRXA 4BIMA 3ABSB 1TM1E 3ELDA 1ZGHA 1U1GA 3MT9A 4NBKA 5FNZA 1I10A 5ELLA 4ZEOA 5BN5B 4JP2A 4EYKA 3ZI7A 4L78A 4B0PA 4PYJA 4LNHA 5TMPA 1VKJA 1ZSVA 4U5XA 2WYUA 4JB0A 3GT7A 4LYFA 1Q0QA 2V98A 3HB7A 1Z33A 2IEDA 1PZEA 3PSHA 1QQAA 4YDSA 4ZHQA 3OZUA 3PLRA 5C8VA 1NYQA 3IURA 2Z5VA 3CA8A 3N05A 4RKWA 4X62B 2YZ2A 3AF3A 4BB9A 3Q7EA 1C9MA 1TD1A 2XGSA 1PO7A 1WU7A 3SYLA 1XDBA 3PV0A 3A9SA 1HMPA 1EJ2A 3RYFA 4A82A 4DARA 5AVXA 1J25A 1TVCA 2KBEA 4AMZA 1XTBA 3DEZA 2O3RA 5LNK6 1CVRA 2QKYA 1DV1A 1LRJA 3UFXB 1ZQ1A 1IOVA 4CUJA 4KACA 3SSOA 4OQ4A 1P1KA 3TLZA 5EAIA 5A4IS 2Q3EA 1JKMA 5IM4A 1U8AA 3O8CA 5BSUA 4EJFA 1QO0A 1KAOA 3JRWA 4FE4A 5JI2E 5C7OO 1VIMA 2A9RA 5LUAA 1V3QE 2Q3MA 1BCSB 4I1UA 2DSTA 1YBVA 2XW6A 4M0PA 4E5YA 1PEYA 1I33A 2YW2A 4PPYA 4EF6A 3E53A 1XPRA 2NSYA 3E2PA 5LP1A 4I5EA 3DFMA 1KJQA 2JIMA 1LBTA 3F3MA 3HUDA 3BWBA 2RI0A 1CY7A 2NYRA 3O4VA 3WL8A 2C78A 4XJXA 4F4JA 5CITA 4U7FA 5HNKA 1CE8A 3HS3A 2C3PA 4D2IA 2WFAA 1I6LA 4Q24A 4A8JA 5J23A 4EHAA 2EKLA 3PA6A 3QY0A 1XZGA 1YSCA 2PU7A 2DLDA 2W43A 2ZTLA 2A9KA 4G89A 3WIVA 5JVDA 1BMFA 1X7HA 2AJDA 2HREA 1AO0A 2BM8A 4ZAGA 4RH3A 5CDSA 1ONSA 4RD3A 3N0WA 4MGIR 4DR7B 1Z12A 4E08A 1W4RA 3EAGA 1ZL0A 1SHJA 3D7RA 5JD5A 4JYMA 5K8JB 4GFDA 1G17A 3GG2A 5FORA 2R4QA 4L4YA 2G09A 1QH0A 4WBXC 2VTBA 1NRIA 2V7TA 4DC9A 3EIFA 4C6HA 1KEKA 1F0PA 4P93A 3K9GA 1SMKA 3IULA 2IYTA 3LPMA 1A95A 4HX2A 3TQIA 1HKHA 1T4BA 2HJHA 4XWKA 4KU4A 1HNNA 2CLLB 1AG9A 5AO9A 2V0GA 3G7NA 9LDTA 3VM6A 1ZVMA 3BILA 2FDXA 3MJRA 2ZS7A 4HEQA 3IDOA 1V1RA 2OAQ1 2IYEA 3N2LA 1AOXA 1U5AA 1NTOA 2FPPB 2ZR0A 3F6EX 4LCEA 3WMEA 3JQCA 1DIOB 2IHTA 3ZDAA 1U9YA 2OAEA 4QREA 1CNMA 3OCUA 1DBPA 4QNMA 4ZYWA 5E7IA 3W5CA 2R96A 3BJMA 3ISTA 3FSGD 3Q1LA 4KIGA 1Z4IA 2ORIA 4N0MA 4ND5A 1XTRA 4OFWA 4KXMA 4CI0B 3LVFO 4G3XA 1CE8B 1NUPA 2PX8A 3UJ9A 2GUWA 2XYPA 3MLBA 3LGSA 4IDHA 2B69A 1NW4A 3U4GA 5MGBA 3F5MA 5JPIA 2XVZA 3ZXIA 2J9ZB 4XPIA 4LDNA 1X70A 3DOHA 3EZLA 1JG7A 2FPXA 2A0UA 3GEBA 2QGZA 4FGZA 1YBAA 4JEIA 1OXMA 5D01A 5B37A 3TPZA 4ZJZA 1FYEA 1WF3A 1OD6A 3KQHA 1UJBA 1EFAA 2HJSA 3SGLA 2QPTA 3EPJA 3L49A 1C3JA 2I8CA 4GBJA 3F4BA 4BZWA 1EXVA 2V3CC 2Q6KA 1E9RA 1IUNA 2H29A 2ZSBA 1MV5A 3H97A 4YQZA 4DMGA 1HE5A 1U8UA 1XQXA 4ROSA 4TS1A 4BNMA 3C1AA 2QRPA 1KXZA 2I66A 5MN6A 2O0HA 2R8RA 3ZWYA 3DL0A 2GEJA 3AU8A 3WFJA 4HC4A 3UWKA 3ICQB 3LHSA 4LA4A 2W6IA 2JHAA 5I9SA 1XNGA 3KOOA 3JTMA 2IV7A 4UBJA 1AGNA 1E2JA 3D6FA 5IVDA 2IF0A 1SUSA 1XAGA 2OCLA 3ND7A 4TWRA 5JSZA 1AA9A 5ALZA 1L2TA 4YJDA 4XCQA 3VHRA 4OUDA 4G0WA 4UZSA 5LC1A 2ATVA 5JAZA 1R18A 3K5HA 5DDIP 4G0QA 3RFUA 2HSZA 3GT0A 4BEBA 3IHWA 4YHHB 2XVMA 1TU4A 4DTCA 2EU8A 4QLOA 5JATA 2NT3A 1JL3A 3ELUA 1HT1E 3K8QA 4RMGA 3SQMA 4X20B 4PGMA 1CEQA 1W87A 4OLFA 4DS3A 4MB6A 1OLXA 3IRVA 4XLZA 2V7UA 5H9WA 3B6EA 1SURA 4L9SA 3T9AA 1ZGBA 1XN4A 3KO8A 4V38A 1G98A 3M6XA 3OETA 4M9QA 1G1AA 4Q3OA 4YMIA 2WHXA 4AYTA 4QZVA 5U9CA 5GV8A 2B30A 2GCGA 1EESA 3GQBA 1RZRA 2PUTA 2OB2A 1TJ5A 2JJ2D 2NTEA 2JFNA 3WQQA 5DM70 2FW9A 1ESEA 1B0AA 1DG9A 3D3QA 2VR1A 4K88A 5AHOA 4LF5B 1G6KA 4O4JF 2OC4A 5GZ3A 4NP6A 1YH3A 1QVAA 4Z3KA 3ROZA 2VPWA 1HL3A 3AFIA 5EPUA 2XB2A 4J1SA 5F2NA 2WQ7A 1V8FA 3B8HA 1P7CA 2CY0A 1ONNA 3I9NA 3M1LA 1GADO 4QRHA 3TIIA 2IXDA 5AW6A 5JXIA 3K1AB 2G06A 2JLVA 2YDYA 2ZB7A 3N6RA 2BHTA 1ZYUA 5AM2A 5BN1A 1S01A 3OZDA 1JDSA 2QG4A 3QU9A 4HV4A 4PZDA 2JHPA 2ZZMA 1W9MA 3T5AA 2PNJA 3F9RA 1ZEMA 4M4SA 2DH6A 3TF5A 4EDFA 4NU0A 2VJKA 2P2NA 1ZA2A 4B6QA 2O1SA 2WZBA 2AHRA 4NZMA 3GUHA 1P60A 3P94A 4W7IA 3OU6A 4PX5A 1ZN7A 5EJEA 2XBLA 2HEGA 4EFNA 3CN9A 2VP0A 2GYWA 3I2YX 1J8YF 4ZALA 4BUJA 3OSZA 2QSUA 3P0FA 3C7CB 4UCFA 4GLBA 3TQOA 2XRMA 2VBCA 2EGUA 1DPGA 2YWDA 1OLXB 4YCJA 3ZW9A 1K6EA 3BWYA 3DAYA 4KIWA 1XT6A 4MVYA 3PPWA 4OYLA 1XEXB 4M1KA 4F84A 5AM5A 2ZIFA 3FAKA 5ITVA 3QKUA 3DF7A 3KP1A 3IERA 4CNQA 2OVBA 4O2LA 1M2HA 1NXVA 1QS0A 2YMMA 4U5QA 5CT8A 3IVCA 4EA7A 3IP5A 1YQDA 3BWXA 3KIPA 5K0TA 1PKEA 1JHUA 1LSUA 3CLRD 4WMLA 1RJEA 2BGLA 4RZHA 4TYPA 4YAFA 2ZIZA 5DWDA 4BMXA 3X2FA 4ECAA 2WFLB 4HBZA 1ZHFA 1J09A 2DWPA 5IBCA 5EEGA 1DIAA 3QHAA 4AJNA 2JEYA 3H7AA 1QTQA 2BTQA 4FFPA 2L0XA 2OGWA 2YICA 4DDHA 5LOVB 1Z06A 4J75A 4UARA 5DBEX 1E3TA 3CR3C 3T3PB 1BG6A 1YR6A 4YFYA 5K4HA 3AXSA 4HLUC 3R9WA 4DSAA 2PUBA 4WASA 4UAVA 2LE0A 5ULLA 2C5FA 1F7UA 3KJIA 1D6JA 1WULS 2VJMB 4I5GA 4TS4A 1NXQA 2HU7A 1XG5A 5GTDA 5HS6A 4CR7A 2X0RA 3I28A 4UHBA 4UU7A 1M6NA 1W96A 1KY2A 2X1LA 3EF1A 2PKRA 4F6RB 1XFAA 4OLBA 1W4BA 4G0PA 4J0IA 4H7JA 2QRMA 3NHBA 3DOUA 3IJRA 4LJ8A 1SQ5A 4Z5XA 1TM4E 1XUOA 4GEGA 1ISFA 3M7IA 1QYIA 3S1AB 1M0WA 3HCWA 2Z0MA 3TI7A 3UH0A 2HH9A 2JAUA 3WGYA 1DQSA 3MYRA 4HWPA 4TRMA 2WOJA 5BQ3A 3LNCA 3DV0A 2E6KA 4FBLA 1STOA 1ZVKA 1QS0B 2A94A 4H7EA 4JNKA 2WMDA 1KU6A 1QMGA 4X7MA 2BYTA 3KZNA 4H1TA 4QJ3A 1DEXA 1YRBA 4AXXA 4ZAXA 4Z54A 2CV1A 2IPOA 2JLZA 4BFYA 4FHZA 1IE3A 1G7CA 5EXSA 2BUBA 3GY0A 2Q2WA 2A9OA 3JSAA 1KDPA 1N9KA 4L85A 1JJ7A 1IATA 2X40A 3B5JA 1R0BA 4Q3LA 4AY5A 5BXQC 4M9SA 3CZQA 1H9CA 1ZJ4A 5FI5A 2G9VA 4QG7A 1NNUA 4Y1GA 3E7XA 5ECGC 2IS1A 2BTQB 2Y3IA 5CLIA 3FDZA 3FHLA 3L4SO 4AQDA 4CIWA 4ZMBA 1KRWA 4KMRA 4F4CA 3LVBA 1ECJA 1Z6YA 3GYGA 4KIUA 3PL5A 2DYKA 4CKBA 4DGSA 4LPSA 1FZQA 3LUJA 1MVNA 2Y76A 3TQCA 4DBLE 1ZH0A 2C83A 5JV5A 5IVKA 3VVCA 3MJ4A 4MO2A 1NQTA 2RHLA 4J16C 16PKA 3TL3A 5JY6A 1GTG1 3JPYA 3U9LA 2E0IA 4OHZA 1U28A 3VSBA 4Q7MB 2P30A 4AMVA 4FYIA 5KVSA 2XADA 3D8UA 2WICA 4RF5A 1W5BA 2FVXA 3LY5A 3OBBA 4DBZA 5FDFA 3M49A 3DDHA 3DE2X 1Z4PX 1YKFA 3JAWB 2VK4A 2PY6A 4BPBA 4E07A 3OCZA 3SFVA 1N6OA 3BMCA 5FI1B 3S2GA 3ZIAA 2DY1A 5MFPA 3F6SA 4TZTA 3O5AA 2DULA 3LL4A 2EFEB 4F91B 3DV0B 3EWSA 3H5LA 4PIMA 1NKSA 4BTLA 5L40A 4UNNA 3BULA 3F1KA 1JEJA 1FY2A 1E8DA 1YTLA 1W75A 1L7VC 2ZBGA 3UUWA 5H3LA 1ENZA 5KJCA 4EHDA 1JQKA 3FLBA 2FFHA 1ULAA 1TJ4A 5CAEA 5ALRA 5C34B 2QY6A 2XRZA 4TQUS 1NR1A 4N12A 3WAGA 1WZNA 2G72A 2Q4BA 4N9WA 3LHDA 4TV8A 4AMGA 5L3VA 1O0CA 1RVDA 2F48A 1UBEA 3IBCA 1NBME 1UZLA 5CK5A 3O1LA 5KSOA 5L6LB 3FDZB 2D62A 2NM0A 3BFKA 5CEEA 5DHQA 3ECAA 4KNVA 4PZYA 2ZUVA 2JFWA 6REQA 5HBRA 2XE4A 1GZ7A 3GXBA 2GLTA 3NV7A 4IX1A 3WGGA 1N3YA 1V25A 4BP1A 3T4XA 2JI9A 1KVRA 3BTOA 3EWIA 3IKLA 3IOEA 1OYYA 4R98A 4WOCA 3VYUB 3G3EA 1CKEA 1JQLB 2C1XA 3NXKA 2OG2A 2QLNA 2D7CA 4HS9A 5AKXA 4YCNA 1VYUA 3A6LA 3ID6C 4TS3A 1C8KA 2R00A 3OI7A 1IOLA 1M8PA 1YA4A 3RF7A 3HB1A 5JNLA 4HG2A 5P8WA 2BEKA 2RCYA 4LYYA 3T3MB 1IM8A 5K3AA 3BPSA 1GRVA 1NVWQ 2DQYA 1QB7A 2C4TA 4N4AA 4FDLA 3N2KB 1K86A 3BMCB 1AKNA 3OJCA 1K97A 5NULA 4JQSA 3AJRA 4POOA 3ZQ4A 3P4XA 2XYHA 3BIJA 2OHJA 2VCHA 2Y93A 1DKRA 1PG0A 1UBOS 1Q0PA 1LPNA 2XNDD 3KFVA 1B23P 5DVZA 4D46A 3LWDA 3BMQA 3AJEA 2Q3HA 1PFQA 2RGGA 3AINA 4KKVA 3C6BA 4BKQA 5HIKA 2EZ9A 4DY4A 2QW0X 1BHJA 2HA7A 3K0FB 4N3GA 3WMXA 3LUGA 3E58A 3FJOA 3RC1A 2YH2A 4D74A 1MENA 4AUKA 4FDVA 1USKA 3VR1A 3L6DA 3O4JA 1GA4A 1NC3A 2WJAA 2Y1DA 3E81A 1GZ6A 4Q21A 1FLNA 3VO1A 4OFXA 1OI3A 1RVV1 3U44A 1ZNQO 1P6UA 3WWYA 3U17A 4EM6A 5JJKA 5A71A 2F9MA 1SBHA 6REQB 3HO6A 4J29A 4L6CA 1M1UA 1H2EA 2PGOA 5IS2A 2NACA 3PTAA 3VKUA 4X6XA 1YIDA 1G21A 4GM0A 2AXQA 3LFTA 4C0KA 2WD7B 5ICEA 1UCFA 3QLUA 1SM4A 5HQ3A 2H16A 5IRCD 3DUWA 4NOKA 4M0CA 1KMQA 3L4JA 1HGXA 4E4RA 2MSCB 1XRJA 2FJ0A 3OIFA 1JR4A 2Z4RA 4J2HA 4D9KA 1NNLA 1A77A 4GI1A 3CW2A 2QZPA 2RAPA 4NONA 2QHXA 2P2GA 2BJWA 3BL8A 2PX0A 2JCBA 5T4HA 3HRIA 3LE8A 3R1IA 4ENSA 4HWOA 5DN6D 4H7IA 4ARIA 4WVFA 1N8SA 3GNQA 3S0JA 3ASVA 1T35A 3A1TA 1W4CA 1QH9A 5HIAA 2AE1A 2EBFX 3O8NA 2O14A 1AQIA 3EEBA 1T6YA 1T8PA 3PUZA 5DCYA 4L95C 4DXDA 4QD3A 5JYBA 5K3EA 1ZIYA 3MGCA 3NV9A 1Z5OA 3U3MA 1GQFA 3PGMA 4IDDA 2A14A 5G4LA 1EX1A 3M9XA 3BSSA 5GVSA 4LOAA 1L9XA 1D2CA 2R8ZA 2ZBFA 1E7SA 3M6IA 4R8SA 4CTJA 3P9CA 1QC5B 1KNQA 4JOQA 1JZTA 4JSYA 3U44B 5DW3A 1FNMA 4IO1A 3V7UA 1U1FA 2GKGA 3GWZA 4R9VA 3SX0A 1D2NA 2RGRA 1XQVA 4YQYA 1LUAA 2PBFA 4GQAA 4GW3A 4OQNA 1UPTA 2NU7B 2AF4C 3AR8A 7ABPA 2HRBA 2P4SA 4OYRA 3QU5A 1OT5A 2IOYA 4J0KA 1UFKA 3ZNPA 3OICA 1W59A 3UYLA 3V6LA 4EYOA 3E4CA 1YZKA 2YINC 1MUUA 10MHA 5FTKA 3BCRA 1Q5PA 2B7CA 3ETEA 1VPWA 1W44A 1ZD5A 1GPJA 3EQ6A 2BMEA 4X3PA 1TUBB 5E7QA 4B82A 1G7TA 2VHTA 421PA 4PG4A 3A3YA 1H2HA 4ZCRA 1B14A 2GVDC 2IOQA 5ALQA 5CNJA 4FGKA 4MS3A 1XQYA 3QVWA 4LJRA 1ODKA 2QVBA 1NAIA 4MP3A 4Q02A 3IQZA 1FLAA 1M3SA 4RS3A 3QI2A 2NO1A 4O2AA 2CEKA 2C42A 3NIGB 4KX5A 4H6WA 3F90A 2PZKA 3HA2A 2J87A 3L1KA 1DCKA 4RJLA 2JGLA 1JXMA 2WM8A 1XLTA 4A1OA 1Q22A 4BCCA 2XMZA 1NI4B 5L4SA 2XA9A 3LJKA 3IV6A 5C8YB 4ZXPA 3AZOA 1Z3CA 2E2WA 4U2BA 1NU8A 5COAA 1R0YA 3KEMA 1MA0A 4C0XA 4N5NA 1JZQA 1KA9H 4MGYR 1KY3A 5ALEA 1NG9A 4TWIA 4ILEA 3V33A 1VHTA 1DBIA 3JALA 1II8B 2ZE5A 5HIMA 4AG5A 4P4SB 1HDZA 5HZHA 2OLJA 2FU5C 4ZO8A 4DLPA 1KGDA 4GECA 3BD9A 1TQHA 4AMUA 1H8HD 5K9ZA 1CDZA 2B78A 2VNIA 3QPUA 4GUDA 1N8KA 4YQEA 1VBFA 2BKLA 2TRSB 2CHVA 2J4CA 4G5YA 2WAXA 5ALGA 4KR9A 3SXUB 1U0BB 1H3FA 2RGEA 3NIWA 4WFKA 5IYZF 3FD8A 4UOEA 3N0VA 3ZNOA 1T5IA 2CYAA 5ALOA 4ZVNA 1WPQA 4Z1MA 3RSQA 3WMRA 2FWMX 1PD1A 2VPZA 3DCIA 2M6SA 3CLHA 3NJ4A 4MS3B 3PK0A 3H65A 5DYWA 2D06A 2HHAA 3NHSA 4Y2HA 4ENVA 5AQ1A 3TSAA 3RROA 3UUEA 4CLHA 1MB9A 3WFIA 5CNMA 2BGMA 5BW5A 1TUGA 1KH3A 1N7IA 3ZZUA 5FLYA 2LR0A 1DADA 4O2AB 2BGNA 2X41A 4NEHB 2QPOA 4WACA 3R3VA 2DU8A 2NSLA 1F1JA 1U80A 2RKWA 5CK4A 4C7VA 1NXXA 2WKWA 2IP2A 1RAFA 2EG9A 2Y1CA 2ZYSA 1CHDA 4C7XA 5PNTA 1I4OA 1N77A 1SAYA 1YB7A 3GBPA 4B5KA 1E9EA 4R51A 4RQTA 2IELA 4B33A 2PQ2A 1P3JA 1SO8A 3PJDA 3ZJYA 2QL9A 5F1PA 4Q93A 1KARA 4DQVA 1MORA 2FEMA 2QU8A 3CF2A 4OXNA 1KWKA 3BTSA 5J5CA 3Q0IA 4KSYA 3H8SA 2VH1A 5B58T 2JIPA 3AEYA 4GQIA 1MX3A 1GTMA 3N6XA 1CEYA 3UBMA 5DMXA 5B2ZA 3DFIA 4L5CA 1A9YA 5B1HA 3R76A 4TRJA 1MGOA 1YNOA 1HNZB 3K6RA 1NBWB 2ZUSA 1SU4A 3EJ6A 2QLBA 3E1GA 4FWIB 4NYMR 5AVTA 4L4UA 4ANFA 4D0NA 2C9OA 3RHTA 1GFSA 4OCZA 1RTTA 4QVGA 4N82A 1YCHA 4YROA 3E2MA 5EFZA 5E3JA 1AIPA 3HCAA 2QZZA 4FLEA 3LBAA 5K0LA 1JMVA 3K1TA 2W7TA 4KXNA 3IAFA 4Q7QA 5CA1F 1ZESA 5HKKA 3UW3A 4KQFA 4WL0A 3V4PB 4E5DA 3ICWA 3V1MA 1DPFA 4MEBA 1JJIA 3QXJA 4PM4A 4UM9D 3ZWDA 3ZWKA 4K05A 1SKYB 1ID8A 1FYWA 4ID9A 3KDSE 5KOYA 1XF1A 3EMDA 3W6ZA 4BVKA 2QGNA 2J6CA 4HLQB 2QQ0A 4I99A 1WHTA 3FBTA 3O38A 4Q9JA 3V2UA 4PQRA 3OZBA 1N8NA 4QUJA 4DPMA 2PRSA 4CN9A 3B3FA 3ANSA 4CR6A 1AHPA 3INYA 1OI2A 3WZ2A 1IEXA 3FG9A 4DJEC 3JYOA 2CJXA 4ENQA 5ABPA 5J4LA 3ZHBA 5DLQC 2X1HA 3C70A 4WESB 1VKHA 2WJYA 2J9RA 1RYHA 1HYGA 1JNYA 3WGQA 1N6PA 3C7KA 5CA0B 5CLFA 1GZSA 1XVVA 3NC4A 6CHYA 3ICVA 1A4UA 4FNOA 2F1JA 2RDMA 2XMPA 5LQSA 1M2VA 3EGIA 1NRJB 1KDVA 3R9XA 5LZ8A 2G77B 5IFLA 3DAHA 1OLSA 2AOTB 1NXOA 5F64A 3AW9A 4LJAA 4XARA 4XASA 1E6WA 3PX3A 2XB9A 4I2NA 4B9EA 1E3LA 5F7XA 5DP1A 2HM7A 2OAP1 4PAOA 1CUWA 2UVPB 4ZQCB 3KCNA 4TKUB 1SULA 5EWJA 2W6ZA 5GQSA 2BT4A 4EUNA 3C3BA 1GU0A 4KZPA 4O4LF 4JK3A 4AWAA 4MVJA 1SHLA 5L3SB 2XMSA 5KDOA 2QTGA 1E2GA 1F48A 1WZCA 2MJLA 3GLKA 2GPNA 3UWOA 4YTEA 1OIVA 3VBEA 1L7EA 5FTNA 4BQPA 5BOSA 1D1SA 2IE8A 2R6ZA 2BW0A 1TVKA 4PAWA 2VZEA 4O2RA 2ZWOA 1XO1A 2OILA 1BC5A 4G8BA 3SSMA 4FR2A 2B5VA 3I0NA 4WCDA 3LIIA 1OZHA 4QUBA 5CCXA 3W5AA 3H17A 3BK7A 4B47A 3R7BA 2QBYB 3PD7A 4R9NA 1QVRA 3M70A 3OE1A 1QG4A 4NATA 3AVOA 5C81A 2ZYWX 4A8JC 1EUDA 1JTVA 2SKCA 1ZHHA 2BELA 2QRJA 3D59A 5IKEA 1XA0A 1LLCA 2Q2VA 3BWDD 2CNWA 1U2QA 2QSZA 1DEHA 5IF3A 1FSFA 3A2MA 3KL2A 3LI2A 5JWRA 1L7BA 3RSCA 1RPTA 3KG2A 5JJ5A 1ST3A 2RHTA 3O2NA 2JB9A 2W83A 4MI1A 3Q8XB 3OEED 3VV3A 3MJCA 1WQ3A 1GYPA 3A27A 3JQ8B 3PGJA 2BL4A 3F9IA 1OY1A 1NR7A 1W25A 4JLKA 2C9ZA 1E1NA 2I1LA 4JI1B 4YR9A 5BV7A 3GLUA 5E9JA 4GL4A 1DCFA 4HYTA 5FPSA 1C1HA 1GN9A 1OYWA 1KY5A 1XTJA 2H5IA 1USVA 2XE8A 4M8LA 3X1ZA 3KPUA 5AVUA 3OUZA 5HZGA 3BVPA 4JA0A 4F97A 4FDUA 4B3SB 3P0RA 1WY7A 3P27A 1JSCA 5EWJB 4P3YA 4YP6A 5T41A 1T1IA 4A10A 4JUIA 3UHPA 4IGIA 2ZDHA 2G9NA 2KB0A 2ONYA 3A6KA 3A6FA 3DC7A 5HS4A 5JSFA 1EUCA 1EFUA 1V8DA 1JXOA 1B00A 1P7YA 5B30A 4U6SA 4QHTA 4TQAA 2LCQA 5JNRA 2Y6UA 2WWWA 5JDIA 2L18A 3BJRA 2OB1A 1ZRSA 3GLFB 4UVEA 2WC1A 1C9EA 4A16A 5CB4F 3U7QA 5EL0A 3G9TA 1II9A 3A6HA 3OAAA 3CF4A 3UJDA 5IG2A 1JVBA 1L5GB 3MINA 2ZW9A 5CP8A 2C94A 3RF6A 1IRXA 1HYBA 3C24A 3IEPA 2Z8ZA 3CN7A 3WLNA 4F85A 1ZG3A 1GGMA 4F12A 5CLJA 2WT8A 2FYTA 1I3LA 4QUHA 1T2FA 4LXIA 3NOXA 2ZWAA 5CB8A 5FUMA 1YUNA 1T9GR 1G3RA 2ZCUA 2XUZA 4LK2A 5JRJA 2VP6A 3PXEA 4CEHA 4DLUA 3HYLA 2QWXA 1NW6A 3NETA 5DOVA 1DL5A 1XJ0A 2C9YA 3Q87B 2XCOA 3LWBA 4R81A 4XLTA 1XMJA 3AFMA 4WLNA 3FNGA 4YRKA 3TX2A 5JJBA 4CQNA 2G0NA 2PU5A 3OZ7A 1CSEE 3S68A 4C88A 2ZUFA 4Z9AA 4AYXA 2OSBA 2P7IA 2QL7A 2XX3A 1WXDA 2FLKA 3VR3D 3HYNA 3I1FA 4NL4H 2R5WA 3SIRA 1E2MA 4WGGA 5A2QA 4XJVA 4D4LA 3C3EA 4C4OA 1I2MA 3A9CA 4UVHA 1W5FA 1YZNA 1X0VA 3A7DA 4TLEA 2FMIA 1EUCB 1NASA 3AONB 4WADA 4OAPA 4MWEA 4YWHA 1BRMA 5B2FA 3RYTC 3ROEA 3ZHVA 4BMVA 1B0ZA 4GE3A 4BUZA 2OFOA 1QGDA 4Z7NB 3EXFB 3HCRA 4XTCS 5I6DA 3U7QB 1Q0UA 4EQ6A 4DLAA 2A1UA 1NVVQ 3QLVA 1Y7PA 4L75A 4I4TA 1I9GA 2IPXA 1LK5A 1TVEA 4P0PB 3CLTD 3T35A 3ONWA 1H0RA 1PQUA 3HP4A 2OTCA 3QXGA 4C0JA 5C32A 5SZHB 4EMTA 4M1YA 5KDDA 3M4XA 1OZ0A 3T06B 4MVJM 1Z0SA 3G2LA 5JADA 3O8QA 4IBOA 1A88A 4JGGA 1Q3KA 2OQRA 2I2XB 4F9EA 5TMEA 1FXWA 4CEHB 4URXR 2AZ4A 2VQDA 4W5WA 1X1SA 4MR9B 5IUKC 2X3YA 4YPVA 2WV9A 3JQ7A 1I1QB 3EC2A 3HWX1 3CRNA 4LUCA 1N2SA 3A6GA 4C1NA 2WLSA 2OBXA 3IQEA 2POCA 3GPDG 2LRHA 1QAQA 2B8JA 3BHIA 4IUYA 3O21A 4TWAA 2F8TA 2UYQA 4BN0A 4YP5A 2Z9DA 2IPMA 4OKIA 2EKZA 4CHGA 3GPCA 3JRXA 1KJWA 2YWEA 3N28A 1P2BA 1TX4B 1L5ZA 4MITA 1K5GA 4KO8A 3F1LA 3CZMA 5U1PA 5B3KA 4LAFA 1FSPA 1PX0A 4G41A 2EERA 2KI5A 5BT9A 2CMGA 1XU9A 1Y4UA 3HJGA 4X6YA 2QM3A 1WQ1R 4NY1A 2DBRA 1V4NA 3DBVO 2TMGA 2AJBA 3GT3A 1NUAA 4ZYLA 3V8PA 1LLUA 3BTUA 5DT9A 1GZ3A 4KFSA 3TFOA 1BZYA 1SN7A 3TGPA 3CO5A 1QDEA 5LXTB 3T0FA 1IWPB 2ZDQA 3WK5A 3PEYA 3NEAA 3PDWA 2GT1A 3CUWA 3NIBA 4M1WA 4MW0A 4Q05A 1DBSA 2R5FA 4O4HF 1ABBA 1L7XA 1U2ZA 3WC4A 3WKCA 4RGBA 3B6ZA 1IBKB 4LCBA 3ZCVA 1CJBA 4O5AA 4DCMA 1G63A 4B2PA 3QX3A 4OGFA 1GG9A 5DV9A 5ECWA 2QXYA 3TIGA 3SQXA 1SC9A 3LPCA 3F67A 4ZQHA 1IUOA 3FSJX 1Q0SA 3AR2A 4CIXA 1M67A 1YR2A 4UHJA 3URMA 4HX5A 5C1DA 2AR7A 4XUDA 5AKEA 4F56A 4CCYB 5CJJA 4TLLB 2CUZA 4RTOA 4N48A 2VBGA 3HL0A 1JHAA 2VJAA 1KK3A 3CKMA 4MKXA 4IMIB 5DLEA 3B13B 3ST7A 5I7UA 1PVDA 3OFND 1X39A 2P1RA 4DLBA 3SY8A 4LDJA 1EIZA 4UDYX 4RVOA 5CT4A 4CF6A 1E79A 4NZZA 6PFKA 3R3WA 3KJQA 2ZRKA 1UBHS 2Z5FA 2B7BA 2HTFA 3ZU4A 1EVJA 1HEIA 2Z3VA 2C2BA 5A7FA 2GK6A 4RNDB 1KZHA 3ESYA 4Z4GA 5FF9A 3WMGA 1DAOA 2PWZA 3HVIA 2DWOA 1B8VA 4HDRA 4CG1A 3PA8A 5KVCA 2HLDD 4WGFA 4LSZA 3RU7A 1JQDA 2MYUA 1K3FA 1AKQA 1QZTA 1HO3A 1QHFA 3QOYA 2Q8QA 4GDMA 4FK8A 4PLHA 5JCJA 1W94A 1XMXA 2I2FA 2XUQA 2A59A 2XT9A 1LW6E 3QWFA 5D84A 4EELA 3LQ2A 1N34B 4ID3A 4MRPA 4P7BA 4BZQA 2VPIA 3P2MA 3TECE 3DVQX 4P33A 1BVYF 2CCGA 2JDIA 2QIOA 4P7KA 3A4IA 5LFAA 2BFOA 3H5AA 4YMWA 3TCNA 3FE2A 5DYYA 4HDOB 3BM5A 2VXYA 3UMBA 2VHEA 4ZQFA 3P0EA 2AC2A 3QA3E 1JGTA 1M54A 1RAEA 2QPAA 2UYGA 4WWHA 2P4QA 2IUUA 2AXPA 2FZEA 2O2XA 3R24A 1OUMA 1C7JA 1EH5A 2JGMA 4RPGA 4TXHA 3WRVA 5CBPA 3A2NA 2F43A 2VSNA 3IUYA 3FMVA 1RXCA 1WLYA 2CGEA 1BD3A 1RPJA 4QATA 5DLYA 1W1UA 3LLUA 1VJGA 3AWIA 1F2VA 4J7CA 4LMRA 2GBCA 3KT8A 5ISMA 1XTIA 2ODBA 3MUEA 1R0WA 5KIAA 1EWTA 4WKBA 1W93A 3IMFA 3GFBA 1QIFA 1PJAA 4BNYA 4UUOA 2JCGA 4YV1A 2AQHA 5C5IA 1XXHA 5CH3A 4LXGA 3ADKA 1LJLA 3EXG1 1DEAA 4FB4A 3LRTA 1P0CA 3RS4A 4ZGGA 1AGYA 3KSDO 4G5FA 4HDRB 2YXBA 3ELYA 4RVDA 1QYRA 1C2TA 3C3DA 1K9SA 5K6AA 3Q8LA 1JFLA 1CW2B 4XAQA 3DLBA 2DLCX 3FNRA 4LOJA 1NJ6A 3LW8A 2ZUCA 2V59A 1V4BA 3GUCA 5MFZA 2G4VA 2G8LA 2X6QA 3K05A 4MGHA 5CJ2A 3VR5D 1KJNA 4RZSA 1U28C 4WFQA 1RWVA 1SB8A 1OV4A 5AI4A 5GINE 3L6UA 2COUA 4H3KB 2JI7A 3ZW7A 1UXJA 2P0AA 3GRYA 1W36B 3ROFA 2BM9A 1GL9B 1K7FB 1U3CA 2VF4X 3FCEA 4C6SA 5H3CA 4FINA 2VYFA 4IZHA 5J9FA 5CBPB 1LX7A 1ZY2A 3DOOA 1O0SA 1P39A 2WMYA 4I3GA 1XL0A 4R1NA 2H9IA 3AY7A 3KX2A 4PNZA 1CQWA 1RYMA 1Y3FE 1KKMA 4P5EA 1KZ7B 3TYXA 2H48A 2PGAA 4F4DA 2V7QD 3OEHA 3AY3A 1HM5A 1T6ZA 3FB1A 2YFKA 2ATCA 3SEFA 2CFIA 1FFSA 3GNTA 1H22A 5HBGA 3A2KA 4IV5A 1XXHB 1R9NA 3IJPA 3AJ8A 4Q37A 2ZG6A 1W34A 2CLEB 3F6PA 3OE4A 4HNHA 1M1NA 4HDNB 2YVLA 4D9JA 4EPTA 4I55A 1L4GA 4UJ5A 4DZZA 2QP4A 3OPVA 4ZYTA 3H8WA 2VDUE 1I14A 4Q1DA 2Y1EA 2CMDA 1UOOA 1QIIA 1YR3A 4WCVA 1QWOA 1EI9A 2JD0A 4G4JA 4XIIA 3EIWA 1MTZA 3ZCXA 5BW4A 3CVUA 2GM5A 2P3LA 3HFGA 4K9KA 5LZ5A 3DLAA 3M6VA 1KC1A 3OX3A 4IXMA 3TLKA 2Q5LA 1EDBA 3EFOA 4V39A 1SOVA 1PZXA 2XUDA 1XK7A 3EIHA 3H4IA 3ICCA 4H4CA 5EQFA 4YXWA 2BBWA 3OTIA 1YL7A 2R00C 2VK8A 2ZP1A 4LE2A 4BJ6A 2IEAA 1G8YA 5KQGA 2Z8XA 4UBOA 1ONOA 3PLAE 1NWHA 4MMYB 4WI1A 3FWZA 4D9BA 3GP5A 3K70D 4IFBA 3WYGA 3AV3A 3ADBA 2HFKA 1Y37A 2YS7A 1Y1KE 5FBWB 3TB4A 3NDBB 3BHJA 1J0BA 3NGMA 1TJYA 1P9OA 1QHNA 3KQKA 3CZAA 4KQ1A 3VO9A 2CLIB 2JGIA 1NG1A 1T43A 3RLFA 3CRQA 4WK4B 2O52A 2AFVA 3E5RA 4WLUA 5K8LA 3EGDB 1T91A 3PDUA 4RAOA 1C3XA 3T7KA 4G86A 1CFZA 4M86A 1HDCA 5FKJA 3IODA 4AZ3B 2KQUA 1FRZA 1UMBB 1ITZA 1S9DA 4UAGA 1E5QA 3ILSA 3JAKB 4NJOA 3DMHA 2CHEA 2W58A 1M1NB 2AJLI 2ZAYA 5F4BA 3TQRA 3WRXA 2EFJA 2CFOA 4EGJA 4YA6A 4I55B 1QHHB 1E9FA 2PPLA 3TW8A 2Y1XA 3OIUA 2R25B 1RKBA 1V47A 2MU1A 3KUXA 3CH5A 1XP8A 4CQMA 5EJIA 1CLUA 1W1IA 4FBMA 3L06A 1LZKA 2O2GA 2JBHA 2PR7A 3OT4A 2FVYA 3TUZC 3UJNA 2V6MA 1Y7TA 5JQGB 4UTRA 1BQ4A 1UPBA 2G1AA 1H2FA 3EFOB 3OP1A 3QLUC 1M6YA 2HMUA 5DBGA 5EY5B 3KQWA 4B2LA 2CMKA 2DBYA 2EL9A 1V6CA 1Y1SA 3LHIA 1E69A 3PX2A 4YJ3A 4FT4A 1PNQA 1LRKA 1MW9X 2AX4A 1JHQA 3BE4A 3UAYA 1EVIA 3HCCA 3IVAA 4KYIB 2OZLB 3EPRA 2HW8A 4Q34A 2G9UA 2IZ7A 2IV3A 2B8EA 4JXKA 4C0WA 4CM9A 2D0DA 1JXQA 1MQ8B 2EC5A 3W79A 4E7OA 2GF9A 3V4OA 1KJYA 1WXEA 3EBPA 4EG6A 2B21A 1VSVA 3U0VA 4ZVUA 5DH9A 2REOA 5ALDA 1NVFA 4D44A 5A06A 2YFQA 4IEEA 5BSKA 2VEDA 1H2RS 3C6MA 2PV7A 2RCNA 2VYVA 1QRDA 4RKRA 1J97A 1PLKA 5DNUA 1AN0A 4GU5A 5EMJA 5HG0A 3SJBA 2ZOSA 1I9CA 2ZJ6A 3JU3A 3NBQA 4V0SA 3EIEA 4DUPA 2PBZA 4KO4S 3ZQ6A 3FPJA 2Y68A 3KKQA 1MDFA 4BQNA 1ECCA 4E21A 4WE3A 3C3MA 2GSWA 3UTDA 1FUEA 3INNA 1NJGA 1OLUA 2BKXA 2DJ5A 4Z9FA 1W48A 3O0DA 3RUAA 1HQDA 2XTMA 5CHEA 1FX0A 3Q5DA 4TTPA 4U7TB 4CQMB 1Z0ZA 1PEKE 2J9FB 3T4EA 3EH1A 4H3SA 3WDMA 4D9CA 3G59A 4CKWA 1C0PA 3GGDA 1SEVA 4MEAA 5ALLA 2UZ3A 3CMCO 4UU1A 1SKYE 4CDNA 2EBUA 5E8RA 3ZGLA 4DWWA 3D6JA 3MJFA 1CRPA 1IBSA 3MZ0A 5F1KA 2H00A 1WMAA 1ENOA 4TSFD 5CEJA 3U6BA 1O08A 1W0JD 3OURA 2X4DA 5FTLA 4WLOA 3FKSA 3U4QA 1XBTA 4J49A 4QDZA 4YJ3B 4CGYA 4YP0A 3S99A 4Q4AA 3RRXA 2YYAA 5CFOA 3WNZA 1EXWA 4GI2A 1S3FA 2CSUA 4FFBB 4CLOB 1DC7A 1SY7A 2RB4A 3VR5H 5JE8A 4QGFA 4XFDA 2YL2A 3IA2A 1PJSA 2ERYA 1Y4AE 4TV9A 1YJ8A 2PZJA 4LZPA 3JQEA 4MVJP 1IMOA 4ZCTA 3TMKA 3BQ9A 3ZKWB 1NF2A 1UAGA 1XVIA 1QGUA 2VAMA 1JALA 2HU2A 1EVEA 3GLSA 4W7HA 1R4NA 2YIMA 1AURA 1QGYA 3ZY2A 3EGOA 3EQ2A 4PBTA 3HQ4O 3X43A 4RQBA 3CUSA 1ANKA 2C4WA 2GO1A 3EA4A 2A0FA 4MUGA 1H6DA 1QZUA 4TVOA 4EB6B 5C37A 3U7JA 1PLJA 2HYDA 2IBMA 3KQLA 1SIWA 3R7DA 3RI3A 4Y9UA 2HC9A 1P4AA 1HYQA 3D81A 3WGZA 4UTPA 3IPRA 3FGPA 5LQMA 3MAGA 4JAVC 4X6UA 1T0HB 4N47A 3RM3A 3UHJA 1FX0B 1OFVA 3WNDA 4AWXA 1ADBA 3VPAA 3OF5A 4NBUA 5EXPA 1V26A 1O58A 4G4SO 2EGGA 1JSXA 3OOHA 3GI1A 4WA7A 2XZOA 3I12A 1X38A 3K6SA 2P0YA 2XYQA 3WHIA 4LSMA 1NUSA 1G42A 4K03A 4BX8A 4QT4A 2V6BA 1MU0A 2AFRA 3ZYCA 1B8UA 3Q72A 1QQTA 1KYIA 2H2HA 4R40A 3U4QB 3JQQA 4NPHA 2GOYA 2X2EA 3BT7A 2CXHA 3VYRB 3UGTA 4A6EA 3T9EA 4Y2UA 1BN7A 1ISSA 1Z2CA 2HBYA 3GT4A 2OPHA 2H4XA 4ZANA 3W5JA 2JD1A 3QTTA 4Q4JA 1DKMA 2QD2A 1L5KA 3ZDRA 1Z17A 4TTTS 7GPBA 3B6JA 2CLKB 2BR5A 1OILA 1OWLA 4TV9B 2V7GA 4K46A 4RK0A 5IWAB 1GG8A 4U3JB 2ROQA 4S3MA 2C3UA 4L0DA 2G80A 4MR8A 5KNBA 1KI9A 1NMQA 1QGUB 2EXXA 4GD3Q 3PUXA 1MKYA 2H5EA 4V0NA 1X74A 3VV2A 3HO8A 1VE9A 1FMFA 1CY8A 2PMKA 3B6IA 3GZNA 2BBTA 4JI5B 2ACVA 2VAVA 1NN3A 3GJ4A 221PA 4FCCA 4ALJA 2NUTA 3ZNQA 1A69A 5EKUA 4BVHA 1IPEA 1O1YA 1WMDA 3FPBA 2XUHA 3GEEA 2IGTA 5AT1A 1TT7A 1VYTA 2VP3A 4M0UA 3RYHA 4RKYA 4I50B 1HFJA 3NB0A 4NS1A 4M1OA 5E1MA 3PUWA 2QSYA 1M2WA 1RXIA 5KTRA 2YTZA 4QUIA 4FCWA 4Z9YA 2O3UA 3WLEA 2OBLA 3L8GA 1ES9A 3WWPA 3GLFE 3C4JA 1JRLA 3OPXA 2ZI9A 1GXSA 4EF4A 1T2CA 4Q7LA 2IHUA 1YRYE 5P21A 1Q50A 3PYLA 5D3ZA 4CFZA 2H52A 1RZVA 2CKMA 3FCUB 4RS4A 3O6VA 4LYJA 5HF8A 4E2ZA 1LVUA 4J94A 5IXYA 3RYCA 1TKBA 1KPIA 4HRYA 5FBKA 2FZGA 4QQ8A 3ZLBA 1AKRA 4Q7KA 4B79A 4MV7A 1L1QA 5JMTA 3DE3X 5SV2A 1SD2A 2DOKA 4LJ6A 4S24A 3V46A 3EB9A 5F7ZA 4L08A 521PA 1B1AA 4KGXA 1TYAE 3QBEA 2Q99A 8AT1A 4DR5B 4NG4A 2ONKA 4P32A 1E2NA 4COOA 2QRNA 4I36A 3U7FB 1QE5A 3HJAA 2YV2A 1I13A 1Z68A 3IXQA 1E4OA 2Y27A 2Z95A 1XKQA 3N2EA 3Q40A 2HCTA 3VR2D 4AP6A 1KEWA 1W5SA 2YFHA 3DOEA 5DTIA 2JW5A 2FSPA 3W6NA 1TLFA 1IXYA 1IXSB 2Z6VA 3GOHA 3OESA 4OGKA 5IM4F 1S4QA 1NMZA 1RRVA 3VSDA 3PJEA 4FKZA 3MD9A 2ZANA 1RAIA 1RI5A 3HUFA 3VPGA 1O4VA 2RHBA 2QAIA 5BR7A 2FKAA 1IZ7A 3IS3A 2NUTB 3IV9A 3D02A 2C9MA 2Q3BA 2Q46A 1U9ZA 1KSHA 4L8VA 2ILVA 3HJNA 4O4IA 3FVTA 4YV7A 2Y0EA 1S2MA 1HQYE 3V8NA 1ZSNA 1NMYA 3R9KA 3HZRA 3NJRA 3SX2A 3I4LA 1J8VA 4RK6A 5IJ9B 4QYTA 5HTKA 3EASA 3B1YA 4XX0B 1A76A 2KYRA 3ZHYA 4AD8A 1CDDA 3AF5A 1P44A 2ECOA 2GPSA 1THGA 3F6BX 3E8SA 1JJAA 3CS3A 4G1BA 5IULC 3IXMA 2JRLA 5JVDF 1ZMBA 3X1WA 5CFRA 1PL6A 2R4UA 2W9XA 3G9UA 2CJYA 4AROA 1OA1A 1SCAA 5IZCA 5BQFA 3WLOA 1C7QA 1PSZA 3UH1A 2RONA 3LC0A 5A0VA 1TO1E 1D0IA 4RTSA 4PSAA 1FNBA 5BN4A 1YGYA 4QTXA 3PR1A 1EP2B 3DP7A 3JVUA 3FUTA 4DIOA 3GCWA 2W2TA 4RWEA 4X8OA 4UHFA 5IP5A 5C7LO 1WL8A 2FW6A 2GN4A 2X0DA 1NQOA 2ZIEA 4D7AA 2J48A 4KSCA 2PJRA 1KYYA 4URFA 5IAEA 1RAGA 3ZK8A 4F3TA 3IQDB 2YZ7A 2FSGA 4N0PA 4R1PA 2XEDA 1U0GA 2D2FA 4N8EA 2OOKA 3I5AA 3N5CA 4IUDS 4YAKA 2NAPA 3H9JA 3R6LA 2PS0A 3O2QB 4KWEA 4OHYA 3GMDA 1MAAA 3MWDA 3THOA 3GF4A 1UKYA 3MS2A 1QTIA 3AJDA 2Q6TA 5DLPA 2L19A 4BX0A 5HKLA 2OCPA 4NU8X 2NZYA 2IBSA 2ZI5A 4NPCA 3EWAA 2OV3A 5E3HA 2FG7C 4FC7A 5BWNA 1KPGA 2OYSA 6ABPA 2Y9MB 1TF7A 3L7JA 2FTKE 2NZUG 3GDGA 3P2YA 1V16A 3ZHOA 1EK1A 2WJHA 3E7FA 3GK3A 3IIIA 3LUAA 1PI3A 5HF5A 4GI3A 5IDYA 3A1WA 5JW6A 1JP7A 4MI3A 3TAHA 3L0YA 4DILA 3VC7A 2JK0A 1K4MA 2Q3CA 4BL5A 4M7RA 2DFTA 2AK3A 2DRIA 3Q3HA 1WMBA 1MP0A 4MJ3A 4QX6A 3NAGA 2V6GA 4MI6A 2IL1A 1QU3A 1LQUA 4IOLA 4ASUA 3A11A 3GR6A 2XCLA 4FE7A 4R9RA 3HLYA 1TB4A 1X1BA 2UZ1A 2BI7A 2ZB4A 1VI2A 3I2GA 3PF8A 2CHUA 4NZOA 5DTEA 3A25A 1LD3A 3ROXA 3DCNA 3N8IA 4YAIA 4U39A 5BN4B 4BNWA 2AMYA 4RZ2A 2VP9A 4RM3A 4ZQIA 1ISPA 3WDSA 1LY1A 4ENUA 2H4JA 1Q92A 3C3JA 1P9NA 5AW1A 5JDIC 3TTWA 1M74A 2PWPA 3VR0A 1EFPA 5TEWA 1MN6A 4QEKA 4EX7A 4ZVTA 1RKQA 2R9VA 1EEHA 4QXPA 5DASA 4MRNA 3RB8A 3AIKA 3SYRA 2G07A 3TIFA 4X00A 1TF2A 4KV7A 2J3JA 2XDQB 1V8OA 4AJKA 4A2CA 2WT9A 2YUTA 3O0TA 4IZOA 3HZZA 1QVVA 3OG9A 4KQHA 4O2BB 4C2AA 2X2OA 2VKQA 1UK9A 1FYVA 3MWDB 1VL2A 1ZICA 4LXXA 2FXVA 3H1GA 4MRMA 3V8VA 2Z2IA 1RWPA 2B25A 5L7WA 3SSNA 2GS9A 1ILWA 1I7NA 4TXLA 1BNCA 4YJGA 4HGPA 5DEIA 3UHAA 1EVZA 4LCJA 3PXGA 3ROGA 4JBYA 2FZVA 1V16B 3BZWA 3MBKA 2Q1UA 3SXJA 1OT3A 2CUKA 1SCNE 5G0TA 2QTMA 1A2OA 1L4EA 2P9JA 3GUVA 5E7MA 5DSTA 4UXHA 3VBCA 2EFHB 3LMKA 2A92A 1XDGA 4EYGA 1PZGA 2ZRLA 4X9XA 4D82A 4HNTA 3GZ4A 2FX5A 3ITKA 4X64B 1BGVA 1WX1A 2BKAA 3X1DA 4CM3A 2UZ1B 4DSNA 4P58A 5HM6A 4G2NA 1WKVA 2HCRA 4B6OA 5I7RA 4LHXA 3H19A 2DHQA 1Z2PX 1Z5ZA 4Q4CA 1OV6A 3IAHA 1MFZA 5B6JA 3U40A 3L6EA 3H1PA 1BHSA 1XZLA 2A3RA 4WBSA 1M8JA 4S04A 4EJSA 1L5YA 3KSUA 2YHIA 1YS9A 2PLNA 1QBGA 3CBGA 3QLVC 2ACWA 4IAOA 5KS2A 2HSDA 4QHYA 4R2WA 2VDJA 1XCOA 1PJQA 1WD5A 3EMVA 2CFRA 3DM9B 3IEIA 2IYAA 3MPOA 3Q7RA 4J7AA 4UC0A 2AMVA 5DXAA 5LDGA 3TEJA 2VS1A 3PU6A 1R15A 1G8HA 1RRKA 4ZYZA 3B1KA 4BBAA 3IBYA 1FRNA 3HE3A 4NMMA 4DLRA 1JKXA 4ZV7A 1WR8A 3HDTA 1JX6A 1HRKA 1GPLA 1IHUA 4MRMB 3PGVA 1FRQA 1S2OA 2A8YA 2HZ7A 3LFHA 2FQYA 3NTRA 4YJHA 2AFIA 3FRHA 4MPRA 4PHHA 4J2OA 3ZHQA 5C5EA 2IS6A 3B5IA 1TI7A 3IIJA 3O1JC 4XSHA 2WU0A 1J9ZA 3H4MA 5B5SA 1JEYB 3W3ZB 5JBQA 1P0MA 4XWGA 1SCKA 3DZ8A 4KI0A 1APBA 1YJBA 1EZ4A 4LY0A 5KX5A 4ENTA 1HNXB 3PD0A 2QTAA 3IAS1 4IDAA 2V65A 2RKBA 1UBCA 3B51X 3IOBA 3OLYA 1KJ9A 3IDQA 2PKCA 3G8DA 4Q18A 3TNYA 3ZZ1A 6NULA 3PX7A 4M87A 4NOLA 5JLJA 2HCBA 1M76A 2Q6OA 4BAUA 4PTZA 4WOBA 4GNKA 3QENA 3KT3A 1YOBA 5EE5B 5DBHX 4E13A 3I6BA 2NYUA 3FOAA 4UNSA 1GO2A 4H60A 5DF1A 3V34A 3FFBA 1PZMA 1DRVA 2IIVA 3K3PA 2CXSA 2OV8A 1K7EB 1OREA 3UWSA 3ZDCA 5FV4A 1UC5B 2QSJA 3QJ5A 4D80A 4EJSB 2RK4A 4WAUA 3WLAA 3WLJA 2F9LA 1PGNA 4J76A 4Q3BA 2XUGA 3ZIDA 5JNWA 1VPVA 3LK7A 4L0MA 4D25A 4N7MA 5JSYA 1TYCA 3BBPA 1XJQA 3HCPA 1Z2EA 3MJHA 4ZJUA 2ATXA 3BEOA 2APJA 3K2IA 1YR9A 4NBNA 1X80B 3TOZA 3UWMA 1CY2A 5EXDA 1U8TA 2O3JA 3NO4A 1XXHE 2GPTA 2QRGA 5J59A 3MWLA 4YAEA 4RYDA 4Y9TA 3DDOA 3NCTA 1UBTS 1E0AA 2VYQA 2AFIB 3ICPA 3PXXA 1BMQA 2OE2A 2PRYA 2HHJA 2VT7A 3KHUA 1YE3A 4IJVA 4J0HA 4OQDA 4JU9A 2ECKA 5EHXA 4W82A 3W06A 4NBTA 2RAFA 3EXAA 2X42A 3AEQA 3D54D 1SA0B 4BU0A 4BFUA 2WTEA 3OEWA 3ZDEA 3MMSA 3VU0A 5IUJC 2AFHA 1WU8A 2ZUDA 3UWPA 1Z16A 3TLBA 4ER3A 5BN3B 4LKOA 1QIEA 1RBZA 4TGLA 3VH2A 3WSTA 5A0FA 1KS9A 2IHZA 1ZU4A 2RGUA 2YBEA 3L0BA 3PNKA 4HGYA 4OGLA 5FLKA 2F55A 1EBBA 1ETUA 4YMTA 4J4BA 1SC1A 4D26A 2VHJA 1KVTA 3M4JA 2G5TA 5DHUA 1B2RA 3QF4A 5HCUA 5LB2A 3RSGA 5E3IA 2OGZA 1TK3A 4ZRNA 4ADSG 1NSFA 2WPNA 2IU6A 2YOHA 3BRWD 3PPXA 4N40A 4CHTA 3TRIA 3ZEAA 4Q01A 1R6AA 1ZS9A 4MYRA 4NE7A 4KPYA 4PICA 3R3HA 5J1SB 4JGIA 2V96A 1Q6YA 2EX0A 2D59A 1P6QA 2XZPA 2YY7A 3F7NA 2BV3A 2OOSA 3IALA 3PGXA 3Q3GE 3BSWA 4M1ZA 2OFWA 2JHGA 4P4NA 4P9NA 1BD4A 5ALPA 4XVUA 4KQIA 3AZPA 1OF1A 3KV1A 3WB0A 3E9DA 4NE9A 3ZW8A 1W36C 4U6NA 2WSBA 3DP9A 1PLLA 3UFBA 3NPAA 3P4UA 3GLGB 3W4IA 2PO5A 3HABA 4X84A 1ZNXA 5SY6A 3OFVA 4BNVA 2WVHA 4B7UA 3B9QA 1OH8A 4JKYA 1GNLA 1SBZA 3DO6A 5I7EA 4US0R 3PWKA 3AEQB 4IRXA 1ZU5A 4DA4A 4DV0B 4OBBA 3N8DA 4TLAA 3SXPA 1AQNA 1O9GA 1NVVR 5FTMA 4AKEA 1AXGA 2GJKA 4QGGA 2G7ZA 5DXJA 2BH9A 2XMGA 3K1JA 2QPLA 5EZ5A 2JC3A 3IA7A 1UC4B 1CRLA 4IW3B 1S6YA 1FFYA 3D3WA 4PCUA 1YS6A 2XQIA 4LGMA 2HD4A 1PYDA 4NYJQ 5IM5A 4KPUB 2IDMA 1MO3A 3UK6A 2VA8A 2BGTA 1X19A 2C9DA 1FJGB 3QF4B 4YUXA 4KUHA 1IZZA 4AJPA 5K6AC 1QR6A 1D3AA 2IZ0A 1E1CA 5B7PA 2OXRA 3LKVA 3NIDB 4TV8F 3LZCA 3DJYA 4O0MA 4Y6GB 4PZZA 1N6IA 3LO5A 3QXHA 5E6UA 3P0IA 2FNAA 1D9ZA 2J3HA 2OO7A 4YO7A 5JD3A 1LS1A 3RVMA 4HN4B 5KU7A 2QY9A 2FV8A 4W9RA 3A9UA 1VKZA 3EQZA 4ER6A 1KMHA 4L27A 1G66A 5FTJA 1FC0A 4UUPA 4U8HA 1GGHA 2NNLD 1GTRA 1WW2A 2V3WA 3OOJA 4LHYA 1ZBQA 3QF7A 4TRNA 1RQ7A 1CULC 2GHQA 2Y1GA 2EQBA 4R6XA 4XIYA 2CL6X 4ZT5A 3A1NA 3AWDA 4CT5A 1Z56C 3C74A 3FZEA 5FCDA 1O6BA 5FBHA 4BNGA 3KR0A 3NBAA 2O1WA 2X86A 3FZYA 1TEHA 4JOSA 4XVRA 1Q2UA 3JD0A 1KGSA 1NF9A 3CSSA 4OTZA 5BUZA 2C3OA 1XQ9A 4BO0A 1ABFA 1P72A 3RKSA 3S1SA 2V1UA 3W9BA 3S44A 1R16A 2BDUA 2V6JA 2ZSUA 2ZDGA 4EKEA 3BRCA 3NKLA 3SBDA 4NV0A 5I7HA 2XI4A 1TA0A 4B4OA 4GF5A 3TKLA 1F2TA 1Q19A 2OZPA 4JFRA 1MJFA 2HSWA 3L8YA 3LUKA 5COQA 3S5JA 4GZ3A 3WDKA 1CUCA 2AYYA 5JNVA 4DDMA 2PZEA 4OEHA 4YB8A 5LP6A 4DV1B 2GN2A 1K8ZB 3VPSA 1RABA 5FHRA 2DPGA 3LOUA 4ZKDA 1I5RA 1L5WA 3DTVD 3GPIA 1MB2A 1P7WA 4GPTA 1KZYC 1A5ZA 3WSWA 4HPWA 3DO5A 2ZIGA 5F7OA 3WNQA 3GH3A 1YZVA 2CL5A 5T6MA 5EMLA 4EO7A 1AGXA 1E1CB 1PJ8A 3CRW1 4NOMA 4C08A 1A72A 1C3LA 5JALA 1UMCA 1T8YA 3O7MA 4NKRA 4WUVA 3J81A 3IIMA 1QSGA 4M1SA 4DQKA 3FPFA 3DMGA 5A5VA 4X90A 4M54A 5B3AA 4Z4CA 1U04A 3KHTA 1XCGB 1BA3A 3PC4A 4P84A 3HN2A 5TQ2A 3K5IA 2WKPA 4M88A 1KIAA 3NFRA 1KMHB 2F3SA 5EGSA 5F51A 3NHLA 5JY1A 3A3PA 5TIIA 3PGA1 2VK1A 3ESXA 4W8GA 3RC7A 1QXSA 2UUAB 4XX1A 4DLLA 3PJRA 2VSQA 3T9BA 1Z7GA 3L7AA 3TNJA 1N2ZA 2BEJA 4MO9A 3VVBA 4WNIA 1FIUA 3R6GA 1X1RA 2H2WA 4M9RA 3HYSA 5BQPA 3E5HA 1FUYB 2BC9A 3TZBA 2P77A 1C8BA 2Q1TA 4OM7A 4KLRA 5K51A 4ZCQA 5M5BA 2I1VB 3ZK9A 2IKQA 5ALXA 4YUVA 2QLFA 1BEEA 1LPPA 2SCUA 1MQ9A 2LNDA 1ORDA 2GLUA 2W2VA 2Y9PB 2Y2UA 3WRXC 2XOKA 2XKKA 3WGLA 3BCUA 3Q3CA 4IJ6A 3ZWCA 5AXAA 3C3XA 2DR0A 3MT8A 3W6UA 4ZDJA 3ETNA 1OWOA 3OZIA 1WMSA 3LM8A 3WA6A 1HYEA 1DTWA 2BSXA 4OHVA 2P6MA 3D9QX 4M9CA 2ZKLA 3UYKA 2IYYA 3CM0A 1OROA 4HUQA 3SIWA 5AM0A 2YNMA 1KOLA 1KZGB 1R4MA 3BH7A 3DQQA 4NQZA 4ZRDA 5BNIA 2GN9A 4HQNA 1NUHA 1GPDG