3PHCA

Crystal structure of plasmodium falciparum purine nucleoside phosphorylase in complex with dadme-immg
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
243
structure length
243
Chain Sequence
NLLRHLKISKEQITPVVLVVGDPGRVDKIKVVCDSYVDLAYNREYKSVECHYKGQKFLCVSHGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHLLIHGDFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMYYPNKIIPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKLATKYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Plasmodium falciparum purine nucleoside phosphorylase in complex with DADMe-ImmG
rcsb
source organism Plasmodium falciparum
molecule tags Transferase/transferase inhibitor
molecule keywords Purine nucleoside phosphorylase
total genus 82
structure length 243
sequence length 243
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2010-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3phcA00
1ZOSA 1PR2A 2AC7A 4LNHA 1T8RA 1SD1A 3DPSA 4G89A 4JP5A 1PR4A 3ONVA 1N3IA 4QAQA 1JE1A 1CB0A 5EPUA 4DABA 5F7JA 4L5AA 3EMVA 4MCHA 3KHSA 3EUEA 4K6OA 1Y1SA 4FFSA 3P0EA 5F76A 4ECEA 1PWYE 2A0YA 1ODIA 4M3NA 1TCUA 3E0QA 4F3KA 3KVRA 5DK6A 4D8VA 1U1FA 3GGSA 3PNSA 4D8XA 3KVYA 4QFBA 1ODLA 1U1EA 2ISCA 2H8GA 3IEXA 4JWTA 2QTGA 1T8WA 4DARA 2HRDA 3FB1A 1JYSA 3OPVA 1A9SA 4R2WA 2OC9A 1T0UA 1ZL2A 4D8YA 4KN5A 4DA7A 1VHJA 4WKOA 1Y1RA 3OZDA 1YR3A 4DAOA 1RSZA 3E9ZA 4I2VA 4OY3A 1ULBA 4F2WA 4L5YA 3BGSA 1RT9A 4QATA 4DA6A 1C3XA 4E1VA 1XE3A 4H1TA 5CYGA 1OVGA 2AI3A 4WKPA 2HSWA 1VMKA 1JPVA 5CCDA 1U1GA 3ENZA 4GMHA 4QARA 4L6IA 4NS1A 3UAVA 1RCTE 1RYZA 3PNPA 1JDUA 3BL6A 4DA0A 1RXYA 5I3CA 1YRYE 4BN0A 3TL6A 4L5CA 3PHBE 1B8NA 2ON6A 1SQ6A 1V48A 1PR5A 5B7NA 2RJ3A 1Z35A 1PK7A 3OZCA 3P0FA 1PR1A 3O4VA 4MCIA 1V2HE 5F77A 1V4NA 3U40A 1JDZA 1A9PA 4IP0A 1OTXA 1OV6A 3C74A 3T94A 1V45E 1G2OA 1NC1A 2BSXA 4BMXA 4WKBA 3NM6B 3BSFA 4EARA 1VFNA 2Q7OE 5F7XA 3INYA 4RJ2A 3NM4A 4TXNA 4DAEA 1B8OA 1OU4A 4LKRA 5CYFA 4OF4A 3UAWA 4GKAA 2HWUA 4L0MA 1ODJA 4F3CA 3EEIA 4PNPA 2QPLA 2OXFA 4TTIA 3QPBA 1PR0A 1RXUA 1SD2A 3OZBA 1Z36A 3MB8A 1TGYA 5F73A 1Z39A 3FAZA 1T8YA 4JOSA 3K8OE 1JDVA 2XRFA 3NBQA 5FAKA 4R2XA 1OTYA 2A8YA 1Q1GA 3OOEA 1PKEA 3EUFA 1TCVA 1Z37A 1Y1TA 1JP7A 4MARA 3UAZA 4TS9A 1PW7A 5JPCA 1NW4A 1TGVA 1U1DA 1LVUA 5ETJA 1ODKA 2P4SA 4TXLA 4QEZA 4LNAA 5EFOA 1RFGE 1V41E 1Y6QA 1FXUA 4G41A 3PHCA 3LBAA 1A69A 3LA8A 2OECA 4YMLA 4TTJA 3LGSA 1PBNA 1Z5PA 4OEHA 5IU6A 4OJTA 4YNBA 5EUBA 5F7ZA 4YO8A 3KU4A 4TXMA 4NY1A 1YQUA 1Z5OA 2HN9A 1U1CA 3FWPA 3SCZA 3FOWA 4BMYA 3NM5A 1LV8A 2QTTA 5C80A 1Y1QA 1JDTA 4G8JA 1A9OA 2IQ5A 2A0XA 4OGLA 1A9TA 3F8WA 3O6VA 1PR6A 4TYMA 2OC4A 2AI1A 1PF7E 4DANA 4F1WA 1RXSA 1PK9A 4P54A 2B94A 4TTAA 1K9SA 4TS3A 3BJEA 5B7QA 3UAXA 4DA8A 1T8SA 5B7PA 1SJ9A 1ECPA 4LDNA 3OOHA 3KVVA 5IFKA 3E9RA 1TD1A 4BMZA 4UC0A 1JE0A 5KB3A 4M7WA 5F7OA 1OUMA 3DJFA 1V3QE 4WKCA 1I80A 1YQQA 4D98A 5CXQA 4F2PA 2A0WA 1ULAA 3FUCA 3K8QA 4U2KA 4TXJA 4EB8A 1NC3A 1Z5NA 5CXSA 3UT6A 3OCCA 1QE5A 1JDSA 3IOMA 1M73E 4GLFA 5F78A 3UAYA 1CG6A 3GB9A 1Z33A 1WTAA 4WKNA 3ODGA 3DF9A 3DDOA 3DP9A 5K1ZA 2AI2A 1A9RA 1K3FA 4R31A 5B7GA 2I4TA 1LX7A 4M1EA 4TXHA 3MMSA 4X24A 1YBFA 4GLJA 3D1VA 1Z34A 4OGKA 2I8AA 3FNQA 5CCEA 2GUWA 4YJKA 2QDKA 4D9HA 4PR3A 1RR6A 3OF3A 2PGAA 1RXCA 1A9QA 1VHWA 2QSUA 3OZEA 3KUKA 4LZWA 4QASA 1Y6RA 1K27A 4NSNA 1Z38A
chains in the Genus database with same CATH superfamily
4ID3A 1OILA 2IITA 3L04A 3PGVA 1SUEA 1SZJG 1XAHA 3GNSA 4HQ0A 4WVLA 4WZAB 2UKDA 5GV8A 3FNFA 4RQUA 4Z1OA 4WCVA 1M9NA 2J3KA 1QZTA 1DNPA 1LSUA 1MENA 1RM3A 3DDWA 3KKOA 1X74A 3A9RA 3JAKA 4YA6A 1KH2A 4YXFA 1KYZA 2E18A 4LSMA 4QVKA 4B3FX 3NHKA 4LYYA 1OZHA 3JQ9C 3WMGA 1D2NA 2CYCA 1LCIA 3WICA 1TCCA 4DQUA 3EAGA 2ZYWX 4WESA 3CZCA 2O52A 2NU8A 3OHPA 4C06A 3BILA 2HXSA 3F5MA 4EX6A 3KQOA 4EX7A 2VIIA 1W2WB 3V1NA 4DNQA 1RPNA 2G63A 3PK0A 4R81A 4BNXA 4YJ2A 3W5DA 2O3QA 4E2ZA 4EECA 4YMHA 3PC8A 4PCVA 3TEJA 3ZUPA 1D2RA 3AZOA 2D5IA 1SVSA 4H7IA 3K70C 2IZ0A 4ZOCA 5KBYA 4Q1VA 2VA9A 1CZRA 2CY0A 2OPHA 2JI7A 2WUDA 4HZUB 5LWQA 3MWYW 2I34A 1IQUA 1R10A 1NUUA 2C4VA 1QHEA 3KELA 3LP8A 3ONEA 4Q4HA 3CZAA 4UJ3A 4UUQA 3VAZA 1HT2E 4CGYA 2ZWAA 4BVJA 4M3NA 1IXYA 4QO8A 2B2XA 1MORA 1P60A 4LUCA 5JOQA 4YP9A 3NX4A 4B0PA 1O96B 2VH2A 1GM5A 4H0CA 1K68A 3CZPA 1R0ZA 3NOXA 3EMDA 3ZV4A 5LA6A 2OA0A 2OHXA 4FOPA 2IYLD 5BNZA 2B37A 3VU9A 3AVYA 4MMXB 2Z9DA 3H5WA 3IMEA 3RTGA 3Q7RA 1E1RD 1HA3A 1NX9A 4RHUA 3A9TA 1W59A 3RTAA 3I9JA 1P19A 3PIDA 1EINA 2FSFA 3D43A 1LGYA 3HVUA 3OQHA 3FTCA 4L4UA 4LYHA 4IBOA 2NU9B 3DF7A 3UATA 3TH5A 1W4RA 3ZWPA 3PWSA 3CIOA 3BE6A 1LFDB 2QTAA 3DVRX 4FYYA 3T7JA 1RABA 1NI4B 1ZD5A 4IH9A 2Y4NA 1UOQA 1DLIA 3RRJA 5HDBB 3K6JA 1MNAA 4ZGGA 3VMMA 4C88A 1T8WA 2QTBA 3ZDCA 1XMPA 1Q3HA 1WDTA 4BMVA 2Y9PB 5H70A 3ZWBA 2IHKA 3ZBTA 2F67A 5HZMA 2SNIE 1OYOA 1PNOA 1Y8QA 1I01A 5A02A 1E2NA 3CE9A 2WE8A 4WXRA 1DIRA 3F5QA 3FZNA 1GPWB 4R5MA 4EMBA 1DZ3A 4KN5A 4C7BA 3PKIA 5H16A 3SVZA 2Q5FA 4LOKA 2HMWA 1L5ZA 4ZHQA 1XRJA 1ZVQA 3H7IA 4LNUB 1UEXC 1X1SA 3OJXA 3UQYS 3IJPA 4C0WA 4ZEMA 1L7OA 3ADBA 2ACKA 3Q2IA 3RU7A 4AXBA 1GU7A 4BX9A 1J8VA 1CQWA 1YDWA 3R6GA 1FUUA 4MR7B 4BAGA 1P18A 5KHLB 1EZ1A 3WI7A 2GM9A 1CQJB 4IG4A 2HV9A 1QWOA 3F8TA 2AFVA 4DLYA 1WAMA 1QPBA 1LD3A 3BFJA 1KK3A 1DX9A 2WHYA 1ORIA 5A9RA 4S2UA 3DHVA 1W4LA 1JWLA 1QP4A 3FVVA 1M1YB 1Y3AA 2EFGA 4X7RA 1N2JA 5JHGB 3WZMA 2CB0A 4WK6A 2YFYA 2W11A 3SY8A 3WL5A 3RVBA 3MUEA 3JPYA 4FCTA 2VP5A 2ORWA 2PM8A 1WRBA 4JXJA 2EP7A 5IH7A 3E61A 2DR2A 4BO2A 1EVEA 3GH1A 1VMKA 3KRTA 2IYOA 2Z3VA 3EPLA 3DB1A 3GFFA 1PE0A 5J23A 3MJSA 2VHUA 2C0PA 4UHFA 2GRAA 5B2FA 2JI6A 4P86A 2QTFA 2VYNA 3H2JA 4RTJA 2MSNA 6REQA 1BYIA 1M2FA 3DBOB 3BDAA 1F9EA 1QIEA 1R0RE 4G3XA 4LJKA 4P92A 2JZNA 2HMTA 4MEAA 5AJZA 1SA0B 2QLNA 3RQIA 5HUJA 2KI5A 1HPLA 4OHFA 5SZKB 4R71A 3E3NA 3FLAA 2ZRAA 3PNPA 8ADHA 1UKEA 2FSIA 2ZT5A 3H4MA 2VJQA 3QLUA 4N5NA 4EY6A 1TL7C 4EYEA 3AR8A 1QYVA 2C7GA 1BZYA 4AJLA 2V6MA 3GJ3A 4TYQA 5BUCA 1RIIA 4GE0A 1Q1ZA 1YDEA 2ZTVA 5EKDA 5AVUA 1U94A 3KKLA 2QMEA 1YI8A 3I8OA 4Z7QB 1WZUA 1FF9A 2Q8PA 2F9FA 1U7OA 3OM1A 1EVJA 1ZQ9A 2QGNA 4G5SA 1O9HA 3KQVA 1V5GA 2FAXA 3R44A 3ESDA 2FQ1A 4OI4A 1W5BA 1UFRA 3DEJA 4R3WA 3RM3A 2G7MC 3I30X 1NE7A 5JQGF 4DV1B 2R6CA 1CR6A 3AUKA 4J03A 1ZW1A 1FJ2A 1WE2A 4B1FA 4P80A 3IBYA 3PI6A 4RA9A 4REQA 4DSAA 2NUTB 3JSXA 1QQ5A 5KINB 1JKXA 5HUQA 1ZD2P 5G53C 1M1YA 3TRDA 3IPYA 3NNDA 4ZU1X 1I5RA 1V7CA 1MXHA 2NUPB 3D4LA 5I8ZA 2IOQA 2I7XA 3AKEA 2HPZA 1UIMA 2KBFA 3HDQA 3K1ZA 4I4TB 2FHPA 2F17A 4ZO4A 1E6WA 3DHWC 3L4EA 1U0JA 1YA4A 1CVRA 5KPJA 4MWEA 4NV1A 1A72A 1XPUA 3OLVA 5GVRA 4BV3A 4YP1A 3WFIA 3TLJA 3GLFE 5EZSA 1ECCA 4X6YA 3VU8A 1P8JA 3OFJA 2YX1A 2BUCA 1WU8A 3VXKA 1RYNA 5IAJA 3KUUA 1PFWA 2FH5B 1E5VA 1G2IA 5AUNB 1ZMRA 4Q9AA 4QG7A 4LJSA 3SC2A 1NQTA 1YU6A 2ZDQA 3QVKA 2VPQA 3AY6A 5EE9A 5EGSA 2WABA 5EPOA 1J1IA 4ZCRA 5KIAA 5GONB 2CXXA 3D8RA 5BRAA 2ZBUA 3QVLA 3PX2A 5G3ZA 1NIJA 2E82A 2FR8C 3A2NA 5JPDA 3LKVA 4QTZA 4EPYA 5JAIA 1NXVA 1WW8A 121PA 2MJLA 1O03A 4D0NA 5CGQB 2AD5A 2Z8XA 5JZOA 1VKZA 3CFYA 1ZGZA 3R75A 1QDLB 4DAEA 2HFKA 3WGMA 1NY5A 4NENB 4FGWA 3AEQA 4R6XA 2W42A 2HT1A 1ADGA 2RC5A 4IIUA 1ZHHA 2UVPA 4KWIA 4P22A 4UHBA 1P2SA 1TPZA 1VE6A 2HU8A 2PWZA 5JD4A 2IIQA 3CZ5A 4PNPA 3UAOA 1NQAO 3FCYA 4IRUB 1E61A 4KW7A 3B3GA 1W36C 4E03A 3GOQA 3FWZA 1SN7A 2EFEB 2LKCA 2IA5A 2ZKLA 1SD2A 4A8HA 3OZRA 1GL9B 3R5HA 1T0PA 5JU6A 5DCWA 3E5NA 1TIKA 1QSGA 2RGDA 1N0VC 3GH3A 3RIEA 3X1ZA 1K0UA 2ISQA 1HKHA 2ZYGA 1TGYA 3JQ6A 1Q1EA 3ZI4A 2VEOA 2YJ4A 2PS9A 1QTIA 3NANA 3FAZA 2G25A 1L4MA 2J67A 3AV0B 3EYAA 3HU3A 4R8LA 3VDQA 5DM60 2PV0A 1COZA 1PVVA 3FETA 3DZGA 3L7JA 3OZWA 1O2DA 4LXYA 3IO5A 4MTLA 4H15A 2FJPA 1JDVA 3U7QB 3VU0A 1EFRD 4LWOA 3HXTA 3DL7A 4JJEA 2MU1A 4M36A 4Q66C 1N0HA 4PBRA 2HHAA 3UMGA 4NCHA 4EI7A 1IVYA 1E98A 1JV2B 2A2ZA 3IGFA 4JCOA 5FWNA 1E2GA 1E6CA 1OAOA 4MVYA 4XQ0A 1ZGBA 5IM4F 1IU9A 2XZTA 1Z26A 1V5WA 4MARA 2I2DA 3UTCA 4HVLA 2JD2A 4EUNA 4EZEA 5FV4A 2IH4A 4CEJA 3EZXA 3T3PB 2JRLA 5A9SA 3M2TA 2BMDA 4P3XA 4DLSA 4G5YA 1JEEA 5DGTA 5JCOC 4K9KA 2HW8A 3WRWA 2CVHA 1IZ8A 1V8PA 3EQ8A 3F5DA 1MABA 5DNDA 3NEYA 4MUHA 5IDXA 5L3VA 1T13A 4KOEC 4FT4A 3S44A 3RCBA 3IESA 1Y4SA 2ZVPX 2XZLA 3A0UA 1W44A 2H06A 3F7MA 2OOKA 1HDCA 2GWRA 3DULA 3GZJA 5E9WA 1Z6ZA 3VQTA 3UB2A 5AI6A 3UC5A 4N3GA 4P6VF 3ASZA 2AYXA 3VDMA 3UM9A 4E3ZA 2R2GA 2QPTA 4R8RA 4R69A 1YT5A 1YXMA 5E6SB 1YJBA 5ARCA 4BVKA 3PCTA 3QF4B 4KXXA 3MHTA 4MR9A 1ND5A 1O95C 1N6PA 3AV3A 3JXEA 3HABA 2G77B 3DVQX 3HDVA 3NWEA 4V02A 3EIUA 4QULA 2ZUDA 1AKRA 4ZQEA 3SYTA 4R3UC 3RANA 3DFIA 1CPYA 2BFPA 3VR5H 5BN3B 4OEHA 1T9GR 1WZCA 1EGMB 3HI4A 4LHXA 4UTOA 4WBSA 3F74A 3M8KA 4HK4A 3O93A 1TD9A 1MU0A 4O5AA 9LDTA 1NNI1 1LC0A 1X8XA 2XB6A 3H99A 4U7HA 3R9KA 1ZM3A 3KEQA 1SHJA 3SIXA 1GL3A 3RROA 5IP5A 3WGUA 5A2QA 3KZOA 2O0JA 3TR0A 3ND6A 3HS3A 3SCZA 3QBVA 2QMYA 4AZ3A 2B2NA 1FFHA 1OHHD 3KDAA 2Z2JA 4O2BF 1C81A 5FF9A 4BMYA 2IY7A 1ONBA 4D25A 1J6UA 2WT8A 1ORTA 4A82A 5IXSA 1GKLA 1JIIA 3KB2A 5EZYA 1KZ6A 4AICA 2Q5LA 2GERA 4F2DA 3IPLA 2VOJA 1O94A 7AT1A 1WQ3A 4PRKA 2WZDA 3TUJC 3W5IA 3WWYA 4GG1A 1HL3A 4BP9A 1KPHA 3F6PA 2D7CA 1B74A 3BA1A 3I12A 1XPJA 2C8JA 5IX8A 4QFCA 3R6WA 1XDDA 5TGZA 3M81A 4Q1AA 5TV2A 2C84A 1PZXA 4HAYA 2ZM6B 4NI5A 4OGLA 1OLXB 2VJKA 1FXWA 1PFUA 1K5GA 1NNLA 4AZ0A 5LN1A 4QXOA 2RD2A 5KNDH 2R86A 1ZSYA 3VV3A 2P4EA 4DLUA 4Q7JB 2G07A 2H63A 3L01A 3WYNA 3CLVA 5AUQA 3FG9A 4UATA 3DONA 4KODA 6NULA 1E6KA 2XSZD 2QR5A 1EFKA 3W9SA 3QV2A 1OD6A 4U63A 3LS2A 3WL3A 2HWWA 2C2GA 5AK0A 2RBKA 1E3SA 1KIMA 1GYPA 4P54A 2B6NA 4WGGA 1JFSA 1KVRA 4JYAB 1FP1D 3EXHB 1ZMXA 3GMDA 1C3OA 1ZSVA 2ZT8A 5ILQA 2JKZA 4PLVA 3MPUA 2Q3LA 5EYPA 3P5BA 3D8NA 4KN6A 4J29A 1P1HA 2O5VA 2NSHA 3O2JA 4Q7MB 5IJWA 3EIXA 4UE2A 3D7LA 4O2LA 3TQCA 1ZM4A 2QI9F 3LZCA 4NATA 4R0MA 3SOPA 1T1RA 1KS9A 3B48A 2O5EA 3AHIA 1BA2A 3KR1A 1WBBA 3VO9A 3PNYA 4BMZA 3A31A 5J5CA 1CSEE 1IOLA 4OLBA 5HK8A 4DG9A 2PRJA 3ADOA 1OUMA 3G49A 1SQGA 5NLLA 1L5LA 1J2EA 3BYZA 3LHDA 1GDTA 1KL7A 4WY5A 5U9CA 1Q20A 4NPCA 2P6MA 3A3PA 3T0GA 4GHWA 3AETB 1G66A 4GP7A 1ZJZA 3B60A 3SK0A 1OU0A 9MHTA 1ULSA 2XNJA 4ALMA 3TSCA 3ZW9A 2VSXA 4JQZA 1UPFA 4KMSA 3R5JA 3WWOA 4UASA 2V1UA 3W2HA 3MERA 4IICA 3LG2A 1BGVA 4B79A 5B12A 1EG2A 2TSYB 2GR9A 2PU5A 2RH5A 1PEKE 2L19A 3HKDB 4MWOA 4YP0A 1PD1A 1U2GC 2NAPA 3V4OA 2HCRA 2FPUA 3NYQA 4N5MA 1M67A 3CE6A 4RCYA 3PNQA 1JG3A 4LOHA 4TZTA 3IUJA 4HDKA 3ZHUA 3U3RA 1MC8A 2VJAA 3OQIA 5KNCH 1KJ9A 3L6DA 4OBWA 1D4ZA 2KW5A 2YVLA 1NW5A 5ALWA 3DV0A 5DNAA 4OFBA 4D9GA 5L7TA 2VSYA 4K3UA 2J5RA 4YAWA 1CY1A 1S4MA 2A4KA 4TLCA 5AJUA 3A1NA 3OFND 2C2MA 5CK5A 2B4RO 5FL7A 3T9EA 3OU2A 2BDUA 4CV2A 5CBPA 1SXGA 2VQ6A 3MWLA 3ODPA 3E22B 3IV6A 4PO1A 5IUNC 2XADA 2C9BA 2I4RA 4JLJA 2P3SA 2D2VA 4U9IS 4QTXA 1TZMA 5JSFA 1UAGA 2PBRA 3MJCA 1DP4A 3CO5A 3A14A 4LS3A 1IONA 1MP0A 3MBKA 5KYWB 3DBRB 4YHHB 3AM1A 3S3TA 2HYDA 3ICPA 4RU1A 5K7SA 3G2PA 2B4QA 2P9BA 2P4UA 4OQNA 1KVTA 1RBZA 4HEHA 4DUPA 4EPTA 1YR9A 1FNCA 3K9BA 3EVCA 5IWAB 4KAXA 1BDMA 5ALKA 3SR3A 4IPTA 2HU2A 4RTLA 1ZGHA 1P80A 4ZQFA 5K0SA 4DM7A 1UOPA 1SIUA 2FEAA 1XP5A 3D7MA 3PE6A 3T3IA 2OMKA 2ES4A 5LC1A 5KTTA 1PGOA 1T43A 5H9WA 2N42A 5EXPA 3T3OA 1CJCA 3KUCA 1X8LA 2HBZA 2GN1A 2QX7A 1L5VA 4LZWA 2I6XA 5BSEA 3HKDA 2W6NA 1F4PA 1Y8CA 5T4BA 1K27A 3JWJA 1U28A 4V0QA 5DHQA 3DAFA 4Y30A 4UZEA 1H9BA 3HCCA 3FNGA 1HYBA 1MIOB 1DUIA 4MGKR 3JD3A 5TEVA 5K8JB 4AJ9A 1PR2A 4V0MA 3THXA 1AS0A 5AHOA 4E2FA 1INLA 4EEKA 5MN5A 3DFUA 1YZLA 3TTYA 4E08A 3W5HA 2PT7A 2WFMA 1XDBA 2ZE6A 4CL3A 4X92A 3A2MA 4KIWA 4IYRA 5AM1A 3NXKA 4PLTA 3WLMA 4BO4A 3TQHA 4Y2JA 3GJSA 2C8KA 3PVZA 1BWSA 2IU6A 3EXIA 3PFBA 4OM8A 2JZOA 2DHEA 1PSZA 2ZVDA 4UXJA 2YN2A 1XJWA 4WY2A 3V9AA 4D9IA 2X6TA 1TZJA 5B55A 2Y1OA 1HO3A 3N8KA 3MJEA 1QCYA 1XMJA 4C05A 2YZ2A 3LQ4A 4BECA 4YCCA 2CXNA 3CLUD 2PH5A 2ZRKA 2VSNA 1HI9A 2ANBA 4BVAA 1JPJA 4DLTA 2OHVA 4DGQA 3WISA 5GJBA 4GLLA 4A8PA 3F2VA 1S2GA 2B36A 2HD4A 2FLKA 4Z9BA 2PV7A 1ECLA 4GOKA 5CRIA 4P0QB 2HJRA 3A7DA 2HLNA 2ZS8A 2FI1A 2IOFA 2GJKA 2DQSA 1O5TA 2A6PA 2QE7D 4JJ8A 2PKXA 1H2ZA 1GL6A 1Q1NA 1MGOA 1M34B 1TJ5A 1Z0ZA 4Q1DA 1GTZA 4H4CA 4LQCA 2R4QA 2QNBA 1Z12A 1QHHA 3HJFA 3D64A 1XCLA 4PY2A 1XQYA 2WKSA 4MDEA 2MMCA 4ZOAA 3B9PA 1YOVB 1U1EA 4OP1A 4ALJA 1NXOA 5BSFA 3LDAA 2W8BA 1ZD3A 4JC8A 4TZ0A 3GT7A 4G67A 2GETA 2XA9A 2D1QA 1ZJJA 2IBMA 2GBFA 2Z08A 3RNLA 5KYTA 2AF4C 4YCNA 4JYZA 1OPXA 2CDCA 2H8GA 4PZ0A 1S9DA 3JWPA 4YN3A 4YWJA 4QXAA 3T7AA 4O4IB 4TS4A 3QNWA 3GR6A 4CMHA 2DKFA 2R6FA 3THWA 3HKCA 2GVDC 2V55B 1N5DA 4C6RA 2R7LA 3LT1A 1YJ8A 4GRAA 4LK2A 4ND8A 4FBLA 2NU6B 1YO6A 5GP1A 1KA9H 1TW2A 5JNUA 1VLLA 1AA9A 2GF2A 2HA4A 1PT6A 5JDCC 1M2GA 1Z0DA 2V98A 5AFSA 3HB9A 1LSSA 5DHRA 5LZ9A 2VDWA 2Y68A 1L9KA 2XIJA 4PQGA 2OC9A 4D8YA 1GPAA 2YMLA 3KAJA 3LOPA 2HRQA 3H5OA 1UJ6A 3VPAA 1AE1A 1G98A 3UT5A 1XRRA 2WKQA 4GZLA 4KP7A 3U9LA 3W5CA 2AJLI 2OESA 1KYIA 4DDMA 4F4DA 2QM8A 3ZK9A 3RADC 4BAZA 4A16A 1W6RA 2GDZA 1Q0UA 2IS2A 1P9OA 3BL5A 2X0EA 2GMWA 4B76A 2PX3A 1O97C 1T2AA 1RWOA 1B3BA 3RPEA 1E3EA 3WL8A 4W5TA 1XKTA 1RM0A 1ZJ5A 2QRGA 3DMNA 4I2VA 1QMPA 5KOHA 1SZCA 3AIKA 1GUAA 1U3WA 3L05A 4JJZA 5C8YF 5E6RB 3VX3A 4J1QA 4R9RA 5SY6A 3VI4B 4K8RB 1XD8A 1N5JA 2WLSA 2WA1A 1QG6A 2I1QA 3ED1A 4G8CA 4LF4B 1D04A 1ILWA 1ETHA 1UBGA 2D8AA 5UKDA 5DKFA 3ZCUA 2O8DB 3N70A 1FP6A 3RJMA 4D9JA 4N3AA 1C3XA 3N7UA 5B36A 4MRNA 4ER3A 1R9NA 1JG6A 4JBGA 3GUUA 3H1BA 3BH0A 1LY1A 1Z25A 2IPLA 3VHXA 5KOIA 2JC3A 3BIWA 4N6OA 4OU4A 3CH7A 3V1KA 2I29A 5IN4A 5KSPA 3IUMA 4PIMA 4OIFA 2UXBB 4BMOB 1JAXA 1CULC 1AS2A 1E0DA 1ZJ4A 2AEEA 2R4TA 3LBFA 1I32A 3N2KA 4RFLA 4ZVTA 1XOIA 5HE9A 3C6ZA 4AZVA 1R0LA 4X1IA 1P1RA 2FGKA 3PHGA 3L84A 3LL4A 1T25A 5CFRA 1TFRA 4YFYA 2C59A 4C4RA 5KQPA 4RS4A 2WHPA 1G4UR 1QIFA 2E55A 6PFKA 3GLVA 2RHJA 3DZJA 2IXDA 4YTEA 3WGTA 2ZJ3A 3WKCA 2BFWA 5KJFA 4MS1A 4QAJA 4M99A 3USES 5BWBA 5C5CA 1EFCA 4JLBA 3OZTA 2F8SA 4C7KA 3GZ4A 2JGMA 3WWCA 1F2UA 3ZDQA 2XOXA 5FHRA 1T0IA 1X7YB 3UWDA 1ZXBA 4G5QA 4L5IA 5FHQA 4EY5A 3DM9B 3VKGA 1RCFA 3GD7A 5AJHA 3ORSA 4XUDA 4L1KA 2OGSA 1L4FA 2OR3A 3HN2A 3O9ZA 4F96A 1W73A 1TVEA 2AN3A 3M2PA 4X7MA 3KAQA 2R6DA 2J3EA 2ONCA 4ZOLF 2WAMA 4ZVNA 2HMSA 5IASA 1GFIA 1B3RA 3V46A 4QU9A 2I7TA 4ASUA 1US8B 2ZE8A 2OSBA 4IQ0A 1PR1A 1J33A 1Z4PX 4EPRA 1MRZA 2H29A 1KEPA 3O4VA 1SOVA 4E5DA 4RETA 4JSRA 1NRIA 3DTVA 3LW7A 3MB5A 1XTKA 3FGPA 4BBJA 5IBQA 3ZIAA 2NT4A 2F1IA 4IMPA 3FAKA 2QLTA 1SCBA 3ZR4B 3A27A 1FYVA 4EDFA 1GA4A 3PNBA 4QBFA 4G9BA 3H83A 4MV5A 3MUFA 4PLCA 4Y6OA 4PG5A 2FZEA 1XRSB 2PLWA 3D4IA 5K8VA 2J46A 2P0EA 5I7HA 1ESEA 1Z4QA 2KLBA 3BCUA 3K92A 4MJXA 5FI5A 1EK0A 1U0BB 2IZZA 1U04A 2PL9A 1G3RA 1F9AA 1ZFNA 3B1WA 4KX3A 3ZJTA 1H8HA 1R8YA 3O4JA 3RK1A 4WKBA 3CUVA 2P6UA 5AW5A 2NZWA 2YICA 3L0CA 4D41A 4GM4A 4KSYA 1F2VA 3PFNA 5A2GA 1GTJ1 4HC4A 1Y9DA 4R9SA 4I3FA 2Q4OA 3SC2B 5JVDB 1Z73A 4YAGA 4B45A 3KXKA 1QLHA 2H85A 3DVSX 1YVPA 1CJTC 1IJFA 4M0FA 2BMJA 2B7CA 1K4YA 2C5AA 3KQSA 3T7IA 4DILA 2YR0A 2JI9A 4RAOA 3UKOA 2HJVA 3SIPA 2DFVA 1L7RA 5ERYA 4PCLA 5J58A 4UTXA 1QRRA 3I53A 4R5HA 1ABEA 3P9XA 2HV8A 1Y9EA 3EHDA 3P9KA 3RAEC 1XXHB 3K0FB 4PFSA 3H9EO 3ZNPA 2Y1WA 1JNYA 1RVDA 3W3ZB 2BF4A 2DWUA 5ARBA 1H4VB 1P5JA 2OB1A 4R1SA 2VTEA 3IP5A 3EE6A 4WEQA 2REQB 2XE8A 5TMEA 1V8FA 3WGQA 4GBED 3D6MA 1DVRA 1E3LA 3QOYA 1VJ0A 1PQPA 3L7MA 4M53A 1BXZA 2GFIA 4U7TB 4YAFA 3CN9A 1ZS9A 2ECQA 5C35A 3OA0A 5JYEA 3LSTA 1SBIA 1VGQA 1P17A 4JNKA 4RY8A 1HEIA 4TTSA 1C1XA 4DQKA 1BKYA 5T4HA 4JLVA 3G2MA 4R84A 3ZS8A 4IF4A 1CIVA 2F1JA 4AX4A 4D6PA 3OWXA 2HLPA 3C3DA 3H4IA 3N6XA 4MDHA 4JP3A 4B34A 3QE9Y 2RI0A 1BX1A 1P4HA 1UKVY 3QW4B 3E9QA 2PPLA 2IYVA 3DTYA 5KTRA 1XTZA 1FQWA 2ASVA 1GOTA 3UPDA 1JG1A 2JATA 4MV8A 5HQTA 2V96A 1QO0D 2WJWA 2VP9A 4M1YA 3HCAA 4FM9A 3HBFA 1CS4C 1THMA 1SM4A 2AQIA 4ETNA 5BOSA 1P44A 1IEWA 2BFCB 1U1DA 1BRMA 1LVUA 1RP7A 3AJEA 4XIFA 1ODKA 2H0RA 2OLJA 3TM4A 1KKUA 4EZBA 2IXFA 3BTOA 3LF2A 5A3QA 1H2RS 5LU9A 2FSHA 2VZLA 3S4YA 2WVGA 1NOIA 3I8SA 2Z6AA 4QYXA 4C4ZA 2JIQA 1DSSG 4DN6A 3GEPA 5J40A 3HO8A 5EFOA 2Y1CA 3EARA 2Q4DA 4HTFB 4QGFA 4AF8A 2XCOA 2OL4A 1HETA 5AM2A 4CE6A 4KYIB 1Z28A 2B5WA 4YJFA 1QMGA 3HGTA 4Q39A 3V48A 4ZC8A 1YZGA 3FPGA 3G9ZA 4INOA 2YH2A 3AYXB 4C14A 5C0OE 4F3NA 2YUIA 2FR0A 4ZGWA 4GMDA 4HDOB 2FLWA 2A1TR 4MWGA 4TTJA 3ZCQA 3F71A 4BQQA 5KSZA 3QYJA 1JLRA 4N7JA 5HJ5A 3U16A 2BM0A 3MFQA 1L8LA 2CJFA 2XB4A 2VYND 2R7KA 1HTWA 3SSOA 2FZLA 4YP7A 4FI3F 4F6LA 1O9BA 1EVKA 1EP3B 3LDUA 4PLGA 3ZY3A 1XLTA 4RQAA 4DADA 3IL2A 1QS0A 2JFYA 3OEYA 3CSSA 1MRNA 1MVOA 1QYIA 2QV7A 3LX6A 4WHMA 5A5DA 4LTNA 1EXVA 4RZ3A 1Z88A 1G7CA 1EJ2A 3OMWA 3PUWA 3IB6A 5A6VA 1AMNA 3VYWA 2CZQA 3SZRA 5FTWA 3SDSA 2F3TA 3TGWA 2ZKIA 3EOAI 3M9WA 5CA1B 2DLNA 1J99A 1BGXT 5ALNA 1EVZA 1KMQA 2BGRA 3H2BA 3NT4A 5BSVA 2LZ0A 3HL4A 3QEBZ 4WXYB 1IBSA 3LNTA 2JA1A 5IDQA 1HDOA 4EJ6A 3ILHA 4CKCB 4ZOBA 5KVAA 1GZSA 3N53A 1SWVA 1ECGA 3TAUA 3TJZA 1JG7A 2JLSA 3C3XA 4LY9A 1CS0B 4BMDA 3TGLA 1CJMA 1T3ZA 2B21A 2VYFA 4NBNA 1VIVA 3MGBA 2DETA 4WQMA 3QG1A 2QR2A 4ODIA 4DKJA 1JAIA 3FDFA 4R1OA 4CKYA 2JFHA 4NBRA 1ZD9A 3C3PA 3V2UA 2X1VA 4EKEA 1SA0A 4Y6PA 4FQ7A 4BZZA 2YJ5A 1KGDA 3ZE6A 5F52A 4QEKA 1TCAA 3ZQUA 1DDOA 3L9WA 4M1OA 1BX0A 2JGNA 4XRRA 1RXVA 4KPYA 4K9RA 3V4VB 2XMRA 3QM1A 5HJ7A 4AULA 3GCXA 2VLBA 3K30A 2V1XA 1EFHA 4HOYA 2C4HA 1AB5A 3KKZA 2XCLA 3PPXA 4I1UA 3VUFA 3D1LA 3L8EA 2LCIA 3L0ZA 1P0PA 5JC8A 1DOZA 1IHOA 1PK9A 1TZBA 1X1RA 1YHYA 3H5VA 3A1DA 2NUBA 3LKBA 5GOTA 1A9XB 3IHTA 4QX6A 1NOKA 4TS3A 1E9AA 2A5DA 1X1BA 3FMFA 3JARB 4G84A 4OOFA 4BWGA 5T4EA 4ZYWA 5AVYA 5GTDA 4D26A 1Z4IA 2DH5A 2JLAA 3MJDA 1J0XO 1JHVA 5BPFA 1CUSA 4I7EA 1GPJA 5HTKA 1VHTA 4M1SA 2EQ5A 3DPIA 3SMVA 4DA8A 3S2YA 5JNTA 3PKZA 1SJ9A 3SR0A 2YDXA 3C4VA 4WCFA 4PLWA 2HPHA 2V5AA 5AW4A 1UWKA 5IDWA 4AP6A 5BSHA 1MBZA 3KHUA 3NDJA 3PJDA 3V6MA 3ML1A 4CTKA 4G0UA 2KQUA 1DBSA 3SHFA 4F6RA 5CDGA 4NE9A 4QGGA 2CL7X 1JE0A 4QSHA 5LLTA 3CRNA 5AM3A 3NBUA 4BFVA 4FS3A 5FTKA 1RWKA 4HDNA 1NBIA 1AO3A 2XA2A 3OE7A 3N3BC 3Q3CA 4P58A 2CJPA 2YWEA 3S1LA 3LLCA 5IKOA 3OCZA 1VP3A 3FUCA 3TUIC 2QPOA 2Y77A 2O7VA 1WPQA 2PR7A 2G5PA 5J59A 3IDZA 4ARZA 1SVLA 4C0BA 5IWCA 2IK8A 3V7WA 2BFOA 1NL3A 1FNBA 2XMBA 2HF9A 2YXDA 3HB5X 3K5HA 3KZCA 5CX1B 5LMNB 3NIFB 4MI6A 2HZBA 2OAGA 2Q3DA 4NNPA 2YVQA 2OYCA 2JCYA 1GZHB 1P1BA 3ST7A 1SVNA 1DQYA 1FSZA 1RMTA 4WTOA 1KY4A 5I7AA 2PNJA 3U62A 2K2QB 2XQIA 4F5EA 4N18A 1VECA 3A4TA 1EZ4A 2OP0A 1HV8A 5EMLA 1CEXA 1WTAA 5KC8A 3ESQA 4UARA 4JVMA 3VOSA 5BNIA 5DW3A 3AEQB 3DDOA 3ZV7A 1PIWA 1QKJA 1TM3E 1W6UA 1YDFA 4HVTA 1N7GA 3K1YA 4JL5A 4URVR 3EG9A 4ZQBA 1JIKA 1IUKA 3ITKA 4LJ9A 1O08A 3V4RA 3OG9A 3K0SA 2I4TA 3HFJA 4G65A 1XVUA 4ENVA 5FR2A 5I4IA 4OQ4A 1X7ZA 3Q8MA 1Y4DE 1MO5A 2GZ1A 3E3AA 1IPHA 2GX6A 3JD1A 3PI7A 5JCZA 2GEFA 2NO6A 5CEEA 1YBFA 1TF7A 2IP4A 3EXIB 4Q9DA 4PN7A 3ZDRA 5H3HA 1OY1A 2A14A 2XVMA 4NOKA 5DF1A 2YV3A 6Q21A 1KQOA 4ZALA 3TOSA 5EESA 1LX6A 2H52A 4MR8B 1AHPA 3KT8A 1IRIA 1HEUA 3FYHA 4LDJA 2G9ZA 2C77A 2WMDA 2Z04A 1RRCA 1E2MA 2EFCB 2GUWA 4NAVA 1JWBB 4QUHA 1VB3A 2QDKA 3OCVA 4QC2A 1FPQA 3P9NA 1P3DA 1WXGA 2WRZA 3AXTA 5FWXA 3ZVKA 3PPYA 4CEHA 3I9LA 1QFZA 3H9GA 3LOUA 3OWHA 3RUCA 3SU8A 5KTPA 3X0DA 2QEQA 5DM0A 3ZDZB 1OB2A 2YXLA 2KHZA 2W00A 2WV7A 4OL0A 5JQGB 1T8PA 1U8CB 3GVIA 3NHLA 4YCMA 1T2DA 4YRTA 1Z62A 7GPBA 1OREA 1SQ0A 2EL7A 4UEOA 2I8LA 2DY1A 2QY9A 5CTAA 3T15A 4E13A 3G0OA 4JC0A 1KMNA 4E14A 2IL1A 2OQ2A 2Z56A 1T2VA 3D4PA 4JOQA 5BVHA 1V16B 1BS9A 2WM2A 4XX0B 1CNFA 3G2LA 3TLBA 2JHGA 4NOMA 5A05A 3V80A 4BGDA 4IG9A 1URPA 1YB2A 2YHSA 4HDSA 4XB2A 1RJGA 3I9MA 1PAUA 3S68A 1WETA 4R8VA 1VMEA 3IQZA 3ULKA 3AIIA 1VJ5A 3R41A 3ZE1B 3RYCA 2Z30A 4PLHA 5KVQA 1F5NA 3PFGA 1S5PA 1D0VA 4Q1EA 4B6EA 2AK3A 1CB0A 2NYAA 4HNVA 3SYRA 1D6MA 3V1LA 2C5FA 2QN7A 1KZ9A 2FMFA 4EW6A 2IFTA 4TUYF 1UJCA 3KHSA 1EHYA 3JW8A 4UFPA 4N8DA 1I51A 3AH8A 4XB1A 3LVBA 5LZ4A 5MF6A 1J56A 1NPDA 3M89A 1XVIA 3DMYA 2O2SA 2WYHA 2MSWA 3LGAA 1WPRA 2CVZA 4EPXA 2CJWA 1DJPA 5HIMA 1V47A 2XI4A 1IQRA 3ZX4A 4ZFNA 4RIIA 1LTQA 1XYYA 4FYWA 1I0LA 1P72A 4UDNA 4C3UA 1ESDA 3RTEA 1HRKA 1R12A 2P35A 2HNBA 1CZKA 5IMSA 2X6QA 1FMJA 1P6UA 3FPBA 5D51S 4DIDA 5I7WA 3S70A 3UJNA 1SOUA 1YNOA 4R1LA 4G5OA 4FNAA 4LIPD 1XQ1A 3DL0A 4B2YA 3TBKA 1RJ9A 2UYCA 1ITZA 1GGNA 3L6OO 4RLHA 1BHQ1 1RJWA 4FHEA 5C2JB 2RK6A 4FD3A 3RSSA 1XD2B 4B35A 3PNVA 4B8YA 2BAGA 3BZWA 5AHXA 3Q8KA 4OSEA 4PHCA 2J87A 1PV2A 3DNFA 4LGYA 5I7RA 4UTVA 3TOCA 3W8FA 1VE9A 3I9OA 3MJVA 4IW3B 2WBLC 2R00C 3OECA 4ZD6A 4CJXA 4HB2A 2BR3A 4UNQA 5EVJA 5G02A 3RKRA 1Q22A 4NLLA 3G0IA 5COBA 3TVYA 3U6BA 1HT0A 4J0GA 3EVZA 1RYHA 5BV2P 3GAMA 1IQPA 4FKMA 1MO2A 3SF8B 2LIPA 3OEED 3I64A 1JU3A 1IN5A 3RSOA 4MRPA 1BCRB 1MJGM 1DEAA 4O59O 4MI3A 3TCNA 5FBQB 1H6CA 5JJIA 3MTGA 3CXUA 2GN9A 2P9CA 3IMFA 4EA9A 4XOIA 1NXSA 2OYSA 3OZSA 5CDYA 1KR5A 3T4EA 2WPDA 2NTEA 1C3OB 4C4PA 4EKIA 4AO7A 3KYIB 4NNJA 4DA7A 4EA8A 1AQLA 4E0BA 3A8TA 3EY9A 1OXBB 3TXAA 5JEDA 2RONA 3HYLA 2ZQ5A 4QBKA 2XXAA 1VCHA 3W4KA 4ID9A 4EDHA 4GKJB 3AVUA 2ZBPA 1D2CA 2A57A 2NXWA 5C8VA 2RHHA 3Q9UA 4UHEA 3ZCSA 1KJ8A 2ZIWB 3QVMA 3CYFA 3E9ZA 4LQLA 3FMOB 1UAAA 4JL6A 3BBLA 5FPYA 4DUGD 2GWHA 5ALPA 5KO2A 2WW8A 5JQGA 3U4HA 1W5TA 5CLLA 1R64A 1N77A 3JAWA 4EKNB 4GE3A 4HGNA 3RSZA 5AW8A 6YASA 5KYKA 4N1AA 4DNFA 1Q6YA 3WIEA 2I1VB 4PXSA 4BIIA 1OIXA 1NP6A 2C2OA 3LQ1A 2IVZA 4Z9AA 5DEIA 1YR1A 1XMQB 2PCLA 4GOJA 1OZGA 1TYBE 1VSTA 2N9UA 2TRSB 2ZITA 2CVOA 3KK0A 4P93A 4BNGA 3FFAA 1DTWB 3TOXA 1SB9A 1ZUWA 1K6IA 2GNAA 4MUJA 1E1KA 3P96A 4MA5A 4NU8X 1LV7A 3AM5A 3X1WA 2IJGX 2Q21A 2XXJA 4OTZA 3OLQA 4YGXB 3GJ8A 1L4YA 2CNBA 4HL6A 1E2IA 4NCNA 4Q9IA 4MCJA 3JQPA 4MV6A 2ZIXA 1R4AA 5A4FS 4FOLA 4NS1A 2UUAB 5THXA 1VZ3A 2XE7A 2L69A 4UUNA 2NVUB 3VZCA 5IJZA 1FS5A 3JZFA 1CR1A 4I19A 2UZ1A 5EJ7A 2J7PA 2VTKA 3LP5A 3QYFA 1BQ4A 3PEWA 5BSRA 1DKPA 1Z08A 2IPOA 2FMTA 5EEHA 3H9UA 5JHHB 5EI5A 2YWGA 4PG6A 4KQFA 3DT6A 3ASUA 4O8ZA 1J42A 1EM8A 2HGSA 5FIUA 1R37A 2HA5A 3PDIA 4HNAA 4YMIA 5A4KA 2OAQ1 3VH3A 3KSDO 3CVVA 2AT1A 2CSUA 2ZDGA 3AJ9A 5HOEA 1YS4A 2C9YA 3FWYA 1EFTA 1YBVA 2VAXA 1E20A 4P5EA 1J0AA 2H8KA 2WVJA 4QNRA 2GCIA 1GPLA 2XXBA 1UMCB 4YECA 3X2EA 3U19A 1M5RA 1IM5A 3WV4A 4B5KA 2IX3A 3I04A 4I8IA 4K9MA 3IBTA 4GR4A 1QV6A 1FMFA 5KKAA 1CRWG 2D0IA 2ZTMA 3HDTA 4M1TA 3C3YA 3U44A 1IDOA 4MKRA 4BN5A 4JJFA 2QBYB 1VBKA 4FW8A 3WL6A 5JMOA 4AMYA 4G25A 2JVIA 1ODSA 7MHTA 1M8FA 1B41A 3AMVA 3ZHBA 4FOTA 4A7PA 5I51A 3O8NA 5G2OA 1T0JB 1QFSA 1KK1A 1LBQA 4I9GA 3ROXA 4BU0A 3IYLW 2KE5A 2WNSA 4IDHA 2N0SA 2XNSA 2HIMA 1RW4A 3I2FA 4CKEB 4KRGA 2GA9A 2Q6IA 1DAHA 1J23A 1M2OA 4ON9A 4ENRA 1ZH2A 1LBEA 3M9LA 2HSJA 2EL9A 1R2QA 2DQZA 2BJWA 3AIMA 3IE0A 4ZZ3A 3GN1A 3EGEA 1U3DA 2W98A 3FOBA 3QKSA 2C8LA 1RI1A 4BMXA 1G5FA 4DPLA 4BEJA 5BW8A 5LFAA 2J9YB 3MCVA 3ZV6A 5CITA 4RIEA 2PVSA 2YYSA 3MJHA 2E7ZA 3OZGA 4WZBE 3SC4A 1W36B 5ALIA 5DBOA 2O0HA 3ORRA 5B53A 5TB5A 5FLXA 3M4ZA 1ZK1A 1NW8A 4X6LA 3H5IA 4KFCA 1NJGA 3ABOB 3WLSA 3OQ6A 3PUJA 4NZZA 5BNTA 3BT7A 3K0CC 5DULA 5DW0A 3LY7A 4OHBA 1H6BA 4XJTA 2VPZA 1EWQA 1GKYA 5CFMA 3DPUA 1A7JA 2BC9A 2OGUA 3F96A 4AP9A 5TR9A 5E9QA 2FMIA 2ID8A 6GPBA 2H1RA 1PR0A 1VPEA 1C41A 1ZIYA 3NC4A 2ZBQA 1O57A 2PUDA 3H3XA 4YH1A 1DAIA 3FFXA 3TBFA 2EHDA 3QNUA 4PGHA 4YP6A 4DVJA 1QVRA 3K6RA 3DS8A 3CB4A 4R51A 1ZDMA 3KZVA 3FBGA 3P9IA 4US2R 1UT5A 3CSUA 4KJXA 1YIAA 1I2CA 2J9RA 4Z53A 4QHYA 3UCXA 1IE3A 3AP2A 1PYGA 3RF6A 3PICA 3OQ1A 4FYKA 1F38A 5CJPA 3VTFA 2PBZA 2PQ2A 1Z47A 4GNRA 3DDZX 4TN1A 2F4VB 2WUFA 4F0JA 2YOHA 5J2UA 3V8VA 1SRRA 1R5OA 4N76A 1YVRA 1C4WA 1SUBA 2X9VA 4P4UA 3RT7A 4E70A 4J7AA 2MIIA 4CM9A 4B6SA 2Q0QA 4EEZA 1KWGA 4J0EA 1NBAA 4KAJA 4P9NA 3F46A 3RKSA 1T4BA 4DC1A 2O8CB 2XNDD 3IRUA 4AF6A 1I6LA 1N78A 3M49A 4D6XA 2QRQA 3FUUA 1GNLA 1I1QB 1SRQA 3KFLA 3LCRA 2R7NA 1CHNA 1KSJA 3AFNA 2OQIA 4Z86A 1H4SA 1MQ9A 4YRMA 1GRCA 1OFTA 1UC8A 2FU5C 4DG5A 1NHGA 1S96A 2WYUA 2R1TA 4FUQA 3L8HA 4QEZA 3U26A 2V65A 2GK3A 1E3WB 1NUPA 3P0HA 1R1DA 4RXTA 4UEJA 5DGDA 3I3OA 4IWNA 1ADCA 5KX5F 2HIHA 5L6LB 1YB6A 5C7YA 1AGPA 2GOYA 5JCPA 2DPLA 2QRPA 4RVUA 1CNEA 5DVZA 3UXHA 2LW7A 4PEVA 1SHZA 1JUDA 1QO7A 4Y2YA 4AYWA 2BFCA 1SKQA 3EWSA 4GLBA 3D5TA 3EGXA 3I39X 2ZYVX 3KR0A 2PUEA 1T34A 2A88A 1XF9A 5F5XA 3GLHA 1SY7A 4QGBA 4RVFA 4BC0A 4HH4A 1I4OA 2BFEB 3WNQA 1RDFA 1AZTA 3PVSA 1P9RA 4Z9YA 4QEDA 3KE9A 3DNMA 1XZMA 1NPYA 2F1RA 3P52A 4U6SA 3ABRB 3G82C 3GWGA 4MUKA 3FOZA 1AQUA 3KWFA 4PVCA 5L8VA 1TCBA 4O4LB 2R8EA 3QXGA 4RV9A 3I72A 3LDFA 4OHOA 2XKKA 2AQKA 5EXDA 1G3IA 3UK0A 3VPGA 2FDXA 3OPYB 4LRQA 4Z1MD 4ZOQI 2MSLA 4WA7A 4HZGA 1ZPDA 1Z06A 3AJDA 4KMRA 1KGSA 2J59A 5AVZA 4MUEA 3RVPA 2WD7B 1EU1A 1BXKA 3M6WA 3MXOA 1QHXA 3C7DB 1FMTA 3UPUA 1IVNA 2Z8YA 4AKHA 3PPWA 1RAIA 5EE0A 1G2QA 1G16A 3AEUA 4EA7A 1SCKA 3FKJA 4KH1A 4JVOA 1ST2A 5HIIA 4D8UA 3H5NA 2C88A 2F48A 3USZA 4IMJB 4MW5A 1FUKA 3EVDA 3OLYA 4XWWA 1A9TA 1R15A 4MS4B 4DS3A 3T3MB 1Y98A 1HDRA 3NCTA 1AUXA 1ECFA 2FWJA 2D59A 2GBLC 1H65A 2PSFA 1I4DD 2Q3EA 1PEAA 1XALA 3A9SA 2J5QA 4UNNA 1XCBA 5EE1A 4DR2B 3QFFA 2QI9C 2HMVA 1FPMA 3UZUA 4WEOA 3B6JA 4IJVA 4CG1A 1MW8X 4XR9A 5JZ9A 5GIOE 1EB9A 2A5LA 3G3EA 5CLFA 7REQA 4QREA 4QPPA 1KEWA 4V2UA 2CCJA 4OOEA 3VVCA 4C4XA 1OA0A 1A1SA 3BZBA 5AH0A 4F45A 2NZJA 1OZAA 4Y6SA 2PZGA 4ZVLA 3B2NA 1XLVA 3QPWA 4XSGA 4X54A 2B94A 4YCAA 5ALEA 1PTJC 4EGJA 2C7PA 1YZNA 4PQEA 1SXQA 4LE0A 3VC7A 3MYRA 3LA6A 4EHJA 3AZQA 3DWFA 1E8NA 2X8WA 5CIYA 4FP9A 2JFPA 4O4JB 1LKZA 1SKYE 3TTUA 4M0MA 2JCSA 3UV7A 1QRUA 3HZZA 2M6KA 4TLMB 2ALJA 1Q5PA 3RG2A 2B35A 5A4IS 4C0LA 5IAAA 1DV1A 3PDWA 2EQBA 4DDTA 3NUZA 2PGIA 2DE0X 1P2VA 3K15A 3T7RA 1W19A 2CDNA 4PC3A 3OZUA 4QQKA 4EHAA 2XR1A 5B1SA 5FB3A 4PG8A 1VJRA 4IGKA 3UJ6A 4XD7D 5KB3A 1WNFA 4M9QA 1H93A 4YRJA 4PVDA 1GUYA 4XLZA 1OV4A 1WZIA 5ALSA 2IC5A 1JZTA 3C7CB 4PIVA 4C4TA 3DE0X 1EKXA 3WK6A 3TOVA 4MUMA 3E5MA 2X2EA 1V9SA 4TXJA 1S8NA 1W88A 3QVWA 1BE1A 5E38A 4Z51A 4KUGA 3H4TA 4W7SA 2JVKA 4YCBA 2ZJ2A 4TYWA 2UZ0A 5DTMA 4N0PA 1CRPA 4KQWA 3HCPA 3TLGA 3WMRA 2OGTA 4H1UA 2WWRA 4W9RA 1PU2A 1N75A 1JAHA 2IEBA 2OLKA 4UU0A 1DWUA 3Q3EA 2DJIA 1QP0A 2BGNA 3T7EA 3IR7A 2G67A 4Y3UA 4JI7B 4FK8A 1NZFA 4ER5A 4Z4GA 1O1YA 4ND5A 4RJKA 2AE2A 4RVCA 3C3EA 3C3KA 1JAZA 1Z82A 1A2BA 3LUJA 2AWOA 1GXSA 4RQBA 3VV2A 3U4AA 4NV3A 1V5EA 3CUYA 3D31A 1GKIA 2OBXA 3BK7A 4NYMR 5L3ZA 4ENQA 3A37A 4JLUA 1QH9A 2AX3A 3CRRA 4X9XA 1Z0KA 2QQFA 4DHWA 3ZXIA 5K8CA 2NYVA 2PKRA 5L95A 4BZXA 1W46A 2VYVA 3AU9A 3OQPA 4MVJI 4Q82A 4ZAYA 2NU8B 3RAGA 4XOUA 1JVBA 3HCBA 4B7UA 2VT3A 2AFRA 3F2IA 4IJUA 1KAGA 1NV9A 2OO7A 3K9WA 3VYTB 4Q93A 4MYUA 2N3ZA 1OXKB 3C8UA 4MLZA 1WEKA 4UMDA 3EA5A 4Y0VA 3ZLUA 4B6RA 3ZCTA 1DRVA 3WP0A 2BEJA 3VYUB 2I6GA 1XTVA 3IILA 1EUQA 1N3LA 5TQVA 5TDHA 1JMKC 1J7JA 4D02A 1JEJA 1Q7TA 1U3TA 2IHTA 3CV3A 2ZK7A 4CUJA 1H9AA 1RQGA 2EBFX 5MGNA 4CG3A 5LVAA 1WSBA 1EGQA 3LQKA 3LCMA 2ZJBA 3OPMA 2Q2OA 4LSWA 3FGZA 2CFOA 1G4AE 2VNIA 4FR2A 5KQGA 1C1YA 3G0GA 3ISVA 3QKWA 5L6MB 3GEDA 4RORA 2PYDA 2ATIA 3UO8B 1GL7A 3JQQA 1KI3A 3EF3A 3NO4A 4PV7A 2WB4A 4LA4A 4LRUA 3IQHX 5E8JA 5LDGA 3ZXSA 2CV2A 2B30A 2C20A 1MT3A 3GBSA 1PTJA 1S01A 3AUSA 1I3NA 1X7HA 3P5SA 4RGYA 4YI3A 1SD1A 4EIWA 1XMIA 1LK5A 2GZHA 2HK8A 3PFHA 3IVMA 1N2CA 3RE1A 4IIXA 1RJDA 1Z6YA 1P0FA 4JP5A 4IH4A 3IEIA 4OSPA 1ECJA 3UJPA 1EM6A 2JEZA 1TYZA 3FD8A 4R7ZA 2PH7A 2O2CA 2DFPA 2Q5CA 4GEGA 4HO1X 3RUAA 3ASVA 2CD7A 4BNLA 4E09A 3AF5A 4DQDA 1ABBA 2IH5A 3CRZA 4M8KA 2B8JA 2HT6A 2AZTA 3MTDA 4HB4A 1J7KA 2O48X 3HU5A 3K9LA 3EZLA 3AC0A 2FXIA 3WLRA 3D5QA 4UNPA 4G5GA 4MIKA 5BR4A 2OBFA 4Q0MA 4XYGA 3DCNA 4HAVA 3BWVA 2WNHA 4LGVA 5JAMA 1JLHA 2F3RA 2O3UA 3LUPA 3FTQA 3WLKX 5FV7A 1ANKA 3DQQA 4OX9Y 4DJ5X 2OORC 5HF6A 4C0SA 1WVIA 3H3JA 4L4SA 4A1FA 2IYFA 3H11A 1BXGB 3ZLTA 4EP1A 2JIPA 1SXJC 1CTQA 2B1IA 2AVNA 3KPYA 2LKDA 1O8CA 1L5HA 3LT5A 1VPVA 3AOGA 4PSCA 1F06A 1TE2A 1Z2OX 4MKIA 2FKNA 1M1NA 2W7TA 3WRYA 1B42A 2R44A 2X3YA 3DW1X 4WWHA 3OICA 5EUMA 3WXMA 4YQFA 5KTOA 4X45A 1SH7A 3KDSE 1F0PA 4LC9A 3WQBA 4E22A 4UMEA 2PUCA 1N6IA 3DC2A 4M22A 3ZQKA 5JNVA 1KAMA 5A9SB 1P7CA 3WLEA 1FSFA 3GFPA 2DGDA 3TE6A 1M2WA 3L4SO 1R88A 2FN8A 3DXZA 4DBZA 3H5LA 5K0LA 3RSQA 1DC8A 4KCGA 3F1KA 2QJFA 3NH9A 1PT7A 1E9FA 2N1MA 5TS3A 2JLXA 5HILA 4CF7A 4DV5B 3REGA 1TU4A 1JDNA 4IFTA 1ZVMA 2A35A 3I5AA 1W4AA 2ILTA 3OP1A 4IDDA 1VKRA 3TPFA 1D1QA 4XVCA 4YRAA 4H59A 2V74B 2H7XA 2D7DA 1N9KA 3NYRA 4FCWA 2FXVA 2Z2KA 2YS7A 3QEMB 3QITA 4ARVA 3W4JA 1LU9A 3N07A 4CMIB 4B6PA 1JH8A 2Q07A 5AW9A 3W1WA 2PH3A 1KZ4A 1BX3A 2R3SA 1YE5A 4IGFA 4TWRA 4DG8A 4EBBA 5IVKA 3SSAA 2JDID 4PZUA 4LXXA 3UHOA 1FX0A 2BFDB 5AKJA 3NDIA 3UFBA 1IZ7A 4HX9A 4BO6A 1WUIS 1U9JA 3BORA 1H6DA 4MRAA 1JIQA 2FPSA 4E5PA 2UXDB 1RIFA 1APBA 3G02A 4FYXA 4YMVA 4TL9A 2O8VA 2ZB4A 3I6ZA 4R1QA 1SU4A 2POQX 2QB5A 4TSKA 3C41J 5AK4A 1JQJC 2HO5A 2APJA 3R7WB 1WY7A 5KJ1A 4UZFA 1KQGA 2RMKA 4RHEA 4YIKA 3VSAA 4HWTA 3DOHA 3WGJA 4L5YA 1G18A 3OI7A 4IXWA 4GLOA 2Y2VA 3EQ6A 2XV1A 3M3DA 1NP7A 2QXYA 4E33A 3GA5A 4EG3A 1U6IA 5E2IA 2ZI9A 5JG7A 4MROA 1CE8B 1N1MA 2MINB 3BKWA 3DEAA 4WGFA 3UUWA 1O4VA 4HI0E 4BGVA 1TYCA 5EOVA 1NVBA 1TUGA 2XT9A 4CKCA 5GVSA 2AUNA 5TMPA 1ZD1A 3H2IA 1FFYA 1V8DA 4Z8YA 3B89A 1ZGCA 5BW4A 1XYVA 1VCMA 1E4EA 5CU7A 4WSOA 1A7KA 4JUIA 3MINB 4ZVPA 2GILA 3AESB 3AJAA 3ADDA 3ZGZA 4GI7A 4HAWA 1RXIA 4XM2A 3LKDA 3OPQA 1F48A 4D4KA 1DWOA 3KJZA 5SZIA 1T9BA 1PG2A 1X8KA 4ZIRB 2FRDA 5AWFC 1IG0A 1RCTE 3ICEA 4XWYA 5EP2A 2QRZA 2TYSB 3H8VA 4WXHA 1YI0A 1L2TA 4QYMA 1AMOA 3FCSB 1AQNA 3W9YA 3IKMB 2G0AA 2BFDA 2AFHE 1JLLB 2YYAA 1Y7TA 3Q7TA 3B51X 3WNCA 1IYZA 2OCBA 2VK2A 1LW6E 3MYYA 1NN3A 5IARA 3RI3A 4ND8B 4OXXA 2DLCX 2Q27A 5E3IA 2PUVA 1YDMA 3F6CA 3M0EA 5EWLA 3C43A 1FCJA 2I7CA 1YR6A 2C96A 2GVZC 3A6KA 2NQ2C 3EXEA 1KWKA 3BXFA 1M0SA 1UAYA 2YL2A 3QBTA 1KQ3A 1YZYA 4NCXA 1J2JA 1Y8AA 5BSMA 4D0SA 2JJYA 4IFBA 1QRTA 1M8JA 4GL4A 4C29A 2H2DA 1P7VA 5CA0A 3BGOS 3H1EA 5A7FA 3GPLA 4FDUA 1BOOA 5IG2A 4QJ4A 4YJHB 4PPYA 2R6R1 6CHYA 4ZPXA 1V4NA 1YFZA 2IODA 7ADHA 1UBJS 4NVRA 5KHOC 1Q83A 4U7JA 1WW3A 2BEKA 1EJ6A 3PDJA 1ZKDA 3R2JA 2VJBA 4CG0A 4EF5A 4E5YA 2V7VA 4PWZA 2V3CC 5CLQA 3F7TA 2DQYA 4DLPA 3ETEA 2JAWA 4NAHA 4U6QA 3UMRA 5ADVA 5HZGA 1OWLA 4B33A 4QECA 1ETUA 1Y3BE 1N2GA 1N9GB 4WT7A 1DV2A 1Q7RA 4WRRA 1H05A 4Y2UA 3UFXA 1GG9A 3PCXA 5DOZA 3EWNA 4S04A 1RI2A 1G291 3NHBA 3LWBA 4IRMA 3VYVA 4BLQA 1HEYA 2FEMA 4HEA1 5IC4A 4GI1A 3GRVA 1WCYA 2QW0X 2IYTA 1FLVA 4W1SA 1BROA 2WYWA 3TIGA 1U9CA 1P45A 1VL6A 4RKEA 4B85A 2H0AA 1HSOA 2BGJA 3HI6A 3WQHA 4C4SA 3O8QA 2CKMA 2GF9A 1C1HA 4OAPA 1OGJA 1WXHA 1XDZA 2Z5FA 3KXPA 1YR8A 3E8MA 3MCUA 2CLMB 1X8JA 1KP3A 5CYFA 2BHSA 4EFDA 4UNIA 1DXQA 2LNDA 2PMCA 2C58A 4G8BA 4MK4A 4QYTA 3VKVA 4D45A 4ZV4A 4L0MA 1LB1B 4PZZA 2RHLA 2IOYA 3BAFA 3C4JA 3FGNA 2EKZA 4MGHA 1A3CA 1Q84A 1Z5GA 1L7BA 3DEHA 3CPSA 1YRAA 5D01A 3ZU5A 4AMZA 4YIHA 4OMUA 3SBDA 4R2IA 2W2QA 3H0CA 1HTTA 1F8FA 4B44A 3VO1A 2P0YA 5DV9A 3GARA 3TNYA 4EOGA 3G0HA 2QMZA 3O26A 3ZKWB 3AHEA 4URUR 2B82A 1Q14A 3BDIA 1HNWB 1AUVA 1Y6GA 2VI5A 1R27A 2YW9A 2IYPA 3FJYA 3MSXA 4OBEA 4PYNA 3ZTYA 3HVRA 2ZXEA 3E0XA 4TMKA 2WZBA 4GX5A 3GF4A 4W8OA 2BTQA 3NAZA 4A8JB 2I4NA 5KAMA 5CP8A 4NICA 3NBQA 3ERCA 2DUUA 3QUQA 4FQ5A 4UFNA 4ARAA 1OTYA 4E12A 5TGDA 1N5LA 1NN0A 1W1IA 1P2DA 3VR0A 4PPNA 2ZRIA 3GDWA 3K1TA 4ZCQA 3S6JA 3W5UA 3RTBA 3ZWNA 1EUZA 2XJ9A 4I46A 5GJVC 4X7PA 5EIEA 1NU6A 4YBRA 4DSUA 3ZHRA 2FLVA 2D2FA 2ANCA 3PC3A 5CT6A 5JXJA 1JP7A 1K98A 2JIDA 3AUAA 3IULA 2CMDA 1PQUA 1JLKA 1HQDA 1U3CA 1R7RA 2FWIA 3CEPB 4II7A 4ZRDA 1OH6A 5I7UA 3NFRA 4MO2A 1XTJA 1HZZC 3UG6A 1P7WA 1GAQA 2PEYA 4EA6A 1PEDA 2XOKA 3WMXA 1DPFA 3A6FA 1N6RA 1DWPA 2WIBA 3QE0A 3EGVA 1DRUA 2JFWA 2ZI5A 3GEBA 1BN6A 1XTBA 1WOMA 3FCAA 1VL1A 3H9CA 3NUGA 3PP8A 1TJ4A 4GC5A 4A0GA 2C8VA 4DPMA 3GXBA 1YAJA 2QE6A 2VXOA 2R96A 1WXQA 3A9WA 1VE3A 2D1TA 4NFHA 5ULLA 4KNWA 4DIFA 2FPWA 4OI0A 3UMBA 2QD5A 3PLRA 4XSHA 3CEJA 3S99A 3RV3A 4BO3A 3F4LA 3L92A 2ICAA 2XNCA 2AN5A 2P90A 2AN1A 1VJCA 3R24A 2FZWA 1C1DA 4IGAA 2DWPA 3B6EA 2P6NA 1J5PA 4GFDA 5EUQB 3LM8A 2R2AA 3M1YA 4KQXA 2OWEA 1KRWA 3HHPA 4KN8A 3OFNA 4BDSA 4GF5A 3HVJA 1K3UB 1ZICA 4X3OA 2NO4A 2GB4A 4JC5A 3FHTA 3C5HA 4GKVA 4JEMA 3EJ6A 1QYRA 2NXJA 5CA1A 2BSQA 1YCDA 4C6HA 5DHSA 2O8EB 3S1AB 2HY7A 3MQ2A 3GLUA 2HJSA 4JX8A 3UK6A 1W0JD 2O0LA 1SXHA 1H2FA 3GX1A 4D0LB 1R0KA 1JKJB 2RHBA 4A0HA 2J09A 5G3YA 2GEVA 2NPIA 3LTEA 3OCXA 1D2GA 5F35A 5E4TA 3W8DA 4BX3A 5BMVF 2GEUA 1UQTA 4PYJA 4I55B 4G0PA 3FKSD 4GXQA 3VR6A 3JWIA 3G0BA 3STVA 2Q7DA 3WLTA 5C80A 2QSZA 3KO8A 4BNDA 3KQLA 1Y1QA 5CIQA 1AK9A 1WCIB 2QXUA 4ML3A 2EJTA 3DKVA 5IT0A 4WLUA 2MSCB 3SC6A 5GPBA 5ALDA 3JAMA 3I0NA 2BJHA 3H13A 3HP4A 3WLJA 1Z15A 4KK4A 5DXFA 2Q9UA 4W5QA 2C04A 1PZHA 2J31A 3Q41A 4LMRA 4LF7B 1K8XB 1OQAA 4KPFC 1B1CA 1MN6A 1JI0A 2QVGA 3BTSA 1DL5A 3O4RA 4P84A 3RS4A 5B1EA 1VRCA 1VRWA 1C1XB 4F4UA 3D3NA 2OZLA 3G0CA 1ZK0A 3FTDA 1AGXA 1EWVA 1VI6A 4P08A 2YYYA 2P9QA 4A6XA 1UBFA 2QTLA 4NFYA 4EHDA 1A5BB 5AKXA 3TQQA 1A2OA 4DEYA 1T4GA 5M04A 3W1VA 1M6VB 2OEPA 2HUPA 3ICVA 5E1OA 2AB0A 4MW0A 1PV4A 2R1UA 1QDEA 1SBNE 4HSGA 2R84A 2BGIA 1PDWA 3V8QA 3WAJA 2VDWB 5FWAA 1QTQA 1TRHA 5IT5A 1YV9A 5FWDA 2OD2A 1ZUD1 4QGHA 2OG1A 4LRSB 4H4EA 1Z4LA 1FSPA 1FFAA 1CUDA 4DQXA 1VSQA 4NMXB 5EWLB 2V59A 2XGJA 2COEA 3BJEA 2QLMA 3IE2A 4UHJA 3TNLA 3VVLA 1VL0A 4DRXB 1SG9A 4DB4A 2XSZA 3EBLA 1M2EA 1JYEA 1T8SA 3L7AA 3OT4A 4LX0A 3BN3A 3O38A 5M29A 1RLIA 5CVEA 3FZQA 1JA1A 4BTVA 5KVSA 3OOHA 3E81A 3WO1A 3G5MA 3E9RA 3LVRE 1SXJD 4G23A 3GIWA 3JQ7A 1G20E 3W90A 4NE7A 4RD2A 1PX2A 3VTKA 1TM4E 2VAPA 3FJOA 1T4CB 4YHBA 3ZDFA 4D7AA 3IHKA 2NO1A 2VJYA 3SEZA 4IRXA 2DB3A 4LVCA 4S3MA 4NJMA 4CLDA 1YJQA 2Q5EA 2QUKA 2WUEA 4ZZIA 3X2SA 4FN4A 4OFXA 4EAAA 3W05A 5LLDA 4GI3A 1EFUA 4YRRA 1O94D 4MHTA 2IIVA 4OMDA 2Y27A 4EAQA 3GUCA 3GAFA 2H3EA 4FGZA 2OM2A 4KC0A 4AROA 2V0GA 3LXRA 3SBOA 3SNKA 4DV3B 1M0EA 3UT6A 2ZJZA 1OHHA 1L6IA 4I1IA 4ND7A 1BWQA 4BAUA 1FS4A 1S7GA 1O9GA 1EWTA 1F6BA 1MJHA 2R6GA 1GQQA 1LPOA 3D7NA 3LW8A 3RFFA 3V3TA 2ZRBA 3WDLA 4B4OA 5EJ4A 3DXXA 2QENA 3RSFA 4R8KA 3R7FA 4MITA 4UD2A 3VJMA 2VJDA 2NQTA 4KNYA 3DTTA 3BIFA 1NSYA 2GZMA 3K72B 3ENQA 2VTBB 4LFAB 1WVGA 2YY7A 1WL8A 4D9EA 1D0IA 1KEVA 2IDKA 1XJQA 4G4JA 4K9NA 3T4UA 3ASYA 4BOYA 5AHWA 4H6PA 1Z4JA 1EUCA 2R8ZA 1NLZA 1Z6TA 3WVNA 1I7QB 2J3HA 2CHQA 4IIVA 4PYMA 3X43A 1OBFO 3O0TA 5KWVA 4J4TA 4P4SB 3EDRA 3HRKA 2BFBA 1NVFA 1OJLA 1Z0JA 1CUGA 1N3YA 4JP1A 4GLJA 4Z49A 3OTIA 4Z7OB 5JAHA 4CL2A 1DDGA 2Z9CA 4ZZ0A 4FWTA 4X65B 3FNQA 3I76A 1LLFA 1U0FA 3VR6D 4A8JC 1GG2A 1K8ZB 4CMCA 1DARA 1N6NA 1PLLA 3MS4A 3PEFA 3ZV3A 1GIAA 3ROPA 5A06A 3WA6A 4NBWA 4NJMB 3NTQA 3TX2A 4EITA 4WH0A 3BBPA 5K09A 5T8KA 4O29A 1U0RA 4MUFA 5J2UB 5JJBA 1EBUA 1XSEA 5JS8A 2JFUA 2YHAA 3GRPA 2WTAA 1D07A 3WHLA 2C4UA 4OUDA 2ZRPA 4QJIA 3HSSA 3VO2A 2EDAA 1NUSA 3NC0C 4CKWA 1IWOA 3FMVA 1WSDA 2NV2B 3ZWYA 1R5NA 2FMHA 2HL6A 4FE3A 4IHJF 2Q3FA 1YL5A 2Y99A 1WDLA 3HA7A 5DNUA 3SIRA 2I67A 4B75A 3UJHA 1OGYA 4N3NA 3UKDA 2XUDA 2JB9A 4D74A 3LT4A 1JHAA 1KS2A 1EFRA 2IDMA 4ADSG 2P2YA 4ZVSA 4D82A 1PP4A 2PX0A 3KOYA 3R23A 3AW8A 4LHYA 4RKRA 2ZJ5A 3H8SA 3OTQA 3WYGA 3O7WA 1H2HA 4ZJUA 4FE4A 2PL5A 4RL6A 5LQAA 4RWEA 1G9XA 1UZNA 1OW3B 4DLZA 3AR9A 1UK7A 2BY4A 4I50A 3VUEA 3AF2A 3D6TB 5EZ6B 1GCUA 2Z57A 2M1XA 3JASA 3ITDA 3HO6A 4MKZA 4Q19A 1WHSA 1X92A 3WHPA 2BFAA 2QGZA 5JZMA 1GSOA 3WYDA 5JO9A 2IUYA 4RZQA 2CEAA 3LECA 3IIJA 1B6GA 4DEXA 1SVIA 3R0XA 4DCGA 1Q95A 1O58A 3Q85A 2DECA 1C30A 3GNQA 2HTEA 1XRNA 2XUJA 3N8IA 1AQYA 3QVXA 4QOJA 5IAGA 3WK9A 2CJXA 5T41A 3MELA 3HG7A 1GFZA 4K6MA 3SS7X 4Q3OA 5ALOA 5F76A 3TW8B 4AFNA 1TEXA 1XFAA 1Y34E 1GT91 1L3CA 4J0KA 4KNVA 4L8FA 4ZICA 1QGZA 3GNLA 4EUKA 3R09A 1YF3A 1OFHA 2VP3A 4WINA 1W7AA 4M1MA 2HFJA 2FUNB 1J90A 4AIIA 2G1JA 4BYGA 4MO9A 1P4AA 2EFYA 3NJ4A 4MMYB 3NORA 3SJAA 4WE3A 4MP8A 1KDOA 1J2TA 2W5UA 1CY0A 1PVDA 4AM8A 1EE9A 1VG0B 4GAEA 5A0FA 4DV2B 1IXSB 5ED0A 4K86A 1K6JA 2AA3A 2YZNA 3CX6A 4O2BA 3OY2A 1KY5A 2IIPA 4I8DA 4J6FA 4P33A 1REQB 3H42B 4X3CA 3KJXA 3C1AA 3T4PA 1LNZA 3UJ8A 3MWDA 3KDPA 1SURA 4FYVA 3UK7A 2HREA 2JK1A 4U2DA 1XZNA 2GKGA 2ZWPA 3QLEA 1ISFA 5CCBA 1AT1A 3YASA 3T3DA 5MDHA 2FFRA 2W2LA 1H6AA 4OHUA 3KWLA 4GMGA 5HJ2A 4B47A 4ND1A 2I91A 2IHNA 4YRIA 1QK5A 3OIYA 1BXGA 1VI5A 1PNRA 2DU8A 4DGSA 1LQUA 4H31A 1B16A 1PGNA 2H1SA 3AP3A 2JI4A 1Y4AE 4P0TA 3JQDA 2ISSD 3LO8A 1WCXA 1DFGA 1KJJA 4P8RA 5EXXA 4QPCA 3VYRB 5IAEA 3ZQ6A 2ORYA 1QRDA 4KL8S 4R98A 2ZSFA 3OPVA 1F17A 1GPNA 4OL9A 4YJFB 3QBDA 4BP8A 4LXIA 3ZNNA 3JVEA 3M34A 4LK3A 2ASEA 1U4SA 1V1RA 3NHUA 4ZXPA 1XYGA 2GBLA 3JU3A 4IDGA 3LYHA 4EKDA 3S1SA 3EPKA 4R6WA 2RHWA 3O3OB 4D4MA 1X3LA 3R5SA 4RACA 3V00A 4CODB 1G0NA 2R8RA 5JBQA 5KREA 3SYKA 3GGOA 5DYWA 3N28A 1XZKA 1YR3A 1XKQA 4KPUB 1X7WA 3GFGA 1TA9A 4LISA 1PSWA 1T1GA 3KAKA 4NHEA 4C9BA 2GM5A 4F85A 3SLGA 1U9YA 4NABA 4O5OA 3DA8A 4WL0A 3N0RA 5CEJA 4FHFA 1R74A 4OY3A 2Z6UA 3CHYA 1QH8B 5JNRA 1A8PA 1JA0A 2DZDA 1ATIA 1RQ2A 5BV0A 3JV7A 2QUHA 1NP3A 1SC9A 1FSSA 1ZK3A 1YE3A 3NFYA 4IIDA 1H8HD 4JR2A 3W2FA 1UXHA 3HACA 3TZEA 1Q0SA 1TJ3A 1PL8A 1XE3A 4TV9F 3UBTA 5CYGA 1H2WA 1EDZA 1FNDA 1CWUA 4WBNB 4YREA 2HSWA 2WV9A 2VJCA 3JALB 2PRZA 5CCDA 3WR5A 3KSAC 2XUQA 2VK1A 2YNMD 1AB6A 3FPCA 1DFHA 1NMZA 1W5AA 3HB4X 4NK5A 5DK4A 3C7AA 1J09A 4L9WA 1CBUA 1EDOA 2AOUB 2F43A 3QWFA 2FQXA 5HBRA 1PWZA 2H5IA 2OZKA 5KTMA 4GMHA 4QARA 3OHSX 1DT3A 3HJCA 2IF2A 4PE5B 1YS6A 5C1IA 1NKSA 1S4QA 4F5YA 5ALRA 4CLXA 4MQFB 4W63A 4GPD1 4X63A 3JQCA 4WMLA 3QEAZ 1NG9A 3NEJA 1XFDA 3L7OA 1JECA 5EQTA 4NCBA 4YEDA 1ADJA 2HK7A 3IVGA 4TTQA 3UGQA 1JHXA 2VLIA 4XWAA 2DCMA 1Y6FA 2PZ8A 1PL6A 3CNLA 4OI2A 1NNEA 4F2GA 4RSHA 4DCMA 1NVXQ 3CKKA 4JEHA 1WHTA 4Y2QA 3QF4A 5EIAA 4HQ6A 2H2GA 1DCTA 4H6VA 3A4MA 2ZUEA 1G3MA 2EU8A 3FNEA 5DJ5A 2P2ZA 2KS6A 1GLVA 2PZMA 1UJMA 2WG2A 3K7EA 1NT4A 4IIJA 5AD1A 2L2QA 2NYRA 3RAFC 1EWYA 4JLMA 3LVFO 4TN5A 5CXUA 3NHWA 1VSBA 2CKDA 2JJ8A 1BDJA 3R7SA 3QXHA 3U13A 3RTCA 3HBMA 4L7QA 4XKJA 4C6TB 4CLOB 1TTTA 2VPYA 4BU1A 1M2VB 2YZMA 5GIPE 3C3MA 5F77A 3SX2A 1Q57A 3CWQA 3COPA 4WV3A 3L7DA 4TQ9A 1XJ5A 4DCPA 3PQ8A 1VMAA 2BIFA 3Q15C 2I5PO 3AO0B 1ISSA 5I7FA 1X15A 4OU5A 2XQVA 3TB6A 2PS0A 2DPXA 3PXUA 4PSVA 2FW9A 4BE7B 5A4AA 3OQNA 2BCGY 1JDZA 4KQCA 4Z0NA 1A9PA 2XRZA 2FRXA 3CEMA 2KLHA 3G2IA 4PICA 2BGLA 2G9UA 3T5BA 1FFXA 2DUWA 2FR1A 2PX2A 4L6CA 4OXRA 2G09A 4BLOA 3L1VA 1VYHA 3J81A 1NF9A 5DO9A 2RK4A 1ZXLA 1G2OA 1I1OA 1NC1A 2PWBA 2PVPA 4L5JA 5ECGC 5H4GA 1L5OA 3KUDA 4BTLA 4EUHA 4FB4A 1D2HA 4YASA 5DNVA 4CIBA 5E7JA 4PCUA 1K7FB 1DWQA 1UWVA 1KO1A 2QD3A 1KAQA 3LV8A 2J8ZA 4BFUA 1O0CA 3L0OA 1ZN9A 3NWBA 3DMRA 4AMUA 3DMHA 1MG0A 1QIGA 3JD4A 4QBIA 3QFTA 4BLSA 5ES4B 1EI9A 3JYNA 4H6XA 4N8SA 2VZ9A 2A9QA 4OI1A 4FOOA 3UAWA 1MJGA 3UB3A 2HWUA 5F3DA 3GEGA 4K9DA 4BV2A 3IEUA 4D3DA 2JIZD 1JHYA 4I1YA 2PYIA 4I1SA 4NYMQ 3VR4D 3PT5A 2WT9A 2P5YA 2XT6A 3BF8A 1XG5A 1RXWA 1ULHA 1SBTA 1MV5A 1NOJA 3UOWA 3K1AA 1GQYA 3A4YA 3NBXX 2YNMA 4FXOA 4LI0A 4KO4S 4ARSA 4RF5A 1ZH4A 2ZSBA 1PZGA 2HLHA 1VLQA 4K6KA 5FTNA 1ZX1A 1AIPA 3RYFB 1GCAA 2YXPX 2IY8A 4FYPA 3ZXYA 1DQZA 3NGLA 3HH8A 1R16A 2A5JA 1H0SA 3TIIA 2XMCA 1CUJA 2O7NA 3L8CA 3B3QA 4INZA 1THGA 4ZQCB 4GGOA 5KHAA 1JDBB 4LYAA 1CUIA 2WFAA 3DZDA 1S0UA 2XGMA 3KCNA 3MEQA 1IHUA 4KGVA 4DB2A 2P4HX 3O4GA 3ZYZA 4HLUC 1BKSB 3OOEA 1E77A 4R16A 3OCJA 4HF7A 5TEWA 3ID6C 1QGAA 4RV4A 1J1UA 1VCIA 4R7TA 4B09A 2F8LA 2PZEA 1QVZA 1YZTA 3U44B 2NP6A 3INGA 3OQJA 3ONFA 1LLQA 3ZZNA 2EP5A 4G0QA 1TGVA 1YVEI 5ALTA 4DHEA 1IZ9A 5D3MB 3BHIA 2XWSA 2O6HA 4H3SA 5ITSA 3LUBA 3THYA 2Z2YA 3DBLB 3K0KA 1J07A 4HYYA 4TTVA 4PINA 5BWMA 4RTRA 3GLFB 4Q4AA 4YMWA 4CN9A 4ZYUA 4AY2A 1P7ZA 3QELB 3QWAA 3N58A 4Z7JA 4QICA 5DGCA 3SZGA 3WL7A 1K66A 2EIXA 3S40A 3U4DA 3CX4A 2VF4X 3P4YA 2VQ3A 3CJTA 5D5HA 3D54D 1R8SA 1RFGE 2F1OA 4NJOA 3OQBA 3Q98A 3FNIA 5TSDA 5EAIA 2GPBA 1QE0A 4TLLB 2AYYA 5BY2A 1UKAA 2QSJA 4EYSA 4Z0PA 4ZAVA 4G41A 3WKAA 1E3MA 1KSHA 5AM0A 3C98A 3WLQA 5D00A 1U81A 4MW7A 1TTPB 1BJRE 1FRQA 1YCFA 2NSDA 3QQPA 3A1UA 4PG4A 4Q15A 3HQ4O 4IZIA 1PBNA 3SR4A 3THRA 5EE5B 2PSSA 2P6OA 2W0MA 3UJBA 1KJZA 3HUTA 5DN6D 3EEOA 2FPKA 2XMPA 2Z1MA 2OSVA 2UZAA 4LVUA 5A71A 4XPIB 3I28A 4J75A 1T35A 4KFTA 4I08A 1GO2A 1VHQA 1AKMA 2FOXA 3KU4A 4UUMA 4IV5A 2J4DA 2FZCA 2HN9A 3EOZA 1VG1A 3FWPA 4RVNA 2GUGA 2XAAA 4JXXA 4M9SA 2J5KA 5AVKA 4WZ6A 1AZSC 3R5FA 1FFXB 1KMHB 4BLTA 4HLUA 1GU0A 3SX0A 4X1YA 5DNYB 2O2ZA 3F47A 4L8GA 1DAOA 3R3YA 4G8JA 2WJ6A 2JCGA 3DBLA 3OZAA 2C0CA 1NIPA 2HSGA 1MVLA 1Z8HA 3HDHA 3X3HA 1WD5A 4C0XA 3L18A 4ZXFA 3PWTA 3HDGA 3MINA 1D6SA 2C4TA 1COWD 1FYEA 1IL0A 3O6VA 4C7VA 5A0TA 1JHRA 1PZFA 3TL3A 2PAFA 1BU5A 3QVGA 1DC4A 3N8NA 5FCDA 4MINA 3HVHA 3WS7A 2AG1A 2RHRA 1K6MA 3HCDA 4C2UA 5I45A 1T9GS 1E92A 3PC4A 4KN9S 4O33A 5DYGA 1VKHA 1Z5UA 3FTPA 3IOCA 4Y6RA 3LMKA 3VGJA 3G8YA 2BTOA 3DE3X 4N8EA 4UULA 1KP9A 2PSDA 3GFRA 3OH8A 1BDBA 3AUXA 3O3CA 3EHEA 3UWSA 3F90A 5BW5A 4Y98A 1R0XA 5I6DA 5KNLA 3GMSA 4W9NC 2R6JA 4Z54A 4RPLA 3AR5A 1A7UA 1YK1A 2P2LA 4B3DA 3RYFA 4ARIA 4IJ5A 4ZCLA 3BG5A 1I14A 1ZK2A 2JPDA 4KH0A 1DO0A 2PBLA 3HUUA 4H7FA 5FL7D 4ZCTA 1X0XA 2CLDX 5CFZA 4YJ3F 2FEOA 1I0ZA 1MX5A 3Q3VA 2RAVA 4EF6A 1DAMA 5K99A 1L8OA 4X71A 1IZZA 3RU9A 4BMNA 3I4LA 3KVVA 2GXSA 5ARDA 5FKJA 5I5GA 1Y7HA 2HADA 2Y0CA 3L0DA 4G0YA 5TMBA 4ZDIA 5B2EA 2I9KA 4HAXA 4X3PA 3W8RA 4EY4A 2JH8A 4WLFA 5A7HA 1QZUA 5F7OA 1GVNB 5EERA 5C46F 2F00A 1WUJS 3OLWA 4YLYA 3QXCA 1FNNA 3GCGA 3JQEA 4N0MA 1BCSB 4NE2A 4E11A 2G0TA 1IXKA 5J2TF 4EF4A 4F2PA 3K8QA 4P4TA 2YCLA 1N2EA 4IJWA 1I3KA 2ZTSA 2C5HA 3A6EA 3N59A 2HX1A 4IDFA 3U56A 2VZ8A 2ZCJA 2O0KA 4TVSA 2OV3A 3LDHA 1VPLA 2D0PB 3I04M 4NC9A 4IUYA 1FK8A 1U1IA 2XGOA 5IM4A 3I37X 4UU8A 2QZJA 2XKBA 1JDSA 5TT0A 2XCTB 1M73E 1BOFA 3SIWA 3T8YA 1L7VC 1QYCA 1TQDA 1HE1C 1MAVA 5SYAA 4CQLA 2ZUTA 3HUEA 1G5QA 2FY8A 2XOEA 3CIFA 4KXWA 4LOJA 1UPAA 1HDXA 4TMTA 2VHCA 1ISGA 1H1LA 1J24A 2BWJA 2OFWA 3HWRA 1JBQA 1KI6B 2O23A 2FEXA 3VC3A 1QU2A 4I4TA 1QF9A