3PHCA

Crystal structure of plasmodium falciparum purine nucleoside phosphorylase in complex with dadme-immg
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
243
structure length
243
Chain Sequence
NLLRHLKISKEQITPVVLVVGDPGRVDKIKVVCDSYVDLAYNREYKSVECHYKGQKFLCVSHGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHLLIHGDFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMYYPNKIIPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKLATKYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Crystal Structure of Plasmodium falciparum purine nucleoside phosphorylase in complex with DADMe-ImmG
rcsb
source organism Plasmodium falciparum
molecule tags Transferase/transferase inhibitor
total genus 82
structure length 243
sequence length 243
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2010-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3phcA00
4NY1A 4WKOA 4WKNA 3K8QA 4H1TA 1B8NA 1VHJA 4I2VA 1B8OA 3FUCA 1SJ9A 1RXSA 2ISCA 3UAZA 3SCZA 4LDNA 1PW7A 1RXCA 5B7NA 4TTAA 3IEXA 4G41A 1JE1A 1V45E 3ONVA 1JP7A 1YBFA 1U1EA 1SD2A 3O4VA 4DA7A 1ODKA 4JP5A 1TGYA 4TXNA 1Z39A 3DDOA 1Q1GA 3OF3A 4EB8A 3PHBE 4ECEA 5I3CA 4D9HA 2GUWA 1VFNA 4TXHA 4E1VA 1LX7A 5F7XA 3OCCA 4M7WA 2ON6A 1Z5OA 4BN0A 3UAVA 1CG6A 3DF9A 3DPSA 5IU6A 3ODGA 3UAXA 1NC3A 3KU4A 5FAKA 4LNAA 3NM5A 1ODLA 1K27A 5EFOA 4JWTA 4L0MA 5ETJA 4R2WA 3OZCA 4TXLA 1OTYA 2A0YA 1ZL2A 3PNSA 1G2OA 4LKRA 1C3XA 4PNPA 1V48A 1M73E 3UAWA 1OUMA 1RXUA 3NBQA 1XE3A 1A9QA 1JE0A 2QTGA 1NW4A 1U1DA 4MCHA 1YRYE 5F78A 1ZOSA 3LBAA 4EARA 4F3CA 3LA8A 2A8YA 3BSFA 4QARA 5EUBA 1JPVA 1PR2A 4OF4A 4NSNA 3KVYA 3BGSA 3KUKA 4GLFA 1V41E 4L5CA 1T8YA 4WKCA 5CCEA 4F1WA 5B7GA 1JDZA 1PR1A 4LNHA 1ECPA 1T0UA 5B7QA 4WKPA 5IFKA 3E9ZA 3K8OE 4G8JA 4X24A 1A69A 4D98A 4QATA 2HSWA 2QPLA 3FWPA 1Z33A 3LGSA 1RFGE 1VHWA 1U1GA 3OOHA 3GGSA 2I4TA 5F7OA 4NS1A 1OTXA 4BMYA 1U1CA 4M3NA 3KVVA 5F77A 4FFSA 1A9RA 1PR6A 1PWYE 1PK7A 1TGVA 4DABA 1JDTA 1WTAA 5F7ZA 5F73A 2H8GA 3DJFA 4QAQA 1K3FA 3FB1A 4MCIA 4F2PA 4U2KA 4F3KA 1RSZA 1RXYA 1RT9A 4QASA 4L5AA 4QEZA 3OZBA 5K1ZA 4KN5A 5CXQA 1V4NA 1LV8A 2AI3A 4OY3A 4D8XA 4YO8A 3INYA 1PR5A 4YMLA 1PKEA 4L6IA 1LVUA 1TCUA 5CYFA 1U1FA 4GKAA 1A9PA 1Z38A 4WKBA 4IP0A 1RR6A 1YQQA 2XRFA 4K6OA 2QTTA 4R31A 4TS9A 3PHCA 4MARA 1ULBA 4TXMA 4DANA 1Z37A 2RJ3A 2I8AA 5B7PA 3PNPA 2QSUA 4OEHA 3P0EA 1Z34A 4R2XA 1Z35A 1PF7E 1RCTE 4TXJA 3U40A 3EUEA 1JYSA 3EEIA 3MB8A 3DP9A 1V2HE 1TCVA 4TTIA 1K9SA 1Y1SA 5JPCA 1A9SA 1SQ6A 1V3QE 4DA0A 5C80A 4YNBA 4GMHA 2A0XA 2OC9A 2OXFA 3ENZA 2OC4A 1Z5PA 3BL6A 1YR3A 1A9TA 1CB0A 4QFBA 4G89A 3O6VA 5KB3A 3KHSA 4OGLA 4LZWA 3OOEA 2IQ5A 1A9OA 3OZEA 3FOWA 4DAEA 4JOSA 3D1VA 4DARA 1Y1RA 4UC0A 1PR0A 3E0QA 3F8WA 2PGAA 5F76A 1YQUA 1Y6RA 1Z5NA 3UT6A 3T94A 3IOMA 4M1EA 1SD1A 3BJEA 5F7JA 1T8SA 1T8WA 2HRDA 2AC7A 1VMKA 5EPUA 1TD1A 3KVRA 2HWUA 4OGKA 4RJ2A 4YJKA 3P0FA 1Y6QA 3OPVA 3QPBA 4P54A 3TL6A 1PBNA 2OECA 4OJTA 1JDVA 4GLJA 2A0WA 3EUFA 1OU4A 3EMVA 4TYMA 5CYGA 1ODIA 1ULAA 3OZDA 2Q7OE 1FXUA 4DA6A 3FAZA 5CCDA 5DK6A 5CXSA 1Y1TA 4TTJA 4F2WA 1N3IA 1RYZA 1Y1QA 2QDKA 3MMSA 4BMZA 4DAOA 1PR4A 1I80A 4D8VA 1OVGA 4BMXA 2AI2A 3C74A 1Z36A 3NM4A 2P4SA 3FNQA 4D8YA 2B94A 3GB9A 1OV6A 3UAYA 1QE5A 1JDSA 4DA8A 2HN9A 2BSXA 1PK9A 2AI1A 4PR3A 1ODJA 4L5YA 3NM6B 4TS3A 1JDUA 1NC1A 3E9RA 1T8RA
chains in the Genus database with same CATH superfamily
2R87A 4MWEA 3AUAA 4TN5A 3TNLA 1NJ6A 4LV8B 3RO7A 3PXEA 3A27A 1V95A 1XL1A 1E66A 2CUTA 4X8HA 3UH0A 3ZTYA 3Q1LA 3FSJX 3G49A 4U8HA 5EHXA 2WABA 4ZT2A 2Q6VA 1TEHA 2DSTA 3DZIA 4XIIA 1RWNA 5K0LA 2MCFA 3SVTA 5J63A 3TH5A 1GHTA 1YBHA 1RBZA 2C9CA 2E49A 3KEQA 5J2TF 3ZHOA 4BJ5A 1DC5A 4AY4A 3ZHCA 2BTQB 2E6KA 2QAGA 4LI3X 4WBSA 3QBDA 4A8JA 4HFJA 2HD4A 2ZU0C 1PFGA 3KP1A 2PHZA 1L8OA 3MCUA 1GN8A 1O6BA 1PNTA 3DF7A 1J33A 5BT9A 5FBLB 3K70D 2G0TA 2IHTA 2V55B 3CY6A 3LHIA 5B1EA 3SKVA 1C0PA 3OQIB 2O2JA 4OOEA 4R1OA 2HHJA 4LC0A 4OFBA 4TKMA 1JP7A 1F2UA 2EP5A 4GOKA 1YBFA 1FDWA 4QDTA 1WR8A 2OA0A 1FNBA 3NOVA 1U6IA 4TV8F 1G21B 3I53A 3GFOA 3TZHA 4B6GA 4TZKA 4ACAA 2QBYA 5A0VA 4PYMA 1QVVA 2H57A 4S35A 3CRZA 1VG0B 1Z4OA 2H0RA 1A4IA 1ZUWA 2ZIFA 1EXNA 2OZLA 3BE6A 4GBED 4UBJA 2VN8A 2WTXA 1Z2DA 5BT8A 1PUIA 3V55A 2WZQA 3MELA 3KNZA 2H1IA 2Q1SA 5DP2A 4HB2A 4EB8A 4YQYA 2HQBA 3UOWA 4K28A 4KDRA 3GFVA 3RC2A 1GTMA 5LPNA 2E4AA 1FYDA 2B37A 1E2DA 4BO2A 1OOEA 2B21A 2XR1A 4I5GA 5DBOA 4B6OA 4JK3A 4E1VA 2DBZA 1T35A 1O6FA 2HA3A 3SYKA 1H6DA 1O96B 4FJ0A 3OCCA 1RVDA 2XWPA 1PVDA 2AFIA 4EFKA 4GMXA 1E6WA 4LOKA 5HKOA 1EFVA 2IUUA 1CYDA 3JQ7A 3EIHA 3T7JA 1RC1A 3WWYA 4B0OA 2GH1A 1EDOA 4L2IA 3VO8A 4D4IA 3DTVA 1L4LA 4Y7DA 4RTLA 3GN2A 4G4SP 5JH7F 3ELUA 1ZVVA 4EHBA 3EPJA 1KFKB 1MV8A 2QVYX 3DNMA 7MHTA 4UOZA 1I4WA 2ONJA 1E2LA 3H4VA 5ES4B 4B4KA 2OORA 4WOPA 1SQ0A 3B9RA 3MFYA 3PS9A 1FNNA 1Y82A 4TUYF 3PBKA 1P1IA 1ETUA 3QVLA 2DLDA 1MT3A 5TSDA 4K9RA 4PTZA 1GP2A 3W2GA 2PLNA 3H0EA 3CEMA 2FWPA 1CZRA 3N2EA 3ORRA 4LSZA 3TSAA 3VQTA 4ENUA 3BAZA 2GRAA 2LNDA 4Q4HB 3QSYA 3H6KA 4F6RA 5AIBA 4FILA 4E08A 2IPOA 2QI9F 3OU7A 5TPZA 4YLYA 5C2JB 2R47A 4OHPA 4J0JA 2X8JA 1XT6A 2J3HA 1W0JD 2ETXA 2YC2C 3IP5A 4I4TB 3CX6A 5DTJA 1SXGA 3ICQB 4H7JA 1PG0A 3UWMA 2XUIA 1ODFA 4RJIA 4P86A 2OYRA 3WYNA 2AJTA 2QQFA 1NQVA 1SH7A 1NUSA 5H59A 4BLSA 4ND4A 2OXTA 1HDGO 2BR3A 1MO3A 1JAHA 4JZKA 5GJCA 1N2EA 4BEWA 1M6EX 5FL7D 2BAGA 4LN1A 3ZDRA 4I19A 4KUHA 3WK8A 3L18A 3UJHA 4CKEB 5EYPB 4JXXA 3SZLA 2W2VA 3B82A 1R6AA 3DR5A 3G0BA 1S89A 2X15A 4Z9XA 1JTFA 3RFTA 1R9JA 4B6QA 4D3DA 5J47A 3C6QA 4O2BB 4J8PA 1TC1A 1Z9BA 2VJOA 2WF7A 4FUTA 3HADA 3ZE8A 4CT4B 5DM1A 3QVGB 3K9WA 4WESA 3QFCA 5IH7A 2PA3A 1U99A 1Y81A 2O8VA 1VIAA 4R0VA 1G0NA 1T2AA 3PQ7A 5ALXA 3UK6A 3ZXSA 2O59A 3WOHA 5I7RA 2WK1A 2Z98A 2UUOA 1IE3A 3A6LA 1ZH6A 3AC0A 4V0LA 3D43A 2GBLA 3DD5A 2P9CA 2XGSA 5K3BA 3W79A 1NVUQ 4DT1B 2XMQA 4NIMA 1YF3A 2QEQA 1DXYA 2H6EA 4LYYA 5F4BA 1XTUA 3IP7A 4R1NA 3U7HB 2ZI6A 2C84A 3FSGD 4CQNA 1CUUA 3O75A 1FTGA 5GINE 4XX0B 2BFFB 2HLHA 5HG0A 5B2ZA 1EXMA 4NXMB 1MG0A 2PS0A 1IHYA 1WVMA 2NZWA 1HDCA 1VP3A 3NFRA 4KLNA 2XYPA 2JAUA 2FX2A 3PEYA 1VA4A 4KK3A 5F51A 4FEYA 5GIOE 2G4CA 5JFTA 2P2LA 2JI4A 3COVA 3GRRA 5JY1A 4PGMA 3SBEA 1V11B 2A6PA 3LBYA 5B1DA 3RBZA 1MHTA 2BDUA 1Y3IA 4QBKA 2PIDA 1WVIA 1ZD2P 3A9WA 3CRVA 2YWFA 1JIJA 2D8MA 4PINA 1Z07A 4NS1A 4IEFB 2EFYA 2C59A 4ZU3A 1CERA 3HCFA 3TLBA 2UYHA 1SBHA 3I30X 4LRUA 1V26A 4ZMBA 5LMZA 1V37A 3F6PA 5EZYB 5T7BA 1JQBA 3F8TA 1E9EA 4KN8A 4AMBA 3KVVA 3OZSA 3PJFA 4Q9JA 3E9MA 1N1DA 3I6ZA 5JZMA 3ZBUA 5KYYB 1YIDA 3QVUA 3T7TA 4YACA 5C51B 5HE8A 2X0FA 2PJRA 5B30A 2IHKA 3NRCA 1H2WA 1CQIA 3QX9A 2JANA 3REOA 1JDTA 1XALA 3O8CA 1H85A 4AX8A 1UZNA 4AP5A 3U37A 1HDXA 3GDHA 5T4BA 3D6TB 3O8NA 4W99A 2W6MA 3KYIB 2GESA 2BMWA 2XVMA 3DEZA 3I58A 3LHFA 1JIKA 1RWQA 4XWYA 1E9BA 4HEA6 1GT6A 4QAQA 5D1NA 4FEAA 2C03A 3HA3A 4JDUA 1KBZA 4QXOA 1NXQA 3R9XB 3FB1A 1THZA 1T36A 1G4AE 2WTUA 2R86A 4KTVE 4J6EA 4O2RA 4U2KA 2G5PA 2OG1A 4MWTA 2NMVA 1T4DA 1REQA 1VB5A 4OHXA 4ERXA 3U44A 1KJJA 1ISSA 1RWMA 5CB0A 2BBSA 1LZLA 1HTWA 1ZK0A 2QRJA 2ZJ8A 3ISVA 5DM0A 3I23A 3UC5A 3OWOA 1T4CA 2BGUA 3V4OA 4G84A 3DHVA 4ZXPA 5I4IA 1N78A 3L1UA 3USCS 1ZR2A 2O7NA 1RLJA 4YUZA 2XRZA 1XMPA 4EY3A 2EKZA 4KN5A 1WY5A 3NI2A 4KR3A 3OEEA 1VMEA 3G2LA 6REQB 3SVLA 1I1QB 1Y48E 1V47A 2I6UA 2Z1MA 3WQHA 3S5JA 4LW8A 3L93A 3JS5A 2BVNA 1PT7A 3TGWA 1XKTA 4JVSB 4C4XA 1O1YA 4DR5B 3R6WA 4UD6A 4AMYA 5BN4A 1EQ2A 5LZ7A 1G98A 4ZMRA 1SXIA 4L4ZA 1S8OA 3TPFA 1KU6A 4R01A 1RYFA 1U0TA 4M8SA 4XCVA 2CBGA 4L07A 5B58C 1GAXA 4X0EA 1GJRA 1K98A 1NUPA 1AGXA 3A31A 2GBFA 4OK3A 3TLCA 4AJNA 1PS9A 4EYGA 2G72A 3S28A 5GP1A 1CDEA 3M6LA 1LRJA 1A8SA 1X1EA 2JFWA 1YQQA 3QWIA 2FRXA 3INNA 1VOTA 1K92A 2QTTA 2UVDA 3AF4A 3ORFA 2IU3A 3M4XA 1VI6A 3HXPA 4ZICA 3G89A 3PDIB 3PHCA 2I6FA 4REOA 2R6ZA 1W5TA 4CEJA 2V5UA 1ND6A 4ID3A 1SUAA 3T54A 2J5BA 1MP0A 3GCDA 1UK6A 2RGCA 3PB3A 3J80A 1WZIA 4MGIR 2NZ2A 3OX2A 3R40A 5GM2A 3RG2A 1PJTA 3P4UA 4XXHA 1R66A 3PUHA 1W0KA 3FWZA 4NG5A 3I2HA 3T3EA 5TS2A 1HO3A 4AWAA 1LV7A 2A1UB 1L7OA 3O4GA 3QU4A 4ND8A 5DTQA 4EHIA 4MQMA 4FNOA 1G66A 1P7WA 5CDYA 4DYHA 2C7BA 1JFLA 4B8ZA 1E1MA 4WOBA 1T3ZA 5U1PA 5F9HA 4BNUA 1QYDA 2DUJA 4Q16A 1RVV1 4WHMA 4F72A 5CA1B 1XZBA 3C6MA 3V1MA 4TMYA 3BPSA 2R00A 1K4MA 5F1YA 1M83A 2PX2A 3WQQA 3PPWA 2GETA 1IZ7A 3D0KA 2G77B 1E1QD 1DEAA 1NUTA 4OJYA 4WLVA 4ZO9A 3VNVA 5JECA 3JZIA 2XVZA 4PU0A 1PL0A 5CIWA 3VC1A 5IZCC 3W1WA 4AVYA 1CY1A 2WJ3A 4ILKA 3W5DA 3EOBI 2PXHA 3JTEA 3QVSA 2EJVA 2J0EA 4YYZA 4LTMA 4F92B 1BMTA 1UMDB 2GJSA 1BTOA 3HR4A 4RHYA 1S8NA 2F9FA 4NCAA 2AC4A 4TMKA 2FB9A 3I5MA 4M1ZA 3ROXA 4BB5A 2DPYA 2H1WA 1ZITA 2XB4A 3DL7A 4L08A 1WDKA 1SC9A 2ZIEA 3K16A 4EJ0A 2AG0A 2J09A 3P9IA 4NEGA 3KUCA 1N5KA 1RQNA 4HY3A 1HYEA 4FYYA 2QQEA 2F4VB 4NZ9A 1EAMA 3K0SA 3ZNOA 5E1BA 3RUDA 2IZ1A 1QP4A 1W25A 2RH5A 1PQYA 5GZ6A 2MSEB 5CFPA 1QIKA 2VYVD 1GM5A 4YPOA 4CTOA 1NI4A 2OVFA 1XJ5A 1AS3A 1YR3A 5BV1A 1ORHA 1U7OA 4ETMA 4ATNA 2X0IA 3EG9A 1OLOA 1EIWA 1T2VA 1ZY2A 2ZVPX 4FU0A 4C6TB 4PEVA 1IHDA 4X63A 4C4RA 4ETNA 5LXTB 3UH1A 2WHRA 2G5CA 4ZQIA 3DBVO 2Q46A 4IJ6A 1MTZA 4MRAA 4DSUA 2C31A 4OA8A 4QO8A 4YRMA 2XGOA 1BMDA 5DZSA 4D97A 3HWRA 3GDOA 1NN1A 5ESWA 4XVRA 2GHTA 1VSBA 1NQXA 3MLAA 2X9LA 3BMXA 1QE3A 1F6BA 1YS7A 2I1VB 5T6MA 3REFA 3U4AA 5CBKA 1HL7A 1W581 3L92A 4NCBA 5CDTA 1OSNA 3GRAA 4RK1A 2QTWB 2AG8A 3BTVA 3A4NA 4GI3A 2EX0A 4QRHA 3FUVA 1IHXA 1SHUX 1D4AA 1VPLA 2NV2B 3O8DA 3LUFA 5AK6A 4ROTA 1N77A 1QHHA 2JIZA 3B1VA 3NGLA 2IYUA 5LDHA 1B1AA 3IA2A 4DV6B 3RHSA 3HGMA 3U17A 2QIPA 1DT3A 1RLUA 3AETA 1CR4A 2B34A 2QLMA 5LLDA 5ADVA 4ISBA 2PG3A 1MXFA 5C52B 1QOQB 4J1TC 4S1PA 3P4YA 4UCFA 4YK7A 2JJ2A 5A1TA 5JRJA 3PR3A 1XJ0A 1U5CA 3GQBB 4HRVA 2G8LA 3OY7A 5IUKC 5A9RA 1W30A 3H83A 1Q84A 1CY2A 1Z74A 4WBNB 1ECFA 2DHQA 4MR7A 1Y8QB 3PZBA 1E4EA 4UASA 1Q0ZA 4OQFA 3U09A 2YWDA 4DR7B 1QV6A 1HNWB 2R6FA 5CPBA 3ZU4A 4RHUA 3JWJA 2BCGY 5ARCA 5KS2A 3RRXA 4PS1A 3HO1A 3F6CA 1UK7A 2WAXA 2BUAA 3ASZA 3DOUA 2ATCA 2O7QA 4FCCA 5EJAA 4JJIA 1RM4A 2ZT6A 4CF3A 4L6AA 3OE5A 2GLXA 2JHCA 3IQHX 4UPDA 2WJAA 4PRZA 3OTOB 4CI0B 2PX8A 1KJYA 1RI1A 2XF2A 3NBFA 5JD3A 1B8VA 3TVDA 3VZPA 4DV5B 3GGJA 4GDMA 2PBFA 3KTAA 4YRJA 4KPEC 2JIOA 4P93A 4HUTA 3KUUA 5FJIA 2AKYA 4AJ2A 5HS4A 1J99A 3RR2A 3PWKA 721PA 3GIDA 5KSWB 2AR0A 3OQNA 4UTZA 1RWVA 2IIBA 1I1HA 2IEAA 2UZ1A 3GLKA 1T1RA 1PR4A 1J24A 3AF0A 3C1TA 3D8BA 1J20A 1I3OA 2YDYA 4YJFA 4JI1B 3NB0A 3VI3B 3FVQA 4NJMA 3DCNA 5L3SA 2REQB 4W5NA 3QVKA 3GC6A 5DHUA 4MMZB 2J3MA 1GGJA 2VHUA 2OBLA 2GEBA 2GF9A 1CCWA 2X5JO 2XMPA 2AUMA 4I55F 1IEWA 1TLLA 2W48A 4C1NA 3UMSA 3TUZC 1P9WA 5EIOA 3C41J 1OLUA 1LQ2A 1RFLA 1JRLA 4F45A 5H82A 2EFCB 3CX7A 4QM6A 3GAMA 3ACBA 2I5PO 1Z6AA 5AK4A 1YZVA 3IXQA 5D1HA 2GK7A 3ZYCA 1ZM3A 1C9KA 4OQPA 5ERYA 4D0GA 1GSOA 1SG6A 3MPOA 4OHKA 5ILGA 1ELOA 3I9JA 4FYKA 4FTWA 1JDSA 1Q22A 3HBFA 1T9HA 4N6OA 4RKRA 3IPLA 4PV7A 4WCFC 2XMGA 4P3KA 3GK3A 3AP3A 1O08A 2W5UA 3SSOA 4UHJA 3X1XA 1I2DA 4UNSA 4BNHA 1BQEA 4PPQA 5FWAA 2BP7A 1WW8A 3HKDB 5BO5A 3PF8A 2F8SA 5L9AA 5I4BA 2AEFA 1T8RA 4RV9A 1Y7TA 3QFRA 4MLZA 5HILA 4EO9A 2CHUA 2WJJA 1X7WA 2FEWB 2I1WA 4WPGA 5BQ5A 5I7SA 4Y6LA 2WTMA 4EF4A 3PNMA 4ENPA 1JU4A 4RK7A 3RBVA 2V4UA 2GPYA 1VE9A 4D79A 2W4QA 4R68A 3FUCA 2YRFA 3B6KA 3SHWA 4WY2A 1WUKS 1C7ZA 1F4PA 2AMJA 2PS3A 3BMNB 1KMMA 4JLSA 2YJTD 1DZ3A 1NA5A 1CTQA 1PW7A 4KE7A 4N82A 5EIHA 3RJTA 2ACVA 3TDNA 2PZLA 3S2IA 3W8FA 1TKBA 1TIBA 4C7JA 5C31A 1K5PA 1KO8A 3GBPA 3AXSA 5BN3A 2QB5A 1N25A 3IEXA 3U3XA 1VJGA 2VQFB 1Z6GA 1L5WA 4D0NA 4G41A 1NX6A 1JV2B 1U7TA 4L8VA 1I8TA 1ONBA 1SCJA 2EFGA 5THQA 4HVTA 2XQJA 5TIIA 1J06A 2I7DA 4N3BA 1G4UR 5K3SA 3R8CA 3RS0A 2AJ8A 4AMZA 5KOHB 1COWA 1RYBA 5TJHA 1SZPA 2A3NA 1GUBA 1ZN8A 3E7PA 5FLKA 1TMOA 1ML3A 3PC8C 1G21E 3COYA 3FUUA 3FZGA 3H2JA 3OC6A 4MJ7A 2BEVB 4I9HA 1IXYA 3NBMA 3KZNA 3ZU6A 4MB2A 1DRWA 1TUIA 3IFSA 5BW5A 4BQNA 2D0DA 3GPLA 4J0HA 5BRNA 2XSZA 4HLNA 2E37A 4R40A 4TL9A 2Q99A 3GUYA 4RTNA 2VQ6A 1M1NB 3T1VA 3MXTA 4IIBA 1KPHA 4KXUA 4CUJA 2JLWA 1E58A 1PZXA 2OZEA 1L7NA 3EF1A 3IEUA 3ZLVA 1P44A 1O8BA 5I3CA 3K1JA 2E5FA 1VPEA 1D5WA 2OCYC 4ZYYA 2FRDC 4FOPA 4W1QA 5KQRA 1CHDA 1YQXA 3F7TA 2XI4A 2QYOA 3HWWA 3PNKA 2C5SA 1LX7A 1JH8A 5IJ0B 2LGJA 1K6XA 1KZGB 5E7IA 4AJHA 5IWCA 1J8VA 1PHPA 2GAAA 3K4QA 1HLGA 1VA5A 3WIBA 1NBHA 4LVOA 5C53B 3BCUA 1OFUA 1GNRA 3F3MA 3MWKA 3FOBA 1GL7A 4CEJB 2JASA 5ER6A 1E2JA 1NJ2A 3OEHA 5TGDA 1EK5A 1XTVA 3FGNA 4ECAA 2JK0A 2J31A 3HB9A 1YHZA 4RZHA 1OWMA 5E2BA 2ZRAA 3EVFA 2L2QA 2EG9A 1AIPA 5K7SA 2B30A 3ECAA 3JR3A 4HN4B 2YZGA 1FS4A 1R6UA 3LT5A 2A92A 4FE4A 4NL4H 4U63A 5HDQA 3RG8A 4BO8A 3FTDA 2JLVA 3KPYA 5BUZA 2QUHA 3PNBA 2GVNA 4DUGA 1UBSB 1TQ8A 4XFKA 3VHLB 5CB4B 3T1QA 3THWB 3ETNA 3G3EA 3UMCA 1VQ1A 4BVFA 3NS7A 4Z3OA 1YUMA 3U7QA 1KZ4A 1S1CA 3VAYA 3A8TA 3TLXA 2X0JA 1KR5A 5G53C 3UAWA 3CBQA 1ZJZA 2HWXA 3HKEB 3VR4A 3KZ1E 1SU4A 1RJ9B 4CCYB 4OQ4A 3E15A 4MUNA 4UHHA 3BD8A 3TQCA 5CDUA 3QQ5A 1DKLA 2YS6A 3P9YA 3M4JA 2PUVA 1XCOA 5TQ2A 4WXHA 3AUSA 1C1DB 3JPYA 4D9NA 5JYEA 2XXAB 3U4QB 3R7AA 1NW4A 1FOEB 4IXMA 5HRCA 1VZ3A 2QZZA 4M8KA 4Y2PA 1WP4A 1YRYE 2NO4A 1Y8RA 4MTLA 5F78A 5AW4A 2WB2A 2KE5A 1FLNA 1DC3A 3TTUA 1O8CA 3BERA 3NYIA 1JJ7A 3C5EA 1G3QA 2IZOA 2OBFA 4XA8A 4DG9A 4M88A 1IZ9A 1T5LA 3P9NA 1I1OA 3QX3A 1QS0B 4GR5A 4Y6PA 4ZO8A 3FDZA 4AN0A 3TW0A 1V41E 2GPNA 4YROA 1GTRA 1SOWA 1YGYA 3FPAA 4OXIA 1Z17A 3B6EA 1MA0A 2PBLA 4ZN6A 5C7IO 2Y66A 5AM4A 4HRAA 4WNAA 1NHWA 5JNRA 1NRJB 4Q66C 1D8TA 4ARCA 4WL0A 1U0HC 2YJ4A 2HCRA 3SAJA 4BKPA 1T0UA 5EERA 2NVUA 2B9EA 2OO5C 1XYGA 3PSAA 1RMQA 1FP4A 2G04A 2O50A 2FG7C 1GR1A 1XR3A 2O0KA 2Q4DA 2V54A 4ARAA 3O38A 4LWZA 5ICSA 1QONA 2ZULA 5TXGA 3HABA 3KZCA 3Q3GE 4BJ6A 3KSBC 3H65A 5LC1A 1J25A 3PXXA 1CUAA 2VTDA 3OCUA 1K0UA 1OF1A 4EGFA 4EMSA 1GZ7A 1BD4A 5ALVA 3KV3O 1RPZA 1BDHA 3EVBA 4WZ6A 4A6DA 1RRCA 1NVBA 4JI0B 3BFJA 1TCAA 3W06A 3FKSA 2F17A 2PR7A 4WXRA 5HUQA 3NUZA 4OOFA 1BS1A 4F5DA 3AHJA 3WYFA 2KWIA 3ZBQA 1Q12A 2ORYA 1R0ZA 1QLHA 3CS3A 1DAIA 2MMGA 4C6RA 4BNWA 2OGZA 4C6HA 2WB4A 1WRBA 2GEUA 4V24A 2JVKA 2UUPA 4J03A 3PA6A 3ENQA 4YRKA 2GD6A 2IXGA 2ID8A 3F6SA 4UW9A 3ZV3A 4WZAB 5JMWA 2GPBA 2XHEA 1LPSA 3A10A 4P3OA 2J3QA 2WSMA 4PYLA 4C0JA 4EL5A 1XPOA 3R7WA 2HQSA 1S0UA 1KIFA 4LCBA 4NZNA 5BSRA 3HJNA 4PYNA 2Z8ZA 1W73A 4TLDA 4ZRDA 3OICA 5JIBA 5IVHA 3SXPA 1WKCA 1A9RA 1A2QA 5A9TA 3L4BC 3VTAA 5C8YF 4N0MA 3PDUA 4P9NA 1W2HA 3DV0A 3DPUA 4FBMA 5BWMA 2BIFA 5GZ3A 4M1YA 4XUEA 4B76A 4DMHA 1RJEA 3F97A 2EW2A 3BAFA 1TYCA 2P3QA 3MAAC 3VO1A 1H1LB 4Q7EA 5JYCA 4OAPA 2V3CC 4XYMA 5HMLA 1MD9A 5EPEA 2IOYA 1OLSB 1JZTA 1V6SA 1C4XA 1EVLA 3QVWA 3DLBA 1RSZA 2XWJI 4PSVA 3T12A 5T3YA 1C3VA 1RXYA 3X1JA 4D2IA 1PGJA 2G5GX 2DC1A 5LLTA 4N5HX 4TVSA 1JSCA 1N5RA 2Q9BA 4QEZA 5ALJA 4Y30A 5C46F 4F9EA 1USKA 4DLLA 5FQOA 4C1BA 5LP6F 5EJ4A 3D0QA 2VHJA 3PQ8A 4N03A 1I0LA 1E1YA 2CDCA 3FNFA 5IZCA 2COEA 3CKYA 2PGLA 4ENQA 4YR9A 2R6GA 5KTMA 3AM1A 3WI7A 3WLIA 4IIHA 1BW9A 4YUWA 3VR2A 1FW6A 3INYA 4BC0A 4RDHA 1N0IA 4FMDB 3HZZA 4BMVA 3IIJA 1U7WA 2SKCA 4XM1A 5EWMA 1PJ2A 1FFSA 1GSIA 2VA9A 4IFBA 2QUJA 3WG9A 1G8HA 3WLPA 2AE1A 2VNSA 1R8SA 1U1FA 3FPHA 2GCNA 1BYUA 2NN3C 1HURA 3FPBA 5FUMA 4WKBA 3ZNPA 1KNQA 3A6DA 4M53A 3VV3A 3LQKA 1L8LA 2Q6TA 5JSYA 1ENOA 3NVAA 2QRVA 5C8XA 2P27A 4MQ4A 1LVHA 1QOZA 2FPOA 2XEXA 2ODBA 1ZJ5A 1WF3A 2IC5A 4H6PA 2OHJA 4RHXA 1N57A 2W6ZA 3JQAA 3ZGLA 5FUQA 1YCDA 2QZPA 2JFXA 1Z26A 2VK4A 3H17A 1M67A 2ASVA 3U7RA 1UJ6A 1E64A 4HMPA 3B2EA 3FX2A 1JBKA 4AMUA 1EIZA 1ZHFA 4JDPA 5LFAA 1SVIA 1I7LA 4YT5A 1KJIA 4ENVA 2FP3A 1BE6A 2GVDC 3FSEA 4CV2A 4FDVA 1VL6A 3O84A 1YZNA 3X43A 2G9ZA 2WHPB 5T4EA 1NVWQ 3RUFA 2PY6A 1XV5A 3STYA 3FKQA 3JW8A 1NBAA 4PPNA 5FA8A 2QTZA 3R5JA 4EENA 5JAIA 2NSDA 1JLLB 4DDHA 4J43A 1E63A 1U5AA 1E92A 4I4TF 5GADl 3GNQA 2WWWA 3JRWA 1X9GA 3IRVA 2IZ5A 3LFHA 2VNJA 4C03A 5G0UA 5JS2A 1DKQA 4X62B 3K70C 1QO0A 1RI4A 3JASB 3IOBA 1O58A 4GHWA 3CHYA 4J1TA 3IAXA 4KWTA 5KNDD 4IDAA 5ITZA 5B53A 3TN7A 4MB6A 2QTHA 2R1ZA 4PLCA 4ZVTA 13PKA 1KEZA 5CHYA 4M4SA 4NE7A 3WAKA 1OX5A 4XWOA 5D2CA 4CTNA 5AVUA 1RKVA 3PXGA 1AS2A 4A82A 2I9PA 1YK1A 1ECJA 2HJHA 2OC9A 1NVAA 2YHBA 4MR8A 5CMLA 3WDLA 4ZVQA 3ISTA 4JMLA 3CUSA 4LISA 2DUUA 5BQOA 4YX9A 4CKYA 2UXCB 4FKBA 3CX8A 4RWZA 2NNWB 2CLKB 2VTKA 3KKOA 2UDPA 4H3VA 4GYYA 3UUFA 5HM6A 3HCPA 2JPDA 2G36A 3IDSA 3Q7IA 1R0KA 3WAGA 5JNUA 1K97A 5JBIA 1JKMA 2XDQA 2RARA 3AVQA 4POOA 2BH2A 5EE0A 2AC2A 3V97A 1NNUA 5E8JA 1NYQA 5KB3A 1WO8A 4PG8A 2R4QA 1RLTA 2A9RA 3MAGA 4KKVA 4GU5A 1SXQA 2R1VA 1E79D 3O3NB 4QJ5A 5HS6A 1SQGA 4TSKA 3F1LA 2MSKA 4FMCB 2AX4A 2RC6A 1MRNA 3H9BA 2HREA 2O1WA 1RXIA 4YAEA 4CM6A 1U9YA 3GPBA 1G42A 2ZWPA 2PKEA 2XBUA 3OLYA 1PNVA 4OHRA 4P36A 7AT1A 4AG5A 4AY5A 2HSGA 4BC1A 1YQUA 3BWYA 2GX6A 1P2FA 2A14A 4YUAA 4EJ6A 2M2IA 4WASA 5LM3A 1MOQA 4RX1A 5K6TA 2Q6LA 1OD6A 1CJTC 2GCOA 2VAPA 4MQEA 4R5MA 1XZNA 5TV2A 3CNHA 3R3JA 3PX3A 4KK4A 3ITEA 4Q15A 1GXSA 1QKIA 3CH4B 5GZ1A 1RRMA 2DWPA 2Z5GA 3GZNA 3ZWNA 3I2IA 2FWMX 4EVSA 4KRGA 1VBMA 5AHXA 2MYNA 2AK2A 2IF2A 2QPOA 1KZYC 4FQ5A 4HWTA 5CFOA 2ZBQA 4K46A 3N7UA 4HTFA 5EQFA 3EPLA 2M6SA 3JSAA 2FUG6 1H2RS 4G24A 3OPVA 4WCFA 4BV2A 1Y7HA 3LD9A 3FF1A 3NDIA 1SUPA 5I7HA 2VJDA 4B3SB 3EZNA 1OAOC 3F73A 2OECA 3AU9A 2JJQA 2XVYA 2Y92A 4JBGA 1V1JA 2ECFA 4C76A 4GZ6A 4I8XA 2HOQA 2R84A 3LCRA 3GPIA 4LRYA 2ZJOA 4N8DA 1USVA 6YASA 3W2EA 1QRRA 1TAUA 5IT5A 3QELA 1DIGA 3C70A 3ZE1B 3ZHYA 2Q3DA 1OV4A 2YV3A 3VR6A 1H42A 3ZWMA 1FS5A 3NU1A 4IS3A 3WBFA 1F48A 5I8ZA 1BE1A 1CZLA 1I01A 3BOSA 1MGOA 1SBNE 2VDUE 5C7YA 1H4QA 3W78A 2FQXA 3SS9X 3U7IA 4DILA 4N12A 3N0TA 2A0FA 5AH0A 5CXSA 3ETJA 1OXKB 3BSSA 3HJFA 3I04M 4EECA 2QSYA 1CR2A 4R2HA 4O08A 3EA0A 1XX6A 1BAPA 1EWKA 3WYCA 1B76A 1CY8A 1HUQA 2X19A 4BV8A 4UM9B 4UXJA 4FYIA 4UZEA 4XM0A 5LQSA 4ZYZA 1NOJA 1THGA 4CNBA 1L7XA 1R12A 1UP4A 2CD7A 3NH6A 4ZVSA 5H3LA 1T9ZA 3AEZA 2XUKA 4B7ZA 1LQUA 3DE2X 2Z8YA 5LOVA 3L7MA 5DRTA 3PQ4A 4ZALA 1TU0A 1RS0A 2FF5A 3LFUA 1MH1A 2VH2A 4LTDA 4WERA 2C2XA 4DNPA 1SUEA 3OHMA 3OWHA 1RM0A 1M2NA 2FWIA 3SXUB 4YCCA 3AJAA 1WTCA 2BFPA 1JQ5A 1A4XA 3L46A 1VGVA 1V1MB 3PC8A 2XNKA 1OLXB 4LPKA 4FDUA 1KQOA 5ERGB 1USGA 1NKVA 4QDUA 4YXWA 2XCSB 3UUWA 1BC5A 4IICA 2XZLA 2XXBA 1N2CE 1MV5A 2F48A 3WHKA 3GEHA 2HK9A 4ML3A 1QRSA 2G07A 3IUBA 2VHQA 3UAYA 1TM4E 3E35A 3Q3VA 1L1FA 5JXHA 4D44A 1C4OA 2ZSAA 2C4VA 3P9QA 4YMSA 2BM1A 4J75A 3MG9A 4U6SA 5EJGA 9LDTA 1A7JA 3JRNA 1WZCA 4IV8A 4KXXA 4DR6B 2BSXA 3CNNA 1TIPA 3BMQA 3RC9A 1EESA 4AJ9A 1PKXA 1UBLS 1QF9A 3EVCA 1P1JA 2FRDA 2H54A 2BKLA 2VUIB 3CFYA 4IDBA 4P5DA 4KSCA 4R8MA 1GPMA 3RFXA 1Q15A 5JHGB 1KZ7B 5FOSA 1VIDA 3LCMA 4NR0A 3DKKA 5U4XA 4NMMA 2Y1FA 1GEGA 4EM6A 2JIMA 4OHYA 1JHXA 1J8QA 3ZCQA 1B8NA 1FX1A 3VX4A 3W6NA 4LS3A 4ZC1A 1AF7A 1JG6A 3UBMA 3S2ZA 5JJ5A 4O4HF 4ZOQI 1NSFA 3FTQA 4ND1A 1SJ9A 2PYDA 3K7EA 1XN4A 3NONA 2AGVA 3CR7A 2HDWA 3QI7A 4MIKA 3OHSX 3AZOA 1J2RA 1DBIA 1Z68A 5LMCA 5JZVA 4AWBA 4HSEA 5U9CA 1ZG3A 5DLQC 5EJ8A 4KQ9A 3E48A 2FI1A 1ZU5A 5G1NA 4B3XA 3LH5A 2NO1A 1OWPA 1OBOA 2Z9CA 1XQYA 3E23A 4JU9A 3R5KA 1ZX1A 3WFIA 4KQWA 4RK0A 3RVKA 2CXHA 2D4HA 3U4IA 3UFBA 2FFRA 5B4TA 4PYRA 1VIVA 3TNDA 1PLLA 6Q21A 2J9FA 4M9QA 1R00A 1RRVA 1JHZA 4KE6A 5AHOA 4YRRA 3WKCA 5L7TA 5LJLA 3Q85A 5B2EA 3BZWA 4PCVA 3I32A 3UWDA 3W4KA 1KDYA 5ERXA 3PGJA 3TQIA 4C05A 1QGZA 4KRXA 2PRJA 1NN0A 2ODQA 2ZBDA 3DH0A 3D6AA 3HRIA 3CH6A 4JUCA 4G1EB 4DQLA 4GYKA 4I8IA 4B2PA 1EB9A 1EZ1A 2F8MA 4XYLA 2HT1A 4BX3A 4LF7B 2IDMA 2J59A 3UB4A 4X54A 1HQCA 1I13A 2CMFA 3IE0A 4K26A 5LA6A 3WGTA 1Z39A 3OSZA 2LDBA 2GEKA 2G25A 1M10A 1C9YA 2AZDA 1VG8A 2I4MA 4EATA 1O77A 1VL2A 4KR7A 2HSZA 3AFOA 1NQTA 4LJAA 5CGQB 2PX6A 1TZKA 1LBEA 2VP3A 5KQMA 1UT6A 4KSBA 3NUQA 2CXUA 2NO0A 2O8NA 3PI6A 3BK1A 5FBZA 3Q10A 4YECA 2FN4A 4GI7A 5F7XA 4O63O 4DWOA 3DS8A 4JT2A 4Y0NA 2Q1XA 4CIXA 3WWCA 2ZSKA 4GPEA 4O4LA 1YUBA 2P0EA 3QEKA 1TAGA 4N01A 2C7VA 5B55A 2R8OA 3T34A 2ZS8A 3IDOA 3DF9A 2G0NA 4GF5A 4DIKA 1OC2A 2LXNA 3W4IA 4JJGA 5JZBA 4JGIA 4N0QA 4AZ0A 4QU9A 1DJPA 2R62A 4LY6A 5IKOA 1ODTC 2BTEA 2P90A 3B1ZA 1G3IA 2ZU6A 4PQGA 4B7CA 2OO5A 2AWNA 5FBKA 3S55A 4XWTA 3DE4X 5AM3A 5FKJA 4MO9A 3PFNA 4BVEA 4E5PA 3WVNA 3NM5A 1G9SA 4M76B 5ABPA 1H6CA 3IHWA 1M8KA 1ESZA 3AI3A 4DLZA 1WQ3A 2IW1A 4I6JA 4I0WB 2CFSA 1L5LA 1SUDA 4RMHA 4MI6A 4JUIA 5DE3A 1QTRA 4Q18A 1M0SA 2B6HA 2FWRA 2FWNA 2Q1UA 3BSWA 3C5WP 3F3SA 3C3DA 3PP8A 4NCHA 4RFVA 5DX1A 4YAGA 3TQHA 4Z7QB 2GYUA 2W71A 1LNSA 4RD2A 3EYWA 3FZQA 3S2SA 1JEYA 3I9OA 2D5CA 2WJIA 3E8XA 3ZVRA 4B9AA 1HZZC 1VGQA 2I1LA 4JOCA 4MEJA 4NU6A 4QPZA 4Y9SA 3ROTA 2VTBB 2QTVA 4FC6A 5JPIA 2XZOA 3ZJTA 2IYSA 5D85A 1XE3A 4GPBA 3E1SA 5AXDA 4MGEA 4BO6A 3TI7A 1KP9A 2A7QA 1LS6A 1OXTA 2OFPA 3CGWA 3QUQA 4O4IA 3GH3A 2H9YA 1AXEA 1HG1A 3AVTA 2KLBA 4AIIA 2PWZA 4KFSA 5AJWA 2EKQA 4MVJD 4FNAA 3I1FA 4OAQA 3KLPX 3KOYA 3MF4A 1T1GA 2I3ZA 1E60A 5TDHA 3HJUA 4IMRA 2WKRA 4RPKA 4TX1A 4P4SA 4HH4A 1ZRNA 2A8YA 4RZQA 1MVLA 5FPPA 4B3BA 4EP1A 3FPEA 5ICEA 1JPVA 3L4BA 2J0VA 2ZBVA 2C29D 4AKGA 2RGUA 2W6OA 3ZS8A 2QN6A 2W2QA 2BE7A 4EABA 5KDLA 4D0SA 4UM9D 5MFZA 2QW1A 4QELA 2XCRB 3KJEA 1KERA 1NJSA 5JTTA 4Q19A 4F1WA 3HYCA 2UU9B 3GJ0A 5FUXA 4JLKA 2Q6IA 1SVNA 1V9SA 1J07A 2A5YB 2JIRA 2ZAOA 3HB7A 3MUEA 3R24A 1PZHA 1X3SA 1A8QA 5DIFA 4MEAA 1RRKA 4UAUA 1RYYA 3HKBA 2RGBA 4IFEA 3IQFA 2Q9CA 3MIIA 3W3AD 4E5SA 1Y6GA 4WLFA 3K8OE 2VK8A 3P71T 4EG4A 4QIHA 1L0BA 1DQRA 1NU8A 4M1TA 4MROA 4QNMA 3TM4A 3MTBA 1LSJA 3T5DA 4JUDX 4DW8A 4BO3A 2BGKA 5JANA 1BFKA 3E9YA 4FYMA 3S2FA 5AKHA 4YRIA 4NFHA 2PAAA 4FLFA 2WJZB 5CK4A 1F8GA 2WTBA 2VF7A 1NN3A 3AR5A 2WAYA 1SU6A 3I2FA 4ID9A 4NPHA 4RD0A 4J3NA 4CKXA 4CLOA 1PV2A 4YN3A 4BNDA 3JARB 4PFKA 1W7AA 2C04A 1LUAA 2X8AA 5J59A 3RHZA 1BXGA 1V4VA 3DAYA 3DWEX 4HX5A 4HZUA 2B2CA 1PLJA 3DXXA 1OXSC 1P3JA 2HMSA 4W6QA 1JPUA 1KKMA 2AXEA 3RUPA 4B46A 1GL6A 3TRFA 4CXMA 2EZ8A 3DAHA 3IAUA 4B80A 2BV3A 4G25A 1PT9A 3UMYA 3JQFC 1U2GC 3WA6A 1BNCA 4BYMA 4N5IX 4WZAE 1XDUA 5IWAB 1B43A 1RYHA 3NKVA 4CKWB 2LIPA 3TB6A 4F3TA 1X1CA 4FFLA 3B78A 3OFVA 3AG5A 3SM9A 3ZQUA 3QF4B 1LU9A 4N5NA 3FTCA 3PFKA 4NYIQ 1PBTA 3OIDA 5FDFA 5KAPA 1PR6A 1ZD9A 2VJAA 4DCTA 1CDOA 5CLQA 1C0LA 1WOMA 4DKXA 5JXJA 2QUBA 1CS0B 3SWWA 5A2QA 1ZUD1 2RHRA 3LY7A 2QOEA 4AZ3A 2GN2A 2CDNA 1HNXB 3RKRA 4O2AA 1PQWA 1QMGA 3SMVA 3WNZA 1A5SB 1FX0B 5CGZA 1P3DA 1BH2A 1M8JA 1KJ8A 4NKRA 4UHKA 4E46A 1AG9A 4RZ2A 1JQ3A 1U2RA 3O4RA 3N8GA 4MW7A 3WKAA 4ALMA 1E2GA 3TCNA 4JIMA 1YMUA 3MSXA 3RS5A 2OCBA 4QUBA 3R20A 1APBA 5NULA 4L02A 1G8JA 4ER5A 4A03A 2BFDB 5IAJA 2W90A 2BFBB 5H02A 3W3ZB 5EZ6B 3WLOA 4B17A 3BL8A 1BQ4A 4MMYB 1ISRA 3M3DA 1ZCJA 3PUIA 3LKBA 4LV5B 2QVXX 5DHSA 4Z4FA 1TVCA 1T3SA 2IYAA 3D1LA 1M9NA 4XJSA 3V3TA 2D06A 3E2PA 2XMRA 4S04A 5ALGA 1X6VA 1XHLA 2O3JA 2OFFA 3KWMA 5THXA 2OMKA 2GD2A 3VR5H 5IANA 2QW0X 3F90A 1LBHA 1QGED 3D31A 3R6TA 4I2NA 4QJBA 1H5QA 2AYZA 4XWWA 4QUDA 2R25B 1CFJA 2Y1XA 1DXQA 4FX2A 4ZODA 1R4NA 1LPPA 2O48X 4N41A 1FRFS 3NJ4A 4YTEA 2R2GA 3LIPA 4DEVA 3FN4A 2W98A 5A6VA 1GNPA 1NPDA 3KQNA 1J5EB 3KPVA 1LKZA 3WTBA 5FULA 1JDBB 2AOXA 4O1HA 1LJLA 3QXHA 3SG0A 5HQ3B 3IB6A 5DNEA 5KSOA 1NMZA 4QDZA 1UBMS 4DIMA 3BK7A 3NATA 3A9SA 1J0AA 4QU8A 3CE6A 1OJ7A 5CNJA 4C2TA 2F1JA 4IJKA 1VBFA 3RTBA 5AFSA 5BUSA 2BGMA 4ZREA 3BFKA 1XD2A 4W6ZA 3KQLA 2O57A 2GHIA 2QJFA 2YFKA 5JALA 4IDHA 1V8FA 2FZGA 5DNWA 5L4LA 1XAJA 2ZRMA 3FYTA 4NOKA 5LUBA 5M34A 3IKMB 4UJ3A 1SKQA 1Z37A 2BFCA 2BZGA 4FXOA 1KL7A 4BVBA 5FLYA 2O3RA 3RVNA 1XPUA 3IAFA 4JEMA 3KB8A 1X13A 1M75A 3KVOA 5FNZA 4ADSG 2BZ1A 5A6SB 1DRJA 3NDPA 1U0NA 1UODA 1AUXA 3E9QA 3OEYA 1Z6YA 2YWHA 4RQTA 2C20A 2OLKA 3W04A 4DPMA 1EFTA 3GN1A 1ZHOA 1DGQA 2XUQA 1GNQA 2PL5A 3NHYA 4UDNA 3KKEA 4BVHA 1YZGA 4B6PA 4F4UA 2BFWA 1VDMA 2PXAA 3F4KA 1NVFA 2PZAA 4ZOEA 1AMUA 4HGPA 4BUZA 1NPTO 4O3MA 4OO3A 4RY0A 4R8LA 4EBFA 3EIXA 4TXJA 4I08A 2WYHA 4DKJA 2RIRA 1UK9A 3JWPA 2B2XA 4EKNB 3QOXA 3W7BA 5LQJA 2K87A 4CQMB 4DYVA 1Q0RA 2WJVA 1W5BA 4B7UA 4D4GA 2FYTA 2YFQA 1DZIA 2WEKA 5KKNB 3AZQA 2O5EA 2EARA 1UM8A 2IYTA 1K9SA 3BIWA 4TVKA 1QU2A 2BISA 4MI1A 1DAEA 2AX3A 2AQKA 4PCLA 1U0OC 3RRBA 2JJYA 2BBWA 2XUOA 4MS1B 3C2QA 1GQ2A 4DA0A 1V3QE 2ZIVB 3C43A 4JX9A 4GMHA 3VUFA 3ZEAA 1OASA 1HK7A 2MDTA 4OGGA 2BEUA 2FHPA 1BWQA 4CUKA 2EG5A 4YUYA 1OAOA 4LGCA 3E5HA 4X1IA 3C8MA 3OBIA 3R4VA 1AC5A 2QN1A 2PPLA 3JR7A 1IMJA 2HPHA 5FL7A 3PHHA 3GY0A 3W9BA 2A94A 1KEEA 2R6AA 2IWRA 3L02A 1YB6A 1UEIA 4MW1A 5DNUA 5DSZA 1Z16A 3DE1X 1N4DA 2BJWA 4JEIA 5D01A 3P96A 4DBZA 3UJ3X 3BIFA 3O6VA 2V1UA 2ZUEA 8OHMA 1BEUB 1Z0SA 3OIWA 4RD3A 1ZM4A 1U3TA 1XMSA 1R3UA 1WPGA 2EC5A 2QTNA 3T7AA 1WF6A 2A9JA 3DONA 1U31A 3AKDA 4NYIR 4XTCS 5IXYA 3UATA 1VE1A 5AI0A 4CT5A 3C3MA 1Y8CA 5ADHA 2P0AA 3BZUA 4KR9A 4KO4S 2QM8A 2IP4A 3L8YA 3RYFA 3ZJYA 1L3CA 1PJ3A 2QL6A 1E1RD 1X9HA 4JVLA 4O4JA 3LUCA 3VBEA 4DQXA 4CL8A 4QWWA 5EQTA 1Z82A 1CUYA 2PSFA 1JHQA 1T26A 1U3GA 4Q3KA 5E9JA 1Z5NA 4KPUB 5COBA 1C80A 4L4UA 2HCBA 1YL5A 3EULA 3E22A 3ESAA 3DZHA 3FSGA 2BMAA 3FPLA 4OQLA 1T9KA 4WFKA 1L7BA 1ZOPA 2JHGA 4L5IA 5FA5A 3PFGA 1T2EA 1VJTA 3KQQA 4Y2TA 2IZ6A 5E1DA 5C4MA 1NVVQ 4J90A 4CG2A 1L2TA 4YAJA 3I4FA 4E14A 3FIUA 4NDAA 3EEBA 3FWHA 2FW7A 2JBAA 3PCXA 1ZQ9A 3I8SA 5CM9C 2DBQA 2E6UX 2AW3A 5E0OA 4YJKA 1LXCA 1P1FA 1Y0BA 4G0YA 4MDEA 2Z09A 1D2AA 5D3KA 3WNCA 4AU1A 1NAHA 4Q12A 1E1CA 2OAEA 2ZWMA 2AMVA 1FMLA 1GUYA 3QPBA 1XAIA 4UUOA 4MS3B 1N3LA 4BS9A 3ZW9A 2XMSA 3KR0A 3A1TA 3FG9A 3UHJA 2BR4A 1IXSB 4G07A 3VXKA 3A6HA 1UQRA 3QNUA 2COKA 3UT5A 4Q34A 5AQ1A 2I2XB 1AO3A 3AQ4A 4NBKA 1PZNA 3AJ8A 1KWKA 4QFCA 3KEFA 2NUTA 1W1IA 3SC3A 3T7CA 1GPUA 2DJIA 3CNBA 3E3NA 2CVFA 1FLAA 4LE1A 5CT6A 2JNWA 3TYXA 1BS2A 1E32A 3MINA 3TSCA 1GQRA 3CEHA 4OHVA 2LIVA 4ZOCA 3O2NA 4HYTA 1Q91A 2Z95A 2BFAA 3AV0B 2BTQA 3G1WA 2EP8A 2IYWA 4QTXA 3NEYA 1I80A 2XUFA 3RYIB 3LLVA 1OILA 2P2ZA 1SHKA 3CZCA 3DOEA 3B1JA 3NIDB 3EAFA 3TQSA 2GRUA 2O05A 1IPFA 3I9V1 3R23A 4JOQA 4L22A 2WILA 1ZSVA 5AI8A 4IH1A 4YALA 1KMIY 4YMGA 2YJNA 4RDCA 4U7DA 1Z62A 1MNQA 1B8UA 2O4CA 3B6ZA 4ZVRA 1Z2EA 1B42A 2VYCA 4PC2A 3RABA 3THSA 3FNQA 10MHA 4EY8A 5P21A 2Z5VA 5H4HA 1K75A 4ENWA 2CVQA 1XEWY 4BCCA 3M4NA 1XZQA 2QGZA 2QGNA 2ZB4A 1UM9A 2G1JA 3BM5A 3GVXA 1J09A 4JC4A 4U6QA 5H9WA 2IX9A 1R0XA 1FSZA 1UQUA 3D7RA 2WLSA 1JXMA 1X15A 2NSLA 2XRMA 1BS9A 3U56A 2HA5A 5MN4A 4FNGA 1A76A 1KPGA 5KQPA 2V0CA 2ZJ7A 3K71B 2VEOA 2IEYA 3HFGA 4XDYA 3L4EA 3FBTA 1SHTX 3IMEA 4WW0A 2P2YA 4G0QA 1FNSA 2WJ6A 3O4IA 4GUAA 4KV7A 4Z9AA 1NC1A 4A6EA 3E9RA 3G2OA 1D1TA 4BX8A 1RKQA 2TECE 3P19A 2C2MA 3PPYA 3H8VA 4TMFA 5EWLA 1Q7EA 3WOVA 4H1HA 4EB6A 4EUKA 4BXOB 1DAPA 1NW3A 3HBLA 1TCCA 2C3UA 5G1PA 5SY9A 4BWYA 1PG5A 3AI2A 3GRKA 3N3AC 5J40A 4DJAA 1LFAA 1I9CA 1EGMB 1XTIA 3K9NA 3IVXA 4QAJA 2GN1A 1ZKDA 2YMPA 3I9LA 2JH3A 5IEJA 4LJ4A 3ZHVA 2I54A 3AY7A 5L8VA 2WINI 3TIVA 2VKTA 1RXSA 5IJXA 1S96A 2AL7A 2PT9A 1PW5A 5JSZA 4K2HA 1HFEL 5JI3E 3NAQA 4ASUD 1L6RA 1Z4QA 4MQFB 4LYEA 4QFMA 1RQLA 1YB5A 2GJAA 2OXRA 5J23A 4CQMD 1XHFA 1QK5A 1AHNA 1XLTC 2PZFA 4J29A 4MWZA 3WKBA 2AN4A 3NJRA 1D3AA 1N2IA 2VDJA 3GLUA 3K2IA 2EQBA 1LLQA 1N0HA 1T6YA 4HI0E 4M0CA 3REQA 2R5NA 4NTZA 4FP9A 2EATA 4JLDA 5CDHA 1E2EA 1Z45A 2XTMA 4DBLC 3G6KA 4KWCA 3CT4A 5CT4A 3NH9A 1CUIA 2ECOA 1SD2A 2VBIA 3TZEA 4GVXA 1HZZA 4MUYA 1ABEA 1NWHA 2P6OA 2BJVA 3LYLA 1IXZA 1NLMA 1FYXA 2PUWA 3MUFA 3RS4A 4GMGA 1FYVA 3ZS9A 1F0KA 1KFEB 2NTYC 1MFPA 3A0RB 3TR0A 5KOJB 4MJLA 4RPJA 3PFFA 1FDRA 3TQOA 4C30A 4V39A 3BGVA 5JDIC 1ADYA 2OFXA 3IAM6 1MPTA 3N75A 4ZRNA 1A95A 2PNJA 2D6FA 3C6BA 2ZUBA 1Q77A 2QQ5A 1YE3A 4XR4A 4CKEA 3JAWB 1RWOA 2L42A 5EYPA 1HE5A 3B7WA 2N47A 2ZRKA 1Z2CA 4KBFA 3DUWA 4KCGA 1MABA 1NVVR 2RKWA 5TVGA 1EFRA 2BELA 3GAAA 3BB4A 3H19A 3L0BA 3L1JA 1N6PA 3Q12A 1ZGBA 4DCUA 5E38A 1KC3A 2A9FA 3I83A 4IUCS 3DTTA 4Y0VA 2WU0A 2J6IA 4DVGA 3TLZA 1M5RA 1D4OA 5HGJA 1HBJA 4ZQHA 2ANBA 3N2ZB 3EW7A 4MKRA 3ET5A 4D57A 4WXYB 2IH5A 2P4HX 4DXDA 3GRVA 4MICA 4WK2B 3HHPA 2RBEA 1H2ZA 5K6AA 5E7MA 4GX0A 2ERYA 4E7PA 2IU4A 2MSCB 1E62A 3OU6A 4DT1A 4ESHA 1KRWA 5JADA 1A88A 1BGVA 3UAXA 4I50F 4ILEA 4BNYA 3I42A 4DV2B 2YOHA 1BO6A 3L8EA 1SKUA 4TWBA 2ID7A 3WDKA 5F33A 1H3EA 4R2WA 1GEEA 4JA2A 2J30A 2N9UA 4Y6RA 4P34A 2ZYRA 3X1YA 1TZBA 4OKNA 4NZZA 4NAHA 1W4AA 2BHSA 7GPBA 3WK9A 4RV4A 2RB4A 4C22A 1AXRA 1FDTA 3TLKA 5LIPA 4B3MB 1TJ5A 4IYRA 2GDJA 2PLFA 3JVEA 1IJEA 3DHYA 1V48A 4BMOB 3X44A 2DQKA 4GD3Q 5FD8A 2WUVA 1RLIA 4GPD1 1T5OA 2UXDB 1B6TA 2X9QA 4XPZA 1TJ3A 3OMWA 3ZLJA 3LGXA 1A9QA 1E5XA 1M2FA 2ZK7A 3CLSD 4J2HA 2DFTA 4XCXA 4P53A 4XYBA 1RHJA 4C08A 3FIJA 1AVTA 3VV2A 1UFKA 3JQFA 2A0KA 1GZ4A 3UHOA 3WFJA 4GSYA 1ZZGA 4KYVA 4Q9AA 4CJXA 3D6JA 3KHUA 1QPZA 2I99A 4N8SA 1T34A 3LBAA 5KYYA 3WXMA 1RXVA 5KI6A 1GZHB 2XODA 4XQ9A 1UKYA 3E70C 5B4UA 1MEOA 3KVYA 2ZCVA 4RNCA 5K8LA 1SBCA 1CUJA 4NOMA 1XRJA 1A3CA 4BBJA 3ESXA 4ANFA 4L5CA 4ZQFA 3JD0A 4PO1A 3UKDA 1ISGA 4S1WA 1XZDA 3GJ8A 4HZGA 3L1HA 5DU2A 3D6UA 1T8YA 3R9XA 1JQEA 4Q01A 4LRXA 1I3CA 4BZPA 1FUKA 5JATA 1LLFA 1TO6A 1U90A 3K05A 5L95A 2C96A 1CUZA 1D2NA 2MYTA 5I7WA 1C9EA 2W0SA 2X41A 3QA3E 4D8WA 5CFLA 5LD2B 1G9XA 2BHTA 2XJ4A 4PSCA 5CTJA 3DTYA 3NPAA 1JJVA 4EA7A 3ENKA 4OX9Y 3BN3A 3LZCA 4EX6A 1X42A 3I0NA 4PLFA 1XDSA 1WCYA 1QQ6A 1XTKA 3DWIA 4AJIA 3GLIB 3EIFA 4K81B 1MZPA 4WLOA 1YQDA 2FZVA 3EUAA 3E81A 3RRMA 3WL8A 2YJ3A 3ADDA 1I2AA 2YCBA 3WGVA 1IJBA 1JSXA 1T1EA 1PYOA 3L7DA 3QG5A 4MRMB 4PHCA 5CLFA 1OFIA 4XI9A 5DGDA 5FTJA 3WWDA 2GM9A 3N0VA 4M0MA 3IAS1 3X0DA 5IYZA 1JI3A 2PWYA 2EZTA 1TK9A 2O9JA 4OMDA 5D3MA 3GD5A 1CJCA 2AUNA 2C57A 2JF0A 2WNHA 2I2AA 4HH0A 2FQQA 2ZSDA 3D7NA 3KOWA 4OHOA 1SG9A 1YH3A 2GXAA 1TMGE 4QZVA 1UMCB 2DOKA 1PL8A 1BEEA 1BGWA 5KNBD 1TI7A 1HZJA 2FMHA 2MR6A 2Y4NA 1P4GA 2ISQA 5HRAA 2OGTA 1X1RA 1DEXA 3NCTA 4RZIA 3AUTA 2VT7A 3TW4A 1AN9A 3DDNA 1JA9A 1YE8A 2P9QA 3DUFB 3MEQA 3QOFA 4HCJA 1UFVA 3KQWA 3R3HA 2C1ZA 4GQBA 1EM8A 1PDWA 4MW9A 4YIKA 4XE5A 3VZRA 3VNBA 3S2YA 1IOVA 4AWXA 4FFSA 4KDEA 4U7GA 4XWAA 1VP9A 2PVCA 3MYRA 1EJ2A 3OY2A 1QZ3A 1U7XA 2QI9C 3PD7A 5KZMB 2H8GA 1GPKA 4RE6A 1WBJB 3VRHA 4MW2A 5FOVA 3MT0A 2CNKA 2XCTB 2C58A 3E9EA 4HH3C 4JZYA 2H7XA 2B25A 2HBQA 4GM1A 5EIAA 3S6JA 5AVWA 3KSAC 5M5BA 1G5TA 2P40A 3JQBC 1SU8A 3A25A 4JJ4A 4LY9A 2ACEA 4F3KA 5JMTA 4DWJA 3KLBA 2R6CA 1X7GA 1ZSNA 2NTJA 3S2UA 3OI7A 1L5HB 5HXAA 1XFDA 1S4MA 3VDNB 3K94A 2VDRB 4PFJA 5ALLA 4G5GA 5D86A 5AOCA 1YBVA 3EZ2A 1QGUA 1PWHA 4HOYA 4INZA 4TTQA 4Y18A 5G2OA 3TRJA 1OFTA 6NULA 4INAA 4DJDC 1K89A 1ZNZA 4I1VA 4IVNA 1C1YA 4IIJB 4B3IA 4PYQA 1AH2A 4R4JA 5CXQA 1YJBA 4EJSC 1N5MA 1TK2A 2Y93A 3ILSA 4YMWA 1CSEE 3P4XA 2OSBA 3HXTA 3GFQA 1WM1A 4A8HA 2RIPA 2H4XA 1PVOA 3OZUA 2AI3A 4XEUA 2XAAA 2IH2A 1N2ZA 2G4LA 4YMLA 1YJQA 2OY0A 2BZSA 5FPTA 1NVEA 2FOXA 1QWSA 3OKAA 3L1IA 3N7AA 1MLDA 1KJNA 2DU8A 4KJXA 4R9RA 3HUFA 3QWBA 2ODPA 3IIKA 3FPGA 1S6YA 1ZS9A 1QUFA 2MSWA 4ZGWA 4Q4JA 5CAEB 3H5VA 5FADA 1H1TA 1NLFA 3GFSA 5TPWA 4RTQA 3OZAA 3KKZA 3ZLBA 3R5XA 4JR1A 5K4HA 1Q0PA 2G88A 2I3GA 2XRFA 4P84A 2WT8A 2VJLA 1KXZA 4MWOA 2P3SA 1V8OA 2Y1CA 3B9PA 3LFTA 4G97A 2R7NA 1RADA 2V65A 1DRKA 1Y63A 4BB0A 1B74A 3QW2A 2P1RA 2NU9B 1QTIA 3C45A 2BDEA 2H00A 4UDOA 3TXYA 1N3YA 2QM0A 4JA0A 1C8VB 2QR2A 4WEOA 3DC7A 4X6YA 2WIGA 4KO3S 1NI5A 3OP1A 2W2NA 2F62A 2IXBA 3I4LA 2PV7A 3B1YA 4CR6A 3W77A 1GGVA 2ZI4A 3P0EA 2FOIA 2AHRA 3CXRA 3NHAA 3OX3A 3F7NA 2ZR0A 3ENNA 1D03A 1V5IA 1M3SA 4P3XA 4TT3A 3BMOB 3RKSA 3TUIC 1NMQA 4CYMA 3UEOA 3HMQA 5JS8A 1P4HA 3EJ6A 5CURA 1WZEA 1L4YA 2OYCA 1Y5NA 4J7CA 3I73A 3WIVA 3KJHA 3RARA 1RBQA 3LL4A 2C4TA 4AT1A 2C95A 3P20A 2DETA 3QSGA 1FJXA 2FPMA 1LF5A 4JH0A 3BXEA 1B0AA 2ZUUA 5LVAA 3KELA 1T9DA 4II7A 5ESRA 3O21A 5TQ0A 3NEJA 4NG4A 4HKTA 3STHA 4K9OA 3EAQA 1EJ0A 2NP7A 2HIMA 2O2ZA 1S2NA 3FKJA 3KXDA 1JA1A 3M49A 4B48A 4EAQA 2UXBB 1TCVA 1X1TA 1JS1X 3SHQA 2OV6A 5T4FA 1B2RA 3RFFA 4BIMA 3ZY6A 2I3AA 1FNCA 1H0SA 1GDHA 1MRSA 1OBVA 2ZG6A 3BXXA 3DP7A 3INRA 4KOAA 4RPGA 3T3NA 2CCKA 3DDUA 3S68A 1JEJA 3C7DB 4LF8B 3LLSA 3W5JA 4K8RB 4PIVA 4B3CA 4B87A 1RCUA 4UAVA 4ZD6A 2VP2A 3M34A 1O0BA 3MGBA 4WA7A 2CE7A 4QA9A 1L7RA 3T7KA 5BN5A 5BNWA 3G0CA 1XZPA 4BAZA 4RDIA 1JZQA 3P52A 3V1YA 2FN8A 2O14A 4ZI7F 3FTNA 3ITDA 3KAJA 5AI4A 1F1JA 1NYRA 4H0CA 5AM2A 3JQEA 4K88A 3G0HA 4EEKA 2FZCA 4JSRA 5FYDA 2Z2KA 4FSHA 1CB0A 3K1ZA 2H63A 1YKSA 5BQXA 2JHFA 4C43A 1KF0A 3C4QA 1H8HD 2A30A 1KQ3A 3OOEA 2PUJA 3FMVA 4N7MA 5TRTA 1B73A 1E2PA 2WF8A 3AW9A 5KNCA 1A9OA 4TLEA 2VHYA 2B0CA 3IEPA 2W2PA 4AP6A 2W6QA 2F4NA 2R1UA 4G5QA 4Q00A 3RYHB 1W96A 4BO9A 3BGDA 3CH7A 3IUYA 3MBIA 3P2MA 1JFFA 3K35A 2PGAA 5HJ7A 4HB3A 1BQ3A 3R44A 2G4VA 1GSHA 1H4VB 3G8YA 4RYDA 1IZ0A 2PFSA 3QRWA 2JVJA 3AOEC 4LZPA 4ZOAA 5ICCA 1CIJA 1CUVA 1ZBQA 1Q0QA 3DE7X 1GKKA 3HL4A 2ZR7A 4JVNA 4UUNA 3UMBA 3ER8A 1JSLA 1E98A 5E3JA 1UMBA 1YDMA 1QANA 1DBSA 3DEAA 3WBJA 4KREA 4JB3A 4FFOA 3KVRA 4HNAB 5KKCA 2YYYA 1HEYA 3U4MA 3T9FA 1NM5C 3AEQA 4RJ2A 4EL0A 1SXPA 1KZ6A 2GM5A 3L6OO 1YBMA 3GGOA 5DNAA 5HDBB 2ZSHA 5C0OE 1UKVY 3UMRA 4EIWA 3KWLA 3SQDA 5BMVF 2MJLA 3E82A 4LOLA 1RAEA 3HKDA 3SEZA 2YHUA 1KMNA 4KOEC 2RB5A 2ACWA 2IYPA 3E8SA 2P75A 4II3A 5LB4A 1P2VA 1XNGA 4PM4A 4B44A 2JAWA 4CDRA 3ML1A 4F46A 4FVTA 3VSBA 3JQQA 1UXHA 4MHSA 4I1RA 3B9QA 5CLLA 5ECYA 5AKZA 4Z3DA 2GTIA 2HF8A 2WWGA 4Z0TA 3SQNA 4TMTA 3ZI7A 2B4QA 4IHJA 5F5LA 2Q7OE 4DA6A 3RRNA 1XRQA 2IOQA 4HNHA 4YCAA 5CA0A 3SF0A 3CUWA 4E5MA 2NO6A 1KP2A 4KH0A 2GSDA 2OGSA 1WUTA 4M1WA 4RA6A 4UPEA 2NVBA 4XGQA 2YXEA 4QNRA 3EOZA 3QE3A 4C2AA 1PFWA 3TLMA 2A59A 4Y2XA 4R41A 5IP5A 2AD5A 2JDID 4PYIA 3TTSA 3VJRA 5F64A 3A9UA 5BW8A 1B14A 3KIPA 4B81A 1XLTA 3H84A 1F2UB 3UV3A 1YTUA 1PI3A 1MAHA 1CX9B 2AI2A 1J70A 1MJHA 3K9HA 4BMPB 3C74A 4OJQA 4W7IA 4NESA 3ICCA 4Y1RB 3CISA 3UUGA 2QBYB 2TYSB 2ZSFA 1IN7A 2R9VA 4FQ7A 4EZIA 4KDCA 3JD2A 2E55A 2OZLB 1EWVA 4HNGA 5LN1A 1ADCA 4QDOA 3VU8A 5DOZA 1L4HA 2AMLA 2VDNB 1SC3A 3R1IA 2BEVA 4M36A 3KFVA 1FZQA 1SKBA 4IVPA 5SY6A 4CEHA 1NG1A 3M3PA 1P7PA 1E2HA 2A35A 1NASA 1O54A 2I03A 3O82A 3Q5EA 4G1MB 2WT4A 3V4ZA 2BGGA 5DTRA 3C3XA 2I65A 3KDAA 4QKQA 4PC3A 4RSMA 4NK5A 3U4GA 4CR7A 3ZDCA 3ZBPA 3WMFA 4ENRA 2CLMB 3IQDB 1F12A 2XT9A 3TTTA 3H1TA 3PWSA 3A2LA 3Q87B 1K7FB 1VLMA 4ZRMA 2AFIB 4ZVUA 5BSHA 3H3FA 2OP1A 2OSVA 1FLVA 3MOSA 3IP1A 3NIBA 2FOLA 4DSAA 4L2IB 3UFXA 1MO2A 1ORWA 4RKYA 3DTVB 3UA4A 1UXJA 1H4TA 2CNWD 2XBMA 2HB6A 2ODWA 4RELA 1N9ZA 1Y4SA 3FFXA 3A1FA 1JUDA 3FJYA 1NN5A 4H1VA 2VF8A 1JU9A 1V5EA 2EKDA 4UQLA 1JT2A 2WIKA 1CW2B 3FM9A 3VU9B 4C2BA 3OEWA 3HU2A 1P19A 5LKRA 1AK1A 1AX9A 4DCNA 2PX4A 4WLNA 3R7FA 3G0IA 3C8DA 4JENA 5C5IA 1XJCA 1Z7EA 1K8RA 2V5VA 4GFDA 4LHSA 4OHUA 1XTTA 4JBYA 4JI5B 4F04A 3L40A 4B2LA 3S81A 2W42A 2GB4A 4E21A 1USWA 4F6RB 3DE3X 3CH5A 4NK4A 4BTVA 2QG4A 4EY5A 4RJTA 1Q5PA 4F5ZA 1P1CA 1TM3E 1Y34E 2X8JB 1IVYA 2CSUA 1HORA 5AJHA 5AQEA 4EPVA 1X1AA 2ZBEA 4CKZA 1E9SA 4AS2A 3THWA 1YWGO 3UJ6A 2WPNA 4C4OA 4LK3A 2FWBA 4LJ6A 2H2AA 4E5YA 4YAKA 2DPHA 2C98A 1IU9A 2W8ZA 3DXZA 4QD3A 4LCEA 3H86A 1QFMA 4IIFA 1SKMA 4RIEA 1NVDA 4JP5A 2ATVA 4WOKA 2FSSA 4Z9FA 1E1DA 5B2FA 3F0TA 4YV1A 2R8RA 1KH1A 2Q4BA 1XBTA 2I3DA 4QC2A 3WX0A 1PGQA 4NS4A 3MOIA 1UMKA 2OHGA 4ACBA 1C1DA 3IUPA 1QRUA 2XXAA 3U4QA 5J2TA 3RQSA 1AQYA 5KNDA 2PZBA 1IN5A 1EG7A 2QTLA 1DG1G 3JZFA 4DLRA 2FEMA 1NV8A 2ZUSA 4D92A 2H4ZA 1T6NA 5E6UA 1XMXA 4WESB 2BFMA 4DC1A 1VFNA 4KFUA 4M21A 3E4CA 2QF7A 2JL1A 3L04A 4YCMA 5LSAA 4I4LA 3MJEA 2SICE 1UPXA 3AINA 2WY2D 1ECLA 2I4RA 4IKEA 1S9HA 3ND7A 2ZSUA 5FR2A 1KIAA 4YQFA 1TU3A 3PUXA 4QBIA 4WNCA 4DMMA 3A3KA 3VPCA 4G4SO 1V5GA 3WADA 4QHTA 3RIYA 2OUKA 4EQ6B 4F4FA 1A71A 4JHXA 2CHEA 3UPTA 2F55A 1XN1A 2HJRA 2H5LA 4G0PA 3L0PA 2CKMA 3DAGA 2V7BA 3AGPA 2FXIA 4J0FA 4LHYA 4P6VF 4PRYA 3ZJUA 2WQ7A 3N2GA 1E79A 5F3WB 5EKTA 1ODLA 3JCZA 3KPUA 5LP1A 5AVTA 1X39A 3C16C 4V0QA 3MMZA 1W52X 4P82A 3SKXA 2Y67A 3ZWOA 6ADHA 3T1NA 1JLMA 4W7SA 3DZBA 1O6CA 2JGEA 3PQ6A 4I9NA 1GVNB 1Y9EA 5TGZA 1DDOA 3PC3A 1AQNA 2GERA 3SHVA 4K6GA 1J2EA 2YHIA 3C7KA 3WQRA 4ZYXA 5C1PA 4R2LA 1AURA 4G0OA 3ROGA 3GOHA 3PIIA 1BXRB 2OV8A 3F47A 4K87A 4YV7A 5JH7A 2CFTA 2JFZA 5K45A 3MW8A 5GAJA 1U8ZA 1XZIA 8AT1A 3LYUA 3NC1C 3KJZA 3T9CA 1E2UA 4BMDA 3R3YA 1UPFA 3FBWA 2RGEA 4LOIA 4TUYA 3VO2A 4X64B 2DWQA 1MQ9A 5FV7A 1CQIB 1O97C 2CMDA 4JEUA 1D6MA 2HA2A 2HPAA 2R4TA 4TWRA 2X42A 2B8JA 3ZZMA 3UK1A 1ZOIA 4MRRA 4YJ2F 1WMBA 4AIRA 1F2DA 4MOWA 3VGJA 4E6EA 3QWHA 2G9UA 3TEMA 1V7PC 3UOGA 3DOFA 2VPZA 3O9MA 3V8MA 3A32A 4J0KA 4BU0A 3FPJA 2MMCA 1UEJA 1NQ5A 2JEZA 3DQPA 4Q9NA 4MUKA 3AUKA 1T36B 1CP2A 2Q5QA 3I09A 1PJSA 5J4LA 5EHNA 1REQB 3U44B 4FKZA 1W47A 1YS6A 2CVOA 1JTEA 2M1ZA 3FVWA 3T15A 3EBOA 1GU1A 4DNOA 1G17A 2FEXA 2FJPA 1T4CB 1ID8A 1H1LA 1JEQA 1RLMA 3ZHTA 3JQBA 1FK8A 2VPXA 3LXMA 3GA0A 4BRWA 1W59A 2LTAA 4P2BA 4Y2JA 4EG1A 1VLHA 3G8CA 1JFRA 4EGSA 1JDZA 1P5JA 1I7QB 4UHCA 4BN5A 1W4LA 3OZTA 3QG1A 3TR6A 2XA9A 4BNVA 1XA0A 5A7HA 1THMA 3T6KA 3WMWA 1ACLA 3GP3A 3SZOA 4DNQA 1WEKA 4ZVLA 1WEHA 1EFCA 1W8IA 2IE8A 2CYBA 2B8EA 2SKEA 1XVIA 5TVKA 4U9IS 3QZUA 4AC9A 2Z2YA 4O29A 1Q14A 4B2IA 4EJSA 1ZEMA 3MJRA 3VMFA 1VE7A 2NZXA 4QATA 3IALA 4Q3DA 1W0CA 5BN4B 3VTFA 5AVSA 4KU4A 1KQGA 1OH8A 2QAIA 3ED5A 3BRSA 3ENWA 3DZGA 5IDVA 1QHGA 3HO8A 4AF8A 3PKIA 3WZMA 2DKFA 3JV7A 4F4CA 4Z4QA 1QU3A 3KDPA 3TX2A 2WLTA 4RJKA 1KJZA 1HMYA 2XA2A 1MUUA 1TW2A 5D5HA 3LUPA 2H08A 1M8FA 2ZJBA 2F8LA 4MX8A 2OFWA 1DIRA 4PXAA 1QFJA 2BHNA 3WK5A 5AHRA 1OTXA 4RVSA 3DTVD 1QVRA 4K0KB 5L7YA 1U1CA 4GGOA 2WAAA 2WD9A 2BHRA 2Q2WA 4OBEA 1LCIA 1SCNE 3AI7A 4M3NA 1ACJA 2JFOA 1ITZA 3VKVA 1FP7A 2IITA 1PJRA 4BFSA 3IMKA 1GILA 1NFFA 3I8XA 4RZXA 1FIUA 4MW5A 1CHNA 3OPNA 4X85A 4D99A 4QHYA 3BD9A 3UXHA 5E4FA 4IHKA 1XTRA 3OOJA 4HGYA 2YY5A 3HN6A 2EL9A 5LR6A 3CZAA 3EPPA 3F9RA 2HNAA 2XCIA 5EIEA 1TVEA 2X6QA 1J2YA 2P4QA 1TM7E 2VKQA 4UAJA 3TOXA 1V5WA 3JALB 4RS4A 4B3GA 1ZRSA 4R71A 1N6KA 1R10A 2ORVA 4HGQA 2BTOA 2JGDA 4WX2B 3GOQA 6CHYA 2M98A 1YU6A 4QECA 5KDDA 3TJRA 4C0WA 1FRNA 1EZZA 4BEVA 2VSYA 2ZB3A 1UJCA 3A4MA 3V1TC 3T5CA 16PKA 5A2GA 5FBWB 4C04A 3E7FA 4HXYA 3UNXA 3KV1A 4KH1A 1X1BA 3HUUA 1F3LA 1LV8A 2RKBA 3ECSA 2J9YB 4G1FA 4HVCA 1TD9A 5D6NA 1USIA 2FGJA 1V1RB 5CD1A 4RHFA 4N3AA 4XOIA 1OAKA 2QRMA 3X1DA 3CPEA 3S70A 1V16A 1U7HA 2PMWB 1JF8A 1XZFA 2IIQA 3CR3C 3OLWA 1JI0A 1W93A 3QUTA 3RRYA 3GJ6A 3PNLA 2Q49A 2ORWA 1PR9A 1JBEA 3EARA 3H9CA 4IOJA 4GEKA 1JDBC 5A3JA 1VLLA 3BWCA 5HOQA 1LQTA 2P6NA 5C37A 3SIRA 5BWNA 4G65A 3IMGA 221PA 2J0SA 1KRHA 3NIGB 5DPMA 1T0JB 4FCVA 1U3CA 2VP9A 3BEDA 4KNWA 5KJFA 2G9NA 4DSZA 4HMQA 4MIYA 1U8CB 5E7JA 3TX6A 4YWJA 4C0SA 2P6RA 3A2KA 5AW9A 3EDMA 2B8WA 5F2OA 1JSRA 1LPMA 4G4IA 4QQNA 1B0PA 4FFBB 1KK2A 4E3WA 3ZWCA 3ICWA 3OJWA 1OXVA 2BW0A 3M2PA 2RJ3A 5SZHB 4WI1A 4YDSA 1CZNA 3GEBA 1X92A 1M66A 3F5DA 3GNSA 5G02A 4DCGA 4XUDA 3RI3A 3ADPA 5LWQA 2O1XA 4Y2SA 2ID9A 5DASA 4H7KA 4MGYR 4B6SA 4JUAA 3NHKA 2BZ0A 1MIOB 1KVSA 4OQNA 1CR6A 2YX1A 2JVIA 3TLEA 4ZANA 3A6JA 4KUEA 1ISMA 1OYVA 3V33A 4HNUA 5KOHA 2E4XA 3DDZX 4D0RA 3AOEA 4N7BA 3JXEA 3MT9A 2FMTA 2VJQA 2ZBFA 2C9OA 2VIIA 3AETB 5G4LA 4CMAA 2W43A 1Z6TA 1HT3A 1P5RA 2EGHA 2GFQA 1NBMA 2I71A 3AHDA 1E0KA 3U40A 3FOCA 2QD1A 1VHTA 3WAJA 1P8AA 1LWNA 3MC1A 2WVGA 1HWYA 4CDGA 1FSGA 3E18A 1I5EA 5EP2A 1JFVA 4GZ3A 4MR7B 1E4EB 2V7UA 4M22A 5GIPE 4LHZA 2H4YA 2C7QA 1NM5A 5JPCA 1A5TA 1L4KA 3QX8A 4IHAA 3OCVA 3CVOA 4CUZA 2QMEA 4C06A 3V46A 5C80A 3ANSA 4DV7B 4J49A 1AHIA 1XRNA 1ZH0A 2ICAA 2IELA 5A0FA 2Q4EA 3W5CA 4KXYA 5A7GA 3HKCB 4LBYA 4PZCA 2AUTA 1F1BA 2OXFA 3UZUA 1Q2XA 3I9NA 4TVOA 1FDOA 4G5OA 1QGDA 3CO0S 1OTHA 5DB4A 3R6LA 5ALTA 4EUEA 3PUVA 4JYAB 1CEEA 1GGHA 2PT6A 4AQ7A 5JZSA 2Z56A 4MVJA 4N8EA 4QYIB 1X1SA 3AB8A 1QQ5A 3CW8X 3M6WA 4V0OA 5DI3A 3TR5A 5I47A 3DMTC 2D2EA 3KL2A 4JB8A 2I6TA 4JQSA 1G291 5FQNA 2PA0A 4D5GA 4ZZIA 3QKUA 2JCVA 3WRYC 4P3NA 4PX3A 4CLDA 1FBTA 5I9MA 4GYJA 4YJFB 3SIXA 1YCGA 4NJMB 5AKKA 5SYMA 3CURA 2C7RA 1SZCA 3PQ2A 1NMSA 3INTA 1IONA 5IBRA 2ZTVA 4CMCA 5BUCA 4OVKA 4DVJA 3ZTTA 3BF8A 1GPDG 1O9BA 4HHEA 1OFUX 3MILA 5EXEA 3UT0A 1MB4A 2AT1A 1XZ8A 2V6BA 4U0JA 4BVLA 3DBRA 1O0CA 4K6FA 2PQ2A 3BCSA 1X8KA 1LA2A 3LK6A 2ZPUA 2IFTA 4PZDA 1T0BA 1O89A 5K6AC 3PKZA 3ZOKA 2C8VA 2OEPA 2ZJ2A 3W9SA 1L4EA 2HEIA 4RA9A 2L69A 3E84A 3LECA 3AUYA 1JQJC 2X1HA 3RKUA 4PTYA 4JBHA 3SXUA 5KHLB 1DIBA 1RRFA 5IJZA 2WVHA 4TLBA 3ASYA 3MRTA 2VWPA 4U7PB 4JVOA 3V9PA 4B74A 1Z5WA 3AIMA 1XELA 3NC0C 4MO2A 4ZJZA 2IUEA 1S2IA 3M1YA 1H2YA 5KYTA 5DO9A 1DI0A 1DHTA 3LP8A 4G9BA 2C4NA 4YS6A 4DQ0A 2HWUA 2VHCA 3EZ6A 4DDUA 1KO4A 4ND6A 3GYBA 3ZNQA 2QSJA 4ZQBA 5SICE 1HMPA 1PE0A 1FUIA 1C2TA 2H9AA 1CC1S 5KNDH 2PUCA 4QT4A 5J2UF 1KDTA 2ZWVA 3SQLA 1W0KD 2BWJA 4MP8A 1UC4B 2NO7A 3EPKA 2DB3A 2XE4A 1X7WB 3C3EA 1ZH2A 3QKIA 3CO5A 3OVMA 5HJ5A 3H04A 2JGKA 2EFEB 2GTPA 3RM3A 1R4MA 3RSGA 2ZE5A 3ND5A 3T8YA 2H4HA 2FA9A 2Y6UA 4I5FA 3RDPA 3D7LA 3QHQA 1TADA 2I6SA 1JEOA 2AEJA 1L7EA 3JYHA 3T0GA 5KOIA 1MJNA 4J07A 1G3UA 2EKPA 1E1KA 4IRMA 1PEDA 3SPXA 4D4MA 1VRVA 4WFJA 1BKDR 5ALHA 2AA3A 2MINB 2PZGA 4FT4A 3D2LA 2WU8A 4US0R 5DSXA 3IUJA 4CM8A 2YMLA 5BN3B 3IEVA 1E0DA 5IC5A 1KK3A 3JZDA 4Q9KA 3ZW7A 2CXPA 3P9XA 5BSTA 3HU5A 2D7DA 3TG8A 3ME5A 1QIFA 4DQDA 1LSUA 1U0SY 3AWIA 4C4TA 1L9XA 1A2OA 4HFRA 4CM7A 1V35A 1BU5A 1D1QA 1EFAA 4Q37A 2JS7A 2NQTA 2ZYGA 3E5RA 2P9YA 3LWDA 3GLGB 4JV5B 4GM4A 1EUZA 1Z36A 3MWDA 4JJ7A 2Z2IA 2QJTA 3MMPA 4WBXC 4A3SA 1K86A 3FOFC 5E6SA 2ZWAA 1A27A 3EZXA 2C61A 4GSLA 4LSGA 2IUYA 1UDRA 3H1GA 5FFMA 1XCMA 3NZEA 3DT8A 5GJVC 5L51A 2QL9A 1N2XA 3EZYA 5E7QA 1WXGA 2Q4OA 2X40A 3DAOA 3TFWA 5THKA 3EN0A 1JEEA 2Y6VA 4WN3A 2UZAA 1XQ9A 3VPAA 1QK3A 1HQKA 2NTEA 5IDXA 5G0VA 4BEJA 1KMCA 1Q7RA 2HLDD 3P9PA 4IDPA 4RPIA 4XB2A 3LG2A 4R3NA 1W85B 1PEAA 1KH2A 2FW9A 3FLMA 4FD2A 4LGYA 4RY8A 1F20A 4B3DA 4G6ZA 3FPKA 2GDZA 2VSNA 1G7CA 4UEOA 4KZKA 3I5YA 3H2IA 3U3JA 3VJKA 2HFKA 2B6NA 1QYVA 4H7DA 4LPSA 2ZRPA 2AFIE 2JBWA 2ZS9A 4MDFA 2ZOSA 1ZLXA 3NM6B 4JC5A 3QQPA 1E4YA 3N76A 1R74A 2P8JA 2PJZA 4R3WA 4U2DA 4BEBA 3X2SA 1DOHA