1G3RA

Crystal structure analysis of pyrococcus furiosus cell division atpase mind
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
237
structure length
237
Chain Sequence
b'MGRIISIVSGKGGTGKTTVTANLSVALGDRGRKVLAVDGDLTMANLSLVLGVDDPDVTLHDVLAGEANVEDAIYMTQFDNVYVLPGAVDWEHVLKADPRKLPEVIKSLKDKFDFILIDCPAGLQLDAMSAMLSGEEALLVTNPEISCLTDTMKVGIVLKKAGLAILGFVLNRYGRSDRDIPPEAAEDVMEVPLLAVIPEDPAIREGTLEGIPAVKYKPESKGAKAFVKLAEEIEKLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION INHIBITOR
publication title Structural and functional studies of MinD ATPase: implications for the molecular recognition of the bacterial cell division apparatus.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Cell cycle, hydrolase
total genus 78
structure length 237
sequence length 237
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13614 AAA_31 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g3rA00
1IN7A 2DHRA 1A1VA 1AQUA 1NBMD 1KI6B 2CMKA 3TAUA 1S1MA 2FEOA 4K81B 3ZD6A 2CL6X 4NHOA 3ZZTA 3LVRE 5F3WB 2JLQA 2BCGY 3EZ6A 4URUR 1A2KC 3K8YA 1T3HA 5H8WA 4UNRA 1WMSA 3W3AA 2CHGA 1AK2A 3BB4A 1D5CA 4IDPA 2FZLA 4RFSB 1XCGB 2F3RA 2L0XA 3W6PA 3ND8A 1SXJA 2AR7A 4EPXA 2GXSA 4EFMA 1ZM3A 2H17A 2J46A 1N6KA 1U0HC 2QNRA 1ANKA 3CRQA 1NIJA 1E0SA 3VU9B 4OL0A 2EU8A 4RZ2A 2IUUA 3TMKA 2ZM5A 3CX8A 4DCNA 2PLFA 2ZRBA 2G1KA 3TVTA 3OIWA 4QGGA 1G3IA 2VBCA 2XOKD 3Q85A 1YZNA 3QUSA 3FFAA 2BM0A 1G9XA 3CWZA 5IK2A 1G291 2REBA 3DMDA 4PQFA 3UXMA 1RJ9A 2OV2A 4Q1FA 1N6PA 4ZO4A 4ZDJA 1XX6A 1E9RA 3LW7A 5B58C 121PA 2QTFA 2G3YA 2RGNA 4NCIA 4US1R 4NTZA 2JDIA 2FSHA 4DC9A 1KO8A 1T8TA 1KO4A 3N5CA 3PEWA 3H2YA 3BB1A 4ZCMA 3WBJA 2B6HA 3GLHB 1BMFA 1KI2A 2FFAA 4FMCF 1D9XA 4BFYA 5EZ6B 1CF4A 2YNMA 5JJKA 1OF1A 2J45A 4DLRA 1IN5A 2RGXA 1AQYA 1E2QA 5EZ5A 2B7BA 2O8CA 2QP4A 2J7PA 4BFWA 3LX5A 5TARA 2P6RA 3P26A 1FL9A 5CIWA 2P6NA 3THYB 2QSYA 3BERA 2NOAA 4QHSA 4D81A 2N46A 3P27A 1XFAA 2VYFA 1CRQA 2EFDB 4DCTA 4BFVA 5FPTA 1G8HA 1KK1A 1JAHA 2ZS8A 4R2IA 3LNCA 2FEMA 4C0AC 3ETLA 2QEQA 4AYWA 1UBGA 3I62A 4XTRA 4FI3C 1N0VC 4MITA 2WSSD 4LHXA 2ORVA 5BXQC 1ZNXA 1UJ2A 3LLMA 2LKDA 1JJVA 1J90A 4TMWA 3QF7A 2HYDA 4PO1A 4PSAA 2GF0A 4PC3A 3GLHE 2PJZA 3VX4A 2N42A 2ZROA 4LBVA 2EWWA 3QPWA 5L3SA 1JPJA 3FB4A 4OQFA 3SYKA 2WKRA 4IOKA 3H1TA 4XVRA 4HLDA 1G4AE 3P4YA 3UKDA 1W44A 4Q7LA 4NYJQ 1CIPA 1J7KA 4B74A 2QPTA 3AB3A 1NY6A 1NBMA 3BFVA 4HB2A 1G7TA 2JLWA 5KNBA 3NBXX 2FGJA 3ZS9A 2ZEJA 1Q1BA 1X8JA 2CCGA 4JVLA 1OYWA 4GBMA 2OEPA 4KFSA 3GJ4A 4GNKA 2P67A 3BWDD 4FN5A 3B85A 3TSOA 3G5UA 3BE4A 4TL7A 3MD0A 3RS4A 1RVDA 3V9PA 3AEZA 1W48A 3DDCA 2R44A 3EZ7A 4KSCA 3Q7PA 3THXA 2HJVA 3LQQA 2VHJA 4PANA 4TSFD 1KKLA 2MMCA 5FBQB 4MKGA 1HE1C 5JCPA 2KJQA 3AH8A 4P4SB 3THWA 1NLZA 4M1YA 2WWHA 4DEXA 3T1VA 2V8OA 4WZBE 5AWFC 2QBYA 2XOKA 4TL6A 5HE9A 1KKMA 3NWJA 3LO5A 4BE7B 3RVBA 1JECA 3U3MA 2XB2A 2AFHE 3DKVA 1EFRD 4ARZB 1IXRC 4AKEA 3SN6A 3KXLA 3GLIB 3CRW1 4PHFA 2GA8A 2ZJ5A 4BFTA 4B75A 3AVVA 5TB5A 4LV5B 2O8BB 1A2BA 3EARA 3VR1A 1HT1E 1N5KA 2QAGB 2CK3D 2EFCB 3PUWA 4MRVA 2Q6TA 5KPJA 1NVUQ 2AK2A 4TQUS 1QHIA 2ZI9A 2GCOA 3PFIA 4Q7JB 1UDWA 4C0QC 5JFGA 5HCIA 3U44A 2ZR9A 2WJHA 1RRCA 4XIGS 2ZJZA 1QF9A 3ZVNA 2WBLC 3TQCA 4DCSA 3SHWA 2RB4A 3E70C 4POAA 2IYUA 2Z0MA 3NIBA 4N1AA 1EX6A 3UWOA 1OT3A 1OW3B 6Q21A 5KDDA 2YJTD 3LBNA 1RW4A 4JLKA 521PA 2HYIC 1XDBA 2QN6A 2H57A 5BWMA 5EXPA 3D3QA 3TW8B 3VKWA 4EPTA 1VHTA 3ZVRA 1J2JA 2QP9X 2Z4SA 1F2TA 2AD1A 4R2HA 3QNUA 3C16C 3GJ3A 1OFIA 1AN0A 1G5RA 2JATA 2BBTA 3A4MA 4LC1A 2AFIE 4IXMA 5EE1A 4ZIRB 2V1UA 1BIFA 1R2QA 3GQBA 1E99A 3CB4A 3CRMA 4ACBA 4A6XA 5DI9A 3CKLA 1E2NA 5C1BA 5HKKD 3CWQA 2N1BA 4TTPA 2CHQA 5IF9A 1JR3E 1TQ4A 1UBFA 1E96A 1X86B 5J5CA 4FWIB 2RHMA 3Q8XB 3TAHA 2HJGA 2YOHA 4RKEA 2GZDA 3VR4A 3AVUA 1IXZA 4PQRA 3X1YA 3R9WA 2IHBA 1G3QA 1KJZA 3KDSE 4V0MA 1M7GA 3GLFE 1KAOA 4D6PA 3CRVA 2PEYA 1LS6A 3ZIAD 3E5HA 4G5GA 2DY1A 2ZJYA 4U7DA 4Q4AA 3D31A 4QL3A 2Q9CA 3N2IA 2IT1A 3NDBB 4OBEA 1DAKA 3CUEF 3K9LA 4K8OA 2RGEA 2IYTA 1Z2CA 4YMVA 4PO9A 1BOFA 4NYIR 5AJWA 3CRRA 4A2PA 3EZ2A 5C4GB 1EFUA 1WDTA 4LYFA 1XD2A 3QKRB 4YONB 1E2PA 2HCJB 4OI0A 4IVQA 3ND9A 1XTRA 4GOKA 1FOEB 1RE0A 4MRSA 1E2JA 4DBLC 4PO8A 4KITB 3SJAA 3DZDA 4XVUA 1P2VA 4HAUA 4P4TA 5TDHA 3DL0A 4C30A 3WHKA 4R7ZA 3K09A 2X8AA 3TH5A 4DUGD 4M4SA 4B3BA 4U02A 4EFLA 4A8JB 1FZQA 1N5JA 4ERNA 5KPDA 2GJ8A 4LV8B 1W36B 2DFKB 4CT5A 1OH7A 3CZPA 5AUPB 4CEHA 2GTPA 1W36D 4PC2A 4DLXA 4L16A 3KKOA 2CK3A 3O8RA 2FDCA 3R9XA 1ZYUA 1OH6A 3EC2A 4JVMA 3RANA 1MRNA 1HURA 1P9NA 4RSGA 2E9SA 5DSZA 1NKSA 3GP8A 2J0QA 1US8A 3AF4A 1E0KA 1Z06A 4TMXA 4JL6A 2A5FA 2FFBA 1Z08A 2J5XA 3DM9B 4X8HA 2G9NA 1KSJA 3GJ0A 1GZSA 3R20A 4M9XA 2ZANA 4U5XA 1U98A 2RH5A 3SI7A 3J81k 4A36A 2F7SA 1UDXA 3AVOA 3CX6A 2CDNA 2VRWA 4HDCA 1HUQA 3AUXA 1IY2A 4LPKA 3VNVA 2BEJA 3QKSB 2BBOA 4R71A 2ZIAA 1SVWA 3PEUA 1E1RA 4DCVA 3V4RA 2GAAA 4MRRA 2GBLC 4NZYA 4FCTA 4TZ6A 1XJQA 2OUKA 3BH7A 3AKCA 3F0TA 1NSFA 2FPLA 4Q7MB 3QXHA 3GFOA 2X2EA 4FD2A 4URXR 4LWZA 1IN6A 2WKPA 4C0BA 5HKKA 1NRJB 1KSGA 1R4AA 2JJ1A 4F93B 1I4TD 2ZRKA 1Z07A 3EIQA 2A5YB 1P3JA 5J4LA 3A36A 2QAGC 4RZXA 1BH2A 1E4VA 2OCYC 5KUTA 2GDJA 3KQNA 3Q5DA 4LJ6A 4LJYA 1GITA 5H68A 1UEJA 2BOVA 4B33A 4DEYA 4RD3A 3K0CC 1EX7A 4PZYA 2ZJ8A 3BBPA 2EYQA 3SBDA 4IRUB 2C77A 3KQUA 3PVSA 2X77A 2Q9AA 2F55A 4WXRA 4DKXA 1RZ3A 4EIWA 3R8FA 2WOJA 3GJ8A 1KNQA 4DDTA 2HF8A 5JMTA 3OIYA 5FOVA 2GK6A 4L4UA 4Q66C 1G5TA 4HI0E 4TYNA 2PZEA 5E4FA 4KXFB 1Z6XA 4G1UC 4PAOA 3FHCB 5CYPA 2QMEA 3PUVA 1S9HA 2ZSAA 3RWOA 2WIAA 3HYTA 5DN6A 3U4QA 4B73A 2ZTSA 1YZUA 2H5EA 3GEEA 4LZZA 3ICEA 1WRBA 4DT1B 5FOWA 1S9DA 3L8YA 1T5LA 4RVCA 1GL6A 4Z54A 1XTSA 2KB0A 4A15A 3DM5A 3U7HB 4PC7A 3KB2A 5FUVA 2WJGA 5GJCA 1P7CA 2GJKA 2GVZC 2ZU6A 3BD9A 1T6NA 1XMSA 3LQRA 4HLQB 2ZUDA 3VAAA 4DUGA 1IXSB 2WZQA 3QXXA 1YR7A 2G6BA 3MSXA 5D3MA 4EQ6A 1D2NA 1JXOA 2PH1A 4TWZA 3CM0A 3K70B 4N0DA 1U81A 3EA5A 1PZNA 2R9VA 2GXAA 2ANBA 1U0LA 2QGZA 3QXCA 4YMUA 2ZUBA 4F92B 3K70D 2QL6A 3C5HA 4PAQA 3EPJA 3VKGA 1DAMA 1Z29A 2X2FA 4Q03A 1ZNWA 2ZJBA 4PZZA 2QPOA 5E7MA 2WJIA 4PQYA 1G7RA 3AP3A 4A0RA 5KNDA 4DLUA 5JJLA 3WP1B 1GM5A 1JQJC 1PUJA 3ASYA 1XTJA 2K5UA 2YWGA 1FMJA 2RGCA 3ZYCA 4DDVA 4LX0A 1FQKA 5AJVB 1II8B 1TQDA 2DPXA 1NNEA 2J59A 3EX7C 5FPYA 4ABYA 2Z6VA 4OQNA 1N3BA 3DEFA 1NY5A 3RRYA 4Q5IA 4CDGA 2NTYC 2FPKA 5FTMA 221PA 4C4PA 2C2HA 2AL7A 3DVLA 2Z5FA 5CDFE 1B23P 2VSFA 4G5RA 4V0NA 3QSYA 2XXAA 3QVVA 3B6EA 2ZRHA 3KFXA 4WVFA 1TEXA 5TMPA 4RY2A 4QRHA 1NVVR 4M1TA 5SZKB 2R8RA 5ELXA 3TUIC 3NC0C 1G3UA 4OQLA 3GMTA 5BQ5A 2WHXA 4HATA 4EJSA 2PEZA 1KI8A 2A2ZA 2FA9A 4EFNA 3A37A 2ZSDA 1P73A 2O52A 2CXXA 3TIFA 3U7GA 1E9FA 4LYJA 1CJUC 1E2GA 4MGKR 1K5GA 4HDOB 2ERYA 2VPPA 3KKNA 2XNDD 5JJIA 2CL7X 3REFA 4C0JA 4ZCIA 4HSEA 2IYWA 4CGZA 2XSZD 3KQKA 3AKEA 2O8FB 1GWNA 3CPJB 3OEED 2V3CC 1OFUX 3S1AB 1HT2E 2WWGA 4YQFA 1CJVC 4XWAA 3NDPA 1TUEA 2H92A 1Z3IX 1W4AA 2WMOB 4LJ8A 4JL5A 1OH8A 3AP1A 1RPZA 1W0KA 4MYTA 5FPHA 3VMFA 2ZI5A 3FOZA 1XPOA 3O47A 2OFWA 3JZMA 5DO9A 4KFRA 3I3SR 1T3SA 2HXYA 3MMPA 1CS4C 5UKDA 3B1YA 2G88A 2Q3HA 1AZTA 3H86A 1MABB 3Q3JB 2QMHA 3ZGXA 4H1UA 3TSWA 1ZU5A 2GETA 1GTVA 2GF9A 2ATVA 3IO3A 1DS6A 1FNMA 2ODBA 2W6JD 4PPFA 5BN4A 1FX0B 3QKUA 1NJGA 1HYQA 1SKYB 3KJEA 1BS1A 3BS4A 3EASA 2IYZA 4C0HA 2YC4C 4MGIR 5SZJA 2ZRNA 2KI5A 4W5HA 2NO1A 3K0EA 4C3ZA 4AYXA 1YKSA 4QNMA 1I4DD 1P75A 2NZJA 4Q00A 1K8RA 1TU4A 2PX0A 2R62A 3PUXA 4ZDWA 1XEWY 2OBNA 1QRAA 1TMKA 2ZRDA 2BMFA 3EZFA 1W2GA 1CEEA 1W47A 3U60B 1Z0KA 2BC9A 1M6NA 2ZETA 1OXUA 3THOA 4MDFA 3C4JA 5KNCA 1IY1A 3OF5A 3RSOA 4KHZA 4RCZA 4JSTA 4TMVA 1GVNB 2UZ3A 1NVVQ 3SYNA 5FI0B 1QZXA 2ZI3A 1OXTA 3RABA 4HAVA 1QVRA 4HZIA 4F38A 1Q22A 5J4VA 1XMVA 3ZH9B 2IS1A 2GWHA 1YZQA 4B71A 3JZAA 4MQBA 4BGDA 2BWJA 1JQLB 1KGDA 1ZCBA 2IC5A 3VR5A 3AVTA 3LXRA 4YC7A 1SKYE 4OQXA 4OJKA 3BFXA 4DHEA 4HZUB 2PCJA 1KNXA 3M1IA 4JLNA 4HUQB 3RSLA 1VG1A 2VEDA 5CM8B 3TBKA 3B7GA 1NJFA 1TNDA 3EIHA 2ORIA 4TL8A 4EUNA 5GVSA 4TLEA 4XOIA 2F43A 4NCKA 4JZKA 3OE7D 2ZRLA 5F9FA 3BAFA 1AGRA 2F3TA 3AF2A 4Q48A 1VECA 3GJ7A 4R98A 2W00A 3SNHA 4FWTA 1E2MA 4CEJB 1IONA 3QXSA 4QM7A 2JLZA 1GL7A 4B44A 2YZ2A 4NP6A 2JCSA 3AKYA 4C7OA 4Q19A 3WHLA 2NO7A 2WJJA 2GCNA 2XNDA 4JSYA 4KSBA 4PPNA 3TUJC 2O8EB 3KZ1E 4M0LA 2GESA 1VG8A 1ZJ6A 2XJ9A 2XSZA 4XD7D 4B6FA 2VP6A 1DG1G 1VCNA 3OEEA 4IDNA 3LAWA 4IFBA 1R8QA 1ZAKA 4Q4HA 4M9QA 1DG3A 2J87A 4M8NE 4XWKA 4G01B 1QHYA 2RMKA 1DAGA 3OIUA 1C1YA 3PENA 1T9HA 4FIDA 4S35A 5FL7D 2ZE8A 5L3SB 2G0NA 2IXGA 1FTSA 4FW9A 2CEAA 3SU8A 3V00A 3WXMA 2BM1A 1EESA 1RYFA 4B3DA 4O2LA 4A1FA 2A30A 1G8FA 5CITA 3IILA 2PJRA 1X8KA 3D6TB 2I1VB 3UG6A 1WCV1 3QBVA 3EWAA 4IXNA 4BFXA 5HPYB 2O0KA 1HY3A 1VMAA 2V55B 2W6JA 2IS4A 2EFGA 2WSMA 2FF7A 1Z47A 1RFLA 2ZVQX 1XWIA 4KJZA 3GEHA 5FUWA 5KSOA 1UF9A 4S2EA 2HV8A 2QRNA 1MH1A 3I73A 1XXHB 5JI2E 3VNUA 4MUAA 1T5IA 5EUQB 1EWRA 2NMVA 4QHYA 1CJTC 1E6CA 2I3BA 1SVIA 3C8UA 4MH0R 1WF3A 5F2EA 3RWMB 2H1LA 4OI2A 4NYMQ 4Y0AA 1TAGA 2Q0HA 4C0LA 4PTLA 5FR2A 3NBYC 2WWYA 1EK0A 4M53A 2WPDA 4RCYA 3TR0A 2D06A 2IEZA 3PIRA 2C04A 2QBYB 3KUCA 4WAUA 3WYAA 1HTWA 3TJZA 2F1JA 2QI9C 3JVUA 5EE0A 1P2SA 2FSIA 4II7A 5EXTA 3EAQA 5FBLB 5GVRA 5JSZB 1KY3A 4OI1A 2IWRA 4JVNA 1QHNA 1H8HD 3FMOB 2IL1A 1OHHD 1QVAA 1XCMA 3CBQA 1UBCA 4W7SA 5KU1A 3WMFA 1Z6TA 2BMEA 3K0FA 4KO8A 1G64A 1GIAA 2ANCA 4NKRA 4HAWA 3HU1A 4E03A 1E2EA 2I1QA 3OAAD 2UKDA 1W4CA 1XXHE 2FFQA 1MO6A 4RD0A 5E3HA 5AR1A 4UXJA 3U44B 1RRPA 3AP2A 1E32A 4NL4H 2I4IA 3R7WB 5LPNA 4MYUA 5GJBA 1GKUB 4HB0A 1J99A 2EW1A 1YR9A 4AKGA 4G3XA 1TX4B 2QP3A 1IN4A 1DPFA 1PLJA 2G83A 2VP2A 2RGBA 3I72A 4JLPA 4Q9IA 2ORWA 1E94E 1HH4A 2R6FA 1MOZA 1ZC3A 2DWQA 3AVYA 4OK5A 5LD2C 1OE0A 1YZGA 3B9PA 4URWR 4Q4LA 3K9NA 1P72A 4G0NA 4QGHA 3GPLA 1G7CA 2A7QA 5EXXA 1E79A 4XD7A 2FH5B 1KSHA 4LJ9A 1E98A 3LLUA 1JBKA 2H16A 4BRUA 3L43A 4Z1MA 2C8VA 3AKDA 1SVOA 2P0EA 3U6BA 3DMNA 3A1TA 5FOSA 5EXSA 5L3QB 1AS3A 4BZPA 3SDZA 4D4KA 1SZPA 4GP7A 4PAMA 1XEFA 4O25A 3QVUA 4ZPXA 2GZAA 1KI6A 4DDWA 3BGWA 1GRRA 2REXB 3QI2A 4GRAA 2FJUA 4PPQA 4WZAE 4XSGA 1Q57A 1NLYA 2AXPA 3NHBA 3O8BA 1E9BA 2GK7A 4DVGA 3NBFA 4YDHB 3UMSA 4DRZA 1VYVA 3AVXA 3ASZA 5P21A 1K6MA 3T5DA 1RC8A 4DSOA 2B7CA 1WBDA 1XBTA 5LB2A 1N6OA 3QBTA 2W0SA 4AK9A 1U9IA 1DBSA 4RFSA 5SZHB 3KXIA 4D0NA 4EPYA 4BFUA 5FTLA 2E1RA 2F9MA 3EPHA 3IIMA 1UKEA 4CEIB 2JJ2D 2Z83A 4A0FA 1ETUA 3FKQA 4E09A 2ODWA 3ADCA 721PA 1ZRHA 4DLVA 1KO1A 2ZXUA 2AD5A 4QNRA 3UANA 1GFIA 4OJQA 4HAXA 1ZD8A 2PT7A 1Z0FA 3B1XA 3ICQB 1LY1A 1XD2B 4PHGA 3GLGB 1FP7A 3ZZUA 4M1OA 4R9UC 1IBRA 1FQJA 3QG1A 4OHZA 1OH5A 5HTKA 3G0HA 4LHVA 3DHWC 3I5YA 1E2DA 2ODEA 4OHWA 1XZQA 3NH9A 1EGAA 2OZEA 2GKSA 1CBUA 4H9GA 1Z0AA 5JEEA 1AIPA 4LHZA 3CPEA 4MYCA 3GLHA 2YWEA 3UK6A 4Q01A 4OYHA 3DOEA 4QG7A 2ZAOA 3QPVA 4PSKA 1H8HA 2BBSA 1OHHA 3RS0A 4GSYA 1UADA 1FNNA 1JR3D 1Z83A 1T3LA 3B1WA 3MJHA 4DB2A 1SHZA 2O8DA 2D74A 4TT3D 4BFZA 3THYA 4GP6A 3OAAA 1G6OA 1LF0A 2B21A 1CRPA 3M0EA 3NC1C 4HB3A 5FPKA 1ELOA 1XF9A 2DR3A 4D82A 1YE8A 1KI1A 3DZ8A 5JS7A 1V5WA 2W0MA 4OKSA 2OT3B 4IVPA 3A4NA 3H84A 3FPAA 4LK2A 5JRJA 2J0UB 3GLGE 1ONBA 1BYUA 1R7RA 2WSSA 4WA7A 5HE8A 5J4YA 4KFUA 2J3EA 2A78A 4QHTA 3I1FA 3IQXA 4AWXA 3A6PC 3GLIE 1G4UR 4DWJA 3C5CA 1Q12A 2IEYA 4HLUA 1R5OA 3EZ9A 3GLFB 1TEVA 3Q5EA 1GRQA 3DPUA 3TLXA 1L2TA 4K46A 1P61B 1S0UA 3W34A 2QTVB 3U61B 1X8LA 1SVKA 5BN3A 4IDQA 2H7VA 1E9AA 2ZYWX 5CB6A 3BIFA 2LCFA 2XTNA 3FDIA 4GI7A 3FMIA 1S96A 5C4MA 1NSTA 2W2XA 2OXCA 5DGXA 4BECA 2KE5A 1UM8A 1GNQA 2XEXA 3AF1A 1ZM7A 1KI3A 2IS2A 1F60A 2IYVA 5EJEA 1LV7A 4U00A 1XZPA 2BMJA 1U8YA 4GMXA 5C18A 5JZVA 4NMMA 2ZRMA 4ESHA 4DIEA 5GADl 5F98A 2O0JA 1R0XA 4OHYA 4V03A 2VSOA 3W8RA 3DOFA 4ZKDA 4UNNA 3Q72A 1XMIA 4TQ9A 1ZP6A 4PC1A 1X1RA 4D80A 1Q1EA 3KQLA 1ODFA 3T1OA 5JHHB 3QY0A 1II0A 3WBKA 3T1QA 3TUZC 2AKAB 3BK7A 3CW2A 5AK0A 1AS2A 4TSFA 4A82A 2JLXA 3KFVA 2MSCB 2NO9A 5JEDA 5EP3A 4AG6A 2W83A 2JJ2A 4M21A 3CIOA 4TLDA 4MKHA 3NTUA 4HEJA 5FUYA 1JNYA 5BW8A 1TF2A 5B30A 5G3YA 3R8CA 1G17A 3IDQA 2VP5A 4GZMA 4P4SA 2ZSEA 1Z0IA 4Q4JB 1VKJA 4X8MA 1CLUA 2YVUA 3NG1A 4NONA 5L3VA 2CCJA 4J0QA 2QA5A 3RRNA 2JASA 2WWWA 5FTKA 2WTUA 4AKHA 3HPRA 1ZW6A 2QY9A 1VIYA 1EFRA 4XJXA 3RLFA 3ONWA 1DAHA 1T4GA 2VHTA 4OK3A 1W4RA 4ARZA 4TMZA 4CZ2A 4TL9A 2VP4A 2ZR7A 3AF3A 2GJAA 1GNPA 1ZIPA 2QE7D 3LW8A 4TLAA 1KDTA 4RJLA 3LXXA 4Q9KA 2QQ0A 3FTQA 2P2LA 2OCBA 1G8YA 1COWD 1E2LA 1NG1A 5DHFA 2HDNB 1H8ED 1WQ1R 1N2CE 1JR3A 2X1VA 5FBWB 2WWFA 1KZ7B 3K0CA 3QEOA 5JECA 1KDPA 4TT3A 4LUCA 2EQBA 1W1WA 3PV0A 1S8FA 1XPRA 5KOYA 1N6RA 3U3RA 4G5OA 3CNNA 3EG5A 3NVAA 1Z5ZA 4URYR 3GLFA 3BC1A 1X6VA 2C96A 2ZRCA 1DVRA 2GHIA 3X1DA 3TKLA 2VA8A 1P5ZB 4JBWA 3RC3A 4AD8A 1A7JA 1M1YE 1JAIA 1DELA 4M1MA 3N70A 1KYIA 1NN1A 2KWIA 4JLVA 3QF4B 4A6PA 3FE2A 3BB3A 4RZUA 4ZIRA 2C5LA 2CJWB 2Q3FA 4NU0A 3SQXA 2PCLA 4NYIQ 4PSVA 4RD2A 2AX4A 1CP2A 1H65A 5K8TA 1NG9A 2GZHA 4CT4B 1ESNA 4HLCA 4MUBA 1Z0JA 3QENA 5KDLA 1N0UA 3CR7A 4X8LA 3U7EB 2LWIA 2PZFA 2XITA 4KLNA 2OE2A 3QPUA 4DSTA 2EYUA 2PMKA 1SGWA 2VHCA 4PHTA 2PMDA 1Q3TA 1WXQA 4A0HA 2RHDA 1G1MA 3CF2A 3ZIAA 4QC2A 4IJMA 1KHTA 2KSQA 4A2WA 1M34E 1UBEA 4QXAA 1G5PA 3LWNA 4LY6A 4P3YA 3BJIC 3HWSA 1M7HA 3PUYA 5BN5A 1Q3HA 2HCBA 1R0YA 1P2TA 1XP8A 2UVQA 4HB4A 1HQCA 4LOAA 3NXSA 3X1ZA 5DI3B 2OFXA 1W4BA 1OXVA 4PR0A 2GEDA 2JAQA 3QKRA 4F4JA 2V9PA 1G16A 1E4YA 3AVPA 5TXGA 2DWPA 1CU1A 3IHWA 3U2QA 4DLTA 2VO1A 3P4XA 4V0KA 1L7VC 3LRPA 2BV3A 2A9KA 5E7IA 4ZI2A 3MWKA 1CR1A 1UFQA 4Z8YA 2CHVA 4BUJA 3SS8A 1EG7A 1RRFA 2VHQA 3EWSA 1W2HA 1U99A 4IFEA 1XB2A 1N5IA 4QJ4A 1Q21A 5DIFA 1D8TA 1AKEA 1EFTA 5IT5A 5JHGB 1O87A 4A8JA 3KL4A 4GT1A 2FSGA 3R9IA 4DLYA 2XZPA 3WP0A 4CRWB 1GNRA 3W5JA 1ZD9A 5KSZA 2QE7A 2GAOA 1FPMA 1N6LA 4JVSB 1P2UA 1VCMA 1KJYA 4B3CA 1VCIA 5DNYB 1U8ZA 2VSXA 3W3ZB 4F4IA 1XJ0A 2O5VA 4MYHA 4Q1AA 4BRWA 3KTAB 4M9SA 4QFMA 4HUTA 1FMLA 1NMXA 4A0GA 1MO5A 1PUIA 2CNWD 5DLQC 1KIMA 3D8BA 1KY2A 1BKDR 2BKUA 4G5SA 1KMHB 3SOPA 3FGNA 2QROA 3SYLA 4JYCA 3W5IA 2EFHB 1GG2A 2BKEA 5HZKA 2HT1A 1JI0A 2ONKA 1P9WA 1OFHA 1F6BA 3AGPA 4NBSA 4BZQA 3A1VA 1OXSC 5J4HA 4WXPA 1MR3F 4TTQA 2PLRA 5BYKA 2DBYA 3RHFA 3QKSA 2VF8A 3HPQA 4LI0A 4QGFA 3ZZ0A 2GCPA 4FCVA 4B2PA 3EA0A 3T34A 3NBZC 1YZLA 1D6JA 3IHLA 3UG7A 3H4MA 5LDDC 4LBWA 1UKZA 2BVNA 3IKJA 1NI3A 2KBEA 3KJHA 4UKDA 4C0SA 2ZITA 5C46F 5J47A 3T61A 4TYWA 3K0AA 1JB1A 3GJ5A 4O0MA 4XTCS 1DOAA 2P5TB 4IDOA 1XEXB 2ZJOA 2BJWA 1R10A 3AVQA 5AJZA 2GEVA 4JT2A 1BO6A 1NP6A 2OCAA 1E1QD 3I92A 4E5UA 2QQEA 4IOMA 2Q3MA 5KYKA 3IEUA 3FKSD 2G1JA 2KBFA 1DARA 1PVOA 3B78A 2D7DA 3FWYA 1AGPA 1Q1QA 2O0HA 4Q9JA 4YDSA 4CYMA 3QEJA 2JJ8A 1ZIOA 5FL3A 3X1WA 3FMFA 1XCPA 1QHHB 4Q4HB 3SHFA 2E87A 2OFOA 3MUFA 1YVDA 2F1IA 5LB4A 4PXAA 4EKDA 3FFBA 3P1JA 4URVR 3EC1A 2IWHA 1ZBDA 1TTTA 1AJEA 4GFDA 4LBYA 1UPTA 4BFSA 1P6XA 4DLWA 4EDHA 2QM8A 4JJZA 1OIWA 2IK8A 2DB3A 1ZUHA 3C14C 4GOJA 4DLZA 2VP9A 5FUXA 4A2QA 5CDFA 2Z43A 2YWHA 3AUYA 2FZ4A 2WOOA 1CR2A 3GD7A 1WE2A 1SXJB 2CLDX 3JVVA 2OLJA 4WOPA 5KSPA 2B92A 2R6GA 2C95A 5LD2B 4P33A 3BRWD 3RNLA 3ADBA 4IW3B 4A9AA 1U90A 1OV4A 1JPNA 4MKFA 4Q1DA 3IGFA 4EJSC 2QMOA 3GFPA 4LRWA 5EUMA 3UPUA 1KI9A 4D4MA 5CK4A 4GPTA 3UMRA 1SVSA 4TYQA 4F7WA 2FN4A 2ZJ2A 1ZM2A 4HAYA 5FR1A 3LBIA 1CXZA 1G18A 2JLUA 1N5LA 1RJ9B 2CL0X 3MAAC 4QGAA 4BEBA 1LFDB 2Q9BA 1LF5A 1F3OA 1ZM9A 2CNWA 3TE6A 3UIEA 3W9YA 4D4JA 4L9SA 1X1SA 1XTIA 1CR4A 1II8A 2ZI4A 1VDZA 4KYIB 4QBGB 4OHXA 1IJEA 2JDID 4Q47A 4C2UA 3TW4A 3NEYA 4JKIA 2IS6A 4D0GA 2PL3A 4LPSA 1Z2AA 3LBHA 4XSHA 3RS3A 4A92A 3RRMA 2O8CB 1DE0A 1SXJE 3HR8A 3I5XA 3OFND 1L8QA 3VR2A 2J7PD 1KI4A 5G40A 3MLEA 5G53C 1S4QA 4KYUA 1E2IA 1RYHA 2ZE7A 3BXZA 3I32A 2G0TA 1TL7C 3A58B 1QHSA 3BFKA 4Q1BA 4NE2A 1OB5A 2FG5A 5CM9C 5KTYA 2OAP1 2IHYA 4M1SA 5TVKA 2REOA 4NPHA 2Y8EA 4DSNA 2JLSA 4US0R 1FUUA 1YRBA 1Z0DA 1MRSA 5DYGA 1KK2A 4B6EA 421PA 4YMSA 3LD9A 1CJKC 1OJLA 3DKPA 2O8FA 3LDAA 2IUSA 5B64A 3ZD7A 3S1AA 2OSBA 5LBIA 5EE3A 1E1QA 3T35A 4HDQB 3GEIA 3FKSA 4LSGA 4V0LA 1ZCAA 5KDOA 4NCNA 4UNPA 2DWOA 2PX3A 3AGQA 2CVFA 3OZXA 2R65A 4I1SA 5JWOA 3CLVA 1YZKA 2AWOA 1KK0A 2NQ2C 4C2TA 4QBFA 2BIFA 1G8GA 4O2RA 3RAPR 3V4FA 4P32A 4Q7KA 2IYLD 5FOXA 4JYBA 3VFDA 3LVQE 1LVGA 5L8VA 1E0JA 1M7BA 5K8IA 4LDJA 3SQWA 1GILA 3T12A 2JLVA 1ZD1A 1IY0A 3X1XA 3BH0A 3LH5A 3WMGA 1FX0A 4BLRA 1XU4A 1G3RA 2XX3A 5IDVA 3LX8A 3AF0A 2C78A 3PUZA 4BPBA 1S3SA 3MWYW 1QG2A 2B8TA 2GNOA 2ZAMA 5CK5A 821PA 2OG2A 2P6UA 3THXB 4W5JA 3VR6A 3HR7A 4D2IA 4DZZA 2QSZA 2ZI7A 2WIBA 4LHWA 4RFVA 1U94A 4PZLA 1U0JA 3L0OA 4KODA 5FOUA 1NN3A 1KDRA 3QJYA 3WMEA 2Z4RA 3THWB 4QBHA 2FSFA 4E07A 4I1OA 4KBFA 4EAQA 2BDTA 4QJ3A 3PEYA 2GVDC 4D25A 2DYKA 3FMPB 1IJFA 4JIMA 1EXMA 1VG0B 4NYJR 1SKQA 3AQ4A 1V43A 3QQ5A 3ZDQA 4BZXA 4CW7A 4AI6A 3SC3A 4GL2A 2VH5R 4I81A 5EP2A 2XZLA 1LS1A 4OK6A 2YYZA 2CLCX 1XTKA 1R0ZA 4FMBB 4UXHA 2ZRJA 5E95A 4I99A 1NBME 1B0UA 4C9BA 1G20E 3UWKA 3GCGA 2AKYA 2OO7A 1CKEA 2VP0A 2J7KA 2CE2X 1LNZA 1P60A 3O8DA 1DAFA 1XJCA 3CR8A 3TR5A 2ZRIA 2QGNA 2DCUA 5GJWC 4HZUA 4DIDA 4HUQA 3ZVMA 1ZUNB 1NIPA 2D7CA 2GCOB 1HA3A 1DADA 3M6AA 2SHKA 3OE7A 4AC9A 1N6IA 4CIDA 2D4HA 3K0SA 2AWNA 5FTNA 3OFNA 4IDHA 2VF7A 2A5JA 5G41A 1Z22A 4Q21A 2ZSFA 4TYPA 5A5GA 4BASA 2O8DB 1XD9A 2A3RA 1SXJC 2WWXA 2WJYA 3A4LA 1GDDA 3MWJA 4KCGA 4CEJA 3FHTA 2IYRA 1LTQA 1YU9A 1CTQA 2IUTA 3EPLA 4C0KA 4NCHA 2XTZA 5GJVC 2FGKA 3C7KA 3VKHA 2IX3A 1LW7A 4M22A 3L82B 2O8EA 5FI1B 4H1VA 1YZTA 2AXNA 4Q1CA 3PJRA 3CONA 3LA6A 1IOZA 1F2TB 4L8GA 1S1CA 5J40A 1Z6GA 2CE7A 1F2UA 5DH9A 4LCBA 4BWYA 4D4LA 1T0JB 3T15A 1L4YA 2BMDA 3KKPA 1QHXA 3MFYA 3F3YA 4MGZR 3AM1A 5FL7A 1NMZA 2G77B 2RGNC 4JL8A 8OHMA 4B2IA 4L5BA 3U5ZB 4JLAA 2D2FA 3PCRB 2QT0A 1ZMXA 3K53A 2QM7A 3SEAA 1W0JD 1AM4D 1Z63A 4B48A 3IPXA 2P65A 1Y63A 4NCJA 1BYIA 1AKYA 1TF5A 1MO4A 2QU8A 1I2DA 1TU3A 5FOTA 4JBYA 2ZS7A 2B8WA 1A82A 2XGJA 2BCJQ 4ZDIA 1XPUA 3U3KA 2C03A 4LJ7A 3TRFA 3SJCA 1OIXA 4ESVA 2WAXA 2RGAA 4Q4AB 3VHLB 3VU9A 4Q18A 1HQYE 1C9KA 2QRZA 2ZE5A 2F9LA 4LV6A 1XXHA 1KK3A 2VLIA 5H70A 3C41J 4LBZA 3TSZA 3ECCA 4DLSA 5FTJA 2XZOA 1G7SA 1E2KA 3B8HA 2HEIA 5DE3A 4P4UA 3BOSA 4M1WA 2LKCA 4PC6A 4TYYA 4BLSA 5H1YA 2IW3A 1QG4A 3TGPA 3FYHA 4DJTA 2AK3A 2ODNA 3EXAA 2DFLA 2ZYVX 4YXWD 2JLYA 2F6RA 3N2EA 4Q9HA 5JWHA 4B76A 2AHOA 4ON9A 3NKVA 5FH9A 1E9DA 4Y0VA 1W5SA 4Q1EA 4NH0A 5JSZA 4JLJA 1KOFA 3KXKA 3RDPA 3WRXC 4V0ME 5KSYA 3B60A 5HR5A 2NO0A 1O3YA 1Z8FA 4PFSA 3G82C 1S2MA 3HYRA 4CEHB 4KV9A 1DAIA 2YWFA 4RD6A 3AVWA 3VQTA 1IM2A 4TQAA 1HEIA 4MKIA 3D7MA 1MO3A 4A4DA 1YRAA 3SZRA 1Y3AA 2CVHA 3I61A 1HE8B 1PV4A 2BJVA 4LGMA 1ZNYA 4M1KA 1E3MA 1US8B 3R7WA 3BORA 2F1HA 4Q9LA 2HF9A 4XVQA 3PXGA 5AUQA 4QOSA 1Z28A 1U9IC 3P32A 3IQWA 4MRNA 2AN9A 1JXMA 2V54A 1VYUA 2ZRPA 1TADA 3W6NA 1KO5A 4JLDA 4W9MC 4AYTA 2PT5A 2RGDA 3IPYA 4P0TA 4JLMA 5K8UA 2IYSA 1GAJA 1LB1B 3LV8A 3WY9A 2GEUA 4OI4A 2ZJAA 1KTVA 1CULC 4FCWA 4UJ3A 1WB9A 3GJ6A 4WIAA 2QTHA 4LJAA 2OCPA 2ZUCA 1F5NA 4TLCA 1E1RD 3IIJA 5G3ZA 1M2OB 1KMQA 2JA1A 5L3QA 1E2HA 3L0IB 3WNCA 1J70A 3QKTA 1G41A 3SFZA 1OPXA 3RS5A 1SULA 2QUZA 2IYYA 3F5FA 1NN5A 4FXPA 3KJIA 2GILA 3KUDA 1W0JA 2ZSBA 3RYTC 1PJRA 4N0EA 2JJ1D 2OESA 4JLBA 2A5GA 2MSDB 4I1VA 4MRPA 2PBRA 1D2EA 2EWVA 2R6DA 1P4SA 2WJVA 4IVRA 3ADDA 3PG5A 5KO2A 1VCOA 1OYYA 4LYAA 3NHAA 3ZLJA 4OHVA 4CEIA 3EIEA 2D62A 4EPWA 5HZHA 4URZR 3B1ZA 1M74A 4LC0A 4B3FX 3ZQ6A 3A1SA 1N6NA 5C2JB 3MWLA 3CH5A 2JIZD 3AV0B 5CJPA 1G19A 2CLSA 1SVMA 1A4RA 5FFMA 4KFTA 4AIIA 2GBLA 2CCKA 3U4QB 1T8UA 3GLGA 2QPAA 4DCUA 1GSIA 5DN6D 1KAGA 3B82A 2WWIA 2NIPA 4X8OA 3SR0A 4HLUC 3GLIA 3T5GA 3BH6A 4LHYA 4YXWA 5J4KA 1YJ5A 5ANRB 1G6HA 2O8BA 4V0OA 4WW0A 2QAGA 1NLFA 2R6AA 4L15A 3U7FB 1SHKA 4ILEA 5D3MB 4EQ6B 5JBQA 2WMNB 3OESA 3H0KA 5JI3E 2GJSA 4M2LA 2PZGA 2C9OA 2VIIA 2ZPTX 5AUNB 2FOLA 1Q44A 3CPHA 1TPZA 1YQTA 5A4JA 5BYJA 1W49A 5AUOB 5K8LA 2OILA 1HV8A 2DFTA 1T91A 4F91B 2ZU0C 2XJ4A 1KZGB 2VTKA 1N0WA 2YV5A 1J8YF 2ECKA 3CX7A 5AJYA 1G3MA 3IBGA 4TZ0A 1XTQA 4QM6A 3A8TA 4LYHA 3GJXC 2H8KA 1F48A 1GKYA 1QHGA 5AJXA 2WICA 2ZS9A 2J0UA 2P3SA 3QOFA 5EE5B 3TK1A 2ZRFA 2BEKA 3CF0A 3DO6A 3WNDA 3NEJA 1OIVA 1Q1ZA 3RC8A 1ZVQA 2J1LA 1VTKA 2NZ8A 2OXRA 2FMXA 2RKOA 4Z8XA 5EP4A 4E22A 5B57C 4G5QA 4AY2A 1KJWA 2JGNA 2XXAB 1MKYA 3QIAA 2H18A 4RD1A 5FBVB 5EQTA 1SVLA 3HU2A 4ACAA 1FW6A 1OFTA 3VHXA 3U3JA 1KDOA 2V1XA 4DXAA 5JRZA 3K09C 1X3SA 3VR3A 3B1VA 2WM9B 4B3XA 3O8CA 4B3GA 4EJSB 1NKTA 1RIFA 2GJ9A 1N6HA 1P62B 1TUIA 3OIVA 1VPLA 5DISB 5F9HA 2HUPA 4ZCLA 3PEVA 4BEJA 4TMKA 4AKIA 1E9EA 3VX3A 2FV8A 1I4LD 3MG9A 4MDEA 1JEDA 1MT0A 2ZRAA 4IOLA 1DO2A 1RRGA 1VIAA 4UQOA 1W46A 2ERXA 3K0AB 4DDUA 5A0FA 4JS0A 2YHSA 1FUKA 1VHLA 3IBYA 4LJ4A 1W7AA 2MSEB 2ZVPX 3F8TA 4US2R 5IRCD 3ZVLA 1ZM4A 1R5BA 2IXEA 3QG5A 4OQMA 1XEWX 1KSFX 3KQHA 3E1SA 4QJ5A 5CLLA 1W0KD 2Q21A 2ONJA 4I1UA 3ZS8A 2W2TA 4B43A 4BLQA 1GL9B 3UATA 1I2MA 4RD4A 2JIZA 4Q4JA 4F4CA 2BBWA 1WP9A 2FPMA 4MA4A 4UNSA 3HU3A 2J0VA 1E9SA 5TV2A 2D3WA 2QT1A 5L3RA 4EPRA 4KI0A 3ZJYA 1OKKD 1OB2A 1TQ2A 4JT4A 3IO5A 3CO5A 4ITRC 2HXSA 2C99A 2XB4A 4QKQA 1IAQA 4B32A 3T06B 2OM2A 4ZKEA 3K9HA 1KO7A 1QDEA 1G8PA 3K9GA 4KLZA 3TQFA 4GOXA 5CJ2A 1ZNZA 1COWA 1FFHA 2XTMA 3A1UA 1J8MF 3LFUA 2ZE6A 4RKFA 2P5SA 2R2AA 1H8EA 2GRJA 3WYFA 1RKBA 4GMDA 1P9RA 1JR6A 1VG9B 4P31A 2TMKA 2QAJA 2V7QD 2IXFA 1R5NA 3QE0A 1IHUA 4JLOA 5DHAA 5KHOC 3KKQA 1UAAA 3KKMA 3MCAA 4L9WA 2J0SA 4D0LB 4JKYA 5HCNA 1JALA 4Q02A 4XH9B 2ATXA 3HP1A 1M8PA 4FMDB 4ASUD 1NL3A 1D2MA 4PHHA 4PPGA 2FX3A 4TN1A 1XRJA 3K1JA 3FHOA 2RAPA 4HYYA 1NF3A 3SBEA 3WNBA 1DAEA 3OEHD 1UKYA 3EW9A 1G21E 1ZUIA 1WBBA 3QF4A 2C9CA 1E9CA 5FPSA 3ZQJA 4DB4A 1IN8A 2WKQA 4UNQA 2F43B 2CJWA 4M9ZA 2BHRA 1ZC4A 2NPIA 4WZ6A 4BQSA 4JMPA 1XNJA 3SE0A 1ZINA 4JJKA 4KBGA 3U6KA 4RZ3A 2ZYUX 3L0PA 2ZYTX 1CJMA 4D26A 3B5JA 4FINA 3U3OA 1MV5A 2JEOA 1YR8A 1S3GA 3M4YA 2X19A 2HLDD 1VYTA 4C7OB 1ZU4A 3CZQA 3A1WA 4A8JC 3MJRA 3L0SA 4DSUA 1W36C 5CLQA 4PX9A 3X2SA 4YMTA 3HDTA 1FTNA 2QG6A 1UKVY 2V6JA 2W6ID 5JS8A 4GDFA 1E0AA 1SQ5A 4ZI3A 2OLKA 4WBSA 2MMGA 4JBXA 1YHNA 3PITA 5DYIA 2XNSA 2YOGA 4MGYR 3PQCA 3W6OA 4BLTA 3RRZA 5JWRA 4UJ5A 4GZLA 4EPVA 4KVGA 621PA 1GOTA 2V4ZA 2ZI6A 3W90A 5DI3A 1TQ6A 5EP1A 1U8AA 5IHPA 1E69A 2DFNA 1EFCA 2J41A 3MGCA 5CB8A 1E2FA 4YMWA 2C9YA 4KVAA 2NGRA 3C15C 4ZV4A 3OHMA 1IQPA 1N25A 2NG1A 4DT1A 3L2OB 3CF6R 2FWRA 2RGGA 4KAXA 2YKGA 2VHUA 1YR6A 1II9A 1OXXK 5E7JA 4YLGA 3ADKA 3SFVA 4AURA 5TY0A 2FNAA 2J9RA 2FE4A 1Z6YA 3GFTA 5EE9A 5M04A 3NH6A 1K5DA 2R6CA 4N3NA 1GP2A 2YC2C 5JLJA 1SXJD 1OKKA 2D2EA 1UEIA 1AZSC 2GXQA 1GRNA 2IYQA 3FVQA 4O3MA 2IBMA 4NDZA 3RS7A 4UXIA 4CVNA 1DO0A 1Q0UA 2QZ4A 2FFHA 1JJ7A 3I8SA 2XAUA 3IEVA 5CYOA 2F1RA 1DEKA 1A5TA 3E2IA 4ZDKA 4IHQA 5IK2D 3P20A 4AG5A 1AS0A 1U2RA 3CNOA 1PLKA 2V7QA 5CIQA 3I8XA 3KTAA 5JCZA 3W8NA 4TTRA 3WYGA 1PLLA 1R6BX 4B47A 2EVWX 3KB1A 4QBIA 2NPFA 4FMCB 3B13B 5SZIA 1OSNA 2QORA 2UZIR 2IA5A 2WPDD 2ZRGA 1NVWQ 3MRSA 4HAZA 2WVJA 2JLRA 2W2VA 1KMHA 4B35A 4ASUA 1FP6A 1QBKC 3T1TA 1BMFD 4IEIA 1NN0A 1WA5A 3LY5A 5B2ZA 2W58A 1T0HB 2VL7A 3QXJA 2FU5C 3SJBA 2IF2A 3KJGA 1KI7A 3UMFA 3Q7QA 2ZREA 3OEHA 4FMDF 4B2LA 1NVXQ 3K0FB 1R8SA 3EPKA 4W5WA 5FBRB 2ZR0A 3L8ZA 2VQSA 3I4LA 1D9ZA 2NO6A 2GXUA 3B2EA 3PR1A 3TVDA 2IYXA 1EWQA 1W5TA 4Z51A 2YINC 4TMTA 4BLOA 2QMUA 4NYMR 2V6IA 1GKIA 2YOFA 1NMYA 5D3QA 3CH4B 1XMJA 1AA9A 2ZQ5A 2HT6A 2A5DA 2C98A 2WAYA 4LJ5A 1XD8A 4IOJA 4XWOA 2CBZA 1XEXA 2RCNA 1L4UA 1TF7A 2HLDA 2QENA 3KX2A 3TNFA 3Q9LA 1EFHA 1CR0A 4V02A 3SJZA 4B34A 3K70C 1R0WA 4BLPA 3CNLA 4IKEA 1DTSA 2W6IA 3WRYC 3IUYA 1JEEA 4I4LA 1C4OA 1Q20A 3VTKA 3RS2A 1E79D 2OHFA 3HJNA 4TLBA 2EFEB 2IF0A 1Z6AA 2OBLA 4IEEA 1ESMA 2OBMA 1F2UB 4CF7A 3B9QA 1QHHA 4Z1MD 1OLOA 4KU4A 1GUAA 2ASEA 2OAQ1 3REGA 1MABA 2WV9A 3IIKA
chains in the Genus database with same CATH superfamily
4UM9B 4M88A 1V4BA 1A1VA 2F3PA 2VDKB 5IVDA 1D0SA 1NBMD 3A3NA 1A9PA 1P2BA 2F3QA 4G56A 4IJ5A 4AF6A 2PANA 2IXDA 4NHOA 5KNBD 3LVRE 4RL4A 2D1QA 2BCGY 1WLSA 2OG1A 2P8JA 1EWYA 3BTUA 1A2KC 1OI3A 1T3HA 3K8YA 1G98A 5TF0A 1L4FA 4NJEA 1Q0LA 1E3LA 5F1OA 3WE7A 4JBNA 4D9JA 4BLPA 2IUYA 3AY7A 4HXYA 3RVJA 5DMXA 3BB4A 5AVJA 2FX2A 3W5BA 1H3FA 3P8ZA 3E0QA 2CVOA 4PIPA 1TJ3A 1PR4A 1VBKA 5HP4A 2OSVA 1O96A 1R37A 4G09A 1QIDA 2NVUB 3RAJA 3ND8A 5DFAA 3ZE8A 3OCZA 4HH0A 2EWMA 4G4SO 3DFMA 4KG7A 4EYEA 1I7SB 3CRQA 5JAUA 1NIJA 1E0SA 4FX5A 3R9KA 2IUUA 5A7FA 1V16B 3O31A 3CX8A 3TMKA 2QIOA 3ICOA 4BWGA 1GYRA 2PLFA 2QSJA 2ZRBA 3NQ41 5ILQA 3TVTA 4ARSA 5AW2A 2C3UA 4UTNA 5EPOA 1G3IA 2RHHA 3AR3A 4D74A 2XOKD 1YZNA 4LE0A 4R8RA 5KKNB 1IM8A 1CCWA 2BM0A 2RGWA 3CWZA 3MQ2A 5IHXA 1DHRA 2ZIXB 1G291 3OE1A 2XA1A 4QEDA 4ZYXA 1SUPA 1RJ9A 3HWRA 2OV2A 1UP6A 2YZNA 5BWBA 4P0PB 2WW8A 3HP7A 5ALUA 5THXA 1XX6A 2O7SA 1L5SA 3AHDA 4MS4B 2G3YA 3CW9A 3T3PB 3T1NA 5HOQA 3EGOA 4HRAA 1M0EA 1KO8A 1BHJA 4PU0A 1KO4A 4CCYA 2XDAA 5JXJA 3CRNA 3OZCA 3KCQA 3LC2O 2FFAA 2QRVA 4FMCF 3R7SA 1RTKA 1V96A 3CC8A 3B7PA 3JQGB 5CDGA 1CF4A 5EZQA 1PJZA 5KAMA 5JJKA 1OF1A 1BGWA 1P1RA 4Y0NA 1IN5A 2MINB 1AQYA 2OBXA 4RV5A 4QDZA 5MFPA 5BPFA 1C50A 4C3UA 1Y42X 1FLDA 3EYAA 3ILVA 4F5YA 2RIPA 1TW2A 2P6NA 4QNNA 3ZWQA 4PZ0A 3C6XA 4BATA 1S8AA 4NCXA 4QHSA 2J5BA 3ABOB 3P27A 1XFAA 1CRQA 4R2JA 4DCTA 3HM9A 3IMEA 4AMUA 1A97A 3LHFA 4C08A 3N9IA 1G8HA 1GCUA 1QIJA 4GHWA 6PFKA 1SBCA 3EXFB 4YLYA 3E15A 3VI3B 3F6SA 4AYWA 3PHGA 1IULA 1UBGA 4NNPA 2PKWA 4D5EA 3RYCA 2R96A 1W88B 4DVJA 4MITA 4LWPA 3IS3A 4BB0A 5BXQC 4G24A 3G2PA 5I5EA 1UJ2A 4XE5A 2GPWA 1JRLA 1J90A 3QF7A 2NZ2A 4S0XA 3A9VA 2IHZA 3DT9A 1CUCA 2HYDA 3LI2A 2D5LA 1YI8A 3KSAC 2ZSHA 3IEKA 3S2UA 3AM3A 1JHXA 2FWAA 5L3SA 2FY8A 1JPJA 4CUJA 5ARBA 3F4KA 3HO1A 3HE3A 4WZBB 1O94C 3NASA 2GYVA 1A72A 2GLUA 2YMLA 5F5XA 1H1TA 1G4AE 1WXDA 1FUEA 2ONZA 3KNZA 1W44A 2OV4A 4D8YA 4Q7LA 4NZNA 4OHUA 4GIBA 1XLTC 1B14A 2VC2B 2X0FA 2Q5IA 4BBAA 4B74A 4Y9DA 4R1SA 2QPTA 2XYQA 1P6QA 1V5IA 2P9BA 3AZPA 2PLAA 4RJ2A 5BSVA 4HB2A 2O48X 3M3PA 3GCWA 3WFJA 3L4JA 2JLWA 2FGJA 2X23A 1C3XA 2ZEJA 3CMMA 4I9FA 5D6NA 1XALA 3ZS9A 4MIYA 3OPYI 3JRNA 4L5AA 1L1QA 2O2IA 4WJKB 3GJ4A 1OZ0A 2W93A 4DMMA 1DFIA 1T8PA 4FN5A 3TSOA 3VU8A 2R1VA 2WINI 4IL5A 4TL7A 1U2QA 4RABA 3RS4A 1CSEE 1RVDA 1EWVA 1XTBA 1W48A 3DDCA 2R44A 3IQZA 3BA1A 3EZ7A 3S7TA 1QG0A 3TD9A 3V8VA 2G5CA 4DS3A 5C7YA 1QQ7A 4YJ3A 4O5AA 3LQQA 1IM5A 4QUEA 4XPZA 3DTTA 5KVQA 2BTOA 1KKLA 4XYMA 1HE1C 3IVAA 3KXDA 4RW0A 5JCPA 4YFVA 1JFSA 2KJQA 3RK4A 2W6PA 4JH0A 3E7XA 3QU5A 3C70A 4OMDA 4P4SB 3MELA 2C7GA 4DLAA 3THWA 1CQXA 2E4WA 3KEFA 2L19A 2WWHA 4J75A 4RELA 3U39A 5AWFC 4MNTA 2CW5A 4RY8A 4JR2A 3BF8A 4AIRA 3NWJA 3FD8A 1AY0A 3LO5A 5F2OA 3UEOA 1HL7A 3BX1A 5TGTA 3RAGA 4ER6A 3U3MA 1Z17A 4TS4A 2AFHE 3DKVA 1GGFA 4LZLA 1JWBB 3DLHA 2CNBA 1ZLYA 3KXLA 2J4CA 4LHSA 3SN6A 2OB2A 3CRW1 5LYJF 2HRQA 1FYEA 2GA8A 2PSHA 2X6QA 2ZJ5A 4Q6WA 5G0VA 1JXQA 3FWHA 3IV9A 1A2BA 2O8BB 1AO3A 3ZGZA 1TM1E 2B61A 1N5KA 1UK6A 1ZD2P 1WNTA 4DN6A 4F2PA 4MRVA 2H5LA 4MPDA 2SBTA 2MDTA 2FPGB 2AK2A 2GZ1A 2X4IA 4Q7JB 5GAJA 5J2UB 1PHPA 5JFGA 5JRDS 2GMWA 1QSGA 1U2EA 3EIXA 4XIGS 1WSAA 4ZO8A 4EO4A 1QK4A 1C7IA 3HJHA 2MSWA 3SXJA 1Q0HA 2OGTA 3PDHA 3RK1A 1IB6A 3DZJA 3TQCA 1X1EA 4DCSA 4UBOA 3K96A 3RFFA 1PU2A 1MGPA 2RB4A 2QTGA 4I0WB 3OICA 2J9XB 4L5YA 6Q21A 2NZUG 3EEOA 1HRKA 1M9NA 2V9CA 1BHSA 5DCYA 5EQDA 2HYIC 4J16A 2H57A 1NZJA 1HI9A 5EXPA 3KO8A 5HF8A 1XF1A 2ZFUA 3RHTA 4R8SA 3PNMA 3ZVRA 3EH1A 5I9LA 4P6VF 1DEHA 2Z4SA 2AD1A 4GSKA 1WJGA 2G63A 3QNUA 4R2HA 2NADA 3C16C 4JOBA 1OFIA 2HQSA 2YIMA 3N0VA 1KJIA 5LXTF 2WVGA 1LRLA 1TUBA 1WDLA 1Z7GA 2R5NA 3JATB 4NNOA 4R2KA 4DCJA 4ZIRB 1BIFA 5LA6B 3GQBA 1E99A 5A3JA 3EOAI 3EXG2 3OM8A 4J9VA 1W5EA 4J6FA 5DI9A 5KYWA 2B9EA 2EBFX 2OZLB 4B87A 2GLTA 4LQLA 2Z8XA 3T9AA 1PT8A 3KEOA 2JHGA 1QOQB 1NVMB 1TQ4A 4DHWA 1TM2A 2RHMA 2ACKA 1ENOA 2GZDA 3I6YA 1Z0ZA 2HRDA 3BCHA 1L5HA 3PNYA 1G3QA 4V0MA 4QARA 4JC0A 3GLFE 2AKEA 1KVTA 5HRCA 1K97A 3EDQA 4HPXB 4NV1A 2NU9A 1YKFA 5L4LA 3BKXA 3E5HA 3JW8A 4CUKA 1JMVA 3HI4A 4U7DA 3UGJA 3D31A 1RWWA 2O8VA 1ECCA 1GN9A 1UC4B 4EUFA 4OBEA 2ZPUA 3HJRA 2YIDA 4HRVA 3ET4A 4EF5A 1Z2CA 1N8SA 3EXHB 4YMVA 5K01A 1L7AA 2WJAA 1BOFA 2OBFA 1V8ZA 3FG9A 2J9FB 4UUNA 5AJWA 3ZU3A 1TLTA 4A2PA 5ES4B 1EVJA 1WDTA 4LYFA 3D1VA 2OXTA 1BX3A 1UBJS 2HCJB 1UUFA 2R8ZA 5T57A 1P4GA 4LOLA 5HGXA 2P27A 1XTRA 3ND9A 2ZWVA 1YI0A 3RFUA 3IELA 4D9HA 2R6HA 4X66B 4K40A 3E48A 1CZKA 4Y1GA 3NWPA 4N18A 4P7FA 4IY1A 2Q5HA 2YWBA 4OMFG 3V7WA 5DGDA 3DZDA 1VJCA 1ADYA 4RC9A 2GI4A 4EKNB 5DLEA 3SBOA 4C30A 4RUKA 4YTEA 2XE6A 4IZHA 1R18A 1SOAA 4EG7A 4TVKA 4B3BA 5FOQA 4U02A 4AJLA 1SUWA 2I6XA 3OFKA 3OJOA 4BIIA 1N5JA 2FPIB 2OCDA 2F8TA 5JAHA 2WE7A 3P4UA 4CT5A 2B5VA 3AEKB 1AT1A 3CZPA 1T1IA 4PC2A 3DE1X 4U2KA 4BX2A 2O2HA 2FDCA 5IMBA 2NACA 1DJPA 4ZCTA 4J0HA 1WABA 3L8CA 3WIVA 3C0KA 2YZKA 3QHAA 4D9MA 1U1DA 1H42A 1EHYA 5K0GA 1R0BA 2Q4RA 1ZHFA 2E9SA 4H08A 3GEGA 4CLOB 1US8A 3AF4A 1Z06A 3FCEA 2EQAA 3K0KA 4GYKA 4YRLA 4CKYA 3AJRA 4JL6A 1IZZA 2XUGA 1O57A 1Z08A 3FPKA 3RQSA 3ZJUA 3F49S 4Y2UA 1F1JA 2JI7A 3GJ0A 4U7JA 5K3DA 2GH1A 4M9XA 2SCUB 4U5XA 1U98A 3LUFA 3CLRD 2HK7A 4CKWB 4QYIB 1T13A 1SMKA 1UOEA 1ZONA 2JAUA 5JDCA 1XROA 3D4PA 3Q41A 1S2DA 3CEJA 2ECPA 5IJXA 1JSRA 4GKAA 1RRVA 1HUQA 2X2PA 1IY2A 4HDCA 2XCRB 2Y4OA 2BRUA 3H3JA 2IZ1A 3ZE6A 5A05A 1GU7A 2B37A 4WBNF 2VWHA 3BDAA 2EJCA 4LRQA 2VBFA 4L72A 5YASA 3C6BA 1E1RA 3BXHA 3EVDA 4QOGA 5BT9A 4IUDS 4MRRA 3BN3A 4FCTA 3OT1B 2FRVA 5EKXA 3BH7A 2P3OA 2D8AA 1NSFA 2FPLA 5C0OE 3W3AH 4E2FA 3H99A 4XUCA 3GFOA 1USUA 1CDZA 1OOEA 2XGSA 2NV2B 3W1EA 3RJ5A 2C4VA 3BMNB 1QZ3A 4C0BA 4C4OA 4K9NA 4WKOA 1R4AA 3OCWA 4X6XA 3COWA 1W34A 4FNMA 1P3JA 3WGNA 3A36A 3QITA 3QMMA 4MMYB 2QM3A 1VBFA 3FVWA 1L5MA 1E4VA 2OCYC 2ZSKA 1ADJA 1V3TA 1HDRA 4L2IA 3ITNA 4AMZA 4LJ6A 2A5LA 4ZVQA 3RG8A 1JPVA 3S4YA 3QVOA 1P7WA 2O1XA 3NAGA 4LQDA 3V4OA 3AKZA 5J43A 1XL0A 2CUTA 1C4WA 4J0JA 1KF0A 4DEYA 4O2AB 3TB4A 4WERA 2HA3A 3PVCA 4B46A 3HXOA 3BBPA 3KQUA 3G9UA 4IRUB 4IYJA 1UDRA 4PN3A 4DKXA 1TYCA 4PNZA 5TMDA 5BWLA 3C3MA 3VO1A 5KREA 1I94B 4E15A 3OE4A 1CQJB 2ID9A 1ONOA 3DD5A 3DJFA 1GTG1 3QVXA 4D8TA 5ADUS 1LGYA 1VM6A 2WNHA 3A6FA 3A6EA 3DOJA 2H4HA 5COAA 1XHFA 1XRLA 4HI0E 4C7MA 5AQ1A 5E4FA 5IDYA 1JSXA 1Z6XA 4PAOA 1KYZA 3KVYA 3IUEA 4FHEA 2I91A 1U6JA 2EHDA 1S9HA 4G0ZA 5T8KA 4R1NA 4DIFA 1NUAA 2ZSAA 4P8RA 2WIAA 4KIFA 2FXIA 5DN6A 4ER5A 2JFNA 1LXCA 2NYAA 3B52X 5CPFA 1S9DA 1TO2E 1XE3A 3ZKWB 1B4DA 4RVCA 2Q07A 3CTMA 1PBTA 4ND1A 3DM5A 2IYEA 3OTHA 3VAZA 2FRDC 3EWNA 3LQKA 1Y0BA 1LQUA 3GGDA 2YBDA 3LF1A 4HLQB 4TTTS 4JI0B 1PG0A 2VT3A 3MSXA 1WVMA 3UTCA 5DEOA 3K70B 5FB3A 5BV1A 4RMHA 2R4TA 2R9VA 3PQ5A 1VE7A 4YMUA 2GWRA 3VKGA 4MVJA 4GXNA 2QL6A 5TEVA 3V8NA 3EPJA 3DBLB 3DDWA 5FUQA 2V7TA 4MQ6A 1Z29A 3PQ6A 1TAUA 2XB8A 4GPAA 3MCVA 2XUJA 4G5XA 4PZZA 4WFKA 5GOTA 5I9BA 4C4AA 4DL9A 3LPLA 1G7RA 3OKCA 1W2WB 4ZYLA 5E0KB 1FSZA 1GQSA 4JP1A 3QV1A 5JJLA 5I8PA 3QWIA 2BTQA 4Y2XA 3WP1B 3ASYA 4X94A 1XTJA 2K5UA 2ZVJA 3IAS1 1FMJA 1HZZA 2H2GA 2EKBA 3ST7A 5TSDA 1P9LA 3WKBA 4IINA 5BUCA 1DU4A 2OBYA 3D3WA 4JUFA 3W1WA 1TVKB 3AJAA 3OLVA 1MU0A 2P4UA 4G1FA 3EX7C 1PJAA 2FUCA 3R3JA 1A8IA 2XUQA 4ABYA 3CU5A 3KOYA 3KQOA 3MBIA 3RRYA 4O2BB 2I67A 4ZO6A 5AK4A 4AZ3B 4EKEA 4XX1A 2AL7A 3DVLA 2FZ5A 1G2PA 3OJWA 1B23P 2Q2OA 4PRLA 1BDIA 2VSFA 2P1DA 3M33A 3H65A 4V0NA 4E2YA 2Z57A 3QVVA 4M9CA 3HA5A 3KFXA 1Z7WA 2WHPB 4WVFA 1T5SA 1IMOA 4WXEA 4UMEA 2VLBA 3WGIA 2Y2VA 3M6VA 3HDVA 1VC2A 4QRHA 4MMZB 1KQGA 2Z5LA 5SZKB 1DKPA 3NC0C 3H11B 4HT3B 2ECOA 2XHZA 4WFQA 3VI4B 5BQ5A 3VBCA 2UDPA 3E0XA 3AHHA 3IC5A 4JUCA 4UAUA 2X0DA 3N2KA 1KI8A 1CRWG 1ZOOA 2H7XA 4O3FA 2Z58A 4D7AA 4CV2A 1E2GA 3NHLA 2P9TA 4WNAB 3GGOA 2ERYA 2VPPA 3DVSX 3K6JA 5JJIA 3K2EA 3REFA 1Z25A 1R74A 2BISA 3MEQA 2YWCA 4I9HA 2IYWA 5BPHA 1JVSA 1T2FA 2I5PO 2EGGA 4CGZA 3AKEA 1WD7A 2X5OA 3KXPA 1LBHA 3O73A 3OEED 1OFUX 3QPDA 1EX9A 1WOMA 3EGDB 1CJVC 1N9GA 1EE1A 1Y5MA 4TV8A 3TCKA 5JAOA 5JMOA 2J0EA 2JBAA 3FF1A 3NDPA 1QTQA 1X8XA 3GA0A 2GKGA 4H17A 1CZNA 4PLYA 1X2BA 3VSBA 1DB3A 4XASA 3VDXA 2EKLA 3AP1A 1YL5A 1EM6A 3EBOA 3O94A 4MYTA 2ZI5A 3VMFA 3FOZA 7MHTA 3UT6A 2OFWA 5K0SA 1F0PA 1VMDA 1VBMA 1T3SA 1GNTA 2HZBA 5HTOA 4Y2TA 1GO2A 3OWXA 3JARB 1I7QB 5ECYA 3SP1A 1A27A 3QYAA 2HN9A 3H2SA 4Q24A 2VDWB 5E9QA 3U5TA 1JU4A 1MNQA 1ENPA 4M8KA 4CI9A 4K7JA 5IMSA 1NX9A 4KI7A 2NW6A 1ECFA 3ZGXA 1RTTA 4H1UA 4UBJA 3TSWA 2PV0A 3GVHA 3LL4A 4N6NA 4PLZA 4NX2A 2W6JD 3I2YX 5BN4A 1ICEA 3UB2A 1GPAA 1PEYA 2EQ5A 3S1SA 1SKYB 2CMHA 3TI7A 5T67A 1G21A 5A4MS 2IYZA 1K8XB 4XA8A 4J1QA 3L6DA 1ZXLA 3FDXA 4OYRA 3U1BA 4CQJA 3QV2A 3TMAA 4PRZA 3E03A 4INJA 2QVZX 1YKSA 5K0NA 1B8PA 3A3YA 3ORRA 1I4DD 1P75A 1NFRA 3OO1A 3EUAA 4BDSA 1TU4A 4RQUA 2YL2A 4ZDWA 2W4QA 3FPSA 3JVDA 4CN9A 4K3UA 4OQEA 2QF7A 4I6EA 2OBNA 2FZEA 1TMKA 4BJ1A 2BMFA 3I2KA 4XCXA 1CEEA 1W47A 4NG4A 5KC8A 4PGGA 3TM4A 3FZQA 5LZ2A 1KYYA 3THOA 4D8UA 5L40A 4OXQA 4FE4A 5FNZA 4CFZA 1IDN1 3HO8A 4FFMA 1YL7A 4BQRA 5K0ZA 3VXKA 1QC5B 2JVKA 5I4BA 4JT8A 1QPBA 2WFLA 4ZI7A 1JBQA 1BSVA 2VTDA 4TXHA 4L50A 3NPAA 4DMGA 3C3KA 3HKEA 3KLNA 4F38A 2H5IA 1BNCA 1GQQA 1JHUA 3AU9A 3P0RA 2MOKA 3EULA 5E1BA 3DWFA 1H0RA 3O4IA 1JQLB 1IB0A 1ZCBA 1CUIA 2IZOA 4DHEA 3DNPA 1TI7A 4QVKA 4XYGA 5U4QA 2PCJA 4JLNA 1BCRA 1HSOA 4YJFB 5CA0F 3OZDA 3RKRA 3VR4H 5IBRA 5A6VA 3E81A 1IEWA 1R9GA 4TLEA 4XOIA 1W1IA 4XUEA 1SBZA 3JVEA 4ZVRA 2C42A 3NYWA 2BFFB 1PQPA 2RHBA 4PG4A 1RIIA 1Q0QA 1AO0A 1X19A 3DO5A 3F78A 3RLIA 1B0ZA 4Q48A 3RC7A 5IBCA 1ZOLA 1MX3A 1UJMA 1UMDA 4R98A 1E2MA 3UV6A 4D99A 1YT5A 3QXSA 5CTAA 2JLZA 5IH3A 5BR8B 4AP9A 2ROQA 4BJ6A 1U0SY 2OORC 2WIDA 3FTDA 4NP6A 4CG0A 4DUPA 4C7OA 4TWIA 4NEQA 4F4UA 1EQAA 1HE2A 2DBVO 4P4GA 4Q19A 5JVDF 2WJJA 2XNDA 5DHSA 2NT3A 1SHLA 3MTDA 4M0LA 1W9MA 2J3JA 2GESA 4BCCA 4E88A 2X5XA 3CT6A 2XSZA 3HH8A 4I8IA 4XD7D 5EUCA 2GDZA 2GN4A 4ZVTA 3BMXA 1QRRA 2JA2A 4IFBA 1AHHA 1JE1A 3CLUD 5CFOA 2W2LA 4XEHA 1Z36A 2P2ZA 2QD5A 1BD3A 4Y1RA 4M8NE 3TLKA 4XWKA 4G01B 5IU6A 3BIOA 3UJ8A 4F5EA 4HNUA 4J6EA 2IPOA 4JCOA 1T9HA 2B1QA 2WJWA 4S35A 2ZE8A 4UM9D 2G0NA 5L3SB 1WXIA 3N7TA 3R4CA 4WACA 3V00A 4YRAA 1UC5B 3RVRA 3WXMA 1EESA 4BQIA 4PZAA 4LWOA 4B3DA 1XKTA 1EVEA 4OU5A 1G8FA 1JEJA 2JFOA 3IILA 3V48A 3ZZNA 2DEUA 3UG6A 4Q15A 2X9NA 3LPDA 1WCV1 2Y68A 5FBKA 4JITA 4KC0A 4BFXA 4QO8A 5KYGA 2V4UA 4D3YA 2Z6AA 3VVBA 5CAEA 1HY3A 1VMAA 4GD3Q 1UOOA 3H7IA 2JAHA 2V0CA 4EGJA 4BGUA 3R76A 4B3HA 4KBYA 1AF4A 2IPXA 5C35A 2Z6UA 4E5KA 4Q39A 4X1YB 4TM7A 5KSOA 3P9CA 3EQ8A 1W96A 4YP6A 3OJFA 2R1VB 3K32A 4EJMA 5FLXA 1LVUA 5EUQB 1JIUA 1XELA 2JFPA 4QZVA 1FS4A 3OT4A 1UBKS 1NRWA 1E9VA 1EVIA 3INNA 2BFBB 1DBRA 5T5QA 2XQFA 1WF3A 1MPTA 3HSYA 1OA0A 3OUUA 3PCTA 4HY3A 1PP4A 3EGVA 3FPEA 1N57A 3OBBA 4N03A 1TAGA 3H5OA 4NHEA 4E08A 4XGQA 3ZY2A 2FW9A 2CFIA 3H0CA 4J3JA 4C0LA 4R0MA 3NBYC 3PNOA 2WWYA 1EGMB 1Q7EA 2FYTA 4QBTA 5F2KA 5TS2A 1JIJA 3QFRA 4RCYA 3KLPX 2GOYA 3TR0A 4Z4IA 1EUCA 2OXIA 4NXNB 1SU4A 2H52A 3WLHA 3G6WA 3NGLA 4HGPA 4IWYA 4UEWA 4DILA 2F1JA 2QI9C 3DHYA 5GVRA 4II7A 4WXHA 4EITA 2HA2A 2Q1XA 2IWRA 3OO0A 2CMDA 2DSTA 2NSYA 3UPTA 1G5FA 3TRIA 2PUEA 2B35A 3R5JA 3C6YA 4I5FA 1C1DA 1XCMA 4BP8A 1L7PA 4L73A 4MR7A 5KU1A 2V98A 1Z6TA 4KO8A 3QEMA 1MNAA 4KVFA 1DP4A 4NE9A 3K6SB 1GIAA 4X5OA 4NICA 1FVXA 4CXMA 4FJ0A 4HAWA 3O21A 1FBTA 3AI1A 4J2OA 4CMHA 4F4FA 3OAAD 2UKDA 4OHOA 3TLGA 4IKPA 1IWOA 1MO6A 4RD0A 4BYMA 4ND4A 3DS8A 2I9PA 5B3AA 3ZNQA 2LR0A 4M8LA 1WCWA 3RHSA 3SFTA 4HB0A 1XOIA 1KJ9A 1J99A 2E2WA 1XQ1A 2EW1A 3WKCA 5A62A 3NOQA 2GKOA 5LOVF 4V0QA 5E1MA 4AKSA 3HFGA 4HN2A 1OBFO 1HH4A 2R6FA 1SHUX 4TV9B 4REQA 4EYSA 4V1CA 1ULHA 3LS2A 3B9PA 4OK5A 2CBXA 3K3PA 5I01A 3TLEA 4QYXA 2XA2A 4Z3KA 2C2YA 4Q4LA 3G2QA 3K9NA 1E6WA 3N07A 2XWQA 4LXHA 3FVVA 2A7QA 1M8KA 4LISA 5DP1A 1K6EA 3M9WA 3C3PA 1KSHA 1FTYA 1QV7A 3WGJA 4I3HA 4NBVA 5KDDA 3K5PA 1AC5A 3VYSB 5KC9A 3NV7A 1PV2A 3EGEA 3G9ZA 3DMNA 3JQ9A 3JZFA 4BNZA 3N1UA 3IRUA 5DZSA 3VO2A 4EMUA 1WPRA 3RUPA 3RODA 3ZHUA 4QECA 3ZU6A 4O25A 3QVUA 4QYMA 1KZYC 3OMLA 4U9UA 3ZDXB 1VL1A 3HGQA 1KDZA 3DL2A 1RMTA 5HNKA 4PPQA 2V3CC 2Y1KA 2AXPA 3ZOKA 3NHBA 4PTZA 1KYWA 4KMRA 2VYVD 3EMKA 5MN5A 2GK7A 3OZAA 5IJZA 4QGBA 4YDHB 3UMSA 3N05A 2JJMA 2JGDB 2V5VA 3ASZA 3AVXA 3T5DA 3OZ7A 4UEJA 3GK3A 1P1KA 4UC0A 1Y5LA 5EERA 4YFYA 4LI3X 3SS9X 4C14A 1U9IA 1CVRA 4UTXA 3LUKA 4RFSA 5FTLA 1CJCA 5HDBB 4GLFA 1KL7A 4HC4A 4ZVUA 1NBOA 3CSUA 4E33A 4OA5A 2ODWA 2WYUA 5H16A 3T95A 5B6JA 2C5FA 3ED5A 3ZDRA 2AD5A 2G07A 5JISA 1CX9B 1RS0A 3JY6A 1GFIA 3PDUA 3ANSA 5DXAA 5BQXA 1LDBA 1J23A 4BAZA 2PT7A 3P97A 1KQNA 1PVDA 3B1XA 4Y7CA 3TR6A 2XNJA 5DW3A 2BP7A 1YFJA 1PFVA 3IUJA 4JXKA 1PKXA 1EUYA 3IAAA 3LUJA 4R9UC 6CHYA 3DXFA 2Q5EA 1GZ4A 5HTKA 1EM8A 1M75A 2V7WA 4COOA 4RPHA 2VATA 4WA8A 4P7BA 1E2DA 2ODEA 2PMEA 3NH9A 4H7FA 4ZT6A 2VHVA 4FLEA 2QN3A 4PG8A 5MGNA 2IYOA 2A3NA 4N6GA 4MYCA 3IDOA 3LOPA 1H93A 4LRXA 5FWYB 1ZUNA 3UK6A 3HRHA 4IV5A 4JQYA 1MTZA 1P5RA 4B3SB 3GY0A 1H8HA 5AM0A 2D54A 1OHHA 1DKNA 4JQOA 4OPMA 5ALGA 1J4AA 3A4IA 1UADA 1MX1A 3HM2A 3PHJA 1JR3D 3G3EA 3O1JC 3GEDA 4ZK6A 1KHHA 1SQGA 2Q27A 1SHZA 3BMOA 2D74A 3DLAA 2VZ8A 3JD4A 4KSYA 4LC9A 4TT3D 4H7KA 5LYYA 4BFZA 4KN6A 1LDYA 4ZEXA 1LF0A 1RHKA 2B21A 4YRTA 5TMBA 1BEUB 4D9GA 1CRPA 3H6HA 4HRXA 1OVGA 4FLFA 1XF9A 3ABRB 1ZJ5A 3EHDA 3H0EA 3PU6A 1KI1A 3DZ8A 4D82A 4E30A 1TM4E 4IVPA 3KZXA 3A4NA 4FNAA 3NM6B 2BGJA 1M0TA 1NUTA 1WMBA 3X2EA 5JRJA 3GLGE 1TDJA 1BYUA 2J5RA 2WSSA 1JV2B 1R15A 3RVOA 5LXTA 4S1OA 1GT6A 1ZUD1 3IUMA 3LQYA 4RK5A 3NTXA 4TOIA 1XAGA 1Q12A 2IEYA 4HLUA 3T7RA 2O0MA 3K1AA 4HVAA 5E2BA 1NDQA 4ABTA 3DPUA 1L2TA 4ZXFA 3VNRA 1J5XA 3FPBA 3E22A 2FUEA 2Y66A 3G5AA 3H18A 3JWIA 4FE3A 5EJ8A 5KQRA 5HUHA 5BN3A 4NL4H 1MF7A 2HLNA 1SJ9A 1WKBA 4L8FA 1YFKA 4HN9A 2C82A 4BS9A 3BIFA 4EECA 1PDWA 4E3ZA 3I4FA 2DMRA 4Q12A 4XM0A 5C4MA 1FSPA 1YQWA 4JN6B 2MU1A 4MPJA 2H7YA 1DRWA 2KE5A 1UM8A 1GKLA 3GCDA 1JTVA 4Q93A 4BECA 1GNQA 1GPDG 5DEIA 3Q6MA 4UU0A 1QU3A 4F2HA 1QR2A 4R2XA 2EERA 1XZPA 2BMJA 5BSKA 2VK8A 1CB0A 4PHCA 3GLRA 4BNDA 5BT8A 4ESHA 1M66A 1KFJB 5GADl 1P45A 2O0JA 4B40A 1FPQA 4ZHQF 4OHYA 4B6GA 3A26A 2BT4A 2ADFA 3GHYA 4RM3A 3W8RA 4DCGA 1TT7A 4RZXA 3Q72A 1QP4A 1EXWA 3WLRA 1SVNA 5KNCH 4D80A 2WMYA 3WLJA 4D42A 2J6CA 3SE7A 3BRQA 3GBPA 2AKAB 3BK7A 5A9SB 4A82A 2QD1A 4MICA 2Q46A 4F8EA 3VRHA 3KFVA 3D02A 4AN0A 1CHNA 5JEDA 4IIEA 4YAIA 4YT2A 4AG6A 3U4MA 5AI4A 1WMDA 4FR0A 3NTUA 4MKHA 3H5TA 5BW8A 5B30A 4ME6A 4V38A 4WLOA 1G17A 4PYJA 1XU9A 3IDQA 4GZMA 4Z7NB 3OCVA 3P9RA 3KEMA 3KDPA 2HPZA 2XRZA 1L4KA 2ZSEA 4Y1EA 1NBAA 4Q4JB 5KIAA 1YD7A 2Y71A 3LCJA 3TF5A 5I7EA 3GUUA 1NU8A 2YWXA 2Q5QA 2CCJA 4QQ8A 4KB5A 4MLPA 5TT0A 1C0IA 2JASA 2WWWA 4EMBA 4CMCA 1VYHA 2QY9A 1W73A 4J0KA 5KWJA 3T9BA 3RLFA 4EJ6A 5ITZA 5C8ZA 5CFZA 1T4GA 2FN3A 2ISQA 2PJUA 3B53X 1G8MA 2WC1A 4G9EA 4PX3A 4TMZA 3UENA 1BA3A 4TL9A 1ONNA 4ARZA 4EUKA 3DL7A 3SC6A 2AFIA 4TTSA 1Y8CA 4J7CA 1QTRA 1BHQ1 1OC4A 2J31A 1U2SA 2VI5A 3DMTA 5HYVA 3OFJA 3F98A 2E4VA 1TA9A 4ND6A 3LW8A 1KDTA 2F4NA 2HK6A 1P4AA 3GAZA 4Q9KA 4BNKA 4D92A 1UBLS 4UPEA 3D4OA 3W4IA 4E5NA 4LA4A 2Z8YM 4ALMA 5DHFA 1P0MA 2HDNB 3VJKA 1RPTA 1LK0A 4NU6A 1MHTA 2X1VA 4LKOA 2O50A 4JDUA 1XFDA 1CZHA 1PW7A 3STYA 3FI9A 4L5JA 1EGHA 4QQRA 2VZEA 3HMQA 2GM3A 2R8XA 3FWNA 3OURA 1N6RA 4X20B 2CDRA 1RLIA 2V9ZA 3CNNA 4URYR 2C96A 2MYUA 1BN6A 1YJAA 3WGLA 5IAJA 4WBNA 3C74A 1A3CA 4NI5A 3TKLA 5LCXA 5IYZB 3PRYA 1DGQA 2I7CA 1M1YE 2PLWA 2AMJA 5HJEA 1DELA 4M1MA 5ENVA 5AKJA 3G2NA 3KSUA 4UDXX 1SKUA 1CIVA 3K71B 1M73E 1WB6A 3I53A 2V7VA 3QF4B 3NHSA 1VFNA 3O3NB 4BNUA 3RS9A 4EHAA 5IF3A 2GK4A 2N3ZA 1N1EA 3OJLA 4QG3A 2C5LA 1U8TA 4BBZA 4KO4S 2PCLA 3G0GA 1KXJA 3NYIA 4PSVA 2XDQA 2CMGA 4KIJA 4XFKA 1CP2A 1ODSA 3K30A 1H65A 4L9RA 3RIMA 4ZZ1A 2GZHA 3OG9A 2PUAA 4JA0A 3HVHA 2ZBUA 1Z0JA 3UFXA 1XZIA 1U2DC 2HB6A 3R4VA 2LWIA 3N39C 1T1SA 4KLNA 1Y5IA 4KNWA 4PZ9A 3DCYA 4KLCA 3CZ9A 3D6FA 4X7PA 2PMKA 5EFOA 2NVWA 3VPBA 1NVGA 1SQ6A 2DKFA 4PHTA 1Q3TA 4U1RA 2A59A 4BP1A 4NCBA 4A0HA 2RHDA 1G1MA 3KOXA 3ZIAA 4KRFA 5KTKA 3D4BA 1GNLA 3OM0A 2L17A 1M34E 4F86A 4HF7A 4UPVA 2VKTA 4RTPA 2W9XA 1KQ3A 2Y67A 3CNEA 1WB4A 1PUXA 2PKCA 2TMDA 3LYUA 3QFHA 4JOQA 1P17A 4LY6A 4YJ2B 5F35A 5AW6A 5B1EA 5JMWA 5BN5A 5C9ZA 1P5HA 2MR6A 5HHTA 2AMLA 2JBAB 1HQCA 3X1ZA 4M89A 4ZD6A 5DXFA 2W8BB 1PG5A 2ZJFA 4YMIA 1DQNA 1Y6GA 4PR0A 2WLTA 2GEDA 3QKRA 4J1SA 1Z5GA 1E4YA 4EB8A 3AL2A 2FK7A 2I8LA 3BEDA 3CNHA 2DWPA 5AW8A 2G1AA 4R81A 4A7PA 2X0NA 2FMFA 3UNXA 3H42B 1NJ6A 1U7PA 4ZI2A 3MWKA 5JTUA 4ZCRA 5AM2A 4I5EA 1AV6A 2P9FA 4Z8YA 4FP9A 4FDAA 4BUJA 3SS8A 2C8LA 3EWSA 3WFZA 4NVRA 3ZN2A 2X76A 3BDIA 1V1JA 3Q6IA 4WLVA 4BO9A 1VKZA 3NGXA 3CKYA 2EX1A 3M6MD 3K8QA 1GYQA 2HQOA 1U65A 3AONB 4NK4A 3R9IA 1T2VA 2C4KA 3BWMA 3RTBA 3RYIA 4EP1A 4RYDA 4YAOA 4WX2B 3RARA 3WP0A 2QW8A 2AVDA 1CHDA 1ZD9A 4E21A 1TMGE 4Z9YA 1G9TA 1N32B 1U1CA 2UYYA 2QD2A 1GQYA 4OIMA 4URHA 1FPMA 5L6MB 5EWJA 1P2UA 1ULUA 2RHTA 3E53A 2PNFA 2VHZA 1VCIA 1OCEA 3QIVA 5DNYB 1U8ZA 2PTGA 2Q8QA 3W3ZB 4F4IA 1BGVA 4BRWA 3E3MA 2YN0A 1C7JA 4M9SA 3UAOA 4Z2YA 3ZUGA 1EIZA 5HBGA 5DLQC 5BNTA 1KIMA 3ETNA 5REQA 1OX6A 3D8BA 3DEHA 3GJYA 3FOFC 2ETVA 3EGWA 4OM8A 1UWKA 1HWYA 5DLYA 3MGAA 4QDXA 1H2YA 3RV3A 3S7ZA 4I66A 3SOPA 3FGNA 4B5KA 2QROA 3SYLA 3JALB 4BB5A 3DOOA 1GYPA 2HT1A 3NOVA 4P3KA 4BZQA 5H7XA 4WI1A 1OXSC 3DTNA 1IOVA 2PM8A 4LW8A 3TINA 3V8PA 4QRIA 5FWDA 3A6KA 2GTIA 2JD0A 5KNBH 1QTNA 4ZOBA 5AXAA 3ONNA 5LP6F 2OKGA 5CG1A 3E9MA 1RCFA 3S28A 2HIAA 2R7KA 3VNSA 5EZYF 3RBVA 2GCPA 2XVMA 1BRMA 1A9SA 2B4KA 3BXEA 3C3DA 1YZLA 3HBJA 4I36A 1D6JA 3RGGA 2Y76A 1Y7LA 3FRIA 3QA9A 4HYEA 4KGXA 4MR8A 3SSAA 4FOTA 3TIGA 2H5JA 2PWZA 3L1JA 2OY0A 2E4AA 4PFKA 1NW6A 4BMVA 5LDDC 1FLAA 4QPPA 3PYLA 3DKRA 5ALNA 2RAUA 1FDOA 4F5WA 1NI3A 3U7RA 1XTTA 2APJA 3K5IA 3KDAA 1ML3A 3NVDA 3OQIB 1RYZA 3DTYA 5C46F 2I22A 4TYWA 3M49A 3Q7IA 1JB1A 5T64A 4O0MA 2OO5A 3ZCRA 3ISTA 2IHNA 5AJZA 1PL7A 2V96A 2CFCA 5HG0A 5C31A 3SJUA 3DLPX 3HKDA 2FR8A 3CY6A 3O0TA 4CIAA 1A2QA 2Q3MA 4QDOA 3IEUA 2ZT8A 4H0FA 3UAWA 2X9GA 4D79A 1G8KA 1DARA 2IEDA