1ODSA

Cephalosporin c deacetylase from bacillus subtilis
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
316
structure length
316
Chain Sequence
QLFDLPLDQLQTYKPEKTAPKDFSEFWKLSLEELAKVQAEPDLQPVDYPADGVKVYRLTYKSFGNARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIHEMVNWALHGYATFGMLVRGQQSSEDTSISPHGHALGWMTKGILDKDTYYYRGVYLDAVRALEVISSFDEVDETRIGVTGGSQGGGLTIAAAALSDIPKAAVADYPYLSNFERAIDVALEEPYLEINSFFRRNGSPETEVQAMKTLSYFDIMNLAYRVKVPVLMSIGLIDKVTPPSTVFAAYNHLETKKELKVYRYFGHEYIPAFQTEKLAFFKQHLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CEPHALOSPORIN C DEACETYLASE
publication title Multifunctional Xylooligosaccharide/Cephalosporin C Deacetylase Revealed by the Hexameric Structure of the Bacillus Subtilis Enzyme at 1.9A Resolution
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 114
structure length 316
sequence length 316
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.1.41: Cephalosporin-C deacetylase.
pdb deposition date 2003-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1odsA00
5AKEA 2Y2VA 2WLSA 3QPDA 5JZ9A 4F60A 1CUXA 3D7RA 5AH0A 2IX9A 3EBLA 3AJAA 4MYSA 1Y7HA 1WB5A 4G8CA 4BP9A 4K5QA 4L72A 4BZWA 1JJIA 5CH3A 2VQ6A 5DJ5A 3PI6A 2WHRA 5JD5A 2HADA 4CIBA 4EBBA 1XQYA 1VKHA 3H1BA 3L1IA 3N2ZB 4HXFB 1XZIA 1XZMA 1JU3A 2XLBA 2QXTA 3FCXA 5KWIA 1KU0A 2ROQA 2XUKA 2D5LA 1CUFA 5LZ9A 1ZI6A 1B41A 1SCKA 4ZREA 2JGJA 3JWEA 2R8BA 1MN6A 4RE6A 4H35A 3ESBA 3AIOA 5ALQA 2XMBA 2ZJFA 1Y37A 1YA4A 3Q8WA 5AKIA 3EQ9A 3F67A 2HU8A 5T4HA 1QJ4A 4WY8A 6YASA 1HPLA 3IUQA 1XRPA 5CXUA 4AO7A 1JU4A 4CCYB 4X6YA 1ORVA 3E4DA 1JMKC 3BDVA 3F9CA 1DWPA 2ACEA 1GGVA 1CUUA 3SC2A 2XT0A 4A5SA 2WJ3A 1ORWA 2RIPA 1CRLA 2XB6A 1ZIXA 2PPLA 3AZPA 4UHHA 5AKXA 3K9BA 4P93A 2QJRA 1FJ2A 1UK8A 2O7VA 3V1NA 2QUBA 1UK6A 2GYWA 1VOTA 5JZBA 3ZI7A 3OC0A 3BIXA 2J3QA 3A70A 2EDAA 1MU0A 2G63A 1E8NA 4F0JA 3IB3A 3KSRA 5ALWA 5K3AA 1E89A 2XMRA 1K4YA 1QO9A 3AIMA 2HA4A 4DGQA 1F0PA 4EY7A 2JEZA 1R1DA 2OCLA 2V98A 1XZBA 1ZD5A 1GQRA 4FFVA 3K6KA 5LZ8A 4EZIA 1ODTC 5HQ3B 3O4JA 4UPDA 5LP1A 5CXXA 4K6GA 5C8VA 3AZQA 1MX5A 2HFKA 2WTNA 3B12A 1ACJA 1UKAA 3FSGA 2HRQA 2OGZA 1NU6A 1TKRA 5FKJA 3MUOA 2HFJA 4MQMA 3WIOA 3F96A 2CMFA 1XZFA 2XUQA 4J0DA 4HVTA 2ZYHA 2XQIA 3PICA 4LHEA 3R0VA 5LKRA 4UBKA 4Y2UA 1XLWA 4FMPA 2OPHA 2QRUA 3STXA 5AO9A 4OUKX 1IZ8A 2R11A 1IUNA 5DTIA 3H2HA 5ALPA 2O2GA 1XZEA 1TCAA 2OAEA 5C8XA 1DINA 3WK7A 1MAHA 5JARA 3FLEA 2JGIA 1YCDA 1G66A 5JAUA 4GHWA 1BEZA 1LBTA 2VSQA 3D5EA 4UBNA 3A6ZA 1QIIA 3BJRA 4Y2XA 1QONA 5LZ4A 2C4HA 2CEKA 4J0CA 1VA4A 4HXEB 4MEAA 2GZSA 4QLAA 5D6OA 5DYTA 5HFAA 5LYYA 4GXNA 3RARA 3O95A 4IHAA 1A8QA 1H22A 4PNZA 1CUZA 2WIKA 1VXOA 4AZ0A 3WKEA 1K8QA 1YAJA 1X2BA 4IH1A 4YX9A 1ZI9A 5HF5A 4I19A 2CZQA 5D7BA 3W2TA 1EHYA 3CXUA 1A7UA 3O9VA 3FYUB 1CUSA 2B9VA 2B4KA 3QITA 3KOOA 4BZZA 5K3FB 2PM8A 4HAIA 2J4FA 2VTVA 5ALTA 1D07A 3R41A 4A23A 4UFOA 3H0CA 1SC9A 4OYYA 4X00A 2W22A 4DM7A 1CUIA 5IH7A 3UUEA 3CN7A 4L0CA 4EB0A 3O4HA 1A8UA 5CH5A 4QEKA 3L1JA 2OQIA 1VZ3A 3M81A 3STWA 5KWJA 3NWOA 3NUZA 1UXOA 1EK2A 5JASA 4U2EA 5AM1A 4G8BA 4ITVA 5ALOA 4QDZA 1USWA 2FUKA 1J2EA 4DNOA 2WILA 4C89A 1EH5A 5ALJA 2Z8XA 4GW3A 3BL8A 3DL7A 4B6GA 3ICWA 2WKWA 3WYDA 2BUBA 5AM4A 1EK1A 1T4MA 2PSHA 3W9BA 1K5PA 5HK8A 1OCEA 3H04A 2QM0A 4FLFA 4IO0A 5HKAA 3WK8A 1CR6A 5JADA 5I9IA 1YASA 1VJ5A 2J4CA 4PV7A 2RHTA 1ODCA 4A16A 4Q3LA 2WU3A 4DMKA 4ARBA 3AZOA 2PU5A 3AINA 3WJ2A 3OOSA 1CIJA 4ZV9A 4PSUA 1L7QA 2JGKA 2QVBA 4C87A 2H7XA 3U1TA 3ANSA 4B82A 2CKMA 4PO3X 3GELA 4GBGA 1XROA 4UHFA 4WFKA 2OCGA 1BCRA 1XZKA 2VJDA 3V1LA 4FBMA 2JEYA 3LS2A 5ALSA 1AUOA 4DIUA 2BJHA 2PKYX 4ZI5A 5JALA 1X2EA 3G0GA 2XDWA 2H7YA 4AQDA 3S8YA 1R88A 1XQXA 1BS9A 1CFJA 2DR0A 3VDXA 1MAAA 2AXEA 2YYSA 2XLCA 2HM7A 4X92A 3VISA 2V97A 4FKBA 1TRHA 4CFSA 2XMQA 3I2HA 4P08A 1XRLA 1G5FA 1BROA 2ACKA 4WFIA 2OG1A 3QZUA 2DSNA 2JGEA 1GPLA 5AI4A 2WFLA 2WIDA 4MEBA 4DMFA 3HYSA 5AI8A 3WK9A 1Q83A 1N1MA 5K3EA 2WU4A 4PF1A 4FWBA 2XQFA 4KE8A 1OXMA 4C4YA 2D0DA 1OILA 3UUFA 1U4NA 3WKAA 1DT3A 4B0PA 4H7FA 1P0PA 3ZLUA 2ES4A 4XJVA 2WIGA 3HI4A 3TJMA 1B6GA 5EI5A 1PJAA 3DD5A 4B9AA 1QIMA 4FNMA 1EDDA 4ZGBA 1IUOA 1ZJ5A 4J3JA 1O6GA 5FPQA 4HS9A 4FNGA 3R3ZA 3OM8A 4RGYA 4MWTA 3Q0TA 5AIAA 1N8SA 1LPSA 2GBIA 4EUSA 3R3UA 3L1HA 4IQ4A 5JAOA 1U8EA 1YSCA 2WJ4A 2WHPA 3C5VA 4X71A 1H2ZA 4DSZA 2H7CA 4G4IA 2XUGA 4BC0A 1HL7A 3PFCA 2Z8ZA 4OU5A 3WQHA 3MVEA 3BE8A 1U2EA 2VT6A 3M83A 4UBMA 1R3DA 4BCBA 4UBLA 3RM3A 3C45A 3QMMA 2JBWA 1JKMA 3FLAA 1XLVA 1ZIYA 5JANA 5ALZA 5AKLA 1TQHA 1XRRA 4W1PA 2PSDA 3DQZA 3V1MA 5LIPA 1R9MA 1G42A 1JFRA 3D2CA 2Z3WA 1QZ3A 1FFEA 1TAHA 3U0VA 5JYCA 4QDXA 2WJ6A 4FLMA 3D0KA 2BKLA 2BFNA 1MNAA 1R4ZA 3QYJA 5CTAA 5EIEA 1O6FA 4GI1A 2B61A 4GLBA 3OPMA 1FFCA 4H7KA 4JEIA 4AMYA 4BC1A 2PBLA 4QDTA 3V9AA 5ALYA 4DMCA 2QMQA 1LPMA 3DJYA 3DNMA 3MGAA 3C5WP 5AM2A 3GZJA 4UHCA 3VJKA 2XQJA 3JW8A 2DFPA 2X76A 3WWCA 2VAXA 2WG0A 1LPBB 1AQLA 2WUGA 4ZWNA 1TCBA 1QIGA 4HRYA 3KWJA 5CURA 4X7BA 2YASA 3DOIA 5ALKA 5A7GA 4NMWA 1U65A 2HU7A 4UBIA 5EGNA 4E46A 3VXKA 1Q84A 5I8PA 3FYTA 3EQ8A 3QMVA 4EY4A 3FYUC 2WFZA 3RK4A 1BEEA 5HF6A 3CN9A 4CCWA 4P9NA 4BVJA 4W1SA 3IA2A 2CJPA 5FP0A 3IURA 1IVYA 2DCMA 3SK0A 1Q0ZA 3AFIA 3F8SA 2AJLI 4C6HA 3WK5A 3ESAA 4MYDA 1YAHA 2UZ0A 5FOQA 4FLEA 1ACLA 4JYMA 5CMLA 5JAPA 1QTRA 3KWFA 4EY5A 3BXPA 5KREA 3WL7A 2Y6VA 1Q0RA 4TVKA 1CQZA 1G4HA 4AO6A 2OXEA 1XRQA 4UFPA 3EF3A 2DHDA 2Z3ZA 1AX9A 4WFJA 1WCYA 2GYUA 1JJFA 2OCIA 3DLTA 1UKCA 5ALMA 3H2GA 2OGSA 3H19A 4UUQA 3K2IA 3KDAA 4IH9A 4JYPA 4OU4A 3DYVA 2FJPA 2HA7A 3WKBA 1ZGBA 3FNBA 1CUJA 2C58A 5SYMA 1AGYA 5AKGA 3I1IA 1W4LA 3TGLA 4QDUA 5DNWA 3VJLA 5AICA 5A6VA 4W63A 4O08A 3D3NA 4AXBA 2ONCA 1CPYA 4B80A 3TEJA 1QTIA 5EFZA 4LXIA 3ZV7A 3VVMA 1CEXA 1RWQA 3QPCA 3R3YA 4GWLA 3CCBA 1QOZA 1EDBA 1UOQA 4B84A 3AUKA 2FX5A 2HA0A 1WPRA 2QR5A 3M82A 2ZJ7A 3H2KA 1J07A 4OB8A 5C81A 3C6XA 2EEPA 3AILA 1QIFA 1A8SA 4B7ZA 2PUJA 5DTJA 3G9XA 3S2ZA 3LIPA 3DOHA 2ECFA 5IVIA 3BIWA 5JIBA 1H2YA 3R3WA 4AO8A 2DQYA 3WWPA 2CUTA 2O2HA 3G02A 5IKXA 2XMDA 4CG3A 1CUDA 1HQDA 1XZLA 3W9UA 2EDCA 1CVLA 3N0TA 1YR2A 1RP1A 2G5PA 4B81A 3E0XA 4AMZA 2JGMA 5ALVA 1JMYA 5AK6A 2PX6A 5FUMA 3G0CA 2NW6A 1YA8A 4BATA 2WUEA 4CCYA 2RGUA 2XUFA 1CUGA 4D9JA 3D4LA 1ZICA 4B85A 2PU7A 3G8YA 4E14A 4MJ3A 4QLOA 1CUEA 1XLUA 5FPPA 5ALGA 4DNPA 4OYLA 5FV4A 3B5EA 4DMHA 4OPMA 1XZJA 2PUHA 3WWOA 2OLEA 4CI9A 3IVMA 1QGED 4K6KA 2ZSHA 1MTZA 5JAHA 4L3WA 3CCCA 4X94A 4C88A 2O2IA 1P0QA 4U2DA 3FSGD 2QJWA 3I6ZA 4K6HA 3ZLVA 1HDEA 4GECA 2ZYRA 3H17A 2XQGA 3T52A 1AKNA 4YASA 4U2GA 2WUDA 1EINA 4Y2PA 4H18A 2VJBA 1N5MA 3I2KA 1E3QA 3D2BA 3LCRA 3PF9A 3WL8A 3PDCA 3WA6A 3FWHA 2DHCA 1XFDA 5HQ3A 5AI5A 3H2IA 5T4BA 4CG2A 1DQZA 5HCUA 1Z68A 1LPNA 4JNCA 2ZYSA 4X6UA 1DWQA 5JATA 2C0QA 1CQWA 4X91A 4PW0A 1NX9A 4J03A 5AK3A 4Y2YA 3RKSA 3I6MA 1GPNA 3VJMA 2DHEA 3GFFA 4E11A 2XQKA 3W04A 2K2QB 3HRHA 5EHNA 1K63A 4UHDA 5K3CA 4RE5A 1BE0A 1QIJA 1WPXA 3G7NA 5HFNA 3HLKA 1ZOIA 2B20A 3WA7A 5ESRA 3WLAA 2Y6UA 1GKLA 1YS2X 1BCSA 5EHZA 5BOVA 1W75A 2C5GA 1A88A 4PSDA 4LYEA 3OURA 2WSLA 2C7BA 2G4LA 5DLPA 1NU8A 4X6XA 2GBGA 2P8SA 5A62A 4H7EA 3FAKA 4Y2VA 3NOXA 4LXHA 1GPKA 2C5FA 5CT4A 1CUVA 1N5RA 3STVA 2OCKA 5ALRA 2XUDA 4CIAA 1WB4A 1W6RA 3NGMA 1EI9A 1P0IA 4KEAA 1XRMA 2J3DA 5AI6A 1C4XA 3E3AA 2BCEA 4BTLA 5YASA 4IH4A 2WIJA 4G5XA 1LBSA 5AKJA 2WTMA 1Y7IA 4J0HA 4TPKA 3QBJA 1CUCA 3HXKA 3G0BA 5KBYA 2QS9A 3G9TA 5JD6A 2XMSA 1DX4A 2AJCA 1E66A 4H7IA 3FYUA 1ZD2P 1QIEA 3ESDA 3D59A 5K3FA 3STTA 4ROTA 2QXUA 4KE7A 4BYMA 3YASA 4KJXA 4BDTA 5CBKA 5ALHA 4AB1A 4BBZA 2RONA 3E1GA 4Y2TA 1K6EA 2YXPX 3BF7A 4DYHA 1MNQA 4YK7A 4AX4A 4S0XA 1QO7A 4Q34A 4H77A 1VLQA 2FJ0A 1MPXA 4YPVA 2VJAA 2VT7A 3D2AA 3PUHA 4DLNA 3IUNA 3SX4A 3HABA 4FOLA 3IBTA 1EA5A 4X93A 2LIPA 1ZD4A 2VATA 1LLFA 3C70A 3DDUA 3G0IA 2H1IA 3WL5A 4H7JA 4Y2SA 2GYVA 3C8HA 4C4XA 3ILSA 1UOPA 5LKAA 2XE4A 3F98A 2I3DA 3GA7A 2IITA 4EY6A 1QE3A 4ZXFA 4BDSA 4J0IA 5AKZA 1GQSA 1H23A 5LZ2A 2I78A 1HKHA 1E8DA 2I3ZA 5ALDA 3PF8A 4ARAA 1W1IA 4OB6A 5BWCA 2HA3A 3I2IA 1UZAA 1LZKA 4Y7DA 4G4JA 2XMCA 1CV2A 4Q05A 5CT8A 4BE4A 4P92A 3UMJA 1I6WA 4INZA 5AI0A 2XUAA 1F8UA 4RPCA 2VJCA 2XUPA 5DWDA 1EDEA 5BV7A 4MWSA 5D3ZA 4BVLA 2V9ZA 1R50A 3IUMA 1EB9A 1J06A 4UBJA 1LGYA 4KE9A 2VEOA 5IVHA 2YH2A 1L7AA 2WQZA 1WM1A 1E8MA 3HJUA 1ISPA 5J3JA 1S8OA 2DQZA 4W1RA 2BAGA 5T4FA 2GZRA 2RAUA 1MJ5A 1C7JA 2HDWA 3W05A 1WB6A 3LIIA 1SFRA 1JI3A 2Z5GA 5ALNA 2HA5A 1ZJ4A 1QLWA 2GBCA 1XKTA 1TIBA 5AHXA 1YS1X 3HACA 1TK3A 5ISMA 4QA9A 5ALFA 4KACA 2Q0XA 3DYIA 3MUNA 4Y9SA 2HL6A 4LXGA 4HTAA 4N8EA 1ZI8A 5D3KA 1PFQA 2HA2A 3H18A 1J1IA 4PQEA 3O4GA 4KE6A 4NVRA 3SWWA 3DCNA 2ZVDA 3O9MA 2X5XA 2PVSA 3V48A 1WHTA 5T4EA 3DKKA 4DTCA 3I2FA 4X3CA 3QMWA 2JGFA 5AOCA 4QZVA 2ZYIA 1UK9A 4X85A 2G5TA 3ED1A 1KEZA 3OTQA 3G0DA 3A2NA 2BGRA 3EIOA 5BWBA 4Q1VA 4QE3A 2ZJ6A 4BE9A 1THTA 1SCIA 3VKFA 1QIDA 3IUJA 1BN7A 4JUIA 1EXWA 1LPPA 2QOEA 5EHQA 5ALIA 2JF0A 1MX1A 2HU5A 4N8DA 1QIHA 4KAJA 5H3HA 2AJDA 3H1AA 1FFAA 1WHSA 4OCZA 2WG1A 1JJBA 2VA9A 1LZLA 1XKLA 5CT6A 5AM5A 5A7FA 3VVLA 4BRSA 3DL4A 4Y2QA 4OB7A 4MQLA 1AZWA 1UKBA 5DNUA 5JZSA 4KRYA 4N5HX 4ZRDA 4AZ3A 3WJ1A 3DS8A 2O7RA 1HLGA 5AI9A 1YB6A 2I03A 1SCQA 3PE6A 4MXDA 5HKBA 4XVCA 1E5TA 1CUAA 1YB7A 3C6BA 3HZOA 1RYYA 4Q82A 3STUA 3P2MA 3ZPXA 3QVMA 3C87A 2Y1KA 3GROA 5HF8A 1FSSA 4B83A 5AM3A 3ZLTA 1UT6A 4HXGA 2XUOA 4GEGA 4H7DA 4NS4A 5AM0A 3BF8A 3O4IA 5AKYA 3FBWA 4BTVA 4BRZA 4B0OA 3BDIA 1TCCA 5AOAA 5K3DA 3WZMA 5E4TA 3QM1A 5ALLA 1QFSA 3HEAA 2BUAA 4X95A 3FLBA 3ICVA 4J7AA 2BGNA 1M33A 4U2CA 5E2IA 3FVRA 3STYA 3C6ZA 4LIPD 1UOOA 5DNVA 2QKYA 4XIIA 1FFBA 1VZ2A 4F5ZA 2XUHA 1XQWA 1MX9A 4NZZA 2AJBA 5LLSA 1MT3A 5CH8A 2WM2A 4UHEA 1THGA 5CT5A 4I4CA 4W1QA 2QUAA 1DX6A 1PV1A 1LPAB 4OD0A 3HC7A 3O0DA 3R3XA 3WIBA 1CLEA 5AKKA 2WIFA 4UBOA 4J0JA 4Y2JA 3FVTA 4M0FA 4H0CA 4BCDA 5AJHA 2XUJA 1FFDA 1ODSA 2E3JA 2HHAA 5CW2A 4U2BA 5CT9A 5AIBA 3I2GA 4TGLA 4LYDA 3C6YA 3IULA 5AKHA 1UFOA 5FXMA 4V2IA 4KRXA 1DTEA 2WFLB 1KU6A 7YASA 4ETWA 4M0EA 1LPOA 4G8DA 2QZPA 1BN6A 4K2AA 4EA6A 5EIAA 3I28A 3WL6A 4Y2RA 4GDMA 3AIKA 4QWMA 1AURA 1ZGCA 1H2WA 4UFNA 3EQ7A 4M0MA 3A2LA 4QDOA 4WCVA 3R40A 3G9UA 3WWEA 2IIVA 1EB8A 2Y2UA 3A2MA 2V96A 1XZDA 3G9ZA 3C43A 2PSJA 4RNCA 3F97A 2GBFA 3H2JA 4BB0A 1BRTA 2RHWA 5ALUA 5E4YA 4FHZA 1AC5A 2X8BA 3TRDA 5K5EA 3ZWQA 4WDQA 3ESCA 3WMRA 4N8SA 3I6YA 3RLIA 4ZV7A 3OG9A 1IMJA 4WJLA 1XZAA 2HA6A 5ALEA 1XZGA 1CUHA 1L7RA 4HRXA 2AJ8A 4W9RA 2VAVA 4BCCA 1QIKA 1IZ7A 2XUIA 1C7IA 4KYVA 4PSCA 4Q3KA 1T2NA 2WHPB 3KXPA 3IIIA 5AP9A 4FTWA 3IDAA 4G9GA 4U2FA 3I2JA 1XQVA 5HF9A 1UK7A 2QT9A 1W52X 1EX9A 1GKKA 4AN1A 3LP5A 4H7HA 2C0PA 4FBLA 3WZLA 1GT6A 4BAUA 1IUPA 1ETHA 2QTBA 5FLKA 5FDFA 2WUFA 2VF2A 1AMNA 4E15A 1QFMA 5DYWA 4G4GA 3BJMA 3FOBA 4XX1A 5EHXA 1H2XA 4BAZA 2HRRA 2PL5A 1EVEA 2ORYA 5SYNA 1W76A 1GXSA 3W06A 5E4JA 1DWOA 1UWCA 1VE7A 3DKRA 3GBSA 4DNFA 5AK4A 3B3QA 2WFMA 4Q3OA 2OGTA 4WY5A 5C7YA 3GUUA 1CUWA 5I7UA 2W6CX 1XRNA 4DNQA 2WHQA 1JT2A 4FFWA 4UHBA 2HIHA 4AN0A 4HZGA 1F6WA 4I3FA 4FDMA 5ALXA 2XI4A 1CUYA 5F4ZA 3PFBA 1WOMA 5IVKA 5JD4A 4CG1A 3PUIA 3M3DA 3I1YA 4G1FA 3HSSA 2RI6A 1DQYA 3BWXA 1XZHA 1VE6A 3X3HA 3T4UA 4BVKA 5C8ZA 3DEAA 5A2GA 1R9NA 1CUBA 3V1KA 1MO2A 1F0NA 2XMGA 2JIDA 5LZ7A 1DT5A 1BU8A 2PSFA 4N5IX 4QWWA 4BP8A 5DYYA 3R3VA 2OQVA 1LNSA 1SOMA 5A71A 1P0MA 1X70A 3WYNA 4G9EA 3WKCA 1EVQA 4QNNA 4EY8A 5AK5A 3QPAA 4Z49A 4J0KA 3LLCA 4OSEA 1HBJA 4F21A 5A7HA 3WK4A 3WI7A 3KD2A 3FCYA 3QH4A 4L9AA 2H9YA 4X97A 5HZGA 4LKOA 4C4ZA 2BUCA 2JGLA 1XZCA 5HK9A 3WKDA 4WDRA 5K3BA 5AOBA 4X90A 4EHBA 5EIHA 3WK6A 1DU4A 3ANTA 4XWGA 2CB9A 4DSAA 2PSEA 4B9EA 2WG2A 4KAAA 2XMZA 4KR0A 4C01A 2CBGA 4BAGA 5LZ5A 1ZD3A 5IVDA 1VA5A 1GZ7A 1VXRA 3JYHA 2ZSIA 3WWDA 5FRDA 3C8DA 4J0GA 5CRIA 4JH0A 2OAGA 4KAFA
chains in the Genus database with same CATH superfamily
1YK1A 4RJ2A 2C4TA 1DEAA 2HV8A 3BT7A 1W59A 4DS3A 1F17A 1H9BA 4RD3A 2PQ0A 4ISBA 1G6KA 1AF4A 2I33A 1TF7A 3HADA 5K8LA 4IL5A 5K05A 1VYUA 2UYQA 2FRVA 5EVCA 4GYJA 3ZD8A 4YO7A 3T5PA 4MYSA 4YRIA 1WB5A 3PHCA 4RQBA 4BP9A 2P2GA 3WGGA 1C1HA 1P2DA 4MS3A 2PUCA 4ZC1A 1U8FO 1U9JA 1UBKS 1NXTA 1ZCJA 2J08A 3K0BA 1SVUA 1YR9A 4GFDA 1GSAA 1L4BA 4WCFA 5CH3A 5B1DA 3ZK7A 4HB0A 2Q2QA 3KHTA 4LYFA 3QGMA 3WSTA 4FZJA 4IXWA 4M99A 4PLVA 1ZD8A 5TJ9A 1XTJA 5JD5A 5ICFA 1TA4A 3O8CA 4FEGA 3HYCA 1KP9A 4PRKA 1X8LA 3GHYA 4EBFA 1PR1A 2ZSDA 3RHSA 1T3HA 1CZHA 1XQYA 3Q98A 4HXFB 4EBBA 3O2JA 3HKDA 4GKVA 4LJ5A 2IA5A 1V16B 2JLRA 4BO8A 2JRCA 1NLYA 4Y0NA 1JU3A 1MGOA 4GEKA 4UDXX 1Q3KA 3IT1A 3R6DA 3F3KA 5CU7A 3N87A 4EDFA 4EJSA 2N9UA 1GU0A 3ABIA 1S2MA 2JFNA 1X77A 4LY3A 1DBIA 4D8TA 4ZYYA 1VYVA 2XUKA 5AD1A 2PK3A 1EUDB 2DTEA 3QHPA 4TSFA 2D5LA 3OVMA 4WEOA 5LZ9A 2CBZA 4FDTA 1B41A 1EM8B 2C42A 2YWEA 3UUWA 4BO0A 1GG8A 1NJSA 3HZRA 3RAJA 5REQB 4GUDA 5T6MA 3BZBA 1O03A 4ZREA 1II8A 2JGJA 1M2WA 3PXBA 4AZVA 3FCAA 2BMDA 4OBEA 1U7ZA 3QEBZ 3CWCA 1UFVA 4OEHA 3W8DA 1HL3A 3SDSA 4YCMA 2ZBDA 1MN6A 5CAEA 3UMYA 4ZHQF 3SZ3A 1O97C 2MYUA 2LV8A 1YB5A 4JBHA 3C74A 3OT4A 3J81k 4R9UC 5JSZB 2I2CA 3MXOA 1TJ4A 4W5OA 3TI7A 1KFCB 4F3RA 6LDHA 1Y37A 3BC1A 3FX2A 4OHWA 3DL0A 2DYKA 5BSVA 3GYBA 4IOMA 4J0QA 3DMHA 5TX7A 3EXHB 5E1BA 3VH3A 1XWWA 2HPVA 1EVYA 1H42A 1OV6A 2AFHA 3C3DA 3KEOA 3Q3JB 4FYHA 4KKXB 4L0DA 3SOZA 2W58A 4RIGA 3F67A 2OCXA 2H5IA 3EEBA 3JPWA 3EFEA 1M2HA 2AH5A 1FP1D 4RV5A 4ES6A 5MN6A 2H4YA 5HOQA 2PUAA 4HLQB 4NBSA 2I91A 4KFCA 3ORQA 1TUBA 3T5CA 3HY6A 3GNTA 3AHIA 3L4KA 3C15C 1JG3A 2P2ZA 1QC5B 1GCUA 4G0MA 4WOKA 3A04A 3T15A 3ZJUA 4EW2A 3GB9A 4NOMA 4CF6A 1IH8A 2OCYC 2QF7A 1U2GA 1YVUA 1ORVA 1E9EA 2RJOA 3BDVA 3FBTA 4IFEA 2F59A 5DM70 2H1SA 1S2NA 2NZXA 3T1TA 5CD9A 4IUDS 4IDAA 3SC2A 3Q6NA 4CIWA 3H6GA 2EW8A 3QOXA 5AXDA 3SHTA 3ET4A 2UZ1A 1ZHFA 3CLSC 1V37A 5IJAA 2C07A 3UG7A 1JAIA 2XTAA 3CLKA 1FXUA 1NVKA 2IYYA 1ZIXA 2PPLA 4HQ6A 3HH8A 3A6LA 3THXB 2QIPA 3GQBB 4OQNA 4ISCA 4ALJA 2BZGA 2BRUC 4FZRA 3GFTA 3ZWOA 5CNMA 1Y98A 1SOVA 4QTZA 1FS4A 3G17A 2J6CA 1UK6A 1OI4A 4FS3A 4XDHA 3SYRA 1KTIA 4UCWA 1U0JA 2VQDA 2OUIA 2XVAA 3WFIA 1L5GB 2PKCA 2Q46A 3ESXA 3C16C 5T67A 5FOXA 4BVAA 4FGKA 1X0XA 4M88A 3OC0A 1T91A 4XYBA 4J4HA 5B7GA 1V1MB 1VTKA 2VRCD 3NHPA 3UAXA 9MHTA 5HTOA 7GPBA 4HSEA 4IJVA 1ABFA 3A70A 5K8VA 1XDGA 2ZK7A 2VG8A 2BLLA 2G63A 3UXMA 3A1TA 1M6YA 4RIHA 1PJCA 3GDWA 5IKEA 3HY4A 1UZMA 3A9VA 2NWQA 2V6MA 3HUFA 2IXBA 3IB3A 3KSRA 3T7RA 3NZEA 1J21A 3DXZA 1ZPDA 2X6QA 2IPMA 1VL5A 1SCUB 2EATA 3DT6A 5K3AA 5T5QA 2DM6A 2O4UX 4TKMA 4B73A 2VCEA 3EB9A 1BVYF 3EISA 3JASA 3OJOA 2PR7A 1GR0A 1WP4A 2CNOA 1E7WA 1QO9A 3OBIA 3FWPA 1BEUB 3QFFA 3ZGNA 4M1WA 4B8YA 4ZOCA 3RUHA 1F0PA 1PBTA 3LW7A 1XAHA 5BSEA 2JEZA 4QDKA 2XZDA 3K4HA 4RFSB 1R1DA 1PT5A 2FEWB 1FTNA 1UDRA 4G8JA 4F71A 3P96A 2Z57A 4NEGA 4ZVKA 3JAWA 2V98A 1W87A 1XDWA 4WNYA 3DCIA 3OT1B 1ZD5A 2OZLB 3ANMA 4IFTA 1YJCA 2NUPA 2Q49A 2YFHA 2JGAA 4KCGA 1HY3A 4FFVA 2EBHX 1GGFA 1FUEA 3DAPA 3RASA 4HDQB 4QGFA 4OGLA 3W2EA 2BFBB 4JI4B 1DG3A 2FWRA 3G85A 4RQUA 4UPDA 1P62B 5JRZA 5KYWA 4YP1A 3JS5A 5TE9A 4ILKA 3T3HA 1CY0A 3ZU2A 1PAUA 1UMKA 2DGDA 2CLHB 4K6GA 2DBQA 4XTRA 4Y6GB 4BIMA 3L0BA 5LM3A 3ICOA 7MDHA 2RGWA 1GV1A 2HFKA 2IEAA 1HT2E 4ZOQI 4IJWA 4OI1A 4H17A 3NHJA 2HJGA 2ORED 4QRDA 3B12A 4LNHA 3MJDA 3NHWA 1RXVA 2PJZA 5HIJA 1EEHA 2E4YA 2W6MA 3R8CA 2DEUA 1PTJA 2X8LA 1V35A 3WHPA 5CFLA 1QE5A 3ZXUB 2PX4A 3MN1A 4O29A 3O8OB 5DHQA 3NVKI 2VH2A 3CEAA 1NU6A 3GEIA 3LBFA 5FKJA 2H48A 3PFFA 4MQMA 4MWGA 2QNIA 3J81A 3OTIA 4B45A 4X7PA 3AVTA 1YDFA 4BJ1A 5D86A 3ONDA 2QAGA 3DZFA 2PRYA 3FOWA 5IANA 3DO6A 1ZNYA 4LY9A 3BB3A 2I1QA 4B3DA 2GTHA 1SU4A 5KOIA 5LKRA 1Y6QA 1W4AA 4X62B 1SMKA 2QRUA 4OXNA 5ED0A 2CDRA 5DYGA 5EKDA 3AHJA 5LC1A 4AS2A 4D7AA 3UT0A 1QZXA 1UXGA 1Z5GA 2C8JA 2P3OA 4IPTA 4Q9JA 3SVLA 4NJOA 3WLOA 1IUNA 2Q3DA 2W98A 3IEUA 5SZKB 3HV2A 3QHQA 8ADHA 4QFBA 1UBTS 4WNCA 5TDHA 2IEBA 3W1WA 4B7AA 3T3DA 4MW0A 3BD8A 1MW8X 2YS7A 4OQPA 1P91A 1FEZA 5EMNA 4FYMA 3RS3A 3ZY3A 4ACAA 5I3CA 1PT6A 1JZQA 2EBWA 4IUBS 5F33A 3WYAA 1TFUA 5JARA 4D96A 1SELA 4KQHA 2ZTLA 5M34A 1TIKA 1SOAA 5BW5A 4WN3A 3FZQA 2JGIA 2GNPA 2OO5A 1REQA 3ZWXA 3QWBA 3CRVA 1ISHA 1OC4A 3HXMA 2JLQA 2VQFB 1Y6FA 1VI6A 1TA9A 2OFXA 4M1MA 2XRMA 4RSGA 3CUKA 5JY1A 1E79A 1LBTA 2AXPA 3QUBA 3QU2A 4URHA 3VTAA 5AJWA 1Y8CA 1I0LA 3HS3A 4Z9YA 5I45A 2NZ8A 4Y2XA 1P2SA 1QF9A 1K27A 1KMCA 1QONA 1RI2A 1E3EA 4RJIA 3VHXB 5BR8B 2UKDA 2PZBA 5C1DA 3CVXA 2C4HA 2HSWA 3KAKA 3QKSB 5SZHB 3P26A 3B7WA 4Z0TA 1VPVA 4HXEB 1LLDA 1EFPA 2YJNA 4DBLC 2GZSA 4KR7A 1N3BA 1T3LA 1SVWA 4GXNA 5D85A 3EXFB 1LJ8A 1KYWA 3TLBA 4Q7LA 1H22A 3PHIA 3W8NA 1Q12A 5U1PA 3RNOA 4YRGA 2ERYA 4FFPA 2CHVA 4UNQA 4X8OA 3WLRA 1VSUA 5EXDA 1X3SA 1KAMA 4G65A 5CM8B 4D3DA 2VYCA 2R97A 3M1YA 3IQGX 1K8QA 3BB4A 4M22A 4RV4A 2ZXUA 1HDCA 4IH1A 4MS4B 4JI1B 4DEYA 5HF5A 1TZBA 2OZPA 1NMQA 2JGDA 3DEFA 2Z4SA 3L1VA 2XCSB 1HT1E 1R6VA 3AG5A 4R41A 4YAFA 4MKXA 3RWMB 3UW1A 2W83A 1XOIA 3CXUA 1I2ZA 3AKEA 3AOEA 3T4PA 5A5DA 2VJOA 2X14A 1CUSA 3B1XA 3U44B 1MOPA 2WYWA 4P4TA 3KOOA 2NZWA 3RS0A 2UUCB 1SWWA 1XV5A 4PC1A 4ZU1X 3H9UA 4HAIA 1X87A 4NV1A 3QE9Y 5KIAA 4PBRA 2GAFA 4JMLA 3IAAA 2XV1A 3LT4A 3CR3C 5HKOA 5KVVA 1FE8A 3C3PA 4FOSA 4NICA 1XBTA 3ITKA 4UEQA 1OJLA 3DTNA 4TZTA 5T6BA 1JVNA 3SQXA 2ZRDA 1VSBA 1YHNA 5DVZA 4K0RA 4HY3A 4RS3A 3RT1A 1L7VC 4CJXA 5I47A 1BNCA 1RACA 3UUEA 5IH7A 3RTGA 3CN7A 1C30A 1NF8A 1OY1A 2I7CA 4TMFA 1X1QA 3DULA 2J9YB 3RIHA 3MJ4A 1GEGA 1FLDA 3IMCA 2WOOA 1A2KC 1VZ3A 1QBGA 1WXQA 4NULA 4JL6A 4EZBA 4DLWA 5KWJA 4KO8A 4J2HA 4YLYA 5AXAA 2CF6A 3NM5A 3GEDA 5A2QA 3SZLA 1ENYA 4JOCA 1F4PA 1XDZA 3A36A 3CEPB 3DEIA 1J42A 4U2EA 5AM1A 2SECE 3VNBA 4EDHA 2VP2A 2O8BA 4CMBA 2RMKA 1Z12A 4QQKA 1KOJA 1AO0A 1WMFA 5ALOA 3KPWA 3EIXA 4RZIA 4RLHA 2ZT7A 1F12A 3CSDA 2D2IA 4ZQIA 2Q27A 4V1CA 4EX6A 2G17A 4N1AA 4YXWD 1JA0A 1VHLA 1M2JA 2O2YA 3EXIB 3PU6A 4IINA 3RC7A 5BPHA 2AYZA 1EH5A 1IXKA 4UU0A 3RV3A 2UUPA 3KXDA 5CJPA 2KB0A 1BXRA 4JGBA 3PD1A 4BQNA 3OE7A 2A3RA 5JC1A 5FADA 3UTDA 5ELXA 3DDZX 4CLEA 3LZCA 5IWAB 3ICWA 5FA5A 5ADVA 1X14A 1QK3A 1EG2A 2J5RA 2QRZA 4RORA 4S1OA 1FP4A 3KT6A 4QXRA 3ZXXA 1FLAA 1KEPA 2VDVE 3ILXA 1JYEA 1SBTA 1FB5A 4NBVA 4B5KA 2FSGA 4A6EA 4CM1A 2G9UA 1SOWA 3EGIA 3TD2A 5A4DA 6GPBA 4JEHA 2HJ9A 1B8VA 3G6KA 1RXEA 1FFWA 2GS9A 4MVJI 4HNVA 3ZVLA 5J2TF 3S8MA 3H04A 1QOQB 1NRWA 5E7IA 3WR5A 1O9GA 3L1KA 2HC9A 4IO0A 3O4VA 4D46A 2R8ZA 5HKAA 2JBHA 3WK8A 4PN7A 4MPJA 3LXUX 3P71T 4MWBA 4H1UA 4LF6B 2O8EA 2LRHA 5L45A 3W4IA 1KFBB 2GKGA 1DE0A 1C1YA 1V5FA 5LQAA 4DV0B 2QVYX 4ICIA 2D0PB 3REOA 3ZX4A 4E4RA 1FX0B 3EEFA 4A16A 4NZOA 4Q3LA 3VDMA 4HUJA 2FLKA 4F9FA 3BHNA 1ZL0A 5JNSA 3IVGA 3N6RA 3X1ZA 2ZUFA 1Z18A 3S2FA 3NONA 5EJIA 3ZXYA 4DGSA 2FFAA 5I7OA 4PXAA 3AINA 1ECPA 2IH4A 1Q17A 2X4GA 2ZIZA 3D3QA 3OOSA 3QXSA 4YT5A 1IOVA 3WB2A 2H1VA 2L19A 3O94A 3GEGA 4J16A 2AN5A 2YWXA 1EFVA 4RBNA 5FYQA 2HMVA 4WBNB 1E6UA 1PL7A 5ER6A 4EB3A 1VM6A 3FOFC 1VHTA 2Z1DA 1JV2B 1U80A 2ABWA 2C97A 1FUIA 2JGKA 4JVSB 3OKAA 5K0TA 4I46A 3HB1A 4PO1A 4ENPA 2HWUA 3QVVA 1L7PA 1KIMA 4TMYA 1LVHA 3B1FA 1U5CA 3GJ8A 4WLVA 3U1TA 2EERA 1INLA 4BFYA 4DLKA 3ANSA 2Q3CA 3GRVA 4IVPA 3WNVA 2X9LA 5TQ0A 5KQGA 1U3UA 3G0OA 4PO3X 3AC0A 5IBQA 2EF1A 4Q3AA 3SX2A 4LPSA 5KOJA 5LP6A 1L4YA 4TTQA 5CBPB 3DTYA 4FCVA 1G8JA 1DJMA 2B83A 5CA0A 5KYUB 2D00A 3LYAA 1AUOA 221PA 3B3GA 1T1JA 4PLFA 2ZWMA 4LXXA 1WCXA 2DHQA 3FUVA 5EXXA 1CJMA 4X64B 4BNYA 1YZYA 1SOUA 5FUBA 3TQHA 3VPSA 4DV7B 3F2IA 1YOVA 1OFUX 2PXXA 4P34A 1ODIA 5AUPB 4D9EA 4DIEA 1LW6E 2FSUA 1JFVA 1HNNA 3M5CA 1XAJA 2XDWA 2N1BA 4D6YA 1CF4A 4IWYA 2BT4A 5BRNA 3T38A 1UINA 4ZYLA 3PR2B 2O19A 4GIBA 2WWGA 4KTVE 1U0HC 2WWFA 2WTUA 1CFJA 4DMUB 4I7EA 3FNIA 1A4IA 2B6NA 2J3MA 2ZUUA 4KUHA 2AXEA 3OEHD 4LOHA 4WESA 2FZ5A 3ROZA 4RWZA 1DCMA 2V97A 4C4OA 3VR0A 1KSFX 2YZ2A 2XMQA 3QWHA 3NALA 1XEWY 4MW7A 1IOWA 4N54A 2TECE 4CGYA 3IT3A 2FWMX 1EXDA 4GXTA 3AFMA 3OWOA 5BNIA 1BROA 1PR0A 3B8EA 2ACKA 4JYAB 4I1OA 1G2IA 3PFGA 4NBNA 4EUHA 3MG9A 4DCCA 4RY2A 4QTYA 4ZTUB 3O8LA 3ZD9A 3H9GA 4L8VA 2IUTA 1XNGA 2JGEA 4MI1A 5FBWB 4EM6A 2YN2A 4ZO9A 3R5TA 1YFKA 1UBMS 4HNAB 1TVCA 3HYSA 3W3AA 4RMNA 5FNVF 4KNVA 5H8WA 3WK9A 2J46A 3RJ9A 2BMAA 2Q2WA 2H31A 3KJQA 3FFAA 4QIHA 1A1SA 3BQNB 1W4ZA 5DP1A 3TGWA 3HL4A 3BWMA 3KLBA 4ZARA 4RA9B 2YDXA 4HBGA 2HPAA 4C4YA 1HZZA 1M7HA 3ZDRA 3LWBA 4RHEA 4WMLA 4BBPA 1NJ8A 1BKYA 3O7WA 4Q6BA 3NYWA 3K73O 3PE3A 3KZXA 1NC1A 4E22A 2HLHA 1PZXA 5KYVA 1T8TA 3CNQS 3SQOA 1DT3A 4NECA 3CLRC 5DULA 1DZIA 3LK7A 1EGHA 3F8TA 1T5SA 2DPHA 4MR9A 1YQTA 5FULA 1DKPA 2ES4A 4JI5B 5DN6D 4D4LA 4R84A 4KL8S 3PNSA 1MV5A 4X3OA 3KAPA 5F5NA 1XA0A 4GKKB 1XXLA 3M6LA 4OIMA 3WO0A 4TWJA 5JAIA 4H6WA 3VU9B 3I8OA 2EBUA 1XMQB 3G88A 4FNMA 5CDSA 2QLFA 4G5GA 4YQYA 4ZGBA 1IUOA 2QR3A 3WYGA 4HVCA 3C3YA 1O6GA 2Q3HA 4ZCPA 2B1GA 3KQUA 4P98A 4MUXA 5AVSA 2C3MA 2X58A 2JIOA 3CUWA 3RSGA 3VR5D 2ZIAA 1QPGA 3ECCA 4QUDA 3RVJA 4XWOA 1IFXA 1N6RA 1XIVA 4G25A 1HQYE 2R6GA 4RGYA 4RD4A 1MQ9A 3ZHVA 3KT0A 2IW1A 1HE5A 4FU0A 4D4JA 2AMYA 4HUQB 5AIAA 1HX7A 2EX0A 4ESVA 3TRIA 4JELA 3M4ZA 2H2AA 1N6IA 3KEMA 1LPSA 3HVUA 4J3NA 1CDDA 2B0CA 2FCAA 4EG5A 1FQKA 3E3MA 1IJBA 5SV2A 5JC8A 5DHPA 4HQRA 5A3JA 4KQ1A 5EPUA 3L1HA 3CRNA 4P0QB 2JHPA 2VDLB 5B7NA 2VOJA 5KYTA 5JAOA 3Q0EA 3NYRA 1ZBQA 1CJTC 3L82B 3SKYA 3S3TA 1U8EA 4NXNB 3B5IA 3ABSB 2GZAA 2WWXA 3QEMB 4EPYA 1YSCA 1Z4PX 1A9ZA 1G18A 5FWAA 4CMCA 1H1TA 1UBGA 4JLBA 3R7LA 3D6VA 1D0VA 3KQQA 3QYFA 3AEKB 1DKUA 4P58A 2OGUA 3TE7A 4Q1AA 4CL8A 1LI5A 2WHPA 3C5VA 3B3AA 3R0JA 2NVBA 4YFYA 1T24A 1KPIA 1UZLA 4ONEA 4E32A 1P5ZB 4G4IA 2XUGA 3TJRA 3VR6H 1ZMRA 1V8BA 2EF0A 2QB5A 4O4LB 2FR1A 1UM8A 1ULZA 4AFNA 3QK7A 5A3VA 4DQDA 5DI3A 3MIIA 5IU6A 1SWVA 4KBYA 2YS6A 2PGAA 3CPEA 4AS3A 5EKTA 4ZVLA 5H4GA 2PKQP 4MIEA 4U00A 4Y7CA 3Q7QA 5K8JB 1G98A 2IYAA 2PNFA 3O21A 3AKCA 1U2EA 1XPOA 2QQEA 6AT1A 5IXSA 4BP3A 3HDTA 3M83A 3DUFB 1B6TA 4ZTZB 1SVKA 2C0CA 2QTNA 1ANKA 2F3UA 3OZCA 3RM3A 3C45A 4DBVO 3QMMA 1ZN2A 4LFCB 3WG9A 1Z4MA 2XRFA 4M9ZA 3G68A 3HDYA 3ZOZA 6NULA 4HQFA 3T3PB 1F2TA 1JKMA 1SRQA 1EK6A 2BH9A 4OGFA 2QBYB 1L7EA 4AW9A 4OBWA 4BWFB 1ZIYA 3LO5A 3T3EA 5JANA 3ISVA 5ALZA 4Y9DA 5LU9A 3IRVA 5LXTA 4KR3A 5LJLA 2IIQA 3EGVA 1TQHA 3M9XA 5AKLA 2ZKLA 3A4NA 3EF0A 4MEJA 2YHUA 4ASUD 5JV5A 1CZUA 3L7KA 4JP8A 2G6TA 2QL5A 3QNUA 2ZVJA 3TS1A 4B40A 2ZATA 4ABYA 2ZU0C 2CFSA 2Q29A 3LQ1A 3D2CA 1QZ3A 3AR9A 5TEVA 4B76A 4YBZA 3LLSA 4HV4A 3B5JA 3GG2A 3QXHA 4Y30A 2P4HX 3IBFA 5GGXA 4QD3A 3V4OA 1KEUA 1VP3A 2OHOA 2WJ6A 3AF2A 5CK5A 2F8TA 3I9LA 1ZIOA 1UPAA 4Q1EA 3AG6A 3QYJA 1Y3CE 4F2HA 3COVA 4PZEA 4FMCF 5AVRA 1YNSA 1POWA 5DHAA 5EIEA 2UYCA 1ODJA 1PVVA 1PGNA 3FGNA 2TMYA 3A9TA 4AMYA 3WSWA 4BC1A 1IATA 2FSIA 4RPLA 4QDTA 3U2QA 3HN7A 4ZRNA 5BN5A 2A94A 3U7QA 2FI1A 1LPMA 1TW2A 3WLSA 4DUYB 3LSYA 3ZVRA 3DNMA 3HNOA 4GXRA 4R51A 4DB2A 3C5WP 4P7FA 4PFKA 4TQAA 3L0YA 5JS2A 4CL2A 3TTTA 4UHCA 2XIQA 4MW6A 2DFPA 3HO6A 1X86B 3PXDA 1RHJA 2SCUB 4IWXA 4PZLA 2WJAA 2VAXA 1B1CA 4UDYX 2D5BA 3TLGB 1Q7RA 3A1DA 4ARSA 3MELA 2WG0A 4U2KA 1XTBA 1LPBB 4GPTA 4MNTA 1Y7TA 3SQMA 5BOSA 3I04M 3EPKA 4OP1A 1E2GA 1Z0UA 3O8DA 3H4IA 5LL6P 2BD0A 2QL7A 2R44A 2JGNA 3MF4A 4HRYA 2W43A 3H16A 2G09A 3EVZA 3Q41A 4JJAA 5CURA 2PL3A 3I1FA 2ZULA 3NDPA 1XMVA 1RM4A 3FAZA 1W19A 3BMCA 1JHAA 3DOIA 5JCPA 3FFWA 2Q1WA 3BFXA 1RLIA 3JQ6A 4ANFA 2X5NA 3B6JA 3JTEA 2HXSA 5A7GA 2FWPA 2IYTA 3KYCA 1F1BA 3GD5A 1OMOA 3RI3A 5A04A 5BWMA 1N77A 3SR0A 2K5UA 2QTVB 3C5EA 2MSEB 4W5WA 4BNJA 5IT4A 1G3UA 1KC1A 3KR9A 4M7RA 1U65A 1T2AA 1JEJA 2VYVD 2ZJZA 2K2WA 5IEJA 1J0BA 1I9CA 2Y68A 4QPNA 4P7JA 3F47A 1S6YA 1C9DB 1NVWQ 1Z6PA 2BTQA 1CWUA 3DW1X 3K6JA 5F35A 3X1KA 3ZU5A 4E5YA 1L4FA 3SVTA 1G8MA 4JIGA 3TKAA 1YJAA 1G8AA 2OZKA 3RK4A 3WLIA 4G84A 3HJFA 1ONNA 2J9GA 3TE6A 3VUFA 2YYAA 5EUQB 3CN9A 2QPTA 4P9NA 5JMWA 1SIWA 1HE4A 2PA0A 3DMYA 4WASA 5DCUA 1WXDA 3CZMA 5J43A 3AU8A 1FRFS 1DC5A 3RYFA 4EJ6A 2AE1A 2BPOA 3CKKA 3JVEA 3NU1A 5TARA 5CVTA 2ZB8A 1JXOA 3WMFA 2HDNB 1C1XB 2DH5A 4FYJA 1NOJA 3PXEA 3F8SA 1B16A 3H11A 5KWVA 3PCXA 1RC8A 1NQWA 4FJ2A 3VPAA 2AJLI 1ADFA 3EVDA 2GYYA 3EZNA 4DLRA 1P4GA 1A77A 1PLLA 5FEUA 3VGJA 3A1FA 3ESAA 3NYQA 2RD2A 1RZRA 3IOBA 1J2YA 3TD6A 1IE3A 1NXWA 2XF2A 3TLMA 3UK6A 2O59A 3NBYC 2LDBA 3OMXA 4BEBA 3CSSA 1DCFA 2MYPA 1H66A 2UZ0A 1VCOA 1ACLA 2UVPB 4FLEA 4OI2A 4ZP1A 5JAPA 4NV0A 3AFNA 3M2TA 5LR6A 3V4RA 2ZYTX 3M6WA 2IQ5A 4PO8A 4EY5A 3JQ8B 5EZYA 3AVQA 4FSXA 4OKNA 3VDRA 3VSBA 4CEJB 4DIFA 5B3LA 4OH7A 4B17A 2JFFA 2RKBA 1NFRA 1CC1S 3EF1A 1S2LA 1Q0RA 2BCJQ 2Z30A 3PB3A 2GESA 1CQZA 4GMHA 4ITRC 2FLVA 3UOWA 4R05A 5IJ9A 4QOGA 2JFZA 3I04A 4YONB 4ZODA 2OXEA 4I1YA 4RABA 3RAEC 4NPAA 2FDXA 2JA1A 2JH8A 1NY6A 1GZ6A 1QUEA 1JPJA 1VPEA 2LVBA 5BQOA 2R25B 1PNRA 1G6HA 2RGEA 1N0VC 4LRYA 3L7BA 1VIDA 4HWTA 4URUR 4WFJA 4XVHA 5A9SB 1T6XA 2VBGA 3TD9A 5BW8A 1JJFA 2WDZA 2XWJI 4RLQA 4RJTA 1FJXA 3RUAA 5K2OA 3M2PA 4L78A 1KETA 1DXYA 4NARA 1GA4A 5C80A 2OGSA 1MV8A 1EZZA 1Q0PA 3H7IA 1SZCA 2ZRBA 2L42A 1PZEA 3N9IA 4JYPA 4OU4A 4MGKR 3HG7A 4JN6B 4H60A 2FJPA 4ND8A 1UJ2A 2HA7A 3IB6A 1DZ3A 3N3BC 1FX1A 3BN3A 1ZGBA 1C8LA 3WKBA 3LUCA 5FA6A 4CLHA 4YCSA 3OJFA 5HRAA 4IR7A 3TNLA 1EG7A 2JDIA 4AQYB 5SYMA 3VNAA 4B74A 3GYGA 1AQJA 5BQXA 1ZFNA 2Z6AA 1NQVA 2G8LA 2P7HA 3I1IA 1Y4SA 4IGFA 2FP4B 4OBXA 4PC7A 4YREA 3JCZA 4RW0A 3EVNA 3WIVA 3W7AA 3D8NA 1JTVA 4LMPA 3HK2A 3DF7A 4YT2A 1U1EA 3E8SA 3JYQA 1KWKA 2C99A 4LJYA 5G53C 5DNWA 5CDFE 5IT5A 4A6XA 1GKYA 5AICA 5A6VA 4O08A 2BEVB 2PUVA 4KXNA 1P7YA 4EW3A 2BV3A 4EG6A 2EFHB 3ZOKA 4KRFA 2II6A 3LK6A 1HFKA 4QHYA 4YJFB 5EFZA 3UV6A 5FAXA 1A9YA 1X80B 1Z2OX 2DBYA 3GIWA 4CIXA 1KK0A 4XRGA 3NANA 5COAA 1TKAA 2ZE7A 1X13A 1FFHA 5DX1A 1ICIA 3VOAA 1NPYA 1CEXA 3QPCA 1NKSA 3V4VB 3MRVA 4X1IB 1BOOA 1V9CA 3CCBA 4A36A 4X66B 3DE0X 1RXWA 3F9IA 4M98A 1EDBA 3AM4A 4GI5A 3ZY5A 1TLLA 2C5AA 1Q57A 5DM60 3PR1A 1ZAYA 2UYHA 4RHYA 3RSZA 4K81B 1ODLA 2FX5A 3CUYA 3KE9A 3BWBA 5ELMA 2QR5A 4JCCA 2I62A 3R23A 3U60B 2GPYA 3NBZC 1NLUA 3GK3A 4O8ZA 4D8WA 4AURA 3LG2A 3DAHA 4EPXA 4X63A 3TQSA 1ZSYA 3M5DA 3PQFA 3TZ6A 4IXMA 4LZOA 5DNYB 1J07A 3TPFA 1BYIA 1SXQA 2CWWA 4MRMA 3E2IA 4G01B 3A31A 1CZOA 2OBFA 3IEIA 3BTVA 2QM7A 3C6XA 4HGYA 4EARA 1WMDA 1RYDA 4FWTA 1R15A 4TMKA 1OH6A 4AI6A 3N0VA 1YO6A 1E1KA 2PUJA 3AM5A 1N2BA 5DTJA 2VZEA 2J41A 4BQQA 5EJ5A 2MMGA 4CMKA 2HRZA 3GUVA 2J6BA 2ZB2A 2H17A 1BMTA 1TNDA 1RAGA 4RHCA 2FRDA 3B6ZA 3EA0A 4Q66C 3WWPA 1T0PA 3MJCA 3LVFO 2CUTA 2EL9A 4QT0A 3V4LA 5JJLA 5KHLB 2XNDD 2XMDA 3L6RA 5IJ0A 1JQAA 4NU6A 5I7WA 4P81A 2QE7D 4UOQA 1H8HA 3KZKA 2B82A 4MGZR 1I4WA 5B6JA 1YR2A 5ITVA 2BR5A 1RP1A 3JZAA 4M9RA 5B6IA 4R9SA 1RRVA 5CVVA 3E0XA 1HDGO 1SXJA 1PG0A 2Y4NA 2ZPAA 4JHLA 3T8YA 4D9NA 4AMZA 4YP7A 1ZN8A 1J8YF 4PYRA 1E96A 1M2VA 2OV3A 2JGMA 3KG2A 5FPYA 4BO6A 5I7HA 3Q40A 9ABPA 4DDKA 5FUMA 1E3IA 2A59A 5EP1A 3VPFA 2XF8A 2P0YA 5JCOA 2YZKA 2CXSA 5IT9A 2W6ID 1ZNWA 1AKVA 1TB4A 2CC2A 1J23A 3DBHA 3FSRA 4UUPA 5DASA 3JAKA 3F71A 4ADSG 4BV9A 3O1IC 4B85A 3NHMA 2XBMA 3ZNQA 2OV4A 3H87A 3W2HA 3RQIA 2PU7A 4P0PB 3DVQX 4FMDF 3GGGA 4MA4A 1GIAA 5JAMA 1XLUA 2JFBA 3GLHB 3WMWA 1QP4A 1WZUA 2QRVB 3U19A 4G07A 5EG5A 3SDZA 3GEPA 2VH5R 5J4VA 4U7DA 3B5EA 4RESA 2AMFA 3FDZB 4R98A 4WK4B 1XZJA 4YP0A 2ZRIA 1JYSA 1P7PA 3AV0B 4PFQA 4RF5A 3WY9A 4CTNA 3WWOA 3PNMA 4CN9A 1Y8AA 2IXTA 3K6RA 1QGED 5HIMA 3EOAI 4GZ3A 2ZAIA 5F9HA 4FT4A 4GVPA 1QS0B 2PWYA 1ZMXA 4ZJYA 3ZYZA 3TNDA 2O1SA 4CZ2A 5JTUA 1RHMA 1E69A 3TXAA 1RYNA 4UZFA 2EAUA 1G8FA 2JRLA 2PPVA 2O2IA 3PEEA 4XEHA 5F7ZA 3BH7A 1V39A 2BHNA 2QJWA 1ID1A 3FD8A 3R09A 1NYTA 3TECE 3BVPA 3I6ZA 2F64A 2H4ZA 2H3EA 4MICA 4EEZA 2OSBA 1XTZA 2YVKA 3ZLVA 1CB0A 1NMSA 3NPMA 2I34A 3TM5A 4BO2A 4MB6A 4XD2A 1ZR2A 2ZYRA 2YWCA 5GZ3A 4RD6A 1QNLA 2J6IA 3PP8A 2PRZA 4NE9A 3VR4D 4F7WA 1AKNA 1GAXA 2VTDA 2DY0A 1MG5A 2WUDA 3DEZA 4PRLA 3WDMA 1J8QA 2HHHB 1EINA 4PZYA 5BMOA 2J9FB 1T3ZA 1OE0A 1SC6A 2C3UA 3VHRA 5IYZA 3IL2A 2F4VB 1DUSA 4ESOA 4N01A 3FGZA 2PHZA 2ET6A 3I2KA 4RF3A 4DG9A 1PR3A 4ETIA 3PXUA 3LCRA 1T2VA 2BGJA 1FP6A 1QRRA 3WL8A 2QN6A 2QLNA 3CZRA 3PDCA 4AJNA 2PBRA 3LLVA 5I7SA 3FWHA 2AD5A 2LWIA 5JJBA 5KSPA 2VTBA 1UXJA 1XFDA 1YJXA 2XCIA 4HH3C 5HQ3A 4QYTA 5T4BA 4FT2A 2YWFA 5EEGA 1LF5A 1D7AA 2YOGA 1AKMA 3R0XA 3DHNA 5IPFA 1JA1A 5IAOA 1XP5A 4X7MA 2YQ4A 2CVZA 1C3OB 4JZYA 1US8A 3DLPX 3IQIX 3JR7A 1GUFA 1PJ2A 5DO9A 1NXQA 1CQWA 3RNLA 4A26A 1Y1PA 1WZ2A 1SVNA 2NNWB 3TIIA 2AE2A 5LA6A 4BZQA 2JIZD 1G1AA 3K70C 5DP2A 4ZAZA 1Z13A 4RTJA 4AJEA 1JPNA 2V58A 5DRYA 5DB4A 2XYHA 4N0MA 5CYPA 1JFSA 3SKVA 2ETVA 4ZALA 4EEKA 2Z04A 3NPAA 4ENRA 3ZJ5A 1WRBA 2DHEA 3GFFA 4NCIA 2CLDX 3X1WA 2EBFX 2OY0A 4RPGA 4OLAA 1JEEA 2WOJA 3HRHA 3NTLA 3USES 3QKRA 3HSYA 3CE9A 3E03A 3LWDA 1QF6A 1ZA2A 2A4MA 1TMKA 3MJFA 4Y9TA 3WQBA 3OJCA 4E31A 4CKEB 3U6KA 1HYBA 1QIJA 2IS1A 3H5WA 3EZ9A 5JVDB 3G7SA 1MOSA 3PJDA 4AIRA 1UMBA 2PLNA 5CXSA 2PRJA 3Q7TA 4HQKA 2L0XA 4OA5A 5LP6F 4KXWA 4ZVSA 2CHEA 3ROEA 4DCTA 5KC9A 1XK6A 4E1AA 4CR8A 5CA0F 2IEGA 5ESRA 3BIJA 2Y6UA 5KDLA 1ODKA 3WLAA 5BW4A 4M9CA 1M34E 1N6LA 4DLYA 3KP1A 2V3CC 2P1DA 4KJZA 1DMSA 4DY6A 3INTA 3W79A 4CFZA 1NNI1 2M9MA 3VA7A 3WVNA 1E7YA 3OURA 4B3XA 4YYZA 3FZEA 5EL0A 1LQUA 2AFIB 3HWRA 4JLKA 4AKEA 1ISSA 4ZAXA 5JI2E 1NU8A 4X6XA 2GBGA 5BMVB 4RQAA 2VXBA 2GBLC 3HVRA 3O3NB 1OV4A 1Z47A 4IXTA 3ZJVA 3PGA1 3U39A 1AZTA 1OLSA 4H7EA 4AXXA 2EG9A 1TTQB 2NUBA 4CKZA 3EGDB 4EVRA 3ZWVA 1SU7A 2VHTA 4YMSA 4LXHA 5KX5A 4CQNA 5TGTA 2YTZA 3PITA 4LWQA 3ZTWA 1IBRA 1TLFA 1PQPA 3B7PA 2O0LA 3EK2A 1JHXA 3AP3A 2R7NA 4LVNA 2XUDA 5ALRA 2PX0A 3F7TA 1WB4A 4EZEA 4CIAA 3ULKA 1IBSA 1WDKA 1YU6A 2PIAA 2PGOA 1NF2A 1G6OA 3NOQA 3O73A 5G0TA 2ARKA 3LVBA 1K2VN 4GRDA 1P0IA 2DBZA 3ITDA 2GZ3A 3WB9A 4UNSA 1ULAA 4LDAA 1XLTA 3MWLA 4KIFA 5AI6A 4C03A 3EVFA 3E3AA 4EEXA 1JBQA 4H3HB 1RJ9B 3RS5A 2BCEA 2KBFA 1J5PA 4BTLA 3AUSA 2BGLA 3JVVA 1U3WA 1XTIA 1ZJJA 4X7RA 1G21E 2BGIA 5YASA 3C2QA 4BWGA 5BR7A 4XUDA 4URXR 4PQFA 1PL0A 2B30A 3GLSA 3H84A 1Q7CA 1E3WB 5AJYA 3UWKA 4TPKA 1NBOA 4EABA 5J5VA 1CUCA 1LBIA 3VTZA 5F77A 3QVGA 1BVUA 1PO7A 3DTVA 3ZY4A 2HPHA 4BNWA 5KDOA 2IZ0A 3G9TA 4YALA 1RPTA 3RYCB 1ZK4A 4DQKA 1RPZA 3F5DA 3KU4A 1E66A 3OFKA 5L9AA 3S5UA 4A27A 2A78A 4CQMB 1XF1A 3FWZA 4Q21A 4QYIB 1M1XB 1QIEA 1D6SA 3PIRA 4KI0A 3D59A 2PTHA 3C3XA 2BHLA 4DJ5X 3STTA 1FUKA 4ROTA 4UEWA 5B57C 3LOQA 4MUHA 3UANA 2Q9AA 1U02A 4ZVRA 2V5VA 2C82A 3P0JA 3SD7A 4H1WA 1I10A 1J2RA 1RIIA 1IY0A 1ZH6A 3EEQA 1F2UA 3EDQA 3AWDA 4BYMA 2PXCA 3YASA 4YJ3B 1C9KA 3OPVA 1EESA 1SU6A 5ALHA 1WUKS 1MXFA 1Q6YA 3AB7A 2F7SA 3G8DA 2XA2A 3GJTA 4MDHA 4UEJA 1KWGA 5A3SA 3AVYA 2YHSA 2H2DA 1IN6A 2RONA 3A27A 3IHTA 3HP7A 4K1XA 1K6EA 4ZT4A 5TLSA 2OP0A 1JKFA 4DJEC 2E37A 1GTVA 5CVUA 3S6JA 1MNQA 3KVRA 4X8LA 5L4NA 4YK7A 4BVHA 1P7VA 3FWYA 3WYFA 4KPUB 3N07A 2ZAOA 4J8PA 5C32A 4OX9Y 1CT9A 2ZI6A 4QTTB 3FOCA 4Q48A 4Q34A 3HYLA 3S5JA 5B2FA 2RG7A 2JCGA 4Q4JA 3OCYA 4H77A 2VSYA 5F2OA 1VLZA 5DLEA 3F6CA 2OV8A 4CV3A 3L49A 2C7RA 3AUFA 1CS4C 2XHEA 1R6BX 1MPXA 2JFQA 3KKKA 4HZIA 5AUNB 3A1NA 1Q0HA 1CY8A 2GHTA 1OWNA 2JJ2A 4TMZA 2XZOA 4ZOLA 4BFLA 3D2AA 4FHEA 1IXRC 3FNQA 4HDNA 1G3MA 3QA3E 4O4HF 1EJ6A 2QVCA 3QVKA 1TM1E 4DLUA 4GI3A 3DAFA 2MCFA 3IUNA 3HABA 4Q4LA 4B2LA 2WBLC 4TKLA 1VE1A 2BN4A 1K89A 1C50A 2JJQA 4HTFB 4F5EA 5JXHA 4X93A 1ZD4A 4M1OA 2P67A 1WB9A 2E85A 3GT7A 2YC4C 3C41J 3C70A 3Q7SA 4KDCA 4U7JA 4BGUA 4D9MA 3MT7A 5EVJA 3LAWA 2H1IA 5FTMA 3PPWA 1CF9A 4I1UA 1PD1A 2WHXA 5EE5B 4C06A 3AP1A 2W9XA 5C9ZA 1NGSA 3KJIA 4O8CA 5ERYA 3RSLA 1DQRA 1KAQA 5DSXA 4AJHA 4NZPA 4DKXA 1P77A 1PR4A 1QK5A 5CJ2A 3ILSA 1RRMA 4FI3F 1QV7A 1UBHS 4C7OA 3D02A 2Q3MA 1R64A 1GRRA 1ACMA 1OWMA 1GTMA 4H4EA 1N33B 4EY6A 2WRZA 1QE3A 2DP4E 4ZXFA 3NDBB 1YJQA 3AY3A 1LDNA 3D6FA 1R0KA 1LWOA 5AKZA 3VOSA 4AAYA 1KI8A 4H1VA 4OQEA 3PDIB 4U63A 1RYHA 3C4JA 3RAGA 4OHCA 3TLYA 3H5VA 3KVVA 4HAVA 1AVTA 4ZCRA 5E8JA 3Q6IA 4MRNA 1IMOA 5F1YA 1BX1A 1VPTA 1CZLA 5ENZA 5LXTF 5K6AA 1UAYA 3Q2KA 4CM9D 3BGDA 2VPQA 5J23A 2P9ZA 5EPEA 4FCCA 1ZJYA 1E8DA 1K1EA 2OPBA 4ZOBA 3ONWA 1UJBA 3JD2A 2A5FA 1EGMB 2XBUA 1WR8A 3QU4A 4M8SA 3UJHA 1K66A 3N8HA 1A98A 1EAMA 4EYSA 1NN5A 1QHGA 3LHSA 3DB1A 3FR8A 3V8RA 4HL6A 2QN1A 3ZKWA 2DHRA 4Y7DA 4G4JA 2VTEA 3FR7A 4TL8A 2CXXA 2JIBA 5JJCA 1ZGZA 3CVOA 2B5VA 3I9MA 4NS1A 4RL4A 5DTEA 3DDCA 3W7BA 4YJ2A 4HEA6 4M8LA 5A4KA 4WX2B 4EUFA 2BFDA 4UVGA 3UMJA 3WBKA 4LDJA 1R6TA 1NFFA 1ZH0A 3NKVA 4ZU3A 1UBRS 2Y92A 4DR2B 2GF0A 4RPCA 4G56A 1HGXA 3BL5A 4FNAA 3CLSD 2O2XA 2FVXA 1O5OA 3PGJA 1M73E 3BAZA 4L22A 1CZKA 3H9JA 4NAVA 5DWDA 5F76A 2QRQA 3DDWA 4P5DA 4YGXB 3UGKA 4IDDA 5B12A 2ZIEA 3GRRA 5D3ZA 2V9ZA 1DTWA 4QFDA 3NUGA 3IUMA 4BMNA 1UM9A 4KE9A 4L9RA 1OTYA 4PG7A 4EGAA 2QPAA 1GLNA 1VKZA 5AJXA 3RH0A 3SS9X 1WY7A 5M7EA 3U16A 4F97A 3KSBC 3D2LA 3TX2A 3VPGA 2WQZA 4W7SA 1C4WA 3T3GA 2ERXA 3W9YA 3HXPA 2VO1A 4I36A 1GCOA 2E2WA 3HJUA 4WEQA 1AG9A 3WGYA 4B47A 3EQZA 3UPUA 3N2KA 3FLMA 1L1QA 3SHOA 3IJ5A 3ASZA 1DQSA 1NVBA 4KWIA 4QAQA 4BBJA 2HDWA 3RU2A 4MQUA 3W05A 2P6NA 4MDFA 1WB6A 4IJMA 4JP5A 4UARA 3VQTA 3MYRA 5BV2P 2JNWA 1O0CA 1Z73A 4EECA 2A5LA 3K1AB 3LVRE 3FN4A 4RKQA 3DG9A 1JLRA 1C8VB 5AJZA 1ZJ4A 1ITZA 1K7SN 1QLWA 3HCAA 1L5KA 1AGXA 5KCMA 4JEMA 4Q03A 1R4MA 1V1JA 3AV3A 1YQUA 3TKLA 4Z2AA 2W00A 2B25A 1Q3TA 2OESA 5A02A 2WVHA 3HCPA 1E3TA 3KRTA 2CVHA 4I5GA 1W5BA 2AFHE 4EAQA 4C30A 3JY6A 3CF4G 5GP1A 2OYRA 2FWJA 2RGAA 2NU7B 4DDHA 1TFRA 1YS1X 2HMYB 4WH0A 1WE2A 4M1QA 2R00C 1UWKA 2EP8A 2RFLA 121PA 3IAS6 2Z5VA 2ZSEA 2PIDA 3LL7A 3GIDA 5AHKA 4D92A 4CLRB 5BYKA 1KJWA 4L75A 1H9AA 5ALFA 1JAHA 2DFKB 1N1EA 3GGPA 2CDBA 3H5NA 1ZVVA 1KDYA 2PE5A 4KPYA 1TVKB 1SVIA 3T1NA 3KTAB 4IMRA 3VR2A 1Y1SA 2GASA 4EO7A 4GYYA 1WSBA 2EHJA 4N8EA 4DWWA 3AJRA 1YH3A 1C7EA 2YBEA 4PE5B 4O1MA 2GO1A 4EF4A 4HGRA 2H16A 4G24A 2IXGA 4HWGA 5JEEA 1BS2A 1L5SA 3P0EA 3H99A 1XCOA 3S1LA 4W5JA 1QGZA 2B1JA 5DDIP 2QUIA 1YBMA 3DP9A 3DCNA 2QQFA 4QRIA 3V48A 1JRLA 3RSSA 4MCJA 2PUDA 1XCGB 4IDCA 4KMMA 3DV0A 4YT4A 1SKQA 2FPMA 1M83A 2CNDA 2GM3A 4PWZA 3TOXA 1NUSA 5K8IA 2WEKA 4CHGA 2YVQA 4BJ6A 3HKEA 1RWWA 3I2FA 1SUDA 4UJ5A 3L4JA 4C2TA 5DTMA 4BPBA 2P8JA 2VJMA 2ATCA 1CVRA 2JGFA 2X7HA 1V1RA 3AVWA 2H1HA 2CL7X 3NTOA 3KFXA 4LGMA 4M9SA 4C5BA 2ZYIA 3FKSA 1V0JA 3HBLA 2G5TA 4PU0A 4V0SA 4X1OA 3SC3A 5P8WA 4FX5A 3CNEA 3ZV6A 4G0YA 4QOSA 3A2NA 5FBLB 5DSTA 4FIDA 1RXSA 2HR1A 2VRBA 5C52B 2CFRA 2RHDA 4OLBA 1D8AA 3EIOA 5BY2A 3OPYA 4DDMA 4Q1VA 2PFSA 3WOVA 1X19A 2B3DA 2FPGA 4JI6B 3VYWA 1RD4A 3M6XA 1I1NA 2JC3A 3E4CA 2PEZA 1XEWX 2Q9BA 3NWPA 3EHEA 4TUYA 5EFOA 3ZK8A 1E5QA 2MSKA 4BNTA 5J1SB 1NOKA 3ZDDA 1BN7A 2A14A 1UZNA 2F1HA 5AJTA 3BM5A 5A4IS 2JD2A 1JHYA 3AQ4A 5KINB 3ISTA 4GE0A 2HU5A 1PFUA 1E6KA 3K1JA 1QK4A 2ADFA 3S40A 3W6PA 2VDNB 1L5VA 3FFBA 2P0AA 3IBSA 2QD1A 2AUMA 5AVZA 4GKBA 5FHQA 5KSOA 5L7WA 4ZRMA 1FFAA 3P2EA 5G0VA 3URKA 2EQBA 5K45A 4UTVA 2E4WA 1U63A 2OILA 2FYTA 2WG1A 2H92A 5JROA 4K28A 4HPXB 2FE4A 2VDMB 1ZNQO 1PS9A 1IHUA 1SKAA 1DC6A 2D0OB 5CP8A 4C6RA 5A7FA 2X9NA 2WE8A 2GF9A 4BRSA 4D4MA 2D1RA 1FQJA 3HNRA 2WJZB 1VSTA 1U2PA 2ZRFA 4OB7A 1SA0B 4MYHA 1KAGA 1U3VA 1UKBA 5G3YA 4HYYA 4HDSB 2IOYA 3NDJA 4KRYA 4R31A 1IU9A 4UE3S 4N5HX 3V46A 1A8PA 4ZRDA 3K5HA 5BV0A 3K70B 2V1XA 3ZGXA 4YPOA 1T5LA 2SKDA 2WYVA 3HFRA 1HLGA 2Q2NA 1OZFA 3J7TA 5FUYA 5AI9A 4BJ3A 4MXDA 3QVWA 4E13A 3CW9A 4XVCA 1CUAA 3IMGA 4LSMA 3UB2A 1TEHA 1S2OA 5KAMA 1YB7A 3I6BA 1QFXA 3W34A 5EA2A 3GR6A 2AYYA 2C92A 3MS4A 3KIPA 1IHDA 3C6BA 3DLHA 1PYGA 4KK3A 1Y6JA 1RRKA 3NO4A 4KREA 3U7JA 3PI7A 4IOJA 1YDEA 1H85A 4AU1A 4PG5A 3FM9A 2P6OA 4DUZB 4RGBA 1KO7A 3NTVA 3QVMA 1XTVA 1GSHA 5HWSA 1BAPA 1IZYA 1P2GA 2Y1KA 2XT6A 3MT0A 3UJBA 4NCXA 3BHJA 1URPA 3GGCA 5FBQB 1IXSB 5IW8A 5AM3A 4JC5A 3RIEA 2HIGA 1LEHA 3A26A 3UFXA 1UT6A 3ZLTA 3N7TA 1F5SA 1DUVG 3C7DB 2DKFA 2VK1A 3DEKA 5IDXA 4OIFA 5AVJA 1VGVA 4KO3S 5H70A 2XUOA 2XKJE 4UXIA 3B6IA 2GFQA 3DWGA 4CUKA 1WD5A 1TKBA 2G83A 4NS4A 4PPGA 4W7IA 4A03A 4CEIA 1GTZA 4TN5A 3VHQA 2E21A 3BF8A 2ZI7A 1K3FA 4BTVA 1VJDA 1L4KA 2UVDA 2Z0MA 3A6DA 3FBWA 3GCDA 3KEGA 3MWJA 3O1LA 4IRXA 3UXHA 1UBSB 4DOMA 5BSGA 4F1JA 2PZEA 2IS2A 2WABA 5K3DA 4WJZA 1D2AA 4XIFA 4EKDA 3KB8A 4EYGA 1GU1A 2C3OA 4XYMA 1AM4D 3PC3A 4P0TA 3THWB 1YZUA 2J4DA 3RVOA 1PK9A 1CLUA 1DC8A 3NHLA 5CFRA 1QFSA 1FU7A 2VBCA 2FHSA 2JLXA 2WWRA 3ZHYA 3EG9A 4NOKA 4DEXA 2ZS7A 1ATZA 4X95A 3K32A 2FH5B 3RBVA 1XNJA 5FB3A 2QROA 1U5BB 2Y0EA 4J7AA 5L3SA 3TFOA 1DAPA 3U4CA 4FHGA 1NQOA 1E1QA 1Q44A 4JWTA 3H97A 4RTKA 1E4EB 5E2IA 3UXEA 3BFKA 1Q77A 3LX8A 1DELA 1WMSA 4KQMA 3DF9A 2VHEA 1WZCA 3FVRA 4M60A 5TY0A 1I94B 4UTPA 4C08A 3A4MA 1RKUA 4RPHA 4TZKA 4UTOA 5KVSA 3C6ZA 4YP9A 1GNVA 3EOBI 4LIPD 5DNVA 3V32A 3K8QA 4J75A 1QG6A 1IN1A 2H2FA 4RIEA 1VHJA 1X7GA 2XEXA 1A3CA 1VDMA 2BBTA 1XQWA 2C96A 4JWKA 1A5BB 4OJQA 4H27A 3UJ8A 1IRIA 3JATA 4HX9A 4DXDA 3DCJA 2B8NA 2VP4A 1NATA 1YR1A 5CH8A 4WCFC 4L51A 1TTHA 4S3MA 3UG6A 2GDZA 2WV9A 4EQZA 4GPAA 4U7PB 1NTOA 4I4CA 5AW4A 2XOKD 4I50A 3TRHA 1FPMA 4M4SA 1YC2A 3FGPA 3ROKA 4G6ZA 2OV1A 1PV1A 1LPAB 1UQUA 4OTZA 4OK3A 2YHIA 1KYVA 1QSGA 1G4UR 1XN1A 1RQPA 4M0PA 5IM5A 3IQEA 4BU1A 2XE7A 3WIBA 1DOAA 2RHGB 5DWVA 4F6CA 4PYQA 5MF6A 4Q9IA 1W4BA 1F8FA 2GPJA 1M34B 2E1PA 1P1JA 1IQPA 4J0JA 4M6WA 4EJSC 1M0WA 2JLCA 4II3A 2PXHA 4GO1A 2MSLA 4ABTA 4JUAA 1HH4A 3M9WA 1DARA 3TTWA 3RWBA 5KNCA 3RC2A 1UFRA 3JQ9A 4LHXA 5AJHA 5TMBA 3E3OA 3GBVA 4CUJA 1FFDA 1GR1A 2GCEA 3PFNA 4OFZA 1R9GA 4P6VF 3U56A 3CZAA 3ELWA 5I9MA 4LC1A 3OHSX 1XXHA 2PUTA 2XA9A 3BZWA 3ROQA 1WUJS 4Z4IA 2VZLA 4O3MA 2HHAA 5CW2A 3B85A 3GH1A 1YOBA 1SBIA 1YKSA 1YGPA 1E2IA 1QQTA 4RETA 4YLEA 3GGSA 4KWCA 5AIBA 4ND5A 3ELYA 1R6UA 3L7NA 1OXVA 3IULA 5LYJF 2IPXA 5AKHA 1Q0UA 4MJ7A 3B36A 3CUEF 3PD0A 4Z51A 1KI9A 2QAIA 2OBNA 3VC3A 4P54A 4OQQA 3LC2O 4PSKA 5LA6F 4DUGD 1QHXA 1AV6A 3ZEAA 2XB9A 3K9NA 1KU6A 1NVAA 1UZUA 5C5DA 4YR7A 5F2KA 7YASA 4LDRA 4ETWA 1LPOA 1WXIA 1KL7A 3BTOA 4MUIA 1QKKA 1NUTA 1WCIB 4G8DA 5KQLA 1DADA 4UW9A 1P5RA 4PYJA 2JAUA 5AJVB 3LUAA 4K2AA 2E1RA 1MFZA 1QR2A 4ECAA 1JQDA 1WY5A 1Y9JA 4P2BA 1D1QA 3ZWKA 4YV2A 3WL6A 3FTEA 1HM5A 1U2GC 1ILEA 1H4TA 1MEEA 2QYSA 3PJRA 2IGTA 3F6BX 3AI1A 4N5LA 4HJXA 3JQAD 2ZYDA 2VLIA 2B9EA 3G0HA 4RY0A 4PYMA 2JA2A 4Q9LA 5EMLA 4FDVA 3TL6A 2AMJA 3W7VA 4FHDA 3ADBA 1ZGCA 8ATCA 3AGQA 3OY7A 5FAKA 4NFLA 3ZK9A 3TIGA 4IJ6A 4HFMA 3BMOB 1D7OA 2BR3A 2NYRA 2Y05A 3B82A 2X22A 2QG6A 3HKCB 5FCDA 3WWEA 2IIVA 4A73A 1B2LA 2R47A 3AEUB 2V96A 1LV8A 1W0KD 3ZIUA 4HFNA 3G9ZA 5JPCA 2PSJA 4GGOA 3GP8A 3P2YA 3WYEA 3F97A 3UENA 3EXG1 3VR5H 1HT0A 2INGX 1ZH8A 3Q10A 4JBXA 1TC2A 3RUEA 3RIXA 3HRIA 4CM5A 1P0FA 3A2KA 3LKBA 2RHWA 3V2UA 5ALUA 1JNXX 3HN2A 1KNXA 2WZCA 5EEHA 1XMOB 3T3OA 4KQ9A 1SQ5A 3H3XA 2W7TA 1H1LA 4ML3A 2B21A 3CLRD 1EBUA 5KX5F 4HFRA 2HXYA 1NXSA 4GLFA 1BQ3A 2BSAA 1BGWA 2IKQA 4A8JB 4MIOA 1P6XA 2IX3A 4L6AA 4R5MA 2GM4A 1IMJA 1L9XA 4UTXA 5JUWA 3D1JA 4C2UA 2YYZA 3K8ZA 1OLXB 4HAXA 1H4SA 1UFQA 4C0KA 3L7DA 1XZGA 4BECA 1W1WA 1NVUQ 3RYTC 2C9ZA 1N9GA 1SHZA 3B1JA 5TEWA 5JJIA 1SXPA 5EE3A 1UJ5A 2XDQA 3GO4A 3VR3A 3D5TA 3SQLA 4ZU6X 5JE8A 4BLVA 3BRCA 2WJGA 5K0JA 3R75A 1MC4A 3TSOA 3MRTA 4DADA 5JS7A 2VAVA 1JXAA 4ND7A 4V38A 7ABPA 3TOCA 1XAIA 2C9CA 1X7DA 3ZE8A 4BNLA 1E7MA 1K9SA 5HKKD 1D2HA 4JNKA 3HGQA 4LW8A 4PSCA 1NW7A 2JAPA 4DR6B 2XVMA 3HPRA 2ZCVA 1IBKB 1GL7A 2ODAA 1A2OA 1AE1A 1CHDA 3QUTA 1QYDA 4FN5A 4G5SA 5CFOA 2FN4A 2Z2ZA 5AP9A 1OXBB 4KDEA 3S2GA 4C22A 1AQYA 2ODEA 2WF9A 4XGKA 1D2RA 4JLDA 3KQLA 2GTPA 3I2JA 2DETA 3EPHA 2WSMA 1HSZA 1P2UA 2QT9A 1O96A 3KK0A 1EX9A 3LF1A 1QRTA 1VYTA 3JQCA 3TLJA 4FZ5A 1GOTA 2XJ9A 4H7HA 3ZQUA 2CXRA 3Q1LA 4PLTA 5TVGA 1MCZA 2AVNA 2R4QA 3DSRA 1GUAA 1GPDG 1XN4A 1SD2A 1IUPA 1MIOA 3CGGA 3PCTA 4X24A 4HDKB 1FNNA 3R6TA 5EHGA 5FL7A 5FOSA 4ZK6A 4X1KB 3L77A 4PG4A 4U6NA 3U3KA 5FPHA 1XPJA 1ZRMA 2EJBA 4FQ5A 2Z2KA 4QOEA 4DIDA 2WUFA 1F5NA 2X3FA 2R751 3M5PA 5G4KB 1ZGJA 5EJ2A 3GCWA 4YR9A 3S99A 1D5CA 3OKPA 1U94A 1P6QA 1SQ0A 3SXUB 2Q8NA 1T35A 1YL5A 1YBVA 1CQIB 2EU8A 5BORA 3CWZA 1EFCA 5SZIA 1UF9A 3R3JA 2QAGC 3OPQA 3TLAA 4KSYA 1EVEA 2I6UA 3OD5A 4JXKA 3P32A 1DXHA 4GYKA 3KQNA 5SYNA 2FCRA 1GXSA 2XA1A 3KXIA 4BNKA 3ZXSA 4B3SB 4Y1RB 4F5YA 3HP4A 5LNK6 2H08A 4ILEA 2O4CA 4DNFA 2WNSA 4Y6OA 5AK4A 1A4RA 2PFGA 2NAFA 2MINB 5FWXA 3NBKA 1OFTA 2WFMA 3PX2A 1X7YB 4K9LA 2G0AA 4ZXPA 2Q9CA 5M3BA 2D74A 1T6NA 1AN0A 3DE1X 4KGZA 4XD7A 4ZOLF 2OGTA 2PKRA 2F3PA 4JLOA 4WY5A 5JYBA 4Q24A 4IIUA 2XTZA 4N3GA 3NT5A 3F6RA 2W6CX 4L28A 4D0LB 3H2YA 1XRNA 1V7PC 4QEDA 4D97A 1P5HA 1PD0A 1Y3IA 4H0NA 5DTRA 3NHYA 3OETA 1IZ0A 2YW9A 1YTLA 2GHIA 3HHPA 1KDOA 4DNQA 4JLAA 4RDXA 1PYOA 4HQ0A 4EG0A 4YY3B 1A9SA 1XPRA 2OO5C 2ZW9A 1JT2A 4LTNA 2QTTA 2R8XA 2PA3A 4MS1B 5TS3A 1TMOA 2A9VA 2Q3FA 4OSPA 4HZGA 3R1IA 2XQVA 5JRDS 3IP1A 1CUYA 2D8MA 4G41A 5TGZA 4K3UA 1BE6A 3GJ0A 2QW8A 4EJSB 3UHPA 1U31A 4MLPA 4PC6A 2V7UA 5FTKA 3T41A 1ZW6A 5HUHA 3T1OA 3TXYA 3M3DA 7REQB 1MG0A 3KSUA 1Y9AA 3NWJA 3O7MA 1P1RA 4YNBA 3U7GA 3H6HA 3TW4A 2WV7A 4OAOA 5ELLA 1DOZA 5JQGB 1U0FA 2CEAA 1XZHA 4QXOA 5TQ2A 2ISQA 1CY7A 2QL6A 3F1KA 3LCVB 2OC9A 1E99A 2XYGA 2R8PA 3NS7A 4B75A 4BFSA 2I7XA 5EMKA 3GFRA 3CRZA 5E1MA 4G36A 5C8ZA 1N2CB 2PDAA 4MW5A 4DRZA 4E88A 2AEJA 1MO2A 2VQ3A 1SKBA 3LPMA 3IV9A 5LZ7A 4CV1A 2B4QA 1TT7A 2PSFA 2G71A 2GB4A 3PTZA 5EXEA 2B94A 4CCAA 4KXVA 2X0FA 2GBPA 4PAWA 1CJUC 2OT3B 4DLLA 5KDDA 1HDXA 1Z0DA 1E4YA 1ST2A 3LCJA 1C8KA 4DWJA 1UBCA 1UJ6A 2ACWA 2PGJA 3AOEC 4HG2A 1THZA 5DEIA 1VLHA 4AP5A 1FW6A 3R3VA 4DCGA 4DNXA 1ECFA 1S89A 1YTUA 4N5NA 3LUKA 3QKWA 1SOMA 4U6QA 2A7XA 1WDMA 2CNWA 1RLOA 2BR4A 5J59A 1ECLA 1ABEA 2QV7A 4TKZA 4TLEA 5HDQA 2GTIA 3CRQA 4YJ2F 4UTRA 1JAYA 4W9MC 4TZ0A 3DEYX 1GRCA 4B32A 1LDBA 2YWHA 4DQVA 4FYVA 3SZMA 3EULA 4ON9A 2V8BA 3PDUA 1OHHA 2J67A 4GR5A 1TXGA 3I5AA 4QVKA 4EY8A 3A3KA 1M5UA 3LLCA 4OSEA 1C9EA 3ENNA 5FUQA 3Q8MA 1T1RA 4ZMBA 1IWPB 1E0DA 2B6HA 2W90A 3Q8XB 4LHSA 4R2IA 3UMCA 1NY5A 5KUTA 3MRSA 4EKNB 4I1PA 3VO8A 2HLDD 3WK4A 2VF8A 1KMIY 3CONA 3FCYA 5BN3B 4L9AA 1JHQA 1IULA 3U9TA 1ULHA 1X7XB 4LC9A 5HZGA 3R7BA 1TAQA 2OVBA 2PGLA 3DHVA 1TYAE 2BUCA 2JGLA 1XZCA 4EH1A 5HK9A 4WDRA 2Y0BA 4OXRA