1ODSA

Cephalosporin c deacetylase from bacillus subtilis
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
316
structure length
316
Chain Sequence
QLFDLPLDQLQTYKPEKTAPKDFSEFWKLSLEELAKVQAEPDLQPVDYPADGVKVYRLTYKSFGNARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIHEMVNWALHGYATFGMLVRGQQSSEDTSISPHGHALGWMTKGILDKDTYYYRGVYLDAVRALEVISSFDEVDETRIGVTGGSQGGGLTIAAAALSDIPKAAVADYPYLSNFERAIDVALEEPYLEINSFFRRNGSPETEVQAMKTLSYFDIMNLAYRVKVPVLMSIGLIDKVTPPSTVFAAYNHLETKKELKVYRYFGHEYIPAFQTEKLAFFKQHLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CEPHALOSPORIN C DEACETYLASE
publication title Multifunctional Xylooligosaccharide/Cephalosporin C Deacetylase Revealed by the Hexameric Structure of the Bacillus Subtilis Enzyme at 1.9A Resolution
pubmed doi rcsb
source organism Bacillus subtilis
total genus 114
structure length 316
sequence length 316
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.1.41: Cephalosporin-C deacetylase.
pdb deposition date 2003-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1odsA00
2GBIA 1BCRA 5C81A 3BXPA 4YK7A 4OYYA 5CT9A 1EINA 2WG1A 3LP5A 2HRQA 4HXFB 4Q3KA 4J0IA 3O9VA 5ALHA 2PKYX 2H1IA 2Y6VA 3FCYA 2PSDA 3QH4A 5LZ5A 3IUJA 1OXMA 2XUPA 4S0XA 1S8OA 4Q05A 2XQGA 3ESBA 2HHAA 2I3ZA 2XUHA 4Q1VA 4EY5A 4QDOA 1IZ8A 1TCBA 1F0NA 3D2BA 2HIHA 3KSRA 4C4XA 1LGYA 2PBLA 1ZGBA 3F9CA 2HM7A 5CH3A 3I2GA 2QUAA 4OUKX 4PW0A 4I3FA 2ES4A 3LIPA 3O0DA 3L1HA 1EK2A 4G1FA 2AJDA 2OCKA 4BP9A 4J0DA 4ZV7A 1W1IA 2JGEA 1MNQA 4BZZA 3G7NA 2VSQA 1CUXA 1GXSA 5FPQA 4UHDA 3ZV7A 4W9RA 4V2IA 2XUJA 3WK6A 2I3DA 2OQIA 1N1MA 3HLKA 5ALJA 4HZGA 4C4ZA 2QJWA 3DYIA 3ZLTA 4A16A 3STWA 4C01A 4EA6A 4FLMA 3DOIA 3V1NA 2OAGA 4HS9A 4BCDA 2V96A 1PFQA 2X76A 2EEPA 3QMVA 5AIAA 5CTAA 3WIBA 4WY5A 4Y2TA 2JEYA 5IKXA 1W52X 3WYDA 1FFBA 4HVTA 3JWEA 1TK3A 5LLSA 4EY8A 4B0OA 1YB6A 5KWIA 1Q0ZA 1PJAA 3KD2A 4P08A 2I78A 2WM2A 3AZQA 2ACKA 4UFNA 2PU5A 3T4UA 2WG0A 5AM3A 1X70A 2YXPX 3C8HA 3ESDA 1XZMA 1G5FA 3PUHA 2PSJA 1N5MA 1Q83A 2ZYSA 5BV7A 4C87A 4Y2RA 3F97A 4C4YA 1SCKA 4BVJA 3H2HA 4J0GA 4AZ3A 4DMHA 2PVSA 3GBSA 3ANSA 5AKKA 4JYPA 5DNUA 1MX1A 2GZRA 3ZPXA 2EDAA 5A7HA 2QRUA 2R11A 4GW3A 4UHFA 3VISA 3OM8A 3PICA 1QIDA 4CIAA 5CH5A 2HA0A 3V1MA 4ZRDA 1G4HA 2YASA 1YA4A 4HRYA 2O2HA 4U2GA 3AZOA 3D7RA 5LYYA 4AZ0A 3DJYA 3IVMA 1EDDA 3EQ9A 1N5RA 5E4YA 5LIPA 4BAUA 3G0CA 3BJRA 5HZGA 3WWCA 2HU7A 1CUCA 3FSGA 3YASA 1YSCA 2B20A 4P93A 2HRRA 2WIJA 3WL5A 2PUHA 4DIUA 2WUGA 4WDQA 2WFLA 5AIBA 5ALSA 4U2BA 3WL8A 5D3KA 2JF0A 5AI8A 3AINA 2DR0A 4FKBA 2ZJFA 3OOSA 2RI6A 4J3JA 1EB9A 4G4JA 4BAGA 1QGED 3IURA 2OGSA 1XZFA 4Y2PA 3C8DA 2Y6UA 4F5ZA 1WOMA 4BDSA 2VJBA 1LPNA 3WK5A 1MU0A 3PDCA 1QIJA 1A8SA 4ZGBA 2QVBA 2FJ0A 3P2MA 4Q3OA 2HU5A 3H1AA 3WKAA 1JI3A 3W2TA 2OCIA 2E3JA 2WTNA 2WIDA 4H7JA 3C70A 2W22A 4IH1A 5AKHA 2XUKA 4KE6A 3W9BA 4F0JA 2C5GA 2HA3A 5ALEA 2CB9A 1E89A 3M83A 5JANA 2XUGA 5EHNA 1H22A 4WDRA 4KYVA 1ZOIA 2XMZA 5AKZA 3VVMA 4B82A 4KRYA 3C6XA 2BAGA 4DM7A 1GQSA 1QIMA 2VEOA 3IULA 4BC0A 1YR2A 2VA9A 1Y37A 3H04A 4UFPA 1CUEA 5AM0A 3C87A 3IBTA 4AX4A 1JMKC 4P9NA 5ALNA 3PF8A 1XZCA 4B85A 1F0PA 3I6MA 4UHEA 2IX9A 1A8QA 4FOLA 1LPOA 2XI4A 5AI6A 5DYWA 1VZ3A 4ITVA 3WIOA 5AHXA 5JD6A 3B12A 1CQWA 4TPKA 3WZLA 3ZLUA 4FTWA 5ALYA 2WHQA 5A2GA 2V9ZA 3HC7A 1JU3A 2J3DA 4B9AA 3WK8A 4UBMA 4PV7A 3ZWQA 2LIPA 1CLEA 3MVEA 4UHCA 1N8SA 2P8SA 1CIJA 4X6UA 2V97A 3F8SA 5AP9A 5BWBA 2FX5A 1ZIXA 5LP1A 2XUFA 4Y2YA 4QDTA 1IMJA 4TVKA 1FSSA 3ILSA 5AM4A 5I8PA 3OTQA 2J3QA 1QJ4A 1WPXA 2UZ0A 4Y2QA 4GBGA 1CUJA 4FLEA 2ONCA 4X97A 4MQLA 2VF2A 3QM1A 4Y2JA 5AK4A 1WB5A 1CRLA 1EHYA 3UMJA 3FSGD 1CUHA 4Y2UA 1THTA 3HZOA 1P0IA 4UFOA 1XRNA 3C45A 1GPKA 3R3UA 1AQLA 2WFLB 5ALIA 1GZ7A 3WJ2A 4U2FA 3QPDA 3RARA 4AMZA 1YA8A 5ESRA 2VT6A 1CUZA 1UT6A 1W75A 4M0FA 3WYNA 5JD4A 5DYTA 5EHXA 1SCQA 1AUOA 4RE6A 2VJDA 4FNGA 1O6FA 4BCCA 4Q34A 5KBYA 3R3XA 2XT0A 4F60A 3WA6A 5JAOA 5HK8A 5SYNA 1A88A 1UKAA 2QMQA 2HU8A 3AUKA 4DGQA 3G02A 5FP0A 3V1KA 5IVKA 4LXIA 3RKSA 3DS8A 2XMCA 5ALUA 1CUAA 1Y7IA 1J06A 2RHTA 4D9JA 3TEJA 5DTIA 3WJ1A 4B81A 1H2YA 2OCLA 3LCRA 4RNCA 1QIGA 3R3VA 3STVA 4IH4A 3K2IA 4G4GA 1CUGA 1UK7A 3G8YA 4KAFA 1VKHA 2PSEA 1P0QA 4XWGA 1QIKA 5FPPA 1MX5A 3I2HA 4GEGA 4AB1A 1BN6A 2PM8A 5D6OA 2NW6A 3FLAA 5CT8A 4B7ZA 3Q8WA 3GFFA 2V98A 2ZSHA 1X2BA 2WJ4A 4TGLA 4OD0A 1WM1A 2HADA 1QFMA 4G4IA 3BJMA 4DNOA 2C5FA 4KE9A 4N5HX 1AC5A 4X00A 1K5PA 3ICVA 1XZAA 1F6WA 3I2IA 5ALKA 1F8UA 3I28A 3V48A 3PE6A 3HEAA 2Y2VA 2DSNA 1FJ2A 2JIDA 1VE6A 1BROA 3IDAA 4QLAA 3KOOA 1JU4A 1ZICA 3I2KA 4G8BA 4GLBA 5HCUA 5T4BA 3K6KA 1WB4A 3O4GA 4INZA 4P92A 3DKKA 3HYSA 3R3WA 1J2EA 5CXUA 4FHZA 3C5WP 1LPPA 4EZIA 2JGKA 3WKEA 5CT4A 3JW8A 1K8QA 5EGNA 5HF5A 3H2IA 2GBCA 1DX4A 3DLTA 2BGRA 4B6GA 2VTVA 2Y2UA 5JASA 4IH9A 4DMCA 2FUKA 3KDAA 4H77A 5FKJA 1M33A 4H0CA 4JUIA 4RE5A 1B41A 4UUQA 3WMRA 6YASA 5D3ZA 3DOHA 4FDMA 4HAIA 5LKRA 4G8CA 5EIAA 1EH5A 5AICA 4J0CA 3T52A 3WI7A 4WCVA 4AO6A 3CN7A 4FFVA 1AX9A 3STYA 2R8BA 4Y9SA 3FCXA 3D4LA 1DWPA 3I6YA 5HKAA 3M3DA 3WK7A 2C0QA 4YASA 3G0DA 4J03A 1R4ZA 1H23A 2XQJA 4OU4A 5FXMA 4E15A 3WL7A 1R50A 5K3FA 2WHRA 5CRIA 5C7YA 1YCDA 1X2EA 4H7HA 1P0MA 2GBGA 4QA9A 4AO8A 3G0IA 4LYEA 1MT3A 1OILA 4AN1A 4PSDA 1D07A 1P0PA 1SFRA 3U1TA 4UBIA 1G66A 3CCBA 5FRDA 1UXOA 2XMDA 3IUNA 4X94A 4ARAA 3TJMA 1EVQA 5ALZA 1NU8A 4DTCA 1USWA 1XZJA 4FBMA 3STTA 4QLOA 2BFNA 1CUBA 3WL6A 2RONA 4A5SA 1GPLA 2ZYIA 2D0DA 1VOTA 3AZPA 5CBKA 3STUA 1E8DA 1MN6A 1GQRA 1MX9A 1AURA 5AKGA 5AO9A 5A6VA 3FYUA 4K2AA 3LLCA 1R1DA 3ANTA 2C4HA 1HPLA 1BEEA 1XZIA 3W06A 4DMKA 4LXGA 1SC9A 1ZIYA 5K3EA 3S8YA 1XZDA 1IVYA 2ORYA 3CXUA 1QOZA 2WU4A 2GYUA 5ALWA 3FBWA 2XLBA 3WKBA 3PI6A 4L0CA 1LBTA 4B0PA 3SK0A 3I1IA 1BEZA 1E8MA 2QTBA 5HF6A 2PSHA 2RHWA 3L1IA 5AOBA 4X91A 4BE9A 1AMNA 3MUOA 3AILA 1ZD2P 1QIEA 1XLWA 2OQVA 1DWQA 4FLFA 1TRHA 4JH0A 5EIEA 4Q82A 1FFAA 1L7RA 5K3DA 3H2JA 5E4JA 5LZ7A 1SOMA 1LPAB 3V1LA 2DHEA 3OC0A 5E2IA 5ALQA 5AI0A 5HF8A 1UK9A 3D0KA 1UFOA 1NU6A 5T4FA 5AH0A 3WK9A 1QIFA 2WSLA 2G5PA 3SX4A 2BJHA 4KRXA 3GROA 1H2XA 5HFAA 1G42A 2X5XA 4H35A 4WFJA 1JKMA 3NUZA 3QBJA 2HFKA 3FNBA 1BCSA 3G0BA 5JADA 1XKLA 4BBZA 1QE3A 4W63A 5JZSA 4BDTA 4X6YA 4BC1A 3A2NA 2HL6A 5K3FB 3A70A 5IVIA 2Z3ZA 5CH8A 4DYHA 2XQIA 1BS9A 4KJXA 5J3JA 3K9BA 2J4FA 1XZBA 3PUIA 5ALFA 4MYDA 3AIMA 3BF8A 4QNNA 1EA5A 4WFKA 2VAVA 3C43A 2XLCA 3WWEA 1T2NA 1IUOA 4UHBA 1DT5A 4UHHA 3DD5A 4X85A 5A7GA 2C58A 2JGFA 5FLKA 1FFEA 1WPRA 1Y7HA 1E3QA 4NS4A 5CW2A 1GKLA 4N8SA 3C6ZA 2CEKA 1W6RA 3VJLA 2H7YA 3R40A 1MAAA 4X95A 2VT7A 5AI5A 4LXHA 5AK6A 5I7UA 4MQMA 4UBKA 3FYUB 1XQVA 2VATA 4DMFA 2PPLA 4FNMA 4OB8A 2Y1KA 1UKCA 4XX1A 1U2EA 3DYVA 3HACA 4M0EA 2K2QB 1XRPA 1EDBA 4ZV9A 2PUJA 2QR5A 4CI9A 5JARA 1VE7A 2G5TA 3I6ZA 1JFRA 1GT6A 5CMLA 2O7VA 1QO9A 5DTJA 5C8VA 5AKYA 4UBJA 1XRLA 1RWQA 1WCYA 1EX9A 2JBWA 1EDEA 2CZQA 2HA4A 4J0HA 4MEAA 3O4HA 3G9UA 2Z8XA 2W6CX 4FWBA 5F4ZA 3WZMA 1ZD4A 2G4LA 4UBOA 4X93A 1CR6A 4ETWA 1ODTC 1CFJA 5K5EA 2BUAA 1XZHA 2ZVDA 1R88A 3LIIA 4GXNA 5CT5A 1TCCA 1JJBA 1XQXA 1VXRA 3I1YA 4I19A 1C7JA 2BKLA 1FFCA 4DLNA 4MWTA 3QMMA 4DNFA 4Z49A 3VVLA 4CG1A 2H9YA 3OURA 3HJUA 1HKHA 4CCWA 2OGZA 4J0KA 1HL7A 4ZXFA 3SC2A 5YASA 2OG1A 2BUBA 5AJHA 4QWMA 4QE3A 3R0VA 1XRQA 2JGJA 4BTVA 3R3YA 4G5XA 5FUMA 5BWCA 4XIIA 4OU5A 4KACA 3BE8A 3FLBA 4U2CA 4X92A 2AJBA 2DHDA 4BB0A 3RM3A 5AK3A 3GELA 5CT6A 5FV4A 4UBNA 4HXEB 7YASA 3H2GA 3I2FA 3FVRA 5AKLA 2VAXA 2IITA 3FYTA 1QZ3A 1WHSA 4MXDA 1XLVA 2WFZA 5DYYA 4E14A 3PFBA 2VJAA 1CQZA 4LHEA 4BRZA 4IHAA 4H7DA 1CVLA 1U65A 3X3HA 1ZI8A 1W4LA 1EVEA 3E4DA 3FWHA 4OB7A 1DINA 4DNPA 3WWOA 3DEAA 1IUPA 2AJ8A 2OCGA 3B5EA 4MWSA 1H2ZA 2EDCA 5EI5A 4QZVA 1ACLA 3H0CA 3W05A 3AFIA 2O2IA 4PSCA 4JNCA 4B9EA 5ALGA 1E8NA 2IIVA 2DFPA 3H2KA 1AGYA 3A2MA 4JYMA 1XZGA 5ALMA 1XLUA 4RPCA 5AK5A 5AM5A 4CG3A 1ZI6A 4A23A 3G9XA 1LPSA 5IVDA 4BVKA 2XUAA 1ORVA 4JEIA 4PQEA 4W1QA 1EXWA 4PO3X 4AXBA 1VZ2A 4W1PA 3QITA 3WA7A 1QONA 1ZJ5A 2CKMA 1QTRA 4AMYA 2WIKA 1VA4A 2HA6A 5ALPA 3VXKA 4PF1A 2AJLI 5ALRA 4EY7A 1K6EA 4LYDA 4DSAA 1LZKA 1R9NA 4MEBA 4IQ4A 2OPHA 3BDIA 2ACEA 4K6HA 4N8DA 4OYLA 1H2WA 4X71A 1MO2A 1KU6A 3ZI7A 5ISMA 5JALA 3U0VA 3BDVA 3QVMA 4NZZA 4UBLA 5JZBA 2XUQA 4X6XA 5LZ9A 3H17A 2H7CA 4N8EA 3QZUA 2JEZA 1XKTA 3BIWA 1UZAA 3NGMA 5HKBA 3CCCA 1O6GA 1UK8A 2WTMA 4HRXA 2ROQA 1FFDA 1ISPA 5JAPA 4M0MA 2WKWA 2VQ6A 3C5VA 5FOQA 3TGLA 1YAHA 4E46A 1VXOA 4KAAA 4EY6A 2CMFA 2XMQA 2CJPA 2OGTA 1CUWA 2B61A 5C8ZA 2WQZA 1J1IA 4L9AA 3R41A 3V9AA 1LPBB 1EB8A 3VJMA 4BE4A 5AI9A 1HQDA 3BIXA 4CFSA 4H18A 4GECA 1UOOA 2J4CA 2B4KA 3TRDA 1ODCA 4BATA 2PX6A 3M82A 4G9EA 4H7FA 3WK4A 5LKAA 1U8EA 3IB3A 4B80A 5FDFA 3E1GA 1CUDA 3AJAA 3DL7A 3EQ7A 5AOCA 1JMYA 1DT3A 3O4IA 4K6KA 4BRSA 3DNMA 4EY4A 5EIHA 1OCEA 2Z5GA 4QWWA 5EFZA 1BU8A 3HRHA 4CG2A 2WIFA 3E0XA 4X3CA 5HK9A 3SWWA 4EBBA 1CUIA 3VJKA 2FJPA 3DDUA 2CUTA 2BUCA 3NOXA 1XRMA 3WKCA 5JIBA 1VLQA 3FYUC 4GWLA 5JAHA 4EUSA 1ZJ4A 1RYYA 4KEAA 1QIIA 1VA5A 3ICWA 2GYWA 5LZ4A 1ACJA 3F98A 1XRRA 1ZI9A 4NVRA 2D5LA 3STXA 1EK1A 1PV1A 2H7XA 2HA7A 4FFWA 4CCYA 2OAEA 1AZWA 2WIGA 5K3CA 1R9MA 1E5TA 2C0PA 2GZSA 2Q0XA 2Z8ZA 3D59A 1JT2A 4I4CA 4UPDA 2YYSA 2XB6A 3W04A 5CXXA 2BCEA 2DCMA 5ALOA 1HDEA 1W76A 3G0GA 1ODSA 1ZD3A 3DQZA 3WLAA 4AQDA 1DTEA 5ALVA 5HQ3A 3GA7A 2BGNA 1XQWA 4K6GA 4EB0A 1CUFA 3BL8A 3WWDA 3HSSA 1R3DA 3GZJA 4PNZA 2XE4A 3A6ZA 2I03A 2PU7A 4H7EA 4N5IX 3WKDA 5CURA 5A71A 5DLPA 2JGLA 2WU3A 3BWXA 4KE8A 1Z68A 2DQZA 4BZWA 4RGYA 1NX9A 3FLEA 2QUBA 4L72A 4PSUA 2GBFA 2XUIA 1TKRA 4ZREA 1K4YA 1UWCA 4LIPD 1HLGA 4Y2SA 3EF3A 4MYSA 3W9UA 4XVCA 2ZYRA 1QLWA 1YB7A 1UKBA 4BAZA 2O7RA 3NWOA 2AJCA 4BVLA 4L3WA 1ZD5A 1E66A 2GYVA 2PSFA 2HFJA 5EHZA 3KWFA 3M81A 1I6WA 3N0TA 4OCZA 4HXGA 5AKXA 1DX6A 2DQYA 5AKJA 3MUNA 4BP8A 4YX9A 2QJRA 2XDWA 3O4JA 1UOQA 2WUFA 1MNAA 1UOPA 4G9GA 5AM2A 3EQ8A 1BE0A 1C7IA 3ED1A 1GGVA 2C7BA 5T4HA 3FVTA 4Q3LA 2B9VA 1WHTA 1MAHA 3EIOA 3D2AA 2QM0A 1XROA 3H19A 1DQZA 3E3AA 4BYMA 5C8XA 5ALLA 5BOVA 1IZ7A 1CUVA 4GDMA 2DHCA 3IUQA 2WLSA 5D7BA 1LPMA 1BN7A 2XUDA 5K3AA 4HTAA 4E11A 1TQHA 3QPCA 5DJ5A 2ZJ6A 5JAUA 5JATA 3N2ZB 4LKOA 4KAJA 1TIBA 3AIOA 4CCYB 1BRTA 2AXEA 3D2CA 4J0JA 4KE7A 3ESCA 1VJ5A 3D3NA 4U2EA 5IVHA 2HA2A 4Y7DA 4ROTA 3DCNA 3HI4A 1SCIA 1QIHA 1MJ5A 2WHPA 5AI4A 3RLIA 1ETHA 3O9MA 3PFCA 4H7IA 5A62A 5T4EA 4Y2VA 5SYMA 2XUOA 3S2ZA 1THGA 2ZSIA 1CUSA 4GI1A 5HQ3B 1J07A 2JGIA 5KREA 3C6BA 3FAKA 5ALTA 5EHQA 4ZI5A 3VKFA 3UUEA 1C4XA 2Z3WA 3Q0TA 4QDZA 3QMWA 2QKYA 1Q0RA 4W1SA 2XQFA 2QZPA 3IUMA 4GHWA 3O95A 4BTLA 1A8UA 1T4MA 1L7AA 2WUDA 4OPMA 2ZJ7A 1U4NA 1WB6A 4DNQA 2HDWA 2O2GA 3F96A 1GKKA 2WJ6A 3LS2A 1XFDA 4G8DA 5LZ8A 3VDXA 3L1JA 1LNSA 3IA2A 5DNWA 3JYHA 4IO0A 2WILA 1QFSA 3HABA 2HA5A 1TCAA 3QYJA 1MPXA 1HBJA 4FMPA 3C6YA 4MJ3A 1QTIA 4YPVA 5HFNA 3RK4A 4XJVA 5AKIA 5ALXA 3UUFA 5DWDA 3A2LA 2ZYHA 1JJIA 2WJ3A 1CUUA 5A7FA 3CN9A 5KWJA 1A7UA 1CV2A 1B6GA 1IUNA 2QXTA 3OPMA 4WFIA 3GUUA 1XQYA 4Y2XA 1YAJA 5E4TA 4OSEA 1UK6A 2XQKA 3KXPA 2CBGA 2QS9A 2QOEA 4DSZA 1QO7A 1GPNA 3OG9A 1DU4A 3F67A 1KU0A 2YH2A 1Q84A 2XMBA 1DQYA 3D5EA 4K5QA 3H1BA 1TAHA 4NMWA 1EI9A 3FOBA 5DNVA 2RGUA 2QT9A 2WFMA 1DWOA 3AIKA 1LBSA 4WJLA 5K3BA 1CPYA 2QXUA 4ZWNA 4U2DA 1MTZA 5ALDA 3H18A 1YASA 3MGAA 4BCBA 1YS1X 2RAUA 4QDXA 1YS2X 4ARBA 4CIBA 4OB6A 3I2JA 1LLFA 2G63A 4QEKA 3KWJA 1XZLA 4WY8A 4AO7A 4O08A 4C89A 4W1RA 3ZLVA 3WQHA 3DKRA 2XMRA 4EHBA 4C6HA 3B3QA 3DL4A 4QDUA 5I9IA 2ECFA 4AN0A 3ESAA 2WHPB 5IH7A 4B83A 5JD5A 4H7KA 4X90A 4F21A 4X7BA 3BF7A 3HXKA 2WG2A 2VJCA 1KEZA 3PF9A 5H3HA 1ORWA 2OLEA 4J7AA 5AKEA 1XZEA 3QPAA 3IIIA 5LZ2A 4C88A 5JZ9A 2X8BA 3G9ZA 3G9TA 5JYCA 4B84A 1LZLA 4FBLA 1RP1A 5AOAA 1CEXA 2RIPA 2XMGA 4KR0A 3WWPA 2OXEA 1K63A 1ZGCA 2XMSA 3R3ZA 3EBLA 1AKNA 5HF9A 1L7QA 2WUEA 5AM1A 2PL5A 1CUYA 1XZKA 1JJFA 2JGMA
chains in the Genus database with same CATH superfamily
1MAVA 1BCRA 1RLUA 2IU4A 2Q7XA 4ZT3A 4OBBA 3MT9A 5L7YA 4B8WA 1C9DB 4Z3DA 5C5EA 1WCWA 1JHYA 3QXJA 1XTVA 3Q7EA 1NI4A 1U7OA 2GLXA 4FMCF 3DO6A 3CF4A 2PLAA 1ISGA 2FKNA 3DMNA 4HH4A 4D99A 3K7EA 1VBFA 2WG1A 2FH5B 3LP5A 2QRGA 1P6QA 4HXFB 4Q9AA 1X0VA 4MLZA 2W93A 4MCIA 4S1WA 5EE9A 1KRHA 1QRTA 4J0IA 5MN5A 3OOJA 1FLNA 1KI7A 3RI3A 2FWRA 2GDJA 4ZO9A 3MBOA 2WIAA 4R0NA 4UCWA 1Q0PA 3RS0A 1JQ3A 1GCAA 3RANA 3FCYA 3THWB 4Z54A 3KXKA 1E1MA 1CYDA 2GVZC 3UAYA 4WLFA 1DIRA 1JLHA 2J5QA 4O59O 1OYYA 5D87A 1KFCB 2BR5A 2CL7X 1F60A 4H6WA 1JR3A 4PTYA 1LV7A 1NRJB 2A1UB 3D3WA 3PV0A 1QNLA 5FULA 3C1AA 3CURA 1P3JA 4C21A 1HDYA 1D09A 2V7GA 3OFSA 1N6OA 1PNVA 4Q05A 1U2DA 2OYRA 2FZ5A 4B3DA 2N1BA 3ED5A 2E87A 1FX0A 2I3ZA 4WOCA 3WL4A 3AXTA 5KSWB 2W42A 4PO8A 4AX8A 1SQFA 3GJ0A 1BQEA 1HK7A 1MH1A 2LBPA 2WVAA 2X0IA 3D8NA 1XJ0A 3KT3A 1E3WB 3Q11A 2P6OA 1IZ9A 3AM4A 4I8IA 3IDFA 5HWSA 1Q19A 3SBOA 4G97A 4CNBA 3K5PA 4CR7A 4E0BA 3PNKA 2G76A 1CKEA 3WZ2A 4LJ7A 3D2BA 5DM2A 2CLSA 5LP6F 2ZIAA 5LQDA 1LGYA 2I7CA 4LV6A 3AR2A 4M1KA 3IEXA 3LK6A 3COYA 3F9CA 3DV0A 5HA5A 5HZKA 1WUKS 3AVVA 1YH3A 5FQNA 5CH3A 3P9XA 2GGSA 3I2GA 4L0MA 4QYMA 4S1VA 2F1KA 4D81A 4DV2B 3HA3A 2X5JO 4ERXA 4K9DA 2ST1A 4UOZA 4ZOQI 5J4LA 3C1UA 4F1KA 4EENA 3FUXA 4PZPA 2YDYA 3O0DA 4HDSB 5HE9A 3L1HA 1BMQA 5JUWA 2FN4A 2VDVE 5DH9A 2ZUBA 3R0IA 2IZZA 4G1FA 4OHWA 4DIDA 3AJDA 2BGJA 3RGWS 2ZWOA 1O4WA 3DHNA 2BTOA 1E2GA 3QHAA 2OCKA 2I2XB 4Q7MB 1TM4E 4KU4A 3LUFA 1G8SA 1GPAA 5C37A 4N47A 4G1VA 1SZCA 4GX5A 4EFKA 2WMNB 5HCIA 4R3NA 5I9SA 1XV5A 1F3OA 2BISA 2IC5A 1AS0A 2CF5A 3FJ1A 3GLIE 1QP7A 4TTQA 4CIVA 3HCWA 4I1YA 4KWIA 2BTEA 1G3MA 2YXLA 4QBIA 1E2IA 3PD7A 5EJIA 4ZJPA 6GPBA 1GXSA 1VJRA 4WZAE 2PCJA 3LM8A 1QHHA 1RAGA 3ENZA 1WDMA 1VMIA 1JWLA 3R3HA 2OGUA 4U9UA 5SY4A 3ACCA 1CHDA 1MB2A 2ZS7A 4YCSA 2FZGA 1C1YA 4IFTA 5J40A 2EP8A 5TPZA 2WE7A 1TCUA 3NHJA 4O4HB 1A8PA 4IDAA 1G3UA 3VBEA 2VSOA 1RHKA 3NFRA 2OQIA 3PDIA 4OIFA 2R8YA 3L8YA 3K1ZA 5ALJA 4XWTA 3CW8X 4NYMR 2CV2A 2HLPA 1Y5RA 4AURA 5FWYB 4ALKA 4F97A 2HMSA 3C3CA 1X9GA 3EIWA 2GM5A 4C4ZA 1XN1A 4BZQA 2WWRA 1UZLA 1S2IA 4KPYA 2DPLA 4UVDA 1TZ2A 3DYIA 4M3NA 2P1RA 2PCLA 3CJRA 1T34A 5JS6A 3STWA 1W0KD 5HMMA 3DTYA 5H81A 4C01A 1DEXA 3RBVA 2BHRA 1RQRA 4ZDKA 4HS9A 4RDCA 4RTOA 3LY8A 4ZOAA 1L7MA 1M2HA 1DRJA 1ZX1A 3PC8C 3OPYB 4OJNA 5LUBA 4EFMA 5JY1A 2A1TR 1NQAO 3E5NA 3FYSA 2P2CA 3K1AB 4IXTA 1ZG3A 4JASB 4RM3A 4RJJA 2ON6A 5K0EA 2O52A 2H1OA 1P4JA 1LSOA 1W52X 2GEJA 4Q1AA 3LHKA 4BV8A 2CNWA 3CPSA 1OXTA 2XYHA 3NIFB 4TT3A 1B76A 2C4MA 4DC1A 2JCXA 1Y3HA 2ECPA 2WINI 4ME6A 4RV4A 5I51A 5LLSA 4L1KA 3KXDA 4B0OA 1YB6A 4UULA 1Z6YA 1A04A 4HUTA 5KWIA 3FNHA 3KD2A 3DFUA 3FOAA 1QHIA 4PGAA 3QLVA 3W6PA 2ZRPA 4JI6B 4R54A 1ST3A 4V0KA 1VLVA 4YRDA 3R23A 2PU5A 1ZR4A 3ZDBA 1ZM2A 2AQIA 5ES4B 4YLGA 2IS6A 4LA4A 5K4AA 4QTUB 3FKSD 4UEWA 4LOKA 3ZH9B 421PA 4P5PA 5EMNA 3RH0A 1DVRA 4Z7NB 3F90A 4DZZA 4WA7A 5IHXA 5HNKA 3CCFA 1SBYA 4FXPA 5KVQA 1QHEA 4UTZA 3LPNA 1Z22A 1XLTA 4R1PA 3FGPA 1J0CA 1TYEB 4DUPA 2GS9A 2R751 1N5MA 2ID8A 3LC0A 3QEMA 4Q4JB 3V4FA 4BV2A 3KDPA 1QP8A 1Q83A 2RB4A 4KVFA 1YHZA 4MIEA 2V9PA 3A28A 2RB5A 4BIIA 3W5BA 5LPNA 4FWTA 1DEAA 2PT7A 4IDDA 2Q9AA 1YU9A 1AQYA 4EG8A 4F38A 3GFRA 1T4DA 4ZQEA 1LLCA 1PU2A 2Q6KA 3S8EA 5HUJA 5FOXA 1QH9A 4LE0A 2P2SA 2NADA 1IY9A 5CYFA 3T1VA 3X1MA 2R00A 1GCIA 3DJFA 3GRVA 2PVSA 3KTFA 4I2NA 4F3CA 2GHQA 1Y6JA 1ZCJA 2QSZA 3TDMA 4UEQA 4QBGB 3WY9A 3WSTA 5B1EA 4KNVA 5ARCA 1V43A 3F3SA 1OVGA 3K4QA 5HPYB 2GRJA 1E7MA 4EGQA 4IIXA 2Q1SA 4JJKA 1VJDA 2EDAA 4QPZA 5I7AA 1PIWA 2CGEA 5A7HA 3S1AA 4P3NA 1UDBA 2QRUA 1UL1X 4LF6B 1BVRA 3KCNA 4YDQA 3RVDA 2OE2A 1C41A 3QV2A 4NAUA 4IJMA 1IWPB 5AXBA 3LXXA 3HGTA 1F8YA 2B6HA 3OFJA 3ASYA 4M8LA 4JV5B 2HA0A 3C5HA 1XA0A 1S8FA 4W5WA 3MQFA 3B6IA 3NBUA 3NTLA 4Q1EA 3WLPA 3K0FA 4D2IA 5CDUA 4MWOA 5CUQA 2O2HA 3FRHA 4CDGA 4B6JA 1BVYF 2GJKA 1V47A 2ZYDA 3D7RA 3MMXA 4QXRA 1V8PA 2BM8A 2H2HA 1C4KA 2W6JA 4MYTA 4RMHA 2XKBA 4G5HA 3IYLW 3PUZA 3IVMA 2OFXA 4XYMA 1WKVA 1N2CE 1SEPA 1Y5MA 1ZVQA 2FRXA 2PKCA 3BJRA 1YR3A 5B58T 1KETA 1MKYA 4B1FA 4ENTA 5IDWA 3DKPA 2X2OA 4MQBA 1M1YA 3HP4A 1PN3A 1HY3A 1QS0B 1S8NA 3GJXC 1N8KA 1E9SA 1Q1GA 3DV9A 4Q3DA 3CBGA 3TS1A 2IH2A 5ADVA 1KOFA 2K2WA 3K0AA 3RIGA 2DUNA 4AF8A 3UGJA 4LDJA 3CVJA 2ZSKA 1GGHA 2JJ2A 2QTNA 3WLKX 2PMDA 2QM8A 2WUGA 2QB5A 4C6TA 3VKHA 2HQRA 3EEBA 4E88A 5ALSA 2J31A 2B5OA 4KMRA 2MYUA 3EYAA 4U2BA 3BH6A 2DULA 1SHJA 5DGXA 5HRUA 3PLAE 4KOEC 2I4MA 3SBXA 1AHNA 1DHTA 2DWUA 2NO9A 3JARB 4FOOA 2IE0A 5DXFA 5E9JA 2R62A 1H6DA 4DVGA 3DWIA 1N9GB 3LLMA 5AVKA 4BVAA 4CBVA 4OVKA 3ZCSA 2UU9B 4MS3B 1PDWA 4NV1A 4BB5A 3OOSA 3I8OA 5EJMA 2NVUA 4GOJA 1MVOA 1NRWA 1C0EA 1UBEA 2IEBA 1I2ZA 1QAOA 2PRJA 1RHUA 3ZWXA 1XZFA 3F4KA 4IINA 4CMEA 2QHXA 3IEMA 4J9VA 4ZT5A 2UVDA 1YL7A 3AEUB 2LTAA 5IS2A 4JB8A 2JJQA 5BORA 1D6MA 1K7CA 4RKFA 1Z36A 4Y6PA 3UXYA 5I8ZA 3DEZA 3LXRA 3GGOA 4TVBA 1WOMA 4YJFB 4TRJA 3T1OA 1XL1A 2NZUG 4UXHA 4LDQA 5ENZA 1HDZA 1SC3A 1CR1A 2ZR7A 4FCTA 4YI3A 3TQCA 1PI3A 3RYFA 1MU0A 1DQRA 3B3GA 1PL8A 2X4GA 2AT1A 1FXWA 3F1LA 4EY3A 1IG0A 3C74A 5H5JA 1WMAA 2A1TS 1W36D 3TI9A 1QKJA 1VRVA 2ONYA 4MGKR 3F49S 4IDFA 4LBWA 5LOVF 4A82A 2V58A 3LWBA 1KHHA 4CRWB 5LMZA 4ENUA 2F4VB 2ZJOA 4EEZA 3OX2A 3P2MA 4Q24A 4XIJA 4D26A 4I55A 3QLUC 3H1AA 4WXMA 1KJNA 1JI3A 2YMMA 3B1ZA 2KHZA 4B74A 4AG6A 2VJYA 2WPNA 3INYA 3TL3A 2OCIA 3D2LA 4PX5A 1IY1A 2QY9A 1R0YA 3FNFA 1U1IA 4MGEA 4P3KA 2IP1A 4YQFA 5JNLA 4I9HA 1XJWA 2W22A 3ZXSA 3KJEA 3OCJA 4ND8B 1YFKA 1H9BA 3F73A 4GX2A 1DDOA 3AR5A 1W19A 5HIMA 4OYRA 4TQ9A 1FFXA 3IDSA 2J67A 1B23P 4KE6A 4G24A 3K9FC 1YRHA 2WTXA 3BVPA 1C4OA 2BY4A 3Q15C 4TN1A 2W2TA 3SSAA 1BS1A 4I1SA 3QFTA 1A4UA 2PD6A 5JANA 3R4CA 1LC3A 1L4GA 1M2WA 4R1SA 4PAMA 5K8VA 5AKZA 3VOAA 2QMZA 1TQ4A 4CV0A 2C2GA 1RXVA 1BYUA 4ML3A 3THYB 2ZJ5A 1F1JA 1HWYA 1BFDA 1L8XA 2GWRA 2CMKA 1NY5A 5EPUA 1L1EA 1WV0A 1V1JA 4ILKA 5GGXA 4U5QA 2XVZA 3RUEA 4BC0A 3OF2A 2BE9A 3KL2A 4EFLA 3CF0A 3QPBA 1PJCA 3K09A 2CNKA 4EMSA 1JHVA 2I6QA 1CUEA 1GR0A 4YAOA 3C87A 4L76A 1RAHA 3HXPA 3IBTA 1TJ3A 3DBOB 4AECA 1JMKC 1X1EA 1CY7A 1Z45A 1SCUB 3OOYA 2EX1A 3S1SA 2C4KA 1JTVA 5ALNA 1DXOA 3MWGA 2HNBA 1T10A 1TZKA 3C5EA 3HMKA 1KYQA 4QUBA 3TIGA 1X1AA 1E5XA 3KVVA 3U4QA 4EFDA 3QSGA 4CT4B 1J09A 1J2JA 1PJBA 1I4WA 2IX9A 3QQ5A 3MD0A 3U4IA 2PLNA 3E27A 1ZIOA 2WZCA 3LF2A 4NAHA 4X1YA 4KAXA 4K26A 1VZ3A 3PSAA 4JU9A 1UFVA 3BOSA 4WKPA 2C07A 3JQFC 2IV3A 3KR2A 2QRVB 4C0XA 5F3DA 4ZZIA 2YJGA 3B12A 3GRCA 3OQMA 1F0KA 4TPKA 1SD2A 2FGJA 4YV2A 4YRFA 1LFDB 2HJSA 1K86A 1WD7A 2XBUA 3JZIA 4N49A 1YDEA 3I1JA 3I0ZA 1DC3A 1RYFA 3N70A 4FTWA 4EA8A 1P5FA 2WHQA 1CDOA 1GAWA 2RHJA 4HTFA 1SO8A 1JNXX 3L4EA 1NYRA 5HYVA 4G0WA 1P91A 2ZI9A 1FNSA 1SR8A 2WM9B 1AUXA 1RABA 3P71T 1DL5A 4HYTA 4YDHB 2EW2A 5BR7A 4PV7A 5JVDA 3W6UA 4BGDA 1DG3A 4ZT7A 1O6BA 2E21A 1SZJG 3DLCA 1CLEA 4DA6A 4ZCRA 1N8SA 3I05A 1Z63A 4GQAA 1OC4A 5DTEA 4G37A 3WNZA 4X6UA 4EO4A 4RK1A 3WV5A 5L7TA 1KYTA 3R7SA 4QX6A 1SK8A 5LP1A 1LBIA 4KQEA 2A5YB 4TV8F 5E95A 4YHHB 3ONNA 2C7OA 1XAHA 2B4TO 2EV9A 5DISB 4ATNA 5CITA 5F7OA 5L95A 4DKJA 3ZVNA 1Y63A 4MUXA 4ARZA 1CXZA 4ZQFA 3E6AA 1E4EB 2NSJA 2UZ0A 4Y2QA 2NO1A 3MSXA 1KIFA 4RMGA 2E0IA 4MQLA 3EVEA 4AZ0B 1ZL2A 3LUHA 4FIZA 2QN8A 3TD6A 3UB4A 1PLKA 4MI1A 3AWDA 1I7PA 3NYIA 3EGCA 3SQNA 1CRLA 1EHYA 3H3FA 2VQ3A 5HDQA 4GOKA 5LFAA 4GPZA 2LVBA 4A10A 1CQIA 1AKRA 1BVHA 1C9EA 1DDGA 1K98A 4AJIA 3R0JA 4DCNA 3ZWWA 5KC8A 1FMFA 1EQAA 2DMRA 3SSNA 3THWA 2OILA 1D0IA 3LNCA 4GT1A 1PNOA 4NESA 3VTZA 4ZAGA 3WQSB 2C42A 1DLIA 2FWPA 1LJLA 4PPNA 3FDXA 5GTDA 3WLRA 1WDLA 3JQBA 1KI8A 4IAOA 5LU8A 4TMKA 1HT0A 1JLSA 3IALA 5TQJA 1B2RA 2JHGA 4FYXA 4F11A 1LVHA 2NN3C 4TV9B 4KG7A 1G8HA 3L7KA 4IX1A 4Q4AA 4JLSA 1W5BA 4BNWA 1HNXB 4YJGA 1CEQA 2VCHA 3QVVA 4ESEA 2C61A 2YVUA 3DDNA 5ESRA 5FWXB 4BO6A 1UBLS 1E7SA 2GCIA 3TTYA 4DG9A 5JD4A 2R66A 1AKTA 1VC2A 3VRHA 1LJUA 4HGRA 1TT5B 3DKVA 3JQ7A 1IJFA 4WASA 4CT5A 3ESRA 4AJNA 1XPUA 1MEJA 3VMMA 2PX0A 1DQPA 2QR2A 4NXMB 3CZCA 2JLYA 2MSDB 3V8RA 3C3WA 4YALA 1TPZA 3PUWA 5BV0A 3EZLA 1Z0UA 1TM7E 3VU0A 4E13A 1V5EA 4RQUA 4FNGA 1FFWA 1W8IA 5DX0A 1VECA 2HQBA 3GZTB 4BCCA 3MB8A 1ZJWA 3EF1A 5A5DA 2JZCA 1DJLA 5BMVF 3EFEA 1PX0A 4IDPA 2DTDA 1L8OA 1UBRS 2GAIA 2AQKA 3E84A 2MINA 3L82B 1AMOA 4NCBA 2IPMA 1P1RA 1CTQA 1SKYB 4GI5A 2IP2A 5SYNA 1A88A 3GP5A 3PR1A 3G5LA 3LQ4A 4PG5A 3TZLA 5CEJA 1M3SA 4E5UA 1FW6A 1O54A 1AB6A 1VHTA 2FPSA 2QMQA 3AUKA 4PZDA 4IJQA 2Y92A 3DMYA 3D0OA 3G02A 4LCJA 4DGQA 3KUCA 1KIAA 4AF6A 2P68A 4ZZ0A 5LNK6 5BV2P 4ISCA 4FC6A 2GTPA 3LD9A 4CF7A 1P18A 3C7CB 1I13A 4ZGGA 4LVNA 4CLOA 1S6YA 3H4MA 4PAOA 1Y7IA 5H02A 5CXSA 3KQVA 1J06A 1P9LA 2RHTA 1F7VA 3QJYA 1QMGA 3EIUA 3WDKA 2IIBA 2OVFA 5DSTA 3TRFA 1CP2A 2Q3BA 1DXQA 1AV6A 4Y98A 4RNCA 3JQEA 2C9YA 4LWPA 4OL9A 3T54A 5LD2C 3HMQA 3MG9A 4WNYA 4OHOA 3MIZA 5KAPA 1QE5A 3WLHA 3TAUA 3K2IA 2P40A 2XXBA 3KQQA 1CUGA 2GXUA 2GPAA 3NNNA 4G4GA 4II2A 4QBHA 4KAFA 3ZD7A 1MPTA 2W5UA 2UZ3A 3QEKA 2C0CA 4MK4A 5DK6A 4K03A 2A5DA 1RJ9A 1DCFA 2GKGA 2D2EA 2HPHA 3GRZA 4WNIA 2M1ZA 1FJHA 4NG4A 5K8TA 3X2FA 3TLBA 4EGAA 3SYNA 4S1PA 2YMLA 2AA3A 3I2HA 4IEFB 2OBLA 5H0IA 4IIGA 4EF5A 3C8MA 1FYVA 1V45E 1Z7BA 2P27A 3PFNA 4RH1A 4PLZA 5D6OA 3ROTA 3ULKA 4G81A 5C5IA 8ATCA 3TRHA 5JEEA 2JLQA 4DGSA 3UXHA 3FLAA 2ILTA 5HHTA 5LJIA 1SQ6A 2Q3LA 2Q27A 1MGOA 1NBHA 4GIBA 2V7QD 3GFFA 5JS8A 2I67A 4B3HA 2ZSHA 4HDQB 1HE3A 3EZFA 4LNHA 2NO6A 4KI7A 1PDOA 2QU8A 1A2OA 5D7NA 4ZCSA 2PE5A 3AVXA 4OD0A 1WM1A 1WKCA 1QFMA 3QP9A 4WVLA 4E30A 5A1JA 2QW1A 2Z9CA 2ZE7A 1I3MA 1NZDA 3MZ0A 3LBNA 4YQYA 5M29A 1KP2A 2GAOA 3C6MA 4I1RA 2DE0X 2X8JB 3CF6R 1NR1A 2QJFA 4NZ9A 2C97A 1Q12A 2R3SA 3PHCA 3SQLA 3OT5A 4KE9A 1AC5A 2QT0A 4XFDA 5G53C 2B1QA 2NUBA 2W90A 1TM1E 3ZTTA 1Y1KE 3NCTA 5EMJA 4EKDA 2JFYA 1XZAA 3I2IA 3C8UA 1OLUA 4Q3EA 2PUDA 4LRSB 3J81A 1N2JA 1F8UA 3NKVA 1DKQA 4KQMA 3RUHA 5JROA 2CK3D 4E5KA 2RGBA 4U3JA 4CEIB 1MORA 4IILA 2WAXA 1XEXA 2VAPA 3RBAA 4C2BA 4MDEA 4C78A 1R6AA 4FYMA 1J2YA 4CWAA 1NLMA 1YUNA 1YWGO 4M0DA 3T3DA 4L08A 3ADCA 5AK0A 3TTSA 3ZZTA 1IN7A 2PR7A 3EHEA 4AAYA 4EB3A 2MHCA 4G8BA 4IMIB 1NYLA 3ENWA 3FDIA 4GLBA 4LHYA 4EAQA 2AZMA 4RTSA 4FGUA 1U0LA 4TYMA 4L27A 2HF2A 3O4GA 2QD1A 5KNBD 2RHRA 1EJ2A 3VA7A 2YWGA 1BMTA 3OO1A 5LWQA 3KS9A 3SSMA 2V03A 1CR2A 1JGTA 2YVKA 3PGXA 4Q4JA 4F9TA 4OK5A 3LV8A 5KYXB 5B3LA 3R3WA 1G19A 3MELA 5EP3A 4FHZA 1DFHA 4MRMB 3BWYA 1SCDA 3C5WP 2IHTA 3PWTA 4HT3B 3VGJA 2I0FA 4J1TA 1N34B 2Q3FA 5HQJA 2YV3A 2JGKA 3PNQA 1M6VA 4R83A 4EZIA 3WKEA 1II0A 4FE4A 3ZHSA 1E20A 4EZEA 2O2ZA 3R6GA 1ZCAA 3W6OA 1IXYA 4DR7B 3I62A 1OFIA 2H2FA 3R5XA 1KSFX 5BY2A 1UT8A 2BGRA 2PL1A 1EX7A 3PUKA 1EK6A 2FW7A 2QNRA 5CYGA 1WE2A 2VPQA 4RZXA 3FWZA 4RTKA 3RABA 3EF0A 2VXOA 4R3UC 4BXOB 1VBMA 2O3UA 2VP4A 2ZU6A 2OXRA 1R6TA 1A71A 1UC8A 1JZQA 2YUIA 4DMCA 2OL4A 1AH2A 1E99A 3EIFA 1OROA 3PX2A 5FKJA 1KRXA 3TSYA 3TLMA 1KO7A 1SUIA 3E23A 2MOKA 1J8VA 1NLYA 2V5UA 3U9LA 1P7WA 4QTXA 2O8EA 4JUIA 4UNPA 1KYWA 5IAGA 3WMRA 6YASA 1EX1A 1P3DA 2I6SA 3JD0A 2YC2C 4LJLA 3V6LA 1IQPA 2P2NA 3I9V6 5KTRA 4HAIA 4DVJA 1RRKA 2OOSA 3AUTA 5G4LA 1V9LA 2H57A 5CA1B 1JFTA 1CS0A 2XXAB 4MIKA 4KB5A 1HTTA 4O5AA 1E2HA 2XAAA 3FYHA 2VPXA 4IOKA 1Y3AA 3O94A 4B76A 2EEZA 5DGDA 3T3GA 3HVHA 4J1NA 4J0CA 4KC0A 4TS3A 3UMCA 3IAFA 4W5TA 2LNDA 3FNRA 4IWYA 4QOHA 1REQA 2GM9A 1SPXA 4K8RB 4WCVA 1PR2A 1TGVA 1IJKA 3IKMB 3WI7A 4YRAA 4RZ2A 1F4VA 1ZH4A 3CN7A 4FFVA 4J4BA 3WLFA 3NWJA 3K70D 2R8BA 5SZKB 3MS2A 1GSOA 5KJCA 3D4LA 1NF2A 1DWPA 1PE0A 1KK0A 3K16A 5CFMA 3K70B 3CR7A 2PBZA 1GQYA 5CA0F 1II8B 2QTLA 3B9QA 5REQB 2C0QA 3WK7A 3BXFA 4CMIA 2F48A 2Q4RA 4PGGA 1JHXA 1H05A 1E2NA 4IRMA 1V95A 1S96A 1R4ZA 1H23A 3DFZA 1U8UA 5FXMA 4E15A 2AC7A 5BW8A 3WL7A 1HETA 4FKMA 4EGFA 4A8TA 1PG5A 1I6MA 5KMGB 1DAEA 1Q6ZA 2J3LA 4R05A 4TTJA 2OFPA 2P4QA 1MBZA 1EFKA 5B1DA 1GUFA 2FLWA 3H6GA 4QA9A 2VNSA 3G0IA 1HDRA 3SF8A 1JDNA 2CFOA 4AXXA 4JJ8A 4ZOEA 2FEPA 2C4NA 2ZFUA 5B30A 1RWPA 5ADHA 3U7HB 4HQFA 2QF7A 4P36A 3BIJA 4CM9D 3EVCA 1SVKA 5K45A 1R0SA 1XAGA 1YGPA 4PC3A 4R01A 2BFAA 2LCQA 4OY3A 3QY9A 2M6SA 4X84A 1G66A 4PQFA 4YVFA 3W2HA 1OU4A 4BX0A 3CCBA 4G5GA 5C31A 3UPUA 4TL6A 3A4MA 2XMDA 3M6VA 1I30A 1OVMA 1Z4MA 1FIUA 2NT4A 1Z6TA 4LPSA 2I29A 4OH1A 3KFXA 4RTJA 1EVQA 2BZ1A 2YTZA 3FF4A 1ZK3A 2D1QA 3D4PA 4NCXA 5D2CA 5LQJA 4HN4B 5GIOE 2LCFA 3ET5A 3QLTA 4AU1A 2IXAA 4IF6A 4Q3CA 2AD5A 4DTCA 2JW5A 3M8KA 3I12A 1NASA 1YDGA 3NKFA 4FBMA 3AFHA 1D1TA 1CFZA 2YMQA 4IS2A 2BFNA 4HP8A 2WWGA 3VSEA 5JQGA 1RWVA 2VTBA 3WL6A 2RONA 3DO8A 2C1ZA 3F4BA 4P7BA 1S2OA 3T7IA 1V4BA 1Z6AA 1JDBC 3AZPA 2PRKA 1GAQA 1ECJA 1GILA 4KKXB 3K9HA 2EIXA 1E8DA 1JTFA 3R8XA 4CTMA 1GQRA 4FI3C 3VZDA 5EJ7A 3RUFA 3WP0A 1L9XA 1T4CA 2C96A 3RSQA 3NEYA 6ABPA 1B16A 3GJ3A 5KYUB 5AKGA 3ORHA 1US8A 2AOUB 5D3MB 5AO9A 4QXMA 1HFEL 4TL9A 5HIIA 4X66B 3FYUA 4LZJA 1N0IA 3TGPA 2E5LB 2OV4A 5H4GA 4YUYA 1IZYA 1H2EA 1CDEA 1EWTA 1SC4A 1WVIA 2NSHA 3GJ8A 3ANTA 4ZOLA 1DXHA 2WTBA 2C4HA 1A76A 1HPLA 1BEEA 1D2AA 4GLLA 3BGIA 5DBOA 3Q85A 4QU5A 3WJ7A 6REQB 2GR9A 3A27A 1V37A 2YS7A 4D9EA 2Q62A 1KAHA 2OZPA 4OF4A 1SC9A 4JI3B 1U8TA 3AFMA 4W82A 5K3EA 3FDFA 5K4HA 3OD5A 3PVCA 3L9XA 4LGCA 3W6ZA 1Q11A 3THYA 1TM3E 4TKMA 1ZUIA 1V1MA 5L45A 1IVYA 1JDJA 1ZNZA 2VP5A 4DZRA 2I2WA 3CR8A 2J3MA 1I5RA 2MYNA 3LFTA 2A59A 2WU4A 4OXNA 4PZZA 1D2EA 3TEMA 4P0PB 2GYUA 4DCUA 4XVHA 3NU1A 4D46A 4ZJYA 3ISTA 2WA1A 4DIEA 3L8EA 4MRSA 1E3MA 2FQQA 1AKVA 5B1SA 5E4FA 5JZVA 2EQAA 5JWHA 1EE2A 1IE3A 4EJSC 1UR5A 4WRRA 3AF3A 4L0CA 1LBTA 2ZRJA 4LYJA 4KMOA 3I1IA 3TINA 1BEZA 1WMBA 2Y1DA 5K1ZA 2RD2A 5HF6A 5JJLA 1JSCA 4S05A 1C1XB 5EIWA 1P7ZA 2WJWA 3EXFB 1EG7A 4X91A 1ELOA 1AMNA 4MI9A 2WUVA 3DZHA 1WUTA 2PRIA 2W2VA 4AG3A 2A7XA 4CVNA 2FPLA 4RV5A 3C7KA 4M7PA 1B0AA 3CQ9A 4G1EB 4RZ3A 5EP1A 4HX5A 2P4UA 5DBIA 4IG4A 1K7YA 5FA6A 4CM8B 3EXG2 4G65A 2BRUA 3KC2A 3RT1A 3GD5A 3OQ6A 1Z39A 3RS5A 1TRHA 2OHIA 3RVSA 2PUCA 4XTRA 2VJMB 1Q22A 5C1DA 4KKVA 5KSOA 1P29A 1L7RA 2GD1O 1DAKA 1T9GR 2Q5FA 1SOMA 1NQVA 2VJNA 4G2NA 1JG7A 3U4CA 2PBFA 1M6HA 4QU8A 2JFVA 4EELA 3DT8A 3ADBA 3KTAA 1FLAA 1ZBQA 5ARBA 4MZXA 3R7BA 4J2OA 4LI0A 1JQ5A 4OGFA 1OI2A 3UJ3X 1LF5A 4GYWA 1JR3D 3ZH2A 4UDXX 2YVLA 2KQUA 2DG2A 2YRFA 4L6IA 4BNNA 3KO8A 3KYCB 1XYYA 2BSQA 1YKFA 3AY6A 4IZHA 1Y8QA 1EZ1A 4TN5A 16PKA 5AH0A 1DKRA 4CL3A 3OZDA 2V5VA 3MWDA 2JD1A 1I10A 1UMBB 3BT7A 2G5PA 1E4EA 1OKKA 2C54A 2BJHA 3RUCA 1VL2A 2VNAA 4XDYA 3BH7A 4DWWA 2OECA 3KNZA 3TW8B 1E9BA 5B6IA 2X5XA 1GPMA 1I36A 5A0TA 1GZ3A 1XNJA 4Q7QA 2UZ1B 5CCDA 4L8LA 2J5XA 3FNBA 3G3EA 1BFKA 1P75A 2H1FA 1RU3A 3SHVA 3ZVRA 1R37A 2VJLA 3D1VA 2P2ZA 2W83A 4KVZA 3ICOA 4ER3A 3QKUA 1MEEA 4LSZA 1KBQA 2ZUVA 4MV1A 3U3KA 2HRZA 2JH9A 5A3SA 2UVQA 4B4WA 3PQDA 3QY0A 1V16A 4E2FA 3FSJX 3Q6NA 1QK5A 1UM9A 4IDOA 1RM3A 4OHYA 4XGQA 8OHMA 2WJAA 4WESB 2GH1A 4Q4HA 1CZKA 2X41A 3E7XA 5FWDA 4X6YA 5K0SA 3C39A 2HV8A 3I3OA 3QX8A 6CHYA 1G5TA 2C29D 5COAA 1EXDA 1NVUQ 1U8AA 2VRCA 1RYEA 4UTXA 4N82A 3ZIDA 1H3FA 3A70A 2BF4A 4I99A 5U4QA 3KJFA 3W3ZB 3DHVA 1WXHA 2Z3ZA 3E7WA 3QEJA 1EFAA 2X8AA 3WADA 2Q45A 3HDHA 5DSZA 5THQA 3V4VB 2QPLA 3CB4A 1Z8HA 4O2BA 5CH8A 1U3GA 3G7SA 3AF6A 3UCFA 4D92A 1QB8A 3VR5A 3FIUA 3Q2OA 4Y2GA 1C8BA 4D9MA 5J3JA 3KE8A 4FJ0A 4B09A 4JUCA 4WXPA 3K9BA 2YDXA 4C3ZA 4DV5B 1GUDA 3OLVA 5DXAA 1U3TA 4K88A 4ZOCA 5ALFA 1P77A 4MTLA 3JS5A 4P31A 2R7LA 4RKYA 2FN3A 3MM4A 1I5EA 1YZYA 4MYDA 1H8HD 3BQ9A 3EG9B 4JYBA 4R2MA 3MT0A 2J9GA 1DJNA 2X3UA 1EA5A 4OHZA 4ON9A 1HV8A 4BX2A 4ZHQB 1M5TA 4B33A 2VAVA 3JAMA 2XLCA 4LFBB 4H3HB 1C2YA 4DG5A 1BMFA 1Q0HA 2FWNA 1XD9A 3M4ZA 4TWJA 1NT2A 4CF3A 1IUOA 2NYUA 2WABA 4ID3A 1ZSYA 5KQMA 2BF7A 4TTRA 3PFFA 1UDCA 5C46F 3I5UA 1PJRA 1T6ZA 3FDJA 3DD5A 5IRCD 1AQ6A 3CZPA 4JP1A 4XGIA 4YRTA 3R7FA 3N75A 2LRHA 4KFSA 4MICA 2ESRA 3SN6A 2O59A 2BMVA 1PR9A 2C58A 5FADA 1UBOS 3G1WA 3GPBA 3SM3A 4OHXA 5K0BA 1U11A 1HSOA 2HWWA 3RC7A 4CW7A 1WPRA 3RVRA 5TY0A 3JAKB 3PENA 4PC7A 1DBRA 4N8SA 4N7MA 4Q4DA 4BWGA 4C04A 3RWBA 3PJRA 3Q7RA 1KJ9A 3KYIB 2MR6A 2RHGB 3TNLA 4ZI7F 5JWRA 4IJWA 5GONF 2DTEA 3SS9X 3WB0A 2XNKA 4JA0A 2XR1A 4ECEA 4DUGD 4P81A 5I7UA 1RKBA 3J81k 3T5AA 1C3VA 4WL0A 3T5GA 2P9BA 2PGAA 3HJGA 1FRNA 2Q5LA 4JLAA 3QWBA 3HDVA 4FHCA 4JMLA 2BFDA 4Q7KA 1Y81A 2IL1A 3LOUA 2X7XA 1E2EA 2CNWD 5IWCA 1E9RA 3AKDA 3DHWC 1HYGA 2R4QA 1ATZA 3MF4A 2VEDA 3DMTA 3N2YA 5AJUA 1L0BA 4N54A 4HF7A 1P0CA 3M89A 4M83A 2ACVA 4DMFA 2PPLA 3A37A 4FNMA 4OQYA 1NUPA 4ZVSA 2Y1KA 1L1FA 1VJCA 4MCAA 1J7JA 4Y1GA 3G2LA 2CZCA 4ZEOA 3RTDA 1PR4A 4ZARA 4ZK2A 3MJRA 2FOXA 3H99A 4JT9A 3SZ3A 1EUQA 1N2ZA 1PL0A 4GSKA 1W49A 5DP2A 5FOWA 1LTQA 2Y05A 3KOUA 4CMJA 2QSUA 1EDBA 4BP3A 3HL0A 1M6EX 3OFND 1L8QA 2ZJZA 2REXB 3DWFA 3P2KA 1N6IA 3HYRA 4UTVA 5DK4A 1CBUA 1ZS9A 5JARA 2IS4A 2JA1A 2W6MA 2O2EA 2ZIWB 3GUYA 5D85A 3VC3A 1VE7A 2G5TA 1Z47A 3I61A 1RJGA 1Z56C 2FK7A 4V1CB 4YR7A 4C7MA 4XQ9A 5CMLA 3R0ZA 5THKA 2FEKA 1KS2A 4M54A 2BBWA 1SKYE 2O7VA 1L5LA 4MIYA 1N5OX 1Z3CA 4AUMA 3IO3A 2BM9A 4N18A 3NASA 5C8VA 1ZHOA 2P3OA 4UBJA 2JI8A 1V8ZA 2GSDA 2ZE5A 2I65A 4HGOA 1RWQA 3LBIA 4LWQA 4YMLA 3HVKA 3PPIA 4FGWA 5F2OA 3LT1A 3K1TA 4TL8A 4AJEA 4CM7A 3UGKA 3HV2A 4E51A 2G9UA 5F2EA 3TNDA 1O5IA 3O4HA 4RESA 5ECDA 3HY4A 3G9UA 1C50A 3N28A 3DMDA 2G88A 4F3NA 5LP6C 1I7LA 1U5BB 5IZCA 3EVAA 4XCXA 4CQJA 2P9CA 1D2CA 1LW7A 2IGTA 2G4LA 2HD4A 4XFJA 3SFZA 1CR6A 1FLVA 1X1QA 3BRSA 4HWSA 5DNEA 4IJKA 4XRGA 5BNWA 3LUKA 4ETWA 4M36A 3B2EA 2VK4A 1ODTC 4CMHA 5DOZA 4LRTB 2UZIR 1X14A 2VDMB 1NZJA 3FCUB 1CFJA 5K5EA 3EH1A 2CVFA 2PJUA 1L1RA 1TC2A 2QYTA 4J6EA 4DDMA 1NSYA 2R8OA 1KDTA 2Y0EA 2JAOA 5D1HA 3AY7A 3DDOA 1JJBA 1XQXA 4MRMA 2A33A 3CVUA 1P7YA 2W6JD 2EWVA 5DBEX 5CG1A 2IHKA 3AC0A 4EGCB 1T91A 3AVPA 5FJJA 2E9SA 5GY7A 4Q21A 1FDVA 1KR5A 2R4TA 1QE0A 3PFIA 4PYRA 1W47A 2CHEA 3ABRB 4ZYUA 4FDAA 4NOJA 3MTEA 3ILVA 3L5OA 4DLNA 4MWTA 1N3LA 3U61B 1BCSB 2VAMA 3FY4A 2JFOA 2GLUA 1O0CA 4DNFA 3E5RA 3VVLA 4QYXA 2CB0A 1XTIA 2H9YA 1R6UA 3Q5EA 2BM1A 1XMJA 3IT3A 4LRUA 4CG1A 1S4MA 1Y1QA 2LKCA 3HJUA 1ISRA 1HKHA 4YCBA 4Y18A 2NQ2C 1DJMA 1ADGA 3SU8A 3KOYA 1GTZA 2OGZA 4J0KA 3PLNA 2C2XA 3NIGB 5D3QA 3H9JA 4RMIA 3CS3A 4BNDA 1UPCA 1NDHA 2CXTA 3T0IA 4B6RA 2BUBA 2KI5A 5AJHA 3VR6H 1AKYA 1K92A 3QVOA 3QA9A 1PJ8A 4QE3A 2YS6A 3EQ2A 4DLVA 1K2VN 1TT7A 3ZE6A 4E07A 1JJVA 5DI9A 1JI0A 3PGKA 1KO4A 1OAOA 3K8OE 1LS1A 1Z83A 3NAMA 1BSVA 1JQBA 3R3YA 3MCZA 3PG5A 4NCKA 5F7XA 4RWZA 5CA1A 1J5XA 5DHUA 4BMPB 3EOZA 4CMAA 2XXAA 2DOKA 1T2VA 2A5JA 2MDTA 4ETMA 4OU5A 1FC0A 2ACWA 2HBZA 3KALA 4PLTA 3FLBA 2DHDA 4IIDA 2QX6A 1QPBA 4LYGA 1CF9A 1N92A 1TZBA 2CLDX 3NKLA 4GPIB 2AX3A 3U0BA 2J3JA 3VPFA 5FV4A 3GUZA 4UBNA 1XD2A 4HXEB 4AKGA 2J6IA 1E2FA 3I2FA 3FVRA 4QJIA 1XC7A 2FU5C 2YYAA 2IITA 3L77A 1EK5A 3OLWA 4IGKA 3OU2A 4LBVA 3HN7A 1M2NA 3EJ6A 3MNFA 2UAGA 2VG8A 5REQA 4JI8B 4LUCA 4YMIA 1SKQA 4LWOA 3LX4A 4MAAA 4RQBA 1OLSA 1TAUA 1ZA1A 2GBLA 1T9BA 2R1TB 3HV0A 1WETA 1GFWA 1GYQA 2L0XA 2VJAA 4IOJA 4JX8A 2BCJQ 2Y3IA 2XTAA 4BRZA 4TX1A 4H7DA 3OMXA 2G71A 5IM5A 4D0NA 1QANA 4KO2S 4MGYR 1JWBB 2ZXFA 4LG1A 2PX3A 3FAZA 4HMQA 1W4LA 2F3RA 1EVEA 4I2VA 4EM6A 1M5UA 4RJ2A 3FWHA 4G25A 4P35A 3H9GA 4L8VA 2JNWA 4RY8A 5KOHB 1GM5A 5ICMA 2IS1A 3DEAA 1KEKA 3E7DA 5JECA 2UXCB 3BMXA 3OJFA 3TFOA 1D3AA 1R18A 1X19A 4ZAXA 1P44A 4M9SA 1VLJA 4A6EA 4EF6A 4F4CA 4MLPA 5JS7A 2CSXA 4WLEA 1WUYA 3WJAA 2EJBA 4QZVA 1ACLA 3L8GA 1IHOA 2R6GA 1CDZA 2DUWA 3LT2A 2JATA 3K2BA 4KPEC 5EE1A 4YJ3A 4UU0A 4MUGA 3WP1B 5MHTA 5ALGA 1IY8A 3NBMA 1KJZA 1TL7C 3BMNB 2IIVA 2J1LA 1R9JA 2Q5OA 1AGYA 3MUFA 5I3ZA 3FPEA 4JYMA 3EASA 4IDQA 1NBEA 1XZGA 2XGSA 5EWJB 2F8LA 2PLRA 2I66A 4FOPA 3UQZA 1DP4A 5HR5A 3EXIB 1K6JA 1CHNA 5AK5A 3PIDA 3NG1A 3KAPA 4NYIQ 3HTXA 5CFOA 4UHKA 4CG3A 5B58C 4XJSA 3TTTA 5L3QB 2YVQA 1U7DA 3PR3A 4O2AA 2YJNA 2FPXA 2B2XA 3D8HA 3P19A 1BO6A 2QN9A 4PSVA 3DDSA 4MV3A 4A23A 1ISHA 4QXPA 1M6WA 3OPNA 4EVIA 3C1TA 2PL9A 1WOYA 2C9OA 4EG7A 3GXBA 3WLMA 2XUAA 3RUPA 4DEYA 4MKXA 4JEIA 4Q93A 4TWAA 4W1QA 3URMA 1EXWA 4EHJA 5AVOA 3LL4A 4RF4A 5HRCA 3GJ4A 1VZ2A 4F2PA 4AL4A 3ZIUA 1OWNA 4PG8A 5B3JC 2OHXA 4LHXA 4TYPA 1B6SA 3H97A 4AY2A 4KDFA 3WA7A 1J2TA 4UHJA 1FDWA 2OK8A 2FFJA 3BHJA 3GLGA 3WRXA 5KX5B 3EXEA 4ALLA 4NBVA 1VA4A 4ARCA 1GDHA 2F8SA 2DGDA 1EWYA 2YV5A 1V3UA 1D2HA 1UWVA 1Y42X 2ERYA 2H16A 2QN7A 3OE5A 3QTTA 2IQIA 4Y6QA 3WYGA 3ZJTA 3ECSA 5TSDA 4PS1A 3B1JA 5ALPA 1RCUA 4CU2A 3GZ4A 4Z0PA 2AG5A 5KTNA 4RDXA 4HNAB 4PF1A 3SE7A 4HEHA 4IIBA 1W44A 1U0NA 1ULSA 1VL6A 1DBSA 2J0VA 1WCV1 4KLCA 1SUWA 4R1TA 4B3SB 5CNJA 3B6EA 5AVJA 4EYQA 4YPFA 1K6EA 4ENRA 3CG4A 1DO0A 1A69A 4MVJF 4IZ6A 1ORHA 2QLLA 4ZXPA 2XCRB 3EXFA 2PWYA 4MEBA 2IYWA 5FUXA 2BJWA 1BDHA 2CDRA 4MW0A 1F9AA 2YWXA 4NX2A 4FS8A 1SVMA 1Z6QA 2ZRDA 1E6EA 3C3BA 5T5QA 1DAMA 1F2UB 2PLFA 2VRWA 1MO5A 4C07A 4C4PA 3UMMA 1N33B 1F8FA 1NPYA 4LISA 3AERB 3K9QO 3QK7A 1CB7A 4HLUA 4X71A 1U90A 1SXHA 3L0BA 4ZEMA 2VJMA 5FBLB 1JEAA 3SQXA 1WTCA 1J49A 1IHDA 3P2OA 4QQ8A 1Q14A 5ISMA 2C5AA 4PYMA 4R8LA 2EATA 4NZZA 3EOBI 1JSRA 4CZ2A 5KVVA 3CWQA 4FU0A 2VDWB 4MARA 1BKYA 5KINB 2VTEA 2ZSUA 3MGGA 4L28A 2FMIA 3BZWA 3GJZA 2XUQA 3B9BA 1PL6A 4X6XA 3QVGA 2CNBA 1JIJA 3NBFA 2D5IA 4MUJA 4MPJA 4UMEA 3SC2B 2YWBA 1FMLA 1QFYA 3UW3A 5J63A 3VR4D 1JV2B 1JUDA 1M10A 1JIVA 4KGZA 2YOHA 4W7SA 4AICA 1U02A 2AKYA 3UOGA 5HKBA 5IABA 2AYYA 1SY7A 5TIIA 2ID7A 2HIAA 2QMHA 3PXCX 4M0MA 3JZDA 3DC2A 1UMBA 2N47A 1TVKA 2RCYA 4ZMBA 1JB1A 4MIOA 2VQ6A 4ZV4A 1BD3A 3HYLA 3HB4X 3RVQA 5FOQA 4P7FA 4LXQA 3W5UA 5IUNC 3B3JA 3MEQA 3SJBA 3VNUA 1PFVA 1D1PA 5CJJA 4EY6A 3W3AH 2XMQA 1Z4KA 2HUPA 3GFBA 4DV0B 2R6ZA 2HWXA 4I6JA 4QGHA 4RTLA 2OKGA 4CF5A 2AR9A 4F2GA 3TLYA 2FP4B 3GEEA 5EVCA 2C57A 3NX4A 1UEXC 4JJEA 3V9AA 1LLQA 1WHSB 2R8XA 5CP8A 3ZOZA 1YB1A 4MJ7A 1KQPA 3VJMA 1O94C 1JS1X 4PQGA 3S40A 3CU5A 4PFSA 4YYEA 4YBZA 1S2GA 4ASUA 2B35A 4P2GA 5DSXA 2ZI4A 3NOOA 3HP7A 4H18A 4OM8A 1Z4QA 1JEYB 1QQBA 2PGNA 1ZVVA 3DCJA 5F1YA 1NMSA 2IH4A 1K5HA 1XZNA 3FRJA 1XU7A 3DTNA 1JFSA 1N0WA 3T4XA 2UYOA 3F2IA 3LG2A 3RUAA 3KIPA 4C7BA 4G9EA 4B17A 2RIRA 4B45A 1V25A 1EUDA 3QNWA 1A98A 4Q9DA 4G4SO 1G7RA 4JXZA 1NVGA 4LWZA 3KPYA 3GIDA 3SLRA 3EAGA 5LKAA 3HFGA 4YMUA 4QOEA 5GM2A 2AN4A 4B80A 5BUQA 1TZMA 3ZQKA 1CUDA 3AJAA 1KFKB 1GZUA 5BVHA 5BWOA 4RKRA 3GJ5A 3GHYA 3KK0A 2W4MA 4BEVA 4UTOA 1LW6E 3O4IA 3D81A 1SUSA 5CVVA 3ITEA 3N0XA 3NANA 4JR2A 2NO5A 3NVAA 5JHGB 2M98A 4BMYA 4CL8A 2Q9UA 5EIHA 3OCVA 2Z5GA 3KEMA 1YHNA 2O07A 1AY0A 2GUGA 3H9UA 4V0SA 4D0GA 1VIDA 4O4JF 3AW8A 4AKTA 4OLHA 1OGYA 2O8VA 2WIFA 4TQGA 4R1MA 3AUFA 2FF7A 3LCCA 3LRPA 4ZQHA 2IY8A 2WQ7A 4YECA 2N0SA 1OT5A 1NC3A 3HR4A 4KYIB 3SWWA 2X9NA 4INAA 2Z8YA 4L9SA 1GLNA 2XY4A 2YWFA 4Y1FA 1CUIA 1Z7WA 1FA9A 3VJKA 4C7XA 2ZI3A 5BYAA 2CUTA 5TGTA 3GVCA 1W2GA 2XGJA 2EJVA 3KR9A 1RXYA 1NWHA 4AJKA 4E2ZA 2Q6VA 5IDVA 2C92A 3EW9A 3IL2A 5LD2B 2C8LA 3PFGA 2W6NA 4URHA 2X4LA 2H3EA 3GN1A 5IARA 5BPFA 3FDZB 5I7OA 1MW8X 4LFAB 4G84A 3X1WA 3OBIA 1SBQA 3HCCA 3MJVA 3ZWNA 2PKWA 1RRVA 4UM9B 3RV3A 3INRA 2C4VA 2FFHA 2FQWA 3PDWA 2IZ0A 1IATA 2BBOA 5E38A 4HUJA 1M1NA 4B3XA 5ICSA 2CLIB 4RTPA 4WE3A 3G49A 4DW8A 4GYKA 1IC6A 2HHLA 4DANA 3FMPB 2WF8A 2PR2A 4N3NA 4V0ME 3WQBA 3NXKA 1YB2A 1E2MA 5LZ4A 4JJGA 1ACJA 4BQFA 1ZNYA 3PGVA 1FZQA 3OETA 3G2HA 3BUSA 4PC6A 4RTQA 3WYAA 4PY2A 5G2OA 5IYZF 2C88A 2WJHA 1M74A 2LDBA 2BKXA 3A04A 3G1TA 4D9IA 3H3XA 1P72A 2LP4Y 4YFYA 2HA7A 4CEHB 3C7TA 1I7DA 3HJTA 3EA5A 1PJ2A 4KQJA 4LGMA 1ZXXA 2P1DA 4CCYA 2OAEA 4EI8A 2QSYA 1OGJA 5EUQB 1G2OA 5DM70 2WIGA 5K3CA 3HO8A 3QKIA 2RKBA 2C0PA 2CVPA 3VH3A 2RAFA 4CKEA 2DH6A 2IXFA 3BBLA 4EA9A 4G0UA 1NI5A 4V1CA 1GVHA 3V6MA 5IUJC 1K27A 4I4CA 4TKUB 1LLUA 2YYSA 5JH7B 3T5CA 2CHQA 3PGA1 4LY6A 4TMZA 5H7XA 3LFUA 1GT91 5CXXA 4MUIA 1JVNA 5JXJA 5J1SB 3P94A 4JI5B 4ACBA 3ZHCA 5JCZA 2DCMA 1JXAA 3JASB 4ZO8A 4XUEA 5I7RA 1NQWA 2ODAA 3LNTA 3DBRA 5L6LB 2ZR9A 3L7LA 1COWA 3PNOA 5IAEA 3IPXA 1H1DA 3AOEC 3RBXA 3FHTA 2IYPA 1JFFA 1OHHA 4P32A 4IDCA 4S2UA 1DUIA 3IO5A 2IV7A 3ODGA 2AV6A 1C7ZA 3IIJA 3W4IA 1UEIA 4AQDA 5JMOA 3BWDD 1SCJA 4JK3A 2YJZA 4JSYA 2QYOA 3VSBA 1UDXA 5KNCA 5LIRA 5SZIA 3CEPB 1E79A 1L3BA 3A26A 1BOFA 4IRXA 2ORED 1U5BA 1CUFA 4PNEA 2KBEA 1V9CA 8AT1A 2P7IA 3A7DA 2J0UA 4D9HA 1IK4A 1H85A 3PC3A 4H4DA 2R87A 2VXBA 5F98A 1R3DA 1BGVA 4JSRA 3ROFA 2WE8A 4R16A 1B2LA 3RK1A 3EZ9A 1JBEA 3ESZA 5AJTA 4RL6A 1KJIA 2W7TA 4MVXA 2H17A 2C7GA 3L6OO 5HILA 4H7EA 4N5IX 3I6IA 2N3ZA 3DTVD 3H9EO 3IR5A 1FS5A 3SD7A 4F6CA 4TMFA 3PI7A 2CFIA 1N2OA 1NV8A 3DTVB 1VKJA 4OEHA 2ECOA 5DLPA 4DV1B 4NATA 2ZRBA 3IAM1 4N5LA 3UIEA 4DLPA 2WU3A 4BZWA 1Z8FA 2DQZA 1ZN9A 3SEAA 1NX9A 4CLDA 4G5OA 3Q9SA 1EVYA 3QV1A 3G2IA 1X1BA 1UDRA 4XYEA 1Y33E 5EWMB 3FOEC 1W0CA 4PSUA 4NJOA 4A27A 2GBFA 3R74A 3U7FB 4ZREA 4IICA 2ENWA 1WCIB 1EWRA 2C2ZA 2OUIA 4DQ0A 5CXQA 1XAJA 3IQEA 1UWCA 2OORA 1IPHA 3OU6A 1K4MA 2C59A 3LDHA 3CW9A 4GZLA 4UXJA 5C5DA 2J08A 3EF3A 4MYSA 2KB0A 3W9UA 1I4EB 2F1OA 3VAYA 2YWJA 1U0FA 2ZTUA 4DE5A 3PEYA 5AQ1A 3TLKA 1CEEA 4PWYA 1YB7A 3T38A 4KGVA 4WFQA 3ZXIA 4BAZA 4WBNF 3NWOA 2IGBA 4HOYA 1M2VA 5ESXA 4KGDA 2C4TA 2EYUA 2B37A 4I0WB 5K8JB 2Y1EA 3FGZA 4M1WA 4D97A 3NHFA 3GDHA 2GCOB 4D4HA 1QH8B 3IC5A 3QXXA 1W85A 3WDMA 4JP8A 1G21B 2GYVA 2ANCA 3PA8A 4JQSA 4IHJA 2VBIA 4URYR 5CLIA 2O7NA 2X13A 4JU8A 4D8YA 1SUEA 4BX3A 2C5LA 2FRVA 4BVGA 1KO8A 1Z4NA 2EARA 1Z12A 1B15A 1DS6A 1H5QA 4OHPA 3KWFA 2XEXA 4R98A 4HB4A 3U44B 5EL0A 2DRIA 4KX3A 4JLDA 4K6OA 4YDRA 3HKDA 4BLUA 5A04A 1AXGA 1P5RA 4OQQA 5FX2A 5KYTA 1OBCA 4OV6B 1WW3A 2JBAB 2DUUA 3FBGA 3FXAA 3GFTA 3MBIA 2HCBA 4GE3A 4IW3B 4DY6A 3MUNA 4KQXA 5F4BA 4YRGA 1GPWB 3KJXA 3TE7A 5K8IA 4L73A 1DKLA 1L1QA 3H5WA 2GRUA 4GX1A 3RAJA 4DCJA 5BW5A 3O4JA 2IHBA 2A84A 3DT9A 4Z2AA 3TECE 1CZHA 2WUFA 1MNAA 3EUEA 3KOMA 3CUYA 1L6RA 1UOPA 4G9GA 3VU8A 1PX2A 5AM2A 4BP1A 2Q2OA 1CWUA 2WWYA 2HGSA 4ER7A 1C7IA 2J41A 2JLSA 3RRMA 3KUKA 3G2MA 2QMOA 3NV9A 5G0SA 1ICEA 4Q48A 3C3JA 4LDAA 4W7IA 4V0QA 1W9MA 4NU6A 5A4IS 4QSHA 4PM4A 3O3CA 2IUYA 3TM4A 1KWKA 4AWAA 4IIHA 3K72B 3L6BA 1LVGA 3X2SA 1T1IA 3VOBA 3DZFA 3LCJA 4BYMA 5DPMA 3WRVA 5FI3A 4E4YA 5J58A 3ER6A 2YUTA 5MF6A 3E2PA 3K0KA 1IZ7A 4NWIA 4Q9IA 2DPHA 2VYFA 2QDKA 2XWSA 2PMWB 4PLYA 2M1XA 4DLUA 3MAJA 3PVZA 2XTZA 3WB9A 2QRKA 3AP3A 1FNBA 3QLUA 1KTVA 1WULS 2SBTA 2Q4OA 3OECA 1YS6A 3VVCA 2P75A 2FSPA 1U3UA 1JDBB 3QYFA 3BMNA 2QU7A 2I7TA 3ONWA 1TQHA 2TMYA 4A8JA 4BB9A 5FA8A 4E5PA 4C2UA 3D31A 1A97A 1Y1SA 2O1WA 3HU2A 3N3BC 3V4OA 4LKOA 4RFVA 2HNKA 4C22A 4AJLA 5I48A 5KYYB 2Q49A 1URPA 5FPTA 1TIBA 2XYVA 1GNSA 1IONA 1I33A 3AIOA 2FMXA 2IZ7A 4G5YA 3V7UA 5CPBA 2OSBA 3EXIA 3OAAA 3PRJA 2W6IA 4J0JA 3LX8A 2X0DA 5IFKA 2AXPA 3ESCA 5DWVA 1OYWA 2SKDA 3LA6A 3VUFA 1EWQA 1PEKE 4ZVOA 1PWYE 1E64A 3PQ8A 4D57A 3B1WA 3G6WA 4A6XA 2AH5A 2QBYB 1Z5NA 2YVAA 2VPIA 3CIOA 5EYPB 3U7QB 3PEFA 2OFFA 1JZSA 1ZBDA 3DCNA 3ZX5A 4E31A 4NNJA 3M70A 1Q21A 1O97C 1U7TA 2YW2A 4OGGA 1WMEA 5DTQA 4DWVA 3SMQA 3KZOA 1N57A 3UG6A 4YCCA 1P7PA 2X4DA 4MKFA 2X4IA 4WN9B 4UDOA 1E1QA 1PQUA 1B74A 4HAYA 5F5XA 4NK4A 3JR7A 2AZDA 1VFNA 3IE0A 3KSBC 2RI1A 2LV8A 4M9UA 4UQPA 5SYMA 3DBLB 3V4RA 1AO0A 1KI6A 1WXDA 1MXFA 1THGA 4GI1A 4P6VF 2E5FA 3T7RA 4EVRA 5BW4A 5HQ3B 5K6TA 4B3TB 3WNDA 2B1JA 4LNUB 4ENQA 2HSJA 3C6BA 3U09A 2Y1WA 3G5MA 4AJHA 3O8OA 3G23A 1HYHA 1R4AA 3IAS1 3M6FA 5EHQA 3VKFA 3B6KA 1VYTA 4PXSA 3BE4A 3RYTC 2R1VB 2ID4A 1IBCA 1FVFA 3V9PA 2OHOA 2O0LA 3KUXA 3GYGA 4BN0A 4LECA 3QVUA 2YBDA 2ZJYA 2M2IA 4YCNA 2JCVA 2LZ0A 2QN6A 1OFUX 3RC2A 2O3JA 2QZPA 3KYJB 3IUMA 1XMPA 4GHWA 1EXMA 3K8QA 3UZUA 5CCXA 5EPOA 4W4TA 4PQRA 4DA7A 3J80A 4TZTA 1V8BA 2WUDA 1GTRA 4TKVA 2Y0BA 3QOFA 1A9OA 1NQUA 2JFHA 2CEAA 1VE9A 2VJOA 1U4NA 3MERA 5GMOA 2ZAOA 1RAFA 3AL2A 2OM6A 4BMCA 1WB6A 2D7CA 3WTCA 2W0MA 3DEYX 3TSOA 3W0LB 5JNTA 2HDWA 1J7KA 1X15A 2O2GA 2HZBA 2W71A 1Q74A 4MW7A 1CERA 3O8BA 1L7VC 1NSTA 3F96A 4MDYA 4PLCA 4XJTA 4MP3A 5D1NA 3ONEA 5CYOA 2UXDB 5DULA 4FP9A 4EECA 2G1JA 1MQ8B 3HE3A 4YFVA 2ZPTX 3JYHA 1NW8A 1WLSA 5B2ZA 5AVWA 2O3SA 4XVUA 1UADA 4HFMA 5DLDA 2P41A 4GPTA 5BRNA 5B12A 4HQRA 1LSUA 1DIBA 2GPSA 1NW4A 2IF0A 3QYJA 2G5CA 3H5IA 1MPXA 2CV1A 1HBJA 1DRWA 2PZGA 5G0VA 5CNIA 1Z62A 3MTGA 5G40A 4XPZA 3ZE2B 1QTIA 4MV7A 1FLDA 3TG8A 1AUPA 1J1UA 5ALXA 3UUFA 1JAZA 3VGPA 3ZY4A 3QJGA 3R76A 4JT4A 2Q6IA 5IKPA 2ZYHA 3MTBA 2MYPA 3WGOA 2HWYA 2AKAB 3HU5A 5EG5A 2XZOA 1ZDMA 1E0JA 1E5LA 3DHYA 4BVFA 1N0VC 4DIKA 1GA4A 1RADA 2ZT6A 4YUAA 3Q7PA 3ZJYA 5BT8A 5KWJA 3TBKA 4RLQA 1Z33A 4REMA 3V5NA 1IUNA 2HU2A 1V11A 3I34X 4BNZA 3OPMA 4WFIA 5KB3A 1I51A 3GUUA 1EHCA 1BMFD 1X6VA 3VYUB 1YAJA 4ALJA 5CIQA 1ZWKA 2VDNB 4FGLA 2FAXA 1XCOA 4JITA 4V0LA 3NW9A 5E4TA 5LOVA 5J2TB 4OSEA 1EBFA 2XQKA 1RMTA 1UXIA 2D2XA 1DBPA 2RKWA 1R5OA 2W6PA 5G41A 4OI1A 1EZ4A 4MR8A 1JIXA 3EPJA 3H5VA 2H18A 3ND8A 1K89A 4DSZA 3K1JA 4HX2A 3DNPA 4R5MA 1ZH6A 3MMSA 1G59A 1KU0A 1DC8A 2P35A 1KXJA 3OZAA 1KI4A 1Z4OA 4DXDA 1RM5A 3EBPA 4I4IA 3G17A 4MQEB 3ZU6A 5JYBA 4BMVA 1UKYA 2IYSA 2B1RA 1AB5A 3ABOB 2CV0A 3GRYA 5B2EA 4JX9A 3IXMA 5LB4A 5C1OA 2Q2NA 2Y8EA 5IAOA 1NUHA 4N0PA 3FE2A 3GOHA 1S0UA 2GN4A 2HF7A 4IY1A 3ZV4A 4NOLA 5DNVA 2E18A 3JQGA 1PYGA 2QT9A 3P0FA 3K73O 4CTJA 3W5CA 1WB9A 4NY1A 1NURA 2EU8A 3WGUA 4EHLA 1GKIA 1XXHE 3FROA 4MUMA 4C4AA 2GZ2A 3P9NA 2DP4E 4FMBB 3D0QA 4LRXA 4YNBA 2ODWA 3UUWA 3V33A 2LUOA 3N86A 3JYQA 4GS5A 2OYCA 3D4BA 1MTZA 4FC7A 1HQCA 4IMPA 2OPBA 4YCDA 4J3NA 1TQDA 3MOIA 3H18A 5BUZA 4YMWA 1P0FA 5IFLA 3FUUA 1U2TA 1WEHA 2WWFA 5HUQA 2P5YA 4FZRA 5JTUA 4P0QB 3ETJA 1CD5A 1QRAA 1I4OA 2O3QA 4O25A 4ARBA 4GBMA 3D8BA 1D6NA 1GCOA 1LLFA 1SOUA 2VHVA 5DYGA 4QKQA 1E1RA 3WNQA 1JHOA 5C3MA 4QEKA 3KWJA 1S2NA 4RZUA 1PGPA 2YYYA 2X9QA 3LTNC 3NMUF 1CEYA 5LYJF 1TYDE 1H8EA 2XSZA 3ZLVA 1HFWA 1OLXB 3A1FA 3IA7A 3DKRA 2QQFA 3LUAA 1MRZA 3NBYC 5CB4B 1W73A 3FDZA 4AMVA 4CHTA 3BORA 3UAXA 4RTNA 2DKOA 4G1CA 4O4IB 3ZC3A 3NPMA 3T3EA 2V7UA 4U1RA 3WMFA 2D06A 2IYOA 3EBOA 3U16A 4YJ2A 1UBTS 2ZK7A 5EZYA 1SCNE 1OREA 4JEMA 4XWKA 2ECFA 7REQB 2VJQA 4FMCB 2WQ6A 3QKSB 2B4QA 4FD3A 3KEOA 3P27A 5JJKA 2SECE 2CSUA 1Z2DA 1XEFA 3EWAA 2JFUA 3K30A 1DLJA 1KH2A 1Q95A 2ZU0C 2ZZMA 1J9EA 5MFPA 1GGKA 1YBHA 3OO0A 5J9FA 2A58A 2NTVA 2TS1A 1E5QA 3R6TA 4B40A 4FMDF 4RGVA 1W87A 1RJDA 2ZI7A 4RZIA