1ODSA

Cephalosporin c deacetylase from bacillus subtilis
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
316
structure length
316
Chain Sequence
b'QLFDLPLDQLQTYKPEKTAPKDFSEFWKLSLEELAKVQAEPDLQPVDYPADGVKVYRLTYKSFGNARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIHEMVNWALHGYATFGMLVRGQQSSEDTSISPHGHALGWMTKGILDKDTYYYRGVYLDAVRALEVISSFDEVDETRIGVTGGSQGGGLTIAAAALSDIPKAAVADYPYLSNFERAIDVALEEPYLEINSFFRRNGSPETEVQAMKTLSYFDIMNLAYRVKVPVLMSIGLIDKVTPPSTVFAAYNHLETKKELKVYRYFGHEYIPAFQTEKLAFFKQHLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CEPHALOSPORIN C DEACETYLASE
molecule tags Hydrolase
source organism Bacillus subtilis
publication title Multifunctional Xylooligosaccharide/Cephalosporin C Deacetylase Revealed by the Hexameric Structure of the Bacillus Subtilis Enzyme at 1.9A Resolution
pubmed doi rcsb
total genus 114
structure length 316
sequence length 316
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.1.41: Cephalosporin-C deacetylase.
pdb deposition date 2003-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1odsA00
3H2HA 3RARA 2QXUA 3U0VA 3AZQA 4Y2QA 1IMJA 5JD4A 5AK5A 1NU8A 2O2IA 2B4KA 4FFWA 3OOSA 3PF9A 5AK4A 1XZLA 4C01A 1CUSA 5LZ5A 5DTJA 3WK4A 4FTWA 3VDXA 3CN9A 3IUJA 1CUEA 2XB6A 2X76A 3FLBA 4FNMA 3WL6A 4FHZA 5AOBA 4PSCA 1EVQA 3STWA 2ZSHA 1XZIA 2JGLA 3QM1A 1GPLA 4Y7DA 4U2FA 5AKYA 1XZKA 4EY6A 1EK1A 2GYVA 4X6YA 1CUAA 2ROQA 4W1SA 4G5XA 2PKYX 2XLCA 2WHQA 4N5IX 1E8DA 3G8YA 2XUOA 1HBJA 1CUHA 5CT5A 4EB0A 1BROA 4QEKA 4KAJA 3RK4A 1XZEA 5EHZA 2AJCA 3CCCA 5DNUA 3V1KA 1YA8A 2HA2A 3GA7A 3G0GA 3HRHA 1JMYA 4KRXA 4BP9A 4CIAA 4H7KA 5JADA 4U2GA 4W63A 4PO3X 2JGMA 2HIHA 6YASA 1YASA 3F96A 4B7ZA 2Q0XA 3D2CA 4UUQA 2OCKA 4EY4A 2HA5A 1WB6A 2X5XA 4L9AA 4Y2VA 4BVJA 3G9TA 4GEGA 2W6CX 3R3UA 2GYUA 1CUYA 1JJFA 1UK9A 3MGAA 2GBCA 3STUA 1Q0ZA 3PICA 4G9GA 4BDTA 4QWWA 1CRLA 3PDCA 1HKHA 3H2JA 1ZJ4A 3TJMA 3I2FA 3D3NA 5C8ZA 1XQVA 2BUBA 3A2LA 4RE5A 3MVEA 1CUXA 1UOPA 4X95A 3NUZA 3I1YA 4BC1A 1NU6A 5IVHA 5JALA 1S8OA 3WKDA 1F0PA 2PSJA 5CRIA 1UZAA 1ZIYA 2QTBA 3C5VA 3QMVA 1Y7IA 2EDAA 4EY8A 2WHPB 4MQMA 2PVSA 4X6XA 4UHHA 1AGYA 4J0GA 3V1LA 4Y2PA 4YX9A 3ED1A 4HAIA 2Z5GA 3M3DA 3KSRA 2BFNA 2D0DA 3OTQA 1IUNA 4KE7A 2HL6A 1K5PA 1CUZA 4K5QA 3C45A 2O7RA 3ICVA 4LXHA 3W05A 5AI0A 1A7UA 5ALXA 4B84A 2Y2UA 1FSSA 2XUQA 1UFOA 4IH1A 4ZXFA 5HK9A 2ZJ6A 5EI5A 2XI4A 2W22A 5LKRA 3E4DA 5CXXA 1C7IA 4CIBA 1XLUA 4L3WA 4UPDA 3CN7A 3WIOA 5AM5A 1XRMA 4WY8A 2BGRA 1N5RA 3R3YA 5AI8A 3AJAA 5LYYA 4WFIA 1ZOIA 2DHEA 3V9AA 1DINA 3UUEA 4U2CA 2HA3A 3N2ZB 5IH7A 1IVYA 5AKHA 1ODTC 1OCEA 2HU8A 2NW6A 2WHRA 4AO6A 3IVMA 2WJ4A 4B81A 1EXWA 3G9XA 3IUMA 4CI9A 2VJAA 2H7YA 1D07A 4Q82A 2XMRA 2QJWA 2WJ6A 3N0TA 2HHAA 1XRLA 4BVLA 3RM3A 3DEAA 1EDDA 4X94A 5CURA 5ALPA 4JH0A 2ZVDA 2QR5A 4XJVA 3JW8A 1BCSA 5E4JA 5HFNA 2XUAA 1CPYA 3F98A 3ICWA 4C87A 2XUPA 1ACLA 3WLAA 3WL7A 2RONA 1SCQA 2QM0A 2HFKA 2Y1KA 5FXMA 3GZJA 4Y2SA 1U4NA 4WDQA 3ESAA 3CCBA 1XROA 4J03A 1VLQA 3BDIA 1J1IA 5DYWA 4BBZA 4HVTA 3ESBA 1EDEA 1E3QA 3M82A 3TGLA 1H23A 1LZKA 2QUBA 3EBLA 1WB5A 1A8UA 4RNCA 2GYWA 5K3FA 5AM0A 3VVLA 1GKLA 3WK7A 5SYNA 2OCLA 4I19A 2HA6A 3AZPA 1AC5A 2VF2A 4ZI5A 4Q3OA 2OAGA 2QVBA 3F97A 4CG3A 1RYYA 4KEAA 4G4JA 5ALYA 2ZYSA 2QMQA 4J0JA 4EY5A 4HTAA 5AM4A 1E89A 3O95A 4AO8A 2D5LA 4F60A 1M33A 4U2BA 2EEPA 3OURA 1CR6A 2XMZA 2PSEA 3C87A 1UWCA 2Z8XA 1LBSA 4BZWA 2FJPA 4KE6A 5DJ5A 4PF1A 3E1GA 2JGFA 3H1BA 2CB9A 2ORYA 4OSEA 2GBIA 2WUFA 5EHNA 3STTA 4BRZA 1O6FA 4FWBA 3SC2A 1DQZA 4BCBA 2ACKA 3IB3A 7YASA 3BJRA 3D2AA 1QIIA 5FLKA 5A7FA 2BCEA 2CJPA 1Q84A 3WA7A 5HF8A 1XZDA 3WL5A 4BAGA 5CH8A 5LP1A 2Z3WA 1YAJA 4J0DA 1BEEA 4W1PA 4ZGBA 1FFAA 1RWQA 1OXMA 3RLIA 2ACEA 4BTLA 5AI4A 2CKMA 5ALIA 1CFJA 2I03A 3BF8A 1XLVA 3VKFA 3ZV7A 2ES4A 4WFKA 3W9UA 4LYDA 4UBIA 2WIKA 3H19A 3K2IA 4IH9A 3LS2A 4QDTA 2WIGA 5JD5A 3BIWA 3FLAA 3WKEA 1VJ5A 4LHEA 2RGUA 1UKBA 2J3DA 5ALLA 5FOQA 4P08A 1W76A 5FRDA 2Y6VA 4HXEB 1VXRA 5AICA 4EY7A 2G5PA 4FBLA 5K3BA 4WCVA 3PE6A 5JASA 2XDWA 1NX9A 1R4ZA 3GUUA 3I2GA 2V9ZA 4W1RA 3C6ZA 1BU8A 3IURA 2J4CA 4X92A 3PUIA 3DKKA 2H1IA 2WU4A 3R0VA 4BAZA 4O08A 2XQJA 4NZZA 2CUTA 2OLEA 1DWPA 3EQ9A 5HK8A 5ISMA 4Y2UA 3HYSA 2BUCA 4BAUA 2WUEA 5EIEA 3B12A 1G4HA 4C4YA 5K3DA 2HM7A 5K3AA 3SX4A 1QIKA 3E0XA 2GBFA 2OCGA 1R1DA 3T52A 4FMPA 4J7AA 5ALDA 2QT9A 4NMWA 2OQVA 1TRHA 1GPKA 5CW2A 1CIJA 2XUJA 4E11A 1CVLA 3R40A 2HA7A 4E14A 1WPRA 1ODSA 2VJCA 4BE9A 4KRYA 1DWOA 5ALUA 4BYMA 3QITA 3B5EA 1THTA 4G8BA 5D3ZA 1AMNA 4UBKA 4GW3A 3Q0TA 4B9AA 1QZ3A 4N8EA 3WZMA 2WFLB 1UXOA 4UBOA 3H2IA 1H22A 5EGNA 2PU5A 3G9UA 3QYJA 1JFRA 1C7JA 2XMBA 1BE0A 1MT3A 3I6YA 1KEZA 1YCDA 3OC0A 3HACA 4KYVA 2HFJA 4H0CA 1CQWA 4N5HX 2XQKA 4DMFA 2GBGA 4UHFA 5FKJA 3HEAA 3W06A 4XWGA 2AJ8A 4L72A 3DDUA 1QTIA 5LZ2A 1KU6A 3QPCA 4TVKA 2RAUA 1LPNA 5ALMA 2J4FA 1DX6A 5CT6A 1DU4A 1DX4A 1FFDA 2O2GA 2OXEA 2VT7A 4OPMA 1F8UA 2AJBA 3WK6A 2BKLA 5A7GA 2WFZA 2CEKA 4AQDA 2OQIA 3QZUA 4UHDA 1UK7A 4Q34A 5AOAA 4MYDA 1QIJA 4OU4A 1XRPA 1MTZA 3HZOA 5AKEA 4MQLA 3FYUA 5T4EA 1CUJA 1ORVA 1CUVA 5A2GA 2OGZA 3AINA 2CBGA 2PU7A 3EQ8A 3ZI7A 3A2MA 4EHBA 3R3ZA 4B85A 5IVIA 2AJLI 1SFRA 3KD2A 2HADA 2WSLA 3BF7A 2XUHA 1IUPA 1B6GA 4N8SA 5JARA 2PUJA 2GZRA 3FYUC 1FFEA 4OYLA 3LLCA 4BP8A 4ETWA 1HQDA 1YB7A 3I2JA 4X93A 5A6VA 5AKXA 3O4HA 3GBSA 5CT9A 1ZJ5A 3LIPA 4Y2TA 4UBJA 4OD0A 3UMJA 4S0XA 1R50A 3LP5A 1DT3A 1XQYA 5AOCA 3WKAA 1QIGA 1LPOA 5AKZA 4A5SA 4GHWA 4J0CA 2WLSA 1WHTA 3K6KA 4G4GA 4AMYA 4ROTA 1GQRA 3PF8A 5JZSA 4AN1A 2WKWA 4OUKX 3WK8A 5ALQA 4PW0A 2I3ZA 4ARAA 4ZV7A 4DNPA 3PFCA 3W9BA 4V2IA 2YYSA 4L0CA 1Q0RA 3A2NA 4MEBA 1N1MA 1EHYA 3R3WA 4XX1A 3WWCA 4H18A 2QXTA 5DTIA 2H7CA 3BJMA 4M0MA 3R41A 3V48A 4UBNA 2CMFA 5FV4A 2J3QA 2VJDA 4CG1A 5EHQA 3C6XA 5JD6A 1MN6A 2DQYA 3I6MA 3EQ7A 4ZREA 4E15A 5DYTA 3G7NA 2VA9A 2WTNA 2YASA 5AKGA 1VA5A 4MEAA 3KWFA 5SYMA 1H2ZA 5ALKA 1J07A 1YB6A 3DYIA 4RGYA 2WILA 2I78A 5EIAA 1EK2A 2PUHA 1DWQA 5FDFA 1MX5A 4XIIA 5KREA 1TCAA 2HRQA 4UHEA 1YAHA 1MNQA 5LIPA 4QE3A 2WG0A 5D3KA 3I2HA 1XQWA 1TKRA 3WWOA 3I1IA 2DQZA 4H35A 5AIAA 2HU7A 3HI4A 1ISPA 5FPQA 5I7UA 3H04A 4FLEA 3ZLVA 3IUNA 4P93A 4BATA 1XZFA 2G5TA 5HQ3A 1LNSA 1AUOA 1JKMA 4A16A 1B41A 3D0KA 1DT5A 2FX5A 3GROA 4QLAA 4INZA 3PUHA 3FLEA 4KAFA 4RE6A 2DFPA 4FNGA 1Y7HA 1ODCA 1LPPA 1QJ4A 5CMLA 3FNBA 1L7RA 1T4MA 4CCYB 1UT6A 4IH4A 1YR2A 4OU5A 3IDAA 2WM2A 3C43A 4CG2A 4CCWA 1QIHA 3DCNA 4TGLA 4FLMA 1JU4A 1XZMA 2E3JA 1U8EA 2FJ0A 1QFSA 3FYUB 2H7XA 3LCRA 1EA5A 1LPSA 2VTVA 4PSDA 3KOOA 3BIXA 4HRXA 1LBTA 4K2AA 4QDUA 1MAHA 1AQLA 2HA4A 1GKKA 2WQZA 4KACA 1PJAA 1Q83A 1WPXA 5ALGA 3DNMA 4CCYA 4AZ0A 1GXSA 3C70A 1ORWA 2WIJA 4JNCA 1BCRA 5AKLA 4UHBA 1XRNA 2V96A 3L1HA 1E8NA 4H7HA 1R9MA 2YH2A 3KDAA 4DIUA 1Z68A 3U1TA 4C88A 1CLEA 1VE7A 3HJUA 4ARBA 1H2YA 3WKCA 2CZQA 5ALNA 3H1AA 4LXIA 1YSCA 1AURA 5JANA 1YS2X 3ILSA 1N5MA 1XKTA 3ESDA 5YASA 1MX1A 3HSSA 2C4HA 1BN7A 1TAHA 4BRSA 3DLTA 1VE6A 1G42A 2WG1A 4UFNA 3VJKA 4Y2RA 2WFMA 4JUIA 2C5GA 1XQXA 5C8VA 3FBWA 3HABA 3FVTA 2Y2VA 3NOXA 5IVDA 3W2TA 2BJHA 3TRDA 1UKAA 2PSDA 5BOVA 4QZVA 1K63A 1W75A 5CT4A 3WK9A 5I9IA 1QOZA 1QLWA 1E8MA 1ZD4A 4XVCA 3GFFA 5AK6A 4A23A 2Z8ZA 1MJ5A 1K8QA 5E2IA 1QIFA 2C58A 2ZYRA 2OPHA 3PI6A 2XMSA 5AI5A 1YS1X 4G8DA 1VOTA 1ZD5A 3D5EA 2JGKA 1PV1A 1LPMA 4PSUA 4AMZA 4AB1A 1HPLA 5JYCA 2RHTA 3FCXA 5K3EA 5DYYA 4C4XA 1CEXA 5JAHA 2RI6A 1CUBA 4Z49A 4UFOA 3D59A 2XT0A 5JATA 2PPLA 1FFBA 1P0PA 3TEJA 1A8QA 3WWDA 2LIPA 3DJYA 3DD5A 5LZ4A 5IVKA 4FLFA 3V1MA 1I6WA 1CUUA 5AK3A 5BWCA 3T4UA 3O4JA 3JWEA 2IITA 4GECA 4GDMA 2PX6A 1H2XA 3O4IA 4G4IA 1KU0A 4QNNA 2PM8A 3WJ1A 1JJBA 3DKRA 3FYTA 5JAUA 2QOEA 4QDXA 2X8BA 2PSFA 4WY5A 1XRRA 3DOHA 3G0IA 1UK8A 1C4XA 3BL8A 4EBBA 1HDEA 4RPCA 3A6ZA 2HRRA 1BEZA 4DNQA 3DL4A 3C6BA 3QMMA 2VQ6A 3FCYA 2ECFA 2UZ0A 2XUKA 4OCZA 4AN0A 1EH5A 3QMWA 1BRTA 3G0DA 2VAVA 4OYYA 4X90A 5HF5A 2AJDA 1X2BA 4X6UA 5AM3A 3AZOA 4W9RA 1EX9A 2QRUA 4Y2XA 1MAAA 4X97A 2OGTA 3B3QA 1VZ2A 4J0IA 4M0EA 1CUGA 4X91A 1CUFA 1QIDA 2O7VA 1HLGA 2WUGA 4BE4A 1RP1A 2WIFA 1AZWA 2JEYA 3QBJA 4UHCA 4LYEA 4DMKA 4K6GA 1WCYA 4H7EA 4G8CA 5AI9A 5AKKA 4U2DA 5C7YA 1T2NA 2I3DA 2XE4A 4DNOA 4J3JA 5DWDA 1X70A 2QJRA 2VT6A 3IUQA 2BAGA 4C4ZA 4B6GA 4B9EA 5FPPA 5CBKA 2JGEA 4FFVA 5A7HA 4HS9A 4IQ4A 5KWJA 1DTEA 3PFBA 3KWJA 3ZLTA 3BXPA 2XQGA 4K6HA 3AFIA 2XLBA 1ZD2P 5LZ8A 5ALZA 5CH5A 5JAPA 1LLFA 3IULA 5AH0A 5HFAA 1K6EA 2V98A 3WK5A 2B20A 5KBYA 3QVMA 4HZGA 4ITVA 2WTMA 1TIBA 3AIKA 1P0IA 1BS9A 1UOOA 3E3AA 4X3CA 4Y9SA 3LIIA 3ZWQA 4HXFB 3VVMA 5ALOA 4QDOA 1IUOA 2DSNA 4AZ3A 2IIVA 2R8BA 4YASA 1E66A 2JBWA 2XMQA 2QUAA 4JEIA 2EDCA 3FWHA 4C89A 4BDSA 5AP9A 1MU0A 4AX4A 4PNZA 4QA9A 1GQSA 3ANTA 5BV7A 4BVKA 5FUMA 5CT8A 1P0QA 4QDZA 4AO7A 3M83A 4OB7A 1TK3A 2VAXA 1XZBA 2PSHA 4BCCA 4GLBA 5IKXA 5BWBA 1EVEA 4DSAA 5ALFA 3W04A 3SWWA 4DLNA 3C8HA 1MNAA 1R88A 4EA6A 5F4ZA 3IIIA 4B80A 5AO9A 4BTVA 5ALRA 1IZ7A 3WKBA 5ALSA 3EF3A 1F6WA 2WU3A 5AHXA 1JU3A 4KAAA 4ZWNA 4G1FA 2V97A 3WL8A 5AIBA 5AI6A 3A70A 2WG2A 5J3JA 2RIPA 5LKAA 1THGA 1YA4A 1CUWA 5AM1A 1SC9A 5HKAA 1ACJA 1ZICA 1QO7A 1VKHA 1XZGA 4WJLA 4ZRDA 1MPXA 1N8SA 3FVRA 5ALJA 3QPAA 3DS8A 5JIBA 4ZV9A 5JAOA 5ALEA 4Q3KA 4M0FA 1WHSA 3ANSA 1JI3A 3VJMA 5ALHA 1W52X 2VEOA 4DSZA 4H7DA 4MWSA 2BUAA 1ZGCA 2BGNA 5JZBA 4X7BA 3C8DA 1LPBB 3MUOA 4DNFA 1ZI6A 3DQZA 2B9VA 5HKBA 5EHXA 1AKNA 3HXKA 4GXNA 1TCCA 1Y37A 3V1NA 4GBGA 4FDMA 1QONA 2JEZA 3BDVA 1EDBA 4OB8A 1HL7A 1ZD3A 2WIDA 1PFQA 4AXBA 1TCBA 1J06A 4DMHA 3DL7A 4KE8A 1ZI9A 2C0QA 3NWOA 5JZ9A 1K4YA 3F67A 4PV7A 2OCIA 1E5TA 5E4TA 2ZJFA 5ALVA 3EIOA 3WIBA 3HLKA 1QO9A 4B83A 4GI1A 3RKSA 1WOMA 4Y2YA 2OG1A 5CH3A 4K6KA 1VA4A 1P0MA 4HXGA 1CUIA 5CXUA 5LZ9A 1UKCA 4MYSA 1JT2A 4UBLA 5C81A 1QIMA 1QIEA 4LIPD 4DTCA 2XUDA 3UUFA 3M81A 4TPKA 2JIDA 2ONCA 3H18A 1SOMA 3H2GA 1LZLA 1ZIXA 3H2KA 3SK0A 4NS4A 4I3FA 5A71A 3C5WP 2DHCA 3ZLUA 4E46A 1JJIA 3VISA 4BB0A 4Q3LA 1VXOA 2PL5A 4X00A 2ZYIA 3D7RA 3O0DA 1QGED 4LXGA 4MJ3A 3AIOA 4F0JA 1O6GA 3IA2A 3CXUA 1W4LA 4H77A 5DNWA 4B0OA 4QLOA 1TQHA 2WJ3A 5EFZA 3WJ2A 4UBMA 1QTRA 4H7JA 1MX9A 4KJXA 2XMGA 4N8DA 2QKYA 4X71A 2H9YA 4DM7A 2WFLA 3JYHA 3S8YA 1GZ7A 5FP0A 5LZ7A 2Y6UA 4X85A 1IZ8A 4OB6A 4YPVA 5HQ3B 1EI9A 3OM8A 1A88A 4Q1VA 3WYDA 5CTAA 4IO0A 3L1JA 3WA6A 5K5EA 4BC0A 4KE9A 1W1IA 1A8SA 4D9JA 1J2EA 3DYVA 2C5FA 3K9BA 3FSGD 2JGIA 3HC7A 1EB9A 1ZI8A 2K2QB 2WUDA 2G63A 3STYA 5HCUA 3BWXA 2RHWA 5E4YA 3G9ZA 2B61A 3X3HA 1CV2A 2O2HA 1GGVA 4F21A 1GPNA 3FAKA 1WM1A 4FOLA 3WWPA 3L1IA 1FFCA 4YK7A 2C7BA 3AILA 3STXA 1ZGBA 4UFPA 5KWIA 1JMKC 4FBMA 4GWLA 5ALWA 1VZ3A 1ETHA 3H17A 4JYPA 4H7FA 5AKIA 2P8SA 3Q8WA 1W6RA 2VJBA 3OPMA 2XMCA 5HZGA 5A62A 3GELA 3NGMA 4MXDA 1XLWA 2XQIA 3D2BA 1G66A 1WB4A 3F9CA 1EINA 1L7AA 4EUSA 2DHDA 1XZJA 3D4LA 2FUKA 2QZPA 1BN6A 3MUNA 5HF6A 3QH4A 1U2EA 1LPAB 2JF0A 2XMDA 4MWTA 1AX9A 1LGYA 1USWA 1R3DA 2GZSA 3O9VA 2VATA 4IHAA 2WHPA 4DMCA 3WYNA 2HDWA 4QWMA 1XZCA 4DYHA 4G9EA 2XUFA 3G02A 5ESRA 1FJ2A 2R11A 1OILA 2XUIA 4DGQA 3AUKA 4JYMA 1X2EA 1H2WA 1CUCA 3O4GA 1U65A 2IX9A 4H7IA 3AIMA 2AXEA 2XUGA 4NVRA 5AJHA 2ZSIA 5T4HA 5C8XA 3WQHA 4B82A 2C0PA 1DQYA 2QS9A 3G0CA 5AM2A 3VXKA 2DR0A 3H0CA 5K3CA 5HF9A 3ZPXA 3WI7A 5I8PA 3BE8A 4F5ZA 1XKLA 3I6ZA 3ESCA 1SCKA 1UOQA 4WFJA 5D6OA 4EZIA 2G4LA 2HA0A 3YASA 3R3XA 2OGSA 4U2EA 3G0BA 5DLPA 5DNVA 3R3VA 3IBTA 5H3HA 4PQEA 4W1QA 4C6HA 1SCIA 5LLSA 2Z3ZA 4Q05A 2JGJA 3I2KA 4P92A 3I2IA 2HU5A 3WWEA 5AKJA 4B0PA 1L7QA 4KR0A 1MO2A 5T4BA 4P9NA 3WZLA 3QPDA 1G5FA 4CFSA 1QE3A 4LKOA 1XRQA 1UK6A 3OG9A 4Y2JA 5D7BA 3VJLA 2XQFA 3F8SA 3FOBA 1EB8A 1F0NA 1R9NA 4FKBA 3WMRA 1XFDA 2VSQA 4HRYA 4I4CA 1CQZA 3P2MA 2PBLA 4BZZA 3DOIA 1CUDA 5K3FB 2OAEA 4J0KA 3FSGA 3C6YA 4J0HA 2ZJ7A 4WDRA 2YXPX 1QFMA 3O9MA 4BCDA 3S2ZA 3STVA 1GT6A 5EIHA 5T4FA 1XZAA 2DCMA 3KXPA 2ZYHA 5ALTA 1XZHA 3I28A
chains in the Genus database with same CATH superfamily
1P3JA 3LY9A 1QFYA 4WCFA 3C3XA 3R7WA 3VYUB 2QXUA 2P5YA 2YHIA 5J1SB 1FYXA 1PNTA 3BHJA 1IMJA 2O3JA 4G09A 1I33A 1WBDA 3LLSA 3RVPA 3V8RA 5HS4A 1TU4A 3JQEA 2BPOA 1BWSA 3OEED 4EVRA 3OOSA 4WLNA 4E08A 3JQ7A 1XZLA 1PGNA 1QB7A 3SSAA 2V7PA 3WK4A 4TQ9A 5MN6A 3VDXA 5LQMA 2GASA 1E1MA 2A1IA 3CN9A 3JVDA 2YFHA 3NV7A 3DMHA 2WP0A 3WL6A 1HTTA 4AZ3B 2DFNA 1KO7A 3D6VA 3H5OA 4OFZA 2JI7A 2QX8A 4PSCA 1EP2B 4DGSA 2MSDB 5JTTA 3LQQA 5T8KC 3AVVA 1ONPA 1UPBA 1G3RA 2XNDA 3PVSA 4MHOA 2YC4C 2QLBA 2WB4A 5DWQA 2EERA 1LDBA 1E9AA 3QV2A 2C8KA 2XZTA 3RJZA 3MW8A 1RQXA 5IBCA 4Y7DA 2HDHA 2Z2IA 2WHXA 5CNMA 2BF7A 3ZTWA 4X24A 5J59A 3W4KA 4RKFA 2O5CA 2A78A 3B1ZA 2XNHA 4Z0NA 2OXRA 5G3YA 2YQ4A 4EYOA 2QL7A 2FZCA 3HYLA 1XXHE 1I1HA 2XF8A 4W1SA 1DRUA 2PKYX 1IWOA 3Q98A 1TZJA 5GONB 4RV9A 3WGUA 4ZI2A 4R2XA 2B4TO 2WEKA 4WXMA 3UWDA 3ZLBA 4Y2GA 3VR5A 1R37A 2NTJA 2PX5A 4OHMA 2PKQO 1FXWF 3HY4A 1YL7A 2PXXA 4IIXA 4CIDA 4EB0A 1WOYA 5G53C 1Y9ZA 4R6XA 4RTLA 3FGPA 1CFZA 4DCVA 1LCIA 1A7JA 4YRMA 1XZEA 3TIVA 5EHZA 1ZCJA 2FWAA 3NC4A 4PGHA 1C4WA 1P62B 4W5WA 3UMVA 1IQUA 4UUAA 3V7UA 2DAPA 2XKJE 5DNUA 4I1PA 3ZE0B 2HPVA 4A8JA 3MJSA 2DWUA 2BW0A 2N75A 3T35A 1FDSA 3E9EA 5KWVA 3B3GA 4BP9A 1ZIOA 5AVUA 4FDUA 1GNPA 3R3JA 4H7KA 4TLMB 2FSFA 3HJGA 1FQWA 1ESEA 4I46A 2ONJA 5B55A 3K2QA 4HKTA 2J7PD 3DMDA 4PO3X 2JGMA 4MW9A 5DX1A 3WO0A 3ZS8A 2C8LA 3C3MA 3F96A 1NLYA 1WVIA 1E9RA 1D2HA 3I01M 4GLFA 4EGFA 1V2HE 3QOYA 2OCKA 4C4AA 1JT9A 3JSAA 5A4IS 1ADFA 2A5YB 2CNOA 1K89A 5FPYA 4JP1A 1N6HA 4ZT7A 2HA5A 4IHKA 1R2QA 4Z1MD 1UBRS 3HVUA 3LE8A 1OX4A 3FG9A 4L9AA 4QGFA 1O0CA 4ALIA 2PL9A 1GO2A 3MLBA 4HP8A 2BZ1A 4BVJA 4RWZA 2BFAA 2PTGA 3B5IA 4YONB 2ZRFA 5DYIA 3Q5GA 4JVOA 2CWDA 2Z6VA 3E9QA 4JHLA 5EMLA 1CUYA 5CFPA 1NJ1A 1UK9A 1EIWA 2O7SA 2A9QA 3H86A 1U1DA 2RI0A 4G9GA 4Q4HA 4QQRA 3WZ2A 1KIFA 1DEOA 4BDTA 2G36A 2Q29A 1HA3A 4LWZA 1JLHA 2ID8A 4JLMA 4V2UA 4ZVRA 1YU9A 1RRFA 3UK6A 3PDCA 4ZOCA 3SS7X 2I4NA 2LDBA 3GRUA 3RIGA 1SXJD 2QAGC 2ZJ3A 4ZHQF 2J32A 1ZJ4A 4TTQA 4DLVA 2X14A 3LUDA 1W25A 2H52A 1I7NA 2R8EA 2ASEA 4GPAA 3E84A 3FOFC 4HEA1 1KZ4A 3TSZA 2CVQA 4A2QA 1XQVA 2A92A 3TR5A 2PQMA 2A3NA 1P5ZB 3KT0A 5IT0A 3N58A 4J7XA 1GYQA 1RAEA 2VWHA 3A2LA 4RE5A 5J5CA 3D3JA 3TFQA 3AB8A 4CMJA 3BMOB 3ORQA 3DZGA 3CNNA 4X60A 2O0KA 4BIMA 4M21A 5DM1A 3NANA 1NU6A 3BRWD 6Q21A 1G8MA 1TXGA 3IV6A 4X9XA 2HSWA 1RYHA 2EKPA 4MROA 1QHEA 1Q92A 2R8PA 1F0PA 3QW4B 2C4MA 4HXYA 2W6IA 5CRIA 3PRYA 5LR6A 4WBNA 1C1YA 3RTDA 2WJJA 1Y6GA 1TYZA 5CA0B 2O7QA 4DJAA 1EVZA 3T5BA 2JEOA 1LJLA 4V3BA 2PVSA 1SOWA 4U7GA 4KU4A 2IZ0A 2PS1A 2VYVD 1T29A 2Z4TA 3AEUB 4J0GA 3RUHA 4DLLA 3EULA 3K70B 3RC8A 3N8IA 5JCPA 4ZKEA 1HYQA 4YX9A 5CB6A 1O97C 5ILOA 2SKEA 1AVTA 3BD9A 3P9NA 5AJZA 3VSCA 3ZNPA 4YMLA 1L5KA 2DTEA 2OO3A 3AI1A 5LBUA 4D3YA 1T35A 3SC4A 3M4XA 4K0KB 1KSGA 3NKFA 2QX4A 4HAXA 2ZJYA 1H2HA 1K5PA 2XXJA 3PNLA 1CUZA 4KGXA 4K5QA 3ROPA 3L43A 3BFJA 3NTOA 3C45A 1ZVVA 4XEUA 3QEOA 4II3A 3V1UA 1D9XA 5EP3A 4NU5A 5DCWA 3CX3A 4MQEB 4F5WA 3I6QA 3QENA 1G59A 2QSZA 3VZRA 1BMFD 1OIWA 2B5OA 3AFOA 4B45A 3MWLA 4NESA 1UFOA 1I2DA 3DWGA 2RBEA 1H5NA 3IQDB 2Q6VA 3BH7A 4ZXFA 2C61A 5J2TF 4YRQA 1J56A 1D0VA 2FEKA 4NFLA 4PZ9A 2XRZA 4M46A 4WN3A 5JSKA 2A4MA 1U0RA 4FDAA 1LK5A 2IEDA 1GDHA 4JLNA 3RYCA 4F5YA 5BV1A 4CIBA 4LSGA 2J07A 3WIOA 1G4UR 3AEKB 5AM5A 4PLPA 1THMA 3LX8A 3LW8A 3ETEA 1ONNA 3HBNA 4TTSA 4KBFA 1E2DA 2BGRA 3ICEA 4F97A 2Z8YA 1NW6A 4JQCA 4BNTA 2WVJA 2DR3A 3ZNOA 1MEEA 1NJ8A 2GYYA 3V9AA 3ROGA 1KNQA 1RM5A 5L3RA 4H2DA 1DZIA 1FDVA 3ZZMA 3RBXA 3PFHA 3HCNA 4QOFA 3UG7A 1N3BA 4IZOA 2HA3A 3GUVA 5GGXA 5IH7A 4JOBA 4CPDA 4NCIA 4Z9AA 3RFXA 4E4TA 3OIWA 5EEGA 5DGHA 2EYQA 2ZIEA 1RJ9B 2WHRA 3OOWA 2X1HA 4IOJA 3IVMA 4AO6A 3PXGA 4BRUA 2D74A 2CDCA 2CW5A 4B8YA 2PUEA 4CMKA 1ZX1A 4CI9A 3LGSA 1SKAA 2VJAA 1NI5A 4K9OA 3TZBA 1PNVA 2H57A 2PZBA 1E9DA 2J3JA 3BEOA 2R79A 2QJWA 1NIJA 1Y1TA 2IYXA 2WJ6A 3F5MA 3QEMA 3N0TA 4LGVA 4YRFA 3WJAA 5C1IA 2NPOA 4ZZ2A 4E33A 2WAAA 3GGDA 3L05A 4F8YA 3HBAA 2EP7A 3L7DA 1SD5A 4IDGA 3P9SA 5ALPA 1RE0A 3SJ7A 1YBFA 3WMEA 3QF7A 1N0VC 4YMGA 3DFUA 3LKDA 5LMUB 3PPYA 1V5FA 2ZSUA 2ZVDA 1U98A 1PEKE 3FHJA 3QA9A 4RHXA 1Z37A 4CCSA 1U3FA 5TMPA 4HSEA 4LXTA 1ISRA 3JW8A 4KQJA 4HQFA 5C1OA 3RYHA 4FE7A 3NVMB 4GPBA 4HZUB 5HFNA 3M2PA 3RGGA 3VBEA 4DDHA 1AQJA 1L5QA 2EKQA 4JGIA 1GU7A 1CPYA 3CUVA 4HDKA 1W94A 3BMQA 4AF7A 1PTKA 5IDQA 1Z0ZA 2XUPA 1ACLA 3WLAA 1PR3A 2IHJA 1E3EA 3UWMA 2RONA 1SCQA 4F4UA 4Q1AA 4PX2A 1QQ5A 2Y1KA 1FNBA 3IMKA 3LC2O 4KL8S 4P5EA 1FRZA 1E1RA 1ZK2A 2GN0A 3OICA 1U4NA 4Y2SA 5LB2A 3ESAA 4C20A 4F4HA 3IKLA 1T9KA 2C9BA 2IOFA 1ESCA 2MSLA 2ZRMA 4YEDA 1J1IA 2P4QA 2WM8A 4KCGA 5B3JC 4FW9A 4B71A 2Q2QA 3ZV3A 1E3QA 1E5LA 2NU9B 1JILA 4REMA 2EFGA 5J47A 1S4QA 3IP8A 1CNMA 3GT0A 3EBLA 2GRJA 2A67A 3IBFA 1U8UA 3INGA 3O03A 4CVNA 1YRQA 2W2MA 4RNCA 4WOBA 1RQRA 2FXVA 3IQIX 1R0BA 3O82A 4V03A 5DISB 4B5KA 3R5TA 4PTZA 5DSXA 2BM1A 5AM0A 5H4HA 1DBWA 2JJMA 3VVLA 5AXCA 1X94A 1Z82A 4LV5B 3V4OA 3JVVA 1Q7EA 2Q3BA 4WZAB 1AB6A 4CKXA 4ZN6A 3KSAC 2EC5A 3DHVA 3IPRA 4CRWB 5C3UA 1V3QE 1DMRA 4FPXA 4E5YA 3HA2A 1L5SA 4Q3OA 1XK7A 1GQOA 1YV9A 1R0ZA 1O57A 3HLYA 5G4KB 3R75A 2QVBA 2DUWA 1EQ2A 3BSYA 1ZJYA 3IAS1 2R1TA 4PLHA 1N6IA 5TARA 1I2ZA 2LGJA 5JO0A 5A04A 4KEAA 2F8SA 1WW3A 3HUDA 4RPLA 3BFXA 5TDHA 5ICFA 1F5NA 3SM9A 5CYGA 1E89A 4FSDA 1MG0A 4G86A 3IAHA 4PS1A 3V7WA 5D3MB 3SR4A 1ZW1A 4E6PA 2VJPA 3CR8A 3I5MA 2EEPA 1KA9H 4YH1A 3TRKA 1G2QA 1CR6A 2XMZA 1VRVA 2ZGVA 2PSEA 4HGRA 3WLTA 1VB3A 4CKWA 1Z06A 1UWCA 2Z8XA 3FMFA 1E61A 4JLWA 4WERA 1H6CA 3EXG1 4RHYA 2VL7A 3AKCA 2RGDA 1RLJA 2FJPA 1R8QA 3W8DA 1RWNA 3BJZA 4KE6A 4XWAA 5LCXA 3JVEA 1VE5A 4HNSA 2H2AA 1B0AA 3E1GA 4KXVA 1PI3A 4OV6B 2B2XA 3CTPA 1V1MA 2Q28A 2JGFA 2MIIA 3HKDB 3OF3A 4IOMA 1MJHA 1WHTB 1ICIA 1RI2A 1TX4B 2ORYA 4I50F 2GMWA 4IIVA 1Z5NA 1QQTA 2EYUA 1L6IA 2GBIA 4ZC8A 1AXGA 1F2DA 4KDFA 5FCDA 1JTVA 3STTA 3CG4A 4M2LA 3KZMA 3QY0A 4RWEA 1T9BA 3PWZA 4TROA 1N5JA 1N6PA 1W93A 3A10A 3LA6A 1LC0A 2V8OA 5KYVA 5FYDA 3R0IA 5K09A 1DJLA 2NZYA 2VIIA 1N2BA 3VX3A 1XPRA 5EWMB 4MHSA 3BFKA 3A9WA 3S2GA 3U7EB 2BMJA 3VOAA 3BH6A 1OVMA 3K1AA 3LX6A 4N39A 3E03A 5FLKA 5JNRA 1Z7GA 3PGXA 1D6NA 3GMTA 2BCEA 1LI5A 1UANA 3GD7A 4D44A 4BB6A 4PBRA 3OPQA 4DAEA 4RVUA 4OQXA 4UUMA 5D7NA 5AVZA 3O8CA 4CQMA 5J2UB 4OHVA 1NXWA 4FQ7A 2AKYA 1BVYF 1T9GS 4FZVA 4OFWA 5COAA 5IC5A 3V7NA 2EG9A 4QIHA 1XNQB 4RJTA 1BS2A 4R1OA 4W1PA 4ZGBA 1NURA 3E2IA 1FFAA 1MC8A 3PPVA 4LJ5A 5TVGA 2WF5A 3FTFA 2WAMA 3IQGX 3ERCA 1YJXA 4PZZA 1WXGA 1TW3A 4R4JA 3ILHA 1WSAA 2FAXA 5JVDF 2VG8A 1OXMA 1ZUNB 5FWDA 1PZNA 1W581 3PUJA 4BLTA 3IBGA 2P68A 4PQGA 5ULLA 1M5UA 3RLIA 4UM9B 4MVJF 2FPRA 2Y0PA 3OH8A 1T6NA 1ZA1A 4MA4A 4P3OA 5FTMA 3ABQB 1XUOA 4RHFA 3DOJA 4TKZA 3R7DA 2KWIA 4DMRA 1TAUA 3RK4A 4R83A 4XB1A 5B4UA 2FOLA 4MVJH 2IU0A 5JNUA 4ZO9A 5KPJA 4EGSA 5B5SA 3C3YA 2CKMA 2LXNA 4E22A 4NBKA 5DHFA 4Y6GB 3DDSA 1S4MA 1VTKA 1WF6A 1CLUA 3VKFA 4JJEA 1R6TA 2QX7A 4P7KA 1RKUA 2ZI3A 3O8QB 3ROXA 2VPWA 2B6HA 4KBGA 4LYDA 4MS3B 3UK1A 3BXZA 5KUTA 4B17A 5HOEA 1VMDA 3ZBUA 1WUYA 4B3SB 4PE5B 3CEJA 4MP6A 5K3SA 3TX6A 3DBRB 5LOVF 4QDTA 2CLFB 2WIGA 1YS9A 1OAOA 3ZWOA 1KNXA 3FLAA 4YACA 4MULA 1F2TA 5IASA 5E9WA 2JIOA 1YQEA 1LLCA 3T9EA 4DC1A 1RBMA 2ZE8A 4TN5A 2NZVG 1Y81A 5FRDA 2Y6VA 4P38A 3RSLA 3GAFA 4TYWA 2Q1TA 4D0NA 4ZVQA 2D00A 1UADA 1SU4A 1ZLXA 4O4JB 5KI6A 3WHLA 1E5XA 3UFXB 2H0QA 2YN2A 5IW8A 2REXB 3N59A 3OP4A 4FBLA 3T9FA 1LDNA 1V16B 4TYNA 2O59A 4IGAA 1WDLA 4ZAFA 2JANA 5J4YA 2A33A 3HZHA 3PE6A 1IEXA 4OGGA 3ZN2A 2PS9A 3E05A 3LV8A 2XDWA 1HEYA 3RIYA 1X1SA 4YV2A 5D84A 1Y7TA 3AKYA 3MSXA 2NX2A 2PGNA 2VBIA 4WRRA 1U2RA 3QWAA 4G5OA 2P4UA 1ND6A 1GVNB 3CJRA 2ZBUA 1BU8A 2G1KA 3IT2A 4ER7A 3BYZA 1G8AA 1N0WA 4JLSA 4DC9A 3GLIE 4X8LA 3OQIA 4U7WA 5B1IA 3TE6A 1KI9A 1KI1A 3T7JA 2FJUA 2J0EA 1ISIA 5I7EA 2OFOA 2ODQA 2X7JA 4OK3A 4W7IA 4XQ0A 1LWNA 1XAJA 3L93A 4ENRA 2I2WA 3JQPA 4K9QA 1GZ6A 3EIEA 4QFDA 3ZGOA 4IG9A 1KI7A 3K96A 3FWPA 4OUDB 2OLEA 3ASZA 1PYOA 3BQ9A 4MJLA 3NWEA 4Z4CA 2BFMA 2DH5A 4AUKA 2N1BA 2PFGA 3QLJA 2V5AA 3VPAA 5ISMA 5SY6A 3KVRA 3HXLA 1P2UA 2Z2YA 5AVRA 3ZY5A 3FHTA 2HHLA 2UVPB 2ZWVA 2XODA 3FYHA 5HDBB 3VR2D 1OFVA 3VR2A 2I7DA 4TMVA 1HK7A 1IPEA 3JS5A 4RO0A 4Y2UA 1P9OA 4V0RA 2ZZMA 1XCJA 1L3BA 1TT5B 2EHDA 5GY7A 2EJCA 4A8JC 1KKMA 2BZ0A 1SC1A 3CQ9A 3D6NB 4C0SA 3BGVA 1G4HA 3MQ4A 2PYDA 1W29A 2C2HA 2R4QA 1Z88A 4I6GA 1LF0A 4UVGA 2CK3A 3VYRB 1TLTA 3F5FA 1G3QA 2FEMA 3AF3A 4QUAA 1WZ2A 1R0XA 3F8WA 3KPJA 5DX8A 2XNDD 4QDJA 4GMKA 4QG7A 3ZQUA 2P2LA 4EG4A 1WD7A 4LMBA 2OCGA 2RB4A 4U02A 4QARA 3WYFA 3OA0A 5JMOA 5F1KA 2RBGA 2O3TA 1ZXXA 2Z83A 4FMPA 4GYJA 4N5MA 2J5RA 421PA 5TQJA 1EKXA 4MI6A 3A4TA 4QU8A 3BE5A 2UZ3A 1NZDA 1Q0QA 3VOBA 1TRHA 2YS7A 1AIPA 4L51A 1TA0A 3KPWA 4RORA 2JJ8A 1NLMA 3HGTA 5A3VA 3TZHA 4BQEA 3QEBZ 4GGOA 2OGWA 5A4KA 2ZJBA 1LV8A 4QFMA 2P0AA 4GF5A 3T3NA 1PN3A 2VZ9A 4BU1A 4ZEWA 5B2FA 4BE9A 2UAGA 2NUAA 3E2MA 4ZA2A 1RKVA 4E5VA 3HXMA 3IESA 2V55B 3PNMA 2XOEA 5ADWA 3ZJTA 3IPLA 4DFDA 1SQFA 5D3ZA 1RBQA 1NBWB 4FEAA 3AW9A 1QTNA 5IZCC 2J6CA 2XTMA 1PZXA 5KOHA 3ZLJA 2OK8A 2ZS9A 4MCAA 4RF4A 4GW3A 1FU8A 4PHTA 1A98A 1E79D 4BE7B 1C8VB 4P7FA 4L75A 5JASA 1T24A 1DUVG 5EESA 4DAOA 1QG2A 4XLZA 1JEYA 2MR6A 1J2TA 5J2TB 3K0BA 2MT9A 5DXJA 2GTHA 2FN7A 1K66A 2EFJA 4EI8A 2NGRA 1VLJA 2WWXA 2WFLB 5BYJA 1WEKA 1YJ5A 4X44A 3KEQA 1UXOA 3QUSA 3HS3A 3WGLA 1WBBA 4AX8A 1Z15A 4HYYA 3L9WA 4FZJA 2G7MC 1VMIA 1JB9A 2H8KA 2O6HA 4J9VA 4GOJA 4WCFB 3R7WB 1FQOA 4MTLA 1BTOA 1I2AA 3JAKA 3NHLA 1QBKC 4M7OA 2WMOB 4HNGA 1NLUA 2P79A 2F67A 3E7WA 3DZKA 1NF2A 4NMMA 2BSQA 4FT2A 3PRKE 1JFRA 4RMJA 1TUGA 3QU4A 2WE8A 1EFKA 4IW3B 1PF7E 4YRJA 4JOQA 1PL7A 3A37A 5TV2A 3P4XA 1YCDA 2B8NA 2HQBA 2HRBA 2QUHA 3BL6A 4OYHA 1IXZA 3Q6IA 1L8QA 3EEYA 1TEVA 1XU4A 2ZXEA 1QH9A 3OVMA 1VL2A 1E1QD 1JW9B 3QEJA 2HLPA 4G0ZA 4E3WA 1IIBA 3JD4A 1TIKA 3JD2A 2II6A 3LECA 1NLFA 5KX5A 4N5HX 3AETA 4UULA 2E48A 3GDOA 2BMDA 4CFSA 4M8KA 5HP4A 3B7PA 1RKBA 1W49A 3MS4A 4GEKA 4ETMA 2FKNA 4C7OB 1QFXA 5JXIA 1AKWA 2VH1A 3KZVA 1M6NA 4XWGA 2AJ8A 3DDUA 1QZXA 3AGQA 3HEBA 4YV1A 3KB6A 4KVGA 3UH0A 1Y4DE 3SIXA 1CRPA 3MIIA 3WOVA 4L5BA 3QPCA 3I9JA 3P9QA 2C4WA 1ZU5A 2HTFA 4HRAA 1L5ZA 1M1YA 4V0NA 1B1AA 2FWPA 3GEMA 4PPQA 4A7PA 4C6TB 1QDEA 5A5GA 3LK7A 1DU4A 1Q6YA 1V6AA 1K2WA 2DWOA 2VPPA 3NBQA 4QG3A 3C1TA 1YBHA 2OXEA 3FZQA 4AECA 3CVYA 2P6RA 2D2VA 4PPNA 3PT9A 2XB4A 4FYXA 3A7EA 1KOFA 2OV6A 3HB5X 4PICA 2YUIA 4KQWA 5JCJA 4BMCA 2HX1A 1VJGA 1C9KA 2IXGA 3QHPA 1F8UA 4P86A 5FO0A 4BVBA 4ECEA 3KD3A 3UHJA 1QXSA 3U7GA 3ZY6A 2Q9CA 3N2IA 5KTYA 1KETA 3U5TA 4CQLB 1N9GB 1U5AA 4LTDA 2I4RA 3OFNA 2FRVA 1XQ1A 2OQIA 3OZUA 1F4PA 3OPYA 4M1OA 5CEEA 1XNHA 3H1FA 2HT1A 4KPFC 4JLBA 4PIVA 3IQWA 3OOEA 1E5QA 1KSFX 3BSSA 3IUSA 3KQUA 4MYDA 4TQUS 3D8TA 4RFSB 3EEIA 3A6LA 1NYTA 1QIJA 1R4MA 4NG4A 1XRPA 1G5TA 4NQRA 3SYNA 5ELXA 1CRZA 1J90A 3TSCA 1YFJA 3FYUA 2B37A 4QOGA 4S1OA 1GZSA 5KU7A 1CUJA 4HEA6 4HT3B 2HF8A 1HMPA 2FZGA 5A2GA 3QEKA 1DAFA 1LQUA 2PU7A 4F1WA 5KZMB 3T7DA 5J9FA 1NQ5A 5EKXA 1XP5A 2QGZA 4XD2A 3EQ8A 3IAEA 4Z51A 3KZCA 5IBPA 3UMFA 5B7NA 1RWMA 3R3ZA 5H9WA 5KSOA 3DSRA 3JXEA 3J7TA 4RYDA 4ZQIA 5F9HA 3FE2A 3UF0A 2R00A 4L15A 1KI4A 1TM7E 3N7TA 1IBKB 5IFLA 5EIBC 4ER3A 4ZVNA 2I6TA 2HADA 3VPXA 2B8WA 1CS0A 4CV1A 1Z7EA 1RI1A 4Q4JA 1PK8A 4J29A 2VVTA 4FKMA 3B38A 1JWLA 4JI8B 2HCJB 3FYUC 4C0BA 3LLCA 3R9IA 3GJTA 4BP8A 3MF4A 1S3FA 1HNNA 1OH7A 3CM0A 1VLHA 4IHQA 4G25A 3RASA 1HQDA 3R2JA 4S1TA 1HT2E 4R51A 3RF7A 1P1IA 3UXMA 3BL5A 1VECA 4EUEA 4G5QA 5C7IO 2V65A 2IYLD 3O4HA 1KSHA 3VZQA 5MFPA 3R44A 2GD6A 1UJMA 1A9OA 1EESA 1FCJA 1M6HA 2ATVA 2ARKA 3GBSA 2GJ8A 1ZJ5A 3E70C 3E9CA 3QSGA 4FYHA 2AFIE 3KOMA 1FYFA 4QJBA 4YJKA 3GLFE 3GLGB 1UC8A 4DUPA 1ZL0A 2FV8A 1BQ3A 2FLWA 3PNOA 4GI5A 4IOLA 3A6FA 4FEGA 5FAKA 4RESA 5JVDB 3UV6A 3V00A 1SHJA 2P2NA 1DT3A 1XQYA 2ZJOA 3N39C 3PFGA 4BO2A 2IE8A 2SCUA 2O54A 3OIFA 3L0PA 4FYVA 1EZ1A 3LM8A 4FMDF 4HWOA 4YJ3F 3TNFA 2B5WA 5LQAA 3CLUD 1LPOA 4HNQA 5AKZA 3N2NA 2PT7A 5ITWA 3B7WA 3TW8B 3TTSA 2C2ZA 4J0CA 1G21B 4JFAA 4B4OA 5K4HA 1QHHB 1B6RA 3WVNA 3ZZ0A 4NFHA 5J2UF 1WHTA 2Q0QA 2IYFA 2VJKA 3AMVA 1G64A 1CR2A 4TV8A 2CBZA 1ST3A 2CCGA 1GQRA 4MV9A 1KK2A 2SKDA 1YDHA 1H9CA 2XZDA 3FAZA 1SUEA 1OGIA 2OQRA 1E99A 4RY2A 1Z45A 1XZNA 4AN1A 2QN1A 3IE2A 1SQ0A 2H2WA 4PSVA 2XMPA 4MUXA 3I8XA 1FLVA 3GLKA 1E5DA 2J33A 2YV4A 5TPWB 2B8EA 1PKXA 1QS0B 1Z33A 2WKWA 3K70C 1U63A 3ANYB 1EFCA 4PW0A 4FB5A 2O14A 4KI7A 3KKQA 1I3CA 1R0LA 2JI9A 1DKNA 1HRDA 3FKQA 4M89A 3T99A 1Y4ZA 1G19A 2LIVA 3EXHC 2WWRA 4BLUA 1SU7A 1YIDA 2PMWB 4RQAA 3IO3A 3PFCA 1Z4LA 4XLLA 4D9IA 1FBTA 4NICA 2YYSA 1GARA 5ADVA 2TS1A 4MW5A 4ESVA 1X77A 1ZWLA 2DKNA 3A2NA 1N1MA 4HDCA 5BWNA 2BZSA 3DDOA 4CIWA 4RTMA 4XX1A 3WWCA 4H18A 4RA6B 4Z4GA 4J91A 5DTIA 2WJAA 3X1ZA 1HX7A 2H7CA 1NVFA 2XJ9A 5JT1A 5KYYA 3CURA 1PEAA 1DG3A 3DLCA 3JASB 3V48A 5F98A 4LQLA 1B8OA 2PLAA 5BWMA 4O5AA 1RKXA 2EW8A 3HKEA 1GNLA 2CL5A 2IZ1A 5GGYA 3QWHA 4TLCA 3HVRA 1KZ9A 1PW5A 3Q1KA 1P7CA 2C57A 7MHTA 2XAUA 4CG1A 2AXQA 1P17A 1EFPA 1MN6A 1Y3BE 3EOBI 2XSZD 4NEHB 3CNOA 3ODGA 1JTFA 2X1MA 3C1AA 4MPJA 3REOA 2DWPA 1XVIA 2O2ZA 3H8JA 4IIEA 4FDLA 5EYPA 5I7OA 3WP1B 3RSZA 1IWBB 1YOVA 5TVKA 2YASA 4F3CA 4QVKA 1CU1A 3K1TA 2RHHA 2R6HA 4WMLA 3S2YA 1VA5A 3U7HB 1CY8A 4NZPA 4F7DA 3FSJX 4G0VA 5ALKA 1GGHA 2CLDX 3BA1A 4XWKA 2E4WA 2JASA 4RGYA 2WILA 1XXLA 2I78A 4LVCA 4AIRA 3KJFA 5LUBA 2IE0A 3H13A 2GJKA 3K4PA 1WA5A 2FHSA 3Q7EA 5EIAA 5EJMA 3EYAA 4K05A 5IX8A 4B8WA 1ZQ1A 3OCWA 2WZBA 5I6DA 2RE8A 5A4JA 1E1CB 1MA0A 5JCOC 2NV6A 1RAFA 3B1XA 1Q1BA 4B7CA 5J23A 2JLUA 3OQOA 4TMFA 8OHMA 3KU1A 1GITA 2WF8A 3JYLA 1DBRA 2CDBA 4RK4A 4UHEA 3T94A 1H3EA 3CSDA 1YAHA 3HCCA 3P4YA 3RO7A 1JYEA 4B76A 1ADYA 5D3KA 1NYLA 2OHJA 3PD1A 1TKRA 4F56A 3K16A 3U3XA 3WGJA 1EBFA 3SKVA 4JDUA 2ZRBA 5HBRA 2D0PB 4W99A 5DBGA 1PUXA 5T41A 3DLHA 3UPTA 1ISPA 1JGTA 2Q5FA 4AMBA 4C3UA 4FUQA 1G0NA 5FPQA 3QOWA 3VYSB 1RVV1 4G5YA 3H4MA 5JC1A 1GUYA 3GRZA 4AM8A 3CS3A 2J5KA 3FHCB 3K0FB 4PS0A 2RIRA 3V46A 5KYUB 1G20A 3IUNA 4P93A 4BATA 1V43A 5GVSA 1SC6A 2VP9A 4AMYA 2G5TA 1L5LA 1JQBA 5KKAA 5HQ3A 3IS3A 4WASA 2ZITA 1BX1A 1MABA 2ATEA 3LJKA 3ZCUA 5LLDA 1H93A 1YR3A 3P0RA 3WWDA 3AVWA 1Q14A 2WSMA 2VQFB 2H5IA 4QRIA 3AEZA 2JH9A 1VLLA 3QW2A 2D1FA 3HVKA 1DT5A 4M9UA 4MUJA 3IP7A 3U37A 2W2NA 2IHBA 3I5UA 3OCJA 3TCKA 1KFEB 1ORIA 3FNFA 1RQGA 3I0ZA 3LO5A 1B6SA 2YOHA 4CJXA 2ZBGA 1SK8A 1J21A 2DFPA 3RQIA 3SHWA 1CULC 2F17A 1JAHA 3O2SB 4KQXA 2QSYA 3BRCA 4BNXA 4HG2A 2HMVA 2VPIA 5L3VA 2CXXA 1UP7A 5FV7A 2EFCB 4NIMA 4MLZA 3ZKWB 2AW5A 2BKAA 4TMWA 1POXA 1L7RA 1S2GA 2QP4A 4KQ2A 4HD8A 5CLLA 1PJRA 3Q41A 4ENSA 5CG2A 3W4JA 3BMNA 3GFVA 4EFDA 1OBVA 4F71A 3HPQA 2FXIA 1M1ZA 2WM2A 3FB4A 2ODEA 3HI6A 4FFBB 1T5BA 1QIHA 3DCNA 4JY7A 4WT7A 2E6UX 1LVGA 3HB9A 3QWFA 1XDGA 1TVMA 1JPVA 2ECQA 3FRHA 2QL5A 2V7EA 3KZKA 4WNYA 4DA7A 2E3JA 4NAVA 4L28A 2C92A 1MT0A 2I7TA 4Q9HA 4WNAB 2DQSA 3OX2A 3EUFA 4KQHA 1E0AA 2P6MA 1ISGA 1RADA 2F59A 3EVCA 4S3MA 3K1AB 3QFSA 4OQQA 4BECA 121PA 1LPSA 1TAQA 2UUAB 1OW3B 4PSDA 5GV7A 1FUUA 3ZYCA 5IABA 4HRXA 1K6MA 3W5IA 4WXRA 3JALB 2X58A 3M2TA 2WSSD 4P7BA 5ARDA 2PY6A 2QEQA 2R87A 3WP0A 3F1KA 1QRTA 5DCYA 3Q5DA 2V7UA 4KACA 5KVSA 4D9NA 2CKDA 4TSFD 3RRFA 5AVVA 1TJ5A 3LLMA 1PJAA 1U3UA 2JLZA 1Q83A 5CYPA 1WPXA 1WXHA 4ENTA 3N9IA 4CCYA 3M6AA 2IU6A 4GOXA 1EFUA 2NVOA 4HS4A 2CNLA 4MDFA 2JATA 4JMPA 1ECGA 4ILEA 2HSZA 3H9UA 2OFXA 4JNCA 4OOFA 5DLEA 3ZTYA 5D1NA 3VI4B 4DBLE 3L46A 5FPKA 3IA7A 4LKRA 1TMOA 4R2WA 5B2ZA 5FUQA 1T5DX 2RGNA 5CU7A 2ZVPX 1H1TA 1ZYUA 1QH8B 2V1UA 5KTMA 4LYYA 1R4NA 2R7MA 4H7HA 4GP9A 1R0WA 2P1RA 3QVOA 2XXAA 3TX2A 1OGYA 3DDWA 4R2IA 1XN4A 5DGCA 5DK4A 4EOGA 1BFKA 3H2YA 3QXCA 5JSZA 1USVA 1MEJA 3OKCA 2GO7A 1NY6A 4MGEA 4XZ3A 3K09C 3T7EA 1ST2A 2BGIA 2R6AA 3AT1A 3TD6A 1MTOA 5CG1A 5EZ6B 3A1NA 5L7YA 2HHJA 3ICCA 5ALNA 4ZQEA 2FKAA 3JQFA 4F1JA 4L7VA 3LMKA 4D56A 3F6BX 4H17A 1GPBA 3EWIA 1SVIA 3K0FA 3L06A 1FP4A 5EP4A 3IIKA 1N5MA 3KQWA 3S5JA 3OKPA 1P2DA 1T13A 1SUAA 2Q6TA 2FN8A 4K3VA 3L0ZA 1XKTA 4TTVA 1YK0A 1MX1A 1ISMA 3HSSA 4LBYA 3O4RA 5HX7A 2ZWMA 1GFSA 2WSBA 5JNVA 1VG8A 2Q9AA 1A9XB 3R6WA 4HDMA 1NZFA 3I45A 4BASA 3ZDEA 4ZAGA 1G7RA 1M7HA 5K6RA 5LMZA 1G42A 1Q12A 1A2OA 4E5PA 3H0KA 4ABYA 1TE2A 3HKBB 4J0QA 3HCRA 4JUIA 4MA5A 3U4DA 3ABSB 4R0VA 4G0YA 1H5UA 2W2XA 3FYCA 1JVNA 3LP8A 1MQAA 5IJWA 3FVTA 4HF7A 4EI2A 2Y2VA 3LC7O 3ER9A 3OY7A 3R9XB 1PRYA 2ZRJA 4QTUB 1MXHA 1AY0A 1PD1A 4B40A 3K6RA 1R00A 4IX9A 5CB4A 5IJXA 2XT9A 4YRAA 4EMSA 4EA9A 5EERA 4WGFA 4HR7A 4I5FA 4J4HA 2HMUA 3KK0A 1OX4B 1NN1A 1SXHA 1UKAA 2MHCA 4UNPA 4DWWA 4BO0A 3LGXA 5BOVA 2ANBA 4GMHA 4BRWA 3PR2B 5H9VA 2EZ9A 5K0GA 1N33B 1EHIA 1RI5A 2R1ZA 1XTRA 2VNJA 2R7AA 3G8BA 3AL2A 1Z38A 4LCEA 5GQSA 3EGDA 1YOVB 3EA4A 4RIEA 3WK9A 3PUXA 2O2EA 4CIVA 4JWKA 5I9IA 1GADO 4OY3A 4XVCA 1ZR4A 2IZ5A 3ENQA 2C95A 2WU8A 3OTWA 3NNNA 1UAYA 4IQ8A 2BGGA 2O8FA 1PP4A 3IDZA 4YY3B 3PQ3A 2W6OA 1T1RA 1BC5A 1ODJA 4OQLA 4TXLA 3MGBA 5TS3A 5KC9A 4ZO8A 1SXJB 2C58A 2N46A 3GUHA 3I92A 3KVVA 4R16A 4ALKA 5BYKA 3RVDA 3QX3A 4QASA 2COUA 2GHQA 4NQZA 3S2IA 3SR3A 1GVHA 2J0UA 5H70A 1E7SA 1JVSA 1Y5RA 3EA0A 2XMSA 3BE6A 1P2BA 3C15C 1UBKS 3ECSA 3H1EA 4KTVE 4XIYA 4D3DA 2A5JA 5A9SB 4C06A 1YS1X 1V5IA 1LLUA 2YJ3A 1VOTA 1ZD5A 3KL2A 1PQ4A 3GPBA 3FVVA 4XVRA 3NTQA 2FG6C 3GH3A 2XA1A 2YIDA 1B2RA 2Z4RA 3EBPA 4ODIA 4UVEA 4XDYA 3NP9A 3TIIA 3VNAA 1E6WA 3T3EA 3ZXYA 2OVBA 4NYMR 1DE0A 5G02A 4DYDA 3T5PA 5J4HA 2WV9A 4YALA 2D1QA 5BRJA 1FMTA 4ZJZA 1XEAA 1IRXA 3IUEA 1GTL1 4AJ4A 4ZTZB 4I81A 4IILA 4GG1A 2HJRA 3I8SA 4PYLA 4M55A 3EQZA 3QMPA 4DSOA 1JQ3A 4V0KA 2QTTA 3FCXA 5UKDA 5K7SA 1QBGA 3L4BA 3EZ6A 1YCHA 5TPWA 4UNSA 4CV2A 2BYTA 4RH1A 4UVIA 1XDBA 3G2JA 1GZHB 1EUZA 2R66A 4M1QA 2C4KA 4YI5A 1C0LA 3T1VA 9LDBA 1T36B 1W4ZA 1FTNA 2ZJ8A 4ZQBA 2QU8A 2ZM6B 3MTJA 3G13A 4DJJA 1QAOA 5JATA 1FX1A 4I2NA 4QSHA 2PEYA 3G8AA 4PIPA 5FBWB 4XW2A 5HDQA 2I6UA 4TRRA 5E1DA 2PVPA 2AHOA 2ZOSA 4Q6BA 3O4FA 3F6YA 4AJHA 1RAGA 4FLFA 5DP1A 2QGFA 3E61A 3LUBA 3A4YA 4IEIA 2VCEA 3IELA 2YYZA 3R7BA 3PSAA 2VP6A 3F9RA 4COOA 3NC0C 1CUUA 3OBIA 4PR0A 2XNJA 1ZD9A 3RVKA 4ZZ1A 2Q4DA 3NRJA 1H2RS 4GQIA 1MHTA 4JI7B 1JQKA 3HCEA 4RPJA 2PZFA 4UREA 1UKEA 4EX7A 4N0QA 1ENZA 1E77A 3L7CA 2C7OA 2NG1A 4PYNA 5B1HA 1DKRA 1B3RA 1OLXB 1YC2A 4IEEA 2DUNA 4UARA 4R8SA 4Z4QA 3PGMA 1E7WA 2C20A 2H5EA 4BNDA 1WTCA 4UUBA 2PM8A 1X15A 3A4IA 3WJ1A 3GN1A 1CE8A 1VLZA 4HATA 2A59A 4A9AA 4EFLA 1JJBA 3MS7A 4DQXA 5I9TA 3C16C 4ZDIA 5HIIA 1G4AE 2QOEA 2V0NA 2AH5A 2QAJA 1RXSA 2ZBFA 3CEHA 3LDFA 1EVLA 2JCSA 3LSYA 3OCYA 4IIFA 4LC1A 2P35A 4DSUA 1Z4KA 2QRVB 2VDKB 3MAAC 4LS3A 4WY5A 3BEDA 4PYRA 4E07A 3G0IA 2NZ8A 3DXFA 1X7XB 3MXTA 3QBDA 5FLYA 3GPCA 4NBNA 3T0FA 1RZ3A 1I6KA 2EL9A 4DRXB 1UWKA 1KWGA 1Q22A 2NU7A 4RPCA 5A03A 3I0MA 3OTIA 3UUGA 2QW0X 4GPTA 3IDSA 3HVIA 2F1HA 3OSUA 4PBSA 3FYDA 2WWFA 4DNQA 1U2QA 1IQ0A 3BCSA 3LG2A 4NBSA 4XUCA 3UW3A 3DD1A 2JCYA 2VQSA 4V0ME 2VQ6A 2ECFA 2W7TA 4B3BA 1E60A 4OCZA 5A3SA 3NLLA 3UXEA 5JPCA 1TKBA 3FI9A 5AQ1A 2XCUA 1RHKA 4PLYA 5EVJA 1BRTA 1EFTA 1JFFB 3OT1A 5IH3A 1Z36A 3G0DA 3ZJYA 2XQVA 3ZZUA 1DIAA 3C14C 2V3VA 2O0JA 4LNUB 3OETA 5KSZA 1IEVA 4N3AA 4XDZA 3LBFA 1N2XA 2HQOA 3AUYA 2YHBA 4FN5A 3WNCA 3AL3A 5LQJA 4S35A 1PR5A 1V11B 1G41A 1RWWA 3MILA 4RAOA 4ZVOA 1ZPDA 4M0KA 4JQSA 2CF5A 1I4TD 4UEWA 1KZ1A 2CNBA 4OGWA 1VJ0A 4WN9A 1J7JA 6CHYA 5IYZA 4W9RA 2OHXA 2WC1A 1F5SA 1N9GA 4QLBA 3M6UA 4P4SA 3U7QB 1O0BA 2VJQA 2ZUBA 2XXAB 2YICA 2ZROA 1OIXA 1UODA 4J0IA 4M0EA 2Q99A 1R6UA 1KI2A 1U7ZA 4GSLA 4X91A 1CUFA 2RHCA 1C4OA 8GPBA 1SVMA 4OTZA 1MGOA 3AWIA 4LNHA 3L82B 1T3LA 1YH3A 4JBHA 2Q49A 1BDBA 2GVZC 4LYEA 1DAOA 1ICEA 3ROQA 2Q07A 1YR9A 4C6TA 1M1YB 4DMKA 1WCYA 4XSHA 2FE1A 2FEXA 2GUWA 3BBPA 3HUTA 3P5BA 4P5DA 5AKKA 3MQ2A 4JI5B 2WWVD 3WMFA 3K09A 1TYCA 2MSKA 3C6KA 4HNUA 3OZIA 1ZH0A 1H2AS 4DIKA 4HNVA 3KQNA 4QGSA 4DNOA 3MN1A 1OB2A 5LP6B 3PGJA 1JV2B 1GTMA 1X70A 3HXPA 3HJBA 4X63A 3T7RA 3P9CA 3VTAA 2VT6A 5JCJD 4L27A 3HB1A 1FMFA 4B6GA 2WA1A 2PMEA 2QHXA 2OTCA 3OQ1A 1RM4A 3EXHB 4AD8A 1P9LA 4EYGA 1RJGA 4LCJA 2JGEA 4YC7A 3RD5A 4GI2A 5A7HA 2AE1A 3AUSA 2XYVA 1NAHA 3HBFA 1A5SB 2MINB 3EA5A 4ZVMA 3SOPA 1P6XA 4Z1MA 3VPCA 5EQFA 1OU4A 2TECE 3A6GA 4AS1A 2E85A 4EUKA 1ZD2P 4GVPA 2FUNB 2EP5A 2X0DA 1N2IA 3UAXA 2VRWA 3KCNA 4RVFA 1G63A 4DXHA 2F1IA 1AQNA 4QHTA 2RGRA 4ZVLA 3HGMA 4F9GA 1NIPA 2E49A 3DUWA 4DV3B 3IODA 1GSAA 1N6NA 3ZBQA 2A94A 5AH0A 5H3LA 4D6YA 3G7UA 2HQ1A 4ZGWA 2R751 5LD2C 5HFAA 1K6EA 1QHIA 1T2UA 2RG1A 4MRAA 3ZDZB 4DT1B 1ID8A 1OVGA 5HKOA 4RPKA 2Z56A 4O1MA 1P3Y1 3HYTA 5KBYA 1GAEO 2DPYA 1JEYB 4YT8A 1J8FA 1HL3A 3LHIA 4OKSA 5LA6F 4CM8B 2FCRA 5DHPA 1M0EA 2DY1A 1I3MA 2QJFA 1VFPA 1EBBA 4DKJA 2C5EA 4AW9A 1V45E 1TIBA 3V8NA 3QJGA 1TYAE 1N7IA 1UMKA 4C0XA 1HLPA 2DT5A 2HR1A 1EZ4A 1SKQA 3PXUA 1U5CA 4HGQA 4D98A 1Q6ZA 5KYUA 4PAQA 5K20A 3D9QX 3EAGA 3KHUA 3UO8B 5LFAA 4CKEA 2IKSA 4MB0A 1JG1A 3HFSA 2P8JA 1XK6A 4Q39A 3PXEA 3G2HA 4KOAA 1IXYA 3VC1A 3M6LA 1IUOA 2DSNA 1EP3B 1KBQA 1Z47A 3G5UA 4AZ3A 2FDXA 3NC1C 1H85A 4XTCS 4DCUA 4YASA 5EMJA 1E66A 2BWJA 2R5FA 1TL7C 2XMQA 2YHAA 2B4AA 4I9UA 1ISHA 3FWHA 4TOIA 1QX3A 4PZUA 1VRCA 7REQB 4RU1A 1U2GC 4R2JA 2D8MA 4YDRA 4C89A 4BDSA 3WWYA 1UMDB 1YHZA 1GCAA 1ZM3A 2VQDA 2AOVA 2LRHA 4HDRA 4KC0A 4PZEA 5ECWA 3OJCA 1K9VF 1DIOB 3DTVB 4QA9A 1Y5MA 5LYJF 4WCDA 1GQSA 3EXEA 3ANTA 1PZMA 5L7TA 2I6XA 3MWGA 4DQLA 2AG1A 1R10A 1YDEA 8ATCA 1E0DA 4HFRA 3AR8A 4QDZA 1MQSA 5AXBA 3S1AB 1NKSA 5F5LA 4AO7A 1TK3A 4C5CA 1MZVA 4B3HA 2PSHA 3FNHA 1T5OA 3Q40A 3B2NA 4GLBA 4JT8A 1QHSA 1QVRA 1Z4QA 4DSAA 2IIBA 2FMUA 1SU6A 5B1EA 2WYOA 2V6FA 4WKNA 2JB9A 5ALFA 3VI3B 3W04A 2YCLA 2OR3A 3SVZA 1QB8A 5HM8A 1SCJA 5J43A 3SWWA 4H4DA 4UVHA 1KFKB 1MNAA 1R88A 4R2LA 1D2RA 4CW7A 4KDEA 4TTAA 3JTMA 2Q2WA 3NFYA 2IEAA 2KMLA 3CVOA 5CM2Z 3RU7A 2IYQA 3IIIA 4B4KA 4KB5A 4ETNA 4HFMA 3M4NA 1XA3A 4QPCA 4B80A 1S2IA 2P3SA 4FGKA 2QQ0A 3FPKA 2R62A 4G81A 1OI3A 4JGBA 4JD5A 1LI4A 5ALRA 3G0HA 2CHGA 5FTWA 4AJPA 2IOYA 5KSYA 4G0OA 4Q3BA 4X7RA 3KLBA 1C7EA 3VKWA 4N3GA 4Z99A 5CW1A 1O5IA 1UJ4A 4O3FA 4MRPA 4RA6A 4AS3A 4YMHA 4TMYA 3T4XA 3E5MA 4EHFA 3G7SA 1WNFA 5AHXA 4ZWNA 4G1FA 1JSXA 3BJIC 3KR2A 3SYKA 3L4JA 1RXVA 2AFHA 4WXYB 3WL8A 4GX5A 2HQSA 3BXXA 1KQNA 4BOYA 1P4HA 2P5SA 3HKCA 1HTWA 1R5JA 5IU6A 2IYVA 3A36A 1JKXA 3AU8A 3KKMA 3LRPA 4F38A 5LKAA 3FDZB 2BF4A 1SC9A 1YBMA 2CLSA 4G67A 2VDPB 3TPCA 5HKAA 4OO3A 3U4HA 3JQGB 4JBXA 3ETNA 4P80A 1QO7A 4OSOA 2FTKE 4X1YA 3TVDA 4ABTA 1XZGA 1U0TA 3FFAA 3K9LA 1FF9A 2A2ZA 3ZU5A 2VS1A 4COKA 4DV5B 3Q9NA 3FVRA 2WNSA 3EXIA 4MDEA 4MS1A 2ZBQA 3REQB 3OLVA 4BQIA 4NH4A 3RVLA 3T7IA 4F3RA 1WU8A 2L42A 3N8DA 3WWZA 3L1UA 1UBFA 4RYLA 5HOQA 1P1KA 3ONFA 3SQDA 2AWNA 4CDRA 4ZVKA 3T0IA 1FTYA 4EVQA 2V7QA 4CKEB 3OZSA 5ALEA 3F0TA 1OC2A 1VPLA 4M0FA 3O74A 3B6ZA 1PQWA 2FSPA 2WKQA 2ZT8A 4LDRA 5FUBA 3GZNA 1W4CA 3T7AA 2WAOA 1JI3A 1HMYA 2CBXA 2J45A 1X3LA 2PWZA 4UZEA 3VR3D 2AF3C 4KQ1A 4MCHA 1W52X 3PJFA 4N47A 4H7DA 4CMGA 1UXHA 1QC5B 3DC7A 2DWQA 2BUAA 4NWIA 5BMVA 6AT1A 1HO3A 1T8UA 1P5FA 3CONA 4WK4B 5FOTA 4PLGA 2OXCA 4EL5A 4HZIA 1SHZA 4KIWA 5FNVA 5IXSA 3OQMA 1MORA 3LUJA 1EFAA 5J63A 2IZ6A 5CDSA 4I8XA 4E30A 2VTBB 5HKBA 3NHJA 4WOKA 5DCUA 1ABBA 1U9CA 3MK31 1RWXA 3B8EA 5LQRA 3UZUA 2J46A 1KZ6A 3P0HA 3PHBE 3RC3A 1DO2A 4PG7A 1WMAA 4QNMA 4Y6SA 2DKFA 5EIOA 3RABA 4FDMA 1A5TA 2G08A 5T67A 4U2KA 5JQGA 3PQ8A 1NVWQ 3BDVA 3EDRA 3O94A 2QQ5A 4O1IA 5FTJA 1HL7A 1VJTA 2GSDA 4CM3A 5A0TA 3C5HA 1BXZA 1DPFA 3GJ8A 4C4TA 5BW6B 3DBHA 3SSOA 3AI3A 4R1QA 5I7SA 3B1VA 3G2IA 3QG5A 1UQUA 1QANA 2HMYB 4DZRA 5JR3A 4DMHA 3UPUA 1LFDB 4M88A 3X43A 1QR2A 2X2FA 3C7KA 1ZI9A 1NN0A 3QF4B 3U80A 3NWOA 4IDAA 3V8PA 4B3JA 4MI9A 2X9VA 1T91A 3CA8A 4DR1B 4WW0A 2GPSA 4GKAA 3I9NA 1OXBB 1AM4D 3PRHA 2OCIA 2NLOA 1ODKA 4R8LA 5E4TA 2ZJFA 3NBZC 5ALVA 1PBNA 2V4MA 4G97A 5BUQA 1ZQ9A 2VT2A 3KCQA 4PNHA 4PTLA 4ZFNA 5JJKA 3HLKA 1H2BA 2R5WA 1QO9A 1NKVA 2E87A 1WZNA 3AC0A 1KO5A 2LE0A 1LSOA 2BFEA 2CLHB 4PG5A 3HJFA 1WOMA 2KB0A 4Y2YA 1DFHA 5EA2A 1JXAA 4HPJB 5IT9A 1LX7A 3A6HA 1R6VA 4B09A 4DMGA 1DRJA 4KLAA 1J0EA 4OXYA 5CXUA 2QQFA 3NTUA 2QT1A 1AO0A 4ZT3A 3C3CA 2NO4A 1TF7A 1DUSA 1EX1A 1ZA2A 1NG9A 2F3UA 3QNUA 1VG9B 1KXJA 1JG4A 1QIMA 4FGWA 4FW8A 4JB0A 3DE2X 2QE6A 4LIPD 2HBRA 3HDYA 3E23A 2UZIR 4J16A 4V38A 3COVA 1EVKA 5FBKA 1WXFA 2W48A 2YMQA 1D6SA 2CL6X 3KUDA 3R3SA 3NFRA 3A1SA 3M81A 4G1BA 4HH4A 3TO5A 4BWYA 1SUPA 1RWBA 3H18A 3OX1A 1ESDA 3RS7A 3TIXB 2VOJA 3IDQA 4WK0B 2VJYA 2WTAA 2FWJA 2VHEA 2WIBA 3WGNA 1U2TA 4KR2A 3LNCA 4BB9A 1JBKA 1CJUC 2FFRA 3GRFA 4D9BA 4I3FA 3VHQA 1G0OA 5CDYA 4GP6A 3THXA 3C5WP 4G56A 4GBMA 3ZU2A 2PR2A 4RH3A 3DZDA 1GPJA 1Z7YA 2IT1A 3PUVA 3K6JA 4H59A 2OM6A 3GLSA 3ILYA 5TPZD 2KSQA 3CNQS 4Q3LA 1VXOA 4O8CA 2EJWA 4BFTA 4GOOD 3NORA 4TYMA 4DCTA 2HPAA 4V1CI 3BUSA 4RL6A 1QGED 2DM6A 1G17A 3A7DA 1Z63A 1E9EA 3Q87B 2BEVB 3N1UA 3MTAA 4C07A 2IHVA 2ZUSA 3DT8A 4HAZA 1K7FB 5JG7A 1E2JA 1NBOA 1NMXA 1W5FA 2VYVA 3H3JA 3LYLA 1I4DD 4NK4A 4Q37A 1XO1A 2H00A 1X86B 2XWBF 4LHWA 3V4LA 3FFXA 2C5SA 4IP0A 3FDXA 1S8FA 2AD1A 3SYLA 1C7FA 2GXSA 4JLVA 1QTRA 4H7JA 2XWQA 2FETA 2NU7B 4FX2A 2ZVJA 4Z9BA 4I1UA 3PVCA 4BL5A 3OTGA 2AMLA 4KJXA 3EEFA 2EW1A 3H9JA 2XMGA 4FOOA 2H17A 4WAUA 2AMYA 2BT4A 4TTJA 3KUUA 4WFQA 4QOJA 4YBZA 2W2PA 4OBWA 4YCJA 3NOVA 4JJZA 4X71A 3GA5A 3M3PA 1IN4A 4Y3UA 3EJ6A 4BNJA 4AQYB 1MCZA 5KVVA 3JYHA 1NNSA 1NW8A 2RH4A 3AEYA 1Q77A 3I0NA 3PUZA 4R1TA 2YVAA 4R81A 4R41A 4UCFA 3W0LB 4EPWA 2P9EA 3ZQ4A 5LZ7A 1SUIA 4CQNA 4B32A 3ZDRA 4CODB 1G2IA 4D4KA 1DADA 4F2PA 1IN1A 3WLJA 4ML3A 1AZSC 1CZKA 3IEPA 1A8IA 2C4VA 3TBHA 1M8FA 5DLDA 5LVAA 4QECA 4G65A 1U94A 3RYHB 5E0OA 5FWXA 3WHKA 1VKZA 2DFKB 4JP2A 3L7BA 3OFVA 4GPZA 3WA6A 5F77A 3D3QA 3ECAA 5LB4A 1Q0TA 3X1MA 4JQZA 5LXTB 5F76A 2PKRA 4IUDS 4QJIA 3B6MA 2OHGA 4N48A 1A8SA 1J2EA 2YC2C 5KOHB 1T5SA 1ZK0A 3TTYA 4Y1RA 5JJ5A 1I7QB 4RD2A 4D57A 3FIUA 2PKWA 4TN1A 1EXVA 3K9BA 3RQSA 1E7RA 2Y1WA 1OYWA 3FSGD 5EJ5A 3ZVMA 3LH5A 4AG3A 3EASA 1JQDA 1O96A 3BG5A 3OM0A 4YAWA 4CZ2A 2DR2A 1B14A 1ZI8A 2JFNA 2JVJA 1CVIA 5D6NA 4RXMA 2MYNA 2X8LA 2W2KB 1KH2A 1M34B 1NVUQ 3BWXA 3RR2A 2FZEA 5BVHA 5C8YF 1B4DA 3QKUA 4JDPA 3H9EO 3PKJA 1AUXA 2ETXA 3TTTA 2A35A 4YWJA 3X3HA 1SY7A 4IQGA 3DXXA 3UJ3X 1U0FA 5JSQA 4EPTA 3E9NA 4F21A 1GPNA 1OA0A 2VDLB 1EWVA 2B1JA 4D6XA 3RPEA 1NQOA 3G2NA 4UNIA 3R3HA 1HE5A 1T0HB 4M6WB 3RADC 4FOLA 4EHAA 1N6RA 2PQ2A 1U7OA 1KO1A 4DRZA 3IAXA 3JRWA 3MEQA 1W4RA 2JHGA 1NMSA 2ZIUB 4BNFA 2C7BA 4G8JA 5JYDA 3K1YA 5FBLB 1LXCA 3AB3A 3BCHA 4UFPA 1P72A 1R6AA 1D7AA 1JXQA 2I7XA 2DGDA 5M5BA 5F9MA 4YP6A 2XGJA 2G9VA 2R47A 3PTLA 4YRCA 1VZ3A 4M1TA 4MUAA 1C1HA 1JEEA 3CJQA 3OZBA 4GVXA 4KXLA 4OHBA 3R7SA 2B8JA 2IXFA 3KHKA 2VUUA 4NYJR 1JQ5A 2UVPA 3KWLA 3TXAA 3C7AA 3TOSA 1W6RA 2P2YA 3ET5A 2EQBA 1GL6A 3KQPA 3NJRA 3SP1A 3WQSB 2I87A 2BDUA 5EJ4A 4U6QA 5LOVA 2QD3A 1ZMTA 5HZGA 3P9RA 3GELA 4C0QC 3GLFA 4C5BA 5ED4A 3X1DA 4MXDA 4D9GA 4CGZA 1G66A 2ZBEA 1AA9A 2O8FB 4IUCS 1HM5A 1FFGA 1Y3AA 4EUSA 3AR4A 2PCLA 2VWPA 2DHDA 3G8CA 4UU0A 5L3QB 4MQEA 1XPUA 1TTTA 5ER9A 1XZJA 2QTZA 3COWA 3SICE 3BT7A 1IIRA 1T9DA 2QE7A 3D4LA 1KS9A 3OLZA 1BN6A 3IVAA 3DQQA 1YR1A 3C41J 3RVBA 1DVRA 3QH4A 4QKQA 1U2EA 2WWWA 1Q50A 3B51X 1LPAB 3C3PA 1GUZA 3HB7A 2JF0A 2YNMA 3KBBA 2IUUA 3WLEA 4MPPA 2ZBRA 1JUDA 1Y63A 5HWSA 3F6PA 5HUJA 4Q3AA 2YMPA 1LGYA 2WTXA 1R3DA 3CT6A 3LKBA 4ZT5A 2W93A 3B36A 5LBTA 4IVPA 2PZKA 2AC7A 2XWJI 3HDGA 3DFFA 1UWLA 1O95D 4M9ZA 1M1NB 1GTG1 2R68A 1A72A 2VATA 3G6KA 4LYJA 4XJTA 3UFXA 1AV6A 2XECA 1A4UA 3EAQA 5AOVA 2VRBA 1KJJA 4QOHA 5LYJB 2QLMA 4XWWA 4I1IA 4OL0A 3UCXA 4DYHA 2FW8A 2XUFA 5AQEA 2X7HA 4O2AB 1KRHA 2ZI9A 3WLNA 3UQYS 4EYQA 1E58A 1R6BX 1DAEA 2R11A 4I1RA 1ZRNA 1IAQA 3RIXA 1N5KA 4FDVA 1BE8A 2XUIA 1IUKA 4DGQA 1N77A 3IOEA 3HVJA 4RK5A 4DB4A 1AE1A 2G07A 1RKQA 4EGQA 3O4GA 1QYRA 2GPTA 1U65A 1JXMA 3TJRA 4LZJA 5HW0A 5KB3A 4YAOA 3GHYA 3F5QA 1D6JA 4YAEA 4C6SA 3EVEA 1E3LA 1RHUA 2XRYA 3NXKA 4AY2A 3AIMA 3LHSA 4GX2A 1QORA 3FJOA 2WOJA 3OIVA 3QXSA 1YJQA 4YPFA 4HNAA 4CMBA 5C2JB 5EN4A 5LD2B 5AJHA 2LVBA 1DC4A 5E1OA 4EAQA 2ZSIA 1ZMRA 3IT0A 1P1JA 1EWTA 4HFNA 2AUNA 5T4HA 4FOSA 4IDDA 4DEXA 3LQRA 3ANXA 4E03A 5JEDA 1DQYA 2O8CA 1L7XA 2QZZA 3FGOA 4LBVA 4YCSA 5LNK1 4OGFA 3FUCA 2Q21A 1HEIA 4U7DA 1O54A 2GZMA 2XOXA 1F2UA 1QG4A 1U8TA 2HRZA 1RVDA 2NOAA 4RIGA 5HF9A 5K3CA 3ZPXA 3IBSA 4PC3A 5DHAA 3MT0A 1J0CA 2OGUA 5B53A 2VFAA 1QH8A 3BAFA 2X9QA 2Z2ZA 1AKQA 3GVCA 3D8BA 3W7AA 5HJEA 4OP2A 3PB3A 1CB0A 1T4CA 3TIFA 4F5ZA 5EKDA 1K0FA 2XOKA 5LQCA 3ZJ4A 2G71A 1I5RA 3B1FA 1OH5A 3ESCA 3PWKA 3H8SA 3N2KB 2G4LA 3M3HA 3RT1A 5FJIA 3FTDA 3EIQA 3R3XA 5I9BA 4MPRA 3GUYA 2C1EA 1JJVA 4QODA 3HCFA 3JV7A 1EXNA 5U4XA 3DV0B 3DYBA 3R3VA 2I4MA 3KKEA 4OJMX 4N3CA 3F7MA 2B7CA 3H0EA 3HDTA 4FYIA 3KPYA 1O95C 2QRQA 4LZAA 3MCTA 1HNZB 3O7MA 4P7JA 1ZDMA 3BGDA 3CLSD 4JKIA 4LYGA 4NX2A 3RUEA 4KXMA 4CETA 2EQ5A 2HBQA 4ILKA 4K88A 1CVRA 1J8MF 2WDPA 4LUCA 2PS0A 4R6WA 2I4OA 4WSOA 3RK1A 2BBWA 4HAWA 5HPYB 4GWKA 1UPTA 1RHJA 2Z3ZA 4CM9A 1AMUA 3P45A 2VDQB 1JDVA 3O6VA 3N2LA 1DBQA 2C97A 3NHAA 4S1VA 1M54A 2O8NA 4WXPA 3DF7A 4BEVA 2GN4A 1KJZA 4C0AC 4FC6A 3D43A 4EECA 5AKJA 3AUJB 3UWPA 4FHDA 4OMUA 2XY4A 3QKTA 4W6QA 1G8HA 3L18A 4B2LA 3SS9X 4ND7A 4P9NA 2ZB8A 4ACBA 1G5FA 1T8YA 2XNKA 5DKFA 5EUQB 4PX5A 3NH9A 3I58A 3EG9A 1VYTA 2ZRLA 3AO0B 1XAHA 3MWEA 4CM6A 2XVZA 5HNKA 4MRMA 2BBOA 3AV3A 2JLBA 3AF2A 1AXRA 2PA3A 5HS6A 3EWSA 4HWRA 4RFVA 3OJWA 3AOEC 3D6AA 1Z7BA 4ENVA 1V47A 2XQFA 2PH1A 3G49A 3OEYA 4GL4A 1RP7A 2B6NA 5E6UB 3UY4A 3THYB 4JU9A 1BYUA 1YD7A 1F0NA 2PANA 3OPVA 3QVKA 4L8VA 4FKBA 4II2A 2VSQA 2YWJA 4LXXA 4EKNB 3SNHA 3BCUA 5JFOA 4I4CA 4HLCA 1OC4A 3C3EA 3VC7A 1AG9A 2H1WA 4M22A 4OXIA 4B35A 4F3TA 1IMOA 3VHXB 4BZZA 3JYPA 4FMCB 1XCOA 2YW9A 3DOIA 1ZS9A 5FIUA 3KR1A 4AQ7A 3U17A 5EZ5A 4ESHA 1TDJA 5KTTA 2HJWA 4LNAA 1L7VC 1NQWA 2CVHA 1OYVA 1FYWA 2PRIA 3QQPA 4KGZA 1NF8A 3OX3A 2IELA 3BOSA 4B3MB 5EXPA 4DV0B 3ONEA 3KTAA 4WDRA 4NV0A 4FGUA 2ZJ0A 3BERA 3NT4A 1DJQA 4YCBA 1QFMA 3HJAA 4P81A 3ZD7A 4B3XA 1E6MA 1J2YA 5F5XA 4H7PA 3RG2A 2QLFA 3QQ5A 3STVA 3DUFB 5T4FA 4CLOA 1KYTA 1MR3F 4GX1A