2OV3A

Crystal structure of 138-173 znua deletion mutant plus zinc bound
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
260
structure length
260
Chain Sequence
DAMDITVSIPPQQYFLEKIGGDLVRVSVLVPGNNDPHTYEPKPQQLAALSEAEAYVLIGLGFEQPWLEKLKAANANMKLIDSAQGITPLEMPGRLMVADPHIWLSPTLVKRQATTIAKELAELDPDNRDQYEANLAAFLAELERLNQELGQILQPLPQRKFIVFHPSWAYFARDYNLVQIPIEVEGQEPSAQELKQLIDTAKENNLTMVFGETQFSTKSSEAIAAEIGAGVELLDPLAADWSSNLKAVAQKIANANSAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Periplasmic binding protein component of an ABC type zinc up
publication title Possible Regulatory Role for the Histidine-Rich Loop in the Zinc Transport Protein, ZnuA
pubmed doi rcsb
source organism Synechocystis sp.
total genus 87
structure length 260
sequence length 260
ec nomenclature
pdb deposition date 2007-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2ov3A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2ov3A02
4LJSA 4GICA 3AESB 1N4DA 4HN9A 4CL2A 5GGYA 1L5HB 1QGUB 5B58T 1M1NB 4OVKA 2AFHA 3MD9A 3K1AA 4G07A 5FLYA 1KAEA 2Q8QA 4TKVA 3AERB 1H1LA 3R5SA 2OV3A 4WESB 1K75A 4NNOA 3AEKA 3TLKA 4MX8A 3ZK9A 3TNYA 4OXRA 5JOQA 3EIWA 2AFIA 1N2ZA 3AEQA 5JJ5A 4MDYA 2WI8A 3PSHA 2XDQA 2OGWA 2AFHB 3U7QA 1QH1A 3LI2A 5CR9A 5HX7A 3UJPA 3K1AB 4WZAA 1EFDN 1PQ4A 5M29A 1G21A 2WHYA 4N01A 2XUZA 4TKVB 1H1LB 2MINA 2XY4A 3PDIA 5M3BA 3MWFA 1KAHA 3LHSA 5GGXA 5JPDA 2OV1A 3AEKB 5JG7A 5I4KA 2O1EA 4HMQA 2PHZA 4M7OA 4H59A 2AFIB 1FP4A 3AEUA 2R79A 1N4AA 4UDNA 3AEQB 2PRSA 1K7SN 4TKUA 5CX1A 2XDQB 3U7QB 2M6LA 1QH1B 2OSVA 3ZK7A 3ZKAA 3BE5A 4PAGA 3AETA 4WZAB 2YNMD 4FNAA 3BE6A 3PSAA 1G21B 1QH8A 3ZTTA 2QI9F 3PDIB 2MINB 1M34A 4MO9A 2PS3A 3ZK8A 1G20A 4IRMA 4OXQA 4B8YA 5AFSA 4UTOA 5KOJA 1ESZA 3HJTA 2X4LA 4WZBA 4PM4A 3AEUB 1FP4B 4WN9A 4INOA 4DBLE 5BVHA 1TOAA 4FI3F 5KHLB 5BVGA 4G09A 4TKUB 5KOHA 1M1YA 2PS9A 5CX1B 4UTPA 3AETB 4HMOA 4WNAA 3HH8A 4MLZA 5M34A 3MINA 1K0FA 1QH8B 2PS0A 2XV1A 3MWGA 4BBPA 3TEFA 1M34B 1KARA 4FKMA 3R5TA 1K2VN 1G20B 5KOJB 4K3VA 4ND8A 1MIOA 1N2CA 4WZBB 4WN9B 5BVHB 2R7AA 3CX3A 1PSZA 5BVGB 3NU1A 5KOHB 1M1YB 2YNMC 2RG7A 4H0FA 4XPIA 3EIXA 3AESA 4FILA 4WNAB 2ETVA 3HXPA 3MINB 1L5HA 4NNPA 1QGUA 4UDOA 2XH8A 1XVLA 4LS3A 1M1NA 2M6KA 5M2QA 5HDQA 3GI1A 4ND8B 1MIOB 1N2CB 4INPA 2Q8PA 3AERA 3G9QA 4WESA 2XQVA 4HMPA 3MFQA 4XPIB
chains in the Genus database with same CATH superfamily
1Q7EA 2VXOA 1JWLA 1F8YA 2FP4B 5IZCC 1NMYA 1ID1A 5TGDA 5FUBA 1NTRA 4ACAA 4KCGA 1FF9A 1Z9BA 3R6LA 1MAHA 3B13B 3LYHA 3MCZA 3VJKA 3VMFA 1DJLA 2VBFA 2V03A 3WOHA 4FP9A 5FAXA 2B9VA 1RRPA 3DF9A 3PPIA 4FZ5A 1PCXA 4D98A 3M9LA 2NPIA 3F5MA 1OCEA 1YULA 2PQ0A 4IDQA 4NYMQ 4DA8A 5M04A 4B3FX 1YONA 4Q3BA 5F64A 1DMSA 1MIHA 2LWIA 4IWNA 1H2BA 2J48A 1FJ2A 2IXAA 2PUTA 2Y1EA 3BGVA 1I7NA 1FLVA 3PNBA 3TBHA 4ZVRA 3QEOA 1NVDA 1RAFA 2XWQA 3RG8A 3EAQA 4CCSA 4EJFA 3M6UA 2VSOA 5K8TA 3T3GA 1GL7A 4AN0A 1WXWA 4PZPA 4S2UA 3T7IA 3V1YA 3CONA 3VPSA 3CJQA 4I3GA 4Q02A 2IXEA 5BSGA 3GLGB 3H7AA 3JX9A 1KMMA 1HRDA 2RGUA 1II8A 1QWOA 3L40A 3NR2A 4QUBA 3UN1A 4DQ0A 5K20A 1IZ0A 1INLA 4FQ8A 4Y2QA 2Q2WA 1FEZA 3OZBA 5LVAA 2ZIVB 1KKMA 5A4JA 4PFKA 3M2PA 2R68A 3V7WA 2WTMA 4AJOA 1YZ3A 1L9XA 3VR6H 4XLTA 4ZAZA 1UEIA 4NFHA 1PRYA 5FWNA 2XUDA 1DHRA 5LNK1 2J41A 3THXA 2VBGA 1MO6A 2PRSA 4XOIA 3TG2A 3W6NA 2A78A 4PHGA 3IP5A 3FCAA 2PXAA 4DV6B 2HMSA 3AJ8A 4CG0A 4KMMA 5KOYA 1T9AA 3EA4A 5FB3A 3EHEA 1II8B 1FTSA 5LM3A 1GCOA 4ZOAA 5EJEA 2LV8A 1Z5NA 4TVKA 4V3BA 2ZYIA 2ZYRA 3AB7A 3HVHA 5A4FS 3DCIA 2PIDA 3KV3O 3KUCA 3U6KA 4B2LA 5AM3A 3A1VA 2HUNA 2Q27A 3C4VA 4DDVA 1Z7BA 5E1MA 2J9YB 4RJIA 4XLLA 3THXB 3PJRA 1QRAA 1WXEA 1GA6A 2VYVD 2VP9A 2WUWE 1UDAA 3CY6A 4Q15A 2PGAA 4EKGA 2C7PA 3E2IA 1D4AA 1XB2A 3A1EA 1O6CA 3INTA 3IMKA 2HQ1A 1FX1A 3BGDA 1QCCA 4L3WA 4RQUA 3RS4A 1R6VA 1P45A 4E22A 4MKFA 3LP5A 1X39A 2XAUA 2EW8A 2GZSA 3DMFA 3BERA 4OMFG 5EERA 2AZTA 2NO4A 1JHXA 3VKHA 3OZGA 1VCHA 2BISA 4H35A 2HYDA 1WVIA 5MN4A 4BIMA 3RODA 3V00A 2NVOA 4PPYA 3E9ZA 3I3OA 4BQRA 3WV5A 4H7PA 1BMFD 3KKMA 4ND7A 3QX9A 3ZZ0A 4HSEA 4CV3A 4PLGA 5KVVA 3IJ5A 1OT3A 3KPYA 3WGJA 2P2SA 1ZI8A 4U2FA 5F5LA 1SCKA 2JFYA 3KCNA 2ZP1A 4C88A 1K3UB 3B3FA 3IDAA 2JFVA 2CNKA 1GTJ1 1YJQA 4GI5A 2OAQ1 1TYDE 4KBGA 4RENA 1OH7A 3BS4A 3F0TA 5DH9A 5DSXA 3D8SA 1E3WA 2G1PA 2BHRA 3QPWA 4V39A 1CEQA 1YZQA 4FC6A 3IDZA 3FMVA 2ILTA 2Y1DA 3FAZA 3MWLA 4CWAA 2HK6A 3WRWA 2JLUA 3P9XA 3JW8A 3I2JA 1TM1E 3IUSA 3TR6A 3MD0A 4ZDKA 2FHPA 1CQZA 4G85A 3PQ7A 3RLFA 1ENYA 2A30A 1B6GA 1UC4B 4M1OA 1YCDA 2AHRA 4TMFA 3IKJA 2RK4A 4YP6A 4CPDA 4W5TA 1E3WB 4NCNA 4ZODA 1QYXA 3AUYA 4R8MA 2I4LA 4PG7A 3T1OA 4BGEA 2Q5OA 4GE0A 1B3RA 3A6FA 2X86A 2J7KA 1O9HA 4NL4H 3SIPA 3UJBA 3D6UA 2ZB4A 5JFOA 1PVOA 2XE6A 2XE4A 1FVFA 2OGWA 2ISQA 4CYMA 5THQA 4AJEA 1SB8A 5CLIA 1O1YA 5DWDA 5AVVA 4OH1A 2HA3A 3C1OA 4V0LA 3K0FA 4IOLA 1SCUA 5SYMA 4YROA 4XFKA 3ZZ1A 1M6NA 5KVCA 3VRHA 1O95A 2HF2A 2YXPX 1IQRA 3JZDA 3KWMA 4M38A 2O3TA 4MQLA 4QFDA 4YCSA 2O1EA 2HH9A 4Q16A 3R76A 3RS5A 5CG2A 4RUKA 1I2AA 2JLZA 5H1YA 2SKEA 4PCUA 3SPXA 4BTEA 3AR6A 1KO7A 2VHVA 1ONSA 1KBZA 2OSVA 4YYZA 1MENA 3BZWA 5DTRA 3PXGA 2H08A 2IZ1A 2J8ZA 3LY8A 2JS7A 4P1ZA 4MVJF 3FPCA 3VAAA 4CN8A 4CT0A 1WU7A 3S2EA 4US1R 4KMOA 4HXEB 3NOVA 2FWNA 1FYDA 1XZFA 1EXWA 2C03A 2Q45A 3K0FB 1SCUB 4HF7A 3A1NA 3ED5A 3PCRB 1ZAKA 4GBGA 4Q4LA 3SZLA 2M6SA 3GGDA 5JMPA 4MR8A 3B60A 4KZKA 5JCOC 2GJ4A 1OWPA 3ZTWA 1CIVA 3T61A 4JCCA 2CHUA 3I28A 2VFAA 2ZJAA 2MHCA 2Z3VA 4H3HB 5C80A 1IBKB 1N0WA 3DUWA 3SN6A 2BHNA 3NAMA 1HPLA 1EGVB 1BWRA 5E6RA 5ALNA 4ZVPA 2C2BA 3MILA 1A95A 2PL3A 2H63A 2V55B 4IJUA 4QXPA 5C5DA 5AI8A 4DFDA 5JSFA 3R7FA 5KBYA 4C87A 1QIEA 3GBSA 4EY7A 1X3SA 1Z68A 4H7EA 1SK8A 3GA7A 2JNWA 3QELA 3VZBA 1DEOA 1VIMA 2ORWA 5C4IA 3RUIA 2OFWA 4L5IA 1DEXA 1EG2A 3AHHA 1J97A 1A2KC 2HPHA 3CO5A 4LN1A 4LC9A 4RDHA 4WV3A 4DYVA 5GP1A 3B7GA 5B1IA 4C4OA 4Z6KA 2D6FA 2HPAA 3DE5X 3G8AA 3IAS1 3MIZA 5E6RB 2J3KA 3D3KA 5AVJA 2Z56A 5ALRA 3TZBA 1V4VA 4JL5A 1OBOA 1U3DA 2A9QA 3HI4A 4KL8S 4ENTA 5INTA 3FX2A 2FJPA 3SC2A 5CXQA 2HJHA 4BNZA 4F6RA 3ECAA 1JVNA 1GUYA 2HQRA 4JUAA 2Q5EA 1E9VA 4QTYA 2WUEA 3FBGA 4L0MA 5CURA 3HNPA 1SZJG 1SOUA 2XUOA 2G8LA 2PS1A 3PLRA 2EERA 2O8BA 3RHZA 1X15A 3GUVA 3DT9A 2JI7A 3MXTA 5JRDS 3RJ5A 3QJYA 2RHWA 2YJNA 3CLKA 3NHLA 2KJQA 1XXLA 2OMEA 4GICA 1GDHA 5EOVA 3SM3A 1KRXA 5HFAA 3H5LA 3NNNA 1Q7CA 3WP0A 1IDOA 1R5BA 2YRXA 4DMHA 1JKFA 1AO0A 4IVNA 2QTZA 4P5DA 4WMLA 3BAFA 2J3QA 3OZIA 1H4VB 1UP7A 3K20A 2VJKA 4W1PA 3SC2B 2ZTMA 4F6RB 4PN3A 2VDQB 1L7AA 4BTLA 3WWCA 3TPFA 3DL2A 3PA6A 4Y2VA 5F12A 4V1CI 4W4TA 4RLSA 4L22A 2CK3A 3F9IA 3K0SA 3KEQA 4J0FA 3FTCA 3HRKA 4NYIR 4BGUA 4DJTA 1E9BA 5AJTA 3VVCA 2O8BB 3KB1A 1ISPA 4YMHA 3GOQA 3PVCA 3KSAC 2OBMA 3OEHD 3SYKA 3MNFA 3ZS9A 1V25A 1FRVA 3HR8A 2ZG6A 2QXUA 1AQYA 4ZK2A 1FTQA 4TYWA 1FMFA 1BH2A 4JEMA 3IXQA 4J3JA 2YWXA 3CSDA 1JXOA 2BYTA 2O5EA 1UDXA 3I5MA 4LYAA 5KKCA 1P5ZB 3W5UA 4D3ZA 3TL3A 1JQ3A 5B55A 4LWPA 3CUEF 4FFNA 4LEIA 2PRKA 2WIGA 1ISIA 4LXQA 5D5HA 3OPMA 2FWMX 1OI2A 4Q4AB 2FJ0A 2QXYA 3PFIA 4Z9BA 5K3DA 4JWTA 2PWYA 1EU1A 2G9ZA 4UDNA 2V6IA 1QFJA 5EC8A 3SHFA 2PANA 2XTJA 4RYDA 5AW0A 3QF4A 2V6FA 4FDVA 3DNMA 2OBBA 1ZGZA 3I5AA 1THGA 1BRMA 2R25B 4JLKA 4BKQA 4FNAA 3KFVA 4RXUA 1NKTA 2P75A 1HH4A 1B6RA 2J4FA 2WP8J 1L6RA 2Q29A 2WT4A 5J1TB 3ZU2A 4DZRA 5KQMA 1THZA 2P40A 3AFHA 4QGHA 3KYIB 5H5JA 4ZMBA 1I3NA 1E2KA 3I62A 4DDTA 2C97A 5F1OA 3Q3GE 3T5CA 3TNDA 4E2XA 4K9RA 5EP1A 3MLEA 4HPXB 4EYEA 3LXMA 3RI3A 3HTXA 2IV2X 3VYUB 3CRW1 2IU3A 4QOEA 3V8EA 1LB1B 2GCOA 4BVEA 3FETA 3QF4B 2C3MA 4DR4B 3IR7A 2GF2A 1WPRA 1ZM7A 1FTWA 3EC7A 1XRLA 2GYWA 3L43A 4MLZA 4P36A 4R83A 5CA0F 5JNTA 1A2OA 1DKMA 1NMQA 4TLCA 3N7UA 1GUFA 5EXPA 2J46A 1JF8A 3C6XA 4K6HA 4ADSG 3AMVA 4AFNA 1QP8A 3IO5A 2RGRA 1RWBA 2QN7A 1WY7A 2BR4A 2ODQA 3D6NB 1Y6GA 1UM8A 2EZ9A 4IG4A 4JQOA 1UXKA 1IY0A 1JA0A 1PKEA 4DN6A 2GCOB 2HK8A 2HYIC 4H2DA 5C7IO 1IUOA 2QTFA 4KV7A 4MGEA 4MQ4A 3DMGA 4PLTA 3VOAA 1SK9A 2FYTA 2Q4EA 2JJ1D 4FGJA 3VR4H 5MGNA 3IR5A 1D2RA 1NNUA 1UZUA 4FX2A 3CG4A 3GEDA 4RX1A 2GM3A 1G16A 1UEJA 3GVXA 4UJ3A 3U39A 1FUUA 3ETLA 2EU8A 1AXGA 4Y30A 1IHXA 3C6QA 4P4UA 1RXVA 1SOMA 5BW6B 5F9MA 1N5RA 4LZPA 3QRWA 3BSWA 3IQWA 5JAMA 4N82A 3JQFC 2VWPA 1YI1A 2WPNA 3F5QA 3G9QA 3NYRA 4FYIA 4NH0A 5DHFA 2XCOA 4XIFA 4B7UA 2QP4A 1T8PA 3I83A 4N3BA 5BUCA 2CXOA 1B0ZA 1TFRA 2ZS8A 4FDAA 3NIFB 3EHDA 4JUIA 2GAOA 4CV1A 1XGKA 2W2LD 5B37A 4YJ3F 2BDUA 4IJ5A 4MQ6A 4DM7A 4OBEA 4EKNB 4L27A 3R5JA 4LYHA 4ZRNA 1O87A 4YB8A 1XEWY 4IIJA 1BA2A 1YGPA 2ST1A 2B35A 3S99A 3DZBA 5LQRA 3F7MA 2A9RA 2BUCA 2RIRA 1D7OA 2PZFA 1VE9A 2RBGA 2G9NA 3H75A 5FPSA 3KVNA 3RVLA 2P11A 4ZV4A 3AVVA 1P62B 5EMNA 2HO4A 3D4IA 3R1IA 4IHJA 2C2XA 4RK6A 3DB2A 3HBJA 4TUYA 4QSMA 1RI3A 4R2WA 2LUOA 1UJ5A 5IG2A 1B73A 1TTPB 5AK3A 4UTNA 1ENZA 1KR5A 1GPAA 3S5JA 1WZEA 1XF1A 2VCHA 4D9GA 1D1SA 3QV1A 2XUPA 4ZAGA 4IIJB 4PQEA 4UARA 1JQ5A 1S01A 4NQZA 5FWAA 1NONA 1VJRA 3TTUA 6Q21A 5K0CA 3ETEA 1D6JA 4P6VF 2EX4A 4A10A 1I2DA 5TJ9A 1JJAA 3UPTA 3WAKA 3D5TA 3HV0A 3QENA 4QOFA 3SOPA 2GJAA 3WIOA 3CM0A 2Y67A 4IHJB 1GA4A 4M0EA 1CP3A 5ARCA 4TUYB 2QRJA 4BYMA 3ER8A 1L5FA 3QBEA 2IVZA 2QKYA 3H2JA 1PN3A 5LUBA 4JJGA 4BBAA 3QUSA 4MMZB 3EDRA 1EIZA 3L7DA 1O54A 1H69A 5EEGA 2I6TA 1CHDA 5E9JA 3SS8A 4DXHA 5CMLA 2WU4A 3AX6A 2RHBA 2WAMA 3KKQA 4FMPA 1I1OA 4QARA 4EA7A 1U80A 3QYFA 1YCGA 3LQQA 3ILXA 2A5GA 3HMQA 3RC2A 1C8LA 3ZQJA 1O2DA 3CNOA 3DZGA 4K40A 5JAHA 2X4LA 2YX1A 4HGZA 3A4TA 4BLOA 4ZJUA 3D7MA 1RAGA 1TCBA 1B1AA 2BZ0A 2E5WA 2GJ9A 2ZVQX 1B8PA 4HBZA 1L5SA 4NBRA 4LF5B 1SPBS 4I9UA 1QK3A 3CVOA 2GUWA 3EUFA 4CFSA 1IXRC 1MFPA 1DL5A 2FFAA 2GO1A 1XA3A 3MWGA 2JJ2D 3W5DA 1JG3A 3MG9A 5ALOA 2H11A 1LJUA 3R5TA 4FXPA 1L4EA 2WYWA 4BEWA 4OXKA 1D04A 3G0OA 3TLMA 1L5ZA 2BR3A 2O7SA 4MRMA 2OMKA 4BATA 5KTRA 2Q5IA 4FI3C 4WGGA 3NT4A 2H8GA 2R8YA 3E35A 3AF1A 2DFNA 4QDKA 3QHAA 3OBBA 1AK9A 2FX5A 4CIYA 3H6KA 2C5AA 1K6MA 4HVTA 4O3FA 2VEOA 4JSYA 4FILA 3UMRA 2GPTA 2ETVA 4LDPA 3U37A 1C9EA 2YTZA 1FXWA 4G1MB 4FKBA 3IVCA 3I39X 4LOHA 4HB4A 4EW3A 8GPBA 1U0TA 3OQVA 1U8XX 3E82A 1FYXA 3QUBA 4MRMB 4UPEA 1W2WB 3EXFB 2ZDGA 3UJAA 3CRVA 3I01A 1V37A 2ZCVA 1RM4A 1YZTA 2ZULA 3EZ7A 2FWPA 3RGGA 3RC3A 4BFVA 2HTFA 5FF9A 1R8SA 3F6PA 3I52A 2Q1SA 4B7ZA 1ZZGA 2PSEA 1SURA 1C8KA 2QSZA 4WD3A 5KHOC 4DW8A 1EP3B 1EFUA 1H8HD 4BFXA 2AFHA 2DGDA 1ADCA 2IQIA 3IT3A 2BDEA 4LJ7A 4Q7QA 5J47A 3K1AA 5K99A 2ZSEA 3PX2A 1GEEA 1SXIA 4KQEA 3ROEA 1MVOA 4F85A 5L40A 2ZRCA 1AG9A 2WVAA 3P96A 4OGKA 3ZHUA 2QRZA 4WSOA 5I7FA 4WOPA 3M9XA 1X87A 4Z53A 3REQA 2FW7A 3DXXA 2FFHA 3QUCA 4Z2AA 5KMGA 4JBGA 3PV0A 2WVGA 4HN2A 4J7XA 4TS9A 3RSZA 1E4OA 3OH8A 1YASA 2W2MA 4L9SA 3OJFA 3PPYA 3TLXA 1MGOA 3VKWA 1EVQA 1X8XA 2ZYTX 4K9MA 5CIQA 2AFHB 3CZAA 3HWWA 4QXRA 3FE2A 5H0IA 4DEYA 2O54A 3VX3A 3K1AB 3F8WA 5BPFA 1EFDN 5AJWA 2ODNA 5JWOA 3C8UA 2ISSD 3GFTA 1T36A 3O1LA 5HJ7A 1RHMA 1A4XA 1N0VC 4YYEA 1SUDA 3ZHOA 4IKPA 3REQB 4P93A 4UQPA 1LDBA 1TVEA 1WXGA 1V8ZA 2C1EA 2R6JA 5F1PA 5KMGB 3QSYA 4X6LA 2ZB2A 4G0UA 1G63A 2A59A 3CRQA 4K0RA 5CVTA 2B82A 3C1TA 1UR5A 1F8FA 2O48X 3ENNA 4YMUA 2W6OA 1P7PA 1BDMA 2WD8A 3LUHA 5CFPA 4OO3A 4IYRA 2FEWB 1DEAA 1T35A 3GR6A 5JNRA 3COJA 1MJ5A 3K0KA 1FVXA 3FSGA 1MW8X 3PSAA 3AR7A 2QTRA 1J24A 1T36B 2CNWA 4ND3A 2W71A 3U19A 3ABZA 7MDHA 3GLGA 4QG7A 5F98A 4BKMA 1MG5A 4YCNA 4B46A 3FDZA 1NM5A 1W4LA 1NW5A 2G08A 3EBOA 3R6DA 2R4UA 2DPXA 4C1NA 4EY6A 3PRJA 5FBRB 4DQDA 2VNSA 4ZJYA 3ZWXA 2CHQA 1RKXA 1ZD3A 4RD6A 2VPIA 2PS9A 1V5FA 4JB3A 4N40A 1ZJZA 5FLEX 3TPZA 2EBFX 2QUBA 4BEJA 4F72A 2QD4A 4HMOA 4TT3A 4RMNA 3WGVA 2HQOA 4ITRC 4EITA 1HSZA 2JFBA 2WU1A 4B74A 5KNCA 3KT6A 3X1WA 2FR8C 3L7BA 1T5HX 1DJMA 2PD3A 3FDZB 4LMBA 2O4CA 4WX2B 4KWTA 1I01A 2XGGA 1Z33A 5ALHA 4CKXA 3U16A 1KYZA 1C5KA 5B7GA 4BLTA 1TUGA 2EV9A 1SD1A 4RCVA 3VVMA 1O6GA 4G5SA 5DNEA 3SYTA 1ORHA 2IYEA 2X42A 1XRSB 1YIDA 2KWIA 5IYZF 2NUPA 1QLWA 2ECOA 3BHJA 3DE6X 1NYLA 4Q3CA 1HDYA 3TL6A 2DP4E 3NH9A 2G76A 4P35A 3U44B 3OMXA 4MW5A 3DQQA 4NY1A 2W90A 3L7AA 4MARA 4O08A 4XX1A 4E5MA 2G8NA 4QLBA 5KC8A 5CFOA 3VR2A 3ZIAA 1PQYA 2XB2A 2J33A 3OIVA 2ZJOA 3PT9A 1REQB 4J4BA 2O1WA 2Y0CA 5CCXA 2EG5A 4DLAA 1EVLA 3CLTD 4J1NA 1F14A 1VLJA 1WPGA 3G2KA 3GG9A 5IP5A 2A4KA 1OXUA 1FXUA 1ZMRA 3RYCA 2NUPB 4WA8A 1KNXA 1NVVR 5JLJA 3AZQA 3QJ5A 3FKJA 2C3OA 5SY6A 2BN4A 4HNVA 1QO7A 4LHVA 1EDZA 2W6NA 3IEVA 4RWZA 3Q7RA 2HHAA 2GRUA 1S8AA 1NN0A 4ZRMA 4D9EA 5EJ7A 1LBSA 1XCMA 2AE1A 3A3PA 4NZYA 5JH7F 5KTYA 1D4OA 4W5OA 1SN7A 4AKIA 3G8DA 1ZW1A 2GYYA 3KBOA 3L2OB 4G23A 4CDGA 3J7AC 3OFNA 2J5RA 3H5NA 4UAVA 5DHUA 5KDOA 1N1EA 2C94A 2QXTA 5FIUA 5BNZA 3QU2A 3USCS 3F6CA 3ZE9A 5D1NA 4CFZA 4J9VA 4MUEA 2JAPA 5FL3A 1U7TA 4PR0A 3OCVA 2ATVA 1DPGA 2IU0A 2BSQA 4PVCA 3FTDA 3GRFA 4ZU1X 3U7RA 3VZRA 3HU5A 1KZ9A 2PEZA 3TSOA 4DLLA 1KJWA 1VP3A 3FJOA 1F0KA 3GX1A 3I72A 4PO3X 4BASA 3OP4A 1KKUA 3CU5A 4MW2A 1LLDA 1MABB 2NQ8A 4Y2RA 1LDMA 1U6IA 4CTNA 4HEHA 1ZD2P 3CRRA 3GZ4A 2OCIA 3G02A 3LPAA 4HLUC 3DAHA 4RVDA 4BU1A 1UMDA 3CUYA 4ECAA 4ZVNA 1CY8A 3U3JA 2IZ6A 1DTEA 4MUKA 4D8UA 3QVLA 2BL4A 1NDHA 4TRJA 1HE2A 2V7WA 4JU9A 2C5GA 1EXVA 3BJRA 3I34X 2H1RA 1EDOA 2WNIA 1P2UA 3ICOA 1WMDA 4Z1MD 1GNVA 4MI1A 4B5LA 4HDKA 1DXQA 3E03A 2FSFA 3GGSA 3PX7A 1E59A 3GQBA 1Q2UA 3EQ6A 4O2LA 5BSVA 2WHRA 3GU3A 1P2TA 1OWLA 3V1KA 4DSAA 1UMDB 4XASA 2H5LA 2OBXA 3RFCA 1RLUA 4ZVMA 2REXB 4GKVA 2HGZA 3BGOS 3UV6A 1YB2A 2XCTB 1M67A 1UBGA 1OXVA 3EZ9A 5A3VA 5E1BA 1J25A 3ZEIA 4YCLA 5DP1A 3S2YA 4L8VA 1GTRA 1NZDA 1HK7A 1GTG1 2B4YA 4UBOA 2ZUCA 3UIEA 5JS8A 1OTHA 2ONYA 1HZJA 3RFUA 2AQ8A 3LCRA 3IAXA 4FE3A 2ZIGA 4HDKB 5J4LA 3GQBB 1T43A 2SBTA 4J16C 5K4AA 3KHSA 1PFYA 4ZZ3A 3K53A 1UDRA 3WHLA 4FWIB 4KV9A 3DO8A 5C5EA 5KKNB 5LLTA 3K5PA 4RTQA 3MJEA 5HK8A 4F9FA 3NT5A 4FIDA 5TXGA 3BB4A 3H9BA 2QN2A 3E1KA 1T9GS 4PYQA 4YMTA 1L5WA 2V9ZA 1SVNA 2D5IA 3H84A 2C4MA 4OQ4A 1G66A 4WZAE 4D4LA 4GZ5A 1L8LA 1ZJ5A 3BFKA 2DQZA 2NX2A 4K46A 4QBTA 3EWNA 2H18A 4M8IA 3I9JA 1NI3A 2DBZA 2ZI5A 3E2MA 3URKA 5IXJA 4PC3A 4KX5A 5FD8A 3PIIA 3R3XA 2V59A 2WWRA 3MCVA 2FX3A 4EELA 5ECDA 1OLSA 1B8VA 1NY5A 4RVSA 2AMJA 2GFHA 4TYMA 5D3KA 1U11A 2JATA 1M5RA 2WIKA 2A88A 4NBUA 1TZ2A 4US2R 3SBXA 2YXEA 4RV4A 1X80A 3GA5A 2XMBA 1XDGA 3TOSA 5DULA 2VTKA 3SX0A 4BNIA 4G0NA 3PCXA 1Y42X 4IIYA 4D74A 1G20E 3F2VA 5CVCA 2D7CA 2JZOA 3LKDA 1NJ6A 4P0TA 2QQEA 4ZKDA 4HQ0A 3ZWQA 3IT0A 3NV9A 4IIBA 3JZAA 3B5IA 1AU9A 1OLSB 3FVRA 2IOFA 1DG3A 2WABA 1AHIA 5ILOA 4POOA 3QQ5A 1GKYA 2HO5A 5C1IA 1I6KA 1WA5A 4Z2YA 3F9CA 4UBKA 1X80B 3NDRA 4MIYA 4MV1A 1OYYA 3LX4A 1G59A 4RD2A 3IL2A 1TA4A 5EUCA 2Y1OA 4QNMA 3QP9A 1DDGA 3JVUA 4H6VA 4KUHA 2Q7XA 5EHGA 1V8FA 1W5FA 3VO1A 3UCXA 3FWNA 4B8ZA 5KSOA 1A9XA 3OQIA 3TZ6A 3E9YA 1DAGA 1UJBA 3HNOA 2H7YA 5GQSA 1GZ5A 3HDJA 1TF2A 5FKJA 3UT5A 4QDXA 5EMJA 1CJUC 4PO9A 3VISA 4B7AA 1QHNA 4KXWA 3AU9A 2DHCA 5CFRA 4W5JA 2BF7A 1VFPA 3MS4A 2C2OA 1O94D 1P3JA 1G291 5LKAA 3A6GA 1PW5A 1QOPB 1X38A 1CY1A 1VB3A 5C8VA 4D42A 2KBFA 1XDSA 3M1LA 4LI0A 1RI2A 5CPFA 1UEXC 3ZZTA 3UT6A 4DVGA 4OTZA 2EYUA 2I91A 3CKMA 2H2WA 3D6MA 4D81A 1OH5A 3A1TA 3I6YA 1ECGA 3IX7A 1A9XB 4KSYA 3OQIB 3RM3A 4B80A 1PLKA 2OCDA 4CT4B 1IUNA 1YK1A 2CV0A 1JB1A 3IJPA 4KRYA 4DB4A 3OE4A 2CMHA 1GPNA 3UT5B 1ULBA 2QE7A 3FPJA 1L7QA 3VNUA 3PZRA 3HBAA 2LW7A 5EZQA 4WUVA 5BQ3A 1DFIA 1PG0A 4UEKA 3O03A 3C5WP 4GLBA 1GM5A 3IOCA 1ZI6A 3SG0A 5L6LB 4MYCA 4CM5A 3GRZA 1J90A 3HY3A 2V45A 2B78A 3GUHA 3G2HA 1W75A 5GWXA 5BN3A 2EFHB 2JIDA 1GTSA 3TF5A 3BRWD 2F00A 2Y1GA 4BAGA 2GAIA 3AJRA 4HB2A 4D8VA 1CZUA 4PSUA 1JMKC 5K0ZA 4XVCA 1XL0A 1KY4A 1P1KA 1PSWA 4I8IA 3KCQA 4MUFA 2VPXA 2J85A 5HM8A 4PIMA 1VMEA 3OURA 1CUUA 3F98A 4PU0A 4A8JC 1ILWA 2HF8A 2PZGA 3MELA 5HTKA 2CYCA 3DNPA 4HRYA 4PWZA 2XNKA 3LFUA 4RZSA 5G4KA 2XVZA 1L2TA 3T3HA 2YVUA 3E4CA 4ERXA 4TVSA 3UAXA 2UYOA 1SBTA 1JJBA 2DSNA 1Z39A 3BGSA 3P9RA 1XRRA 2AXNA 1Q74A 2QUHA 2VSFA 1QNLA 2A1TS 3MRVA 4FOLA 4KTTE 2OCXA 3T7CA 4LIPD 2I3BA 2QT1A 5IDQA 2Q0SA 2HA7A 2VPTA 2D1SA 4F92B 2GBPA 4KIGA 1MJHA 4XB2A 4QU9A 5BSTA 3SZMA 4UBJA 1DCKA 3PL5A 4FMCF 1C1HA 4WLEA 2Q5QA 5AK0A 4DUGA 4Z4FA 3GCWA 1YI8A 5EMLA 2G4CA 3N39C 2ZWVA 3ORSA 5G4KB 3IAFA 3GV0A 2PYDA 4E2YA 4CL2A 1LW6E 1KTIA 1AD2A 3H99A 3RS2A 2WUFA 5I8ZA 5BYAA 4KQIA 2IP2A 2DY1A 3DWGA 1YWGO 5ECGC 5A5FA 1KI3A 4H0NA 3AKCA 1ZRMA 2ZS9A 4J4TA 3CFYA 2AG8A 4EFMA 3GFRA 1YQEA 3R7WA 3PEWA 2V74B 3HUFA 2ZI7A 5IEBA 3EZNA 2GCGA 3WB1A 5IF9A 1I4TD 4WKBA 3M5WA 3VV3A 4DJJA 4LF7B 3B9RA 2OAEA 2G70A 2FSHA 3DEFA 3LXXA 3OO0A 1G17A 4MIKA 4P3XA 4NARA 2OXTA 1P2FA 5DPMA 4ZCSA 1L7MA 2F3TA 1QUFA 3BZBA 5CFLA 3ESRA 1T3ZA 4OBWA 1AKWA 1D1PA 1DBQA 3VKFA 1Y0BA 4UULA 1WW8A 1ZOPA 3P19A 1GPKA 1R8JA 3R7WB 3E9CA 1K89A 4N7MA 1Q15A 4WKPA 1C29B 3SC4A 4KIUA 4EABA 2AD5A 1QE0A 4QRHA 5KNDA 2W6QA 5I7HA 2RBKA 2ZM6B 1I30A 4BJ5A 3DEYX 2PR2A 1K9SA 2RC6A 2GARA 3GH3A 1E9DA 2GN2A 2LE0A 4G8DA 3DEKA 4XA8A 2UKDA 3LV8A 3O92A 4JLBA 1MRNA 4D96A 4EATA 4XUCA 3ES9A 3TQIA 4OLJA 1GTL1 3WGKA 2IYOA 3T7DA 3DQZA 4C0LA 2EEZA 4CIBA 2CSUA 4JFAA 5D51S 3W6PA 4M0LA 3HYRA 1S4MA 3W5VA 2QHXA 5E9WA 2BSXA 1J0EA 5H70A 3MFYA 3H3FA 4E5DA 3C41J 1DZ3A 4KFRA 1OZ0A 3TZEA 2ZJYA 1LPSA 2CLLB 3FHCB 1U5BA 4OG2A 1A82A 9LDTA 2ET6A 4K88A 4DMMA 4FI3F 4MAFA 1YE3A 3KKEA 3MCAA 3ESCA 4JLPA 4CCYA 4TTVA 2ZLBA 4J1TC 2OESA 3QVJA 4RKWA 1IG3A 4WY8A 4F84A 5DCWA 1KDYA 4BNLA 1Z3IX 2JGFA 3FLEA 1JXQA 4Y9TA 5AK6A 3RC8A 2OLEA 2JFQA 5JADA 2B0CA 4KI0A 1FX0A 3IQHX 3X2SA 1IOWA 2VRNA 2XKBA 5I4IA 1R88A 1W36C 1S0UA 3OF2A 4UATA 2F6RA 1N2CA 2FQ1A 1MH9A 1U5BB 1ATZA 2Y9PB 1US8A 2WM9B 1XDUA 1SXGA 1SQ5A 2RGYA 3WNZA 2NYVA 1FY2A 5D85A 4CM9D 4CCYB 1BIFA 1R27A 2QZ9A 1GQFA 3IFSA 3PGVA 4LOAA 3I23A 4CEJA 1AC5A 2IELA 3GUCA 3C3EA 1FX0B 1MV8A 4DSTA 1W30A 1J07A 4ZQHA 1JHVA 1SXPA 3KJNA 4MV6A 1G7SA 1N2CB 3VH1A 3SXJA 1ZIYA 2FCRA 2RH5A 1IN8A 1US8B 1MGPA 1Q83A 4KREA 1EG7A 4F3RA 4GI1A 4WESA 1K7EB 1AGPA 1N92A 3ZHTA 1NQ5A 2J31A 5AHKA 1IXSB 4CEJB 5ES4B 5EE5B 2C4HA 4QXQA 4DWWA 1FC0A 3G2NA 5KAPA 3GJ0A 1HLPA 5CNKA 5JSUA 2ZITA 3FZGA 1WUIS 3DO5A 1J06A 2QJTA 3RRJA 2DHEA 3EQ8A 4HGNA 2DLDA 1Q0QA 4LXIA 2X0DA 4AIIA 5I8PA 3SJAA 2Q3FA 3W8FA 3X1KA 6ADHA 3GLFA 4WESB 1JBKA 4UBIA 4X71A 4JYMA 1N2IA 1EBFA 1DV2A 1UJMA 3LM8A 3P9PA 5FO0A 5IXYA 2OUIA 2R84A 1VE7A 5CA1F 1KWGA 4JP5A 2O2GA 2QTLA 3WRXA 4BLSA 1U81A 3RIMA 1P31A 3ZE6A 2XA9A 2R1UA 3JZMA 1QGDA 1QH1A 2QN9A 2OHJA 2ZXEA 3G0BA 4WK0B 4B7XA 4PCVA 4AZ0A 1T6NA 4UUOA 4YRNA 2FX2A 3FBTA 1V5IA 3GLFB 1X86B 1ACLA 2GZMA 1R0WA 1DRJA 3DOUA 4N5HX 5EPOA 2RKWA 2Z4TA 5AJHA 5A7HA 2GN4A 2VRCD 4GMXA 5T3YA 3SOZA 5HKBA 4EW6A 3OOWA 2F9MA 4BNJA 3CEJA 4JIGA 5JCZA 1F7VA 1RFLA 3LY7A 4ZDWA 5PGMA 5F9FA 3DDUA 2IGTA 2QI9C 4LC0A 3AINA 5T6BA 3EIEA 1NW8A 1V95A 4BNKA 4XIGS 1QH1B 2P9BA 1K6IA 3BBLA 3DPSA 2XSZA 4RHCA 4AZ0B 1KC3A 3HYNA 1IEWA 5L7YA 2ZRAA 3BDIA 1FUIA 3QFTA 4CW7A 1ISRA 1TVMA 1U9CA 1VE3A 4Y6RA 5J2UA 2IS4A 1V3VA 5AFSA 5EXSA 4J0KA 2C57A 4U9IS 1E1NA 1NW7A 3VKVA 4DCGA 2IDZA 3NT2A 3WLNA 4Z7JA 2B8EA 2Z9DA 2IZOA 4G1EB 4JP3A 3L6CA 1K3FA 3KVOA 5ALMA 1AHPA 2QQ0A 5B2FA 1XYYA 2C95A 4BMNA 3MAGA 3NHWA 4JLJA 4IIDA 4QYTA 4BUCA 5GAJA 1WEKA 3B7WA 4MLCA 2G09A 2VXYA 2ZAYA 5CT5A 3B9QA 1W4CA 1EE2A 4QWMA 2G1JA 4BO7A 4GM0A 1A04A 1KARA 5J2UB 1P61B 4N3CA 2A0YA 1LFDB 3TNFA 2HC9A 1XVTA 3LYAA 2IHYA 1ZIXA 3JYOA 5CVUA 5F77A 2BF4A 1NFFA 3ZDFA 3HKCA 1V45E 3OUUA 4BKRA 1N7JA 4WTOA 4GGMX 4WCFA 2YNMA 2Y0PA 2O19A 3DE4X 4I50F 3KTOA 1HDXA 4LYFA 5HIMA 4XH9B 3WZMA 1JIUA 4EEZA 1FJXA 1T8UA 4YI5A 2JEZA 2YFHA 3A6PC 1XV5A 2PNJA 3ZQKA 1KJJA 3IT2A 2EKQA 1OFUX 3KPUA 5HK9A 1X7WA 1CNEA 2OVFA 4EPRA 4FW9A 3HKCB 3DBIA 3L8HA 2IP4A 3KRTA 3PENA 4NFYA 4MDFA 1CTQA 2DWOA 3LCJA 1HA3A 1FNBA 2C96A 3QIVA 3RKRA 4PFJA 2F4VB 2HHLA 3OICA 1X9HA 4GM1A 4LV8B 4IR7A 4QOSA 1JDJA 3UJCA 1XRJA 3CX6A 1XMVA 3ZCPA 5I9BA 1XU4A 1KIAA 2FXVA 3TSCA 1WKVA 1MXFA 2D1FA 3UMBA 4YRSA 2Q6OA 4F5DA 1H3FA 4NRDA 1SCAA 4PLHA 1YDFA 3FB1A 3DL0A 2HWKA 4DA9A 1N2OA 5I9LA 2HEIA 3K70C 3AUTA 1X7WB 4IJMA 4RF5A 1V2HE 2ZTSA 4PINA 1JH9A 2C61A 4WN3A 1Q16A 4DLTA 4H7KA 4W82A 1GUAA 2WMDA 3HI6A 3AEYA 3CLHA 1KFEB 4JEHA 3UQYS 1KEEA 1QH0A 5BQ5A 3E3MA 3AVWA 4RFLA 2VH2A 3L1VA 2XNDD 3NALA 3N6RA 3HCCA 4JUCA 4GC9A 5I9NA 1K7CA 2VJQA 4L28A 1O5OA 1OU4A 2MYPA 5ENVA 3I4CA 2V7VA 2XE8A 2CLMB 3KOZA 3W9BA 4YHBA 1HUQA 3OT4A 4NK5A 2Q5LA 4IJVA 4WKGA 1GT6A 4KC0A 4DJ5X 4HI0E 1VYTA 1GYRA 3H5VA 2NOAA 2PJUA 2OL4A 4I9NA 5D6OA 2O2XA 1IWPB 1GPUA 2XCQA 1IVYA 1KEEB 4HDRA 4JKYA 1M73E 2JLSA 3DKKA 4MVJP 3EGIA 3IP9A 4UJ5A 3G8YA 1FDWA 1G3QA 1PBNA 2R5WA 2IUFA 2ZB3A 3G0CA 4GO1A 5AW5A 1EK5A 2NPOA 1T8RA 2B3TA 4NECA 2WVHA 4ROTA 2D7DA 4D3DA 1U4OA 4FCCA 5IBPA 1XDWA 3ZTTA 4FONA 4PRLA 4WOJA 3T0FA 2CF5A 1RQLA 1T1RA 4GM4A 1MZPA 3SZOA 5EE9A 1BEEA 3DKVA 4UM9B 3QH4A 4HDRB 4IX1A 5EXXA 3WLSA 2ZWPA 4WACA 4N5NA 1H8ED 2HADA 2Q3HA 2DMRA 1XCOA 4F6LA 1QS0A 3TIIA 4YRKA 4P3OA 3JQ8A 1Y4DE 3H4TA 3MWKA 3UMJA 1UBCA 4ER0A 2QZJA 1P39A 1R0BA 1R6TA 5F2NA 1RMYA 1Q92A 2J6HA 4HNRA 5HGXA 3TAUA 2O05A 3GUZA 2JGIA 2OZLA 3W1VA 1Z62A 1X1CA 3FFAA 4X3OA 4CM7A 3LWNA 4ISBA 4BPBA 2NYRA 3ANTA 3BB3A 2PUAA 1FTGA 4JX9A 4TQ9A 3KQOA 4I9GA 1VCNA 4EY3A 1E8NA 1BHQ1 3MTIA 1ENOA 1XMSA 5K0BA 1QS0B 3FGPA 2JGLA 4DUPA 1A76A 1HDEA 2WLSA 3VDMA 1AO3A 1DAEA 1BMDA 2Q6IA 4AUKA 1AXEA 1GGJA 2QLBA 1TIKA 4OGWA 5DGCA 2OZLB 3DWIA 3PX3A 1N33B 1GCAA 3MHPA 5K6TA 4K2AA 4Q37A 3W1EA 2JHCA 2J3HA 2PMCA 1XZAA 2AIRA 1UPAA 2QS9A 2WJHA 3CG0A 2O2JA 4NAVA 3EY4A 4Y9RA 2P9CA 3MC1A 3ZCXA 1Z6PA 5LQKA 3WR5A 1G5QA 5KQLA 4UHHA 5HF5A 3ZHSA 1P8AA 2CL5A 3F8SA 3BIWA 3CPJB 3W3AH 4GXNA 3AVYA 4OGFA 4HDNA 2UVDA 1F0NA 1C2TA 1IL0A 1XZDA 2WWHA 2ZTHA 4LMPA 4RHYA 2W2OA 3QEAZ 3F5DA 3C5CA 3HA5A 4R51A 4QL3A 5IN4A 1I7QB 4KR7A 1GKIA 4AF6A 5TT0A 1BWPA 1ZD4A 1JU9A 1KAEA 4ARUA 1D5WA 3LE8A 1ZCBA 3T35A 4I4NA 3Q3HA 1K88A 1J00A 2OG2A 4QBGB 3GZNA 5L3QA 3RJ9A 4BCDA 4D25A 3MJCA 4HDNB 3W05A 4PO1A 5C8DA 2IE0A 5BNTA 4MWCA 1Z4QA 2AJDA 3P9CA 1ODSA 2BGWA 3ZH9B 3EASA 2HXYA 3D59A 4EFNA 2ADFA 2VT7A 1UT5A 2I1WA 3HCAA 2IYRA 3MJ4A 2PZBA 2BHTA 2G36A 3CXRA 1KS2A 2C4NA 4RFSA 2R751 3E8XA 5J58A 5L9AA 2D13A 5B57C 3GZNB 2P62A 5L3QB 1NE7A 3C4JA 1VE6A 3IO3A 3MLBA 4LX0A 5HGJA 5TEWA 2GCEA 3VR3A 5GADl 4MVJA 4L9WA 4OA8A 5TPZA 3WGGA 1I8TA 4ZQIA 1BXKA 4BWYA 1J4AA 4IVRA 4DOMA 3EPPA 1SQFA 4HP8A 1V43A 3QF7A 3THWB 3EH2A 4OQQA 4MAAA 1LPAB 2GO7A 2PCJA 4Y2GA 3NIBA 4WK6A 1A7JA 1Z83A 1JPUA 1QJCA 4X7BA 1FU4A 1XLTC 3ZW8A 8AT1A 5ICSA 1OWMA 1YDGA 3HDHA 4AROA 1Z2PX 3DBVO 1E3SA 3VDQA 2DQKA 1XNQB 3LA8A 1H4SA 2YDXA 4CETA 2EGGA 3U4AA 5B4TA 4BNUA 3MJFA 4BMOB 2ZSBA 3O47A 1XQWA 3REGA 3SXPA 5IANA 3GRAA 3L0IB 4Q82A 4FCVA 5EJAA 3K2QA 1YTLA 2IXTA 1KRHA 1P0IA 1VKZA 4DMUB 1JR6A 1H93A 3EGDA 1CS4C 4MUIA 1W34A 1IPHA 1UXHA 3GLGE 3IE1A 2IJGX 4HR7A 1GG9A 1UC9A 4CMHA 2PGOA 2UXCB 5KS2A 5LOVF 1VCOA 1XP8A 2CEAA 4PLYA 4UXJA 5CDSA 1IZZA 2B4RO 4X1OA 4KR3A 3GLRA 5EVJA 3N70A 4DCJA 2XUIA 1N0IA 1TECE 2O14A 3HGQA 3RWMB 3U13A 5BV7A 4CF7A 1SKQA 3QBVA 4FYPA 3NFYA 3WJ1A 1ZFNA 2QTNA 4KYTA 4QFCA 4DZTA 1JP7A 3R7LA 1DDIA 3HP4A 4KLRA 4BWFB 2I3ZA 3OG9A 4AX4A 1LI4A 3EGDB 1IAVA 3QMWA 4FNOA 5EWLA 5K01A 1GRVA 4U5QA 3WLRA 3Q3CA 4A82A 1BFDA 2XT6A 1OZFA 4UVHA 3H97A 5ENDA 3TYXA 1VG1A 4XD7D 2CVFA 5EJ5A 1DARA 1NQWA 2G3YA 5JSQA 1T1JA 1BAPA 1ZL0A 3AXSA 3UFXA 1E1QA 1ZD5A 1DEHA 2WJ3A 2R7MA 3GEMA 3OM1A 4NG4A 5IVPA 2HBQA 2G07A 2PU5A 4RZIA 5DM0A 2O5CA 2ZSJA 1T0JB 2A5FA 2WV7A 3N75A 3ESZA 1N25A 3UHAA 5HUHA 1NVXQ 2I2AA 3EOZA 1GPYA 1VE1A 2HT6A 2NTEA 4XM2A 5EWLB 1H2FA 1MJFA 5L3RA 1H85A 2ZRMA 3FSRA 3TMKA 4R0VA 1VKRA 1Y8CA 3MJTA 3UGQA 3ZHCA 3ZWWA 4AJ4A 1ST3A 4MW4A 5AVWA 3CN9A 2G1AA 5EIAA 4O59O 4RHEA 1YK0A 3C7TA 1WP9A 2VF4X 2BRUC 4YJDA 5C3UA 1W59A 3ANSA 3SI7A 2Y3IA 3HDYA 2XUHA 2HD4A 3ORHA 5C32A 4FGZA 1E92A 1BFUA 3T52A 2OBYA 4QFMA 5JJLA 4KN6A 1THMA 2GXQA 3VAYA 2ZPTX 4R1TA 4XQ0A 1Q44A 5G3YA 4CU2A 4D9JA 2CLOB 3AGQA 4IDPA 4RTNA 2YCBA 3CINA 1B0UA 2AOXA 1DWUA 1U6KA 3R74A 3NDJA 5EKTA 5GPBA 1EVJA 3CZ9A 4J7UA 4B3XA 3KR1A 4DMGA 2Z08A 3RVJA 4GS5A 4ETIA 3CE9A 4RIEA 2DKFA 2OHHA 4WY2A 2XA2A 2VF5X 1GZ3A 3IURA 4GZLA 4JELA 4NHEA 4BE9A 3OTGA 4QC2A 1CJMA 1WB5A 2EKPA 2YWRA 3DTVA 3WRYA 3LDAA 3TBKA 1GKKA 1M1UA 5FYDA 3ROXA 1PZMA 4MV7A 1KJ8A 3SEAA 2OGZA 3MWFA 4F0JA 4QAQA 1ORIA 3GFBA 4M49A 4CUZA 3NEAA 4R40A 2JHAA 4HZGA 4C6SA 2IBSA 1O6FA 5AM4A 4AT1A 4Z3DA 2NVUA 3ICVA 4Q1DA 4MYRA 1A5TA 1X7ZA 1WP4A 4NFSA 1DAKA 2PGNA 1AQNA 3DB1A 3EODA 3GT0A 4WNYA 5L3SA 1BMTA 3P27A 5HCUA 3FTFA 1N3IA 5JLAA 3QE4A 2MSNA 3T4EA 3DTVB 2OB1A 4KGXA 3VAZA 1NVUQ 1O0BA 2G9VA 1UDCA 3UB2A 3OIUA 4YDRA 1N3YA 4Q3DA 2CCGA 2NVUB 5CA0A 4TYPA 5BVHA 1NYTA 1E18A 2AQHA 1X7ZB 4YAEA 3FNEA 4JYCA 3KQSA 2FPKA 4UU7A 5LMZA 3IP3A 4YGYA 2EQ5A 4YP0A 3GF4A 3IDFA 5L3SB 4JH0A 2EJUA 3ZCQA 1QKIA 3BM5A 3I4FA 3O21A 5K8JB 4II7A 3ID6C 3HL4A 2ZATA 2VF2A 1N0HA 1ZD8A 3GN1A 3O7MA 4RSRA 4WKOA 5DF1A 4DDHA 4BNGA 5AVSA 4M7PA 4EHBA 2ATIA 6AT1A 3K9HA 3M89A 4M7RA 4BQFA 2VL7A 2Y76A 4EB0A 2HLHA 5CA0B 5AR1A 5BVHB 4C7MA 4M89A 2Q3EA 5LB4A 5B53A 3RPEA 1ZKMA 3RVDA 2CK3D 4HDSA 2X14A 3H16A 3MHTA 3IHKA 3LVQE 4LNUA 1GNTA 5IW8A 2EP8A 3R3JA 2QD2A 1T8TA 3AILA 2DQ4A 3S2GA 5FXMA 1XKQA 4ZOLA 1R12A 5AOCA 5G1OA 1CF4A 4MW1A 4HGPA 3OHSX 5DMXA 4JBHA 2H9YA 4KWHA 1VCMA 4OMCA 3RIXA 2B83A 3GVPA 3MAJA 4KQKA 1FFSA 3PD1A 3STYA 4CEHA 3HWSA 4FYKA 3TLYA 2PX0A 4INPA 1SNYA 1NKSA 4OU5A 3AHDA 2QG4A 1T6ZA 4NG5A 1JG7A 3A2KA 4M0UA 3MFQA 4HDSB 4YJ3A 4LNUB 3DEAA 5EE0A 5FP0A 3UUWA 4JXZA 4MP3A 5C5CA 4R31A 4DR2B 3RAEC 4LJAA 1L7RA 2LNDA 3C8MA 3NTUA 2CSXA 5TMPA 4JSTA 3KXIA 4BRZA 4DAOA 5BR8B 3BMQB 4GSLA 5FOSA 3RRBA 4AUMA 5BRJA 4LQDA 4UTZA 3A05A 4CEHB 2QMEA 3NIWA 1S02A 4FGSA 3OAAA 2Z8YA 4PZUA 5FUQA 1ZH4A 1Z22A 2GEFA 1JDVA 4ILKA 1V6AA 2X4GA 3EWAA 1LTHR 4WFJA 5DI9A 5AQEA 5EYPA 2IODA 4KQ2A 4YJ3B 4Y6LA 3DFMA 3H1FA 1R4MA 1R9JA 4ZC1A 3X1YA 2IUYA 2UAGA 4W9MC 4M0DA 3HK2A 2IHTA 3V48A 1Q19A 3ONWA 5JIBA 3PUJA 1H4QA 5KWIA 5IAEA 2PUVA 3NGLA 1MC5A 1ZMTA 1HZZA 1HETA 1A8QA 1AKUA 3GLQA 1M1ZA 2GBLA 4FYVA 5AM2A 2R1TA 4KITB 2WB4A 3BQNB 4C0WA 1X8LA 4GT1A 3OD1A 4DSUA 2YKGA 2GLXA 5DYGA 1GPH1 1AS2A 1PUJA 1TYAE 5EYPB 3GLTA 1BG6A 1CUAA 3KLBA 3R3YA 2PO5A 1R4MB 2Q4RA 1P2DA 4H4EA 4CMJA 1L8XA 4IM7A 3W78A 4L0QA 2QYSA 3EVZA 1NNEA 3MF4A 3R6WA 1Y8RA 2X9NA 3MERA 5EI5A 4F4FA 1H05A 4IIGA 4URWR 3HCBA 4UTRA 1DINA 1KJ9A 1Z0AA 3RU7A 1ZOSA 1IM2A 1VHDA 3CNLA 2J5XA 4N6OA 2ZPAA 2R1TB 1R74A 2BFOA 3G2JA 1R9MA 3SYLA 1GZ6A 1M34A 1Y82A 1K3TA 2WWGA 2ZROA 4D41A 4IV5A 4YCCA 2GPSA 1AKNA 4RJ2A 4I1YA 3CTMA 3QTLA 2JH9A 5AKZA 4IF4A 2DT8A 1XMXA 2PL1A 4IQ4A 4B4VA 1JQBA 2JK0A 1Y8RB 1T8SA 3ADCA 3NANA 2VJPA 4REOA 3JASA 1XQ9A 4K8RB 1LFAA 4K9DA 3WGMA 4NCJA 2IEDA 2IH4A 1TEXA 3Q5DA 2GF9A 1F0YA 2ZUSA 1PJAA 2FWAA 4B3IA 3E58A 4KQ1A 4XDHA 1M34B 4YDSA 5ALFA 4JLAA 4H3SA 2CFOA 3H1TA 3R7NA 4ZI7F 1OSNA 3D7SA 3ASYA 2YY7A 1A8HA 4HRVA 3KEOA 1VIVA 2CVQA 2H4ZA 3U3KA 1SHJA 2HMTA 3HJUA 2EJBA 1Z34A 4FFWA 2C88A 3JASB 3CLSC 1H5UA 2BBTA 5K0SA 1ODTC 1U4NA 3RJMA 2Q62A 3QPDA 4YRGA 2CFIA 1ZN8A 2GPNA 3DHYA 4L4YA 4PZLA 3H9EO 1P75A 3V8PA 4Q34A 1GUZA 3C7DB 2DB3A 2WKPA 1ADYA 2EJCA 3JYNA 3L6UA 4P7GA 4YCDA 5DHSA 1NX9A 1RWKA 3MTQA 3STHA 2MU1A 1ESMA 1MAUA 5AQ1A 4QFBA 2GXAA 3AERA 4UHKA 3S8YA 4BP9A 1YR2A 4JI1B 3JD0A 2N9UA 3NAGA 4RGBA 3ZI0A 1EP2B 1JHYA 4JLUA 3O4FA 2OPBA 3HKDA 2F3QA 2QD5A 3HPQA 4YBRA 1NYRA 1NUUA 1XZHA 3GP5A 4W63A 5DBFA 3ODGA 2GX6A 3PG5A 3N8KA 1E5TA 5TRTA 5IH7A 3HR4A 4M22A 1VGQA 2Q2QA 2RDMA 2X2EA 3KTAA 4YJ2F 1LC0A 1Z8FA 3L0CA 3WGOA 2RHOA 4LOJA 3W6ZA 5KQSA 1MMFB 4IS3A 4IQ8A 4JV5B 2X0IA 3AERB 4M4SA 1YL5A 1QPZA 2COKA 3R8XA 2Q21A 1D6SA 2O2HA 3H4IA 4QPPA 1M6EX 1Y1LA 2Z8XA 3FOCA 4DC0A 3HKDB 5L3ZA 4ZIRA 2G9QA 3DLCA 3R7DA 3QKUA 2GERA 2ID4A 3ZHVA 2AWNA 2BI8A 2W48A 1G9TA 1XALA 4CTKA 1UPFA 1QCZA 5F4ZA 4MNTA 3TQTA 1QRTA 1E3JA 1XA0A 4X1YA 4V0OA 4OM8A 5E6UB 4K9OA 3WB9A 3WV4A 1NC3A 3KTAB 2L19A 2Y4OA 5D86A 2AW5A 3QX8A 3CEPB 3T9AA 1EDEA 4OATA 1COWA 1LPMA 3A31A 1NMZA 3JQCA 1G41A 3PUKA 3GVIA 3ISJA 1RHQA 1UMCA 3OCWA 5JPDA 4DY6A 3P9IA 2AK2A 3NHSA 2WWWA 2ZBFA 4M1SA 1UBRS 1Z56C 3ERCA 4ZIRB 2OK7A 1JHAA 3JQPA 2F1IA 4Q24A 1Q77A 5HW0A 1C3EA 3HP7A 3VFDA 1M2NA 5IFLA 5ERXA 1H2ZA 4X1YB 4PGAA 1BX3A 3A6JA 2SICE 3NETA 4WDQA 4EB6A 4EMBA 3AP1A 3L8FA 3P20A 4KUEA 4NEQA 4R2JA 4D26A 4J1SA 4B76A 2GXSA 3D1LA 1CDZA 1Z7YA 2D8MA 2H5JA 2E49A 1R0XA 2O3SA 1FJGB 2XEXA 1JKJA 1ISSA 1KETA 3EQZA 3INRA 1L4UA 4FFRA 3B2EA 4FK8A 5FUWA 2XNCA 2IYPA 2YUTA 4P2GA 4P5EA 4B71A 1U6JA 4UTPA 1V0JA 4UHCA 2OCLA 4R01A 4ACBA 4PEVA 4EB6B 3CLRC 2WNHA 3FWHA 4RDIA 3VC2A 2BMAA 2LTAA 2O52A 3SFZA 1QV6A 4O2RA 4UUAA 4NU6A 1G5FA 3HY6A 2QUJA 1J0CA 3H9CA 1JKJB 1MIOA 5JZ9A 3EQ7A 1D0IA 2ZJ7A 3D02A 3D4OA 3TSZA 3OJWA 2PO7A 4KR0A 4X90A 3HJCA 3ORYA 3CX3A 3KAQA 4Q1VA 3JWIA 4ZAWA 4YUVA 5IYZA 3W7BA 2RJNA 4A23A 1Z4OA 1E2HA 2X2OA 4L08A 1E6WA 4C1BA 3QFCA 4DWJA 1SO8A 4KSBA 3NHPA 4UE6A 4D92A 2QZPA 3LW7A 1ULHA 3GYBA 3G6WA 1V26A 5KDDA 2XZDA 3P0RA 3A2NA 2PRIA 1QIIA 5ALTA 2G4LA 5F7OA 5H8WA 1C2YA 4EKEA 3QPCA 1DG1G 4HB3A 1Q57A 1Y9DA 1MIOB 1QHGA 1KI8A 4TLLB 1UQTA 2BI7A 1GL9B 2BT4A 4N0EA 3RRZA 4W8OA 1D1TA 5K8VA 1LXCA 3FROA 3G49A 4G5RA 4H6PA 5FO1A 3A0RB 4GQAA 4URZR 2ATCA 3H4VA 3HP1A 4HYQA 4QBIA 5EMKA 2JLCA 2GNAA 2O2EA 2QN6A 1A9QA 3L4BC 3PS9A 1HE3A 2FUG1 3VQTA 2R97A 3FDFA 1PE0A 4MV3A 4XUGB 4YREA 2C7QA 5A6SB 1E98A 1VG8A 1OLOA 1U7PA 2DU8A 4N0DA 4X85A 5ER6A 4BO0A 1ETHA 3PE6A 5HZHA 2XRZA 1RE0A 3E5MA 4PPGA 1SB9A 2QTHA 3GOHA 5AVOA 3U4CA 4AS3A 4CLRA 3DAYA 2F3RA 1VECA 1I51A 2FMHA 3KJHA 4YK7A 4H1TA 4G8CA 3UJ3X 1GO2A 3T1HB 4JL6A 2QM7A 1U1GA 4KHPB 2QA5A 3GFQA 5HCNA 4OMDA 3BDVA 2VVTA 2DFVA 4HN4B 3C45A 3HB9A 2QU8A 3Q9SA 4BB0A 2DWQA 2J9FA 1XNHA 2VO1A 8MHTA 3NHBA 3UG7A 3BMNA 1IULA 1U8CB 2QGNA 4JR1A 4Z9AA 5HG0A 4FB5A 5K5EA 5ALKA 2CZQA 5JH7B 3E70C 3SC3A 3ZQ4A 2QWXA 4CLRB 4BVAA 3HEBA 4ZVKA 2HWUA 4HAOA 1ICEA 2WHYA 5JCOA 5AVYA 4TT3D 4UKDA 3HO6A 1E7MA 4S35A 5KNCD 1IUKA 1Z08A 2RHJA 4JASB 1OGIA 1AKVA 1R64A 3HVIA 3C8DA 4J8PA 4R5MA 4TVOA 2J9FB 2VPYA 3EZGA 3ZDDA 1QO0A 2YS6A 2QAIA 3MIIA 3TAHA 1IQUA 3BMNB 1IB6A 1JVSA 5TIIA 4OQNA 1UWLA 3UK2A 5BSHA 2I7VA 4FKZA 1GRNA 4P98A 4DJDC 1HDCA 4PBTA 3BE5A 4PAGA 3AETA 4JQSA 4MW6A 3GNSA 3P9NA 4DC9A 2JARA 4L51A 2IK8A 3L06A 4EGCB 5IKPA 4QO8A 1RRCA 3V8QA 2XMRA 1CRPA 3QTBA 1WMEA 2A9JA 3GCZA 5B3KA 1B0AA 2A7QA 3IDOA 4CTOA 5TJHA 1ESZA 3JWJA 1QQBA 3SF8A 2OHGA 3R9XA 1CUFA 3PVZA 2C31A 2FMIA 2BV3A 3KWLA 3T1QA 5JMOA 1AX9A 2PSDA 2WMYA 4LF9B 2AFHE 2FH5B 3ZIAD 3NI2A 1BFKA 4LQLA 3ZH2A 4EG5A 1CV2A 1RPTA 4M8NE 3PEFA 3AETB 3QLUC 1TTTA 1CY2A 2WJWA 3U7HB 3PWSA 3IPYA 4MUBA 1NJFA 3O3OB 4MINA 1LDGA 4IEIA 2K2QB 4X8HA 1IG0A 2CBGA 2HRCA 5BP7A 3E6AA 4GLOA 4DJEC 4YIHA 1M66A 1SCBA 3L6DA 3SF8B 1GDDA 4R71A 2BTEA 2AV6A 2JJ8A 4R1PA 3R9XB 4GLJA 2E0IA 4FZVA 3GFFA 1SHZA 1WNFA 4LZOA 5C7YA 5BRNA 3DG9A 3UATA 5H02A 2I7CA 2CLKB 3Q7PA 3I0NA 2BE7A 2AI2A 4ZT6A 1Z2DA 3ETJA 3SSAA 3OFND 1TD1A 1JDPA 2C2KA 4RVHA 5T7BA 4W5NA 2ICAA 3PQFA 2R86A 4HBGA 5HKLA 1BDHA 2ZI6A 1R10A 3KHTA 5L4LA 2N75A 4BYGA 1QVWA 2QTMA 5JMTA 1XN4A 4LZLA 1VZ3A 4Q01A 2OECA 5JZSA 2IITA 2O2CA 5B64A 4PSVA 5T3UA 5A5VA 1I24A 1NL3A 5IWAB 5A2GA 3LDGA 2PN1A 3ELUA 3G2IA 4L57A 3ZE7A 3KJFA 1K86A 3IS3A 3TKAA 1T2EA 3AF2A 1GPWB 3AV0B 3RW9A 1W4ZA 3T3EA 2GS9A 4CM6A 4F4JA 3Q9UA 1V2GA 1GL6A 3FKSD 4X00A 4ZVSA 5CXXA 1AGYA 3D4LA 4YRPA 1HOXA 4ZMRA 4PLVA 1JEOA 3FNQA 1CZNA 1EGQA 4R4JA 4M87A 5E3IA 1J0BA 3M3PA 1BYUA 3KB2A 2K5UA 5AVKA 5JYCA 5JV5A 5CP8A 3TIXB 2HSZA 3M33A 4TS4A 4UUNA 2NTNA 3LHKA 4YQZA 1KJZA 1O9BA 2VHWA 2WYIA 3VPDA 4D9BA 1PO7A 5B30A 3U1BA 1AKTA 4QJ5A 2HPZA 4G1VA 4IRUB 1PTKA 2WI8A 1HRKA 4KO3S 1T2AA 4OUKX 4ZVOA 1PZFA 1VA4A 1WAMA 4W6QA 5HIJA 4BX3A 1FLAA 1P91A 2OQIA 1QMPA 3R44A 1T4MA 3FR8A 3SFVA 4B2YA 3ON5A 2XY4A 1JIVA 1TUEA 3JZIA 1I1HA 4P83A 4XYGA 1BJKA 1O95C 4DSZA 2RFLA 5F52A 1R6UA 5ALYA 1M7GA 1EQAA 2QB5A 4KZPA 3BH0A 3EH1A 5E1DA 5JNUA 2JVKA 2XQJA 1LDYA 1NVBA 1Q11A 4JA0A 5G3ZA 4EPTA 1P1HA 4PXYA 4L75A 1G3IA 3FGZA 4E2FA 5HE8A 1AQ6A 2CXUA 3T9EA 3ZX5A 2HT1A 2Q4OA 1JMVA 1E1MA 3TN7A 1RCTE 3MGBA 2PIAA 2FQQA 4C4XA 3RVOA 5MF6A 1YC2A 4L16A 3V9PA 4WVLA 3LXRA 1EWRA 2CXHA 4TV8F 1T9KA 1N2SA 2MSWA 1K6JA 3RH0A 1VPEA 4JYPA 5CU7A 1PS0A 5BRAA 2ZXUA 1WVGA 4JR0A 4KMRA 4JVNA 3RSOA 1N1GA 1K06A 3Q6NA 3I1YA 4G2NA 4YH1A 3H5WA 5M34A 3BK7A 3EBLA 2LBPA 4FHDA 5EJGA 4BNXA 1TM7E 3TKYA 4EBBA 4OREX 4TL9A 2BFPA 4RD0A 3S81A 3NTOA 3WL5A 1JFSA 4NAHA 1V1RA 2XQKA 3AL2A 3T9CA 2JLAA 4W5RA 1V6SA 1CETA 1ZH2A 1ZJJA 3SR4A 3TCKA 3NUZA 3QXXA 4FD2A 3TQOA 2ACWA 3CZMA 3QV2A 1Y6ZA 5DCUA 4HUJA 4R1LA 3V6MA 2V58A 3OZRA 4GP6A 2GM4A 1BJRE 2JCXA 2Y0DA 4NX2A 3QIAA 2PG3A 5C1PA 1PZXA 3BJIC 3HYLA 3T3OA 3G0HA 2AG5A 3DOEA 4JUDX 5IJ0A 3ZWKA 1V1RB 1U7ZA 2VTEA 3G5AA 3U61B 1DQSA 3N53A 4OQLA 4F3NA 1VYHA 3KR9A 1F0PA 2QLLA 3MJHA 5G0WA 1TMGE 4CU5A 3E7WA 1CEXA 4OAOA 4IHQA 4XVHA 1JSLA 4URFA 5TC4A 1C4XA 4Q19A 1U1CA 5AVZA 3RS0A 4KB5A 2IE8A 4R7ZA 3V3TA 2G71A 3ITEA 1E2NA 2AOTB 3KKNA 5AXAA 4J7CA 1YFLA 1NW9B 3K5HA 3UNXA 2O0JA 4TWRA 4WJLA 1BXZA 1R66A 1Z0FA 5DYTA 2IFTA 5LMUB 4FMCB 4QEDA 2WUDA 1F4LA 1ZEMA 4XRGA 2PGJA 2F90A 5F78A 5IJ0B 3IEXA 3LUGA 2NZWA 2JG3A 3HJHA 1OWNA 1UPBA 2F3UA 3VHRA 3WRVA 4EVSA 4MROA 3OKCA 5DO9A 1RCFA 2YVAA 5FTMA 1DRKA 3RUDA 1HYGA 2QE7D 3L0OA 2PVSA 2PLRA 5TMEA 2JI4A 3FTEA 1MOSA 4B3CA 3JTMA 1LJ8A 4QGSA 1QFZA 5JEEA 4KKXB 1TZMA 3M7IA 2E4UA 5BMVA 4QBHA 1RJWA 4DRYA 5GM1A 5FBQB 4NCAA 2IYWA 3UICA 5EINA 4RELA 2C7VA 2I2FA 4G36A 5LQDA 4BE4A 2QEQA 2F62A 2GNOA 2VDKB 3E1SA 3E9RA 4QDZA 1OAOA 4U2EA 4DC1A 4DBLC 2X7HA 1YQGA 3HBLA 2QP3A 3O82A 2ZIWB 4JLWA 4RMHA 5IXSA 1M76A 3K6RA 3P9ZA 4YT8A 1SH7A 1URPA 4B2PA 2BSAA 3W9SA 3PHBE 1EEXB 1II0A 1EK6A 3PCTA 4AZ3A 1XCLA 2CXSA 4N7BA 4AYTA 2HCJB 1XEAA 2ADOA 5BMVB 3AR2A 5CIWA 4KDFA 3HUUA 4RETA 3MBIA 1VKJA 1XTVA 3CW8X 4DG5A 1XI2A 2NV2B 3I53A 4R8VA 4A7PA 2JEYA 4AU1A 3BCSA 1M2JA 4AY2A 3ANMA 1E2DA 1HKUA 3U4GA 1IHDA 3IBTA 3ZDZB 1TAQA 4JMPA 2WAXA 2VN8A 2JIOA 5KOJA 4DY4A 1DCMA 2O0MA 1T6YA 2VC2B 2V0NA 3BD6A 3FYTA 4WZBA 5IN5A 3T7KA 3TRJA 1C1DA 1CVLA 1UAGA 3RTBA 3OIYA 3H2GA 3B6KA 2FN7A 4CQMA 2X4DA 4E46A 3EVBA 4E7PA 4HWGA 4TMXA 1FMCA 4IVPA 3STUA 6ABPA 4BZQA 3EVAA 2QW1A 2KW5A 4DUGD 5SV2A 2C1XA 1SM4A 2QZ4A 2CXQA 1PGNA 2D4HA 2OXRA 3F6EX 3OSUA 3UCFA 3UOAB 1V47A 3I5XA 2UYHA 3DAPA 1ZK2A 4EI7A 1MZVA 1NQOA 3DYVA 3WMFA 4A5SA 4KR6A 1CRZA 2JGNA 2NNWB 4MJ3A 1FOEB 2ZJFA 3B51X 4FZJA 4AG6A 3AVQA 4LV6A 5KOJB 4NQRA 1RKVA 3AVOA 3LYUA 4KWCA 4WZBB 2YWDA 3T54A 1N5KA 1C1DB 3OU7A 3O83A 4CQMB 1XZQA 1F12A 1E2LA 1EFLA 4KGVA 4ZREA 3PTZA 3LIPA 3PFCA 5DBIA 4ZEWA 3WHPA 2AB0A 1L3BA 2UZAA 1P7CA 4WXHA 3RDPA 4BVBA 4E5NA 3I5UA 5LIPA 4LUCA 3F2IA 4MH0R 1BE1A 4PWYA 2RHGB 2BGLA 1QWSA 3L0ZA 4I4LA 3CSUA 1WBJB 3HDVA 1BW9B 1VMKA 5A62A 5AI6A 5IWCA 2C92A 3KLMX 4DQUA 1W2GA 4NYJR 1B4DA 1SC3A 3SKVA 4DQVA 1U63A 1SIBE 3C1AA 1MFZA 1E3EA 1K97A 3K96A 5L6MB 2HF9A 1E3IA 2IX3A 3KQLA 4NLLA 4U00A 2GVDC 1CRQA 2X8JA 4H4CA 3KXDA 4LNHA 4X1IA 2B0JA 2DH5A 4A1FA 4DCNA 1PFKA 6PFKA 3QLTA 5I45A 4LF8B 5KNDD 3MWDB 4GD3Q 2NU9A 3II6X 4U8GA 1T9BA 1Z88A 3Q7QA 4S1OA 1KEPA 4FYMA 2WMNB 5AK4A 4DV1B 3MT8A 3SQNA 1CSEE 1TAHA 1Q12A 4JR2A 4D43A 3FSEA 3ZCVA 2X0EA 4XDGA 3TIFA 2X8JB 4L4UA 5DWVA 1FMTA 2OUKA 2R8EA 3T7JA 1WMAA 3IVAA 3OOSA 4ARZA 4HXGA 3R4VA 1P1CA 2VJDA 3MPUA 4O29A 4OL0A 4X24A 4RPKA 4X1IB 3ZR4B 5JS6A 2C9ZA 1N7GA 2V3VA 1VLLA 1SU6A 4MCJA 2NU9B 1EFTA 4QZVA 2BJWA 2H06A 2X0JA 2FMTA 1PR9A 4DLZA 5JROA 4HJXA 5GJCA 2WD9A 5IBRA 2FWIA 1S2NA 2C58A 5HBGA 3H8VA 2B92A 2A14A 4K03A 2GK6A 4R1SA 4KR9A 3D1JA 5CA1B 4TKVB 4ARZB 1QYCA 3V32A 3EMKA 3KKPA 3RFXA 4F9TA 3FCCA 4K81B 1TGYA 2Q3MA 2O20A 2VH5R 4X54A 1A9TA 4Y2YA 4JDUA 4IAOA 1QQTA 2NSHA 3QVTA 4ZO4A 4LFBB 1X7HA 4C7XA 3KKOA 1G2OA 5J1SB 3QVVA 1R0KA 2C5EA 1T5IA 4G1FA 1RM0A 2JDIA 2NZ8A 3OA0A 4GVPA 4OB6A 4UUQA 3A4VA 1L1RA 4OK3A 2PT5A 4ICIA 2FR8A 1DVRA 2CL0X 1LPBB 2UZ3A 3ZKAA 3O91A 4FDUA 3BXEA 1C3LA 1DIAA 1UP6A 2R6FA 3NBKA 4LCBA 4CMBA 2VQFB 2O2ZA 4K6CA 2GTIA 1RD4A 3LPCA 4F21A 3HJTA 2ON6A 3ZGYA 4IXDA 3OC0A 1Z6GA 1CXZA 3BK2A 4Y2PA 4AMBA 3AK4A 2YIVX 3LU1A 2G25A 3TQSA 2J4DA 3G3EA 2P3LA 3I9FA 5C8XA 3BRSA 5COAA 4TX1A 4A0SA 2TS1A 1JZQA 2NO0A 2HJGA 3MA0A 3OMWA 4DR5B 5F9HA 3S27A 5E8RA 1J20A 4PYKA 2A2ZA 1SVWA 2ZAGA 1QIDA 2WILA 4N18A 5CW1A 3IIKA 2QMOA 1AK2A 3L8YA 4C0HA 5IM4F 3IHWA 5KSZA 1R8YA 4I50A 1KPGA 2XBMA 3BA1A 4BWVA 2V7EA 1IZ9A 3OTOB 2I9KA 4PYMA 3E81A 4Y2XA 1J21A 2BFFB 1QORA 2H7CA 1LK7A 3VR1A 3SX4A 1B7GO 2DLCX 3DPUA 1U9JA 3QNMA 1BQ4A 3FY4A 1E9SA 3JPYA 4PC7A 4YRTA 5F33A 4YP7A 3WNVA 1ISGA 4NNPA 4N3AA 2Q1XA 4XPZA 4FFPA 2Z43A 1XAGA 3OU6A 3H11A 4YP5A 4MJXA 3MMPA 4B3HA 3R75A 4CJXA 5H9WA 3F49S 3NX4A 2JBAA 1ZS9A 2CVPA 5D3MA 4I50B 3A6HA 5GOZA 4HL6A 2I80A 3LLCA 2NT3A 4A26A 1WR8A 2X8LA 4LRYA 4C4SA 2ZRHA 1XMIA 1MUUA 1QKKA 4Q9AA 4EKDA 5E4JA 3O4HA 2Q3CA 5EJ4A 3EPLA 2L17A 1I5EA 1V1JA 4GQIA 3ESDA 2Q8NA 5HOEA 1ONBA 2EGHA 4ENUA 2ONKA 3C3JA 3H5RA 3I9MA 4KIWA 3TW4A 5K0TA 2PZAA 1J1IA 3H11B 2J1LA 3UG6A 2GCIA 1JLHA 4PHFA 1Q95A 1KDOA 2OKCA 1JL3A 3KQHA 2FETA 3PDJA 4RAOA 2JBAB 2XSZD 1E2QA 1QRDA 5ER9A 3U3ZA 3PTAA 3FHJA 2QUKA 4FQ5A 4AJJA 3FNBA 3P4YA 4IXWA 1ONPA 1YQQA 3QVWA 3KZCA 3T5AA 2PA0A 1O6BA 1EQ2A 1PL6A 4OHMA 4WQMA 3AEQA 4TM8A 4IZ6A 3T1NA 2XKAA 4K9KA 3H18A 2DPGA 4IKOA 4JC0A 4EPWA 1N0UA 1N2CE 2RAFA 3U7EB 5IT9A 3B6JA 5TDHA 3A1WA 1KFKB 3GXBA 3EFBA 1SMKA 2CXXA 3R3VA 4I1RA 2PM8A 1X77A 1ZAYA 5COBA 2DPHA 3ZV6A 3FLAA 3LDFA 1F2DA 3PQ2A 4AQ7A 1JLMA 1C7ZA 2XDWA 1L7VC 4L15A 1XTSA 1BN6A 1JG4A 1DAPA 2B5OA 3HCPA 3LRXA 4TMVA 3X43A 1JSZA 1L5MA 4KX3A 4E3ZA 4MZXA 3ZQ6A 1JXAA 1PR0A 1WQ1R 2FRXA 3UBMA 3AEQB 2WKRA 1YAJA 2GQ0A 2EVWX 3KZMA 4TRNA 3E05A 1C7QA 2HHCA 2YNMD 1JFFB 4J16A 1WY5A 4CDMA 4WL0A 2C1ZA 1W48A 3GP3A 1Q1QA 4GYYA 4N39A 3QEBZ 1B2LA 1A50B 2OGSA 1B6SA 1NM5C 1PYGA 4Q7MB 3VYTB 2AD1A 3PTLA 3V6LA 2HDNB 3HFRA 3CX7A 2LGJA 2BZ1A 2IEZA 2ABWA 3T4XA 4O4JF 2PGXA 3BTVA 1NWHA 1OV6A 3MSCA 3KKLA 3WK7A 1ULSA 4OJQA 2WDZA 5TGZA 5KHAA 5JARA 4JOCA 1W44A 1XVIA 3WLAA 2BH9A 3GLFE 2CV1A 5AM5A 1OF1A 4LY0A 4OHFA 3DVRX 4RIIA 4S1WA 5IBCA 4WECA 4FR2A 1V9LA 3GH1A 1MD9A 1G8MA 4QLOA 3VI3B 2F4NA 4E21A 2B61A 3DLPX 2PPLA 3M82A 4BNHA 4YLYA 1G8KA 2GLTA 1VPDA 1E6EA 2GN1A 3JD1A 1OH8A 1GHTA 3V80A 4N1AA 3VC1A 4B73A 4TS3A 1EFAA 1GFSA 3ZGOA 1QK4A 4RHXA 3QUAA 5CTJA 4OD0A 4U9UA 3FZQA 4M46A 1WMSA 1IY2A 5FI0B 2E55A 4UUBA 4KTVE 2XZOA 5AIAA 1W25A 4GEGA 2VNKA 1ZD1A 2JAWA 2XYPA 4OMUA 1SKAA 1ZGHA 4ER6A 3VVLA 1SCJA 1UT6A 4XIYA 3ZV7A 1KO5A 1O9GA 2O8NA 3FTPA 3WWPA 3ZE8A 1FYEA 4EENA 3N28A 5JDIA 3UT0A 4MEJA 1XYGA 1G8HA 2HJSA 4RA6A 1EFRA 1JFRA 1IBRA 1P5FA 2J07A 3AHCA 3CH5A 1Z6QA 4ZYTA 3EY9A 1YT5A 1NJ1A 2YZNA 3WNCA 2BM8A 3CLUC 1E0KA 1Z16A 2I65A 4B40A 1NQUA 1RIFA 5SY9A 4WNCA 4JP1A 4MRRA 4AN1A 4CMAA 5ANRB 1T4GA 3PC3A 4DNXA 2VG8A 4G8JA 1WZ2A 5LLDA 2C2MA 2DTDA 3D0RA 4C78A 2YZMA 4MVJI 4RA6B 2DTXA 3N7TA 1QFSA 4FB4A 1RYDA 3D4BA 2VQSA 3ESXA 4DV5B 1QDLB 1R8XA 1U8AA 1D9ZA 1IHYA 2ONCA 3QU5A 3CA8A 3EEQA 4B4DA 1CJCA 3I9LA 1MDFA 1VDZA 4NZOA 4FE4A 5FTNA 2VAVA 2Z09A 3PWZA 1F6DA 2G5CA 2QQGA 1RRGA 3CB4A 4G4JA 1KZ4A 2DEUA 5J4KA 4J0GA 1I7LA 1IN5A 3UVEA 3AQ4A 1G18A 1GZVA 2QROA 3RAPR 3W34A 3P94A 2O3JA 4QREA 1J8FA 4AS1A 4BVLA 2C8LA 4B33A 3C3PA 4EHDA 3QG1A 1FBTA 4Q9NA 5G0UA 3SP1A 5FWYA 4HLQB 2H7XA 2UVQA 3GPBA 2VDMB 3Q8WA 3O9ZA 1G9SA 4ZAYA 3T99A 2MIIA 1W46A 1XNGA 1E79D 1WW3A 4N8EA 2WE7A 5KJEA 4CFYA 1SWVA 4HAXA 2MYNA 2OHIA 3NTRA 3PUYA 3TX2A 1N34B 4EB3A 3D64A 3O5AA 2C78A 4RF2A 1GG5A 3FNFA 3O8DA 1Z35A 4JOSA 1GCGA 5T4FA 3KQUA 4QPDA 4O2BF 4C29A 4UE2A 1SBCA 2HLNA 4BO8A 4OJYA 1C3XA 5JXIA 2HDOA 4QQKA 3LH5A 4DDMA 2HRQA 3VU9A 1WZUA 3SR3A 3BXHA 1EUQA 2XWBF 1BVHA 5FWYB 3B1XA 3MWEB 1KA9H 4QU0A 2R6ZA 1PZHA 1C0EA 4OP3A 3COSA 4TWJA 5LOVA 4RTPA 4YMLA 1UC5B 1R4ZA 1FIUA 4Z4QA 2XVYA 3F78A 1ZUHA 4H6XA 4QTXA 2QP9X 4AKGA 1EZZA 3KQNA 2JANA 3Q9LA 1XHLA 2QPOA 3TZHA 1E4YA 2DFDA 4RK4A 2A6PA 2H4XA 5CG1A 2CLFB 2RHDA 2XYVA 3WMEA 3NWEA 4RH0A 3V4FA 4AECA 5JI2E 4N49A 3WIBA 2B1JA 2OV4A 3HXKA 3Q0IA 3VU9B 4YAUA 4V3CA 4YO8A 1Y37A 2ZAMA 1IATA 5BSUA 3KV1A 3UB3A 2UUCB 4WFKA 4K28A 1MDBA 1NUQA 2P41A 3QE0A 3R20A 4K8OA 4QGAA 5LOVB 3TW6A 2O7VA 1TZJA 4RZHA 3NHMA 3RIGA 4OFBA 2IXGA 2COUA 3EVCA 4YJHA 3A36A 3HFJA 4GVXA 2P7HA 3A9SA 2VJLA 1HOTA 1T2UA 3EPKA 1O08A 4XGRA 1DC5A 1RP1A 3C4QA 2JBHA 5IVHA 2OAP1 5SZJA 3OIDA 1W47A 4DV0B 2XNJA 2J0VA 2XYHA 1BVRA 2D5BA 1GQYA 1HLDA 2OV6A 1RKUA 1F8UA 1NVGA 1NE2A 2RAVA 4UEOA 4F45A 5AVRA 1ZMXA 2QX9A 4KODA 3AVXA 4R0MA 2IHVA 4TQGA 1JG1A 4FHGA 2QSUA 1P3Y1 3ZZUA 4YRBA 4ID9A 4YJHB 3R3ZA 3UJHA 1XLUA 4XUDA 1S3IA 1F17A 1H6BA 3F7OA 3HYSA 4MVJD 2H0QA 2Q1TA 5TPZD 4PRYA 1O0SA 2ZS7A 4X91A 3AI3A 4NOLA 4LKOA 4JD5A 1ZKDA 3I58A 4MKXA 4CR8A 1XPOA 1MEOA 1QIHA 1KRWA 1WNTA 4AG5A 3PQ6A 2R96A 3ZGZA 1F4PA 2W37A 1H2WA 2XDYA 3UAVA 1RPAA 3SKYA 4J7AA 3REFA 4YJGA 4EY8A 4AO8A 4YR7A 2JVJA 4OJKA 5BT8A 1Z7GA 3HWX1 4KO8A 5BWBA 2JFZA 4OXRA 1TVKA 1B15A 5HQ3B 2FFBA 1JALA 1D1QA 3G2PA 4KIJA 4YI3A 1G9XA 3I2FA 2Z1MA 3QNWA 5LA6F 4JB0A 2JCVA 2QRUA 2Z0MA 3BF7A 2Q6VA 1BVUA 2EIHA 3GEHA 5LCXA 3I61A 2AMLA 4L6AA 1PWEA 3D3JA 4TYQA 521PA 4E1VA 4BQOA 1M6YA 1TC2A 4G1UC 5D84A 1II9A 1TLLA 2HKIA 3FNGA 3LC2O 5AXBA 3T7RA 2PUCA 1D3AA 3WHKA 2WSLA 4YJGB 2FLVA 1PS8A 3L02A 5EMMA 3WS7A 1L5YA 2VP3A 1AH2A 1IBSA 1TUIA 1P1JA 1TVKB 1W85A 2EZTA 4M1YA 4RY8A 2GDJA 1KBQA 4D8WA 1RFGE 2Q41A 2YN0A 3EYWA 4FN4A 2WG1A 1JI3A 2HXGA 4PGGA 5ICMA 2PUBA 1PV1A 3A4MA 3WNBA 2OCBA 1Z45A 1DZIA 1JFVA 1HTWA 1U1IA 2AZMA 3A4NA 3OIWA 1NUTA 2YXNA 4G26A 2ZB7A 4G63A 1RRVA 5K1ZA 3L93A 3ZV5A 2A3NA 4AMZA 1QNFA 4L0CA 5DTQA 4EI9A 3HG7A 4WLNA 3KAKA 1AKYA 1DMRA 2I5PO 3ZW9A 2QBYA 4YXWD 3DTYA 4RXTA 4UW9A 1B8UA 5CXSA 2WJ4A 3H2KA 3P2YA 3V4SA 2X5NA 1AA6A 1E1QD 1W85B 2J0SA 2D5AA 1K1EA 2GESA 2P6OA 1XQYA 2RGBA 3RU9A 3DOFA 1XZIA 5ALIA 3VYRB 2IOQA 4UC0A 5F23A 2GN8A 1RI1A 4Y1RA 1DQPA 4P7BA 4N5LA 2W6JA 3GFPA 5DNWA