2OV3A

Crystal structure of 138-173 znua deletion mutant plus zinc bound
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
260
structure length
260
Chain Sequence
b'DAMDITVSIPPQQYFLEKIGGDLVRVSVLVPGNNDPHTYEPKPQQLAALSEAEAYVLIGLGFEQPWLEKLKAANANMKLIDSAQGITPLEMPGRLMVADPHIWLSPTLVKRQATTIAKELAELDPDNRDQYEANLAAFLAELERLNQELGQILQPLPQRKFIVFHPSWAYFARDYNLVQIPIEVEGQEPSAQELKQLIDTAKENNLTMVFGETQFSTKSSEAIAAEIGAGVELLDPLAADWSSNLKAVAQKIANANSAQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic binding protein component of an ABC type zinc up
molecule tags Transport protein
source organism Synechocystis sp.
publication title Possible Regulatory Role for the Histidine-Rich Loop in the Zinc Transport Protein, ZnuA
pubmed doi rcsb
total genus 87
structure length 260
sequence length 260
ec nomenclature
pdb deposition date 2007-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2ov3A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2ov3A02
4UDNA 3G9QA 1FP4B 1M34A 2R7AA 2PRSA 4H0FA 1EFDN 4INPA 4LS3A 1G20A 1MIOA 3ZK9A 4N01A 1N2CA 3AEKA 1QH1B 3PSAA 3MWFA 5CR9A 2XV1A 4FILA 5KOHB 1KAHA 4WESA 1N4AA 4IRMA 2Q8QA 4FKMA 3R5SA 4XPIB 3U7QB 3AEUA 2X4LA 5CX1B 4PAGA 3TEFA 1K75A 3ZK8A 1KARA 1H1LA 3R5TA 3U7QA 1K7SN 5M29A 5M34A 4WZAA 3MINA 1K2VN 2Q8PA 3BE6A 4LJSA 4PM4A 4TKUB 5HX7A 3AESB 2R79A 2XH8A 2WHYA 4XPIA 2AFIA 1PSZA 3AERA 2QI9F 2MINB 1G21A 4WZBA 5KOHA 3AEQA 1M34B 4K3VA 3AETA 1N2CB 2PS3A 3K1AB 2M6LA 5M2QA 4UTOA 4WN9B 3TLKA 1M1NB 1N2ZA 3PDIB 4MX8A 1L5HA 5BVGB 1QGUA 3MINB 4HMOA 5BVHA 1QH8B 4WNAA 1K0FA 4MDYA 4GICA 4TKVB 2XDQA 2XUZA 4UTPA 3LI2A 4OXQA 4NNPA 3UJPA 5BVHB 2OGWA 2AFHA 4OXRA 3AEUB 1QH8A 4WNAB 3ZK7A 3AEKB 1L5HB 1XVLA 4NNOA 1M1NA 4CL2A 5KOJA 2RG7A 3AEQB 1QH1A 2PHZA 4M7OA 1M1YA 3K1AA 5AFSA 5KOJB 4G07A 5M3BA 2WI8A 3LHSA 4BBPA 3BE5A 1G21B 2MINA 2PS9A 3AERB 2PS0A 4FNAA 2AFHB 4WZAB 5FLYA 1H1LB 2OV3A 2YNMD 3AESA 4ND8A 2XDQB 5HDQA 3GI1A 2M6KA 4MLZA 3PDIA 2ETVA 3MD9A 2OSVA 3EIXA 3MWGA 5B58T 4HMQA 3AETB 4WN9A 3HXPA 5GGYA 5JG7A 1FP4A 5KHLB 4WZBB 2OV1A 1M1YB 1G20B 1MIOB 2XQVA 4B8YA 3ZTTA 3MFQA 1KAEA 1TOAA 5GGXA 4DBLE 4OVKA 4MO9A 4TKUA 3NU1A 3HJTA 2AFIB 3EIWA 2O1EA 5I4KA 4HN9A 3HH8A 3CX3A 4INOA 1ESZA 4ND8B 5CX1A 2XY4A 1PQ4A 3PSHA 3TNYA 4G09A 4H59A 5JPDA 5JJ5A 1QGUB 4UDOA 2YNMC 5JOQA 4WESB 4TKVA 4FI3F 3ZKAA 5BVGA 4HMPA 1N4DA
chains in the Genus database with same CATH superfamily
3ZG6A 3NYIA 2HEGA 3PHLA 1KQ3A 1K66A 2OOSA 3TKYA 4R8RA 1MIOA 1AGXA 1UBUS 1BC5A 1NT2A 5AK5A 2FVYA 4NABA 2QD2A 4QPDA 3A4TA 3Q9UA 1H9BA 3FIJA 2Y1CA 2I6GA 4GNKA 4HNHA 4B40A 1GRCA 4FFLA 3CEAA 2XMPA 2AC2A 9GPBA 5FBVB 2I4TA 1JQ5A 5ALHA 1PZHA 1SXJA 1BKSB 3T9CA 2O2CA 3T3EA 2FGJA 5DBOA 3LE8A 1U31A 4QOFA 1WB9A 1RTTA 1PJSA 2NZUG 1D5CA 4QRHA 1X2BA 3AF6A 1SBIA 2Q07A 1NIJA 3HXMA 1ZJ5A 4O4LB 3HL0A 2ANCA 4TN5A 7MHTA 2Q4DA 3QF4A 3AL3A 1FRQA 1OCEA 4HGZA 2HWKA 4RV4A 1U3WA 1V5WA 4UEOA 2R87A 1S2MA 2WF8A 3AUTA 3RVRA 4GM4A 4V0RA 3ZVRA 8MHTA 1I0ZA 2ZRBA 1R10A 4UMEA 5B1DA 5J5CA 4CE6A 4PRLA 1SOWA 4G5FA 4LY6A 1BX0A 3BXZA 1R5OA 2ECQA 1QZ3A 2AQIA 2R8RA 1RRPA 2ZVJA 3NT5A 4KXYA 2H2GA 4KPFC 2A59A 3ZCUA 4OL0A 3SXUA 3AH8A 3AUFA 3LBHA 1Y42X 3FYCA 1FS4A 3VTKA 5C1OA 3GN1A 1SBQA 3OOSA 1NF2A 4OB6A 1Z7GA 1II8A 2HSEA 4WH0A 1VYHA 2HLPA 5G0SA 3B3GA 1I7LA 3IOMA 1A5SB 2AMFA 1M2GA 3LH5A 4HAIA 4HPXB 2E3JA 3QU5A 5EHZA 1M5RA 4AUMA 1UK7A 2CFSA 5E9WA 4RVGA 1Y4DE 4PSCA 4KQ2A 5EMLA 4DG5A 1RZVA 3FDFA 1E2KA 4MRPA 1W6UA 3ER6A 2CVPA 3VKHA 3E3MA 1R5JA 2IZ5A 3W5BA 1UEJA 2V7QD 1F6DA 3T3OA 1NJ2A 1ZGGA 3AFOA 2B8JA 3L2OB 1HKHA 5TVGA 1BMQA 1O89A 1NMQA 3ROEA 2NPFA 3MYYA 4Z4EA 1J1UA 3BWMA 1TPZA 1GAWA 3T0FA 1XP5A 1B14A 4BFYA 5JZMA 4P92A 3KKQA 4P4NA 4XRRA 3TZKA 2PZKA 3N2EA 5EG5A 4CKCB 5BW8A 1WXQA 4HATA 3HM9A 3E1SA 2YJTD 2Z9CA 1BVRA 4KE6A 5L40A 4WLFA 3TIVA 4BB5A 2P9JA 4BV2A 4EWLA 3CO0S 5H4HA 1XVUA 3FMIA 2D7JA 3KHSA 5IEJA 4NCKA 3EDQA 1L4FA 1JR4A 2IS2A 2PKXA 1M1XB 2GYVA 1WD7A 2ZBEA 4RZUA 3EAFA 4TV8F 2O7RA 1P0QA 1EIZA 5CURA 3TAXA 4B5LA 5DE3A 4LC1A 3E3NA 2BV3A 4CLHA 2PRZA 1RZ3A 2V9CA 4E15A 1MO6A 3TLYA 4CCYA 3W2IA 4IJUA 4ZKEA 3RFFA 3C3CA 3VQTA 2IEGA 2A30A 1BTOA 4WCDA 2XW6A 3LDHA 1ISHA 4LC0A 3S2ZA 1RYEA 5TEVA 2NP6A 2PSDA 5BN4B 5LZ9A 3PGXA 3NHRA 4BNIA 2COEA 3R3SA 3SJBA 1DC5A 1MJFA 1QGUB 3BWEA 1CUVA 4HWSA 4UVIA 5SYMA 5K0EA 2RGBA 2PL3A 2AW3A 2XPCA 2Y4OA 1OXTA 3FZQA 4QLBA 2NYRA 3DCNA 1USVA 2WY2D 5LMCA 3NNSA 1IXYA 1QB8A 3ELUA 2NSYA 2ZWOA 5GOZA 2AKEA 4RA6B 3TDNA 3VRHA 2PFSA 2ODTX 4D92A 2BBWA 5BNIA 5D3ZA 2RGRA 3QNUA 4LOKA 1OOEA 3PC8C 3AIOA 3SEZA 4KSBA 1V3TA 2GKOA 5FWXA 4IBOA 2ZIXA 4G5XA 1ZU4A 2ZAYA 2GJ8A 5G2OA 3WJ2A 3BD7A 3OCVA 4HBGA 3VHXB 2QMYA 4DQKA 5AM5A 4HQOA 1DG9A 3TIGA 1G3QA 3MCZA 2OLJA 3HKEB 2YXBA 5J5AA 5TF4A 4IMJB 3KYDA 2YZKA 1YC5A 3COZA 4EKEA 5DHUA 4Y2JA 2SKDA 3NEAA 4LXXA 1DAIA 3LGAA 1RYDA 3T7KA 2XOKA 2MU1A 2R62A 4MGHA 1GKIA 2CZCA 3VOBA 3W8RA 2PXAA 1Y8AA 3ZW9A 3VU8A 3N0XA 4RF5A 4WX2B 4K3VA 4D0GA 1Q7CA 1NDUA 3IRUA 4N18A 1G8YA 1Y9ZA 3TRJA 4WBNA 1LFDB 4P4LA 2ZB3A 3K0CA 3MWEB 3JQDA 4I8IA 1N75A 4IO1A 4A5OA 3EVFA 4LRUA 1XAJA 3E53A 4PO1A 2FP3A 2Q3FA 4OI4A 4PGMA 3FVTA 1RW4A 5IANA 2B83A 4EI8A 3GYGA 4TXHA 4X66B 1KZ9A 1X1QA 1Y3IA 3KAQA 1CLUA 1W8DA 2F64A 4BNXA 4J91A 2IYQA 1A72A 1MC8A 2I6FA 2PZEA 1X87A 1RM3A 2OHIA 3FSGA 3LT0A 5JUWA 1NUSA 1ZD4A 4RE5A 3OT1B 4G24A 3NQ41 1O6GA 4A0SA 4B76A 1E1YA 1O7JA 4OQMA 1P3DA 3WJ7A 1YS4A 2N42A 4R4JA 3U7JA 3HFRA 4MVJP 4F4UA 3DBHB 3JXEA 4GBED 3R3JA 4OLFA 4Z7QB 1XA3A 1TE2A 3BEDA 3RJTA 4ZVUA 1P6XA 4KTVE 3TLMA 1OZ0A 1U0OC 2NVUB 4F2DA 4M9RA 3NNNA 1KO8A 4XX0A 1JPJA 5EZYA 4B17A 2IS6A 1XGKA 1ZK2A 1UP4A 4NY1A 1O5OA 5IDWA 2EEPA 1IONA 3WYNA 3IAM1 3VR5A 2XYVA 2QUKA 1LZLA 2QNBA 3EG9A 5ESXA 2WIJA 3G88A 3N0TA 2YKGA 4DNXA 1A8SA 4KQ1A 1Z8HA 4KXFB 5FO1A 5KYXB 3MJEA 4GSKA 1CKEA 1DOAA 1SUDA 1Q1QA 2X7HA 1BROA 3JU3A 3OUTA 4OLAA 4PCUA 3VC3A 1QHHA 3IJ5A 5ALWA 5K01A 4GKKB 4FS3A 4EF5A 4S3MA 2QS9A 3BSSA 4FSHA 5AJXA 3TLGB 4DA7A 5A2GA 1NJSA 4A0QA 1NQXA 3MUFA 1QO0D 3PB3A 2WU4A 3NBKA 3BMXA 4QG7A 5H70A 3GLRA 1DEHA 4D6YA 4UM9B 2KI5A 5A7FA 5KINB 3K9LA 5KVCA 5T7BA 3LF2A 1P7YA 1R0ZA 2ACKA 2PSJA 2Q9BA 3FX2A 5JSKA 4YAKA 3WGGA 3KG2A 1RHJA 5TV2A 3IMCA 4CEJA 1EDBA 1UPTA 5IJAA 1U5CA 2C5FA 4AKEA 3N6RA 3GP5A 2ST1A 2W2KB 3ASYA 4TTAA 2EFGA 2HRDA 1UBFA 2H4HA 1W2GA 2WOJA 4WUTA 3IOCA 1ZM4A 4LZNA 1UFKA 1T0UA 4MKHA 1F1JA 2J08A 4IKEA 4OXXA 1GZVA 2BM0A 2HXGA 1X92A 4KVGA 2ZKLA 1B8OA 1CRWG 4INPA 5D84A 1N2CA 5HQ3B 1L7BA 2HR1A 2BEJA 1OFIA 4DPLA 4OHOA 4NDZA 3JD3A 4U39A 1D4OA 3UXYA 4CR6A 2DAPA 3IIIA 4KDEA 4YI3A 3RFXA 2UZ1A 4UBMA 4DCVA 5D51S 4DLAA 4R1PA 1XKQA 3AB3A 3LUBA 4OI2A 5IJXA 4DXDA 5CA0A 5JR3A 1LVGA 1PGQA 4UD2A 3WHLA 4B3MB 2DT5A 2ZEJA 2OXCA 3JD4A 4YDHB 3BXHA 3WDLA 4C76A 4RJLA 4EI7A 2XUFA 5B5SA 1ULUA 5JIBA 1OROA 1P18A 2I7XA 3GDOA 3MXTA 2R79A 3VH3A 5AVSA 4XPIA 1G16A 2W2LA 3CURA 4RKFA 2P4HX 2QW0X 3T5CA 5BWLA 4X1IA 3SNHA 1ES9A 3PPVA 2IBMA 2GJKA 4QGAA 4QRIA 4HFJA 3PJRA 2JFGA 4NOLA 1RJ9B 3DONA 5HIIA 3SYRA 1OD6A 2XD4A 1VRWA 5B36A 3FLAA 5ALZA 5EC8A 1KOJA 2WR8A 2M1ZA 3UHPA 2OGSA 2FFRA 1PL0A 1QANA 1FBNA 1TVMA 1TI7A 1ZGAA 4HYTA 3N5KA 3V1UA 4LK2A 2D7DA 1VE7A 4LOIA 2JANA 1T8SA 1KJYA 1UBHS 3H4IA 4CMEA 1AHNA 4M9ZA 5IKXA 2G25A 4MEBA 4TMKA 4ZQIA 1U3GA 2DJ5A 4N76A 2OT3B 3COYA 3SX2A 3VHQA 1I32A 2AG1A 1MA0A 3BRSA 4MTCA 2ZUFA 1PFYA 1D3AA 1VLQA 3I04A 3KPWA 1Y6FA 1W73A 3RVBA 2QU7A 2X5NA 2DCUA 4FLEA 3LHKA 1RDFA 2E6KA 3A26A 4PZ0A 5TQ0B 3SHQA 4LTDA 3UG6A 3AKYA 1WWKA 2DPMA 2QN1A 3HWRA 1P4GA 4O5AA 4ZOEA 5DF1A 3NATA 4ZIRB 5AI8A 3MHTA 2LVBA 3N05A 1IN8A 4FNOA 4BQRA 4L73A 3ABZA 5SY4A 5KTNA 3UMFA 3GDHA 4FDMA 5A1JA 4HG2A 2ZYRA 3UG7A 4G8CA 3PXUA 4U7DA 4JI1B 4LF8B 3CUKA 1OBCA 3ZGVA 3AHFA 1PYDA 3QBTA 2QMOA 4F2WA 2IW3A 5EUMA 6PFKA 1X94A 1R6XA 1F5NA 1VKJA 3A4IA 4XDGA 2FX2A 4RVCA 3V4LA 2DUJA 4KQ6A 4C3UA 3M3HA 2XJ4A 1BD3A 3QKTA 1EAMA 2FSSA 4KX5A 4EK9A 1I4WA 3GW8A 1FXSA 1P0PA 3AL2A 4L28A 4L4YA 3QPVA 2RBGA 2PGXA 4TQ9A 5A71A 2ZJFA 3PXGA 3LHIA 3VC2A 2EC5A 4AJLA 3DOFA 4NI5A 8GPBA 3TSOA 5DCWA 3JYLA 1SHZA 3L1KA 1M0TA 3HKDA 3OLWA 2HZBA 1C1DA 3HM2A 1VLJA 3MC1A 3PJEA 1X1BA 3LUAA 2PVSA 4KAAA 1SCQA 3VR5H 4E3WA 2I2FA 1KAEA 4LZPA 1E3IA 3QXHA 1TCAA 1ECLA 4M0EA 1P39A 3PUVA 3LK7A 4MP6A 1GTVA 4GZ3A 3HCFA 3OA2A 1GG5A 1KI3A 2JBHA 1P4AA 1JG3A 3KO8A 4JHXA 4EBBA 3RVOA 2HCJB 3PNMA 5JYBA 4BXOA 1NRJB 3FETA 1DBIA 3DYIA 5TQVA 5JJ5A 5FADA 1UBCA 2DJIA 4UVEA 2EARA 5FBKA 3K4PA 2FKNA 3ADBA 3DMNA 5JH7A 3PDHA 5JS7A 4PLYA 5J2TA 3USCS 4MWZA 1QTQA 3TOCA 3VYTB 2GZ1A 4HMPA 3QTTA 4MB0A 3ZGYA 4CGYA 2WWIA 2A0KA 1DTEA 2GBCA 2XX3A 4I1OA 4K3UA 4WXMA 3UKJA 4A8JA 4E07A 3IAHA 2WEKA 1SCAA 1FPMA 3VYSB 3CLSC 3FZYA 3OQVA 5KTPA 3T4PA 4QRDA 3RJMA 2OC9A 1XD9A 4NVRA 4DWWA 1GPNA 2BJVA 4JWKA 2YUTA 4F12A 1DMSA 4RTOA 1V1RA 3C7KA 1P0IA 5ES4B 3TZ6A 4R9NA 4G86A 5FD8A 1K7XB 4DQ0A 4RGVA 1JZSA 1X7ZB 2JGEA 5DIZA 4H27A 3ZHOA 3TSYA 5FTLA 2QMHA 4P84A 2G28A 1OKKA 3L8ZA 3D8SA 3MINA 3I5YA 4Z4QA 4DLTA 2JI8A 3GRRA 4AYWA 3RS5A 3VDMA 5IUJC 3VSEA 2LKCA 5IWCA 2AOVA 1LPBB 2ID4A 2XMCA 3G0BA 3IBTA 5EYPA 2YWGA 1OU4A 5JDIA 1KI7A 5A5FA 4RIEA 3T3IA 4FMBB 1ZUNA 4N3AA 5TR9A 3Q8KA 1N2CB 3I6ZA 4B71A 1JAZA 2A9KA 3G0GA 4FD2A 3DZ8A 4JEIA 4MQ6A 1YL7A 4Y3UA 4N47A 1X74A 4R31A 1DWPA 1V6CA 3M6WA 1BGWA 1WF6A 5DTRA 1NA5A 1ZN7A 4IXWA 3TD2A 1G8AA 3T7IA 4M1YA 1F8XA 2DC1A 3PFFA 5ADUS 4HB3A 4MTLA 5HPYB 2A7XA 3R3ZA 4CYMA 3IPCA 2ZBDA 3H7IA 3NETA 3SVLA 1NV8A 1QRDA 2P67A 1ODFA 3CLTC 5BV2P 4PLCA 5GOTA 2XCOA 1CQWA 1KJZA 5BWOA 3GT4A 4FFSA 3O3MB 4XX0B 3ZCSA 1R6DA 1TB4A 2PUVA 1LI5A 3WB0A 4QJ5A 5JNWA 1BRTA 2NO7A 2E9SA 4DA9A 2VEOA 4PRZA 5EE0A 2MR5A 3L7LA 1TAQA 3GP8A 2V8BA 3GEMA 3OFSA 1PJTA 3ZV3A 4BNZA 3MQFA 5E1DA 5KCZA 3H5IA 2RJ3A 3FJOA 3SM3A 1ST3A 4I4TB 3ANXA 2KPOA 2BHSA 2GILA 2H65A 3X3HA 1DUVG 1NMXA 2K7ZA 3IA7A 3IILA 5CDYA 2ZP1A 4FYMA 1PT6A 2JVKA 3SZMA 2C2GA 3UQYS 4J43A 1OWLA 1FRNA 2WG2A 4C05A 3PVZA 5CP8A 1K98A 1NBMA 1CJBA 3M9LA 1DKQA 2PEYA 2UVDA 2VTVA 3R5FA 5DHQA 2CV2A 3BWCA 4MV7A 3ZTYA 2J87A 4MQBA 1OF1A 2BTEA 2O54A 1JHMA 3GF4A 3N2GA 3EMKA 2JIDA 1NQWA 3PE3A 1SA0B 3QY9A 3DL4A 4B46A 2FR8C 3TINA 4DSTA 3ENVA 4PX2A 3BULA 3DT6A 4FB4A 4D3FA 1DPFA 1XXHB 3RD5A 1WUJS 3D8BA 1Q0UA 5CT5A 5F4ZA 1K3TA 3WRYA 5BR4A 1IJFA 3VA7A 4FSDA 5G53C 4JI2B 1NDQA 2BEWB 3JAKA 3T41A 1RYHA 4DGSA 1CPYA 2CHVA 1XTVA 2GCGA 4PX3A 3ONVA 3TJMA 3UJ8A 1O94A 2JJQA 2O8EA 2NM0A 2A1TS 3BTOA 1NC1A 2ZUCA 5D3MB 4XYGA 2JIOA 4RD2A 4Y2XA 5T67A 2PGDA 4HI0E 1NLFA 2D1FA 1ACLA 4Y1GA 1GXSB 1T8TA 4F96A 4AKGA 2J9XB 4ZU6X 4DCGA 4F8JA 4D26A 2H7VA 4TN1A 1E9RA 1XHFA 3Q0IA 5BXYA 3G2KA 3WLQA 1QYXA 4LS3A 1DG3A 3PUYA 3WNZA 4G1VA 4ODIA 1KKLA 1ZO8A 3HCAA 4BPBA 1GNTA 2NADA 1LJ8A 2J45A 5DI3A 4UUPA 1N8SA 1X15A 2IIBA 5EFOA 1OHHD 1HUQA 3L06A 1QQ6A 4BFUA 2D06A 4HTAA 1A9ZA 2YWJA 3E3OA 4RETA 4XPIB 4ZYTA 5KWIA 1L7QA 3OC0A 4AO8A 2OWEA 1F14A 5AVKA 1CRLA 5J4KA 2YICA 2VWPA 4PNEA 4RY9A 4B4WA 1LC0A 1GFZA 1MU0A 1KTVA 2BGRA 3WGVA 1WXEA 1JVNA 3FPFA 4G8JA 4AZ0B 5HX7A 4LWZA 1EAYA 2C99A 5LUBA 3UPUA 1DDIA 2RC5A 4AN1A 2D4HA 2X13A 2KE5A 3E9ZA 1T5SA 5ALKA 3W5HA 1SPBS 1TVEA 3NWBA 4GZLA 2AR0A 4PHTA 1C2YA 4TTTS 4DBZA 1NXWA 4PC7A 1FEZA 4B6JA 1XELA 5FTJA 4EA7A 1XTTA 2HA3A 2BFPA 4HL6A 4R2MA 2QBYA 2E4XA 3ZS8A 3EBLA 3TLJA 5A9SA 4Y2TA 3ELYA 4F6LA 3A1VA 4LYAA 3V7WA 4EA9A 5JC1A 2PE5A 5FNVB 2XQKA 2B5WA 3EC1A 2CLCX 1KDZA 2OGTA 3TL6A 3LX4A 2ZYIA 1CSEE 2RHWA 1E7MA 4FE4A 3THYB 3E35A 2Q3EA 4G0UA 3WQRA 3EIQA 4OX9Y 3QG1A 5JECA 3U1BA 1NG9A 4IFBA 2E49A 4LJKA 3QLVC 4RD6A 4W5QA 1YACA 1V3VA 5AOAA 1YT5A 1R64A 5FLKA 1QG6A 3UT6A 1AUXA 2QY6A 2BR4A 3HJRA 3T4XA 1HRKA 2GLTA 5ALSA 3UY4A 3GD7A 3C74A 1TIPA 4Q16A 2YXNA 1C9EA 4JXXA 3TQTA 5E6SB 1E92A 3GJ5A 2BBSA 4MZXA 4KITB 3RYCA 2CE7A 3RBXA 3PFNA 4Z2AA 4HB4A 5EMMA 1V96A 4FDLA 4XAQA 3SEQA 4R1UA 4S1PA 1SBZA 4BVHA 3H2HA 4OCZA 2YHAA 1DEOA 4TS9A 3I09A 2CMHA 4PAOA 1UKVY 3JQRA 3AG6A 2R6ZA 1KA9H 3QPWA 3AZPA 3OESA 4O1IA 4P98A 5ALNA 2FPMA 4W9NA 4PF1A 1KEEA 1W4RA 3A31A 3NXSA 1CBUA 3WADA 3ASZA 1NUAA 1QZTA 1D4AA 2FMIA 1GAQA 3PCTA 4ZAZA 1VFNA 3QWBA 4FZRA 2BEWA 4AO7A 4XEUA 4C0HA 4MUAA 3TFQA 4TYWA 1NXVA 1JEAA 1WMBA 1OYWA 2GJAA 3E58A 4IDBA 4US0R 1WZ2A 1PN3A 2BY4A 5KSYA 1EZZA 4ZHQF 2ATCA 1NP7A 4TS1A 2B1GA 4HS9A 3TCKA 4ZYXA 2CWWA 1X80A 4MCHA 4CIXA 4XR9A 3DXFA 3TBHA 5ICGA 1PCXA 1W0KD 1TIKA 4IIGA 4E5PA 5C7IO 3WLMA 2QM0A 4YNBA 3NWJA 4CTOA 5TQ2A 2ERXA 1YHZA 4NHOA 5D86A 3OTHA 3TGLA 4R1TA 1N9GA 4ZGGA 1EWYA 3JD0A 3ZIDA 4FFOA 1L7MA 1A4IA 2W6MA 1S89A 1ONNA 2QVYX 3AYZB 1OLXA 5DBFA 3C3PA 4HRAA 4ZT3A 1KJNA 3KWJA 1ZZGA 4U8HA 2Z3ZA 5AKKA 4ZANA 3OKAA 3FDXA 3NHYA 4UBIA 4DLLA 3A4LA 3SEAA 3BG5A 3WOVA 3BIJA 3PZRA 4RJ2A 2VPTA 2QYHA 3K73O 2H2DA 2IY8A 3W8FA 4TKZA 1KAOA 2X9LA 3A7EA 4NJMB 4KGXA 3RH0A 1PT5A 2JK0A 4LV6A 2IYNA 1FC0A 5LQSA 3BB4A 3S5UA 4A2CA 3FPLA 1KSGA 4M86A 5CJPA 1MB0A 3RC1A 2ZTMA 1B8NA 1G4UR 2C31A 3RYFB 3QOYA 3UJBA 3W9SA 2BZSA 2QLTA 4XWGA 1V4BA 4TKUB 3RTCA 4JVSB 2P3QA 1PE0A 2AFIA 2WG1A 1OJ7A 1Y81A 2BGMA 3ODPA 1APBA 1C3EA 3T6KA 2WF7A 4J4BA 3WSVA 3ZZ0A 1NOIA 1T43A 1HMYA 2WP8J 4GMHA 3ORSA 2GCEA 3C5VA 3OQMA 4IP0A 2R9VA 2ZG6A 4Z4FA 1Q7BA 3DO5A 1YZHA 2GHTA 1OZHA 2JFHA 1DC8A 2Q6OA 1CTQA 4C7MA 3LRPA 2WWHA 4PSAA 4J75A 4FWBA 1YR8A 4OGFA 1JPUA 2QVXX 3F4BA 4MDYA 1XLVA 3PIDA 1XLUA 1XEXB 3IUYA 3MUNA 3UC5A 4ERXA 2P2SA 2JZNA 2HGSA 1UBNA 3ENKA 2SBTA 2MR6A 1QAMA 3PPIA 5DVZA 4C4OA 4UHCA 3TW8A 1X38A 4EB3A 2GI4A 2Y9MB 3OECA 1E9BA 2CNWD 2IXDA 5DNWA 2QB5A 2BD0A 2R44A 4G5YA 5B1SA 4OQQA 5U9CA 3DHVA 3DMPA 1XVVA 2LNDA 3QU7A 2G9VA 3L0YA 1KVUA 3EZFA 5EHIA 5KQPA 2Z3WA 1E1CB 1I6LA 1U63A 4YT8A 2IHBA 1W93A 3NHAA 3MCTA 1IHXA 3L8CA 3L4KA 3HSSA 1PGPA 2XR1A 1CY1A 3N74A 4RZSA 5DLYA 3C3BA 1C81A 3K2IA 4QD3A 4RD0A 4G84A 1XUOA 4CKXA 4QL3A 5JWRA 2H4JA 2NYAA 1JU4A 1NATA 3GP3A 4TT8A 1NJ6A 4C0KA 3NT4A 1AXGA 1ZIYA 2FP4B 2K5UA 2NUTB 4YMLA 1VG0B 4Q7JB 1J2TA 1TYBE 4F6RB 4RHXA 3UV6A 1B42A 3GCGA 4PBSA 2HRZA 4FMDB 4EYEA 1SXQA 3KDPA 4CF6A 1KFKB 4OQDA 4PZPA 3SFTA 1KMIY 3H4TA 3OUZA 1CE8A 1C1XB 1ODSA 3LBIA 2GO7A 2FEXA 4FUTA 4KO3S 2JEZA 4YRZA 5BP7A 3M4YA 3LX8A 5IM4F 1RI1A 2HJ9A 3I4LA 3AVXA 4GP9A 4LFBB 1E1MA 4U7FA 1PSDA 3K09A 4GR9A 3OTWA 3Q85A 1R15A 4QBTA 4Y98A 1Y1LA 3CMCO 3DEJA 2PA0A 3G6WA 1UT5A 4NE2A 3W8DA 4H3VA 1GO2A 3HB1A 3STWA 1NXXA 1U2GC 3G8CA 3DCJA 1HT0A 3DZIA 3K31A 2G67A 2EL7A 2QRGA 2IP1A 2B4YA 3KJGA 2PD4A 2QLFA 4EYQA 2YHIB 5FFNA 1W48A 4LCBA 1OIWA 5ALJA 4AJHA 4EF4A 3GD5A 4JP2A 2Y68A 4EM6A 4QBHA 3VZRA 1UK8A 4E5MA 3BE8A 1L5SA 2MSKA 5CEJA 1PNTA 3CKYA 1FFBA 4A3SA 1TUIA 3HVIA 2W4MA 1IXKA 1OXSC 2C95A 3CRZA 2HAEA 4G6ZA 5CT9A 5FOQA 1P2GA 3DDUA 1UPFA 2Q5OA 3QVVA 3RIHA 5HIMA 4CG2A 3K9HA 2ZWIA 4UUNA 4BP1A 1V5IA 2OTCA 1ADCA 3L7BA 3V2IA 2DMRA 3W6NA 5EJMA 2DBRA 4LJLA 4TYQA 1NU6A 3PLRA 1IN5A 1M5UA 5BYAA 2QG4A 1U28A 5KNCA 2QYTA 5KNBA 4C5BA 1RP1A 4MAFA 5AW9A 1L4GA 1NVKA 4I3GA 4MRMA 5EKTA 3R40A 3CBGA 4NZZA 4H16A 2QRNA 4K9QA 3W2EA 3VR2A 5KVVA 1DOHA 2OUKA 5DI9A 2PSSA 5KSPA 1RRGA 5C8DA 3HGMA 3ZDYB 3QOXA 4NCXA 4QAQA 2WKPA 4A92A 1DKLA 4DFDA 1BDIA 2RCNA 3BS4A 2I65A 4L4XA 3S0JA 5IBQA 5D85A 4NBSA 1YCFA 2EATA 3P0EA 3ZLTA 1RKVA 1U8FO 1GUDA 3IR6A 4M49A 4QUEA 5DGCA 4AN4A 2V7TA 1PW7A 3HA2A 1KI1A 3PENA 3A6ZA 3EVGA 3T7EA 5KOYA 3GRVA 2VP5A 4MIEA 3UJ6A 3O4HA 1KFJB 4OUDA 5BWBA 3VJKA 4C88A 4MR9A 2CB9A 4B7XA 1L1RA 4G89A 5DBHX 4YRAA 5THQA 5ECYA 1I01A 5CCEA 3DO6A 4G1UC 2FX3A 5KEIA 3H97A 2A35A 4CKEB 4J1NA 4X91A 4Y9DA 5CNJA 4E46A 4POOA 1MQ8B 2XSZA 3DE1X 3F1KA 5CK5A 4UBJA 1SKQA 1P91A 4TSRA 1AY0A 5BY2A 5C1PA 3DZBA 4KYUA 1L1FA 2BYTA 5GY7A 2WZBA 4I9FA 2RB4A 1HZJA 2Q7OE 1ML4A 1NKSA 4R68A 2WAOA 3M3DA 1ETUA 1EFHA 4AN0A 2BZ0A 4NU5A 3ZV4A 1UMBA 1J9EA 3H6HA 2FSHA 2ZI5A 4GP7A 3GFVA 1CUZA 2ETVA 3FTNA 4X1YB 4D0RA 1Z4KA 1T4CB 4S1NA 6LDHA 4DV0B 1N3LA 2HCFA 3T1QA 3CC8A 4NENA 3GEEA 2BP7A 1QTNA 2UAGA 5DSXA 3B5JA 5EXTA 3WGLA 1PF7E 3G7NA 3IPRA 1KOGA 2YHUA 3U3DA 1P31A 3EN0A 5B6IA 2YWFA 5BVGA 5LOVA 2WYVA 1U04A 3FN4A 4HAOA 3TG8A 2QUAA 1YJQA 2WTNA 1CU1A 4CDRA 4W63A 3P9NA 3UCEA 2JKZA 4XVCA 1EFKA 3FNRA 3CUUA 3DWIA 3ISJA 2O2XA 1DIRA 1YZ3A 4O4IA 2ZJ2A 1O95C 2CFIA 1HDZA 3U7IA 4B6PA 3H11A 4CV0A 2KJQA 4PVDA 1P5FA 3P9YA 4JI8B 2CSXA 2YWCA 5DEIA 4AJIA 4D98A 2G82A 4Z7OB 1E8DA 4RHEA 2RH5A 3V8RA 1C3OA 5AK4A 1M2FA 3NGMA 3GELA 4F60A 3ZU2A 3FNGA 4B3JA 2GT1A 3TZEA 2R7AA 4QOSA 3USZA 4MPTA 3FNQA 2JGDA 1LBEA 2DGDA 2HRRA 3LV8A 3QM1A 4K9LA 4YJ3A 3MRVA 3EA5A 3GLFB 1FSPA 1O6FA 3KTOA 2FWAA 4N0PA 3R8CA 4KDCA 1NN3A 5LLTA 4OLBA 4OBEA 4BEJA 4EKNB 2Q2WA 2H51A 4U5XA 4LHSA 2VPYA 4B9AA 2FZVA 2AEFA 4U63A 5TMDA 2G4VA 3ZCXA 2GS9A 5DZSA 1L4UA 3BDVA 1YB5A 4BEWA 1Z39A 4KVAA 1KIAA 2GF9A 2ATEA 2VUSA 1GU1A 2EJVA 3FB1A 3KTAB 4G81A 3ZVLA 5C1DA 1H3EA 1UAYA 2WKRA 4LZZA 2GXAA 1G21E 5IJ0A 3CT6A 3AMVA 5DHTA 4A36A 3TTYA 3S1AB 1UWLA 1QZUA 2G40A 2IVZA 3CSUA 4R2IA 5JCJA 1GUZA 1CJKC 3FKSD 4ZRDA 1KJ8A 5I5EA 3WGTA 4JNKA 3AI3A 1ZD1A 2AFIE 3A1WA 3ZWBA 1KQOA 1MJNA 2WC1A 2J07A 1SRQA 4YMSA 4RVNA 3LX6A 1NX6A 1NR5A 1FFWA 1M8KA 1OSNA 1YFZA 2VPXA 3SHFA 3NDBB 2AI3A 3B36A 1T4CA 1CZLA 3FBTA 1UBKS 3K0AB 3VR3D 2AMLA 2QNRA 4AMUA 2P0EA 2XUZA 4V2IA 1LXCA 4KX3A 1R5BA 2XWSA 3OZTA 3ROFA 1V39A 1QHIA 3WL5A 2XI4A 2YC4C 1UBOS 2EQAA 4Q1AA 4F06A 3NUZA 1YWGO 3PFBA 4I9NA 4JUDX 4DL9A 1NLMA 3ND7A 4X8HA 3L40A 2BLLA 4GR5A 1PK9A 1X7WB 3T61A 1L7EA 5K2MA 5IP5A 1HWYA 5DFAA 4CL2A 3OWXA 4HK4A 3M6AA 5JZ9A 3TB6A 4WY5A 1V5FA 1EWRA 2WMDA 3F0TA 3JAMA 5DJ5A 1JMVA 4RKRA 2PBFA 3BGDA 4EKGA 3KZKA 1YBVA 4CUZA 1DFGA 1P1RA 1OGJA 1GTMA 2VT6A 3P9RA 2D6FA 4DVGA 2BFMA 3VDRA 4ZDJA 2ZIEA 1G3IA 4ROSA 1RTKA 2UYCA 4NYIR 3AM3A 2IEIA 1BEUB 1E6KA 3JVUA 1IQRA 4MUFA 4NG4A 4AWBA 2ZVDA 1G9TA 4KZPA 3LPLA 3H5OA 2B2CA 3RLFA 2GEUA 1R74A 4QQRA 4KR2A 4IR7A 4JJZA 1CY6A 3KQMA 4UTNA 2HHHB 4NARA 1IHDA 3K9BA 4UE2A 2PD3A 3PE4A 1HTTA 4NV3A 5BORA 4YT5A 2O3RA 1H6DA 1W87A 4MW4A 5JWHA 2DQZA 5JTTA 1I7DA 3K3PA 2O4UX 4J0CA 1V95A 3AFMA 3KE8A 2I54A 2DYKA 4HDMA 1J0CA 1CQIA 1QRSA 2H1RA 3ER9A 2D62A 3ANMA 4A9AA 3RG8A 3EVDA 5L7WA 3R0IA 5ITZA 2IBTA 4GUDA 4RZIA 4K26A 1NYLA 3STXA 2HBRA 1L2TA 3BD8A 2OM6A 1N25A 3QOWA 3ECSA 4P2BA 3AR5A 3VR4A 2HM7A 3ESBA 5A4AA 5ITWA 2NACA 3LS2A 3R3WA 3RGWS 1OH6A 3N8HA 4K2HA 3UJ9A 2G1KA 3UGKA 1IRIA 1A9PA 1UT8A 4ZZ1A 2QRVA 4WL0A 5IXSA 1WZCA 4P5EA 5BSFA 4QQFA 2IX9A 5FEMA 1QWSA 5C4MA 2B1RA 4GL2A 1G7SA 4XTRA 3MAJA 4W9RA 4GM0A 1FDIA 3BXEA 1I3NA 2FPGB 4B7AA 3LOQA 3THWB 5EMKA 2G76A 2ACEA 4GYKA 3FSJX 2ZCUA 2UYHA 1FTNA 3I30X 1MV8A 3O90A 2ZT8A 1TC1A 1RRVA 2JNWA 1KVTA 2O0LA 1AS0A 4ND6A 4TTRA 1E60A 3NBFA 4MYDA 5C37A 2AQHA 5E9QA 1P1CA 2I03A 4ADSG 3SZGA 1Q3TA 4EG5A 2QN6A 3C97A 4YI5A 5H3CA 4FPXA 1USGA 3TDMA 3TOSA 4PQEA 1XMPA 3ZBUA 2FNAA 1BH2A 4OIFA 1AKNA 3AVVA 1KFEB 4PPQA 1QRRA 4LHYA 5HIJA 3LMKA 2ZB2A 1WPGA 4CV2A 1YQEA 1BW9B 1UBTS 3BWBA 4LYGA 5AVOA 1VI6A 1Y7LA 2NGRA 3FBGA 4ZVNA 3U3KA 3A11A 1LBQA 4XOIA 3K1JA 3LLMA 3HC7A 4OHFA 3SFZA 3O4VA 4QA9A 4V02A 3UQZA 2WYIA 4P7FA 2B78A 4LDZA 3ITEA 1ND6A 3JCZA 2BFBA 3GAAA 4E5NA 2ZJ4A 4QREA 1OLXB 4U4AA 3FZNA 5FORA 3UFBA 3AUUA 4CG0A 4IJ6A 3HCWA 2IXGA 3KXKA 5TT1A 1WMDA 2ZUBA 3WK5A 4ARSA 4JOQA 5BRJA 1JFRA 1FYWA 1K8QA 3HSYA 4YHBA 4OQLA 3ZD8A 2OXEA 3O9MA 4DA4A 1JEYB 4JJGA 2H8GA 3QFHA 4YAOA 3ZUPA 4FC7A 4DBVO 3H9EO 3DXZA 2K2QB 3MCUA 1SQGA 3RYIA 2JPDA 1UXHA 2ZGVA 1Z2NX 1WLYA 2YXLA 4N0EA 1Z5WA 4EG4A 4WCVA 4X20A 3TX6A 4Z0PA 3LO5A 4D3XA 2FMKA 3JVIA 3DMRA 4C06A 2NXCA 3QJ5A 4J76A 5T57A 3C15C 1EK2A 4FNAA 1U7PA 1MTOA 4AI6A 1A2BA 4OBBA 2CNBA 3PR1A 4GVPA 4MRVA 4L78A 4YREA 3RT1A 2G70A 1PD1A 4YXFA 5TXGA 3GPBA 1KQNA 3OFNA 5AHRA 4UHDA 5GONB 1ULHA 3D3NA 2O20A 3G2JA 1BQ4A 2JB9A 2VS1A 5FUBA 4XJTA 1X42A 4I4TF 5LBTA 1XTRA 1N6RA 1JIKA 1LK5A 1CJSA 3CLRD 3PNQA 5DGHA 2Q0XA 3ETCA 4IWNA 1EFLA 1NVVQ 4LRTB 4LXIA 3ZU4A 4MR7A 5K3DA 2R7NA 3TDKA 4DGQA 4ENRA 5AJHA 4YJFB 3BN3A 6ABPA 1W581 1EEXB 2OPBA 1WEHA 2OHVA 2Y1LA 1Y7TA 2ZJYA 3T4UA 4JYMA 4WECA 2OORC 1GG2A 2KLHA 4U3JA 2PGLA 4IHAA 3B1KA 1K8RA 2H4XA 2HQSA 2AF3C 1GGKA 2NZXA 3CX6A 3IFSA 4G41A 2Q6IA 3HU3A 3KLBA 4NCNA 1XZAA 4FYIA 4O4HA 4P3KA 3U1VA 4NYIQ 1TAUA 2MSNA 4CIVA 1BAPA 2YXEA 4OBWA 3TTXA 4AB1A 3O6VA 4CODB 4QUJA 1JX6A 5LOVF 4PPFA 3VNVA 3KK0A 1O57A 3LDGA 4Q7MB 1DT5A 3HP7A 2BMAA 5HS4A 4JX8A 2J31A 1CT9A 2W98A 3LT4A 4GPZA 4MUKA 3FZEA 4A03A 3I37X 4UVDA 4PCVA 3FZGA 3F71A 2R3SA 3UK1A 5BN3A 3RADC 1MT0A 2FVXA 4IV8A 4PR3A 3WQSB 2DR2A 5FJIA 3GOHA 1J8VA 2ZSBA 1ZUD1 2VDLB 1DE0A 3PSAA 4NULA 1ZH0A 5JZOA 1K3FA 4GWKA 4M1MA 2IU6A 4Y8VA 1E5TA 1GLVA 2HC9A 3JW8A 4WZZA 3MW8A 2FFQA 1KMQA 1N0VC 1NBAA 1WVMA 3PXDA 3T8YA 3AVWA 4ZMBA 4URWR 4IVNA 2ZIAA 4YPVA 5P21A 5JXWA 5YASA 5IXYA 1JDBB 2WE7A 3R3UA 1KFCB 5M29A 4EKDA 3D8RA 3KOZA 4KBYA 4CIBA 5K0NA 1XTQA 2PUEA 2ZU6A 3FYDA 1SUFA 1FFXB 4QX6A 1W88A 2O6HA 5H9VA 4DJAA 1MB2A 3AB7A 2IZOA 4X8MA 3NDPA 1IULA 1U9ZA 1QOPB 3T1OA 3UPTA 2QVBA 4RIHA 3DOOA 4QFBA 2Y1KA 3THWA 1WR8A 2ZUDA 1Q7GA 2IW1A 4N49A 1B2RA 1Z34A 4U7JA 2GTPA 2IUTA 4ZDWA 4NAUA 3LRXA 3H83A 2AN1A 1NMSA 2VT2A 5FWAA 5BO5A 3WS7A 4EW1A 3BK1A 1ZRHA 1XVIA 5CD1A 3HYRA 4I4CA 4ZO4A 1NMYA 4RORA 3M5DA 2KHZA 1CEEA 2LW7A 4KG7A 4KIWA 2YOHA 2A3NA 1J42A 2CDBA 4P08A 3WA7A 4IINA 2ZJ5A 3U48A 5DO9A 3ACCA 4M0LA 3EXG1 4JQCA 4M1KA 2TMDA 2GXQA 1VCIA 3R7SA 4UQOA 4BNLA 3AKCA 2B9VA 1BG6A 1ZBDA 3I4CA 4OJKA 3JR7A 5D5HA 4C6RA 1R27A 4CVNA 2PMBA 4FZJA 4JEUA 1HR0B 3JWGA 1GT6A 1V5EA 3ZGZA 3H8WA 2X1LA 2QL6A 4WFKA 4OHMA 4PR0A 2MINA 4GDMA 3TPFA 5DM0A 4RESA 3S3TA 2ES4A 3AERB 4CCAA 5K20A 1YHYA 1OAOA 2Y1OA 4GVLA 1FS6A 4O3MA 2GKGA 3W5CA 1J8DA 1ZQ9A 3QE3A 2H6EA 2X0KA 3PGLA 3OZFA 1M1UA 1XHLA 1CHNA 4FZVA 4KXQA 1OH7A 4F04A 4ARZA 4JDPA 3D6UA 5HCIA 2P40A 4H6PA 3W1WA 3DE6X 2IZ6A 3ILXA 3LG2A 3VV2A 3EXHC 3D54D 4S24A 5THXA 2AH5A 3AUXA 1UR5A 1Q1NA 4HWPA 4QHSA 2Q6KA 5LDGA 2JIZD 3HDQA 4L8YA 4N9QA 1GQYA 4D6XA 1XD2B 5JD3A 5GADl 4AAYA 2QTWB 4KREA 2YFKA 2EKDA 3VR2D 5AM3A 1Y37A 1V4NA 1LFAA 2P9FA 4YP1A 3U5TA 1IMJA 1P33A 2BKUA 2QYSA 2V4MA 3Q7PA 2J9RA 4C29A 4FFWA 1DIAA 1MGOA 3FM9A 1ICIA 2Z08A 2C2BA 2XY4A 1ZOSA 3A28A 3CR3C 4KO8A 2HU2A 2ZYUX 4PC2A 1LWOA 4CKBA 1CUBA 5KKCA 5KWSA 1I5OA 4ZHQB 5DIFA 4A0FA 2HRQA 2QAIA 1N6LA 2PCJA 5B2FA 1GLGA 4JOCA 4MKRA 4I5FA 1SD1A 1TM5E 3BJZA 3CNLA 3L02A 5IVDA 1MG0A 3HUFA 3Q7EA 4E2XA 2ALJA 5HILA 2DM6A 1UM8A 1AQYA 1NAIA 2GKSA 5EERA 5IT0A 1YQDA 5TGDA 2XXAB 1T3HA 1SCDA 1ZCJA 2I1WA 3N0WA 4MKIA 1S7GA 4R83A 2BKVA 1E2JA 2E55A 3OKFA 3HS3A 1ISIA 1VZ3A 3HY6A 2IYXA 4P7BA 4LFAB 2P5SA 2IUEA 3GGGA 1O87A 1GVNB 2WJHA 3QKWA 1NF8A 1TZ2A 4JLDA 1BU5A 4QDZA 5CNIA 1AN0A 3PX2A 5EHGA 1T8PA 1JSCA 4F5EA 1J22A 2VDVE 1K7SN 4QZVA 4PTLA 4XVUA 1G8JA 1W2HA 1XLTA 3E7DA 4LF7B 2EEZA 2Z58A 5DNEA 3O8RA 2JAXA 5IZCC 3KAKA 2RI0A 2P4QA 4P9NA 3UZUA 2MINB 2Y1EA 4EOGA 4B3GA 4PLZA 3QVTA 3UTCA 4MARA 3EH2A 3PJDA 3G23A 1DP4A 3KT0A 4HGNA 1XZNA 4MQ5A 2EFEB 2GCPA 1ZH8A 2VRCD 3LL4A 4FOSA 1M73E 4Z49A 3AFGA 2P9HA 3IP7A 4X90A 3CUEF 4KAFA 1NBIA 5JATA 1MJHA 5K3EA 3EFOA 2YMPA 1NNLA 3TPCA 2P41A 1QZZA 3GFBA 1GYRA 5JHHB 5M04A 2B2NA 1JDPA 1LBIA 3G7SA 4JVMA 2X7JA 2H1VA 3IS3A 1WUKS 3I2JA 3ZWCA 1NVBA 2Q5JA 2XNCA 2ODNA 4BATA 2JJ1A 1NPDA 2CXQA 2CZQA 5HUHA 4LDPA 5KU1A 1L7RA 1XVAA 3FSRA 1QB7A 1T9GR 1YFKA 4UUOA 1OR8A 4X1KA 3BK7A 4R0NA 1YI8A 2XCRB 4JB3A 1JFFA 2P9BA 3PFKA 2H9IA 3PFCA 2FLVA 4IJQA 1P3Y1 1ZM2A 2RKBA 5KOJB 2XUPA 4E7PA 5IWAB 2BGNA 4G07A 4DDMA 4ESHA 4YH1A 2V45A 5EZYF 2EX1A 1UXOA 5K2OA 3ISTA 4KO1S 1N92A 5CDGA 2Z4TA 3FUWA 1MHTA 1DTSA 5H5JA 2VQ6A 2O05A 4N5DA 2B8EA 3G6KA 2PNJA 4F4CA 5FPTA 3IUQA 4W7IA 5DW3A 3RVKA 3RC3A 1JHRA 3VPHA 4YRDA 2IDZA 1CDDA 1MW9X 1XZFA 4YQEA 4JYAB 7GPBA 2HRCA 2IUSA 3GLIE 3BJEA 4Z53A 3IE2A 3SZUA 3KE9A 4AIRA 2EJUA 2X1VA 3FHOA 4RTQA 1NVWQ 5GGYA 1HYEA 1MN6A 1E3WA 3SQXA 1LF5A 3DL2A 3W04A 2C7RA 3PRKE 3N53A 1ZVQA 1RP7A 4ZIRA 1E5LA 3B7WA 3JWPA 2PRKA 3V4FA 3NWOA 4K28A 2XOEA 3TI9A 4F71A 3GLGB 3D0KA 2BPOA 1NRIA 4JLVA 4OK5A 4AECA 1QYCA 1X39A 3WJAA 2QXUA 2GZAA 1HSZA 3H6KA 2BFDB 5HCNA 2WSLA 1SKUA 1BCRB 4NESA 4BMPB 2VUIB 1MQAA 3R7WA 1NNUA 5CYFA 3U3XA 5LZ2A 2VTBB 1DEKA 3GJ3A 1C5KA 2R6R1 2JZCA 3G2QA 3OX4A 2V1XA 2JDID 3FSGD 1KO5A 1AQ6A 1VIDA 3ZWWA 1HT1E 3NONA 4ENWA 3GLFA 3HRHA 2O2JA 4FUQA 5EVCA 2WTXA 1F7UA 5BQOA 1EUCB 3LXMA 4I99A 3URMA 4BWFB 4D9BA 4ABTA 4K9RA 1RQNA 3NOVA 2WIKA 2IY7A 1XVTA 4WBSA 2XB9A 1SELA 5HQJA 4ZV4A 5KTRA 1V11B 1Z2DA 4JH0A 4N41A 2AN5A 3AU8A 4M83A 4WGGA 5K09A 4CV1A 2LDXA 3F5SA 3IXQA 2GZDA 1XL0A 4NYMR 4TM8A 5BV7A 3IUJA 1I2AA 2GVZC 3KXLA 1GN8A 2DFLA 3PGJA 4TLBA 5P8WA 2QIOA 3H1PA 2C00A 3BMNA 1U0LA 1Z88A 1K7YA 4LCJA 1P74A 2FF5A 3DKIA 2C4VA 3AV3A 4FCCA 4CLXA 5ENZA 3ROZA 4R6WA 1OT3A 1Y3HA 4ACBA 3IB3A 1LSJA 1JHDA 3KLPX 1T36B 4H3SA 4ZOCA 1VPVA 3JQPA 4DMKA 1R8XA 1W1WA 1K8XB 4MVJM 2C3UA 3AUSA 2VXYA 4F3YA 3KOXA 3AJ9A 3KJZA 3PUKA 2V4ZA 1PAUA 1CR1A 1XZQA 2JRLA 4E5SA 5IVKA 3EODA 1YR7A 3EIOA 3TLBA 3A9CA 3X0DA 3UJPA 3KQVA 2AFRA 2A4MA 1MAAA 3BH7A 4JMPA 5KBYA 3IV9A 2JFYA 2DY0A 1Z2EA 2CUNA 2QPOA 4GPIB 4YLYA 1ECBA 2Z4SA 2CXRA 1A8PA 2X77A 3KUXA 5ITSA 1Z15A 4UC0A 3N2KB 1VE6A 9ATCA 4J3NA 4MDEA 1PWEA 4GT1A 3LP6A 5HE9A 4KR3A 1NWHA 4NX2A 3FRJA 4CMHA 3SXPA 2A5LA 2H7CA 2OWDA 4JK3A 1J2JA 1TJPB 1KAGA 3P2IA 5EJ4A 4TLAA 1F0NA 4K81B 2W6QA 1EVQA 2HBZA 2XT6A 3I34X 4ZCPA 2OBBA 2ZW9A 4R9VA 1BDMA 3FI9A 1G5IA 1QR2A 3OE5A 4RAOA 4C6TB 3EEOA 3Q8LA 1ID8A 1IZYA 3OFVA 2RSLA 3PQ5A 5IJWA 3IHWA 5D87A 1FBTA 2EP8A 1XKXA 1JE1A 2BIFA 4HRXA 3UUGA 5JSUA 3MRTA 3VKGA 1RVDA 1J90A 2CFRA 1V6SA 4LF5B 1HQDA 1ZAYA 1NE2A 4PLHA 5JS6A 3RHZA 4YV7A 2BGWA 2C20A 4TV9A 2IYWA 1CQIB 3BGSA 4Q4LA 4E09A 1GNQA 4OYHA 4HPJB 4EJSB 2PMKA 4Q01A 3DZFA 1IM5A 4MUBA 4BMVA 5JXGA 3ZQUA 4INJA 2H9AA 1VLLA 3R23A 1Z06A 4TXJA 2EFDB 3ZJVA 2ZUEA 1ZWKA 1WV1A 3CH6A 1PJBA 3JQFA 5I4KA 3PLNA 2ZIGA 4PYMA 4YBRA 3OQJA 3RODA 1RXYA 4JB0A 4OMCA 1BJRE 2G63A 3LHFA 3HYSA 2QPAA 3KUKA 2PL5A 3A36A 3MBIA 3K4HA 4DJTA 1FLAA 1WBJB 2EJBA 1BA2A 2WAMA 2QQ0A 2X5OA 4XOUA 3V1TC 3RUIA 3TI7A 4BVJA 2CZGA 1EJBA 3NASA 4BPRA 2CE2X 2Y05A 2J9GA 2XNDA 1YXMA 4HH0A 1TW2A 1O08A 1E3JA 2EF1A 4MS4A 4BNJA 3K2BA 2YASA 3P9XA 4JS0A 2RAVA 1GPH1 3VH1A 1O97C 2FYTA 2CJWA 1Z5PA 1MNQA 1TTHA 1VYUA 4QEKA 2AIRA 3VOSA 4KU4A 1OIVA 3GH1A 1T9BA 1E2EA 1GPUA 5C9ZA 2VJOA 2C07A 2J5KA 4RACA 3PNLA 5KOHB 3V4OA 3A14A 3MGGA 3QLEA 1PZEA 3LIIA 4I14A 4JLSA 3NHBA 1DLJA 2PIDA 2I22A 4B80A 1UJ4A 2CXPA 4ASUD 5A2QA 4H6XA 3H5TA 2BFDA 4KP7A 2BN4A 1QCDA 2FFHA 1U1CA 3QPUA 3FFAA 1PV2A 2UDPA 2QTHA 3KB2A 4FS8A 2ASVA 3WGIA 4BP8A 2WNIA 5FF9A 1RAHA 5FUWA 3QEJA 4FLMA 1G20E 1G64A 4GKVA 4K40A 4M0PA 4AYXA 3LCMA 2X3YA 4EO7A 2CVOA 3BL5A 4IIFA 3U80A 4DWOA 4ENPA 3ESXA 4BVEA 1RE1A 2UXBB 2ISCA 3M3PA 3ET4A 4LNHA 2BGKA 2Y2UA 1FOEB 2QLBA 4PBTA 2BEKA 2IFTA 1MDBA 3B82A 4UHEA 3DTVD 4YDSA 3RBAA 3BDAA 3PQFA 2IDJA 4ZYVA 4JT2A 4HSEA 3QXSA 1BDHA 4X6YA 4KTTE 3C1OA 3FNHA 2B1QA 1QIGA 2PM8A 2PSFA 1L4HA 3BH6A 3MPUA 3OX2A 1QF6A 1G8FA 5TVKA 1VBFA 2Z0MA 5K3BA 3CSDA 4QUAA 1TIBA 4UXIA 4OA5A 3DLBA 1I2BA 1MIHA 2A5FA 4WNCA 4ZU1X 1GV0A 1RWQA 4YRJA 3KSZO 2FPXA 2Q0QA 3GYBA 4CMAA 5LA6A 3QMWA 4FJ0A 4MHSA 4YONB 5BN1A 2RAFA 1XALA 3AILA 3OA0A 5AKZA 3ZE1B 3ZK7A 5B2EA 3VAZA 3KHTA 3K5WA 3ZDXB 4A4DA 1P17A 5FTMA 1RJWA 5JSHA 5F3RA 2YH2A 4EKIA 3PI7A 2VHXA 3BCHA 1QHEA 2CVZA 5J4YA 3I9KA 1KVQA 1FXUA 2I7TA 3JARB 5HF5A 2ERYA 2AFHE 1NIPA 1PGNA 2BP7B 2QU8A 3HBNA 2DRIA 3KZXA 5LZ7A 4EUEA 3NHKA 5F5LA 3H04A 1ZRMA 1J09A 3B1XA 2JJ2A 1Z29A 1ZJYA 2H16A 5IKMA 1DO8A 5DTQA 5JXIA 2NO9A 1THGA 4L85A 2RHTA 2ACWA 1KJWA 1YZFA 2J1LA 3DBOB 3MTJA 3MWLA 1ZCFA 5A02A 4LMAA 1ZN8A 4A23A 1WQ1R 3AWIA 1WW3A 1R6UA 2HPAA 4FCTA 1HT2E 2JF0A 3T5DA 1GUBA 3I39X 4H18A 4YRCA 2IYZA 4YCAA 2PLRA 3PA6A 1A2OA 1LBHA 4KV9A 4X3PA 4TXMA 4NAVA 3W8NA 4GLBA 3DWFA 3GUUA 4Q3OA 3HUUA 3LC7O 5DCLA 2FZ4A 3NKVA 4OSPA 3WK8A 3RF7A 4DG9A 3ONDA 3UMCA 4AG5A 3M34A 4TM7A 3AI7A 2ZRKA 5HF8A 2FMXA 4KYVA 4XWYA 3WLJA 4WADA 1PWXA 1CUCA 2O8CB 4NPCA 4UHBA 2C4NA 2F55A 4AS1A 1JQLB 4MS1A 4OXKA 1OMOA 2O23A 3EJ6A 5GONA 1O6CA 1Q84A 4DLBA 4F86A 2R6CA 1YDGA 3R6WA 4MYSA 4EG0A 1T0IA 1XMXA 1IOWA 1D2CA 1L4BA 3BSWA 2OCIA 2VJBA 1JIVA 1D9XA 1NU8A 4II2A 3VYRB 4C0LA 3AW9A 1ATZA 4MYTA 1LTHR 5AMXA 1E6LA 4BB6A 2XNDD 3RVJA 4KQFA 4D43A 2NO0A 2JD2A 2VCEA 2CLDX 1A27A 1CIVA 1EZ4A 1RRMA 1E5DA 5JJLA 2E7ZA 3KDSE 3P2YA 4ZJUA 2X0IA 1C30A 1KP3A 1QMPA 2YZMA 3OQ6A 4IDHA 5DSZA 5HK9A 1BHSA 4NWIA 2HHCA 3C1AA 1EFRA 3GDWA 4DYDA 4Q05A 3SDBA 2C4WA 5IBRA 1ITZA 3TVTA 3JZIA 3L6CA 3TBFA 1Y8ZA 4KFTA 2PBRA 1H1LA 1ZEJA 2H11A 4UM7A 5FWNA 4BWYA 1UMBB 2VDJA 1EWKA 4BJ1A 1N5IA 3EB9A 2P2LA 3CKMA 3PGA1 3UT5A 3ILYA 4V2UA 4BE4A 1FUUA 1ZVMA 3GVPA 3BMQB 4LOJA 4R69A 5ALGA 5JANA 5JS1A 2XWBF 4BEVA 4J0JA 1DCFA 3LBFA 2CMDA 1SVMA 2QD3A 1EKXA 1ZD8A 3ABQB 3F6CA 1Q1GA 3TZLA 4ESOA 1IG0A 1G0NA 4YRNA 1DC4A 4TSKA 3F67A 4DQUA 1HGXA 4WDQA 5K3SA 5JPCA 4RV9A 4HYYA 2LCQA 2O9JA 2WFAA 2UZ4A 3D7KA 4Y0AA 4TKVB 1BH6A 5EQDA 2Q2OA 2Z2KA 4NNPA 5CU7A 4R1OA 4PIPA 4P0PB 4MI3A 2YFQA 3EG5A 2ZULA 3U4AA 1KRXA 3A6KA 4Q3KA 4JI7B 1PX2A 1D5WA 4LZLA 3DFKA 3ZDFA 1Z4JA 3MJCA 2Z9BA 4I5DA 3NPAA 4H15A 3IDQA 4PSUA 3VGJA 2E1RA 3RSGA 5DNUA 5KQMA 3MJDA 1ZGCA 3QHPA 4KL8S 3CVWA 4HGOA 2GCOA 1O9HA 1O2DA 5F51A 3H1EA 4ZAVA 4BL5A 4EG3A 2GYYA 5EQTA 4CFZA 4YUAA 5AVWA 4P4SB 1ZMXA 4FFBB 1KOFA 1ACMA 4PPNA 5SY9A 3SJZA 5CFPA 3LTNC 3P4UA 3ETEA 2I91A 4W8OA 3BL8A 2QRKA 4JT8A 2DFPA 4JB8A 4RQAA 5J4LA 2ODAA 2ZWVA 3TTWA 3I3SR 4NXMB 3TSAA 1HLDA 1HL3A 3I52A 3O21A 4CI9A 1FUIA 4I9GA 4KMSA 4PYQA 4E2FA 2JGFA 2GN8A 2FDCA 1SIUA 4HNUA 5BQ3A 3SZLA 1SQFA 2R8PA 3SGLA 3HJGA 1EK0A 1CFZA 1MQSA 1A9TA 1RI5A 3ZD9A 1OLUA 2A1IA 1PRYA 4TVOA 4EH1A 4K6GA 5HK8A 2XDWA 3ZTTA 1DLIA 4HCJA 1DVRA 2OM2A 1H8ED 1U8UA 3L1JA 3Q72A 2IIPA 3WL7A 5ALIA 4OK3A 4X1KB 4QARA 2P9ZA 3KEGA 1VOTA 4BRWA 5TS3A 2QTNA 1NNSA 1GL6A 4HN9A 1WCV1 2XUHA 2Z5GA 1W1UA 2WRZA 2VYCA 4Z9XA 2H4ZA 2ZIWB 3KVRA 4UDOA 1BHO1 4EG6A 3ZBPA 1VKRA 3KOWA 3BRWA 1G41A 4GR4A 1V7PC 1JVBA 2VFAA 4I4LA 2DPLA 2DR0A 2EZ9A 2XF2A 1V9SA 1AOXA 2FDRA 3EVAA 1EHCA 2OD7A 3KELA 4FGSA 4CCYB 3EXG2 4G5QA 3DZHA 3TD9A 3V3TA 3U4QB 5EGSA 1VB5A 1EP9A 1JB9A 1N5MA 1BFDA 2EJTA 2G9QA 5FULA 4KXNA 3TNDA 1SXHA 1BW9A 1OFUA 1R4MA 1O6ZA 3DULA 4P5PA 1LPNA 2HWYA 2QUBA 1EX7A 1T1RA 2D2EA 1BXGA 1O3YA 3IXMA 4P7KA 1IAQA 1TVKA 2FQXA 2OOKA 2IEBA 3O2JA 5I9SA 3T3HA 3NJ8A 4B34A 4WUVA 4R1NA 4NBKA 1X7YA 3SBDA 1KH3A 1JR6A 2P75A 1BYIA 5TJ9A 1Z35A 4MVCA 2PRJA 1QQ7A 4M0DA 1ZN9A 1TU3A 2FPSA 3LLCA 4DC9A 1EESA 4J0QA 4MAAA 4CW7A 2JLZA 4XJSA 3KKMA 3MS7A 1GPWB 5ALEA 2X23A 1Z56C 4DCOA 3W79A 4ENUA 3PQCA 4Q3CA 2FZCA 5LPNA 4FEGA 4GXRA 3NC0C 3OE7D 2WJIA 3PEUA 1XAHA 1HLFA 4BBAA 2M6LA 3L8HA 2XXAA 3F96A 4KLZA 4BUCA 3GU3A 1QTRA 5CLHA 3EEYA 5BQFA 1WD5A 1XBTA 4PC6A 3ZIAD 3K8YA 1D0VA 3BJMA 4WOJA 4LFCB 3TFWA 2I9KA 2QRVB 4CF4A 4TTVA 2G9NA 1S0UA 3AHCA 1V48A 2FR1A 5BN4A 1LI4A 3SF0A 4OH7A 3Q5EA 4XWAA 4D9FA 3SQMA 3L6BA 4Q3LA 5COBA 4OYRA 3AP3A 2YOGA 2FFAA 4JFAA 4OXRA 4E4RA 2XBLA 1U7WA 1XTZA 4Q1VA 5LP6A 3LK6A 4UE3S 1VGVA 2L17A 1G42A 2PGNA 1I4LD 1G5RA 3VC7A 2IZ7A 2YY7A 1IPEA 3V32A 1HLGA 4CM7A 3W6UA 2N75A 2PQ0A 3OZIA 2ZT5A 3GGSA 4QVGA 4G9GA 2PWPA 3VOAA 3O3OB 1S2DA 2VVTA 1JSRA 2ZZMA 3T9BA 5FBWB 1H8EA 4LXHA 3D4PA 1FSFA 1ZUIA 2P6OA 1C7ZA 1UKAA 2XDYA 3H05A 5JCOA 3U9SA 1TKAA 2P9QA 4RXUA 3V3KA 4PFQA 3FVVA 2J6BA 3A6LA 2GFQA 3PXCX 4M8KA 5DBGA 4BUJA 2VDRB 3OEED 3AK4A 4KIFA 2ZE8A 3RU9A 3P2OA 5G1NA 3K35A 1ZNQO 3UJCA 1MXHA 3GK3A 1KR2A 3WGJA 2P9GA 4ZZ3A 2XRMA 3T7DA 2XUGA 2R48A 3UJ7A 2XVXA 2XSZD 3HQ4O 3L41A 3N2ZB 4MJXA 3DEFA 1HDXA 3WGQA 1E2MA 4AF8A 4CQMD 2VRBA 2X2PA 5JSZA 2PKEA 1DKOA 3LECA 1U11A 4YYZA 1FCJA 3DGEC 4BIMA 4E22A 1UZAA 3GFPA 3DT8A 3QFRA 3VBEA 4J4HA 4EHDA 2Q4OA 3NU1A 1BJKA 5HBGA 3FHJA 3ZCPA 5BV0A 5SYAA 3VO1A 1HK7A 4O33A 2O8FB 5B1HA 3RBZA 3P9PA 2KB0A 2W6JA 3F5QA 4O4JB 2CF6A 3DTNA 4ZVRA 5B1YA 4RVSA 4XZ3A 3O83A 1ZD2P 4GRAA 5AKGA 1J21A 1R6VA 4DA0A 1CUIA 1R5NA 4M87A 4UEKA 2C5AA 3ZQKA 1OFUX 3TVDA 2XLBA 2FUEA 2XEXA 3NJ4A 1UOQA 1HE4A 3EMBA 4JIMA 1J1IA 4UTVA 5CLIA 4RF2A 221PA 2OHFA 2W8BA 3RS3A 5F23A 1GPYA 1EQAA 2X42A 3N28A 3MT9A 4COKA 2QTGA 3DL0A 3F1LA 3BA1A 3LFTA 3MPOA 6CHYA 1BMFA 2CDCA 4FJ1A 1Q0RA 3Q8MA 1UIRA 3QYFA 2DWCA 1ZU5A 1YI1A 3FIUA 3I0ZA 1N9KA 3QVOA 2DE0X 4GC5A 4B82A 3IE1A 2JFUA 1L5RA 4M6WB 5JMOA 1TEVA 4OF4A 3ZDCA 1R6AA 1VHTA 1I3KA 3PQ4A 4GI5A 4LJSA 3VC1A 4B74A 1X1AA 3W78A 5H83A 4P3YA 2BSAA 3QA9A 4Q82A 1QGOA 4OKNA 4UOQA 1G21A 3EGXA 4LNUA 2YQ4A 4L8WB 4KE7A 2HA0A 3D3JA 1PR5A 2A94A 1ZQ1A 4X7MA 5EIAA 2FMFA 1MMFB 2MDTA 3MJSA 4HF7A 3K1AB 3VSCA 1RLJA 4BN4A 1QOZA 3I6MA 3LC2O 1UXIA 1RZUA 2XHEA 5F76A 3ZWXA 4EHKA 3DSRA 3OIDA 3X2SA 2REOA 3HA5A 2CXSA 4CGZA 4RTKA 1DBQA 5DH9A 5HG0A 1R8YA 1JE0A 2OHHA 4QEZA 3KOYA 4WNAA 3WLFA 2ZT7A 3FWPA 2BFOA 2IDKA 2VA8A 5BV1A 5ICEA 3D9QX 4XLTA 2WU1A 3EUFA 3HV0A 4ID3A 2B1IA 2BR3A 3NT2A 3RJ9A 4EGJA 1AH2A 5L95A 1DZIA 2CNWA 2CLLB 4NNOA 5EJFA 1LK0A 1KWKA 2R1TA 2VBIA 5BURA 4P0TA 5DWVA 4M9SA 1S3GA 3JQBC 4DDTA 5IAEA 3EOBI 2SCUB 2HI0A 3AEZA 5ECWA 2GH1A 3RW9A 4OP1A 3VYUB 4DG8A 4FFNA 4CLDA 2Q8NA 4H77A 5J2UF 3T9EA 1H05A 4P4TA 4KI7A 3R75A 3TD6A 1PJ4A 1JDUA 2Z4RA 3OF3A 5FLYA 4G3XA 2HJHA 3MQ4A 5B4UA 2WJ3A 4YV2A 4D8YA 3Q2IA 4Y2SA 5HDQA 3TQCA 1FTGA 1RJFA 5ITVA 3K0AA 2I7DA 4QUBA 3FLBA 3QFFA 4Q4JA 3SBEA 3X1ZA 4M1WA 3C5EA 3QTBA 5L9AA 4M1EA 1P2SA 1T3LA 3IC5A 2HJRA 2HMYB 4P5DA 4QASA 5AK6A 3T3DA 4EZEA 3CLVA 2RAPA 2PBLA 5AXCA 2XE8A 2XUIA 5CB6A 4LBZA 2GAFA 3PYXA 4LZAA 2ENWA 2EYUA 4FTWA 5HRCA 4G56A 2OV1A 2WUEA 2ZIVB 3VZSA 1E6MA 3WWEA 4BJ6A 1MO2A 3AUKA 1QM5A 2X2OA 4YP9A 3KZ1E 4L22A 1RKQA 4PV7A 4QYXA 4ARZB 1U0BB 3NVDA 2NU9B 5GJVC 5KTYA 1HOTA 2ATIA 2YFYA 5EWMA 2MMGA 1U8EA 4H9GA 4O1HA 5DX8A 2PK3A 3ZC3A 2ZRCA 3AV0B 2HMSA 3UXEA 4KXXA 2A9FA 4H59A 3U26A 3UCXA 1N5RA 1X77A 2F3TA 3OLZA 3AO0B 2X7XA 4JENA 5JNTA 5KJ6A 4HQLA 1Y80A 4UCFA 1WETA 1LV7A 2BMFA 2VSYA 3GZJA 3U60B 2OZPA 2AHOA 1CEQA 5JAOA 5IAGA 2F62A 3RS2A 3HP4A 4JX9A 2G77B 4FOLA 4LMBA 4R01A 2F1IA 5IN4A 4QNNA 2XMQA 1W47A 3MT7A 1J23A 4HWGA 4TUYF 5EJIA 2IPNA 3TIIA 3WIUA 1BXZA 4I5IA 2NYVA 4QDJA 3FDZA 4QNRA 1RQLA 3T15A 4BMNA 3RI3A 2BMEA 3OTIA 4RULA 1GG9A 2HA7A 1G5PA 2I8CA 1VMDA 2HDWA 2QK4A 3JYHA 3WMRA 2EGUA 2WM3A 5EJAA 3VZCA 1STOA 1H2RS 2PX3A 2Z8ZA 2C2YA 4M1ZA 3HCCA 4DLUA 2C4KA 4QXQA 2P1ZA 1TJNA 3V1YA 4UPEA 1L4EA 5CBPB 5JNSA 3W8EA 4OX9B 2UV8A 5GAJA 5HCUA 2IH5A 1NVXQ 2ZJOA 2HNKA 1TYZA 3BE4A 2EYQA 4P6VF 1VKHA 4KLCA 3LWZA 5BYBA 4ZGWA 4UQLA 2H0QA 2PX8A 5IKOA 3GT0A 1L5ZA 1HFWA 3JR3A 4BLQA 2E37A 3IUSA 4FN4A 1MEJA 2I78A 4PG4A 4I1VA 3TM4A 3TSCA 1PTKA 3V7YA 4RANA 4YCLA 2J9ZB 3A6HA 3PR3A 1XPJA 4DMCA 2QUIA 2WWGA 3L4JA 2VQFB 3ZEAA 2WICA 4GWGA 1EX6A 2A9VA 4KE8A 3WIEA 1LRJA 3MINB 5JQGF 2YJZA 2DLCX 2BJHA 4BJ5A 1V8BA 1KMHB 3ILVA 1AGRA 2FG5A 1YAHA 1TTQB 2GSWA 4L0DA 1USWA 4AO6A 4KQCA 5DWDA 5CXQA 3E9EA 4WD3A 3DLHA 3B7GA 5GZ3A 3U4IA 4RENA 1Z0ZA 2XUOA 4NYJR 3I0MA 3CX4A 1C4OA 4R3NA 3P71T 2WMNB 4WFJA 5CFRA 4TWAA 1M7BA 1Q74A 3CISA 2GYUA 4MKZA 1KAMA 3A9UA 4GL4A 4RL4A 4H7FA 3U81A 4GOMD 1I4TD 3OO0A 2I2WA 2XXJA 4RNDB 3RVLA 4DLPA 1C9MA 1JJFA 4YIHA 4XQGA 2WU3A 4BBPA 1E9EA 2GWHA 1COWD 2R5NA 2HBQA 1X3LA 1TU0A 3HXTA 3LM8A 5EJ6A 5LYJA 3LCCA 5CT4A 3I83A 3KYJB 4MPPA 1NBWB 1T26A 3IALA 5C7YA 1YF3A 1DEXA 1KYVA 2X19A 5CDTA 1CJTC 2QTMA 4YPFA 4FGUA 4HFMA 2ZUSA 5CFNA 2G1UA 2BKLA 1UAAA 4DMHA 4KIGA 4YV1A 3EVZA 5FI1B 4D4LA 2UXCB 5JJKA 4LOAA 1R4ZA 1PQUA 4GEKA 1F4VA 3KCNA 4X97A 2A0XA 3SX0A 4B2PA 3HGTA 1B43A 4DCSA 1QGED 1TLFA 1K6MA 5EIBD 2F43B 3T06B 1GDTA 2GDJA 5ALFA 3PNPA 4FYKA 3KM0A 5J2TB 3UT5B 2ZRJA 2I2CA 1KIMA 2ZAIA 1GIAA 3PDUA 5I9BA 1GRQA 1KYYA 3SQNA 4GSLA 3QQ5A 1JH8A 4B7UA 2NU6B 3E7WA 5HUJA 3WK6A 2W93A 4FWIB 3OURA 3PCXA 1V1MB 3FVRA 5I4IA 4LDQA 5KTKA 3O4IA 4OMFG 3T0IA 1WHSB 1KYQA 4FHEA 4UU8A 1CP2A 4UDNA 1GNVA 1VLZA 3UH0A 2R65A 3OOYA 4XYMA 1ODLA 3PC8A 4IJWA 3F2VA 3T7TA 4DUGD 2DKOA 3TE6A 3CJTA 4YBZA 1UDCA 3WB9A 2J8ZA 4OEHA 5CT6A 4C22A 1DHTA 1R1DA 4BU1A 4UMFA 2IIVA 4JLBA 3RSOA 3ZVMA 3KFXA 2AUNA 2FRVA 3GLHA 5BWNA 1YBFA 2VSNA 4YJGB 4E7OA 3V4PB 4KXMA 2J3JA 3DCYA 1G8HA 1SG9A 3EFOB 3KT3A 4TRRA 1QU3A 3H7AA 1KQGA 3PHGA 1RWVA 1GAJA 1U0RA 4U00A 4QKQA 1Q5PA 4HGRA 1R0XA 4X6UA 4ZEXA 3DYVA 1NQUA 2QI9F 4J7XA 4KDRA 4K03A 4UBNA 4DIMA 1B6SA 1V8ZA 3KD3A 5MN4A 3B38A 5EZ6B 2HTFA 1PR1A 3M89A 3P0JA 4INAA 3RTDA 2NTVA 3VSAA 1RCFA 3I2HA 4K05A 2JI4A 5DX0A 3X1WA 1NJFA 5KDDA 4HRVA 2Q5QA 1AO0A 1RXWA 1JFFB 5ALVA 3U2QA 3HKCA 1GTG1 3TEJA 4F3TA 3OJCA 1T2UA 4HLCA 5LQCA 1KL7A 4M4SA 2FP4A 3FUTA 3WZLA 2PZFA 3UYKA 3LY5A 1JMKC 1A8UA 3IV6A 4ZZIA 3KV3O 3D31A 5TEWA 5BOSB 1P72A 1FPQA 4ZV9A 1WVIA 5DWQA 5DULA 1GOTA 1OB5A 4KRXA 1R0CA 4QAJA 5I4CA 3NTRA 5B12A 1TFUA 4BO0A 4CIWA 1BVUA 2JHCA 3O47A 4RF3A 4TL7A 2AOUB 4I5GA 4P3XA 3CNOA 2C8LA 1GARA 1V9CA 1L7AA 1F8YA 1SVUA 3HU5A 1ATIA 3N8NA 4ZVTA 4WE3A 5KB3A 4F4HA 3R6TA 4V39A 2Q3MA 3FWYA 4MINA 4TV9B 5F7ZA 4DNOA 3JWEA 2FWRA 1BXRA 3FGNA 2GBIA 1TD1A 1XV5A 4DR6B 3SJ7A 2ISSD 3HJUA 3NH9A 4DB4A 3HK2A 2WJZB 4HN4B 5K3AA 1GRVA 1S8AA 3ZJYA 1NBME 3FPEA 3GGJA 1LPMA 1OAOC 1UJ2A 2FEOA 3NPMA 4HAYA 5DYTA 5ERXA 3TZQA 4CIAA 4Q4DA 3CRMA 4V38A 5IX8A 4L2IA 2QV0A 4NCBA 1MAVA 1FNDA 3BFKA 3R9WA 2J3KA 4ZI7F 4ZO8A 5F64A 3S8YA 4ARBA 1U0EA 5HNKA 1WOMA 2QUZA 3H9JA 5JQGA 5E3IA 3ISVA 4TVBA 3DBHA 3IHLA 1SB8A 3R76A 1HE3A 4EMUA 3I0NA 1I9GA 5EJ9A 4GE0A 2O1EA 5EUBA 1Q15A 3THYA 3EG9B 4EJ6A 4ER3A 5K8IA 5M7EA 1FUYB 2PJZA 4XDHA 2VPQA 4BLRA 3T5PA 3FJ1A 4M89A 1BGVA 1CZKA 1SXJC 3JQ9C 3ADCA 2DPGA 2AXNA 2FWJA 1DNPA 4M1QA 5IYZA 4NHEA 1TW3A 4H35A 3DDOA 1IUNA 3NDIA 4HQRA 3R5JA 4IDQA 4GLLA 1IK4A 4GOXA 1S8NA 5EHXA 1LSSA 1ZCBA 4AJ2A 3AR2A 3P26A 3TQIA 1EWTA 2ILVA 2Q5EA 1I4OA 2FFJA 2QR3A 3F7NA 3IDSA 5EE5B 3G5TA 4GW3A 2YN0A 4YN3A 1GU7A 3R0VA 4HNSA 2ZS8A 1VIMA 2Z8YA 4MS4B 1C3JA 2RH8A 3AEUA 3UH1A 1YS2X 3WQHA 1YVPA 2AN9A 2KM1A 4HXYA 1FW6A 3HBAA 1A98A 1YB4A 5C0OE 2FUCA 3GPDG 2HXYA 1EE9A 5CGZA 3DJYA 3HFGA 1E3TA 2OHOA 4RFLA 4YK7A 3SE7A 3F7TA 4CZ2A 1K3UB 5E6UA 5ENVA 4PQGA 2ZSAA 1AV6A 1FVFA 5DOVA 2GAAA 1PFQA 4FYVA 3VDQA 4FKBA 1L3IA 1N36B 4WY2A 5EVJA 4E2YA 3CVJA 1BKDR 4XM0A 3QX9A 3HY3A 1BHQ1 1U1EA 2QYOA 3DMFA 1ML3A 3H2IA 2O3QA 4MWSA 4NOKA 3HJHA 1OXBB 1L5LA 4MP3A 2OFOA 2Q3JA 2RAUA 1X9GA 4MQEB 1LGYA 3B13B 1B0UA 1NI3A 1TM7E 1CVRA 4LEIA 4NFLA 3DZKA 3V8EA 4B32A 3TOVA 2Z1DA 1E3LA 5C5CA 1XQ9A 2BAGA 3NB0A 3R20A 5E7QA 2IU0A 1KI2A 3BCRA 4W99A 2HB6A 3QELB 4W5OA 1XQVA 3LIPA 1UPCA 1XTBA 3M4NA 1V1RB 2W90A 4ZOLA 5KKNB 4EG8A 5CA1A 1EXDA 3OEWA 1E99A 2RHBA 4AT1A 4HDSB 1EQUA 2PDAA 3WKDA 2A86A 5EE9A 3OSZA 3D2LA 5AJUA 2H8KA 3LY8A 1QRTA 4FR2A 4R7GA 2O7VA 2FJPA 3ZVNA 3E7FA 4BNVA 3BQMB 3BAFA 4D44A 1NUTA 3KXIA 2IS1A 1JA0A 1RBYA 1QNFA 4PGFA 2GN6A 1XCJA 4ZAFA 3BMCB 5AIAA 3B9QA 3V6MA 2JIZA 1TEXA 2HJVA 4FGZA 2C9ZA 4JXZA 1Z16A 4OH1A 5EKXA 3T1HB 1T6NA 3DPSA 2C2HA 1UP7A 2O5RA 1B93A 4NCJA 5TY0A 5CDUA 1GRNA 2XGOA 3HA7A 4CM9A 2WWTA 1RMTA 1YOVB 3T9AA 2ZB4A 2BFAA 2JFPA 2R84A 4HH4A 5LZ5A 4C4SA 5HZMA 3OH8A 2IYOA 1Y5LA 3FPAA 4WA8A 5CCDA 4ZCIA 2VPIA 5ER6A 1PK7A 1L5KA 3ADDA 1SOMA 4F1WA 5FKJA 3U56A 3F8TA 4YFVA 5JASA 4EITA 3KZOA 5JMWA 2B4AA 4G23A 4UPVA 3ZLJA 2EFYA 1ZLYA 4S1OA 3ZXSA 4X45A 4YAIA 4KH0A 4LJAA 2VI5A 1QGYA 4UPDA 4TVKA 4E4TA 1ONPA 4CKYA 2FZEA 2O5VA 2FE4A 3RVPA 4IVRA 3H2JA 3WK4A 3BFXA 4MW9A 2FZWA 1E1LA 4YUWA 2I2AA 3CVUA 4EUHA 1L3BA 4LBWA 4XVHA 4YY3B 3BZWA 1LQ2A 5NLLA 3DOIA 5KVAA 2IDMA 3TCXB 4B3TB 4Y2UA 4P2GA 2CL7X 4H0CA 1CS0B 1Q44A 2FZ5A 2QE7D 3KJXA 2W2LD 1AKEA 1YA4A 2VSQA 2VP2A 1B8UA 3I01M 4FMCF 5I8ZA 3ZU5A 1ELOA 1YJXA 3LQQA 4MAMA 1D1SA 4J9UE 4M60A 4IJMA 1FTSA 2C2MA 4AS3A 3F6EX 1B3RA 5AVUA 2PLNA 3GO4A 1LH0A 2FEAA 3LZCA 4RD4A 4B83A 3GFSA 3EEFA 5CVVA 4JBNA 4BV9A 5T8KA 2FSPA 2FSUA 2H0RA 2JAPA 5AR1A 5TB5A 2HDOA 2WIBA 4OD0A 4MB6A 4XI9A 3VPSA 2JLRA 3OCWA 4X1OA 1P2UA 5G0WA 1GEGA 4A5SA 2QD1A 1Z3CA 4TYPA 2RHLA 5TARA 1ZBQA 4WY8A 2P90A 1UBJS 1ZIDA 2G09A 1JI0A 2G80A 3DXYA 3U3OA 3VKWA 3TLKA 5K0LA 3MA0A 4JC4A 3U7EB 4D82A 3RK4A 4DABA 1AUQA 4P81A 3RFCA 3G2MA 4ALLA 2WQ7A 1KYZA 2EWMA 3C0KA 3P20A 1GAEO 1OT5A 2EERA 2XZPA 3Q3EA 2RMKA 3O82A 4G97A 4LHEA 5E8RA 4DUPA 4EB0A 2QTZA 3HR4A 2AXPA 4EY7A 1T35A 3BEOA 5DM2A 1E79D 2J7KA 1OX4A 4M1TA 3EUAA 1GP2A 3ONNA 4URYR 2X8LA 2GZRA 3R7NA 4ARVA 5KYTA 2GEDA 3VH2A 1WDMA 5MDHA 1C9NA 3P2KA 3I6YA 1G5FA 3HCOA 4PYIA 4F4DA 4XDYA 3P1JA 1QO0A 1RD4A 1QHXA 1JR3A 1WZUA 4JUFA 3FGZA 1YTLA 1Q91A 4IQGA 4U2FA 1Z2OX 5F5XA 1RXCA 3WSTA 3DE0X 4AZ0A 2W2PA 4YRMA 1JWBB 1XROA 5ER9A 4CN8A 3R44A 1O96A 1GILA 4IH4A 4ARIA 2OO5C 1AT1A 4RSGA 2P62A 1OIXA 2BE9A 2I4RA 2PH5A 3CLRC 3E22A 3N8IA 3ORHA 3MSCA 1U1GA 1Z08A 4Z5XA 1MTZA 1I2ZA 5A0VA 4IHJF 1E2FA 2PSHA 3U4DA 1UMKA 2GEJA 1HT3A 3BGWA 2AL7A 3EIXA 3EULA 3N8DA 3P19A 1CQXA 1MENA 3ABOB 4N5IX 3VPXA 2INGX 2PKWA 2YHSA 2WNHA 4IEIA 1CS0A 1NVGA 4REQB 2WSYB 1N6PA 2XZDA 5A5EA 2QRMA 4NTZA 4WKOA 4F3KA 4N48A 3ANLA 1BFUA 1SM4A 4PFKA 4N0MA 1GPJA 1TF5A 1HPLA 2EQBA 1WPQA 5JNVA 1Z8FA 4UAVA 2Q3HA 5AOCA 1GADO 1R3DA 2D13A 4F84A 4RMIA 2QXTA 2RGNA 1N2JA 1PLLA 1TQHA 1UT6A 5DK6A 2HW8A 2VK2A 2QRZA 5D3MA 3IMFA 2X8JA 4J1SA 1UINA 1WCXA 3SG0A 4BECA 4QQNA 1MRNA 1XZBA 5ARBA 1A97A 2QL9A 3D4OA 3NS7A 2OAEA 4UASA 4A2PA 3MTBA 5GV8A 4FMPA 1RWNA 1S3SA 3B78A 4E6PA 5K8CA 3EEQA 1M8PA 4FONA 3MF4A 1AKWA 4S0XA 5TE9A 1T3GA 1TDJA 1Y33E 2JBWA 2CVFA 2Z83A 4LTMA 5K0SA 1ZJWA 4O4JF 4IMIB 1XOIA 1IK6A 1JKJB 3BMQA 1J4AA 4GVXA 3L8FA 2DT8A 2XV1A 3EIEA 1GT91 5T3YA 2CLMB 2AXQA 1QP0A 2HV8A 4MGIR 1DJMA 2YTZA 3N07A 1RU3A 1YK1A 3Q4GA 4H4DA 3REOA 1AGPA 5GM1A 2C5GA 4OKSA 1OLOA 3KJQA 1U2GA 1L5VA 4JJKA 1LNQA 3QVWA 4FYHA 4P32A 3AESB 3PEFA 4Z9BA 1NUQA 1JDJA 3FPHA 4Q48A 4JVLA 3WRWA 3MTQA 2VDWA 2B36A 2FWMX 1C41A 5FUXA 3D5TA 1M34B 2PD6A 1FTWA 1FQOA 1ZUHA 2IXFA 3GEIA 1XP8A 4N8EA 2AR9A 4WV3A 5DOZA 5DXJA 5EZ5A 3W7BA 5K0CA 1YA8A 1CK4A 3G2LA 3N2GB 4OLJA 2GNAA 2QX6A 4X64B 1CY4A 5T6MA 1YZUA 5ALOA 4DIFA 2X1HA 4BV3A 2AN3A 4OAQA 1GA6A 4HDOB 4KW7A 2ON6A 4GICA