2OV3A

Crystal structure of 138-173 znua deletion mutant plus zinc bound
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
260
structure length
260
Chain Sequence
DAMDITVSIPPQQYFLEKIGGDLVRVSVLVPGNNDPHTYEPKPQQLAALSEAEAYVLIGLGFEQPWLEKLKAANANMKLIDSAQGITPLEMPGRLMVADPHIWLSPTLVKRQATTIAKELAELDPDNRDQYEANLAAFLAELERLNQELGQILQPLPQRKFIVFHPSWAYFARDYNLVQIPIEVEGQEPSAQELKQLIDTAKENNLTMVFGETQFSTKSSEAIAAEIGAGVELLDPLAADWSSNLKAVAQKIANANSAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic binding protein component of an ABC type zinc up
publication title Possible Regulatory Role for the Histidine-Rich Loop in the Zinc Transport Protein, ZnuA
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Transport protein
total genus 87
structure length 260
sequence length 260
ec nomenclature
pdb deposition date 2007-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2ov3A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2ov3A02
4K3VA 1G21B 2XY4A 3MINB 3PSAA 4TKVB 3TLKA 2OV1A 5BVGB 2XUZA 4WN9A 2MINA 4XPIB 4UTPA 5I4KA 3G9QA 4ND8A 1TOAA 2XDQA 5KOJA 2M6KA 2QI9F 2O1EA 4HMOA 4WNAA 5CX1A 5M2QA 3AEUA 3EIXA 1H1LA 4WN9B 2MINB 1N2CA 3EIWA 1N4DA 4FNAA 2R7AA 4ND8B 2XDQB 5KOJB 4INOA 4WNAB 3HXPA 3MWGA 5CX1B 5FLYA 3AEUB 1H1LB 1QGUA 2ETVA 4M7OA 1N2CB 5JJ5A 1FP4A 4LS3A 2PS3A 5GGYA 4HMQA 1EFDN 1QGUB 3BE6A 1MIOA 3HH8A 4N01A 1FP4B 1M1NA 5M34A 2RG7A 4H0FA 4GICA 4OXQA 1G20A 2PS9A 5KOHA 1KAEA 1MIOB 5HX7A 4CL2A 2PRSA 1K0FA 1QH1A 3MFQA 4BBPA 1K7SN 3ZKAA 1M1NB 2OV3A 3AETA 1L5HA 2Q8QA 5B58T 4PM4A 1G20B 1PQ4A 3LI2A 1K75A 4OXRA 3AESA 5M3BA 3CX3A 1QH1B 3LHSA 3HJTA 2WI8A 3AETB 5CR9A 1L5HB 4NNPA 5JOQA 2WHYA 3AESB 3MWFA 4WZAA 3ZTTA 3BE5A 5HDQA 4IRMA 3AEQA 4FI3F 3UJPA 3U7QA 4WESA 4FILA 4G07A 4WZAB 4FKMA 1M34A 2XQVA 5GGXA 2OSVA 2PHZA 5BVHA 3AEQB 3TEFA 4B8YA 3ZK8A 4UTOA 3U7QB 4MLZA 4WESB 3AEKA 2AFIA 3PDIA 1K2VN 4UDOA 3R5SA 2YNMD 1M34B 5AFSA 2X4LA 5BVHB 3R5TA 2XH8A 3MD9A 5JPDA 1KAHA 1M1YA 3AEKB 1N2ZA 2AFIB 2YNMC 3PDIB 4HMPA 3AERA 1ESZA 1QH8A 4G09A 4INPA 1M1YB 2Q8PA 3GI1A 4WZBA 1N4AA 5KOHB 3AERB 1XVLA 4UDNA 1QH8B 2OGWA 4H59A 5KHLB 3NU1A 4MDYA 3TNYA 2XV1A 4MX8A 4TKUA 4NNOA 3K1AA 4WZBB 3ZK7A 3PSHA 4OVKA 5JG7A 4MO9A 5M29A 1PSZA 2AFHA 4HN9A 4DBLE 4TKUB 3K1AB 1G21A 2PS0A 3ZK9A 3MINA 1KARA 4TKVA 2AFHB 5BVGA 4PAGA 2M6LA 2R79A 4LJSA 4XPIA
chains in the Genus database with same CATH superfamily
1F20A 2ZLBA 4N49A 2DZDA 3DDOA 3I4LA 4ZEWA 1G66A 3GXBA 3HZHA 3FOAA 3B82A 4FNGA 1OWOA 3RV3A 4D92A 1N1EA 4AQ7A 4KWIA 1N2BA 1UM8A 2PS1A 3Q2OA 2UYHA 5TQ2B 2QPTA 2OAEA 4QUKA 5ECGC 1U3DA 4X1OA 3V7WA 4JLWA 2F4VB 2I8LA 5DVZA 3KWMA 2J7PD 5EQDA 4LV6A 4KE8A 2WPDA 1XO1A 3HFSA 4U9UA 3AJ8A 2RK6A 3HLYA 2AG8A 5FJJA 2GK7A 2QDKA 2OBYA 3DF9A 4PS1A 3S2EA 4AN1A 4AJIA 5IARA 5LKRA 3G3EA 4W5TA 5K3SA 1DARA 1KH2A 3I9LA 4TTJA 4W4TA 4IO1A 5IAKA 4F3NA 1XD9A 5FLKA 2IS4A 2DBYA 1VKOA 4Z3OA 4DABA 2ZBUA 2A1UB 3LX5A 1AGYA 1FXWA 3KT0A 4KTVE 3QPCA 4RC9A 4LJYA 5J5VA 4C4ZA 3N2NA 4AC9A 3CU5A 1SU4A 4HNGA 3PD1A 3UMRA 3WZMA 3NKVA 4UNRA 3TOZA 4QQ8A 1X7YA 2FRXA 3MOIA 4O4JF 4CMIA 3KOXA 4NCBA 1DBWA 3DB2A 1C8BA 3HJHA 3ZKAA 1HLPA 1YI0A 2ERCA 3H2GA 4GO1A 2OK7A 4YXWD 1DVRA 2IPLA 2D3WA 3VGJA 1QQ5A 2GM9A 2QLTA 5CT4A 2FCAA 4KV7A 4QUDA 3E3AA 1W85A 2QN2A 5IDYA 3WRXC 2O2EA 2RGNC 4L6CA 2IP2A 2A0FA 2O7NA 4RH0A 2LWIA 1P6XA 2SCUA 3WB2A 4UM7A 2H51A 4EYQA 1S8NA 3VH3A 1JDBB 3QTTA 4Q93A 1XP8A 4JJAA 1O9BA 4E3ZA 3LUCA 4ND1A 3GP3A 2WA1A 4GPTA 2EF1A 1EVQA 3RE1A 2VF2A 2QIOA 2VEOA 3AW8A 1MB2A 1EBBA 2C5GA 3LQ4A 1HF3A 3C8UA 1KS2A 5CLGA 5TMEA 1NXOA 4AY5A 2ZSHA 4CQMA 3MUOA 3MAGA 2A78A 1QWOA 3IIMA 4Q9KA 1XVAA 4R4JA 5GWXA 3W5VA 2M1ZA 3DSRA 1SAYA 2NW6A 4MA5A 1ZQ9A 2Q2OA 4MUMA 4X6LA 4F4UA 4IIYA 3PEWA 3PUJA 3O0TA 2XCOA 1KYVA 2C8VA 3ESDA 3BXHA 3WLEA 2H2FA 2XMZA 2ZR9A 1W30A 2YUIA 4FX5A 4G1EB 3RQSA 2P67A 2V74B 1QMGA 2VQ6A 4TSKA 3ZV4A 5BUQA 4DV0B 3KS9A 2X5JO 3KRTA 3S5UA 4JI1B 3HB0A 4HFJA 4B6OA 2JFUA 4B2YA 1QTIA 3MGGA 5BWBA 2NU7B 4M87A 2A4MA 4DWVA 3CONA 1OWPA 3BHIA 4NPHA 4MX8A 2QQEA 4JYZA 1APBA 5SICE 4Q0MA 2GESA 1W5AA 7REQB 1IZZA 1GARA 1FVHA 2WHEA 4HAOA 5CYOA 3UXHA 4H7HA 2C0CA 3B5IA 1OFTA 2WDPA 3GFOA 4REQB 4WY8A 2WUDA 2QTVA 3WJ1A 4GNKA 5AVYA 1ZYUA 2OESA 2B8EA 5HNKA 3C1OA 4A82A 5K9ZA 4UXHA 2Z3VA 3AI2A 4B6SA 2Z30A 1QPGA 4GLFA 3CNNA 5I9BA 5DHSA 3IO5A 2IH4A 3B8HA 5IUKC 1ZC4A 1JAYA 1KEVA 2V6FA 4MWOA 3WQHA 4D3FA 4MS1A 2CLDX 1RM3A 4YAEA 5J9FA 3REQA 3P2EA 4QJ4A 4G5GA 2AEMA 4RW0A 3TQCA 4EJ6A 2C4MA 2G88A 2V59A 3K9GA 4F71A 5FDFA 2ISQA 3UPTA 3VKHA 3JVEA 3BT7A 2ZUDA 3T1VA 2ZBFA 3E7FA 1S7CA 1TK3A 4YCSA 3RFUA 1JG2A 3AJ9A 3RJTA 1GAXA 2QLBA 1KJ8A 2WWWA 4INZA 5H59A 5JQGF 1N2CB 2BY4A 4L1KA 3STVA 3U48A 4XE5A 4FBLA 3VR3A 2H1CA 821PA 1L0BA 4JLKA 1RZRD 5LMUB 4L7VA 5D6NA 1F6BA 3SJ7A 2OB2A 1W9HA 1Z83A 3L6RA 3NNNA 4MQBA 4H15A 1Z82A 2A14A 4XWTA 3C3DA 2WD7B 5AJHA 4EG7A 3D3JA 2FZVA 5IKMA 4AWBA 4OJNA 1XNRB 3T9EA 1H4SA 1E6LA 2FWIA 3U1VA 4QRDA 4YECA 4R05A 3BRSA 5DZSA 1P1BA 1A8PA 3OU2A 1OYOA 3K16A 3GHYA 4FBGA 2Q5FA 4B5LA 3OIFA 4Q3OA 3ITNA 1XMQB 4DYVA 1HWYA 1I5RA 5AM1A 3RVBA 1IB6A 2ZR7A 4A03A 5HKKD 4S0ZA 2JDID 1YSCA 4BDSA 2Q4RA 2E9SA 3JATB 4XB1A 3LVFO 1WTCA 4GI1A 3BE4A 5G0VA 1CNEA 1FRZA 1VYUA 3B1VA 3GEEA 2XZDA 5CJ2A 3EPLA 1B73A 1N7IA 3UYLA 2O4UX 2QYTA 2C4VA 4JLNA 2X9VA 2M9MA 4MLZA 3F5SA 5AJVB 5AM2A 3K09C 1A3CA 2R6ZA 2DSTA 4Q3AA 2BM0A 4RS4A 1PJCA 2VHQA 3TWOA 2ZYWX 4UQPA 2C4NA 1FFXA 1EX7A 4JASB 3KJHA 1HE3A 1N2ZA 2AK3A 3DNPA 2XWBF 3ZI0A 3PQ4A 1GTZA 2IOFA 1K5HA 3D6FA 2E6UX 2WTUA 4Y6GB 2IEDA 5LMNB 1V8FA 2EBHX 1G5IA 1WSWA 2AEFA 4Y1RB 4D5EA 2LE0A 2RGDA 3MPUA 1TCVA 7GPBA 4X20A 4B0OA 4L4SA 1N9GB 4MKRA 1G3RA 1L3BA 3ENQA 3FMOB 2WJPA 1AOXA 1E7SA 1KIAA 2W48A 2BH2A 2HA3A 1LKZA 1X1TA 1I94B 4TKUA 2HUNA 2ZKLA 1B00A 1HZJA 2LRHA 1GXSA 4ARAA 2DWOA 1KVQA 2CV1A 2ASEA 4F1JA 1EVZA 3G13A 2R48A 3HI6A 2RGAA 4WK6A 4FS3A 1OU4A 2IU6A 3M83A 4UUOA 3SX0A 3ZHSA 4X94A 2QAGC 3D6MA 2XZTA 3EXAA 1INLA 3MINA 1KTVA 5KIAA 3ER8A 2XIJA 3I92A 1E9BA 4MVJM 1JJIA 1VGQA 5GJCA 3RF6A 4YVFA 3KUXA 4GYWA 1LRJA 3WLRA 2FH5B 2W8BB 1JKFA 1UOEA 3T4UA 1FC0A 3V8RA 1ZD4A 2A5GA 5T3UA 2Z09A 1LV8A 2PSHA 5P8WA 4AKGA 3EA0A 3RS9A 2A6PA 3MYRA 1XA0A 1GPKA 1UQUA 2CF5A 2O2XA 4LNHA 3H86A 4I0WB 2IGBA 2Z9CA 1B6RA 1FUEA 1Z12A 1U5CA 3SBXA 4HWKA 2H1HA 4J3JA 3V2UA 3T8YA 3LO5A 2ZTVA 5HBGA 4LYDA 2PO7A 4O63O 4LF8B 1IFXA 1Z4PX 2YXEA 1C8KA 3CLUD 4DF3A 1W87A 1SMKA 1ISHA 4QT4A 2G5GX 5F76A 1Z33A 1EE1A 5CB0A 2QJTA 3LO8A 4GWKA 4TMWA 3ZNNA 4DLNA 5JAPA 1JEAA 1U2EA 3L93A 1NPYA 1NQVA 4O2AA 2EX1A 5D1NA 1QHGA 3AZQA 3HH8A 1ZGAA 2GVNA 4I08A 3RAEC 2MWMA 4WLFA 3DUWA 1IHUA 1P5JA 2I6QA 3H9GA 4Z3DA 1KH3A 3LFHA 1B14A 1QHIA 3BF8A 4HUQA 1YOVA 5A3SA 3D64A 1GKUB 1LBHA 4B4OA 1GEGA 3G88A 3N0WA 2GZSA 4Q66C 5D5PA 3VKVA 4M1TA 2UUCB 3MMPA 1Y8AA 4DTCA 1B1AA 3K6KA 4WX2B 3ST7A 5ICGA 3A4LA 1ZRMA 4ARZA 5BV1A 1IVYA 2XYRA 1BKYA 1WQ3A 2VSNA 3O1IC 3L07A 5AVOA 2REBA 1WX1A 1KETA 5JOQA 4QVKA 2WU1A 2YVAA 4Y30A 2JA1A 3RBVA 3BMOB 1PRYA 1U0FA 4AZTA 1JYFA 1PJ3A 3FPFA 3NJ8A 5LBIA 5G0SA 4DIDA 2JRLA 3V1KA 1TUGA 3PU6A 5CGQB 1QYDA 2I03A 1JEYA 1Z25A 2J9YB 3FDFA 3QUQA 4G8CA 2R6R1 3HUTA 2WHXA 4CV3A 1EDDA 4KRGA 3MHTA 2O0KA 1C0PA 2GVZC 3GJTA 3OZXA 5ALRA 4LXXA 4XJSA 3F6CA 3H5TA 3D8NA 5AW0A 1A04A 5BUZA 1DIAA 4LZOA 2H48A 3AQIA 1S96A 1V3QE 4RD4A 2O8CA 3ZE2B 2ONKA 3GA0A 2ZRMA 1SA0B 1ZOSA 2Q1YA 5FTMA 3ED1A 1WG8A 2FWJA 2PX0A 2FPXA 3MB5A 3LRPA 3TI7A 3CEPB 4N1AA 2PX2A 2AOVA 2M2IA 1Z26A 1UMBB 5FTWA 3VKGA 1H0SA 5ARCA 3CUKA 3IAEA 3DMPA 3F1LA 4F2DA 2IYQA 1NBWB 1HPLA 3VPGA 2HDNB 3BA1A 3F6EX 2IV7A 5K3AA 3ZWOA 1Z17A 2B35A 5T4HA 3WYDA 2ZJ1A 3NYQA 3UAXA 4RTJA 2GXAA 2PJRA 3QWBA 4XWOA 2EFJA 4Y6SA 4GDMA 4ECAA 1QH9A 3N8DA 3WK7A 4UU7A 5B7QA 1CUAA 4C0BA 1RJ9B 4CRWB 4IDAA 1CRPA 1Y5MA 1UBJS 4FOSA 3AIKA 1N9KA 2IW1A 5KQRA 2OMKA 4GX5A 4M1OA 1OZFA 4P7BA 4ZV9A 3WX0A 1TJPB 4ZOLA 3STYA 3PPYA 1G8GA 1GL7A 2QVCA 4DR2B 1KMHA 4WJZA 4UTPA 5DHQA 2P5UA 1D8AA 5KYXA 3GZ4A 1ZGZA 3W9SA 1YHNA 2EU8A 1ENYA 1PGJA 3JQCA 2OZVA 3USZA 3BE8A 4V3BA 4DQDA 1NE7A 3TW6A 4ZRMA 1SCQA 2MU1A 4XDGA 5KOYA 1SOVA 3DBRA 4OMDA 5B1SA 2OC4A 4CM8A 5AW2A 3E81A 5IJ9A 4L9AA 2H59A 5IC5A 5DULA 1CNFA 2IODA 1SWWA 1Y82A 3F3SA 5EGNA 3RSOA 4Q37A 5KOJA 5LQKA 1OROA 2HV9A 1KEKA 5GINE 1H1LA 1N6NA 4OPMA 5KQSA 1RJWA 2ZIGA 3EIWA 4IKEA 2JLRA 1DBQA 1LPSA 3L8YA 3OOWA 4NAVA 1E8MA 3A2MA 1Z47A 1PGPA 4CM3A 1F14A 3H9JA 4UCXA 4V1CB 1FLAA 2CNKA 3CIOA 3G02A 3PTZA 4KO4S 2AOUB 4E2YA 5HS6A 1Y4UA 1E2LA 4GMDA 4MRVA 2EIHA 2ADMA 2GCGA 3FWPA 1VL6A 1CC1S 3D59A 3F3YA 3O8QA 3OSUA 3OZGA 4I50F 5HIIA 1NQ5A 3PT5A 3UO8B 2PMBA 4E5VA 3IQWA 4WCFB 4DV4B 3ROZA 3CVYA 4I5FA 4DXAA 2FMUA 3OX3A 3DZBA 3UMJA 3DB1A 3VU9A 2I71A 1LFAA 3PHJA 4Z9XA 4C7OA 4YXWA 3R9XA 2XNSA 4MWSA 4HGNA 1RM5A 2C4HA 5EJ9A 1KEWA 4PPFA 1ZQ1A 3RU9A 3ZWNA 2N0SA 2XVAA 3BD8A 1J90A 4X1KA 1CU1A 2VZEA 3I0MA 3JYOA 5H68A 1P9NA 1I9GA 2R1TA 2Y92A 3WGZA 2QPOA 2RKWA 1ODSA 2IHZA 1CUVA 1R0SA 3DE5X 4E09A 2HA0A 4IDPA 1N3LA 1KIMA 3CTMA 4K0RA 5EPEA 1V7CA 4EF5A 1ZOLA 2I4NA 2JJ2A 3HWRA 2V0GA 2BEWA 3AIOA 2HIGA 2XE8A 3QP9A 4D4MA 4DCMA 1J5XA 5JDCC 4OHWA 3EGCA 5TQJA 1C3VA 3EFOA 4P83A 5CHYA 1Q19A 1E9AA 4M83A 5TS3A 2QZPA 2C7PA 3SVTA 4GPZA 3TE7A 1K7CA 1EZ1A 2GKSA 3DTVB 1I0LA 3VC3A 3L7JA 1DIOB 1SXQA 1IQPA 5A6SA 2QTZA 2OKCA 4GXRA 1E5XA 3GJZA 4R1TA 4TROA 1CQXA 3JV7A 2W2OA 2OOKA 4F5ZA 4NESA 1ZVJA 3ZHTA 4MARA 1GFZA 5JSUA 2NVBA 3LGXA 3JQDA 3AKDA 3A05A 4NU8X 3DMNA 2AQIA 4OK3A 2GRUA 1P9OA 1NR7A 3U62A 3ZZNA 3OQIB 2HBYA 3W1WA 4AKSA 9LDTA 2ZUEA 1NUSA 4ZAYA 3ONVA 2CVHA 2V5VA 3RU7A 4R8MA 3ZWWA 1GVHA 4I5EA 2N75A 3WHLA 1G3MA 3HB4X 1EI9A 3LX6A 3N70A 2IYSA 1E1YA 1HDOA 4GVLA 4QFDA 4FOLA 4CHGA 2GK4A 4D45A 1AQNA 2HRDA 3IDAA 1ZOPA 4V3CA 2FG7C 2YVLA 1T3GA 3M0EA 4H0NA 2HLDD 2W58A 2TMDA 5GTDA 4HXFB 2PRJA 1P60A 1ECGA 1ZD3A 2IYVA 1GSHA 5CURA 4LFBB 4FD2A 1UEJA 2DULA 2PKXA 3KSDO 5LU8A 3KUKA 3EGXB 3NBXX 4QJBA 3W34A 2W6IA 4BFYA 1SCIA 2IXGA 2ZUCA 3K1TA 3V4RA 3C74A 2VOEA 2OFFA 2ZTUA 4R2MA 3RJMA 5EZ6B 2ORIA 3OOYA 3RSCA 3UGQA 4RK0A 1M8FA 1U3UA 4EX7A 4S04A 2FY8A 2BH9A 4K9SA 4FC6A 5BSEA 3GO4A 4R7GA 3OKCA 2ZB8A 1G9SA 4LC0A 1TYZA 4QTUB 5H4GA 3ZDCA 1L7AA 2JG3A 3FCXA 4JC5A 3E1KA 5AP9A 3W05A 4J94A 1II9A 4LZZA 1CV2A 2GPWA 4C7JA 1PWHA 3SQWA 1C9KA 5E6UB 4QPPA 3REFA 2RMKA 5DNEA 5I7RA 4BFUA 2HIHA 1KO4A 1Z0IA 4WXRA 3WGNA 3OD5A 4KN9S 1AF7A 1PW5A 2QQ5A 2OILA 5CVDA 3R74A 4HAIA 5IHPA 3KSZO 5LZ7A 2A9KA 3IJPA 1DTWA 3AO0B 5CYPA 1Y6FA 3HVUA 3P52A 4H1HA 1GLVA 2UYQA 4YRAA 1HGXA 1G59A 1T2NA 4XX0A 3SMVA 5JISA 5M3BA 2BEUB 1WABA 4NMMA 3EVZA 4I3FA 2OO5C 3ILVA 5CD1A 2GN1A 3V1MA 1G8MA 3DLAA 1F1JA 4OA5A 2I1QA 2P4QA 5DISB 3U4CA 3B9QA 3ZQ6A 2V96A 3VJMA 2Q5OA 4MVJI 1UQTA 4O33A 4KE9A 4DDWA 1LPOA 5C1BA 2J0UB 4UC0A 4ZYYA 1CB7A 2BZ1A 1WTAA 2BF7A 3R23A 1E2FA 1XZKA 1EX6A 3WWOA 4PHCA 3NBAA 1F38A 2C9MA 4RK6A 4XB6B 5D8DA 4R9VA 4EHKA 4ILEA 1ZD5A 3ZS8A 2P9HA 2QLFA 4UULA 1M6HA 4CIVA 1BNCA 7YASA 1KEPA 1E2IA 4F38A 3UT5A 1SVSA 5THKA 4KQ9A 4BB5A 1RC1A 1X3SA 2F3QA 4KQ1A 1FSPA 4O1HA 3TQTA 1S8AA 4C6RA 2GZMA 4J3FA 2SKEA 3NPMA 5CLIA 4NBRA 4QAJA 5AKEA 4DZZA 2K4MA 2YWXA 3WDLA 4ED9A 3SEZA 5BN5B 3IILA 1KDYA 4G5XA 2AMFA 3BN3A 4PYRA 2FI1A 1T91A 2O1WA 2ZWOA 4NDNE 4XQEA 3WWEA 1KEEA 1EP9A 5EZYA 2XYPA 4ZEVA 4CGZA 2EP7A 4Q82A 2ZUTA 4Q9DA 1JB1A 3ZR4B 1UMKA 3TW0A 1FJGB 4Q05A 4AMVA 4OU4A 1LPNA 4IVQA 3EVGA 1U7TA 2WF5A 3MMNA 1DRVA 1RI3A 3DYBA 4KDEA 4NNOA 3SP1A 1GNLA 1HUQA 1Q1EA 2BHTA 4NYJR 1BSVA 2PMWB 2WG1A 1PP4A 2GO1A 2I4LA 2ZWIA 3BOSA 4LDZA 5KO2A 3VNSA 4BV2A 5M04A 1JPJA 2IRWA 4PHHA 4ARIA 3D3KA 1BWRA 1NXQA 3F8WA 2G0NA 3A25A 4KW7A 3SC6A 5HMLA 3I5MA 3SZOA 2BEJA 4DRYA 2FX2A 1G0NA 4IXTA 2IEAA 4QYWA 2E4XA 3F8SA 3K2EA 1KMMA 3ADPA 3CSDA 5AKJA 5SZKB 4AIRA 4BCCA 2G7ZA 2PZFA 4LMBA 1AQUA 3A04A 3C7TA 3M3DA 3WKEA 1EWYA 3PD7A 2P1DA 1X1BA 1ORVA 2GO7A 3E9ZA 3EDCA 2VZ9A 4K46A 4RPGA 2ZSFA 4ZAVA 3W0LB 1XSEA 2H7YA 1GPWB 2QMUA 1KK0A 2XHZA 1WNTA 4HNTA 3NLLA 3O1JC 2GD6A 2Y2VA 3OT1A 4WERA 3LYLA 1M2OB 1NZFA 3N1UA 5G1OA 3UENA 3K5IA 4X65B 3W5IA 1RADA 1YTLA 1ZX1A 1YDWA 1MVOA 4J7XA 3C6KA 2R9VA 2C54A 4BE9A 4IUDS 2CB0A 5I7WA 4URFA 3KPJA 4H6PA 4J0JA 3AEUB 4ZRDA 1W6RA 4KSYA 1E2JA 1OT3A 1JJBA 1PKXA 2QTBA 5K6AA 5EA2A 3OZAA 2O14A 1VLVA 3UJCA 4MHSA 1G2PA 4U7JA 2AKYA 5EG5A 1TIBA 4QLBA 3B52X 1KY4A 5EIBC 3VPDA 1QR2A 1E6KA 1EFVB 3DDUA 1FDRA 1Z2OX 3KG2A 4EHAA 3FB4A 1M66A 1KQPA 3CS3A 1F0YA 4YO7A 1Q0HA 1V2GA 4C22A 4F45A 1DJPA 5HZHA 4DSUA 4JLSA 1KVRA 1J99A 1WXEA 3CPEA 1UINA 3PWSA 2BDUA 3OZRA 3R7NA 1J7KA 3WL4A 1IZ0A 1US8A 3BMCA 1JPUA 3FTQA 3KX2A 4JFRA 5CXQA 1E4VA 2WJ3A 1Q44A 3NBUA 5HGJA 1G8HA 1DKUA 3EQ7A 3ZWYA 4Y2RA 2NPIA 3RRNA 1WMAA 4FLEA 1X7ZB 4HZGA 3FSJX 4G0QA 4XW2A 1N7JA 3A6HA 4ESHA 2G9ZA 2WJYA 1P74A 4TZKA 1A9YA 2NU9B 1OH7A 2INGX 2O5CA 1XHEA 1RI4A 4IXDA 2QEQA 4Y2SA 5H1YA 3RSSA 5C18A 4POOA 4N18A 1O2DA 4YCAA 1P7YA 4AUNA 4C4YA 2XCRB 1E8NA 2HWUA 2VBCA 4YJKA 5MHTA 5J23A 3K0HA 4DVJA 1GQ2A 4CF7A 1I6MA 1VDZA 3UG6A 3CPHA 3DVSX 4HDNB 4PVCA 4F86A 1WW3A 2QRZA 2SKCA 4N47A 3GZJA 5KKAA 1HFWA 3ESZA 3ZD6A 1MXHA 2X0IA 3ONNA 1T4MA 4XGNA 3VYWA 3L7YA 5TS2A 3EZGA 3P9YA 1NATA 1VOTA 4YR7A 2NMVA 3MAJA 3KB8A 2F43B 2R60A 3SDZA 2BFCB 3MILA 1OIWA 1SUBA 1DGQA 4DY6A 1S1MA 2H1LA 3O2NA 4RZIA 4X24A 1V41E 3IVMA 3OFSA 3RR2A 3EQ8A 3PUZA 4KFTA 3GLIB 4YB8A 1R0WA 3K4QA 2WE8A 3Q7TA 1S2OA 3UXEA 1X0VA 3JSAA 5DNAA 4YCMA 1AKYA 1QYWA 5FAXA 4H1WA 4YUYA 1ZCJA 5E9JA 3CBQA 1NFFA 1ORWA 1TYEB 2FN9A 4X7RA 3SJBA 3CLRC 3W77A 5IASA 2Z9BA 1BVRA 3C3WA 4IF4A 1GGNA 4XDZA 2FUEA 4YYEA 1CJKC 4NBNA 3SNHA 1RAIA 5I9LA 4GEKA 1T9CA 4BQRA 2BKLA 2AG6A 4PNHA 4BVBA 1N8NA 2FFAA 3HKBA 2OORC 4RQAA 3MM4A 4E7PA 5CFZA 8MHTA 2J31A 3S1AB 2I67A 4CXMA 4LF4B 2P8JA 2G9VA 1IZ7A 3BEOA 3PFWO 1E7WA 5FO1A 4B1FA 4EYKA 5FB3A 4YN3A 4M8LA 2CJFA 2F3TA 1JPNA 1YRQA 2I87A 3O8OB 5DHAA 2PLFA 4M21A 3EUAA 3DDZX 3U0VA 3ABQB 1T5LA 2OV2A 2NXWA 1XMIA 4KTTE 1OILA 1UDRA 5CB8A 3AY7A 4YT8A 3DAHA 3LT5A 4RHFA 1PR6A 5FUBA 3OLYA 2F90A 3CF4A 1D0IA 4WLUA 4ZVRA 3WR5A 2H4FA 3GEPA 2FJUA 1CTQA 5DLQC 1NONA 1HTWA 3HXPA 1CF9A 1XWFA 2ZBRA 4KQCA 2ONJA 1TT5A 3QUCA 2BONA 4RTQA 1LW6E 4YV7A 2PD6A 4K6MA 5L3RA 4PFQA 1HTBA 3I2GA 5FAKA 4M54A 2EVWX 2GPBA 3DLPX 3UQYS 3ZW7A 2X9GA 3LXUX 4W9NA 2PR7A 2CLHB 2J0VA 3VX4A 4XTCS 2BD0A 3AK4A 2UXDB 3CRVA 3PYXA 3AC0A 1YBVA 5C9ZA 1KFJB 2IYLD 4CTJA 4FEAA 3TKAA 1JQKA 1GPH1 4G5HA 2FOXA 2WUGA 1K3FA 3EYAA 4RIIA 3RRZA 3NCHA 3RC1A 5KSYA 3SR4A 1B2LA 3NYRA 4HWRA 1RRFA 4IWNA 3OCVA 4M1YA 4Q01A 2HRQA 3RHFA 5A9SB 5CBPA 4ZYTA 1ZJJA 2Q6VA 2O2HA 3GRUA 3HSKA 3HO8A 2QMEA 1IK4A 3V7FA 3P7MA 4D6XA 4DYDA 3PC4A 4HWPA 1DXYA 3L5KA 4D0LB 1ID1A 1REQB 1IEQA 3MLEA 4A0GA 3E05A 1HE2A 3CWZA 2A5YB 3NHSA 5BNFA 1ZLXA 3EA4A 3U4AA 1TCAA 1IG3A 4GWLA 1RIFA 4QXOA 3ESAA 3IV6A 3QX7A 4IIJB 1O94A 5JS6A 2K2QB 4CIXA 3FWZA 3IVAA 1UJMA 4MRSA 3I2YX 3HSSA 5J59A 4DJJA 5DSZA 1NT4A 4MPDA 2FRDA 1QP4A 2Q7DA 3OX4A 3KV1A 1I5OA 1PJ4A 1EM8A 5EYPB 4E31A 1Z6ZA 4JXZA 2VDWB 4QYIA 4I5GA 4IRUB 1RJGA 1RWQA 2IEYA 3C3BA 4LZJA 5JNLA 2Z8XA 2FDRA 2XTMA 4MGZR 4TYQA 3SC4A 3WRVA 1G2QA 1DIGA 2CDNA 3D5TA 1XMVA 4R1UA 4Z9AA 4EMBA 3CEAA 4YRLA 3J7AC 3MT0A 4Z7JA 2QVZX 3IBSA 1P1IA 3M6FA 3RSGA 1CR0A 3BSFA 3I5YA 1Z75A 1U04A 2X2PA 2Q3LA 2Z04A 3Q0IA 4CHTA 2PUGA 2DFKB 2LTAA 4GX0A 5IZCC 2R0QC 5CA1B 3RF7A 4PHGA 3KYCA 5IBQA 3I2IA 4U2KA 4UVEA 4Q7MB 3TNDA 1HURA 1JDSA 5DEIA 4TUYB 3BWCA 1U7WA 2J0SA 3RBXA 5EXXA 1ACLA 5DGXA 5KVQA 3E8SA 5TDHA 3L8HA 4HFRA 1AB5A 4KMMA 4MDHA 2AW5A 2NU6B 1KFCB 1V7ZA 2WSMA 4Q9NA 1M1UA 5KREA 3KQUA 3EOBI 4C0LA 1Y6QA 3M81A 1AV7A 1NMEA 4G63A 1T0IA 1C81A 4M9QA 5BQPA 3CW9A 4RMHA 5JAMA 2Q5EA 1QG4A 1PWYE 4UM5A 4MV5A 3EEQA 3EVCA 3GG2A 4I55F 3EUFA 5KNDA 2Y8EA 4NYJQ 4QYXA 3BRQA 4M37A 2O2GA 4RVDA 2I2DA 4BO8A 1POWA 3EEYA 2PUBA 1MH1A 2VYCA 2NYVA 3AGPA 3RW9A 2B8WA 2NUPB 1HEYA 4R1LA 3AW9A 5TR9A 2A7QA 3PDWA 4J6FA 1IM2A 4J1TA 3IMCA 3C4VA 3CTPA 2ZJAA 4YXFA 3NXKA 5I7OA 3N9IA 2GPJA 3IAXA 4GMGA 3NM6B 4OMCA 4QO7A 5AO9A 1KZ4A 4QU5A 5ESWA 2PS3A 2JBHA 2VJCA 1O8CA 4KIFA 3COSA 4PCVA 5JSZA 3A1SA 1VPVA 4J03A 5KCMA 3ITDA 4GZ6A 4OCZA 3ZBPA 3LP8A 2PPVA 1L1RA 2QVGA 3WGHA 2A3NA 4TN1A 5TV2A 1ML3A 3DR3A 3AY3A 3B48A 2WWTA 2Y0PA 5JE8A 1K4YA 1DCTA 3OPMA 4LXIA 1XCBA 4IIJF 5FI1B 3F5MA 9LDBA 3EX7C 3TTYA 4NJMB 1P7ZA 3JD2A 3CN7A 2QD5A 1LI5A 3DW3X 3QH4A 4W99A 1W4LA 4B3RB 2ETXA 3G49A 2PXCA 3IP6A 2XCIA 3B1KA 3BDAA 1YKSA 5D3KA 3L49A 5EZQA 4L15A 2OP0A 3FMPB 3MWYW 2H63A 1BMDA 1UDAA 3AUFA 2JFOA 3CJRA 3GJ5A 2X0FA 5LLTA 2JLCA 3I0NA 4M1EA 5LD2B 3U60B 1ODJA 2ZRPA 3W2FA 4I1PA 1ZM2A 1G19A 2EZ4A 4FR0A 5GZ6A 1SC4A 2QLJA 4R31A 4ZOEA 2LDBA 3WAGA 5AHRA 4I6JA 4QDZA 1A95A 1GCAA 4RADA 2FE4A 3H9CA 3KBBA 3W1VA 1GTJ1 2VA9A 1MG0A 2A5JA 1X1QA 1YWGO 1BQ4A 2WM9B 4F9GA 5ED0A 4ZCQA 4RPKA 1GPUA 3CLSC 4LV8B 1ZEMA 1Y3CE 4BEJA 5CA1F 2FPMA 3GGSA 4YRJA 2V4UA 1P1HA 3H5LA 4TUYF 4INJA 2PCJA 2C1XA 4KXQA 4XZ3A 5F7ZA 5ULLA 3VA7A 2RIPA 4P82A 1S3IA 1XRNA 3NGLA 2VDPB 4AG3A 3DVQX 3QU4A 2VDOB 4IEEA 5KNBA 1L5WA 3MCAA 3QHAA 1KJ9A 4F4HA 3NEYA 2VAVA 3VUEA 2DT5A 2ZYIA 4UVDA 4RXUA 3DE1X 1Z3CA 3GJQA 2AJTA 3PENA 4L9RA 2IX3A 2VDUE 1X9GA 2BGTA 3JWIA 3EAGA 3P9SA 4N40A 4TL8A 4Q48A 3FCAA 5IJXA 2GSDA 3FOFC 4MPPA 1M8PA 5JH7A 3SYMA 1U9IC 1YCHA 3PSHA 4DLAA 1ZJYA 3GGDA 3ZWDA 5EIEA 3DM5A 1TVMA 5FORA 3I5XA 4TT8A 3W4KA 4M0EA 3H4TA 5DDIP 4LC1A 4DT1A 1E60A 4GZMA 4EM6A 3ZKWB 1D04A 4RKWA 2YBEA 3WGLA 3IKMB 1HFJA 4QDJA 2IUEA 2H8KA 1CQJB 1KZ9A 1OXKB 1TQ4A 4P7FA 4UEOA 3RJZA 2NYRA 5TSDA 5KKNB 3G2MA 1XVIA 3HV0A 5LXTB 4R41A 3VU8A 4WGFA 1SKMA 2QZJA 4AICA 4F72A 3PFHA 3R9WA 1VE6A 2EGHA 3P9XA 5E7QA 4RO0A 1P9WA 1V1RA 1FTYA 1GPLA 5BN4A 1BHO1 3HJAA 4P3KA 4PU0A 3O83A 5REQB 1GGHA 3FPAA 1XRLA 1HE1C 1TZKA 3PHHA 1U3WA 1PJRA 2YOGA 1TLFA 3R5JA 1P0CA 5GM1A 5JLAA 3WGTA 1H5UA 3FF1A 3TX6A 1C8VB 1NF9A 4DEXA 4BO2A 4C07A 2E4UA 4RM3A 4ARCA 1YL7A 2ZQZA 4YBZA 1BHSA 1YS9A 1C9JA 3V1NA 1W5FA 3ZCVA 3L04A 6GPBA 1HMYA 2QLMA 1M8KA 1Y1TA 1IAVA 2PT9A 4IP0A 2K7ZA 3KPWA 4FYYA 3VJLA 1E0JA 3C8ZA 3OAAA 2PXXA 4IJUA 1Y8CA 1ICIA 3VU1A 4UTXA 1ZA1A 3RSHA 4BNJA 3JZIA 1CQWA 2AF4C 1TKRA 1GUZA 1XU9A 4LNUB 4ZREA 4EQZA 4KITB 5BYAA 2F1HA 4ENPA 4U2FA 2Y6UA 1NAIA 3NW9A 1JHPA 1W581 2VHCA 4MV8A 4TWIA 4YRCA 2Q8QA 5EUBA 2DTEA 3F98A 1TJ4A 3CEHA 1C4OA 2NU8B 2JRCA 3EDOA 1Z7GA 4BLUA 2NNLD 3IT1A 5CB4B 2J30A 4J7CA 2PD4A 4Y9SA 3G2NA 1N5IA 1SBTA 3SX4A 4ATNA 3FTEA 4A0QA 2PT7A 3AMVA 1NXWA 3QEMA 3D8SA 5FULA 1ZWLA 1AKUA 4EZIA 1QZ3A 1SXJC 2ONCA 3I83A 2YY5A 2CD7A 1VIDA 2PGDA 3BZWA 3DPIA 2IK8A 4DQ0A 3EWSA 5D5HA 1XQXA 1Y3FE 1R18A 3TLBA 4P4UA 1BOOA 3A58B 3DBVO 1A71A 3O3MB 4KXNA 5JANA 1UJ6A 2VBFA 5FV4A 4A0HA 4DDHA 2HADA 4HT3B 3P2MA 4NMXB 3OIWA 2JFBA 4KAXA 2KBFA 2HO5A 4UVHA 4J0HA 1FPMA 1SKYE 3D3EA 3HN6A 4TL9A 4UREA 3UMCA 5ITZB 3IA7A 4XYGA 5M5BA 3DLHA 4FT4A 1GO2A 1TD1A 2AYYA 4FGSA 4C3ZA 3GR6A 3B13B 2H92A 2OUIA 3Q10A 1JIVA 3MTBA 4U9HS 4BO0A 5ALMA 3OO1A 4L0DA 2YY7A 3LUHA 4M9SA 4JQZA 1M1YB 2FW0A 2M32A 2JW5A 4EZBA 4F6RB 5LXTF 5BQFA 2IEBA 3A0RB 1SCNE 2OCBA 3ESCA 4G1CA 2XYQA 5FI5A 4ZZ1A 1QPBA 3IVXA 1SQSA 3BIJA 2WNIA 2GEDA 2FAXA 2VNKA 4JB8A 2FSIA 5K3CA 4BJ6A 1PSZA 1BXRA 2QUIA 4TVBA 4MHOA 3ZH9B 3GMTA 2EIXA 5KSZA 1VGRA 3FYHA 1IU9A 1GAQA 3UB2A 5LA6B 1EXNA 4UHJA 2XMBA 3W8EA 2WHQA 4A8PA 3AGQA 4C4TA 2YZKA 4U2BA 2OY0A 5C7OO 5GOZA 3G82C 3HQ4O 5IM5A 1NIPA 5DYNA 3TNFA 3F47A 5C3MA 1XR3A 1FS5A 2Y4NA 1RYYA 1JWBB 3PNSA 4QWMA 5EI5A 2QVBA 4B2LA 2V03A 1UBRS 1RRPA 3T9DA 5IN4A 3CGGA 2EQBA 4RJ2A 1YQUA 3CCCA 1U2ZA 1GQFA 2C7VA 2EZTA 5G2OA 1ZU4A 1EINA 2V7TA 5FNVF 4GMKA 4MIOA 3C5VA 4AQYB 4RQBA 5HFAA 2VHYA 1T4CA 2X7XA 4LYYA 4A9AA 5IF3A 5IT0A 4LOKA 2VTEA 5F73A 1Y1QA 2FF7A 2PVCA 3QF4A 3DZ8A 3WQBA 1SUFA 1ZMRA 3P94A 5ENVA 4E4RA 2WOOA 4DA0A 1Q0TA 4MJLA 3M1IA 4C78A 1ISIA 1IYZA 1VCIA 3QV2A 7AT1A 1NW8A 2XT0A 1D1QA 1U3TA 3CF0A 1I3KA 1BMTA 3LBIA 1Z2PX 5E1MA 5G3ZA 3RYIB 4CMKA 1Z4QA 4NE9A 1E9SA 4P98A 2H2HA 1E5LA 3PUVA 2O3TA 2YQ5A 2WMYA 2W8ZA 3L8FA 5BMVF 1K2WA 4M46A 5F3WB 1FP4B 1OW3B 2RKBA 3PFGA 3RTBA 4HDQB 3UUEA 3ND9A 2W00A 5LP6B 3WRXA 3WE7A 4M98A 1MIOB 3AF4A 4US0R 1BFKA 3JVDA 2RGNA 3L7CA 4BLPA 4B75A 1LK5A 1T5BA 3E5RA 4L51A 5K0GA 2P3LA 3RK0A 3WYAA 3HCNA 4JKYA 3OQMA 3F6PA 2IS1A 1QGOA 1NYRA 3FYSA 3NYWA 5A02A 3EG9B 2GPSA 3RVRA 4W5OA 2LCFA 4DQLA 1YB7A 5FH9A 4ADSG 2IBTA 3N0XA 3U7RA 4HC4A 2XXAB 1ZVVA 3N76A 4YIHA 7MHTA 3DWFA 1CIJA 2R8YA 1P1FA 3H99A 2YMQA 4O0LA 1M72A 2DH5A 3RRYA 3FJ1A 2H65A 4J16C 3TSOA 2PKWA 4UJ5A 1U2TA 3ZTTA 4NBVA 1RXCA 2IWRA 3NTUA 1XXLA 1ZEJA 1H4VB 4Z51A 5IJ0A 5IZ4A 1VL1A 2HPVA 4QBIA 4NU6A 4C01A 3K70C 4D9HA 3NGXA 2DFDA 2IPNA 1YRAA 3W4IA 4UMVA 2B4KA 3LUFA 4LGYA 1Z7YA 3E6AA 4GOLD 4U6QA 2X14A 1EHCA 2PZKA 2YMPA 4HQNA 2QTRA 4PW0A 4GDFA 3E3MA 1OAAA 4MLCA 5DPMA 3E23A 4ZVNA 1IHYA 2I55A 1L8QA 3O84A 4XA8A 5F21A 4F96A 5L4SA 3T1HB 1URPA 1Z0ZA 4NCHA 1UBNA 4UU8A 2KPOA 2AWNA 2ID9A 3UT6A 2UZ4A 1E6CA 5F9MA 3S5JA 1C5KA 1EGVB 2IF0A 3K6RA 3K92A 4L57A 1AGPA 4YO8A 2P2GA 2X9LA 4H1VA 5K8JB 2D7DA 4BUZA 5DLPA 1L5LA 1YRYE 2F9LA 4HDRA 1BX0A 1PZGA 1YKGA 5KTPA 2CDBA 3ENNA 4P22A 4LQDA 2HSZA 3CWQA 4KXFB 4EH1A 3G5AA 2JI9A 4CMAA 3QTLA 2O07A 3RVNA 2MYNA 4B6RA 1BVHA 1YVEI 2HTEA 1R1DA 3L8GA 5JNWA 2WP8J 3OFJA 4AS1A 1DKQA 1GZ6A 5IDXA 4F8YA 3U16A 3F2VA 3ZK9A 5MFZA 3KSAC 3IH5A 2WJ6A 3I12A 4AQDA 3ZHCA 4M22A 1P2VA 3RKUA 2ZI9A 3CRQA 3AL3A 4EFLA 2CL0X 3PCTA 2A58A 2L69A 4FHFA 4NG5A 5C4IA 3LUJA 2AX4A 2XGOA 2AWOA 3G79A 1KI6B 4XGRA 1PYGA 3EQ6A 4NQRA 4WCVA 2UDPA 2PUHA 1E98A 3HBNA 4TOIA 2QSJA 4MR8B 1CUIA 3EPHA 4XWYA 9GPBA 3SU8A 4J1SA 2GAIA 4BQQA 4LUCA 5LP6F 1NUAA 1VQ1A 5CX1A 1SO8A 3GQVA 4WFKA 3ISJA 4KK4A 4FDAA 4I9GA 1D9XA 4N03A 4Q00A 1JEQA 1L5SA 1KP3A 3KLOA 1QQ7A 4RZXA 2GYVA 5JSFA 3W5SA 4BV3A 5K6TA 4ZI7B 5CCEA 2P7HA 3A7EA 1AKRA 5JY6A 4HLUC 5BPFA 3JQFC 5ILGA 1K3TA 1U2DC 3WIOA 4CUJA 1NMQA 1N6PA 1SWVA 1E2PA 3GRRA 3KDPA 3S8MA 2RDMA 4HTFA 4KU4A 3MCVA 1BA3A 5ICFA 5CIQA 1XTUA 1W75A 1JE1A 2WAXA 3HCFA 3SI7A 4OH1A 2V6GA 1LJLA 1A4RA 2W4MA 3AHDA 1EK0A 3QE9Y 1LF0A 2J6BA 3TIVA 2I7CA 2JJ1D 3T7AA 2GN0A 2HL6A 3HDTA 1U3VA 2ZB3A 1WHTA 1M0EA 1DFGA 2GJ4A 2PZBA 3LG2A 5A5EA 5IWAB 4OXRA 4ND5A 2WKPA 4BBZA 1K6EA 2GN4A 4EFNA 2XVZA 3TPFA 2AIRA 3FDZA 3ZUPA 2Q49A 2YVKA 3DVLA 5E38A 5IAJA 3UATA 2BFOA 3EAQA 3MWFA 5DMXA 2HA6A 3JTEA 4ACAA 3MSXA 5BMVB 2YCBA 3MWDB 4TRRA 3MF4A 4H1TA 2OBLA 5CTAA 4DMKA 4DLYA 3HVJA 3OJXA 2Q9CA 4HQ6A 4HVTA 3IA2A 3K09A 4NOMA 1ULZA 1N2EA 1OYVA 4FKMA 2Z2KA 3DE0X 4YQYA 3ZHBA 2VWHA 4MYUA 4YONB 2ZRGA 3LC0A 3WBKA 3OF2A 1FSFA 4RVNA 3X1JA 3QNMA 4L8FA 1GN9A 4DTIA 3CVWA 2R8OA 4B3CA 4AKTA 4R2XA 4S2EA 4NLLA 1EDZA 1U8FO 3FWYA 1KYZA 3KBOA 3L0PA 4KYTA 4OI1A 3W3ZB 4C7VA 3KYDA 1NNLA 3SZRA 4RTRA 5FUVA 3T3EA 1ESZA 4ZIRA 4URUR 2RHLA 1F9AA 4LDPA 2XMPA 3H1BA 2BKUA 1ZNYA 5LOVB 3VZBA 4PYJA 2DPHA 4IFBA 5ALKA 2Y0CA 3FIUA 3QVGA 3UMBA 2O2IA 2VQDA 4EL5A 2B99A 4QTXA 5AHOA 2PH3A 1D6NA 4FZ3A 5HJ2A 1T6BY 1SCKA 1DUIA 4W5JA 4WV3A 5LYYA 1XDSA 2ZBQA 3T0GA 2B1JA 1YT5A 3K0KA 4LYAA 3TUZC 1Z6QA 2QAGA 3Q0TA 3N2LA 4RY0A 5AW6A 2QVLA 3ER6A 5ALYA 3FA2A 3WQSB 4I8XA 1RWBA 5DM4A 4AUEA 2PUTA 5HKBA 1JSLA 2XVYA 3TLGB 2ARKA 1NV8A 1RYEA 2XSZD 3QHPA 2XNHA 4HS9A 3ODGA 3TTSA 3UAGA 3UH1A 4ZI7F 3NH9A 3OMLA 2ZYGA 2ZROA 4RA6A 2BP7A 3IUEA 4F3CA 5AUNB 5KB3A 4B44A 1G21B 1SRQA 2CXNA 3FG9A 3LPAA 3ODPA 3PXAA 4H7EA 4YMHA 3EGWA 5J4LA 3SJAA 3IEMA 3PPXA 2X5KO 2JHAA 4K87A 1J0DA 1C80A 1U0OC 1V96A 1L4EA 4MPTA 3M70A 4NRDA 3EXIB 3STWA 4GI2A 3NHWA 4X00A 4XWGA 3PCXA 2XQJA 4TXNA 1TU4A 4A8JC 4YMTA 4BP9A 3LSTA 3SPXA 1H9BA 1L1QA 1ORTA 2Y1LA 3D4LA 2WFAA 3ET5A 2FDXA 3LYAA 3NASA 1YZLA 1QSGA 2J6IA 2W6OA 2XLBA 3OETA 4QQKA 4JHXA 4V2IA 5B1HA 4BWFB 3AKEA 3K5HA 4UDXX 2GILA 4PYNA 3RC7A 3ZZ0A 3FKSD 1Y5NA 2O7SA 5EIBD 3MNFA 5DGIA 3MT7A 3TLCA 4EB6A 2FQWA 5F1KA 1EKXA 3PJFA 5K0NA 3GJRA 2ZIZA 4V02A 4F21A 4FN5A 4WADA 5KDOA 4D3ZA 1QGUB 4ME6A 5JHGB 4XQGA 4OXXA 3EJWA 4AB1A 2NQTA 4DMRA 2COKA 5C5DA 2QRMA 4IKPA 4QC2A 2OCAA 3GH1A 4PWYA 4PYLA 4MGHA 4XDYA 4XR4A 2AZ4A 3UFXA 4HNUA 1P6UA 2HUPA 4PLCA 3ZE9A 4CIYA 5EE5B 2R6AA 4MINA 2C92A 3G6KA 3G7SA 5LB2A 1W5TA 3DTVD 1OREA 3M6WA 5IH3A 3JD0A 3ZYZA 1SIBE 3KHUA 4L95C 2FK8A 1CVRA 4IQ4A 1ZD2P 4P0QB 4I2NA 2IW3A 1QH1B 1Z34A 3OPYB 4OBBA 4DR6B 3B85A 1KSFX 1Z22A 4TMTA 4FYHA 5G3YA 4GOMD 1E18A 7ADHA 5JTUA 3FZEA 4NWIA 4RX1A 1FX0A 5LOVF 4QQFA 1CR1A 4MB2A 4UFOA 1WP9A 1YJAA 2Q2VA 3FPKA 5IJAA 1ADFA 3BJMA 5C0OE 1MC4A 4OFZA 2RH9B 3SY8A 1XZGA 1XXHE 1PIWA 2P9GA 1JHQA 4IVNA 2BTOA 2G70A 5A0VA 4B7AA 4P3XA 3AQ4A 4ZO9A 5ALLA 1ZXXA 2ZWPA 4Q1VA 1GYRA 2FN7A 3QITA 4B4KA 3UVEA 4A0SA 3R6WA 4ZZIA 5L3QA 2OHHA 2JHPA 3UMMA 4RV4A 3ZNQA 4DA9A 3QKRB 4X54A 1FTSA 5G1PA 3R5TA 2NO0A 2UVQA 3W7BA 2PMKA 3NDPA 1EQ2A 1ISSA 1ORRA 1SXIA 5A5FA 1GAWA 1N8KA 1WZNA 2P5SA 4J1NA 1C2YA 1TK2A 1D5WA 1F3LA 1P2DA 1VCNA 3HBAA 3Q9UA 1H8HA 1MX9A 2DE0X 2Q7XA 4W5WA 3U17A 1M5UA 3K96A 2F1IA 3CR7A 4E5SA 1UAYA 2VSOA 2YH2A 1IOWA 5CVEA 1OGIA 5JRDS 2KM1A 3CLRD 1OFGA 4WT7A 3D7RA 4XRGA 1R37A 2VUUA 3R0JA 3FWNA 5C52B 1J2UA 4CQLB 3DAFA 4BASA 1DBVO 1Q6YA 3E18A 2YFKA 2HT1A 2IIQA 1PZNA 2B36A 2EZ8A 3DW1X 2YYZA 2P91A 1BCSA 1GUDA 4LWQA 4C4OA 1C4XA 1DJMA 1VMIA 3BQMB 3HKCB 2RK4A 5EMLA 1P72A 1GGEA 1NVWQ 2A0UA 5FFMA 1KI7A 4K26A 3RV4A 1F4LA 3OEED 3TS1A 2P6PA 1OY1A 3I1YA 3KE8A 1L5ZA 5GMOA 3FTPA 3UUGA 4ZMBA 5BVGA 4HR7A 4PLZA 4D9FA 3V6MA 2PJDA 2WSSD 5DBHX 2XUOA 3ASZA 3GUZA 3MWLA 4GOXA 1CJUC 4E30A 3GT0A 4A1OA 3BA6A 4RVOA 3D4NA 1QC5A 5J1TB 1SOAA 1U6JA 2Q0QA 2Y99A 1OLXB 3EHDA 4QUAA 4WN9A 4WPGA 3SZLA 2OD9A 2FW9A 3TVYA 1GUBA 1EB9A 4N4AA 1LBQA 5CT6A 3T3NA 2IHUA 4M2LA 1WMFA 1FFAA 1WBBA 2X5XA 4CODB 3B3FA 1EXWA 4M49A 1ZH2A 1GRRA 2O6LA 2ZXEA 1PFUA 2C84A 2C99A 2PFKA 2ZFUA 3TKYA 3WY9A 4F11A 1WCWA 3NETA 3C5CA 1B6TA 1I33A 2A7XA 2R4QA 2IXEA 3DOOA 4JSYA 2BBOA 3ERCA 1TZMA 1PEKE 2ZQYA 2CJPA 3IEKA 3NUZA 3HCAA 4K9NA 4ESEA 1DC7A 5C80A 2ET6A 3GJ0A 4JBIA 1Y9AA 4HGQA 1MABA 3P19A 4Q4DA 4D8XA 3R7WB 5CA0F 5AUOB 4XM2A 3RYTC 3H5RA 3U3KA 4DCGA 4HP8A 5AK4A 3TBHA 2POQX 1VI6A 3L6OO 2P79A 4OLBA 1Q22A 1OJLA 1FXUA 2X8AA 3SOZA 2WNSA 1I7NA 2Z8ZA 3IQZA 1PQYA 4MI1A 3T95A 4AKEA 5DNUA 2FWAA 4HAYA 1U8EA 1TC2A 4OBWA 1M33A 1ULTA 4LXHA 2VN8A 3VR1A 3GC6A 3IFSA 2BEVA 3IUMA 5KYNA 1VG9B 3QW4B 4M89A 2RGYA 4EMTA 1G17A 1QFXA 1ZUIA 1XRQA 2C82A 3QIVA 2XCTB 2ASVA 1EUDA 2VLBA 4YLEA 3ANYB 3KEFA 4B9AA 4EO7A 2J3HA 1O6GA 4YGYA 2NZ2A 4LXQA 1EGMB 1O96B 2ECQA 3DUFB 3O21A 2EFGA 2H00A 3BE5A 4H3VA 4RD1A 4EJSA 2N1MA 5JDCA 3AEQA 1G7CA 2XKKA 13PKA 1QYVA 4JBWA 2WU4A 1WMEA 1TECE 2BFEA 2J1LA 4KLRA 1UMCA 5KYYA 4ZQCB 1CZOA 1BDJA 1IXSB 1GIAA 1EEHA 1MDFA 2FSFA 3P32A 4RHXA 1QH0A 3T3HA 3HJBA 4E5NA 1WETA 1FMFA 1LI4A 1MNAA 1UOQA 2FMTA 2OHGA 2D5BA 4JUAA 3VR6A 5EIXA 3M4XA 5GOTA 3R6GA 4OX9Y 5HCNA 1TZBA 2V0NA 1NBME 2HCJB 2O8DA 4B7UA 4TTAA 3SCZA 2OXRA 2YCLA 3G2QA 3WLJA 5IUJC 4GYJA 3STTA 2XW6A 1WB9A 5BN3B 1G8PA 2QN3A 2UVDA 4UASA 3RTEA 4X60A 2P5YA 2R2AA 1PFVA 2CHQA 3DKKA 3DV0B 1GT91 2PRYA 2W6MA 5EUQB 3LY5A 2HSWA 4DQXA 1Y63A 3JD4A 3MWEB 3U6KA 3THXB 4GR5A 4TPKA 3L8EA 2J33A 4UMDA 1QIKA 4H17A 4DMHA 2XV1A 2OBBA 4UBOA 4W8HA 3M5DA 1OZAA 4BXOA 5FFNA 5KQMA 3OPQA 4AZ3B 4CF6A 1EXDA 2H4JA 1OV4A 4C87A 1CUGA 1YMUA 1ADYA 1SU8A 3AUTA 1XLWA 4LX8A 1E6MA 3E7WA 3ORSA 2X4IA 4KI7A 4Q3CA 3UTDA 4D3DA 3P97A 5DMHA 1B26A 1HORA 2H2GA 4QVIA 2X5NA 2Q6IA 1KE2A 1YULA 4KXVA 3RJ5A 2JKYA 1M6EX 2ZVPX 4OL9A 2YXPX 2R62A 1G9XA 1UKBA 1CLEA 1D8TA 2WAAA 3IIJA 3QVKA 5TMDA 4E46A 5K8LA 4C03A 3BMQB 4GXNA 3HFGA 3GRKA 4G0YA 1BJRE 1Q1AA 1DLIA 4AWAA 1CEQA 2HNKA 2O8FA 2CMFA 2F9MA 5BORA 3NRBA 1QHFA 4UHCA 4BLTA 3FVWA 2EW2A 3O82A 4EA9A 3F7NA 3E9CA 3LIIA 1TGYA 3IPXA 5HKAA 2K87A 1VHDA 5HRAA 1XHFA 2ZS7A 2OFWA 4KH0A 2ANBA 2XDQB 1QS0B 2JCVA 4AKHA 1UAGA 1GNTA 4BNWA 1DKRA 4LJ8A 1R27A 1RU3A 1H6CA 2IZ5A 2I2BA 2JJMA 2X8BA 3FJOA 4JOCA 3ZWPA 4FFWA 4UMEA 5BWOA 5DNCA 2A0KA 1BAPA 1VSBA 1Q16A 1UBHS 3KHKA 4DB2A 1CW2B 3G85A 5ALQA 2C95A 221PA 3GLGB 3NQ41 3VHLB 1NJ6A 2HMYB 2YV3A 3CZQA 4D98A 3TRIA 1H6BA 2JJ1A 3V2GA 2A9JA 2I4TA 3JWPA 5ILQA 6CHYA 2OO5A 4BNDB 4FYIA 4DMUB 2BGNA 2QL6A 1ODTC 4OK6A 1SXJE 4JLPA 2H6EA 3UYKA 4N3CA 3I23A 2E21A 4MYSA 2LDXA 3FLAA 3GOQA 5FOSA 4TZ0A 2ZT8A 4UNIA 5AI6A 3WWPA 5HIMA 2I22A 3LWNA 4RSMA 3AUXA 3K71B 1KKMA 2A94A 3I8XA 2AOWA 5DYIA 5F9HA 1VIVA 4CKBB 3L06A 1WIWA 1XRSB 1ZINA 2E48A 1CUWA 2ZBEA 3P2JA 1G6HA 1OKKA 3DV9A 4HTAA 1JDUA 4U2DA 3AEZA 1LB1B 4F84A 1NOJA 1W6UA 1OXSC 2YHBA 4ZDIA 4WI1A 5FOWA 4JEMA 5IWCA 2R8EA 4EGQA 2B61A 2BFBB 1F0PA 3CLSD 4QTYA 5EQTA 3L8DA 2AFIE 4QEZA 4DJAA 4N12A 5CA0B 1H8ED 3NOQA 4FP9A 1BW9A 2ISSD 2O3UA 4B33A 4KEAA 4DLRA 2XUJA 4EY3A 5HM6A 4K86A 3S55A 2VYNA 2MYPA 1OYWA 2D1TA 4I2VA 2HBRA 1EFKA 5A4AA 2BF4A 5HCIA 2H5JA 3PQ8A 1LQ2A 4WZBE 1GGMA 4FJ0A 4KFCA 1KK1A 1CY8A 1N0WA 3PGA1 1AKWA 5CXSA 5LZ2A 4G09A 3CFYA 1G1AA 3KLPX 5CT5A 4BVFA 5GVRA 3X1YA 4D4IA 4PQFA 3FI9A 2A88A 4MCIA 4MW0A 5DXAA 3AJDA 4XYMA 1C2TA 5LZ9A 1VZ2A 4JLOA 4DDUA 3HK2A 1OLSB 3GIDA 1JIUA 1OPRA 3GVCA 1T6ZA 4X6YA 2GETA 1ZR2A 4EUEA 3FI0A 5JXGA 2LKCA 4FIZA 4EKIA 1M1ZA 1KI9A 2WR8A 1A97A 3JQ8B 4MEJA 3GGPA 1QE3A 4URYR 1PUIA 1R6XA 1OBHA 2XSZA 2P0EA 2XIQA 4CCYA 3EEFA 3MQFA 2DKOA 3K9CA 3OP4A 3NNDA 4WINA 1OAOC 1MF7A 5HF9A 4TKVA 3CR8A 1EJBA 3JQ7B 3KPUA 5EJEA 3QKSB 1RC8A 4RPCA 1KS9A 3F74A 1NN1A 2VSFA 3B6JA 2FETA 3P9KA 4QRHA 2VP9A 1A9XA 1RHRA 2JB9A 5DXJA 5FPTA 1I80A 3DEZA 4MQEA 2PWPA 3PJEA 4CF4A 3D1JA 2D2XA 4C2TA 3C39A 1QDUA 1W29A 2SKDA 3DBLA 3H1FA 3P2KA 3R3UA 2CJYA 1XVVA 2X3UA 3EQ2A 4ZPJA 2QA5A 3ZV3A 3MTDA 4X6UA 2PKQO 1Y37A 1JSCA 1KMCA 1F0NA 3WGMA 4CLHA 2F8MA 2IGTA 4XVRA 4G37A 4D42A 2ZVQX 2WF7A 5BW5A 3IESA 4CMGA 2HO4A 5B1EA 4YJGA 1X80B 1LLQA 5LLSA 2UYYA 1CSEE 3FMFA 2CNBA 5AXCA 2GI4A 2I3GA 5EIWA 1TDJA 5U9CA 5I45A 1QYRA 2FPIA 3FKSA 3BWBA 2VHTA 3TW8A 1Y7PA 4FEYA 3ME5A 4ZMRA 1KEZA 1HKHA 1W2WB 5HSGA 2C2MA 2WWRA 4UUMA 1WXFA 2J3KA 3RIEA 1WDKA 2A1TS 3GRCA 3N2EA 3KB6A 4TYNA 2WQZA 1QXSA 2XCLA 3IQXA 2O3QA 2YASA 4PEVA 4BV8A 3W06A 2G1AA 3IJEB 1CCWA 1E9DA 2VEDA 1TVKB 1H0KA 3H1TA 3OTQA 5HK8A 3RT7A 3V7NA 5L6LB 3F6SA 1ZVKA 1WU8A 2AMYA 2W2NA 2QIPA 1T9AA 3H04A 4NENB 1L8OA 4POAA 1UEIA 1OE0A 2NX2A 4J6EA 1UEXC 2IV2X 3WAKA 1Q83A 3UCEA 3SLKA 5HP4A 3FVRA 5I7HA 1GTSA 2GASA 1JE0A 4KB5A 1Z0UA 2HU2A 1WE2A 3AETB 4HDKB 1Z7WA 1F5NA 3LQ2A 2G09A 3O75A 4FE7A 3H9QA 4IUCS 4X85A 3OQ6A 4H4EA 2RARA 1KSGA 3UV3A 5I01A 5KZMB 2ECKA 2QM3A 5DHRA 4EMUA 3SZUA 1RFLA 1N1GA 1A50B 1D4OA 1HLDA 3FJYA 4LTNA 4UE6A 3WMEA 4EKGA 2ZJOA 3VO9A 4KREA 3IKTA 1K4KA 3CUTA 1L8LA 1QMPA 3H2BA 4UARA 3FCSB 1ETHA 1QG6A 4IQFA 2B6NA 4P2GA 5ELMA 4B7XA 5FADA 3JALB 3QPBA 4BMXA 1KSJA 3TZCA 2FPUA 4N9WA 4A10A 1W0JD 2DVMA 1F2TA 2SBTA 1RZ3A 3KAPA 4US1R 4GQIA 2FZWA 5DLEA 4EG5A 2X2OA 1EP2B 2XH8A 2Z58A 4HEHA 1LZLA 1U0JA 1NE2A 1YHYA 1NT2A 2P8SA 3NEJA 4HZUB 1Z88A 1OCEA 4N8SA 3U56A 1EX9A 3PQEA 1F3OA 4OXYA 1CG6A 3AB7A 4DAOA 3IE1A 2BGKA 5K8IA 3C6XA 4FHDA 2YN4A 1PQUA 5C81A 5JS8A 3WGKA 3W6UA 4CJXA 4BVLA 4RY2A 1Q7GA 1UF9A 2RHJA 1OR8A 3KQKA 3ZG6A 3RUPA 1YB4A 4ZKEA 2XQIA 4PBSA 1FFHA 5HQTA 1CY4A 2X5OA 1E9RA 2W42A 4RBNA 4IHAA 1SR8A 2MT9A 3N7TA 3V4SA 2OORA 3IMKA 3ZU4A 1IAQA 4ZO7A 4KFSA 1IJFA 1JXQA 1UBEA 3PIDA 3D43A 3OEEA 4CI9A 4IMIB 4YMVA 3RHZA 2CZGA 4UEJA 2DJIA 3KR0A 5E6RA 2P9CA 3QSYA 4RA9A 4FSDA 5F7XA 3FPCA 2QW0X 1RPJA 4ZK6A 2WSSA 1RE0A 3R4VA 5D3ZA 1LX6A 4DCOA 1G3QA 1SC6A 3OM0A 3L4BC 4X8HA 4CYMA 2C59A 4JC0A 1YH3A 2Z5LA 1JLKA 3B3AA 1UC5B 1ODKA 3LM8A 3MJRA 3HBLA 3BB4A 3IAM6 1CQIB 4FDVA 1X2EA 3THOA 3JZAA 1GDTA 2XITA 4Y2VA 4H77A 2XGSA 1VKHA 3UPDA 4B0PA 3NIGB 4G0UA 3ZCXA 5I4BA 5JUWA 1VRCA 1Y8RB 5CNJA 3RC9A 3FBTA 2LNDA 3RLIA 3VR2A 3U44B 3GAZA 5C8YA 1WM1A 2JNWA 2B21A 2QG6A 3EGDA 3TDKA 3A11A 3ABZA 2KX7A 2YVQA 1GR0A 4F5EA 2Q0SA 1IQ0A 2J08A 3CF6R 4JI2B 2O5EA 4M1QA 5I9TA 2HA5A 1AV6A 2PXAA 1BS1A 2V9ZA 4YAOA 1PK7A 1EK6A 5ABPA 5EP2A 5J4VA 4HDSB 2YV4A 2HI0A 3ETCA 5AKYA 3HTXA 3IKLA 2MSNA 3JVVA 3QWAA 1T8TA 1NMYA 2ATIA 1FQWA 2EEZA 3JU3A 4O2BB 4ZVUA 5IBCA 1X7DA 3K05A 3PQ7A 1X9IA 4ND4A 5KDDA 1FU7A 1A69A 1BQEA 1MNQA 1LBIA 1NY6A 1KYYA 1L7RA 1K4MA 2JFFA 2JGDA 2XKAA 1WCYA 2H54A 5DIZA 4TSRA 1ZIPA 4LE2A 3EWIA 3JASB 5DNVA 2QMQA 5BQ5A 3MGCA 3ZVNA 3HN2A 1E5TA 4FLMA 4NV1A 3SR0A 4B6JA 1SNYA 4ZHQA 2EW1A 2RHHA 3QWIA 3EISA 1V39A 4WLOA 3UXMA 2ISCA 1FVFA 2VA8A 3MRSA 3S40A 2YOFA 3VC1A 4CGYA 5IYZF 3TPCA 4AY2A 3LL7A 1WEKA 3M6IA 5JY1A 4OGWA 4LMRA 2WF9A 2BM8A 4YEDA 4G4IA 2ZE8A 2ZIXB 1OI2A 2Z0MA 1Z5UA 2D3TA 4XGQA 4YT5A 3TMYA 3A0UA 4IGFA 4JL6A 2GF0A 1IBRA 4UKDA 2ACKA 1EDBA 4KRXA 3X43A 4RULA 3K70D 1Z4NA 3KAQA 3G8DA 1N5KA 1KSHA 3KKQA 4DAEA 1MOZA 1JX6A 1PJ2A 1AMOA 1UCFA 1LVUA 2HWWA 2AI1A 4K0KB 4OD0A 5AJUA 1UC8A 1RBZA 4TV8B 4DHWA 3IULA 5BVHA 1VHWA 1XXHA 4ZGGA 5LFAA 2J3DA 2XMQA 4IGAA 2XE7A 3CX7A 1R8YA 1LNZA 1LXCA 1QVZA 1TM1E 2IU3A 2ZR0A 3GQBA 4HAVA 3SIXA 2WHRA 1A82A 4PTYA 3LQYA 5GONA 2EP5A 2G9RA 1E3LA 4NV3A 3ZHQA 1M6VA 2FUG1 1ZIXA 3GLFB 2OCKA 4J2OA 4CIDA 1NAHA 3LE8A 1O08A 5KWEA 2IE0A 4EA8A 4IJ6A 2PNJA 3TO5A 1AK1A 4GPEA 4W7IA 1PNOA 5CH8A 3ZU3A 5ADUS 1BDIA 4KR2A 2V65A 5DHPA 1WULS 1NR5A 4Q3EA 4V1CI 5IHXA 1BEUB 1IQRA 4O5OA 1GNRA 4RMJA 4GM0A 5AUPB 1L4LA 3IELA 3ORQA 4Q5IA 3CZMA 3FIJA 1I6KA 1GHTA 1E1CA 4RU1A 4RSRA 3H3JA 5F98A 5K3BA 5JASA 4E22A 1PTJC 2ZUUA 3RVJA 1KQGA 1R0XA 4NK5A 2OBXA 3VYTB 2BCGY 3LJKA 4RQUA 2CXRA 2A86A 2WUEA 2JGMA 4N6OA 4UVIA 4JN6B 1D2AA 3INGA 2CNNA 2DUWA 1DLJA 3EMDA 3Q41A 4TSFA 3X1KA 1P2UA 2HMVA 2YKGA 4XCVA 4ALIA 4KIJA 1ITZA 4LX0A 3FZNA 4O2BF 4ARSA 4CKZA 1UAAA 1LS1A 1TU3A 2WHPB 1THZA 1NSYA 4HQKA 1UK7A 3DKIA 3MBKA 4UMFA 1NJFA 1RBQA 5LYJA 1WF6A 1PV2A 1JFLA 1M7GA 1PZEA 3TL6A 1GZ5A 1AS0A 1KXZA 3LZ6A 2P9EA 4TKZA 3PXEA 1A5BB 4K1LA 5C35A 5BWMA 1A9OA 3NKLA 3R41A 4IQ0A 5PGMA 4G3XA 4BO3A 4M99A 4TWAA 3ZWKA 3W1EA 3KR1A 3HNPA 1CY7A 1ZSYA 3G5UA 2XD9A 4EG0A 1BYUA 1L5VA 1E0KA 3JAKA 4DANA 3TMKA 5JZ9A 3FTFA 1P4AA 2I4MA 5T8KC 3LBHA 1VBFA 1PEDA 4GQBA 4IV0A 1C9MA 4JFAA 1PT7A 3C48A 3PUIA 1RM0A 1V7QA 4DL9A 8LDHA 3JQBC 1ZVQA 2WD9A 4YS6A 1U31A 3GPDG 2EYQA 1FK8A 4FCTA 4JJKA 2G83A 2X4DA 2X58A 2YN0A 4WA8A 2MDTA 4EATA 1SHZA 1ZISA 3FD8A 1UL1X 1K0FA 4TV8F 1YDGA 4E7OA 4K7JA 1X7YB 5L7YA 5HUJA 3LI2A 5IG2A 4CMIB 2CLCX 1E2UA 1COWA 1CY2A 1QYCA 3O7WA 5CR9A 4L73A 5FBRB 3KJGA 5FR1A 3TD2A 1NU6A 4EB8A 3RREA 1W85B 1X87A 4X61A 3VAYA 2W6CX 3ON5A 1WQ4A 1XMJA 2SCUB 3NTRA 1VCMA 4QEDA 2CL7X 3HSYA 3OJWA 3WBBA 2Q07A 1LQUA 1YK1A 4XD2A 5EKTA 5JS7A 5AI0A 4R8RA 1H8EA 4NE2A 4UXIA 5IMBA 5BR1A 5K3OA 1UR5A 1C7EA 4DLVA 3ONWA 5K01A 8GPBA 1NLZA 1ZP6A 2VK2A 3NTQA 1CFJA 3IHTA 4D0SA 3RSLA 4NTZA 4RF5A 4EA7A 1HDYA 2OGTA 5CD9A 2D0DA 4DLUA 4Y1GA 1L7PA 3UKJA 4XIJA 4CQMB 3C2QA 2AFRA 2AVNA 1TJYA 3I3SR 4P6VF 2Y1XA 1NBMA 2CXTA 1WCXA 3RS4A 3FROA 3BDIA 4YJ2A 1HOTA 1E2EA 1JQEA 5TIIA 4JLBA 2D6FA 2JC3A 4MA0A 1I2MA 1NQUA 4FDTA 3FNQA 5B53A 1V8BA 5HCUA 2JCXA 2GMWA 1T1EA 4TMZA 3PQ3A 3KFLA 4JJ6A 3B78A 1CKEA 1EE2A 4JP5A 3TN7A 1A8QA 4PIMA 3X1XA 2DYKA 1IN4A 3MCUA 1G5TA 4BNLA 3V8MA 2W6JD 1MHTA 1JKJA 4TZ6A 2DJ5A 1MENA 3D6HA 3OCWA 3T7KA 1COZA 4ZK2A 3H8WA 3JRXA 5FPHA 1E7MA 1PLJA 3QVTA 4DSOA 1UKZA 3NM5A 1RKVA 4NBWA 4QASA 3TE6A 4U7HA 1RWPA 3DAPA 4G84A 4LV5B 1K3UB 4UXJA 1UJ4A 2JI8A 2VDRB 1FMCA 3GGCA 4UTNA 1H6DA 2QTVB 3A26A 3QXHA 4AZ0A 3HYSA 4GC9A 3NANA 4LJLA 4TTQA 3ZQKA 2O05A 3WNDA 2BV3A 4BNYA 5KX5A 5HF6A 1NM5C 3SFTA 1F1BA 1AS3A 3KIPA 4XQ0A 1RNLA 1VE1A 4GBMA 3V1TC 3N6XA 5G1NA 4XM1A 3FFBA 3W5BA 2XYHA 2ZJ5A 3ET4A 4AZWA 4QM7A 2PM8A 4MS1B 2J3LA 5ALXA 3I04A 4RPJA 2H06A 1B16A 1J24A 4IZIA 3BPSA 2D2VA 3LT1A 1IY1A 4YK7A 5CVCA 3REQB 2WM2A 3GVPA 3U3OA 2JKZA 4PN7A 2IBSA 3A31A 3SHOA 2JIMA 3MWGA 1QP0A 3T0FA 2P1RA 2JBWA 1PV4A 1TVEA 3T5DA 4YRDA 4M7OA 1X7HA 4W8OA 5F5NA 1QGYA 4OQMA 4P80A 4BVHA 1NFRA 621PA 4P32A 5DFAA 1UXIA 1WAMA 4OMUA 1F8XA 5INTA 3QBJA 2IYUA 1NV9A 2DPLA 2WP0A 2XWPA 2ZBPA 3IEPA 2XUHA 2V8BA 1O57A 4KAAA 4RABA 1E2BA 4YRNA 2B9VA 3VKWA 4EYOA 5KINB 1KAEA 3BJIC 2VKQA 4M0CA 2LUOA 4BECA 2B1QA 4C4AA 4EKNB 1E4EA 2DECA 1HSZA 1SC9A 3GBPA 3SEAA 5FBLB 3UF0A 1M2KA 2C1ZA 1K75A 4YFYA 5J4KA 3QUBA 1FRVA 1M74A 1SXJA 5DWVA 5JXJA 4YRIA 5HM8A 4MW2A 4BIIA 2IITA 1KZ1A 3ANLA 5F1PA 3U7HB 1EDEA 2W90A 2OC9A 1UJCA 4B4DA 2P2YA 2J4DA 1FNBA 3WL8A 4NHOA 4LNAA 5E7IA 4DG8A 2OQIA 2XZPA 2JF0A 1H23A 4M0KA 3T7CA 1EG7A 1DADA 1S3FA 1IULA 4ZU6X 3KFVA 1C0LA 4MV6A 5BYBA 2HCBA 2IP4A 2AMJA 3HZRA 1M0SA 2QJWA 3A3YA 3M4YA 4S2UA 5F35A 1PNTA 1QIFA 2AFIA 1OFIA 4I4NA 1JA0A 5EFOA 3RJ9A 1K06A 1NXPA 1OX6A 1ZIOA 3LQ1A 4G5OA 4KLZA 1ZGGA 4DKXA 2HCRA 1C1YA 1DAPA 5TEWA 2OE2A 2ZJ4A 5LP1A 1RI2A 5JXIA 1ZC3A 1M67A 1XTBA 3B9RA 3EVNA 3FHOA 4UPEA 1ZJWA 1AHIA 4KLCA 2AZXA 4RVGA 3U3MA 1FSSA 4RUKA 2PMEA 5BW4A 3ICVA 1FFXB 4WZBA 5EOVA 2HHHB 10MHA 4GKAA 4ZEXA 4G0MA 5IU6A 5IS2A 4IHJA 5ARDA 3EPPA 4IDBA 4BWGA 4GL2A 2R87A 5I6DA 1E4YA 4MDYA 4GAEA 5L3ZA 1DHRA 3O8DA 2I9KA 4X20B 3KB1A 3IX7A 2QTAA 3JTMA 4HB0A 4KPGA 3NWOA 3GRZA 2J32A 4LJ7A 1J2JA 3O7MA 4UHEA 5JYDA 3N0TA 5AK6A 1JFFA 2D4HA 2GEUA 1SZJG 2GEJA 1RTTA 3LBNA 3PGKA 4OB7A 4ZO8A 4TKUB 4AYWA 4E08A 4CLOA 3ZBUA 4G23A 1DHTA 2B3DA 1EESA 3BTUA 1GXSB 3H4MA 4G8JA 4X3PA 5SYMA 3PFKA 2FWRA 1AKQA 1RXVA 1C9YA 2PU7A 1P4JA 1Q0UA 3LGSA 3QUAA 2WT8A 3WOVA 1ISPA 4DZTA 3IPRA 3OJFA 4L78A 3MINB 5AM5A 1MUUA 4PX9A 5HXAA 5JQWA 5F2OA 1NSTA 1H22A 1VRVA 1JHRA 3NP7A 3UJ7A 5A4KA 3ZWAA 4ID9A 2PUWA 1DC6A 3H9BA 2CE2X 3OQ1A 4L6IA 3ZZTA 1AMUA 2EBFX 3DMRA 3URKA 3UWKA 4DEVA 3JQPA 1FUIA 2VWQA 4KK3A 3VSCA 2C42A 4J0GA 1I32A 2DQ4A 1PX0A 1CR6A 5B1DA 5B30A 3B6KA 3TOXA 4OTZA 1I4WA 3QE4A 5CK5A 3PL5A 5TARA 4ZHSA 1Z3IX 5CLJA 1B0ZA 1JG6A 1PNRA 1CPYA 3TSWA 2ZXUA 1Q0QA 3HDVA 3S99A 5KUTA 2JFGA 2AUMA 3SVLA 1KY3A 4C88A 3DFUA 2KHZA 3K5WA 1KZ6A 4MIKA 1M1XB 3ONEA 1QRDA 4YREA 3RNOA 3T5PA 5EPUA 5CDSA 4UZEA 3QUSA 4CF3A 1KYXA 2ATVA 3IEUA 1TUBA 2J9GA 5FP0A 2GFIA 4QGBA 2CJXA 3LTEA 1TPZA 1UWCA 1TKBA 4QBHA 1LF5A 4JLUA 1RFGE 1WB4A 4O2AB 4PYIA 1IHXA 3E7DA 2WWXA 2ZSUA 2W2TA 4OQFA 4UD6A 4D6YA 1LV7A 4UU0A 3LAWA 4BB9A 4HUQB 1ESNA 1YOVB 4J16A 3ZGLA 2JVJA 4J9UE 1K5GA 5FWDA 3HKEA 3HU5A 4K6OA 4QUIA 2JIZA 3A6KA 5H5JA 3VTAA 5EJ4A 1TEXA 3L7MA 1Z63A 2AKEA 4LYHA 4PNPA 1GG5A 3VR4D 5CEJA 3DONA 4ARZB 2QDXA 2CGEA 3F49S 3ONFA 4F4CA 2PBFA 3WYNA 4OX9B 3AR9A 2CYCA 3QBDA 4JKIA 4WJKB 5ALDA 4D74A 4JNKA 3DQQA 1EJ2A 2B1RA 2A2ZA 4BFXA 3DFKA 2WAOA 1P7VA 1IWOA 3NVAA 3PRHA 4LHEA 3T7SA 2ODEA 2QVXX 4H3SA 4EUNA 2LCIA 2I6UA 1IN8A 2DPYA 3QMPA 1IVNA 1JEYB 1JPVA 5E1DA 2QMYA 4J07A 4DARA 2QQ0A 3U19A 4AX8A 4ESVA 5ALEA 3R7LA 4BNZA 1A7KA 1D1PA 4LIPD 5AVUA 3KXDA 5JARA 1J8QA 2EKLA 1BQ3A 1JJFA 1AURA 4MR9A 4EJFA 1LPMA 2O8CB 2I7DA 3U4IA 5DHTA 4B3IA 4N5HX 1JKXA 1YBFA 2PMDA 2WWVD 3TIIA 1QCCA 4Z2YA 1O1YA 5KPDA 4E2WA 4KOEC 5C5IA 1SUPA 3AZPA 2PN1A 3D02A 4LHZA 3N2GA 3IUSA 4XQ9A 1QDEA 1ENPA 3GLKA 3RSZA 2P2CA 3LHKA 4KV9A 1HEUA 3EARA 3BILA 4TWRA 4L8YA 1OV6A 5CVJA 2OOSA 2QR3A 5LB4A 3U61B 5KS2A 1PEAA 2YQZA 3L0YA 1QU2A 3SF8A 1YVPA 1T9GS 4JHLA 4P4LA 3N2YA 1XD8A 5SY4A 4Q6BA 3A1EA 1EWQA 3UAWA 2H4ZA 2Z5GA 1JMYA 4QQRA 2GLTA 5EUCA 3TINA 2IIBA 4BMYA 4ZMSA 3MGAA 1P75A 2EBUA 4UOQA 3TM4A 4MV7A 4OP3A 2RD2A 4KR9A 1PF7E 1UMDA 3AHIA 3GJ3A 2DAPA 3UFBA 4A1FA 2JS7A 1AGNA 4ZOLB 1ULBA 2HWKA 3GAMA 1UADA 3UQZA 1KMHB 1SBQA 3WKDA 2CCGA 1AD2A 3V1UA 3SEQA 4YAGA 4HAXA 3V4PB 5KYXB 3P9RA 1PBTA 4OHPA 4RETA 4JI0B 3W8DA 3CVVA 4KWEA 1UWVA 2B1IA 4O2AF 2XYGA 1O5OA 1BYIA 1SBNE 4HLUA 1JMVA 5K0CA 1DO8A 3JQFA 1TJNA 4P92A 1Y3AA 3DBRB 1U2DA 4CM8B 3DYIA 2NXCA 4F3RA 1XTZA 4FGUA 4LAFA 5IJ9B 1QNLA 4C7MA 5KOJB 1AQ6A 3CLKA 4LWZA 1H1LB 1JU3A 2GM5A 2W2LA 4DNQA 5C53B 1JDJA 3WHPA 4DEYA 1E3WA 4U5QA 3CEJA 4L5JA 2XD4A 4D9GA 3CH7A 3V80A 2GPAA 2NVUA 2CHGA 1GDDA 4V0LA 2BSAA 4PAQA 2QP4A 5JC1A 1PL8A 2BFWA 2BLLA 2HMSA 4QPZA 3TOVA 3RU3A 2C5SA 2C4TA 2AN4A 3O8QB 1OGYA 1SVIA 2B5OA 4FGZA 1T9BA 4YP5A 3EIFA 3E15A 2PTGA 3FRIA 4I9FA 4CFYA 4DCTA 4RMIA 4F4JA 3AR8A 1F2DA 2Q21A 4LYEA 1K7SN 2P2NA 4JP1A 2HZBA 1PJQA 1Q3TA 1WV1A 1YQWA 3N2ZB 3VU9B 1G291 2QX4A 1GEEA 3I05A 3HLTA 1QO0A 1MQAA 5IT4A 4MW4A 3CX3A 2H7CA 4C7OB 1OFVA 1W49A 2MSWA 2NACA 3PXUA 2CNLA 3R9XB 3U4MA 3K94A 2V58A 3HP1A 3QOFA 1WUYA 4NNPA 4Q02A 1Z35A 1L5OA 2YYSA 1NRWA 4N6GA 3VO2A 2JGJA 4X1KB 4R0MA 1Y4SA 2QENA 2R7LA 3OFND 2V1UA 4PGFA 4I1YA 4IRMA 2FDCA 3USES 4CEJA 3B1FA 1RPZA 3QIAA 4EHJA 2R1TB 4NF2A 2MMGA 1IZ9A 2R8RA 1WR8A 3STXA 3L4KA 2AMVA 1Y6RA 2QUHA 3NDRA 4AULA 5K7SA 1X1AA 1CXZA 3K1YA 4R71A 3OZIA 4BPBA 2WG2A 3HBJA 1EXMA 4ZCPA 3BB1A 3PNQA 2W93A 2BEWB 2CFCA 4P33A 5C5CA 1QO9A 3JWGA 1C0EA 4YUZA 1UDCA 3LCRA 3EDYA 4HEJA 4EABA 2YTZA 3EFOB 2REQA 4X92A 1FP6A 3X2FA 1A5ZA 3ZS9A 3QF7A 2XB2A 4NU5A 2YWRA 4PPYA 5AHWA 3EY9A 1KQOA 1ETUA 1ZOOA 2C04A 3OCYA 4ZVQA 4HVCA 1XTJA 1PG2A 4WEQA 2QE7A 4Q9JA 1E1KA 5DU2A 5JS2A 5AT1A 1XKLA 2MSKA 1DEOA 2R8BA 1V7PC 5A6SB 4ZYUA 4I1VA 2QRQA 1IEWA 2ZSAA 1XK7A 4ZOLF 1JS1X 1CP2A 4AU1A 4CEIA 1JLRA 3M34A 5IBRA 1YGYA 2Y76A 4GIBA 2X15A 3ESQA 4HHEA 3RIXA 3OLZA 1AZTA 1DX6A 2ILVA 4BKOA 3NHBA 2W6JA 1QOPB 2VNAA 3IURA 3KHTA 5DCUA 3T1OA 3WHKA 4CLXA 2JAUA 4UAUA 5SZJA 4UAJA 1RQPA 3R7DA 5KTKA 2E0IA 2UZ3A 4WMLA 5C4GB 3FUVA 5JMPA 4LFAB 4LQ4A 3KYIB 2AC7A 1U0HC 3IIEA 4GECA 4WFIA 2F1KA 5B6JA 2YWGA 2Z4SA 2W98A 1OLUA 4GOOD 4RGYA 1Q3HA 3VHQA 2J7KA 3RT9A 4OUDA 3HB7A 5E9AA 3LFTA 3CV3A 3GA5A 3GWZA 4FYXA 3ZCSA 4K2AA 3UT0A 4A8JA 5A4FS 1PT5A 2QXYA 3GF4A 1Y1SA 2Z5FA 4LDJA 5AHXA 2XMGA 3F5FA 1QHEA 3QMVA 5CT9A 2B9EA 3PXCX 3R3WA 1YUBA 3WI7A 4CPDA 3RAFC 5A3JA 3ONDA 4R1PA 3VOAA 3B89A 3RVDA 1TM2A 1WXQA 1G8AA 2PUJA 2QL9A 3HFRA 4FVTA 2ZUBA 4JD5A 2VRCD 4JYPA 3H75A 5EL0A 3WO0A 2ZSKA 1QE5A 3DE2X 5TY0A 2BMEA 5DSXA 2WVJA 4FUQA 4FT2A 1XF9A 3IJ5A 1HBJA 3NHPA 1ZWKA 4LI0A 4LS3A 1C0IA 5GQSA 3K6SA 4HLQB 1QP8A 1Z9BA 3VZQA 5IANA 4D3SA 3ESYA 2OPBA 2OQRA 4S3MA 5DTQA 4BO7A 3TNLA 3ZJTA 2PUDA 4TLAA 1RW4A 2ZJ2A 4WWHA 2PS9A 4K8RB 3E84A 3BSYA 2DPXA 4ALMA 3HYNA 3OE7A 3WVNA 2IHBA 2P90A 2ZT7A 3V8QA 1SM4A 3DMTC 3IE2A 4X93A 5CW2A