4FILA

Structure of fhud2 from staphylococcus aureus with bound ferrioxamine b
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
256
structure length
256
Chain Sequence
PKRIAVVAPTYAGGLKKLGANIVAVNQQVDQSKVLKDKFKGVTKIGDGDVEKVAKEKPDLIIVYSTDKDIAAYQAVAPTVVVDYNKHKYLEQQEMLGKIVGKEDKVKAWKKDWEETTAKDGKEIKKAIGQDATVSLFDEFDKKLYTYGDNWGRGGEVLYQAFGLKMQPEQQKLTAKAGWAEVKQEEIEKYAGDYIVSTSEGKPTPGYESTNMWKNLKATKEGHIVKVDAGTYWYNDPYTLDFMRKDLKEKLIKAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal and solution structure analysis of FhuD2 from Staphylococcus aureus in multiple unliganded conformations and bound to ferrioxamine-B.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Metal binding protein
molecule keywords Ferric hydroxamate receptor 2
total genus 92
structure length 256
sequence length 256
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4filA02
4FI3F 3PSHA 2PHZA 3NU1A 1N2ZA 3U7QB 4TKUA 4ND8B 4ND8A 3TLKA 3R5TA 5M29A 4TKUB 2PRSA 5CX1A 1QGUA 2XH8A 5JJ5A 2QI9F 2YNMD 2M6KA 1M1NB 1N2CB 2Q8QA 1M1NA 1PSZA 5KOJB 3AESB 1QGUB 5BVGB 3AETB 4FNAA 3MFQA 5JPDA 1K75A 4CL2A 4IRMA 4WESB 5CR9A 4OXRA 4WZBA 2ETVA 1XVLA 3K1AB 1KAHA 4BBPA 1KARA 1G20A 1K7SN 3PDIA 2XDQB 2PS0A 1M1YA 4G09A 3TEFA 3AEUB 5KHLB 3AEQB 3AERB 1FP4A 4MDYA 1FP4B 4MX8A 1QH1A 5M34A 3BE6A 4OXQA 2AFHA 3HJTA 2PS9A 1MIOB 4HMOA 1MIOA 5GGYA 4UTPA 4UTOA 5M2QA 4PM4A 3UJPA 5JG7A 1K2VN 4TKVA 5B58T 5HX7A 1N4AA 1L5HB 3G9QA 3MINB 4HMPA 2WHYA 5BVHB 2OV3A 3AEKB 3EIWA 2WI8A 4INPA 4H59A 2X4LA 3AESA 2XQVA 4HMQA 3ZK7A 4N01A 2OSVA 2MINB 4HN9A 1N2CA 3HH8A 3ZK9A 3MD9A 4FKMA 4WN9B 4PAGA 3EIXA 1G21B 3BE5A 1G21A 2R7AA 4LS3A 2XY4A 1G20B 3AETA 1ESZA 3ZK8A 5KOHB 4MLZA 4XPIB 4WN9A 3K1AA 4FILA 4H0FA 4NNOA 5BVGA 2PS3A 1K0FA 4INOA 4WNAA 3CX3A 4WNAB 4B8YA 3MWGA 1EFDN 1QH8A 2Q8PA 5M3BA 5CX1B 5KOHA 4XPIA 2RG7A 2XUZA 2M6LA 3AEKA 5AFSA 3U7QA 3LI2A 4DBLE 3GI1A 4LJSA 5KOJA 2MINA 4OVKA 5GGXA 4NNPA 2OV1A 4UDNA 3MWFA 3ZKAA 5BVHA 2AFHB 2AFIA 1H1LB 4WZAB 1L5HA 1KAEA 4GICA 4TKVB 4UDOA 3R5SA 2O1EA 1H1LA 4WZAA 3ZTTA 5HDQA 3TNYA 3PDIB 4K3VA 1TOAA 5JOQA 3PSAA 3MINA 1N4DA 1QH1B 1M34A 2OGWA 3AEQA 4MO9A 1M34B 5I4KA 3AERA 2YNMC 2R79A 3AEUA 2AFIB 2XDQA 1M1YB 2XV1A 5FLYA 1QH8B 3LHSA 1PQ4A 4G07A 4WESA 3HXPA 4M7OA 4WZBB
chains in the Genus database with same CATH superfamily
5KQSA 2Z5VA 3EODA 1EFKA 3Q3GE 1XKLA 4IJ6A 4QFCA 4TYPA 3U7QB 2PZBA 2OGZA 1QKKA 5H9VA 3DWGA 3SEAA 2FZVA 2FX2A 5I9BA 1U2EA 3FUCA 4NSNA 3HRKA 2O2HA 5IASA 1DWPA 2YHAA 2CBGA 3NBUA 2CXQA 2FFJA 3K30A 4DJDC 3ZWKA 5H3HA 3T5DA 2X4DA 4OATA 1ZD4A 4IFBA 4IH9A 4DL9A 2JGLA 4ERXA 2C5SA 1YIAA 1GZSA 4LDRA 4M4SA 2Z9DA 2JPDA 3HSYA 4NFSA 1PS8A 4PLCA 4F3TA 1GNSA 4ML3A 3OICA 2UYHA 3OURA 2I6QA 2FR1A 3R3SA 4WXMA 4GOMD 5AWFC 4F72A 1OZ0A 4QHSA 5FUBA 3THOA 5BN4B 2A2ZA 2EX1A 4MVJD 1RKXA 3HCDA 1JMVA 2HQBA 1BJKA 1COZA 2QSYA 5AH0A 2D0OB 2K6GA 3DEKA 3T8YA 3NVMB 3M5CA 4YHBA 3VR2A 4G9EA 2R11A 2CUKA 1XVVA 4RABA 4YUXA 4HPJB 1SC3A 1IBKB 4JFRA 3PD7A 3PWKA 2PVPA 5EMKA 2B9VA 4BKRA 4CLOA 2DG2A 2OC9A 1E64A 1PD0A 1P0CA 3FBTA 3MSXA 3FPBA 1FDOA 1N3LA 2ISCA 2VTVA 2ZAYA 3K5WA 3PZRA 4GMGA 3NT2A 3FYDA 4OI2A 4TV9A 1NT2A 5REQA 1U0BB 5A7FA 1J49A 2QS9A 2QZ4A 3QE3A 2K2QB 1N9GA 3SZ3A 2O3SA 3FLAA 1GVHA 4JVLA 4Q1DA 2DUNA 1L5KA 3D0QA 5ES3A 1MO3A 4IQGA 3WS7A 5C1BA 4Y7CA 3OT5A 3B5IA 2H8GA 2JIBA 1FFYA 1Q7EA 1QV6A 5JRDS 1G9SA 1IB6A 4LHVA 5DKFA 2COKA 3D6TB 5E4TA 4JI2B 1C7JA 1G21B 4ZV9A 4E11A 2QY6A 4P3KA 3QJGA 3C16C 3PEUA 3W8RA 3CBQA 4C4TA 1Z88A 2A3RA 1KI2A 2GA8A 2CF5A 1HEYA 1QH8A 2VHVA 2CHUA 3FTQA 3GT0A 3P0HA 2O5CA 1KVUA 1PR2A 1YE8A 2D5AA 2ZPAA 5E2BA 4EEZA 3FPFA 4K6GA 9GPBA 5GADl 4QBGB 1S4MA 2ZVQX 2YL2A 3CLTC 3DL4A 3I53A 3LD9A 4UVHA 4LJSA 5JSZA 3IP1A 4CDNA 4URYR 1ZUD1 3VHRA 2X2OA 4RA9A 1G3MA 4YRCA 5FL3A 5JWHA 3TCXB 2OCXA 3SLRA 1UQTA 2WAXA 1RT9A 3EXEA 4OO3A 2NPFA 2BH2A 1JDSA 1GFZA 1OR8A 1PX2A 2GA9A 3D3KA 3EHEA 1PLKA 4KRGA 3LNTA 5IHPA 5DMXA 1N32B 5IDWA 1X0XA 2O50A 2C7VA 2WVGA 4JVNA 3NWPA 1IBRA 2XDWA 3ASVA 4O5AA 3C8HA 5HF8A 4JI7B 1LQUA 1YJ5A 4RVSA 4IY1A 2H08A 1U04A 2VYVA 4LYDA 2JFFA 1ZK1A 1I1QB 4GX1A 4IAOA 4EF5A 2OGWA 4B09A 1OFHA 1XLUA 2VRCD 3IB3A 4Y6SA 1QPZA 2IKSA 3Q7EA 4O08A 1KS2A 1KBQA 1YTUA 4KYUA 5BT9A 3DAFA 2IHVA 3NXSA 4PYQA 4KQ6A 4CIVA 1ANKA 2B83A 2QYSA 4OHXA 2WTXA 3INNA 1LPPA 3LJKA 3QKTA 3TLGB 1FMTA 4DY4A 2J5RA 3ELWA 1KJNA 2J7PD 4DQXA 3DNPA 5KNBA 1JQKA 3AXSA 3DFMA 3I61A 2J5XA 3VC7A 4IGEA 5IM4F 2XVZA 1BGXT 3T06B 1QO9A 1MEOA 1W9HA 4JZKA 4MRSA 5K3CA 1OMOA 4MUFA 5DX1A 3OQOA 2OCGA 1U3UA 2BKVA 1DQZA 2IF2A 4QXPA 4QSHA 5HTKA 3U37A 4E07A 4HFNA 1XMOB 5IH7A 1S1MA 1RIFA 1YRWA 4OYLA 3V7UA 1ZVQA 1YXMA 5A4DA 3WMXA 2O8EB 4D8VA 1V41E 3CWZA 2BFNA 2CFIA 3R6LA 3C1OA 3NYWA 3PNMA 3SNKA 3TSZA 5LLDA 2ZRAA 3EMBA 4N3BA 3GLHA 3T1NA 2CJXA 2AZTA 4EGAA 5C1PA 4MVJM 1T9DA 1U7TA 1FCJA 1P3DA 2HA6A 1J00A 1W5FA 4YUYA 5KTRA 1ST2A 1YQUA 2ICAA 4ZOBA 1QQ5A 5KHLB 1V3VA 2GERA 1JKJB 2WP8J 2IHTA 2WYOA 3A1SA 3ZDQA 1U8XX 2EZ9A 5HTOA 4J4HA 1CDZA 1ZJYA 2NG1A 1UK7A 2PL1A 1JKMA 1GKUB 2GEBA 3AY6A 4HMOA 4QT0A 2WJHA 5T3UA 2X9NA 1FY2A 1G5IA 5E9WA 1MCZA 3KAKA 3RS2A 4Z1OA 2PT5A 5LQDA 4UNSA 4NBLA 1QK3A 5JJCA 1B15A 4LOLA 4XXHA 4AN1A 3L0IB 1BQ4A 4PC1A 3AILA 2GKGA 2YZ7A 1TYCA 1UPBA 1JSZA 3DXFA 3H99A 5DCWA 4I9NA 4LAFA 3RO7A 3WWZA 4QFMA 2ODPA 2C9DA 4L6IA 2FU5C 1T4GA 4G85A 3X44A 3THYA 4ZYYA 7REQA 3QFSA 5E8RA 1P4HA 5EVCA 2H4FA 1P4SA 4P1ZA 3ND6A 3DE2X 5BQPA 2ZROA 2ZR0A 3C7DB 2P2SA 3JD2A 2WJGA 4ZPJA 2REBA 1OZGA 1RWPA 2VRBA 4UHEA 5H82A 4UU7A 1WQ1R 1W47A 4BQNA 2P40A 3CX3A 4BMYA 3TGWA 2Q8PA 3EZ9A 1OIWA 1RYMA 3JASB 4TWAA 3JQ7B 3MOGA 1H6AA 2R6GA 3OY7A 3V3TA 3ETEA 1DUIA 2JGMA 1E94E 4UAGA 4Z4FA 3RM3A 3KFXA 5HKLA 3VKGA 4PNPA 4FC6A 5D7BA 5GGXA 3I5UA 4I5EA 4BWVA 4E21A 2XVYA 5CH5A 2Y4OA 2BDUA 4JVOA 1EJBA 4OGGA 1TRKA 1RE0A 1Y63A 2QIPA 3I39X 3O0DA 1L5GB 4WUVA 3SQLA 5BW6B 1V5IA 5D2CA 1MABB 1ZGZA 5CTAA 1S89A 3SF8A 3DG9A 5COBA 3T9BA 2PZAA 3ZHXA 4GIBA 5ICCA 2DR3A 4DN6A 4I5FA 3LHKA 1CVLA 4MVXA 4CG1A 4NX2A 1MC1A 2R8YA 1EK2A 1CUVA 1LQ2A 3KZXA 5L7TA 1XD8A 2WDPA 3I62A 1NDQA 4URHA 1YI8A 2QN7A 5FA5A 1M34A 3IDSA 2KPOA 3SK0A 1HQKA 3QOFA 5C46F 2VJBA 3ASYA 4N1AA 4RXUA 1FSSA 2R79A 4MI9A 4CTOA 5LMZA 4WLFA 3H4MA 4KSYA 1UAYA 1UMKA 3ZNPA 4CDGA 3GNSA 5F7JA 2Y0PA 3BA6A 3KE9A 4E15A 5GJWC 4MA0A 1P73A 3GD7A 3DMNA 3RQIA 3R6GA 3R7LA 4W8OA 3I76A 5I8PA 1GKYA 4CODB 1YR3A 4Y2TA 2QX9A 1L2TA 4XSVA 1HXHA 2HA0A 4IIJB 5FJJA 3T5PA 1N1GA 1RABA 2OFXA 4HXEB 4QUAA 1EBBA 2V1XA 2YJZA 5L9AA 4BGDA 4OK5A 2GCOA 1R9GA 4LOKA 2ZP1A 1W29A 2PYDA 3NM5A 3W9BA 4EM6A 3D7RA 1A2QA 4LCEA 3FM9A 4XFJA 3VJLA 4JQCA 1CJMA 1JSRA 1MTOA 1FNNA 1MB0A 4TSKA 4U8HA 1Z2DA 2PD3A 4IWYA 3TFWA 3UJCA 4YMHA 5IABA 2QTZA 3OZGA 2BKUA 1J9ZA 2J9XB 3RAFC 3KOUA 3ZDZB 4JBHA 4XUGB 4BLTA 1UMDB 3BTSA 1KO1A 4X62B 2XXAA 3PB3A 1COWD 3ISTA 1VBKA 1XCGB 2WU3A 3MBIA 4KPFC 3RSZA 2XT9A 5CG1A 5JD6A 2RGYA 1CG6A 1NNI1 2HO4A 2VOJA 2YIDA 3A9CA 1HWYA 2CCJA 1TEXA 3L06A 2ZJAA 1Y9EA 3C3AA 4LOHA 5KKAA 3ZWOA 3L0SA 2J9GA 2XB9A 3THWB 4GI1A 4Q18A 3GJRA 3RS8A 1J9EA 1BVRA 2G1AA 2IOFK 2Q2QA 3JU3A 4RMIA 4RDXA 1XPRA 1FE8A 2HA7A 3IQIX 4Y9RA 1QPGA 4UEQA 4MKGA 2NNLD 4UTPA 1C7RA 2WWWA 4LJ9A 1QRSA 3R24A 3AF2A 3IXMA 4IHJF 4Q01A 2J3HA 1YZYA 3F47A 1R0RE 2AJLI 1OIXA 3G9QA 4UOZA 3IC5A 3GLUA 5TQ0A 1OH7A 3BE8A 3WP0A 1MT0A 4K9MA 4Q3NA 1Z5WA 2I22A 2X9LA 2WIAA 4AJEA 2EW2A 3OIYA 4JBLA 1A7UA 4RTLA 4KGXA 5DM1A 2AI2A 3ZD8A 6CHYA 4JODA 1LZKA 3CH5A 3M5DA 4UASA 1XZDA 4HLUA 5HVNA 5SICE 3MWDA 3N2IA 3N8KA 3PIRA 1QORA 4F6LA 2RHMA 3SXPA 3SSOA 5BSVA 5AJVB 1ZOPA 4ZGBA 3D5QA 3RC8A 4DCCA 2BUAA 1U4OA 3VU9A 5ALKA 3E82A 3GRKA 2C5GA 4UCFA 1O2DA 1UC4B 1JHVA 3L7DA 3RKRA 1NTOA 2WTEA 3V4LA 1KP2A 2F2TA 1OXVA 3TBKA 2FPIB 3GT3A 1U28C 4UQOA 1G0NA 4YLEA 3K9FC 2AN3A 4RHTA 1L7VC 1XZEA 4PSVA 4L6CA 4WECA 1OZFA 4N47A 4DUPA 4IVNA 3H8VA 1YZNA 4YRBA 4U7FA 2ATIA 5JXWA 1RACA 4BP8A 2BMDA 3WOHA 3NHBA 1T2UA 3ONNA 1W4CA 2DP4E 2OAEA 4ZU6X 4FGZA 2CY0A 2Z1DA 3V7WA 5E38A 1D0SA 5K51A 3G0HA 2YBDA 1W0JD 4HYEA 5CW2A 2VSQA 4AWBA 1AQNA 3NVKI 2H4WA 3U3XA 4HDOB 2YICA 4QU0A 1OWOA 4TTVA 3V8QA 4HTFA 2MR6A 4EL5A 3D81A 5ELLA 5HZGA 5K99A 2ZWVA 5ALFA 5ERGB 2ZIEA 3PXEA 1Y4AE 5LZ9A 3JARB 4F11A 4BRZA 1NF3A 4Z9FA 3SDZA 3D6HA 3IR5A 1PX0A 5K4GA 5KYKA 1G64A 1GCGA 1YBVA 2C31A 3LK7A 3MCTA 3PQ5A 1MLDA 4RXMA 1RRMA 3WDSA 1QGOA 2H9IA 4AXXA 4NZMA 1Y1LA 2C9YA 1Z62A 3GARA 5AO9A 2EWMA 2XRZA 2NO1A 1Y9JA 1SUPA 3L8MA 5K3BA 3ZXSA 3JATB 3MGKA 3SQNA 2KE5A 4BFXA 4S04A 1RJFA 2PK3A 2BUCA 5AQ1A 4X3OA 3ABQB 3F6SA 3QPWA 1DJOA 2RGDA 4B7ZA 3OPNA 1XQXA 4JLMA 4TL7A 3S29A 3TCKA 3MQ2A 1HDYA 4DHWA 2CVQA 2IT1A 3MLEA 2I62A 2VJOA 3C48A 1Q77A 1SQFA 3LXXA 3UOGA 1EG7A 4UD2A 4D4LA 1NR5A 3ESYA 5EI5A 1CUJA 2D54A 3AFGA 3RS7A 3SHTA 2FR0A 4DC1A 3L7BA 4V2UA 2FFAA 2JJ2D 3B7WA 3PRKE 4CI9A 2R1TB 1F8GA 4B6SA 3DL2A 3SM9A 4DDKA 4O6VA 1EGMB 2C8LA 3AM1A 3PJGA 5AJHA 1XNQB 1CYEA 2XZDA 2QUKA 3RVDA 4R2JA 4E30A 3ZWAA 5C8VA 3RYHB 5IT4A 1ML4A 1L5QA 1TYEB 1Z4QA 3S44A 4CM6A 1YRLA 3CX8A 4CF4A 2H65A 3Q9NA 1L8XA 3M6UA 4HHEA 4NEGA 4AULA 4HWSA 3EXG2 4A2QA 2EFEB 2WJ3A 5FDFA 1R64A 1T5BA 5LBTA 1RR6A 1V37A 2HAEA 3QX7A 5JNRA 3RWBA 2J5KA 1KAGA 1SQSA 3IMFA 2W6PA 4C1NA 1WVMA 5EZYF 4NYIR 1M1XB 2IJGX 2E89A 3U5TA 3KUCA 4BFTA 3VNUA 5DI3B 2FH5B 4C1BA 3RFXA 4EHFA 1TJ3A 5JS7A 3AR8A 3WB1A 4EG1A 5JNTA 4WKBA 3UKJA 4OGLA 3PT9A 4DARA 4HB2A 1ZOIA 1UBGA 5CYGA 2IYXA 1RBZA 1XF1A 5JI2E 1XMQB 2FUG1 4GUDA 4DPKA 4BXOA 1PG5A 1Y9AA 2C42A 2QTHA 4XDHA 5HILA 3D1JA 3KQTA 2A5YB 1J0EA 3WNQA 4NMWA 4XE5A 3N8NA 2XUDA 2CFRA 3OLCX 4KHZA 1ADFA 2LE0A 4QVGA 5DVZA 3NVDA 1QCZA 1A69A 1ADCA 1JHXA 1U9ZA 2W4QA 1R4MA 2RGUA 4LNAA 4LZJA 3TL3A 3ZK8A 3R3XA 4DSOA 1GVNB 5EJ5A 4XI9A 1I3LA 2R7LA 4JI0B 2FZEA 3IEIA 3AJRA 3QFHA 2G0TA 2GM4A 2JASA 3ESBA 4G0OA 4L07A 3VU0A 1D9XA 4YXWA 1QKJA 1SELA 1IWBB 2MYNA 4LWPA 3MS7A 3EPRA 4BWFB 4DRZA 1H0KA 4I6JA 4MS4B 4XLZA 4BBAA 4JKIA 4KLCA 1IZ8A 4XCQA 2XCSB 3KQLA 3R74A 3DAGA 2UXCB 3K1YA 3E9YA 4GW3A 5J2TB 3PC6A 4G86A 1BWQA 2WM9B 4OVKA 5JYEA 3SQXA 2A4MA 1GSOA 1CQIA 1GM5A 4YJ3B 2BM0A 1F0YA 1QQ6A 2NX2A 3CKMA 4W5RA 4WFIA 3EOAI 1RXSA 4LSMA 2H2GA 4TZ6A 4P54A 4EYQA 1Q74A 5F1KA 4LVUA 1T9ZA 5LU8A 1X77A 3G6KA 5CM2Z 1E1DA 2FSFA 3A26A 4TXMA 3ZV5A 5IVPA 5BV2P 1FZQA 3FGZA 4E7PA 1GRVA 1IOVA 4OFXA 1J8MF 2P1ZA 3LWDA 4PX2A 5DV9A 2FMHA 1R5JA 3HCEA 2J09A 3K32A 3X3HA 1EFLA 4AP5A 3WLAA 1JFFA 1YUBA 5DLPA 1AGPA 1Z17A 3LY9A 3EBOA 2JL1A 4U7DA 5FFNA 2QE7A 5EQTA 5IZ4A 4WY2A 4CLOB 4OAOA 4IDBA 4E13A 4B6EA 1WDWB 3ID6C 4A82A 2VNAA 2CMGA 4EGCB 1BFKA 2B1IA 1OI3A 5A1JA 1YOBA 3OZUA 5A3SA 1MVNA 4DM3A 3R0ZA 5DOZA 2IA5A 4YCCA 5K05A 1EAYA 2VKTA 4KTVE 4PZPA 4CR6A 1M6VB 2IX3A 3QW2A 4JQZA 4KO4S 5HF6A 2X8AA 3KQNA 2D00A 3KT6A 2PUHA 5JO0A 4YP6A 1ORWA 1G42A 3SX2A 3MTIA 3AHFA 5IM4A 3RIYA 4QPCA 3ZY4A 2DKOA 1QE3A 3F7OA 4JROA 1BA2A 4NE7A 5CVVA 2RIPA 1ABBA 2QSJA 1S2NA 4XZ3A 1LWNA 1ZUIA 3HNPA 2JJQA 3I0MA 2O0JA 1ICEA 3P9QA 4M1OA 4D8YA 3HJGA 1K86A 4COOA 3NP7A 2QU8A 1LSOA 3B9QA 1W85A 3AJEA 4PXYA 1EGQA 3PEYA 2QRQA 1Y8QB 4L15A 4MKRA 5CB0A 2EF1A 3SMQA 3SQDA 1ZIOA 2V6GA 4BAUA 4CT0A 4K40A 2SECE 1TAHA 4OHBA 3U7RA 2ZU6A 2AW5A 3DPSA 4ZWNA 3VZBA 4EMUA 5KNDH 2BFDB 1C3VA 4PNZA 2VDUE 3L41A 1L1FA 1M8GA 2ORYA 4LTNA 1VE1A 1A77A 2BKXA 1ZM3A 3VH4A 5E1BA 5HE8A 3TLBA 1JLHA 4DOMA 3SF8B 4CL3A 1EK6A 5E4JA 2VDJA 3VJMA 1MB3A 4UBKA 2BGNA 2DC1A 2PLFA 2HD4A 3CUKA 4RVOA 1M66A 3BZBA 4KRXA 4K8OA 2XQVA 3G8AA 1O6BA 2WE8A 4K6FA 2GAOA 3LLMA 4RBNA 1ONBA 4EUFA 5CEJA 2JCVA 1TLFA 1MO5A 4X44A 5GAJA 3X2FA 2C2WA 2CK3D 1SOVA 1ACLA 1UT6A 1X1TA 2HTEA 4ID3A 5D8DA 5IKMA 4FQ8A 2P91A 4Y98A 5B6PA 3E3AA 1N1DA 5TGTA 4QARA 5GM1A 1UZMA 1UBUS 2V6MA 4G37A 2FK7A 4JHXA 2NO9A 2RG1A 5FADA 1OAKA 3KOXA 4D7AA 2R5WA 1I94B 1VKNA 4KH0A 3M1YA 1K6XA 1RZ3A 1SFRA 1NSTA 4YAIA 4IIFA 1N6IA 1Q19A 4TV8A 4ZVSA 2Q5HA 2X40A 4FHEA 3V1LA 4Q9IA 1TTTA 4YGYA 5CGZA 4JKYA 4Z7OB 5AM0A 4FW9A 5CITA 2WVHA 3L77A 1IMJA 2PY6A 1I4LD 3QEJA 1ZU5A 4FZ3A 5HK8A 1JR3E 1XL1A 4MGYR 4JBGA 3EC2A 3IHTA 2VSXA 4PSKA 5JAQA 1Z5GA 4DQ0A 5DU2A 5JASA 1BU8A 1L7QA 1VDZA 1XTZA 2ECPA 2HYDA 2XNDA 3E61A 1A9ZA 2GN8A 2KM1A 3ESZA 4UDOA 5KVAA 2H4XA 4GM1A 4Y1GA 2IXTA 3ZQUA 2CJPA 3LPLA 2XGSA 3ZW8A 1JHDA 2FFBA 1J39A 4KQXA 3MXOA 4L16A 4Y9UA 1GCIA 4I4LA 2DY1A 2OTCA 4I2VA 3OEEA 3UTCA 3KD3A 4BLSA 1NATA 2O8FA 4CUKA 4GGOA 2O4CA 4K8RB 2V6BA 3KJIA 1WXIA 4LQCA 1V16B 4N8SA 4U9UA 3UPUA 2OP0A 4LHYA 2X4GA 3EZ2A 2G0NA 3EXEB 5IX8A 4WXYB 2JLZA 3PXAA 1YAJA 1YH3A 5EMJA 1YACA 5KVSA 3MA0A 1WX1A 3EZ7A 5CT5A 3AXTA 4N54A 3AVUA 4HGPA 4DTIA 3HJFA 1H23A 2XMGA 2CFTA 3FMVA 4FI3F 5AUQA 1I7DA 4LF8B 1UMCA 4PZAA 1ZHHA 4ZDJA 1C1XB 1CX9B 3WA6A 1DHRA 1KHHA 4YAUA 3SG0A 3RYFB 4L0QA 3TRJA 1R66A 4JLSA 3AH8A 3TRDA 1UKCA 2X1LA 3GT4A 4GI3A 5CB6A 1FTGA 2H16A 3OD1A 3PICA 2CKMA 1ZVMA 3BTOA 4ER7A 3V8MA 3OIDA 5CLJA 1G3QA 1FBNA 5ALDA 4F56A 4MWZA 2BL4A 1KGSA 1MZPA 3HE3A 1DB3A 4QPDA 3DFKA 4GGMX 1TO6A 1T2EA 3FPEA 1BS2A 3MK31 1F7VA 3ROTA 4AW9A 2FRVA 2A7XA 5KDOA 2GZSA 2HPVA 2F00A 2Z4RA 2CD9A 4JN6B 1KYWA 1EK0A 1LDNA 3KTDA 4OSPA 3CE6A 1QIJA 3R3JA 4DUGD 1KEUA 4RTPA 2OHOA 3JVDA 1IPFA 3TZ6A 4D9IA 4OM8A 3EIQA 5D86A 5ALEA 2H4JA 1VIDA 4PLZA 4CKCA 1DC8A 2QRVB 4P34A 4BMSA 1TYDE 3QVOA 2B82A 4M0KA 2LPMA 3N2EA 5FD8A 5AVXA 4EY8A 1M1UA 5JMOA 1DIHA 4HZUA 2VIIA 3OTWA 3P9PA 3VR2D 5BP7A 4JSRA 4J9UE 4Y2RA 3VR6D 3AHEA 4BPBA 4AZ3B 5CVCA 1KI9A 2I4OA 1NJGA 3FUUA 3I8OA 2NV6A 3PFGA 2X5NA 1EJ6A 4M1TA 3UB4A 1T8RA 2FN3A 4JJAA 1ZD3A 2SKCA 3BFPA 2E6KA 3HSKA 2QB5A 2DHRA 3KR1A 3ZHBA 2IQIA 3H8SA 5D01A 4AZVA 4ENRA 4YLYA 1VE3A 2IBTA 2VZ8A 1JE0A 3CJQA 1BWPA 3RFFA 1MP0A 1K7YA 1F60A 2VQSA 1U9IC 3MB5A 3OLXA 3HA3A 4WKOA 3WLTA 4O59O 1EFVB 1SVWA 4IXDA 2C78A 3KVNA 4ZALA 1NBME 3WLRA 4CMEC 1UM9B 1XJWA 2B92A 3FPLA 3Q7TA 2OP1A 1HMYA 1D2AA 4AMUA 4JJIA 5M3BA 3UQYS 4KAAA 5EY5B 2DT5A 3Q9SA 1WUIS 3JQ9A 1ZLYA 2RK6A 1AS3A 1H5NA 1OH8A 3AJAA 2BEUB 5LB2A 3NHUA 4KJZA 4UNRA 1SGWA 2PT9A 5KYUB 5AUOB 4JOSA 1XTUA 3E81A 3HTXA 4Q6WA 2D1SA 3HFSA 1F4VA 1HY3A 4KO1S 1QF9A 3TUZC 5B57C 2VPZA 3N0XA 1SPBS 1ZJZA 2HRZA 3GPCA 1QX3A 4ZXFA 1NJ5A 1ONNA 1U6JA 3H1FA 4E5KA 5F9FA 4KGVA 4J0KA 3ZWNA 4MS1A 1NJSA 4JUAA 3UB3A 1R8YA 3U4IA 5F5NA 2QKYA 3ZY6A 1AZWA 3F73A 1NF2A 1H9AA 1OWPA 3D4LA 2DAPA 3PRJA 1NNUA 4M9CA 3S68A 2VP3A 3ET4A 4OYYA 2GCGA 4FX2A 2XHEA 5C1OA 3GPLA 1CFJA 1KXZA 2V4MA 3UXMA 4MEBA 4LXUA 1SOAA 4QGGA 2YNMC 5G0VA 4PN3A 3EPHA 1IHOA 1MT3A 5GONA 1QTNA 2L19A 2CN1A 1TGVA 4OH1A 4L3WA 1OT5A 1ULTA 1G5PA 1YS6A 2R66A 1JR2A 1KP3A 4MUYA 4MPRA 1N8KA 1NY5A 2JFPA 2O9JA 1N7HA 3UT5A 2WKRA 4Q9JA 1KZ9A 1ZH6A 1EUDB 1SUCA 3MGCA 4W5QA 3KEQA 4TZTA 3FHCB 4RE6A 4Y2HA 3RTBA 2PQ6A 3MJRA 5HF5A 2AK2A 2ID8A 2HQ1A 4EVSA 3SC3A 2JCGA 5EPUA 3U26A 5D6NA 4E5PA 2BHLA 1JFRA 1YJ8A 4H7IA 2IYVA 1P5RA 2WA1A 3B5JA 1LZLA 3NATA 4IKEA 1XMXA 5J1TB 2MSLA 1BEEA 2OYRA 3LPMA 2RKOA 1YV9A 1TT7A 3K73O 2IS6A 4GXTA 4YHHB 1V3QE 1RQPA 4BLQA 1SJ9A 1JB9A 2FPSA 2Q46A 2V45A 2YMMA 1LDEA 3OWOA 5CTJA 4EDHA 2RGEA 1RJGA 5TGZA 3DT6A 4AJKA 1GFSA 4GMFA 3ZC3A 4EHAA 4RDCA 2WF6A 3C3EA 3UCEA 2VJCA 1I80A 3OP1A 4G97A 4Y6GB 3FHOA 3VGJA 2WSMA 3EOBI 4O2BB 4TN1A 5TRTA 4DZRA 5FWXB 5TMEA 2C4TA 4YQYA 1XP5A 1OZHA 2JBAA 1KR5A 5D1HA 1SKAA 4ZVTA 1G19A 1J90A 1A7JA 1FL9A 2AN4A 2PKCA 4O0MA 5CLGA 5BR8B 4ZV7A 3K20A 3J7AC 2NW6A 4P36A 1P80A 2BKLA 4MHTA 2C61A 4YV0A 1EGHA 3VPDA 2WHRA 1ONOA 4G23A 1JDZA 4N0QA 3EGCA 2W2KA 2DUMA 4IWXA 1QBKC 1EGVB 4KO3S 3L02A 4D42A 1TU0A 2PGJA 4LDAA 3RV3A 4WK4B 4WBNA 1APBA 3HWSA 1KS9A 4H59A 2OMEA 3PRHA 3LY5A 3WA7A 1EWYA 2DKFA 4HWKA 2BEVB 3QVUA 4PZUA 2IPMA 2JLXA 4GMKA 4UPDA 5DO9A 5EJAA 3ETLA 5IH3A 3PNOA 5PGMA 2BMAA 4QPNA 4HDAA 4OV6B 4DZTA 3RVLA 4L78A 4W5TA 1X3SA 4CM1A 4LJ4A 3FCYA 3M1IA 3AO0B 2X0EA 4U0KA 4W5JA 3GZ4A 1YZ3A 1NN3A 3L0DA 1TA4A 4QOFA 4CMGA 3GGCA 3A2KA 1QGZA 3DEHA 4TLAA 1JHMA 1P2FA 5ARDA 3KCNA 1F8FA 2FQQA 4FDMA 2GM9A 1K66A 4M76B 4IVPA 3OLVA 1PUXA 2CLHB 1HDCA 2C2GA 3Q3CA 4LIPD 5CJJA 4XYLA 4MI6A 3NHJA 1TC2A 3PC7A 3WK7A 4Z51A 1C8VB 1UFQA 1JR3D 4ZN6A 2CDAA 3BMCB 2I33A 3WLIA 3W34A 1H2YA 4NBRA 1VHWA 2AC7A 5DCUA 5JMTA 1YKSA 3OF3A 3AIOA 4W1SA 3LQFA 5IT9A 4BU1A 5LJIA 4KTTE 3KLNA 4R1TA 3WLHA 2QTCA 4Q7JB 4HNTA 1FSFA 4IICA 4BNMA 4E7OA 4L0DA 1U2SA 4Z0HO 2V8OA 4ZIRA 4FKZA 2Y99A 3EG9A 2R60A 3FMGA 4UBOA 1VSTA 1K6IA 2C7GA 1O6ZA 1PL6A 3AERA 1NRJB 1HFJA 3FOCA 4HQ0A 4Q4LA 4TRJA 3RWMB 3VU8A 3C6XA 4JI6B 1Q92A 2W22A 3KB2A 5JAOA 3N7UA 3U3DA 2ID7A 1P1FA 1ZXLA 3TEJA 1VLLA 4DR1B 3TW6A 3TQCA 2O3TA 2P2NA 3PS9A 1YBMA 4GLFA 1RP1A 3IUPA 2OB2A 3JR3A 2QLFA 2R8XA 3M7IA 3F1LA 4BNJA 1B3RA 1IM5A 3I9LA 3OMXA 1A2KC 3Q6NA 5LP6A 5ALVA 1AF4A 3LA6A 1HYHA 3LVQE 1TW2A 1JWLA 2P3SA 1EFAA 2RHRA 1U2GA 1HZZC 4BV2A 2NP6A 1SZJG 4B3CA 4KVAA 4CLHA 3UT0A 1U2ZA 1DG3A 2OSBA 4MGHA 5CVEA 3TJRA 3W1VA 4DA0A 2ZAIA 4NOMA 3QY9A 5DEIA 2PMEA 1OXUA 3H6KA 4MLCA 3MFQA 5E4YA 5FWYB 5J5CA 4C08A 2YY5A 4W6QA 3V80A 4R9UC 3S6JA 1ZN7A 1AD2A 4WESB 4V03A 4HUTA 3NHAA 1UBCA 4KODA 1W581 4EO4A 2WT9A 4ZZ1A 2VT6A 2PFSA 4IJQA 4C2UA 4HDSA 1CJTC 2DTXA 2QM3A 1Q0RA 1Z06A 1FTSA 3OT1B 1UBEA 3LGAA 3VO2A 1N78A 2IDKA 3FYTA 2IHKA 1U2TA 1T3SA 3DXYA 3LRTA 1NOJA 3IUSA 4F60A 3FCOA 3KYJB 1H1DA 5KCZA 3FYSA 3SX0A 2LWIA 1ZUNB 5MGNA 4LN1A 5JWOA 2VO1A 3QPVA 2OHJA 1B23P 3FMOB 3ILVA 4HFRA 2AD5A 2JF0A 2PX8A 4D4MA 4EUEA 2FMTA 2OCAA 1VTKA 1J33A 3JARA 4KNWA 2GO7A 1ZJJA 3BM5A 3MS2A 4Q3EA 5KDLA 1RU3A 4HUJA 3FAKA 4EI7A 3FFAA 5JAHA 3N05A 4YRFA 1E18A 3HWRA 3BF8A 3CEAA 5T64A 4GPD1 3FCAA 4LDZA 2ZXEA 3I72A 3COJA 2CL7X 1KY4A 1QP0A 4LS3A 2AUTA 4KGDA 1FDUA 4JYPA 1X1DA 1GHTA 2FWJA 1SOUA 3BQMB 3JW8A 4WMLA 3OUZA 1LV7A 3KJFA 2ZSDA 4WLOA 4EB8A 3IAFA 3ND9A 2GRUA 5K8IA 2I1LA 2VDRB 5B7PA 4RHYA 3P9CA 1GLNA 3FOEC 2BCEA 3CY6A 3SC4A 3C6KA 3QP9A 1G38A 1NC3A 3LXUX 3W2GA 2FMUA 4PNEA 4OBWA 2AQ8A 2P3QA 4WL0A 1NSFA 4BKMA 1B6SA 1OXTA 2GYUA 2IEZA 3B1KA 2YMPA 3F98A 3ZGVA 1EPUA 1NMSA 4F4IA 2D13A 1DEKA 4Q4CA 1YZQA 4URWR 3J80A 1E3IA 3BWCA 2B36A 4HDKA 1PR9A 4HAYA 4RTKA 4KR6A 3GLFE 2YZGA 4URUR 1QE0A 2FX3A 3G5AA 3LMKA 5HZKA 4EG5A 2YTZA 4CEHB 5H83A 1JQDA 1CB7A 1GGMA 3D3JA 1EU1A 3BXXA 4C6SA 3W3AH 2E4ZA 3BB4A 1JDTA 1I0LA 4ZJYA 4GQBA 4KKVA 4W4TA 1RHRA 1UFKA 2VJMB 2ZBRA 4F97A 1B3BA 4YP7A 3IAS6 6Q21A 1LVGA 3O26A 2IU4A 3IOEA 4IUBS 3RLFA 2C5HA 1LLDA 4NJOA 1U1IA 3QF7A 1XDWA 2DJIA 2XT0A 3OH8A 1L4BA 4M0DA 1ABFA 4NQZA 5F5LA 3B12A 2C7RA 4CCYA 4G0UA 3IAHA 1S4QA 1SXPA 3A1TA 3VAYA 5JZ9A 4BQEA 3RODA 5L6LB 4K1XA 5TQ2A 1RSZA 4JFAA 3RJ9A 3UA4A 3S2EA 3E4CA 2SICE 4CLDA 1KY5A 3VDNB 3WWOA 1FRNA 2H8KA 3ZQ4A 5LKRA 3A6FA 2Z9BA 2R86A 2Q1UA 3A3PA 2BFOA 5DLDA 3CVYA 5A4MS 1ZKMA 1RIIA 1MNQA 2ON6A 4IDFA 5CLLA 4WCFB 4BV9A 2FPLA 4MMXB 3ZGZA 1G4HA 2HI0A 1SQGA 3VX3A 2WG2A 1L7MA 1SBYA 1QBGA 1Z36A 1LPMA 1YR7A 2OM6A 2EKQA 3GRAA 2RONA 3JVVA 2AVDA 3ZIAD 1JE1A 2F1RA 4M53A 2ZYSA 4C07A 5LYJB 1NLFA 1Z22A 2X8JB 4P7KA 4LTDA 2GF9A 2PPVA 2OZLB 3L4SO 4G6ZA 4P8RA 1E6WA 1ULSA 2GPTA 2XTZA 4E6PA 3P9YA 5JQGA 1XOIA 1KDZA 3EXFA 1CUBA 1ORVA 1E8MA 1NYLA 4LECA 1Y8QA 2FZ4A 2HMUA 2E55A 2CZGA 2YWFA 3DXZA 3GRRA 3K0HA 5CM8B 5EJEA 1G5TA 5EHQA 3MOSA 2NXEA 4L5YA 1UQUA 4TRMA 1XQ6A 5KTSA 1XRQA 4I4IA 2WKWA 1QUFA 4PFSA 3D5TA 1XEWY 3ICCA 2AF3C 4YLGA 1X74A 5I7UA 5JYDA 1ZSVA 3QYJA 2O14A 3F4LA 3V9AA 1P7WA 3AR6A 2X2FA 4N01A 2ZRDA 1MENA 3K9GA 1LSSA 4C9BA 1Z73A 4HH0A 5CK5A 4TYQA 4RY0A 3T7RA 4AWAA 1GGVA 3KOYA 5L51A 1KNXA 3OJEA 3TDKA 3VOSA 3GF4A 1SXQA 4FFPA 4JJFA 3GL9A 3IDAA 5FNVB 4NBSA 3GAFA 3HA5A 4NS1A 1V8FA 1YQXA 4W1RA 4DSUA 4GDMA 5B36A 5K8LA 2OZPA 1C8LA 3DT9A 3IBTA 3NV9A 5H02A 2QLTA 1W0CA 3GRCA 5K6AC 5L95A 1PLLA 4ZKDA 5B58C 3TZQA 2NYAA 2IX9A 1A5BB 3P0JA 1UMCB 3HJHA 3CWCA 3DEZA 2R96A 3HDGA 1V95A 3DNMA 1GNQA 1Z4NA 2BTOA 1E98A 1SU8A 2GCOB 4H1HA 5F2NA 3DTNA 2H1VA 3QLEA 4QBIA 1EA7A 1GTG1 4BPRA 1XFDA 5JEDA 3LX8A 2WEKA 1HE3A 1QO7A 2NTNA 3OVMA 3KOMA 4ZDIA 5KPJA 1JEAA 4QUBA 2AW3A 1M8KA 4Y9SA 4EG4A 4TKVB 5ECDA 1EIZA 1RRGA 4MUBA 3JQBA 3OKCA 3RBVA 5JTTA 5ICGA 2AV6A 4LNUA 1PTJC 2GNPA 2CHFA 5ESXA 1V48A 2J48A 3HPRA 3PX3A 3SNHA 3ZY5A 4PCUA 4TUYF 4WV3A 2QJRA 3GNLA 4ICIA 4EI8A 3BH7A 3EGOA 1VL2A 3T1QA 3SIRA 4CR7A 1TZMA 1Y82A 4NCNA 2ERCA 4ETMA 1NX9A 5DASA 4RTNA 2IPXA 3W7AA 4REMA 1QRUA 3WTBA 4YUVA 1BDIA 2PR7A 2YS7A 3ROPA 2ZRIA 2ZSKA 4YJDA 5G4KA 2OM2A 1K8ZB 4LGMA 3E8SA 2H5IA 4NENB 3KYCA 2CNWD 2O23A 2PUEA 2V59A 1NIJA 2ASVA 1NVAA 1M0TA 1M74A 1PQPA 2WMDA 2A9FA 4RXTA 4S1OA 1I4WA 1J4AA 1YT5A 2B4TO 2XHZA 3FF4A 3DS8A 3HV0A 1F5SA 4EELA 2ZJ6A 4EOGA 3JQAB 4X1IB 3MMZA 3N0RA 4JITA 5DTQA 3DV0B 5DXFA 3ZVLA 1R6VA 5F51A 4YMGA 4KREA 1BS9A 3GDOA 1WDLA 3E48A 3VPAA 4XWYA 4R0MA 1OLUA 4N65A 4NOJA 1TX4B 5JMWA 5KNCD 1PG2A 1X8JA 2QD4A 4YRGA 3ZY3A 2H2IA 5FWAA 3TDNA 1NW9B 2C04A 3QKUA 3OJLA 5EEHA 2PQMA 4LRUA 2XGJA 1FOEB 1CF9A 1WXWA 2HPAA 1BMFA 4MVJP 3RS0A 3P96A 5KKCA 4WCFC 3VR5H 3VNBA 2FQYA 3S5JA 1XCMA 1KZ6A 4Y2QA 3CKYA 3HXLA 3KT8A 2PBLA 4M1SA 3WRVA 4ABYA 2Z8ZA 2CNOA 1FTWA 4LK2A 5BSEA 4N7RA 1SPXA 1ZWKA 3QLVC 4YJHA 3OG9A 4J4BA 4BLWA 3CZMA 3A6LA 4BUZA 4V24A 2V7XA 2I55A 3M9WA 4PM4A 3F6YA 3LU1A 3IQDB 3OETA 5AOBA 1Y4ZA 1JIVA 3MUNA 2E9SA 4URXR 3C1AA 1PW7A 2CVPA 3IVCA 4Z7JA 5EUQB 4W7IA 4A8HA 3OBIA 3GLGA 2WIGA 3AUFA 2HA2A 1I6WA 4QYIA 1W85B 2WLTA 1VG1A 3P2IA 1ZNYA 2Q6VA 4BTLA 3TG2A 2R4UA 3K31A 5KSOA 4DLBA 5TIIA 2ZI7A 1CQJB 1EVKA 4BNZA 1YHYA 2J45A 5KWSA 1JFTA 2FQ1A 4V0NA 5KNBH 3FETA 3KKOA 3M5PA 2J4CA 2YQ5A 3DZGA 3HY4A 3L6EA 3N9IA 1EX1A 3P0IA 4GMDA 4WKGA 3A36A 3ZDDA 1HFEL 3MWGA 1G6OA 3I2IA 5KJEA 1W5TA 4FYVA 4UUQA 1WB9A 3KEFA 2QVXX 3KV3O 1KDTA 3ZGOA 1DNPA 2WTAA 2HA3A 3NIDB 1NBEA 4LJKA 1QR6A 4PLYA 4UXJA 3CLSD 3I23A 4D98A 2I87A 4UBLA 4XEUA 1KRWA 4G1VA 2GHTA 1J0XO 1MNAA 2C98A 4G89A 5CH8A 2AS0A 3SJ7A 5B2ZA 4OL9A 4ZVNA 1J2RA 5IKXA 4N5HX 3TCNA 1YDHA 2J30A 1R6TA 3OA2A 4K9OA 1FYEA 3OHPA 3MGBA 3F2IA 3VTZA 2A14A 3RU9A 2FFQA 1DKMA 1Q0QA 1E0SA 2ODTX 3CUVA 1RMQA 5E3JA 5DMHA 4KMSA 2N1MA 3MTBA 3IQGX 2H0RA 2DUUA 5B1IA 4KDRA 5JJLA 4TZ0A 1XZMA 2O5EA 1NL3A 3CUYA 3IODA 5A06A 1ECFA 1Q1EA 3RUFA 3P19A 5A0TA 3E05A 3L79A 3H9UA 1ITZA 4GSLA 2Q4BA 1Z5VA 2KI5A 5AK0A 4IF4A 2YOFA 3HDJA 2HV9A 4LDQA 3BSFA 1P9NA 2PHZA 1V1RB 4R8RA 2GN1A 4TS9A 2NSJA 1LX6A 1WR8A 3BK7A 3E2PA 4Z5XA 2QAIA 3PDCA 3OEWA 3WKDA 3X1KA 3I6YA 1SKUA 1NWHA 4F8JA 4RD0A 1WMFA 2GMWA 1WS6A 1NQTA 5AKKA 5EYPA 3FOAA 4R9SA 4YIKA 4XJTA 1SVMA 1NPDA 1CUZA 1OTHA 2CV0A 1U3TA 1DIOB 4CMAA 4G0MA 3N86A 1I5EA 2JKVA 2QNRA 1CC1S 4PO1A 4IO0A 3ZV3A 2VDWB 4MYDA 4WFKA 1Z7GA 3PHCA 2W2QA 2B3TA 3WGZA 3B1XA 5LUAA 4G5YA 4JBIA 5CDTA 4PLFA 4DILA 1G20A 3HVJA 4QD3A 2CSUA 1II9A 4HJXA 3RSSA 4QQRA 4YFYA 3ROFA 4M0CA 1UXKA 2W6CX 3AHIA 5CXXA 4RIGA 3E8XA 3QLUA 1FP4A 4GOJA 3ROXA 4UC0A 5JQGB 3MRVA 2GPWA 2BIFA 2J3LA 2VF4X 4BNNA 3FSGD 5AD1A 2RGGA 1I1OA 4LY0A 5HM6A 3AVOA 5T4HA 2WD8A 1JB1A 4ITUA 4P58A 1XZBA 2H51A 3COPA 5D3ZA 4DUZB 2YYAA 3PGJA 4X6YA 2D74A 5DTEA 1WABA 3KOWA 4D1YA 4YR9A 4Y6QA 2P75A 4OHFA 2ZYVX 3EVZA 1OWLA 2FP4B 4ZARA 1K97A 1HQCA 4JU9A 2QRMA 3CZ9A 2QYHA 3MD0A 1V6AA 2ZJBA 1E4EB 1XFAA 4YV2A 2RGNC 5C4GB 3FG9A 4B87A 4M22A 1I0ZA 4BB0A 2C2BA 1IUKA 3LV8A 3UF0A 4ECAA 4GEKA 1MJ5A 1MX3A 2IYNA 3JQPA 3T7SA 1ZGCA 1BDMA 3NTVA 3G0BA 1KEEA 3DSRA 3A4TA 4NE2A 3MJFA 4KSCA 1AQIA 1HNWB 4AJPA 3KZCA 1KMHA 2GAFA 3GRPA 3DL7A 1ZVJA 2PZ8A 3CRQA 4INJA 5CT4A 1OGYA 1G2QA 1H4VB 1K92A 3MMNA 2J67A 2C4VA 1QO0D 2MHCA 2Q1SA 3VDMA 3B3AA 1RAAA 2GN0A 2JAOA 2A9QA 1XJ0A 2OR3A 1VOTA 2G77B 1SCJA 4LJ6A 4RSRA 1P0QA 2IYYA 5EEGA 4CU5A 3K70B 3ESQA 1UAGA 1ULHA 1T6NA 1Y3DE 2BAGA 4HDCA 1WSAA 3FNHA 3FTCA 4MYHA 2Z6QA 7MHTA 2CHVA 1AGRA 2FRDA 4ILKA 3TZHA 4CF5A 2HHLA 4E94A 4WJZA 2X5KO 3LBFA 1TFRA 1SRRA 1KO8A 3N8IA 2O7QA 3ZJTA 3EEQA 1GA6A 2WU0A 1C0PA 1ZCBA 1U2PA 2DPGA 3CLRD 4QDOA 2O2IA 4M0PA 3I1IA 4HGNA 3O4VA 1WP9A 4D0NA 5DP2A 1FYFA 2FSVA 5H59A 4EYSA 4U6NA 1FFWA 1ZU4A 4NK5A 5FWXA 1QIGA 2CKDA 1GWNA 1LPSA 2P62A 4XIGS 3K5PA 3UC9A 4B4VA 3BZWA 3ORSA 3ER6A 5IAEA 3OZTA 3OQPA 4M9ZA 1JMYA 3UMMA 3FJYA 5CA1B 5EL0A 3GUZA 4UE3S 1Q1ZA 4X92A 3FGOA 2I1VB 3RB8A 3EIUA 3S7TA 2GKSA 1KVTA 3I1FA 2PWBA 3B38A 4JBXA 4YJ2F 5E3IA 5DBGA 2D0IA 4Y2JA 3VYWA 4PEVA 3N75A 4H1TA 1BVHA 2ENUA 1UJ4A 4D9FA 2ID9A 2RD2A 3M70A 5E1OA 2R85A 4M1EA 3THXA 4D92A 3WI7A 1A9SA 3UPDA 3DYBA 2ZJFA 4O2AB 2NYVA 2V7VA 1EA5A 2LIPA 4MW6A 1E7SA 4MVJA 1GUFA 1XEXB 3LS2A 4XX1A 4YCNA 4X7PA 3S2YA 2A6PA 3WOVA 3DHVA 3GN1A 4XRRA 3RS9A 4C6TA 1LDMA 1LI4A 4PQGA 1YONA 3OE7D 1W0KA 4KVFA 4W5NA 5JUWA 1VE5A 4ARSA 2HBQA 2BJWA 5B1YA 3SX4A 4IHJB 4BNWA 2BE7A 3R7NA 4BO7A 2FCRA 3QEAZ 1EX7A 2WG0A 4FHGA 2IWHA 1EXDA 2P6MA 3RRNA 1FYDA 2C3YA 1WMSA 2HGSA 1KO7A 4DJAA 4Q9LA 3L6BA 3P0EA 1E9VA 3V32A 3ZHUA 3OM0A 2GZMA 1J56A 4CTMA 3QQPA 2IODA 2DSNA 2QN3A 3QKWA 4G5FA 1N4AA 3WR5A 4ZYVA 5DGDA 4L4SA 2ODQA 5C8DA 3GFFA 2WYIA 2OBYA 2GH1A 1E3DA 3C5VA 3F5FA 1XD9A 4ACBA 3TAHA 4LF9B 1DEAA 4E32A 2GUGA 2ATCA 2ZUBA 4LKOA 4QLOA 4LYAA 4F4UA 2GAJA 5KU7A 1Y1SA 1I1NA 3O8BA 1Q22A 2OHIA 3F4BA 4BBJA 2I99A 2BCJQ 1WHTA 1DMSA 1L1RA 3T5TA 2JARA 1ZY2A 1CUUA 2B21A 2G0AA 3A4YA 3QF4B 4FLEA 4NFYA 4TPKA 2PX4A 3KTAA 2LRHA 3QKRB 1QJ4A 3X2SA 1G4UR 5I7WA 1D2RA 4RL4A 3N0TA 1JX6A 2J6BA 5EMMA 2QW8A 1GR1A 5DT9A 1NLYA 3LUHA 1QU3A 4LGYA 3L4EA 3B6MA 1M76A 3T15A 1V1RA 3MLAA 3KK0A 2ZBPA 4QUEA 1UC5B 3AWDA 1HKHA 1EP9A 2AWOA 1AOXA 3GU3A 5CH3A 4Q4HA 4DLPA 5ITSA 2OD7A 2W2VA 3SQOA 2IGTA 4UE2A 4YCMA 2Z56A 2WJIA 4L5AA 5BWCA 3F9RA 4DLKA 3ELYA 3ZJUA 4WASA 4YX9A 4LOIA 1N8SA 3D8TA 3CZCA 3HR8A 2XB8A 2JA2A 1I4TD 3OPMA 4IIJF 4MV9A 5H0IA 3TD2A 1G63A 2IU6A 1IXKA 1T5IA 2VP6A 3EGXB 4PFQA 5IM5A 2XIQA 1L1EA 4R69A 4BJHB 2D7CA 1KI8A 2XQGA 3CXUA 1K0UA 1SC1A 5GPBA 3IIIA 2JVKA 2L0XA 2N42A 3M8KA 3HBFA 4L85A 2O8FB 4TVKA 4GBJA 2A9VA 3PP8A 2WP0A 3DNFA 4ZRMA 2MWMA 1A88A 2G28A 5EXDA 2WTUA 4CQJA 3GLGE 4DWOA 2QUZA 1TB4A 1GL9B 2BD0A 3EJ6A 4PRYA 4TT3A 2JCXA 3O73A 2YS6A 1ZD1A 1PJAA 3O9MA 4HP8A 4HFMA 5J2TA 4INAA 3ZYCA 4MO2A 3KZMA 1ZD8A 3L6RA 4I1IA 4MS4A 3JX9A 4B3XA 2WJYA 2MSNA 4I55F 3H75A 4L8VA 1B00A 1PR3A 1ZNWA 4IFTA 5L7YA 3DLBA 2RHBA 2W37A 3TLCA 4DJJA 1I14A 3KYBA 1Y80A 2XE4A 1M1NB 1VBNA 4Q7LA 3LYHA 5FORA 4ZYLA 2MIIA 4TTAA 5CXUA 5J4LA 1UBOS 5C8XA 3EXHB 4OHPA 5K0GA 3L92A 2VT2A 4PAQA 3GWGA 1VMAA 2PU5A 4ZHSA 2VJQA 4WCFA 4BQOA 1N25A 2AXEA 3RVJA 1M2VB 4L76A 1P5JA 1M1ZA 2PCJA 3ESDA 4MP6A 1V7ZA 1Y89A 1QS0A 4QODA 3SYMA 4AS1A 1PL7A 4U7GA 3LVBA 5KSZA 1C14A 4ND4A 4BAZA 3CCBA 3W5JA 5AK4A 1KARA 3KWFA 4RW0A 4TXNA 3SIPA 4A0SA 1KVQA 3CMCO 3K53A 2O2SA 1UBJS 2CLKB 1LBHA 2CMKA 2QG9A 3A4IA 4GGPA 4MDYA 4RX1A 4Z7QB 2QMQA 1AT1A 1NVFA 1SBNE 2ORVA 2D8AA 3B53X 2AUMA 3IP9A 2XX3A 2P65A 3TXAA 1GXSB 1Z07A 3PXDA 1YL6A 4D25A 5M2QA 1XTBA 4QL3A 4NICA 3CLKA 1K7EB 1ZMTA 2XA2A 3CLUD 4K26A 4PY2A 3SGLA 2ABWA 1J06A 1L7OA 4JC0A 3UYKA 3WL6A 4AURA 1E6EA 2Q29A 3K96A 3PFNA 1NPYA 4RACA 1YCFA 1L6RA 1Q83A 2CBXA 4J7AA 4S3MA 5KI6A 3ZQ6A 4C0BA 1VI5A 1VSVA 4KE8A 4JL5A 2NXWA 1KKUA 5KX5B 2IL1A 3GFSA 3DO8A 5KYYA 2GTIA 2G7ZA 3PGMA 1NTRA 3GJXC 5KREA 2YVAA 5JARA 3TYXA 4PGHA 2CYCA 2D5CA 1KYXA 1SCNE 3NBZC 3BWBA 2PFGA 1C8BA 3GDGA 4HAOA 4GKVA 4LE1A 3TD6A 2I7CA 4F9GA 3BERA 3QVMA 1TK9A 2FOLA 3HXKA 4FXPA 2XKBA 5JJIA 2R751 5KYTA 3H65A 1KMHB 2HJGA 2C83A 1Q1NA 4FE7A 1OFUX 4UBIA 4ZZ3A 3DR5A 2B7BA 2ZRGA 4OIMA 4KN9S 1ZP6A 2WUVA 4MAFA 3W8NA 2Q62A 2WAMA 4EA6A 1QF7A 4RADA 4KEAA 1KEKA 2CL0X 4O4IA 5B7GA 5JQGF 3GLIA 1NC1A 4S1VA 3CQ9A 3QHQA 4PG7A 4BDSA 2N0SA 1Q0HA 4A0RA 4RPHA 2BGJA 1KI4A 1QC5B 1UOOA 4J07A 2ZRLA 1ZH0A 2QZJA 3PD1A 4RVFA 1LQTA 4MW1A 4WNIA 4KXMA 4ZO6A 1YTLA 1B8UA 3PHIA 2W98A 2YJNA 4G5RA 2WD7B 4NBUA 4TLEA 5TJHA 4B5LA 4DCSA 3FTFA 3AINA 4EGSA 1FUKA 2Z2XA 4WLEA 1NOIA 2MYUA 3EDQA 4OM7A 1AK2A 4V0OA 1N5RA 2QQ5A 5GV8A 4J3NA 1ISHA 3LZCA 4DYVA 1E0DA 1U8YA 4FR2A 2QSZA 3GLHE 4R2KA 4A36A 3LLUA 5CA0A 4U5XA 5C51B 2C0PA 5LZ7A 1J2TA 2BRUC 2AOUB 1F17A 2J3DA 2PRKA 2FKNA 3CPJB 3FCUB 4IEFB 4RZUA 2OLJA 2FZKA 4GM0A 1NDUA 5JU6A 4KWEA 4ID9A 1HOTA 5HIAA 1TKBA 1PNQA 1YJBA 2CDBA 3QVTA 1MPXA 1O95A 3BQNB 4XOUA 2RH9B 2FHPA 4IH4A 4K9LA 4A0HA 2E87A 3A6JA 4HWOA 4N18A 4OQFA 2EZTA 1U5AA 4ND8A 2ZSBA 3OHMA 4CLRA 2PRSA 2ZB7A 4MTCA 4B3GA 2XITA 3PITA 5JFOA 3ZVNA 1DAIA 3TSAA 4BFVA 1C8KA 2W6QA 2P1RA 3QNUA 4QM7A 3ZR4B 4JX8A 3BVPA 3K1JA 2O0HA 4CN8A 5F2OA 1RRCA 1U7DA 4GC5A 1GUYA 5DYTA 1E8NA 2CYAA 2Q2WA 2NQ8A 3ITNA 3T5GA 1DEXA 4HZUB 3WNZA 3KJQA 4MW2A 1AF7A 5SYMA 4DIKA 1N75A 3QF4A 3V1TC 3ZY2A 5J4KA 2J4FA 1V7CA 1U7OA 5LNK6 3N2KA 1JTEA 5CDYA 1PK9A 3V8PA 3UFXB 3TTTA 4NNJA 4A4DA 1U6IA 5FA8A 3P26A 3Q72A 4LBZA 4NYJQ 1NGSA 2BGLA 3BRQA 4RVUA 3VA7A 4DXAA 5A7GA 3KKZA 1FXUA 3EZYA 3GEPA 4RTMA 2BFMA 2RGNA 2V4ZA 4M8SA 1H42A 4KUGA 1L7BA 2ZJOA 3D4OA 1E5VA 1KYIA 4WQMA 4A3SA 3ZLUA 1EBUA 4PQYA 1RKQA 2FETA 4X3PA 3M9LA 1F48A 3IDZA 1K7CA 1QHGA 3DWIA 3IH5A 3OWXA 3TZKA 1MX1A 4S1NA 3MWLA 2NTEA 2Z30A 2D2XA 2HL6A 2Q28A 2YDYA 3DMPA 3HI6A 3PWTA 4R2WA 3AV0B 1I3KA 2WWYA 3B1JA 2FR8C 4HMQA 1ZSYA 4DQDA 2G09A 3JAWA 4C04A 2YYSA 3OEYA 2HK7A 3RJ5A 2G36A 5EKXA 4NV0A 1KH2A 3O3OB 4Q1EA 2OT3B 3PVCA 3SDSA 3BMCA 5FTJA 1DIGA 3AW8A 1H5QA 3AETA 6YASA 5KOHB 5LL6P 4XIJA 5FHQA 4X7MA 1CPYA 1XPUA 3BFJA 2LKDA 5HGXA 1II0A 2DMRA 1PJ3A 1UL1X 2W6JD 3AJ9A 3DZBA 2HO5A 3HCRA 3W9YA 2FRDC 5TY0A 3TQQA 3IT3A 2XTMA 4U00A 1QK4A 4TT3D 4S2EA 1IL0A 3CISA 3CNQS 4OB7A 4Q1AA 4GLBA 4I4CA 3RI3A 1O57A 2OBNA 4TMVA 3UG6A 3KBBA 2F8SA 4MIKA 1TVEA 4CM3A 1P72A 4MWSA 5CHEA 2FMXA 4OMUA 1VHTA 3ENWA 4ZMRA 4UHKA 1E66A 1JILA 5JLAA 1P7CA 1PGQA 4N9WA 1C1XA 4OB8A 1XK7A 3NDIA 7ADHA 4ZDWA 4AKIA 1QP8A 1NFFA 3HCWA 1DKNA 3QJYA 4XASA 4P4SA 5PNTA 3HB9A 1XAGA 2G72A 2YY7A 4R9RA 4PN7A 2J41A 3UFXA 2AI1A 2VQ3A 3EUAA 1GNPA 1Q0PA 4HLQB 5LIRA 4KIWA 5EXEA 3W3AA 5B7QA 4NZNA 2BW0A 2HMWA 4DANA 4F3YA 3K8YA 5HKKA 4LXGA 3I2GA 5HCUA 2Y0BA 4PYMA 3DOOA 4HUQA 3GGDA 1GTZA 3GELA 3Q12A 1TU3A 2E7ZA 1QLHA 4AQDA 4BE4A 3L0CA 3O8QA 2YUTA 3T5CA 1H3FA 1JR4A 1Y81A 1M2WA 2PNFA 2UVPB 4D8UA 1LS1A 4OL0A 4C30A 1R0CA 1LLCA 4NOKA 2QTBA 3EBPA 4BRWA 2QWXA 3BS4A 4ZOLA 4LXQA 1R9JA 4N5NA 2HNKA 3SIWA 1LDBA 1VJ5A 1UCFA 4KGZA 2KJQA 1A5SB 3R9KA 3WBKA 4DLNA 2EGGA 2QD5A 1USWA 5F3DA 4U8GA 3NHRA 4D6PA 3OZVA 1NBAA 3GH1A 5CNJA 5C5DA 1QG6A 1QGUB 1DX4A 4QQNA 3ZDEA 5DNVA 2FV8A 1D6JA 3BT7A 3I9KA 3I5XA 4Q48A 1KEVA 2GPAA 4GZ3A 3WADA 4BNUA 3W77A 4OLBA 3S27A 2V7EA 1YS2X 3T7TA 3W4IA 2PXCA 3TOVA 4BASA 5A5DA 1HTTA 1ELOA 3P4YA 3FX2A 2OK7A 4XFKA 1Z7BA 2HU7A 4KXFB 3WMWA 4S35A 2YQZA 4O33A 3DKRA 4LMRA 4PF1A 3NBXX 3GRVA 5JC8A 3ROMA 3OOYA 4J7CA 3JYLA 3QBVA 3WK4A 3I28A 2WTBA 2O7RA 1UDRA 1CK4A 3KPYA 1UK9A 3IPCA 1YZGA 1IZYA 3QX8A 4MR9A 3WGNA 3ZD7A 4MJ3A 4EI9A 1Q7BA 2IV7A 4EO7A 1EX6A 1FQKA 1QONA 2C8VA 3ESCA 1NUUA 4MUMA 4N82A 4BMNA 4FFRA 1KTVA 4PLPA 3A10A 1M2HA 1N3BA 2QQ0A 2I2WA 4PAWA 4V2IA 2FVYA 1LBTA 1NRWA 3DZCA 3ONWA 3QTTA 5DCLA 3C4QA 5KYUA 2P1DA 3TW4A 1E7RA 1S5PA 3OPYB 4KYTA 1N2CA 3ZK9A 1N57A 4DSZA 1TQ2A 4FDLA 3KG2A 4M1ZA 5AM4A 4H6PA 4BVLA 4WBNF 3H42B 1XPJA 3NTUA 3EPJA 2QJTA 2VH1A 5CBKA 1MOZA 3ANMA 4L28A 1EDDA 4ZOLB 2ZM5A 4UUOA 2YVQA 4E5VA 1N6NA 2LZ0A 4IJWA 1M2KA 1UMDA 3OIGA 3OQ6A 2D7JA 3W5CA 1RC8A 2XXAB 1E2PA 5AJTA 1T9GR 1K5PA 2QUAA 1D0VA 1TO2E 3IP3A 5HBRA 3C24A 4S1TA 2PA3A 4MWTA 3ZCPA 1SUSA 3DZHA 4BX9A 1IDOA 3G8DA 3DMGA 4TVSA 1RLTA 1GL3A 4DIBA 4E14A 2GFIA 2ADOA 3JQGB 4LDNA 1SXHA 3RFTA 2I8LA 1MHPA 2A5LA 3DDOA 3PCTA 1TIBA 1EFCA 1V5WA 3INGA 4TT8A 2G4CA 3DE0X 3UCXA 5CXQA 2WAOA 3HYTA 4PLGA 1KJJA 2HMAA 3PL5A 3Q3EA 4R1QA 2FZ5A 3LOQA 4B43A 4DG8A 3AUUA 1QE5A 2PZMA 2XCLA 4ZI7B 5I4BA 3H3XA 2I0FA 4PO9A 1P3JA 3VR5D 1Z38A 1L5HA 4Z3KA 1XCJA 2NU6B 3WHIA 1OAOA 1B2LA 1BKSB 3EH1A 1TMGE 4C01A 1J2JA 1BKYA 1H8ED 3SKXA 5JY1A 3KSMA 3B9PA 1SVUA 2DKNA 3AB7A 4Q9HA 3ZHSA 2FG7C 1HNNA 2VF5X 2ZJYA 3LT4A 4IYRA 4UFNA 3WGYA 1U3WA 2JI6A 4PZCA 1SAYA 1XYYA 3C3XA 4S0ZA 5EWMB 4A6XA 1OREA 4F6RA 2GZAA 2VDQB 1B2RA 2X7XA 1R4AA 3EXAA 1H93A 1Q7TA 1P62B 1P4RA 3V4RA 3SEQA 4BE9A 2E85A 1OBCA 2PTGA 3IP5A 3UEOA 1HT1E 2OO3A 4YEDA 3A4NA 1U0LA 3LO8A 3TIFA 2CLMB 5EP1A 1L5YA 4QM6A 4N0DA 4CEIA 3H2ZA 4KC0A 1TF7A 4PZYA 1HTWA 4TKLA 4UXIA 5DX8A 1QV7A 5KHAA 4C05A 3N07A 5EP3A 1EZ4A 4GSKA 4EPRA 3V1MA 3ME5A 3DOJA 2FZGA 4KPGA 4BTVA 3RH0A 8ABPA 2DCUA 4KK3A 3WSVA 4DDHA 3T7KA 1D9ZA 2WB2A 2N1BA 3BHJA 2A1UB 3K94A 2CFOA 3P2EA 1JXQA 1P29A 5I7AA 3WMGA 3OQNA 1B26A 3QXHA 3BZUA 1D1TA 3TZBA 5HJ2A 2GBPA 3IXQA 4B3FX 4YRDA 4TQ9A 2FN9A 1VCOA 1HM5A 1NZDA 4KWHA 3FVWA 4R1OA 3NOXA 1U11A 3OCYA 1OXSC 2BEVA 4HDQB 3B89A 4PLHA 4RZSA 4ER5A 2P2DA 5EERA 4N5DA 1HL3A 4QYSA 4IUYA 3GAZA 3L4JA 1A8UA 3EIHA 2OZVA 4FK8A 1R4MB 4QRHA 1NE7A 3MLBA 2VBGA 3F8WA 2QT1A 3RC7A 2YYZA 3QWBA 5LMNB 5E6SB 4ZOQI 5BUCA 3CFYA 2JIPA 3EOZA 4ESVA 1URPA 3CN9A 4B2LA 4B3HA 3ST7A 5KVVA 2Q9UA 1KOGA 4BX0A 5IEJA 2C07A 1JH9A 2JGDB 2ZYTX 5J40A 3H0CA 5J63A 3NYRA 3G5LA 4TLBA 3T4EA 1L8OA 1XHFA 3TR5A 1P2SA 2PT6A 3QXGA 4UM8B 2BOVA 2GX6A 4DNFA 1ZYUA 5CIYA 4CEHA 4PHCA 4UZEA 2HRRA 2I7XA 2DH6A 1T0IA 1TQ8A 3F3MA 3RS5A 1N2JA 1S9DA 1RWVA 3O84A 4TQUS 2G6TA 4RPJA 1WD5A 1WNFA 2HLDA 2VUUA 2WK1A 1IRXA 2IWRA 3K9QO 3VUFA 2GFHA 3WBJA 2VA9A 5F2EA 4QPZA 1JPUA 3UC5A 1DXYA 5BQXA 1AXEA 2OG1A 1Q50A 2VAMA 4NXNB 3NETA 3KWLA 2OFPA 2H7VA 2ILTA 4R54A 1B43A 1JL3A 3NGMA 5FTWA 1MRNA 1KZ4A 1FPQA 3B6EA 4HY3A 4JV5B 1ZR4A 4B7XA 1NMQA 2GESA 2C7BA 4MLZA 2PMKA 5DWQA 4H0FA 2EZ4A 5D3MB 2ZDHA 1DU4A 3NC1C 1H05A 4JLOA 4WIAA 1NP7A 2CGEA 5EPOA 5T6MA 4B8YA 2H00A 1RAGA 3IV6A 1RI4A 1HGXA 3GPBA 4NU0A 4BP9A 2ZI5A 2DF8A 1Q1BA 1ZD5A 2Q4OA 3MWKA 1M54A 1T4CA 1ZDMA 1MD9A 3JYPA 2X8BA 4RZ3A 3U56A 1XNRB 4S1WA 3DVQX 1E58A 1L8QA 4IDCA 5JSQA 3Q3VA 5DM0A 3ZXIA 3U7HB 3M34A 4IS2A 3CTPA 4LXHA 4HD8A 3SXUA 4J94A 1V4NA 2DULA 2WMNB 2ZT6A 2ZYDA 1TLLA 4REOA 2AYZA 3O3MB 4NZPA 4OF4A 1QWOA 1T0HB 1TUIA 2BRUA 4H1UA 4C5CA 4ZPXA 1LNQA 4ZXPA 3RUHA 4BRSA 4LHZA 4DYDA 3E6AA 2Z5LA 1T6YA 2FG6C 1E2FA 2FQWA 1W6UA 2P2ZA 3GZNB 1GAJA 2PMCA 1E7QA 5DI9A 4EJSB 4LMAA 1VLHA 1QKIA 3TLAA 1NJ2A 3P45A 3LO5A 3KEGA 2G4VA 2OGUA 2YV5A 1KEWA 3OT1A 3HVIA 3NWOA 4GBMA 4MQMA 4PVDA 1KE1A 4CDRA 4ZTUB 2Y9MB 3ILHA 4Q3CA 3ZHRA 1T43A 4BQRA 3CN7A 4WPGA 3G79A 1KZ1A 1BHQ1 2HUPA 3QPUA 4DS3A 2JGNA 1XCOA 3NYQA 2FSIA 3PSHA 3QU9A 2WUGA 3L07A 4GC9A 1JPNA 2PA0A 1PDOA 2OAGA 5CVJA 4L4XA 3A6DA 4AKTA 4BNIA 3UKOA 3HDYA 4QBKA 2GF2A 4RV9A 4WKCA 4YWHA 2V5UA 2VK1A 3D8UA 3EWAA 1DQYA 3OX3A 4FMCF 4NVRA 3RVQA 2ZKIA 1AZTA 4ZMSA 5LQCA 3PPXA 5BR4A 2G63A 4EVQA 4GNKA 3ZU3A 2OV8A 1E79A 5D3MA 1U94A 4AO6A 4DMUB 5K45A 3CF0A 1G98A 4N7MA 2RFLA 4ZVPA 3V48A 1JG7A 1TXGA 1V71A 2C2XA 3W2FA 4FWTA 1U63A 4QTYA 2NV2B 2GPBA 2N47A 2QZ9A 2QAGA 2I3DA 3JQAD 1OFTA 3HMKA 3SF0A 3TLGA 1ZUWA 3PHLA 3HGTA 3DLIA 1Z5UA 2IP1A 1XDZA 2HLPA 1OU4A 2XIJA 4XWTA 3EQ2A 3HVHA 5MDHA 3UPTA 3MMPA 2W6NA 2VCHA 4EI2A 2JGRA 3DVLA 3ICQB 2X8LA 1ZM7A 5IHXA 3HWX1 2LP4Y 1F0KA 2HA5A 1B6TA 1D8AA 1HUQA 1K3FA 5JNUA 3CF4G 4KRFA 1MJGA 2BJVA 1P45A 1U3GA 1MX9A 1MIOA 5GGYA 4EGJA 1ZZGA 2ZI4A 3JYNA 4FT4A 4HWGA 4BV8A 1OPRA 1K08A 5GP1A 4C7VA 3OC0A 1AA9A 2Q7OE 4P4SB 4RE5A 2IPAB 1II8B 1C29B 2G9VA 2YCBA 4XVCA 4Z6KA 5HDBB 2ZREA 4FOLA 4H4CA 1BXKA 1BHO1 3T7IA 2N46A 3V9PA 1O3YA 3OJXA 3RC2A 1XT6A 1NPTO 3GFQA 2ZRFA 2H57A 3OECA 2QENA 1Q6YA 3DD1A 4CM5A 4IV0A 1ETHA 3TNJA 4R7ZA 4C87A 1NNSA 2CJWA 1JJAA 1U90A 1W44A 4HGOA 4TRNA 1L7PA 5ESRA 1OFIA 3ADCA 4LF5B 1YBAA 1AUPA 3BULA 3Q9LA 2IVFA 5LYJA 2EKZA 4I66A 4B2YA 2WJJA 3HN2A 4RY8A 2H54A 2G82A 4N4AA 1Q3TA 1ID1A 4INOA 4CEJB 1U65A 1YDEA 4OJKA 2ZJ5A 2HA4A 2F8LA 4PCLA 2W2PA 2IXGA 3BJRA 4PE5B 5KAPA 4D81A 5FV4A 4G3XA 3RAPR 1I10A 3B3FA 1OX4A 2ZCVA 4K03A 4NY1A 5EE1A 1Y5LA 3K0KA 4JJKA 3GVXA 1P4JA 4X84A 5LNK1 3IUQA 2R1VB 3Q8XB 5I9MA 1Y7TA 1FA9A 3BWEA 4K6CA 3DC2A 1JDVA 4N0EA 5KEIA 1CDOA 4LWQA 1RQGA 1XA3A 3RRYA 2GK4A 1QCCA 4IHQA 4LFCB 3TX6A 1S8NA 1Z83A 2A5FA 5ENVA 3ZE0B 2C1XA 2NSLA 2WKSA 2ALJA 1FVXA 2Z58A 3N2NA 3PLRA 1F1BA 2Z8YM 3CR7A 1KWKA 4P7GA 1BXRB 1DJLA 1PR6A 5AW4A 5CDSA 2J0UA 3JYQA 3UJHA 3WIOA 2XQJA 3VJRA 1P2BA 1LI5A 4ZEOA 1EVEA 2HF2A 4HB4A 1THZA 3MUEA 1SG9A 1G2OA 2PGLA 2XVMA 1WHSB 1Y8RB 2FLVA 3DCNA 3DE6X 1RWQA 3DBRA 4MR7B 1X7HA 1SBZA 4HPXB 4OGKA 3ZIAA 4PYOA 1GPBA 1YRAA 5INTA 2VTBA 4C21A 3ZE1B 4CQMB 1N2CE 1JRLA 1EZ1A 1YOVB 1U31A 2GEFA 1SQ5A 2HTFA 4H16A 2DVMA 3H9GA 3HNRA 4GX2A 3TB6A 3VKFA 3A1CA 1GPAA 1EM8A 3B6JA 3IOYA 4NG4A 4PPFA 5BR7A 3VVCA 4XW2A 1MFPA 4BATA 5IC6A 3GJ7A 4HH3C 4HAXA 3RTDA 2WD9A 3MVEA 4F2HA 1ZUHA 2GARA 3L40A 1KSGA 3RD5A 1MO4A 4IJVA 3A31A 4J6FA 5IUKC 1SCUA 2Z09A 1RJ9B 2YDXA 2AYXA 2SCUB 2ZRCA 3FGPA 2IXDA 3LBAA 4WZBA 1OIVA 2Q3HA 3VHLB 3L04A 2JFXA 4FDVA 4R8VA 3PDIA 3HK2A 5EIBC 3CURA 3IXLA 3NOOA 1F20A 2AJCA 3W5BA 1AKTA 1CR0A 4Q03A 3W5DA 3O4IA 4K5QA 3R7DA 3GJSA 1JKJA 4L5CA 1YA4A 3RVBA 3VRHA 2GNAA 5DLYA 4DB4A 4MYSA 4YK7A 2QUBA 4TMKA 4F8EA 2CLLB 3WFZA 3AVXA 1JAXA 2VUHB 3GD5A 3PFWO 1FS5A 1RC1A 4WNCA 2OHHA 4EW2A 4BEVA 1CEYA 1NUAA 1P33A 5ALQA 1NRIA 4IYJA 4KNVA 1L5FA 4EPYA 2I67A 5CDUA 3K70D 5BWLA 1F2VA 2VYFA 4MQEA 4ZTZB 1GTJ1 4QG7A 2XCRB 1KK3A 5B1SA 3PE3A 4CE6A 3ZLJA 5F3RA 1KMIY 1YSCA 2C4MA 3HACA 3KFVA 4BN5A 4DR3B 1L3CA 2ZSEA 4XVQA 1W0KD 1FNCA 1A5AB 2WHPB 4HN9A 3R8CA 3BSYA 4CL8A 3H5TA 4PC3A 1U7HA 1T26A 3B7PA 2B4RO 3JSAA 4PZDA 2FUG6 3ZE8A 2W83A 1JLRA 3M1LA 3LXMA 2P2LA 2X0RA 3A04A 4FOOA 4L5JA 4C0HA 4FNGA 1YQGA 2UUPA 3FHJA 3W5UA 1NRXA 1BEZA 4YRSA 3PF9A 5LB4A 2G9NA 2OO5C 4TSRA 1ACJA 4YY3B 4FZVA 1ZIXA 2P0AA 3SN6A 3NIWA 1R8SA 1SZPA 1Z6ZA 3EUEA 2FPWA 4L72A 3WMFA 3X1XA 1ODFA 1MOPA 4X64B 2C92A 4E5NA 1JYEA 4FS3A 1IOWA 3IJEB 4I3FA 2W00A 1CSEE 4W5HA 5EVJA 5KHOC 4M9SA 3WB9A 1JBQA 2O05A 1RHMA 2REQB 5KX5A 1GTRA 4IXWA 1JHOA 1FUYB 3HKCB 3TLEA 3GO4A 3OIVA 4OJMX 3IILA 1GL6A 1GGKA 2IUSA 5T41A 4FM9A 1ZGAA 2IE8A 4FEEA 2JLQA 1JFFB 4RAOA 5CB4F 1JAHA 3M83A 3BA1A 1HPLA 3OIWA 1NVXQ 1VMKA 2HWXA 4R2LA 3L8HA 4K3VA 4Q4DA 1FNSA 1CY2A 5D1NA 2IHJA 5E1DA 2X15A 3AZQA 2DFKB 5K0FA 3P2OA 1O6FA 4BO1A 1YIOA 4UAVA 4AMVA 2P2CA 3MJ4A 4Y2VA 5D51S 4DV1B 1FXSA 1HR0B 3TZEA 1V8OA 1GDDA 1E1RD 1CQIB 2O0LA 1ADJA 3L84A 5IJAA 3HYLA 1GG8A 1RTKA 1MH1A 3IP7A 2MOKA 3ANXA 4M8LA 2QTFA 5G3YA 2HM7A 1R3DA 4RWZA 521PA 2JLUA 3VNVA 1EJ2A 1J24A 3LY8A 3OZIA 2XYQA 3SM3A 3UAXA 2Y6UA 4GOXA 3AR4A 2V96A 4K3UA 1KAQA 3O1IC 3MIZA 1L7AA 4UNNA 1E2IA 1XWIA 2RB5A 1ZBDA 1DIAA 2ILVA 1SBQA 3EUWA 3NC0C 4RK6A 3WBFA 4HVCA 3EF3A 1M5RA 1XKXA 3GQVA 4F06A 2GTHA 3F0TA 4FFWA 4HS4A 4DADA 4YUZA 1Z63A 4H7JA 3RSOA 2I9KA 1NJFA 2FNAA 2QM0A 1ZBQA 4BV3A 3HFGA 5JHHB 4X54A 3G0CA 4NJMB 3UJ6A 4JCCA 2AQIA 1SIUA 3VMFA 4AYWA 2G17A 4H0CA 1GA1A 4IOJA 1FTNA 3MSCA 2ONZA 1QZ3A 2KWIA 2PKXA 2ZI9A 2JVIA 1B1CA 3HJTA 4X90A 1ULAA 4BIMA 4OHWA 3O0TA 3WAJA 1T4BA 2GZRA 3CRW1 4J9VA 2OC4A 2R5NA 2GO1A 1AGYA 1X8LA 2DLCX 1NUQA 2F55A 2ZCJA 3RJZA 1T1JA 1BX3A 5E7QA 1MO6A 1QB8A 3RJTA 3V2GA 5LVAA 1KF0A 1GPYA 3TB4A 1CW2B 3RVSA 4XWKA 5JBQA 5LBUA 2NN3C 5J2UF 3AOGA 3DV2A 2NM0A 4LYEA 1FNDA 3S1AB 2O3UA 5AVTA 5CCDA 4EB6A 3B1YA 2JI4A 1QRDA 1OAAA 3N5KA 1VG0B 4O02B 4RTRA 2QM7A 4LISA 1C9KA 3LIIA 4QUKA 4FILA 2R4TA 3U31A 1UWKA 1J09A 3KTAB 5FX2A 4LWOA 1SUIA 3I09A 1Y6JA 3WGMA 3MWYW 2VYND 3G49A 4ZQIA 2CHQA 5DOVA 2JH8A 3VYTB 2ZE6A 3Q40A 1WSWA 1PFUA 2ZRKA 3C15C 2EG5A 3K8OE 1GQSA 4FNMA 5IDYA 1I2AA 2EZ8A 1F9AA 5NULA 4BC1A 4DM4A 3GEHA 5CIQA 3F6RA 3IKLA 2BISA 5ALXA 1IOLA 3HZZA 3L4BA 5AM5A 1GPWB 3O8RA 2VBCA 3FZGA 4HDMA 2HMSA 3L01A 1V11B 3OTGA 4BN0A 4KAJA 1EEXB 1CS4C 2PX2A 3KUUA 3H5LA 1TOAA 4IWNA 1MJNA 2XB6A 4L8WB 4PG6A 1T1RA 3FOBA 1T9CA 3DDUA 1QVAA 3HU1A 3ZNQA 5IBRA 2HY7A 2J3KA 3VH1A 1FU8A 4RMGA 3IBGA 3ZHVA 1TECE 5FI1B 4ZQCB 1D2MA 2AN5A 4BU0A 4ZT2A 3BMQB 3ILSA 1XVTA 1QDLB 3G2MA 4F4DA 2B0JA 1BYUA 1BG6A 4NAUA 5IN5A 1AXGA 3G2HA 1K63A 4U9HS 1P6UA 4O3MA 4F92B 1S96A 2WRZA 2P9EA 3BWMA 4KKXB 4C3UA 5LXTF 3R76A 4DWJA 3DR3A 3NM4A 2A94A 2FPKA 2FJ0A 3DE4X 3ZTWA 3PLAE 3FNRA 2A86A 3CGWA 3T7EA 2UU9B 2HDHA 5HSGA 1NXPA 5C2JB 4OLFA 4YV1A 3VU9B 5EJ6A 1KH1A 2WUWE 2XNDD 3FWYA 4JDUA 2WG1A 2GSWA 2VQ6A 4B48A 4ZCPA 4MITA 3P9ZA 2W43A 2QXYA 3H5AA 3C6ZA 4FU0A 1N0WA 4TQAA 1E8DA 2ZRHA 1KFEB 3L7JA 5EZQA 3WK5A 3GJTA 2EDAA 4D9NA 2QBYB 4P3XA 3PPYA 4RGVA 4JX9A 3DQQA 1JLLA 1M1YA 1M2OB 5AJYA 4H7PA 3EEBA 4M3NA 1WQ3A 3I04M 4XX0A 5KMGB 3ZV4A 5DBHX 4HUQB 4MV7A 4Z2AA 2IYOA 2YIVX 1ECCA 3WZMA 5LM3A 3ENNA 4EHJA 1YB2A 3NTRA 4CTNA 1XHLA 3OP4A 1KETA 4KWTA 5LU9A 5HOEA 3FLMA 3JWHA 1PK8A 3TIXB 5BWMA 4M89A 4EBBA 1BX0A 3QVLA 4TMWA 1IY9A 3T3HA 3DB2A 1G66A 5ESDA 2YVLA 3C8DA 4UTXA 4ZC8A 3AONB 1MDFA 3DP7A 4OG2A 3SLGA 3VKUA 2MCFA 3AUJB 4I6EA 4AN4A 2RGWA 3VOAA 4G4IA 2BYTA 1J8QA 1N6KA 4LF4B 4KSBA 1M33A 2PLRA 5CA0F 2IEBA 5L3ZA 2XYHA 3V8VA 3HU3A 5JI3E 2EEZA 4KO8A 1W52X 2RHWA 1HNZB 1L3IA 2R00A 1BXGA 4S0XA 1ARZA 4O2LA 3RT7A 1UUFA 1T2VA 3OCUA 2JK1A 3L7IA 3LPAA 2C2ZA 4K2HA 2REOA 4LJAA 1S8AA 4J1SA 3EB9A 1HQDA 2FI1A 2I76A 3NRJA 5CFNA 2ZDGA 2VNIA 4OQQA 4B81A 1L0BA 1Z4LA 2VHWA 2XOKA 5FTNA 5A0VA 2W6MA 4K6KA 1A50B 4M55A 1E1KA 2D4AA 3NDPA 3PWSA 4NESA 5DLEA 3P20A 4YO7A 4RENA 1EUYA 4RLHA 2HJHA 3JWJA 2WYHA 3CO0S 4RQAA 3BMOB 4MB2A 1E9RA 3L1KA 5FPTA 4ENPA 4MR8A 5BMVA 2AE2A 3RAEC 1PYGA 4TTRA 2IS1A 1BCRA 3EXG1 4EHNA 5ALLA 3IELA 3QU4A 1TIPA 2JLRA 4ZT5A 3CRNA 4OI1A 2O1EA 2NADA 2JEOA 1EFTA 1GRQA 1XN1A 2Y92A 2DECA 3TOZA 1TKRA 4WK0B 1RKBA 5AQEA 3KQMA 2DQYA 4IZOA 4NP6A 3VKVA 5B1EA 2OY0A 3DVRX 5HRCA 3L0BA 1YS7A 2Z6VA 1BN6A 4BNHA 2E2WA 4TMFA 4NLLA 3LFTA 2W2LA 2QRKA 1YDGA 2R8OA 3TPZA 1K4YA 2WHEA 5B3AA 2NU6A 2QTWB 4GKJB 1RD4A 2IUEA 1G8FA 1PZEA 3ZHOA 2DXIA 3QEMB 5BMOA 4K81B 3A9RA 4ALIA 1KMMA 2ZRJA 1TQ4A 3IYLW 4KIUA 4KQCA 2VCEA 1P1IA 2V65A 4JGBA 2NXNA 3NOQA 4ND8B 2JEZA 4FMDF 4CLRB 5BV7A 1PBNA 4BC0A 5D5QA 4KFSA 1REQB 2DERA 4K9KA 4R9VA 4D0RA 1P74A 3L8YA 1DAPA 3ORYA 4XYGA 3G7UA 1UMBA 1DOAA 1MV5A 721PA 4OHUA 2DBYA 3MMXA 1E1YA 2AEMA 1SXJD 1OXMA 1L8AA 2ODWA 3TNDA 2IZ1A 4AKGA 2AOUA 3AVVA 3QGMA 2AJ8A 2YMQA 4D3SA 4UUPA 2ZIXA 1Z4IA 3M6XA 1D07A 4OXYA 3WWPA 4IIHA