4FILA

Structure of fhud2 from staphylococcus aureus with bound ferrioxamine b
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
256
structure length
256
Chain Sequence
PKRIAVVAPTYAGGLKKLGANIVAVNQQVDQSKVLKDKFKGVTKIGDGDVEKVAKEKPDLIIVYSTDKDIAAYQAVAPTVVVDYNKHKYLEQQEMLGKIVGKEDKVKAWKKDWEETTAKDGKEIKKAIGQDATVSLFDEFDKKLYTYGDNWGRGGEVLYQAFGLKMQPEQQKLTAKAGWAEVKQEEIEKYAGDYIVSTSEGKPTPGYESTNMWKNLKATKEGHIVKVDAGTYWYNDPYTLDFMRKDLKEKLIKAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Ferric hydroxamate receptor 2
publication title Crystal and solution structure analysis of FhuD2 from Staphylococcus aureus in multiple unliganded conformations and bound to ferrioxamine-B.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 92
structure length 256
sequence length 256
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4filA02
3AEQB 2XY4A 1M1YA 2PHZA 4OXRA 3MINA 5JPDA 5M29A 5JOQA 4WZBB 1N2CA 2XDQA 4ND8A 1XVLA 1K2VN 4OVKA 4NNPA 2QI9F 4WNAB 2XQVA 5HX7A 4K3VA 3AEUB 4NNOA 2ETVA 3R5SA 5KHLB 2OGWA 3ZTTA 4MDYA 4G09A 1M34A 3ZK9A 2OV3A 4WESA 4BBPA 4WNAA 1M1NB 2RG7A 4MX8A 2MINA 3AERB 3TEFA 1K7SN 2WI8A 4HN9A 4LS3A 1G20A 4TKUA 5I4KA 1KAEA 5HDQA 3HH8A 4XPIB 1K75A 4HMPA 4FI3F 4B8YA 1QGUB 4UTOA 1G21B 2OV1A 4MLZA 4UDNA 5KOJB 1QH1B 1H1LB 5BVHB 4HMQA 4IRMA 5FLYA 3MWGA 3CX3A 3BE5A 3U7QB 4UTPA 5M3BA 2AFIA 5JJ5A 5CX1A 2AFHB 4PAGA 3PSHA 3AEQA 4GICA 5M34A 3K1AA 4WN9B 4DBLE 3EIWA 2XUZA 3MFQA 1QH8B 1KARA 5GGXA 1H1LA 3R5TA 4WZBA 4N01A 2O1EA 4OXQA 2M6LA 2AFHA 3ZKAA 3AEUA 5B58T 3UJPA 1N4DA 4H0FA 3BE6A 4UDOA 5KOHB 5BVGB 3TLKA 1EFDN 5CR9A 5JG7A 1M1NA 3MD9A 4WZAB 3AERA 2R79A 4FKMA 3G9QA 4TKVB 3AESB 4XPIA 1L5HB 2OSVA 3AEKB 3NU1A 3PDIB 1QGUA 3AETA 2PS0A 2Q8QA 2PS9A 1G21A 1N2ZA 3AETB 3K1AB 1QH1A 5KOJA 4HMOA 5BVHA 1M1YB 3MWFA 4MO9A 2XV1A 3MINB 2M6KA 1FP4B 1PSZA 3U7QA 3ZK7A 2XDQB 4FNAA 2PRSA 4LJSA 4M7OA 5GGYA 5M2QA 2YNMC 4INOA 3EIXA 4INPA 4WN9A 1QH8A 4G07A 1FP4A 1M34B 1K0FA 3ZK8A 4WESB 2X4LA 5AFSA 4PM4A 2R7AA 2Q8PA 2MINB 2YNMD 5KOHA 3GI1A 1G20B 4TKUB 5BVGA 3HXPA 3HJTA 1MIOB 1ESZA 4WZAA 2PS3A 3PSAA 3LI2A 1N4AA 2XH8A 4FILA 3LHSA 4TKVA 3AESA 1TOAA 1N2CB 1L5HA 2WHYA 3TNYA 3AEKA 3PDIA 4ND8B 4CL2A 2AFIB 1MIOA 5CX1B 1PQ4A 4H59A 1KAHA
chains in the Genus database with same CATH superfamily
1FVFA 3ZHQA 4N18A 4PZZA 4DEXA 3P0HA 1OAAA 1ECLA 4ZHQF 4L5CA 4DYVA 1AMNA 1BE1A 1JHOA 2HIAA 4M38A 4LECA 1CETA 5FKJA 4DDWA 1P7CA 3ZY5A 4UM9B 4LF5B 3QHAA 2OYRA 3TGPA 3C8UA 4L0CA 5KTMA 4TWBA 4FR2A 1EWRA 2B5VA 2EIXA 1RQXA 1SKUA 3FDXA 2O0KA 4YFYA 4PO8A 2HTEA 2ZWVA 2VTBB 3COZA 4X64B 3ADPA 2E4VA 1KYXA 3UV3A 3QA3E 4V03A 3NM4A 4FOTA 1N7IA 3NQ41 4MIEA 3MUEA 3M6AA 4AULA 2NSDA 3EOBI 3F4BA 3NW9A 5DXFA 2B4TO 4TGLA 1YRAA 2Z5FA 3CWZA 1W7AA 4XLTA 4HMQA 3UMVA 2I2WA 1RCTE 3AHFA 3TPFA 3T1YB 3WKBA 1TA0A 5C1BA 1A9QA 4R05A 4RTQA 3SHWA 3KFXA 4ABYA 1S2GA 2WF8A 3R3UA 2ZB3A 3R7BA 4GKJB 4I55A 3MTGA 4EO9A 3ZVMA 4J0FA 3WK6A 5TF4A 4HN2A 4LXUA 2Y2VA 3N75A 2PSDA 3SX4A 2RGBA 3SAJA 4BQQA 3PWZA 4OXQA 1UR5A 821PA 4RK0A 3S1SA 1P2BA 3EGDB 5TVKA 4EZEA 3ZU6A 4JC4A 3VR1A 2QPOA 1HT0A 3QU9A 2VA9A 3THYB 2Q2OA 3LT4A 3JYNA 3CZRA 4J7CA 3Q1LA 5LIRA 2RHJA 1BMFD 2IOHA 1Y6RA 3AJ8A 2XIQA 3PHBE 2R79A 5D86A 4DC0A 1GGMA 3O2NA 4RSRA 2WD7B 3UJ9A 1UPCA 3NIFB 1TAQA 2Q7OE 4EW6A 3PPXA 3WLRA 5C0OE 1U8CB 1E58A 1Z7BA 1X7XA 2UZIR 2EKDA 4IO0A 3QOWA 2C4NA 4J1SA 3DAPA 1IZ0A 2ZGVA 3CVOA 5KNCA 3V4RA 1FTGA 3A6HA 5FUBA 1C1XB 4M0FA 3I6BA 1A8UA 1GAJA 1O97D 3ISVA 1RLMA 3PB3A 4E4YA 5I51A 5M2QA 1WY5A 3WGIA 2F3QA 3RWBA 3TZKA 1KMHA 3R0IA 3L5OA 4A6DA 2BFFA 3C98A 2V96A 2DH6A 2HJWA 3RS3A 5JMPA 4II3A 2P68A 1L6IA 5EWMB 3UA3A 4D8XA 3PTAA 4GNKA 1NXSA 3QUAA 1MB3A 1YQDA 1D2RA 3BKXA 4AS2A 1YDHA 1CJVC 1FZQA 4RCYA 2QU8A 5EE5B 1POXA 1K8YB 1E9RA 1RMTA 2JCSA 1YL7A 2WWIA 2Z5LA 2ZRPA 3VBEA 3WWYA 1YNSA 4EBBA 5JHHB 2YICA 1C9DB 2IYVA 3OCJA 3OA2A 3K71B 3BWXA 1PWXA 1DAIA 1X42A 1KO8A 4JOCA 4UDYX 4QG3A 5J58A 1SVOA 1CW2B 1M6VB 1W96A 2B3DA 2QJOA 2REXB 3K5HA 4ZC1A 1E2BA 3ZWWA 3UT5A 4DM4A 3PA8A 2J9YB 3PL5A 4GKBA 4MP3A 5BSHA 3RYCA 1UFQA 1FDSA 2HBYA 4MQEA 1KL7A 1TOAA 5DHRA 5K2MA 3D6NB 2CY0A 4K8OA 3CNNA 4QBHA 3B1VA 4ZOLA 1VI5A 4OHBA 3I9FA 5CURA 4GVXA 3ROTA 1Z6YA 5KREA 4Q01A 3N86A 4Z54A 2XRZA 2YS6A 4D97A 5A4AA 3JARB 2XVMA 4FYYA 4QTTB 2RH8A 2BV3A 2Y6UA 4JJKA 2GN0A 4BC1A 4W7HA 1G8FA 2C77A 2O7VA 2XGGA 1YZUA 2FX3A 1DHRA 1OV6A 2H54A 5HX7A 1FP2A 5DRTA 3R9XA 3GT4A 1RBMA 3F5SA 2NVOA 5TY0A 3D8SA 1RWPA 3BS4A 1M34A 1JBKA 3D2BA 3MERA 3BGOS 3GG2A 4EPVA 2BGGA 1J8QA 3FPBA 1DKRA 3GPLA 3FCCA 2GZ2A 5SZKB 4IGFA 3W9YA 3D7LA 5AHOA 1Y9DA 1Y8QB 1SCNE 1O95C 4G81A 4C5CA 3O2JA 2AFIE 1GR1A 1C8VB 1PL7A 1F7VA 5DNAA 4X1IA 4B3GA 3FZYA 1DX6A 1HORA 2DT5A 3CV3A 3ME5A 3QPWA 1LLQA 3OP1A 4LYGA 2PAFA 3OE1A 1Q2XA 4FK8A 4EECA 5KOJB 1NF3A 3QLVC 1X38A 4PG4A 4BO0A 2WWVD 5AW0A 2QIPA 3FYUA 4BX3A 5CB8A 2V58A 3RT1A 3TNLA 2ECFA 2QS9A 5EVCA 4Y0AA 3TQTA 4ZIRA 3CY6A 1KQGA 5IM4A 3QY0A 2WJVA 2JFWA 1QLWA 1XF9A 2C78A 3AHHA 2OENG 1KZ7B 3ESRA 3N07A 4TQAA 4ID9A 5TS2A 1EVQA 1GQFA 3SXUA 5BMOA 3RT9A 3E7PA 3K8QA 4AY4A 4C0KA 1QTNA 3T7KA 2VJKA 3GOQA 4HZUA 1HDXA 1FUEA 1DRVA 4HHEA 3AR8A 1UJBA 3LWDA 4MPTA 4V2IA 1IXZA 2H4FA 3ANSA 4H7HA 3I9V1 3OEED 2ROQA 4Q16A 4BJ5A 1YRHA 3LUGA 5KEIA 3UAVA 2PBZA 1NWHA 1V5GA 4RE5A 5K8JB 4ROSA 2OQIA 3EC2A 3EGWA 4Y1RA 3TSAA 4BB9A 2NO6A 5KYVA 1WOYA 4K9LA 1MABB 3K1ZA 1MQ8B 3QX9A 4DNPA 2GCEA 1E59A 5LYYA 2ZYAA 4F7DA 1AXGA 4NQZA 4DC9A 4DWOA 4AKIA 2BDUA 3Q8XB 1JKFA 1Q1EA 2EBUA 4TRNA 4LF4B 4UTNA 1YZFA 2TMDA 2ZVJA 4RPLA 3IEMA 3GEEA 3ZD7A 1KPGA 2FPUA 2C4MA 3M8KA 6GPBA 1NLYA 4K3UA 4KFUA 2YUIA 3TZLA 4EZBA 2HOQA 4RTKA 2C94A 4INPA 2E82A 2EW2A 3H42B 3NYRA 3HYCA 5FF9A 1I2BA 4LRYA 4CM1A 2EKBA 3C6KA 2PUGA 4WFKA 3PR1A 4G1MB 3QYFA 1G63A 1AOXA 1OX6A 2F1HA 4C76A 1VMAA 3O75A 3QU4A 5AHWA 3G2JA 1VPVA 2JGDB 3OFVA 1PR9A 1R10A 1ZN2A 4X7PA 2FEWB 1EA5A 2ZBDA 3LLVA 3D31A 1S0UA 3C48A 2GS9A 2VYQA 1U04A 1L8XA 1YZ3A 1ULAA 4L5AA 5ALZA 1U8AA 2RKOA 1RRPA 3KBBA 1OBOA 3LQRA 2Q62A 4KO1S 5SV2A 1EFKA 1AQIA 1ZD3A 3OU2A 4MH0R 3SYKA 1RRVA 3DXXA 1NUQA 3D02A 2IT1A 4JJ7A 4PLGA 3ZW7A 1OLSB 4WCFC 5JBIA 2WEKA 5KQSA 2ZT8A 1C9EA 1SUFA 2IIPA 1E5XA 1NVBA 3LBNA 3PCRB 3MT8A 4ICIA 3ZVNA 1D2GA 4LRUA 1ZUIA 3I1YA 3EAGA 1F2DA 2IE8A 2V97A 1IFXA 3EA0A 3RYHA 1AKWA 3WYNA 4C7JA 4DCOA 3PF9A 3SIRA 1RFGE 5AI6A 4CN9A 1FP7A 1PCXA 4TYWA 1CPYA 1HMYA 2EP7A 1Q16A 2XWPA 4Y6OA 5I7OA 1IB0A 5GY7A 1FFWA 5JH7F 2QL7A 2WYIA 3ZHVA 3FUCA 4NEQA 2J6HA 1TECE 1TVKB 3PC2A 4UZSA 4DIEA 3BRWA 5F1KA 3AERB 2J3KA 2VDRB 2HMVA 3DB1A 3KKZA 4R1NA 3UBTA 2GX6A 3G8CA 1N77A 2Q49A 3PPVA 1G8AA 3G8YA 3UAGA 2VHZA 5AHXA 4O4JF 1VE5A 2G88A 4DJJA 2G67A 2OBXA 3ICVA 3LS2A 5BXQC 4UPVA 5DHAA 4YRGA 1L7DA 2IYSA 2AJLI 3D3QA 3U7QB 5FBQB 4AKSA 3R3HA 1IH8A 4NBRA 1YR6A 5EWLB 1XTBA 3G2MA 4REOA 3UMGA 3GT3A 1CRZA 2BONA 2IV2X 3EODA 4CGZA 1GWNA 1BJRE 1W1IA 1SIWA 3R5TA 1Z34A 2QYOA 2QUBA 4A2PA 2M6RA 1E2DA 1QRTA 4F7WA 5EKXA 4BNDA 4BEBA 3HJHA 4ZXFA 3V4ZA 2RGYA 2B1GA 1QIHA 1U8UA 1BJKA 1KSJA 2A1TS 2PZFA 2P11A 3KPUA 4Q37A 4D57A 4DLZA 2Z08A 3K53A 2D0PB 2IXFA 3EPPA 3NATA 4H0FA 4C03A 2NYUA 4B85A 3PVSA 1DLIA 2UZ3A 3E3AA 3MAJA 4GM1A 4P4SB 1G7RA 1V2HE 3A6EA 4ZVRA 4DV4B 3K8ZA 2O8DA 1D3AA 1PFQA 1I7LA 2H0QA 1I0ZA 2QGZA 3H1FA 4MV8A 4NU5A 4OJMX 1RYMA 1V8PA 3DE0X 4TV9B 4GECA 3IOYA 1M6NA 3DL2A 4ENUA 3OPYI 4IS2A 4RPJA 2BKXA 4UUOA 3SSOA 2XMSA 2YDXA 1RJFA 3PJEA 4KX5A 4MKRA 4DT1A 4K9NA 1YA6A 2VWQA 3F2IA 1JQBA 1KH3A 5GTDA 2XV1A 3KZKA 3O83A 4HQOA 1WB5A 3BFVA 4KE6A 1GXSA 2VNAA 3DULA 3H2ZA 3ON5A 1QHXA 6ADHA 2P0EA 4DV0B 3Q0EA 1PL6A 4A73A 4EFLA 4QDOA 4WJLA 5CA1B 2EFYA 3KOOA 3LFUA 4NBNA 1XAIA 1A77A 3ROGA 5ARBA 3DMYA 3GLHB 1T1JA 2JBAB 2GPBA 2PYDA 3TUJC 2ID8A 3ZGVA 4G0QA 4CR6A 4JL8A 3EC1A 1JEJA 5THKA 3W1VA 1ETHA 5TR9A 1U0JA 2CDRA 3K9NA 4TRRA 5LMZA 3NVMB 1SUAA 3NPAA 1LK0A 3TG8A 2J5BA 3DCJA 2ZB4A 3KJFA 4MEJA 4KBYA 3DVLA 1KEZA 2B3TA 1HX7A 4EF4A 3BD9A 3MSXA 1GYPA 2HJ9A 3S81A 2I4LA 2EU8A 1F3LA 3QXHA 4YECA 3D0QA 1HRDA 3QPAA 3MBKA 5TPWB 1Q83A 1QWOA 2L2QA 5LZ8A 3MWLA 4DDHA 1J21A 5TQ2B 1FF9A 2I8LA 2R6ZA 3U1TA 5I7UA 2QYTA 2ZANA 1GA6A 4G8DA 2BBOA 1OI7A 1N33B 3AI2A 3OPQA 4XIJA 1W19A 3EVTA 3PUZA 1XRPA 4B6FA 4Z4IA 1WKCA 1ZH6A 4E5NA 4XWWA 5BMVB 2QT0A 3FM9A 3QRWA 3F8TA 3ZGOA 1JHPA 3ZXUB 1X7WB 3CQ9A 1XVLA 3TBFA 1W8DA 3LP6A 5I8WA 5LQCA 4YBZA 2IBSA 1XCJA 2C3OA 1IM8A 2ZIAA 2FF5A 1L4FA 4RYDA 2ZRBA 3V3KA 3WGNA 3FVQA 5H3LA 3PD0A 4DE5A 3BJZA 1MEJA 1V7PC 1WR8A 3K7EA 3U40A 3BQ9A 4RAQA 4TLEA 3F73A 2HMAA 3K20A 5FNVB 5KSZA 3N2KA 2R8YA 1XVUA 5AOCA 1CT9A 4M1EA 2FCRA 4Q1CA 4HXEB 3NOXA 4OQFA 4WHMA 1VPWA 3NKLA 4RS4A 5JCXA 1LSJA 1SVNA 4EEKA 2H00A 5JIBA 4M54A 3WJ2A 3IP1A 4R1OA 3S2IA 3OQVA 2C7OA 4BIIA 1H8EA 1Z26A 3G0IA 1J2RA 5J1SB 1Y42X 3G8BA 2XOEA 4KCGA 4J1QA 2H1OA 1XA3A 2FPWA 3K0CA 3GJTA 4B31A 4Y6QA 1P2TA 4YV1A 4MR9A 4EHJA 2A88A 2WUGA 2ZB2A 4OQXA 2Z2IA 4LJ9A 5AXDA 3URMA 3ETGA 4U39A 3AL2A 3PFIA 3F49S 1TKRA 4IGIA 4WZBA 4OAPA 2WIKA 3PQ6A 4MMXB 2VT3A 3FPSA 3HCCA 4GDMA 4KV9A 5HSGA 4WGFA 2K2WA 3CM0A 2ZB8A 3ENZA 3BSWA 4Q3AA 1PEDA 4RK5A 3VPSA 3G0BA 1IM2A 1TK2A 4LYJA 3ZHRA 4F4IA 5DK6A 1PGOA 1Q0QA 1QUFA 2CWWA 4GZLA 1AZSC 1DO8A 3WZLA 1V96A 1R0SA 3O9ZA 4QULA 2VSYA 2IW3A 1VE7A 1QHGA 2DWUA 5E0KB 3B1JA 4QYIB 1NX6A 2Z8XA 3FKQA 3OQIB 3W9UA 3L1UA 5FL7D 4G0VA 4ZZ2A 1GG8A 2ZTUA 4XB1A 2XCTB 1JIUA 4CMCA 4O8ZA 2Y0EA 3PDIB 3SMVA 3SC6A 2VF8A 1JYFA 2QRJA 3AKYA 3DZDA 2QMYA 3PNSA 4FEAA 3VYTB 5ITZA 1NY5A 2PX6A 1CWUA 2FQYA 3C3JA 4LOHA 3LFTA 5LLTA 3FOFC 3ZZ0A 3D3WB 5CVVA 5I9BA 5UKDA 4DANA 1D6MA 1TIBA 2G40A 2HLPA 3I83A 4BMZA 2H57A 3OZWA 4JJGA 2LKCA 3WL6A 1TKBA 1ZD2P 3CG0A 4Z53A 4H2DA 1HYHA 3WBKA 3KLPX 2HM7A 2R25B 1Z12A 1C1XA 4G07A 3DDSA 1YZGA 3HGTA 4JLSA 3GT7A 4Q9NA 1SFRA 4RPIA 2VNJA 4E5DA 2OZLA 3PHIA 4XQ9A 1H2FA 2HD4A 3Q2IA 4R7TA 1PZXA 2M9MA 3S1LA 3CXUA 4AUNA 3TXYA 5C4MA 2R7AA 1XN1A 3CB2A 1KTIA 2OLEA 2GSWA 1DBQA 2IXGA 3AHGA 1DWUA 3RAGA 3V7NA 1PZFA 3EEIA 3LSYA 1HNZB 3HXPA 5EHGA 2YOHA 1EWYA 4NARA 1OFVA 1M54A 2R8RA 4GOMD 1PK7A 3L49A 4KE9A 2JLZA 2A5GA 2J33A 4CIAA 2HDNB 1G5QA 1C8LA 3ZE8A 1PQYA 4OPMA 4G1UC 1U2QA 1NBIA 2CCKA 3QBEA 4TX1A 5GJCA 3ZHTA 5A4FS 2DFLA 1ULUA 1B1CA 3ROPA 1O6GA 1C30B 1JVBA 3T61A 1VMIA 2WMOB 1U7WA 1B23P 3EEOA 1K6MA 1JIIA 2ZWAA 1KI4A 3T1QA 4XYBA 4B2LA 2FW8A 4X7BA 5EE3A 1FQWA 2GD2A 4G1EB 1ECCA 4NNPA 4OMUA 5LQJA 3OE5A 1NP7A 3HGMA 4LTNA 4AJIA 3U1BA 1XPRA 4G0NA 1ZGJA 2HQSA 2IPOA 1G20E 4GBED 2PS1A 2DC1A 421PA 4NBKA 1XK7A 4OUDA 2OV3A 1BKYA 1Y9EA 1NV8A 2H4XA 2FKNA 5DIFA 4BBPA 3ESDA 2XXAB 4DMLA 1I1QB 1N9GA 5DTEA 1E5VA 3EF0A 3LTEA 2I33A 2CMGA 3PRYA 4TMYA 3TOSA 1JFTA 3SKYA 1M9NA 1KVRA 2O6HA 4NCIA 2NUPB 3F7OA 3MJSA 4U4AA 3S2SA 5EJEA 1BD3A 1VL1A 3ZLJA 1Z22A 4G0WA 1TJPB 1E3WA 5I5GA 2Z30A 3OQHA 4DLBA 3SWWA 3AQIA 1RI2A 2I7DA 2FSHA 2IEYA 1JPNA 1EFCA 1WE2A 1NVAA 1YJBA 2VHQA 5JS1A 4AZTA 2CCGA 1YC5A 4JGIA 1SBZA 3CBGA 3FFAA 4ONEA 3DR3A 1WPXA 2FEKA 3RK1A 1V6SA 1PZNA 1FNNA 4YRNA 5LQDA 2JD2A 2PGLA 4G0OA 2I22A 1B43A 5DSXA 5JC1A 3HS3A 4JK3A 3W04A 1PBNA 1ISIA 4KQ2A 3OD5A 1G6KA 5CBPA 2P5YA 2IWRA 2Z09A 3DXFA 3MIIA 5CXXA 2EZ9A 2UZ4A 1XT6A 5DLQC 3K2IA 1DAKA 1Z73A 2EWWA 3OEYA 1JHUA 2SECE 2AMFA 4KX3A 4OA8A 2DERA 1RYHA 2J41A 4IKPA 3I4LA 4KK3A 2B7BA 4NSNA 4UM8B 2NXJA 1XG5A 4PCAA 4BLTA 4E5PA 1QRAA 1XL0A 4RMIA 2QVGA 2PZMA 2OK8A 3GJZA 5EGNA 3UN1A 1TYBE 2ZIXA 4UATA 5FULA 1J06A 4M36A 2PL3A 4PPGA 3DTVB 4E12A 2PS0A 2FPGB 2EJWA 1BFDA 1J8VA 1GPBA 2C5SA 2DHQA 3DFMA 3EY9A 4S2EA 4DSTA 1YTLA 2F43B 3AGPA 2XMPA 3UWDA 1JHDA 3A70A 2PH1A 4M0LA 4N54A 3RBVA 4CLOB 5FX2A 2PTHA 2R48A 5KNDD 2GBLA 1JHYA 3W78A 4H7IA 4ZT7A 5E6RB 3VOBA 1BVHA 1XTUA 1FUUA 1JBQA 5KAMA 2A92A 4IM7A 2YZGA 3CKYA 4ISBA 3UMMA 1ZJJA 3PXCX 1Z18A 2SKDA 1RXWA 1LJLA 3ZWQA 3AKEA 2NXWA 4GIBA 4WXRA 4MIKA 3A9VA 3B20A 3HRIA 4O2AB 2ZM6B 5HJ7A 1H9AA 1N6HA 3Q8WA 1C8BA 1IHDA 1Q1GA 4U3JB 1BS9A 1KEEB 3GZNB 4JH0A 4PY2A 2X14A 4M1YA 5BV0A 4IF6A 2WJWA 3H2HA 3O0DA 3TSYA 1YR9A 4O5OA 4R0VA 2Z8ZA 4O0MA 1LPOA 1WXEA 2VDLB 4WT7A 2J6IA 2X5JO 1P29A 2QAGC 3KD3A 3S28A 4D3FA 4YX9A 1I4LD 4WFJA 4IJUA 4RCZA 3BHIA 3FVWA 3W2HA 4D0SA 5IJWA 1IYZA 1N3LA 3S2ZA 1E1CB 1EPUA 3RF6A 1T5OA 1Y5LA 3VZSA 2WIBA 3I34X 3EHEA 3GEMA 3GOHA 1U2DC 1TLTA 3HVJA 3AT1A 2VZEA 1RAGA 2FG5A 4R8LA 1QGZA 2DM6A 2C2YA 5IH7A 2YS7A 1R12A 4K6KA 1JPUA 4BVJA 1GNQA 2BZSA 2CLCX 4DYDA 1F20A 4ID3A 1KBZA 3KXLA 1VQ1A 3KPYA 4IDEA 4NS4A 3VR2A 5AW6A 4DBLC 2Z3ZA 1E4EB 3IA7A 3BFPA 4Q18A 1QGAA 2KPOA 4XVCA 5KJCA 5E2IA 3E05A 3MA0A 5AJUA 2XHEA 3PFGA 1LJ8A 4IKEA 4KQCA 5E6SA 1USUA 4FFPA 4YRKA 3DBLA 3HCWA 4ZGBA 1CTQA 4LWOA 4ZCMA 1J0DA 4HRAA 3T1VA 1NNLA 1KIFA 4Y9DA 2FSFA 2OCKA 1IWPB 3B8EA 4AS1A 1ACLA 2H9YA 3M6IA 1R0ZA 1H5UA 2DUJA 3VX3A 5LMCA 3LT5A 4EFKA 4INZA 3NLLA 1T6XA 2FPKA 4J7UA 3P0JA 1O5IA 1USVA 4LC9A 2BFAA 4A27A 3W5BA 4LTMA 1WD7A 3I4FA 5TF0A 3GY0A 3RTEA 5TARA 2X2EA 2WZCA 2ODQA 2V7XA 4DR4B 2CUKA 3H5TA 4YAWA 1OWMA 4GVPA 1G8PA 4ND2A 1FXWA 1WXIA 3N7TA 3T5DA 4CKZA 1W581 5JVDA 4GXRA 1RE0A 4GRDA 3W2TA 3LHDA 3BN3A 1UAGA 5L95A 3URKA 1YWGO 5DOVA 1A9YA 1I7DA 1B4DA 4NYJR 1VSVA 2QU7A 1YI0A 3DBOB 1F48A 4QYWA 4D0LB 5ISMA 2DP4E 4JB2A 1G21E 5F5NA 4Q82A 4XWOA 5KQRA 4EL5A 3ZJYA 1IL0A 3KSMA 1FTNA 5CNKA 1V5IA 1XAGA 3KOZA 2HWUA 3GMSA 3HEBA 4JBXA 4MHOA 5J4LA 4F93B 3B3AA 2VH2A 4ZHSA 4NBTA 5EVJA 1F60A 2Z2XA 2G09A 1RPTA 5FBKA 1K5DA 1NM5A 4GM4A 4P7BA 1BU5A 4NENB 4YCAA 3QBDA 1LF5A 4WOCA 5FJJA 721PA 3EXIA 4YT8A 1OZHA 2FRDA 5JARA 3PTZA 3T5TA 1KDRA 1X7DA 5C8YB 2VYFA 3ELBA 1Q0SA 3L02A 4KC0A 1VRWA 2PY6A 5D1NA 4AN0A 3KYDB 4IOJA 2GK6A 2YJTD 3LQFA 4DLWA 1ADFA 5G41A 1LVUA 4OQEA 3RS8A 4CE6A 4GQIA 2FSUA 2AN5A 2P9YA 2QRNA 3BIXA 4TXLA 5KC9A 1NN5A 1FYFA 1B00A 1MX3A 3OO1A 1C0PA 3Q11A 1WETA 2H1WA 3PUWA 1NLZA 4YQZA 5FPSA 2O8EB 2F3TA 2ZS7A 1L7PA 2HJVA 2ZT6A 3C6MA 4IVNA 3N2LA 5AVSA 3D8HA 2XOXA 3DMNA 4MRSA 3EGOA 4MR7B 5GV8A 1HEIA 3Q9UA 2G4LA 3FTPA 3CF0A 5KKAA 2QZSA 4C06A 2ILVA 4YRAA 1PR2A 2A1UB 3R3XA 2PH7A 1B76A 2X19A 3Q72A 4RE6A 4Y2QA 2AQHA 2XI4A 4Y7CA 3QBJA 4POOA 2HA4A 4M88A 1OX4B 5SICE 3RNOA 4EWLA 1E7QA 1CY2A 1S3FA 3BORA 4KQGA 4RTMA 4C21A 3IEPA 2O2IA 5DPMA 3RWOA 2C96A 1SOAA 1EGQA 1ZK4A 1PDOA 1XYYA 3T9FA 4JC5A 4EHBA 3Q98A 4G8JA 4QFCA 5BW4A 3H17A 4I4TF 3W8NA 1DB3A 1RYBA 2M1XA 2I2CA 1QIEA 2H5JA 4IF4A 3T9DA 4OKNA 4EPRA 5BRJA 1ZCBA 2C5EA 2ETVA 4P0PB 3IDOA 2CB9A 2J32A 4CJXA 3KT0A 1K97A 3AI1A 3K8YA 4YUZA 1RXIA 2D1SA 5B7NA 2ZSKA 1TMGE 2ZYGA 4FFOA 4FGKA 5D84A 1LI5A 4M8LA 3WGTA 4P7KA 2X3FA 2Z1MA 4MAFA 3BWMA 1V8OA 1X6VA 3BIFA 4X90A 1ZA2A 3EMBA 4TRMA 4C22A 2V0CA 3A1NA 1ZJ6A 5AD1A 1M2JA 4CIBA 5I48A 2A14A 2XUGA 1QP7A 1ODJA 1QG6A 2GO7A 4AAYA 4JYAB 3FPEA 2IXDA 2XE8A 4EITA 2I03A 3G82C 2BEVB 4NYJQ 4OG2A 2W48A 3AHEA 4L85A 4MVJI 5EMKA 3WXBA 2G25A 1FMCA 1P72A 3B5IA 4X1YB 4CM3A 5KTRA 2IHNA 1T1IA 3ENKA 5IMSA 4TV8B 3I04A 1Z6QA 1ECBA 2V7GA 2P78A 5J59A 4HB0A 1YQXA 3B3FA 2QMEA 4NDNE 3ZHYA 4BFTA 3EOAI 3HFGA 4GKVA 3COYA 1MT3A 4Q7LA 1JXMA 2IXBA 5HQTA 1RPZA 4OL9A 4OH7A 3IQGX 4Q1VA 4HUTA 3CZPA 3I53A 3VU1A 2W2PA 3QKUA 4B84A 3HA5A 1GGHA 3I0MA 4MUYA 5IBRA 2OD9A 5LBIA 2XRMA 2QLNA 1E62A 3O73A 1CE8B 3EZ6A 3MJTA 4QQFA 3F6SA 3H99A 4NATA 4K6MA 4PZPA 2XF2A 5GVRA 1MFPA 4FFLA 4B3MB 3LBHA 4RA9A 4DAEA 1RHQA 2PYIA 1P5HA 1SXJD 3OBIA 4L50A 4ND1A 1LLDA 2CV0A 1NQWA 5BOSB 3QXSA 4FNOA 4ZMRA 3BMNB 3D4IA 1PX0A 3EGXB 2O1WA 3VA7A 1P2UA 1ZL0A 5FFMA 4HDKA 3WB9A 1M2GA 1G3IA 3L0YA 4XE5A 5FUVA 2NAPA 3TVDA 3B82A 1IN5A 2QVLA 4XAQA 5EJ2A 3RYFB 2YIVX 3UFXB 4NF2A 4LHSA 4KAFA 2BCEA 3J81A 2CK3D 4M0UA 3HDJA 3E7XA 2ASVA 1A1SA 3C8ZA 3JQAD 3PXUA 4KYVA 1X8XA 1C3EA 3IJ5A 3OJWA 4KODA 3TTYA 2CLHB 4D5EA 5I01A 5JASA 4FCVA 4ZZ3A 4GAEA 1GYRA 5LQSA 4IOMA 3EG9B 4X85A 3INYA 2JI7A 3VVMA 1Z4NA 1KI1A 2GETA 3A9UA 4JODA 2HPZA 4OA5A 3ZX4A 4LGVA 3OCXA 2FWMX 3TTTA 5LWHA 2KLHA 3AV0B 4KDCA 4P3YA 2XQIA 4F86A 2WM3A 1HQKA 3B89A 4LY6A 1JSRA 1LZKA 4X6YA 1MW8X 3JALB 4M4SA 2YNMD 1JQ5A 4WJKB 4YJFB 5F2EA 2HGZA 2ZSHA 1RZVA 2H5IA 4XFDA 1GPWB 3FHLA 4LHWA 4YXWD 1EDZA 1NE7A 5DTRA 2O1SA 4BLWA 1V2GA 1R6XA 4BMOB 4CFZA 2H1LA 4BIMA 2YXBA 5A4KA 4LF9B 1CUJA 3MW8A 3LQ1A 1SG0A 4OL0A 4HLUC 3NHUA 4JVSB 1RWBA 1VBFA 2E6KA 4R31A 4CXMA 3NT2A 4KMSA 4N3GA 1TZJA 3FY4A 3AMVA 2Y1XA 4GP7A 4JI1B 1THTA 1UT8A 3MGGA 4UNNA 4YBRA 3BF8A 4RWEA 5A05A 2ZG6A 1A27A 4IHJA 3G5TA 3TJRA 4HKTA 1BQ3A 5DHFA 2JJQA 4NNJA 4IO1A 2V7BA 3T3PB 1QF9A 3DDCA 2RGUA 3LW8A 5E9WA 3UJHA 3ED1A 5CFOA 2VTEA 3CYFA 3RU2A 1B42A 3R5SA 4X71A 4GLBA 3NDPA 1CRQA 3WRXA 1DKLA 3D6FA 3H5LA 3NTLA 3F6CA 4TRJA 1T9DA 3EGIA 4KXQA 3HDVA 3SIPA 4COOA 1ESDA 1R18A 2CLEB 2GFQA 2G6BA 1Z7WA 1M8KA 3OICA 1TTQB 2P69A 3MYYA 4R98A 1YF3A 3SQOA 3NG1A 4B6JA 2JGJA 5FFNA 2MR5A 3T12A 4DMKA 1DVRA 5CT9A 5DM60 3L40A 4DZRA 4YAKA 2XXAA 3WIBA 2AV6A 4O4LA 3IPLA 2NUTA 1JPVA 1ORDA 3QKRA 4N9WA 1IIRA 2C2OA 4B8WA 4EMBA 3G59A 2PYZA 2YXNA 2AFIA 2RK3A 2C8KA 1AGPA 3I4CA 4XJVA 1T29A 4MJ7A 3VKFA 2IH4A 3Q6MA 2WKQA 2QF7A 2WG0A 1P7ZA 2VRNA 1JXAA 3LDHA 1R5JA 4G86A 4Q1FA 5KI6A 3A1VA 1HFKA 1CNFA 1GSIA 3OM9A 4ESEA 1CUUA 1IQ0A 3TOVA 1IXKA 4RTSA 4QUJA 2HSEA 3R3JA 2YWDA 2HFKA 1N6LA 3L5KA 1JEQB 3MCUA 3UUFA 2XLCA 2ZJ0A 1DAFA 1LUAA 2R87A 1SKYB 1WRBA 2HZ7A 5CHYA 4E1AA 1RZRD 1OFUA 2FQ1A 2ZAIA 1FE8A 2HXYA 2VXYA 2QLJA 3HLTA 4HAZA 5BSUA 4EABA 1U0LA 3MRSA 3ZGZA 2WU0A 2Y4NA 3EBLA 3VHLB 3ZCTA 1G64A 1K88A 2JDIA 3CUWA 3QWAA 2ZYVX 3EF3A 3L06A 4R3WA 1QC5A 4EQ6A 4OM7A 1UF9A 5G0UA 1Y4DE 4CM5A 2BELA 1A69A 1NUAA 2W0SA 5KYUA 1ZM2A 3LDUA 3QTTA 4F5ZA 1YJ5A 3RCBA 3VJRA 1Y1SA 2QUJA 1P39A 1CUDA 1P6XA 3ECCA 4E09A 5JQWA 2BI8A 1G19A 1IHUA 2QTFA 3KKMA 4QOGA 3WGOA 3KSUA 1CY8A 3FNRA 1ZCAA 3VU8A 1CIJA 4MTLA 2P4UA 3HV2A 1I8TA 4UBIA 2G9NA 5U4XA 1L5QA 2WHEA 2WJIA 4LZLA 4URYR 3CW8X 2OORA 4CLOA 3P0IA 2W11A 2OLKA 3E03A 3HR4A 4LMBA 3IAM6 4MRMB 4QQRA 4UREA 3SY8A 3ANXA 3EIUA 4Y2XA 4HWSA 2AZTA 5CW2A 4ZEOA 3C7AA 5CK4A 1W52X 1V6CA 3SZGA 5A71A 2Z9CA 5BSRA 4F72A 2HU7A 5JC8A 5JFGA 2AR9A 2IUTA 2CDCA 1SQFA 3ITNA 5IJAA 2RARA 2HW8A 3H9CA 4O2AA 1AS2A 4AJLA 4B81A 1XZCA 1FFSA 2Z04A 2C9MA 3WFZA 3AX6A 3B2QA 5KCMA 1RS0A 2CVFA 3CT4A 2A58A 1UXOA 3RSCA 1FRQA 4LHVA 4Q7JB 1CZUA 4NPHA 5H4GA 5EYPA 3AF5A 4BZZA 1K5PA 1IUOA 1GCIA 2ZTHA 1VRVA 1I3LA 3ROKA 3WL3A 1FTWA 4HTFB 4RMNA 2QTLA 1XO1A 2JL1A 4IR7A 4LHXA 5TE9A 4ABTA 1E32A 3NEPX 4JJ4A 2VP9A 2P2CA 5HKLA 2EVWX 1TT5A 3FPKA 3G2OA 4L4YA 5AVWA 2BI4A 1S2OA 3HE3A 3Q8MA 2FZKA 5LQUA 4NCAA 2AKEA 3CHYA 3JVVA 5BV2P 3C6QA 1QFMA 1JG2A 1KU6A 1OI4A 2MHCA 2PPVA 1ORTA 2WPDD 2IITA 1V9CA 4IFTA 5EERA 1E7RA 2JI9A 1M7HA 3IBGA 2X1LA 4WK2B 2O07A 3TLEA 2IEAA 3JATA 3M3DA 5IMBA 1HY3A 3PK0A 2H9AA 4MMZB 1PV2A 1TC1A 1BN7A 1E4EA 3AVTA 1GA1A 1IBCA 1ZBQA 4Q9DA 3L0DA 1M83A 2NYAA 3M89A 2P0AA 4TYPA 3SIWA 3FNBA 4N3BA 3QPUA 4LCBA 1M2KA 4CCYB 2NSHA 1J0BA 3TI7A 2VF7A 5C53B 4JD5A 1CR1A 1FS5A 5AW1A 3OECA 4CM8B 5ELXA 5DSTA 1MA3A 1Y6JA 4JELA 4PFKA 3S27A 1H93A 3DJYA 4DSZA 4Z7JA 1FIUA 3HJFA 3KKNA 5LB2A 1C0EA 1PJAA 1JTFA 3VYVA 3OZTA 1UZUA 3LT2A 4M8NE 1A8HA 1W0JA 3TLCA 1RAEA 3WBBA 4QXQA 4E5MA 2L19A 3LL4A 3P2IA 1D6SA 1SBNE 1B73A 3JWHA 2V59A 4IBOA 2OUKA 1ND5A 5AVQA 2EJCA 3VNBA 2XXBA 3DE4X 5EGSA 2ZJ5A 5ALUA 4E6EA 3SPXA 1ZIDA 2NVWA 2PGJA 4P5EA 4AYWA 1P0PA 2ZRHA 1F6BA 3H75A 3TD2A 1J8YF 2VK2A 3OQNA 5LQNA 4QFMA 4LY9A 3F5MA 1XEWX 3QPCA 3U0BA 3VZQA 4KQ6A 4U2BA 2CVZA 4Y9RA 1RQPA 1WIWA 2ZAGA 4DCPA 6PFKA 4GQBA 1XNRB 1D04A 1LKZA 2E4ZA 1M74A 2ECOA 2VWGA 1TO6A 1N6OA 2ZJ7A 4KQIA 1U5CA 4I9UA 4MW9A 2BDTA 1EJBA 3E23A 4HMOA 3TW8A 4C6SA 2OXIA 4DR6B 1P4AA 2QTHA 2PMKA 5TGDA 1QU3A 4Z0HO 1S01A 3RIEA 1XQWA 1XA0A 1BU8A 1Z37A 2D1RA 5FDFA 4E33A 1U63A 1YJQA 4D3SA 5AKLA 5TEVA 5GWXA 1VHJA 3K96A 2D5AA 4MXDA 4MLPA 4S1VA 5ALVA 3QUBA 2NGRA 3EMVA 1VL2A 3H7AA 2QBYA 1E7YA 1RSZA 2P9BA 3F3YA 1LDYA 3GWGA 3QKTA 3ZBPA 3ZIUA 4O63O 3DO8A 3LY9A 4FP9A 2WZDA 1R4MA 2PVSA 3BJRA 3DL4A 3FOAA 5TVGA 5GINE 1GARA 1VIVA 1Q84A 1PX2A 2YJ5A 5AKEA 2ONYA 4DNQA 3SSMA 2VHJA 2ZTVA 3CO0S 3EQZA 1QFSA 3RRBA 3GLGA 2I65A 1BDHA 5K4HA 1IUNA 1PF7E 1FFAA 2JIZD 3I05A 3OOSA 2QAGB 3Q9NA 4JLAA 2ZRFA 3JCZA 4X5OA 2FQQA 2W37A 4MR7A 1R5BA 2BZ0A 4ZI7A 4OI0A 3HMKA 3HZHA 3MS4A 4GPD1 4HBZA 5CX1B 5LZ9A 3LKVA 4MW1A 1P5RA 1D1PA 3FH0A 5DI9A 2VUSA 2FRVA 3T7EA 1JG7A 1JDBC 2KJQA 4LCEA 4C0BA 1NXOA 4P34A 1OX4A 1W1UA 2Q1XA 4OUKX 5LKRA 4URZR 3SNKA 1YVDA 1XU9A 2BTQB 2YWFA 2UKDA 1G5PA 2POCA 2Q4OA 3BWEA 2KBFA 4OVKA 4QD3A 3I04M 4OQZA 3AEUB 3ZXSA 1UDCA 2ISCA 2GSDA 3DKVA 2JFVA 2EJTA 1OTYA 4JXKA 5J4HA 3I6IA 1CQPA 4PFSA 5H9WA 1KZ6A 3G89A 4E2WA 1NUSA 3IMCA 3ID6C 1Q44A 3PUYA 4FHGA 4JP3A 2NYRA 2FK7A 4QU0A 2WUDA 4WESA 3ZH9B 5I9NA 4AQ7A 5BNTA 1YIOA 1BXKA 4LBVA 3TSZA 1RM5A 3CWCA 5ALDA 2BGUA 5DN6A 3MUNA 1JJBA 3FHOA 1K7EB 4IUDS 4L0MA 4ZO4A 3HU5A 3I52A 3RS5A 3WC4A 3I62A 2PD6A 2DZDA 1BYUA 1E7MA 3DW3X 1XLVA 4UULA 5HEKA 1E3MA 3GIWA 5CLIA 4X20B 4HDOB 5HCIA 3ICWA 4D4JA 2JS7A 1EHCA 1U2SA 4M9UA 4ZAXA 1F12A 1UM9A 4WVLA 3FYCA 1XV5A 2OXRA 2PUTA 3F5FA 5FP0A 3TSCA 4DIDA 1EB8A 1NJ1A 4RO0A 1CF2O 2PLNA 4XGIA 3U49A 4BVEA 4OAOA 1T8YA 2YYZA 3EIWA 2HCBA 2DWOA 3VUFA 1J25A 3HKBB 5CH3A 4XSGA 4UBNA 1X70A 3CF4G 2GMWA 2M98A 5JSQA 2D8MA 2P2LA 5HBRA 4KXUA 1OH6A 1E2FA 2DR2A 3TZ6A 1OBHA 4NJEB 2AKAB 3WYGA 1E6CA 3D8RA 4IHQA 5B58T 1MB0A 3VOTA 5ED0A 5LQKA 4HY3A 1E2JA 2E1RA 1I9CA 2CUNA 1EP2B 2HO5A 1L7EA 1C3OB 1KYQA 1ULZA 3E9RA 1JDUA 3TLKA 1N7GA 2Y1KA 3Q15C 3T3DA 3PXAA 2EYQA 2G9RA 3C8DA 4BLOA 3C3BA 3P2MA 4J1TC 5CA0A 1BROA 1U8TA 1Y3DE 3HU1A 3MHTA 3LPNA 4HAIA 1VGVA 3DFFA 4I46A 5D3KA 4ZT5A 2GBGA 1T2VA 4DG5A 5C32A 5EMJA 2VDMB 5JY1A 1TF2A 2PS9A 4DKXA 2DR3A 1X94A 5TNXA 4KPGA 3OF2A 3PHGA 1ESMA 1OYOA 1TM5E 2XNCA 4OV6B 3WRVA 5IRCD 4C4ZA 5IAJA 3GVCA 1DV2A 5GVSA 2EF1A 3UAXA 1LSSA 4Q5IA 1OAKA 5GOZA 3WKEA 5AUNB 1SVSA 3BH6A 1OZFA 4LE0A 4DXDA 1AHIA 1DKOA 2OPHA 2HIGA 1W4AA 1ZICA 3AVQA 5K51A 2E4XA 4PBTA 3M2TA 2QN1A 3M7IA 1E2QA 2QUAA 2RGXA 1IZ8A 2P67A 3OFND 4FSHA 4E5YA 3DEIA 1W6UA 2NZXA 2Z4SA 3CZAA 3KL2A 4OIFA 4Q02A 5FQNA 5CMLA 3CH7A 4F4CA 4B2PA 5AM4A 4XJSA 1BX3A 2ZUDA 4HQNA 4LWQA 4Q48A 4UM5A 1ENYA 4ZQGA 4D0GA 5FWNA 4UM7A 3T3GA 5KKCA 1NMSA 3PX7A 2VTVA 4GOJA 1X86B 5ALTA 1ZH4A 1D0VA 5HIAA 1DRKA 5JEEA 4WXMA 4V0SA 3K05A 4BZWA 2AXPA 1Q0RA 2VOEA 5B4VA 3MJ4A 1WUYA 1ZWKA 1HR0B 3D8TA 4OMFG 5FA6A 4CKWA 2IDMA 3HRKA 3BGDA 3SLGA 5LCXA 4B4UA 3WGKA 2UVPB 2H4HA 2ZDGA 4G9BA 4ARSA 1MQ9A 1KR5A 3BSSA 4YXFA 1YOVB 3EIFA 5KTKA 2JG3A 2D5BA 1WZUA 1XA4A 1JR6A 2I2AA 4NYIR 1GDDA 3IEIA 4P4LA 3VC1A 3BAFA 4OKSA 4P0QB 5FYDA 1JG3A 5B2EA 1B0ZA 1KWKA 2NXNA 5JNLA 4M1TA 5BN4B 4TQUS 3E48A 1PD1A 4B2IA 3ZWXA 4DLAA 5KNDH 2QZZA 1EIZA 1HC7A 1G20A 3K70C 3IQWA 2FP4B 5HDQA 4ZWNA 3ADBA 2WSSA 3ICEA 1XD9A 4HPWA 1KEWA 4R3UC 3COJA 1KZ4A 5DIZA 4BFLA 4D8UA 4DLTA 1OWOA 3RHFA 2EBWA 1ISMA 2ZIVB 3R1IA 1TM1E 3H2GA 3GEHA 4PAQA 3RROA 2YVLA 4ON9A 2V98A 2Y67A 2Z8YM 3NBUA 2J0UB 2D3WA 3IV7A 4RS3A 4EFMA 1F8YA 1XWFA 3HVIA 4G5YA 3ANLA 3QVGB 4L1KA 1TW3A 4YRIA 4P2BA 5L3VA 3EA5A 3AU9A 16PKA 1US8B 2A1IA 2QY9A 3D8NA 1BDMA 1NVDA 2CLOB 2AOUA 2H1IA 3DFIA 3U9LA 2IH2A 2ZZKA 4PS0A 1N4DA 2BFBB 2OC4A 3HU2A 4A92A 4MHSA 1ZZEA 3H2JA 4RK6A 2X4DA 3KUDA 1S89A 4LK2A 8AT1A 5B1DA 4RXUA 4JU8A 1KZHA 2Z9DA 4ZREA 4FFRA 2VK4A 1KQNA 1IPFA 4IX9A 1FX0A 1L7AA 2XQGA 5E4TA 3KO8A 5K0NA 1E79A 2FHSA 4TKVB 3GP8A 2ATXA 3O4RA 1CDZA 3TIXB 2B2NA 1OOEA 3LBIA 1Q21A 2BEWB 4TSRA 5MGNA 2Q3JA 5KYNA 4B0PA 3WMEA 2ZBQA 2CJWA 1DT3A 3CN9A 4G5OA 2M6KA 2WHXA 3NBFA 4Y1FA 2Z83A 4V2UA 2J4CA 3CNLA 4KLCA 2WB2A 3A2LA 4TTAA 2IPXA 3K0EA 1UJ5A 2IYLD 5DWDA 8ABPA 2GD6A 2WVGA 4F91B 2HWYA 4OHFA 3MUOA 4WDRA 1AGXA 1HZZA 1QO0D 1KVTA 1HPLA 1BIFA 1L5VA 5EIAA 5EJ9A 1OLUB 1X1BA 1MZVA 3WV5A 1DJNA 1WKVA 3HCOA 1CJSA 2VP2A 3TDNA 2PXHA 5CU7A 3D1JA 4AUMA 1Q1AA 4HWPA 2Q3LA 4LV5B 5I3ZA 1H3EA 4DV1B 2GD1O 1ODCA 3HXOA 1HEUA 1JUDA 1I2MA 4GUAA 1X8JA 1FQJA 2JFNA 3LI2A 1OWNA 2HTFA 4NP6A 1PJLA 2EFEB 2QQEA 3AF4A 1LVHA 3H13A 3NWPA 4GOND 4QELA 4TM8A 2QTVB 5CK5A 1P91A 3GPCA 3HO6A 4FMBB 3N9IA 4GS5A 2JFXA 4JEMA 2BBWA 3ZU3A 4ZICA 5G0TA 4RF3A 5LBUA 2QTGA 5C1OA 2V65A 4UU0A 2IHVA 4LXQA 3Q9SA 4BP3A 4DMMA 5KX5A 1PNTA 2EZUA 4KQFA 4WOJA 4RELA 621PA 1DIHA 3NOVA 3Q0IA 5G0WA 3RODA 3ZWKA 3A4NA 1E99A 4ZOCA 2BE9A 3U6BA 4FN5A 3RTDA 3DMHA 1Z75A 3U1VA 5KO2A 1HLDA 1PL0A 4R2LA 3UQYS 1VA5A 3NX4A 4NDAA 3OMWA 2G1AA 3W8FA 2Z3WA 5CYPA 5CLHA 3RIYA 3RW9A 1M5TA 3AUSA 4G8CA 3R4CA 4D9BA 1KYIA 2P4HX 4D41A 5DRYA 1H1DA 4E4TA 3AUFA 3DMGA 2MOKA 3B52X 4I0WB 1F6DA 1JJIA 2QD3A 1USGA 1S2NA 1EVEA 4NI5A 3HCAA 4LDNA 4W8HA 5EL0A 3U7HB 4H27A 3OY7A 2JB9A 4OJKA 5MHTA 1JX6A 1GRNA 2OCDA 4XTCS 4BP9A 2C7PA 1MVNA 1K8ZB 1UMDB 1V8FA 3T7IA 3IOMA 4HDCA 2E87A 4QDUA 2QMUA 3MWGA 1RI1A 4N5MA 4Q47A 1CDOA 3PCXA 1NC3A 1OBCA 2X3YA 1UKBA 2I6UA 3LH5A 4OBEA 4RD2A 1D1QA 1EBBA 1I4WA 4DWVA 4EKIA 4XWTA 4ES6A 5NULA 4EO4A 3GYGA 4R01A 3NGLA 2I9KA 4F60A 4LI3X 1Z4KA 3HLKA 4F3CA 5BYAA 1PZGA 4HOYA 3FKSA 2I2FA 4GL2A 3NDRA 4O4HB 5K6AC 2WWXA 1PBTA 2I76A 1QK4A 1UBJS 5C1IA 3WGQA 1VRCA 3PNOA 4AX4A 1E9SA 4CLRB 4EI2A 1QVZA 3KAPA 4ZRNA 1L5GB 2R6JA 2EFDB 2RHWA 3RREA 5IU6A 2VJAA 3GQBA 2F90A 2ZDHA 3K5PA 3IVGA 3E8XA 1U3WA 2WWGA 3MPUA 3X1YA 3ROZA 1Y0BA 3D9QX 1L3CA 3HBNA 4N3NA 2DHRA 5H82A 1QZXA 5CA1F 1RIFA 3AONB 3G2PA 1PVDA 1G8SA 3TH5A 1OGJA 1G21A 3ZLVA 4BNZA 1E8NA 5J4YA 3TEJA 1BX0A 4RETA 1A8PA 2RC5A 3B48A 1SVKA 1ZGHA 2D1QA 3N59A 5EMLA 4C7XA 1BSVA 1BEZA 1RAFA 2E21A 4BYMA 3E9MA 2VSOA 3H16A 1UJCA 2C00A 1A9SA 5K0SA 2I3DA 4ERNA 1A9XB 5IKPA 1A4IA 3ZZ1A 2QPTA 3AP2A 4V1CI 1VXOA 5KB3A 2IHUA 1VHTA 4JBWA 1ZI6A 2R3SA 4YJHB 2WV9A 2B94A 4KR2A 3ZY2A 4J7AA 1VECA 1JS1X 3B78A 2H2WA 3OKAA 3GNSA 4X92A 5CJ2A 1EA7A 3PXDA 4GGMX 4E21A 1DHTA 3ITKA 1DI0A 3IQDB 2P9HA 3G0GA 4DPLA 1N2BA 3W5IA 3OWXA 5DNUA 2IY8A 3GPDG 3L7YA 5BMVF 3M9XA 1BXGB 1P19A 3O7MA 4OFBA 3EVFA 4GD3Q 5ILQA 3FCXA 4WK4B 4DJDC 1E0DA 4BUJA 5C35A 3AVUA 1DWQA 3T7JA 4P93A 1MCZA 3V2GA 1G9SA 2JAWA 2XD9A 3TKLA 3UY4A 3VO9A 2FEOA 2ZT7A 1UMBB 3K1AA 4PCUA 3HL4A 2PSEA 5DT2A 3GNLA 2ZSDA 2OWEA 3VAZA 2FSVA 4F9EA 4CODB 1QGYA 4CKBB 3FWNA 3IV6A 3SC3A 1IXRC 1AHHA 4PC7A 1J0CA 4HQ0A 3HR7A 3FFTA 4UVGA 4IUCS 4GBMA 3TQFA 3THXB 4Z6KA 4FBLA 2Z1NA 1E2PA 5ESDA 3OZUA 1PEKE 2XVAA 4DLNA 2C4TA 4PN7A 1SBQA 5B3KA 3VFDA 4RDIA 2MSWA 2X5OA 3KOXA 4R3NA 1VE6A 1JKJB 2WJZB 2Y1WA 3FG9A 1C7FA 1EX6A 1GILA 2DTEA 1CUWA 2X8WA 1I2CA 2FGJA 3G2IA 1AUXA 1WHSB 3I2GA 1KI3A 4LS3A 4ENVA 4XOIA 5HVNA 4I6EA 1D2AA 1E61A 3GT0A 1EU1A 2W2OA 3TO5A 4DCGA 4ZOEA 3EFBA 4JGBA 3FMIA 1C14A 4TTIA 1J8FA 1KHTA 2E1PA 1XU4A 2J46A 4Z99A 1D1SA 4IH9A 3ELUA 4XCQA 3D6JA 3T99A 4FKBA 4DCVA 3EAQA 2DB3A 3BK1A 4B83A 3EPKA 1SHUX 1EHIA 1LPPA 1QYIA 2PIAA 4WXYB 5D5HA 3OZEA 2JLVA 2BE7A 1P1KA 4CMIA 1JSZA 4ZVKA 1U0RA 5DNWA 3LLSA 3NONA 2GNAA 2AK2A 1I1OA 4PE5B 1PG0A 2REQA 4TN5A 2GF0A 3QVUA 5IYZF 2ZSJA 2IHKA 3E3MA 4WY2A 4AJKA 2Y77A 4C07A 3FYDA 2GDZA 2TECE 5F33A 4EB3A 1QIDA 4KDEA 4URVR 1XJ5A 1Y7TA 2D3TA 4KGDA 3FYSA 1Z0JA 3N53A 2AXNA 1N6NA 3AG5A 1SO8A 2QL5A 3VAAA 1U9IC 1IPEA 3QWBA 1DQSA 1ESCA 4RZXA 3WLAA 5KSWB 1LH0A 3AR5A 2JVKA 4EJFA 1DIOB 3Q5EA 1RWKA 3OZVA 2YKGA 3ANTA 1KJJA 3BE8A 1C1HA 1Q19A 3OQJA 4J0EA 1IULA 1KI8A 2BHRA 1NJ6A 2WBLC 1DBVO 1RXCA 3AIMA 3AUYA 4B7CA 5E7QA 1XCMA 5A04A 3G9XA 2XXJA 3F46A 4F8JA 3Q8LA 4F5WA 2GD0A 1F17A 2Y71A 3L01A 5BN5B 2ZDQA 2MSCB 3V5NA 1VHDA 4MPJA 5AW5A 2H2AA 4DCMA 4MKIA 5K6RA 2R2AA 1M7BA 1CS0B 2AHRA 4X3PA 4UTVA 3DE7X 3JVUA 1RBQA 1YBFA 3E3OA 4QDXA 2O2ZA 1I2DA 3VBCA 3VNVA 4GF5A 5F2NA 4RLHA 4P4GA 1T5SA 2QRKA 1Z28A 1CYEA 2TYSB 1DC7A 2ZUCA 3N3BC 4ZYYA 5J2TB 1PS9A 3H2BA 1EK0A 4JUDX 2YV5A 1TF5A 4BBZA 3EZFA 3NRJA 4HGOA 4GZMA 4TXMA 1GLGA 1A95A 4UHJA 5HWSA 1NU6A 1Y7LA 3D4LA 1H2AS 4X1KA 1OKKA 3DW1X 5AK4A 4Z9YA 5EZYF 3SXJA 1U3VA 3X1MA 4CIDA 4FM9A 1ZZGA 2ERXA 4M76B 4LMRA 1BHO1 3LRXA 3FUWA 3Q41A 1REQB 3RTBA 4DA7A 5KJ6A 3IQHX 3O6VA 2CFSA 1VBMA 3GBPA 3DAFA 2HH9A 3FUVA 3NB0A 1Q74A 5CGZA 4D9HA 4EGSA 3KTAB 3WI7A 2ZEJA 2DLCX 1PQ4A 1R9JA 1X2EA 4BECA 2F3RA 4PTLA 4ZDKA 1EGAA 1RWXA 3M0EA 4UOEA 1R50A 1C3VA 1CBUA 5HUHA 1XMQB 2HSDA 4UUQA 3NBXX 4TMXA 3H5OA 2IDZA 3UH0A 3OJFA 4YMVA 1A4XA 2ZREA 3D8UA 3QG5A 3VGJA 2B1JA 4PG8A 2C5LA 3AFOA 2ATIA 5EPOA 4ZEWA 3MWDB 1OX5A 1ZRHA 3C3AA 2WF5A 2CL6X 3A1WA 4HB2A 4KW7A 4BV2A 4U7PB 5TGTA 1TE2A 1X1AA 3JPYA 4XIYA 3LF2A 2VNHA 1CR6A 2YXDA 3A3KA 3GXOA 2LDBA 3ILXA 4LZOA 1EUZA 4QGAA 4RFSA 5DW0A 1JHRA 1X7ZA 1XSEA 3GZ4A 4A8JB 2FR8C 1VJ5A 5LPNA 5BN4A 2P1RA 3CX8A 5HE9A 4DQUA 2XYGA 5GM1A 1SK9A 1ZONA 2Q4EA 1ZNQO 3K0SA 2YMMA 4G37A 2W2XA 3MG9A 2ZQYA 1YR8A 3E82A 5NLLA 4Q7MB 1V3VA 3OT5A 1XZQA 2FP4A 1T24A 4X61A 1KFJB 4X84A 5A7GA 1M8JA 2HN9A 3CH4B 5C2JB 4QM7A 2Y3IA 1T3ZA 3HY4A 4YT5A 4QT0A 1DG3A 3AFHA 3MHPA 4F85A 1LVGA 1WM1A 3EMDA 4OJTA 4U8HA 5C34B 4E5KA 4KIGA 6NULA 3R9WA 1W88A 2C4UA 3BDVA 3CBQA 1YVEI 1L4KA 1OFHA 3FHCB 3H8SA 3HKCA 1KJZA 4PHTA 1H22A 4B6PA 2CVQA 3W9SA 3I2FA 2OXTA 4B7UA 1IU9A 1M6YA 2BEKA 4H60A 3RE1A 2CXNA 4LI0A 3DZBA 3OZFA 3P20A 4MQ4A 3RK0A 1R0CA 3G8DA 3QPDA 3RUCA 5B3LA 4C29A 4K6HA 1MGOA 1US8A 1WG8A 2AK3A 4RHFA 5DP2A 1FLNA 3IKJA 3UAWA 1WQ4A 1PJQA 5CHEA 1YS4A 3L05A 3NR2A 4QGHA 4BQEA 2UZ1B 5AQEA 4IDOA 3IAXA 1CZLA 2HUNA 1I4TD 1CIVA 1SKQA 2ZZMA 1H94A 1UC9A 4XKJA 3SKVA 1V3UA 4TLBA 3IQIX 4QOIA 2A3NA 3IUJA 2EQ5A 4CU5A 2X15A 3KBOA 1OYYA 2G3YA 2GCGA 3BL8A 1HM5A 2QTCA 3G9ZA 3P2OA 1HOTA 5BNFA 4DCUA 2QQGA 4OSPA 3LQ4A 4GRIA 2G9QA 4XB6B 3WLQA 4BB6A 3TAHA 4MYUA 1OXBB 3VZPA 2BEWA 3K9GA 3WMXA 4O4IB 2IIQA 3WKAA 1GKIA 5JD3A 4M6WB 4A0GA 1YE5A 1NRJB 2BVNA 5LM3A 4MDEA 3GGGA 1W25A 3MIZA 1TCAA 4X7RA 5MN6A 1OIWA 2LVBA 3AC0A 5HIKA 5KDOA 3MMXA 1YVPA 1UXHA 2QNIA 2YWXA 4BPRA 4AJNA 2UUBB 1BVUA 4MUIA 1R7RA 1PJSA 3L1HA 2AOTB 4YB8A 3LE8A 4BMSA 4BQNA 2G1UA 2PG3A 4P4UA 1D03A 3VJKA 1TZ2A 2CXRA 5HZGA 2GKGA 5CAEB 1HYGA 5KHOC 3EFEA 2CHQA 1SU8A 3PFHA 3EPLA 2WJJA 3ILHA 3EGEA 4IDHA 4DY4A 1MA0A 2FN3A 4HAYA 5HMMA 3RKSA 3RUAA 4MS4B 3RU9A 2BR3A 3AEQB 5BWOA 2VF5X 3FWZA 5REQA 4E51A 2ZETA 1E1LA 4JC0A 2H29A 2W7TA 4BFXA 5LP6C 1IAVA 3PVZA 3ZN2A 1EDOA 2W2MA 3QENA 4HEQA 2YVAA 3WGLA 4B3HA 3OX2A 2Q6KA 2ZRCA 1S8NA 5JMTA 4DREA 4MPPA 2KW5A 4B6OA 5KTPA 3OIYA 4C88A 1K92A 1KI6A 4B4KA 1JDZA 2NU6B 3AHDA 3N6VA 4QLBA 5JDCA 1RJ9B 4RGBA 4X1OA 4PZLA 2XB8A 2FP3A 3NXSA 3ZQ4A 2C9OA 2JIBA 3IEUA 4LBZA 3CLSD 3B5EA 4GR9A 4DCTA 4EKEA 3I3OA 4J43A 2QLBA 1U8EA 2SBTA 1B93A 1ZMOA 3IRVA 4N7MA 1HH4A 5CLLA 2MYNA 4EVRA 1QDUA 3QF4A 3TFWA 1M10A 5K3BA 3K70B 5AQ1A 1II0A 3AR4A 4URXR 4RPGA 4OP3A 3LHKA 5EJMA 4L4RA 3J81k 5AH0A 4HGZA 3VC3A 4S05A 4OQYA 3VKUA 2YX1A 4PSAA 4WOKA 1ODFA 5JFTA 4P4NA 4HB3A 3QLUA 1MQSA 4IS3A 3L4SO 4ZCPA 3RIXA 3L4EA 3QXGA 2G5TA 4I81A 3GCWA 4MKFA 5KWSA 2G8NA 1UBEA 5EKTA 2B8TA 3I0NA 3PLRA 2CFIA 1QV7A 2DUWA 3CEJA 3IDAA 3WGHA 1U6JA 3DQQA 3R5FA 2ET6A 2GPWA 4BFWA 4I4LA 4EA8A 1L7QA 4NIMA 2JRCA 2BDEA 2FF7A 3LC2O 4IJKA 4TQ9A 2PCJA 3BRCA 2YJGA 2Z56A 3LT1A 3WX0A 4D4HA 4CI0B 1DRWA 4YV7A 3BWCA 1GFIA 3JRXA 3Q7SA 4JBNA 1NVFA 2N0SA 1BVYF 2J87A 1PS0A 3VH3A 3K0AA 4DA9A 1L4UA 1Z83A 2PGOA 4RZ3A 2QG6A 4CLRA 1QORA 4JB8A 4UARA 5C8YF 2CNLA 3DJFA 5I8PA 3EXFB 1LI7A 2H7XA 2EX0A 4P92A 2EKQA 4RD4A 4RENA 4E46A 3QOXA 3QPBA 2QE7A 5EPUA 1QIGA 5C5DA 3B2NA 3K9CA 5HQ3B 5BSEA 5IAOA 4EHNA 1G66A 1HRKA 2JIDA 2CZQA 3BFJA 5KOYA 1M1YB 1A7AA 1RAIA 1KEUA 4DV2B 2HJHA 5ALQA 4D4IA 2FZVA 5H1YA 4XD7D 4RL4A 1K9SA 4WLOA 1HBJA 1U9JA 1WHTA 4JBIA 4ME6A 4UFNA 4BO7A 4A2CA 1UC8A 3T41A 4WOPA 3PICA 2VAMA 4JT4A 4RU1A 3FNQA 2VVTA 3HBAA 4ZA2A 2PRJA 3CRQA 2B6NA 4LJ7A 4L02A 2CBZA 2Q3MA 2KE5A 4EJSC 1HT3A 2XYRA 5EUQB 2C7GA 2W8ZA 2W8BB 3M4XA 1JHQA 2WNIA 1NVUQ 1LPAB 1I3MA 3V1TC 4EQZA 3HKEB 3CZCA 1FFBA 4U7DA 3RRJA 3GFOA 1VPLA 3TLAA 2A9QA 2VBGA 2NVBA 4ZQEA 2OAEA 1PP4A 2O50A 2WC1A 1T9GR 1FTQA 4OTZA 4C78A 2Q6VA 1Z0KA 2RHRA 4N7BA 4TS4A 5JWRA 3C3WA 3A3NA 3IHTA 4U2DA 1S3GA 2VPWA 4AF8A 3O8NA 1OZGA 1ZVKA 1VL0A 5IAKA 4BOYA 2A0XA 1SU7A 2YHAA 1SD5A 4I7EA 2EG5A 4BQSA 2IHBA 2TS1A 4DAOA 3ENVA 2XEXA 3S1AB 1EFTA 3K6RA 2CE2X 4QFBA 1NJFA 4TS1A 1TUIA 2O2DA 3O8BA 3RS0A 2GN4A 2WMDA 1VP3A 3AF6A 2V74B 3W8EA 3A2NA 3PCTA 2V5AA 1WSWA 3CZQA 4HRYA 2FLWA 4TV8F 5SZIA 5JECA 3KKLA 1T2FA 5FBLB 2WSIA 4R83A 2D4HA 4A82A 5JJ5A 1G3QA 4PWYA 4HZIA 1VCOA 1E1QA 3DQZA 1GCUA 3FTDA 3E5RA 4IHAA 1KBQA 4KAAA 1VJGA 3VR6H 1COWD 2EGUA 3EUWA 4BVHA 3BX1A 2EDAA 3MELA 4ZO6A 3FGNA 1HFJA 6AT1A 2G77B 3E18A 3P2YA 1O03A 1WHSA 4GEGA 4LYFA 4EUKA 3AHJA 5BVHB 3UXEA 4D42A 4PICA 1BMTA 4PCVA 5KU1A 3O38A 4I6JA 4K9MA 3GD5A 3T15A 4KMOA 4UNSA 2AVNA 3VYUB 1L5SA 3AB7A 4UUMA 3UW3A 2BFDB 3CX4A 3QMWA 3U60B 2QM3A 1VHQA 5F4ZA 2BKEA 4L5BA 4EY8A 3AVPA 3ICQB 2EG9A 2W2LA 1CJKC 1VOTA 4M86A 3LRPA 4C1NA 2J9FA 1E63A 2WJ4A 4RZUA 3RWMB 1N2JA 2C1EA 5A3QA 3FHTA 3GAMA 4QODA 1SY7A 2F3UA 2H1FA 3GCXA 1I7SB 2XBMA 2QZ4A 1V7CA 1DOZA 2C42A 2VDQB 1GL3A 2BWJA 4JXXA 1V1RB 4PSVA 2OXFA 4D43A 4OI1A 2XBUA 1OWPA 4U9IS 3VU9B 3GL9A 4TUYB 4YMLA 1VCIA 1PWEA 3A9RA 2G76A 4AXXA 3P2KA 5EJ5A 5C51B 4DMRA 4HDRB 1JBEA 1R16A 1JQJC 2HPAA 2YXLA 4KO8A 4EG5A 2P9EA 5FTNA 1ZY2A 4KWTA 3K09C 2NPOA 2WAYA 1PQUA 1UJNA 3FGPA 4YYEA 1E7SA 1KDTA 2UXDB 5DTQA 3T0FA 1HXHA 4KHPB 4ED9A 4G0UA 5LZ4A 4WKBA 1FFXB 2FEPA 4AU1A 5G0SA 5AMXA 3MS7A 1CHNA 4C7OB 3NVKI 3KQVA 1A88A 3OJLA 2J48A 4JL5A 1J70A 3IESA 4AO6A 1P1RA 2GM5A 1ILWA 1TFRA 1XMOB 4R8MA 1USWA 1D4OA 2X4LA 1TQ4A 3TR5A 5JO9A 3UXYA 4C43A 1T3TA 3NEJA 5E0OA 4CIWA 5IHXA 3NALA 4MUEA 3I5UA 1PUXA 3O3CA 4H7KA 4JKOA 4EW3A 5KJ1A 5KOHA 3IBYA 1Y4AE 1BCRB 4REQB 1OHHD 3HJTA 4Q4AB 3C0KA 3R0JA 1YZQA 1A9TA 4CCSA 4CQMB 2B5OA 2PZJA 4C0AC 5I9LA 2W9XA 4JLNA 4BJ6A 3KOMA 2C20A 3ND9A 1L1FA 2BP7B 4G6ZA 3EHDA 1KMMA 3PL1A 4F38A 3TMAA 1RQNA 2X9NA 3HXLA 2XB9A 4C0XA 5JZ9A 4DTIA 3JRWA 2W6MA 2HF2A 2P2SA 4QDKA 3WDLA 5CUQA 2XADA 5E4FA 8LDHA 1FW8A 1RC1A 2XSZA 4U8GA 4KI7A 4B76A 3ISTA 3QK7A 1SKMA 4LRTB 3UK2A 4RKQA 1D2NA 4YA6A 2JCYA 3KTAA 1ZXXA 3RKRA 4Q4JB 1EYZA 3IIMA 4PGGA 3TQQA 2G5GX 3C4QA 5DYTA 3TX2A 3UMFA 1L1EA 4H7FA 3DKKA 2W6IA 1VBKA 1HYQA 3TBKA 3EUEA 2RMKA 2YV3A 2R8EA 3PQ7A 4EHLA 2PT5A 1Q20A 3QEJA 4M87A 1H2ZA 4X63A 4FWIB 3GA0A 3H05A 3HU3A 2PDAA 4M0CA 3SDSA 2IX9A 3ZCSA 4BUZA 1V16A 1A5TA 2FR0A 3P4UA 4FLMA 4OH1A 1E4YA 3F5QA 2EFGA 4MV5A 1N8SA 1TQHA 4Y1GA 4D5GA 4LSWA 3TW0A 2VYCA 4D4KA 2CNBA 1YZLA 2JA2A 1CQJB 2B83A 4K6OA 1MOZA 2CFCA 1Y3FE 4NAUA 2VCYA 2C88A 1LY1A 1B6RA 1BRTA 1F4PA 1R27A 3CCBA 3FR8A 1YZNA 5E95A 4B9EA 4F4DA 4HK4A 1TT7A 2PUAA 3Q7TA 5C9ZA 3PPYA 2BMWA 3GARA 3BXHA 4WKOA 5ITVA 5I7EA 2RHTA 3C6XA 1KMCA 4HT3B 3OC0A 3AUAA 1OGIA 5AKXA 1QAMA 3O8QB 4MGIR 1FLVA 1LLCA 3K5IA 2WTAA 2DQSA 1DC8A 2XT0A 1OQAA 3HC7A 4KB5A 4XJXA 2B7CA 1I6KA 3X44A 4JZYA 1T9BA 3AFMA 3SOZA 1MN6A 1N0IA 2DU8A 3GHHA 3IIIA 4KACA 2YJZA 4NZPA 3LVFO 5ER9A 5CR9A 3TM5A 5FPYA 3ZVLA 2BR5A 2J3DA 3EXHA 3QOYA 2NNWB 1VKZA 4BCDA 1DIRA 3DUWA 4KR3A 1DNPA 4U2EA 4BNHA 1J5EB 1WTCA 3G02A 4BKOA 1U1DA 3CPEA 4W6ZA 4JZKA 5B6PA 1LLUA 4UMVA 2XCUA 3GRZA 3PXXA 4X41A 2IOYA 4GKAA 4AG5A 5TSDA 4AECA 1VJ0A 3N6XA 3ABIA 3PPWA 3RFXA 2UZ1A 1WW8A 3QU2A 1NA5A 4L4ZA 5JI3E 3V33A 2R7KA 3D64A 3M1YA 3B38A 5TQJA 2CT8A 3LP5A 3ZHUA 2NVUA 4KV7A 4MWOA 3AF1A 1UOQA 1QH8A 4PZDA 3RT7A 4CEHA 3KAJA 3R7AA 3PXEA 2F1OA 4LOLA 4LRXA 4NYMR 1B8NA 5J4VA 3DKIA 1KYYA 2HF9A 2NAFA 3KNZA 1EFHA 2RH9B 1CY6A 3PWSA 4YRTA 2WJYA 1VCMA 1Y1RA 2GZ3A 4R51A 1C7EA 4YAUA 1K4MA 3ZCUA 4K6GA 1KE1A 3K1JA 2GVDC 4GW3A 3KUUA 1XK6A 3A2MA 1T8PA 4DSAA 1FXUA 1JQLB 1V9LA 3ITDA 3K4PA 2RHLA 1NI4A 3CPSA 1NTOA 1QHEA 3D2CA 2XCLA 2Y92A 1RJDA 2CW5A 1HGXA 5F1OA 5JAPA 3JAMA 1SCIA 3LHSA 2YV4A 4MLCA 4FGWA 4MYSA 4DXAA 1N2SA 5JNSA 5L53A 3K9HA 1ODIA 3VVBA 1QFJA 1OI3A 1BAPA 2GN1A 4XDHA 1QK3A 2WF6A 3JZAA 4U7FA 4ALJA 2PQ0A 3VPHA 4FFMA 4EOGA 5CAEA 1A71A 5EJ8A 3E1KA 3CE9A 3QELB 5AESA 4QVGA 2IIBA 2CWDA 1KJ8A 2IUEA 3GLUA 3GRFA 4LYEA 4N39A 5TMPA 1EXDA 2FN9A 1I7PA 2YJ3A 2NO5A 2NNLD 5CFZA 3TMYA 1QSGA 1DFIA 1XF1A 4P08A 4CTOA 1ZD9A 3BD7A 4OBXA 1C7JA 3F1LA 4FE3A 4HDNB 5K5EA 4AZSA 5DW3A 5IYZA 5KCZA 2DFKB 3TKAA 1CD5A 1F14A 1Y48E 2HHJA 4AC9A 4D45A 2PSSA 3G1WA 4DCSA 1N5OX 1NQ5A 2HL6A 4LZZA 4RTPA 5M04A 1E3SA 4F1WA 3KQTA 1SKBA 1AKNA 5T4HA 5DNCA 4GLOA 4DQDA 4EA9A 4JJEA 3H5AA 1QGED 2PLWA 1WDKA 3MB5A 3PPIA 4GYKA 1U1IA 2YW2A 4HPJB 4QASA 1J8DA 2Z3VA 5F9MA 3A6LA 4MIOA 3RRNA 4PVDA 3OTHA 4IRMA 5FOQA 1J4AA 2O52A 3RABA 1W6RA 3RNLA 1V11B 4L9RA 1UK9A 3A2KA 3JQQA 3CKLA 3VTKA 1EQUA 3RARA 1VFNA 1WCIB 1ZNWA 1THZA 3RIMA 1UBTS 4NH4A 4RH3A 3D0RA 3I58A 3TTVA 1UEXC 2YW9A 3QYAA 2ZUUA 4QPNA 4C3VA 4CM7A 4HQLA 4Z9AA 2YYAA 3KZVA 2ZRJA 5HTKA 3GLRA 5IDYA 5AUOB 3E4DA 1DXOA 5FWDA 3B9RA 4NYMQ 5ICSA 2FEXA 2C9YA 3V32A 5HRUA 3FB4A 1QP4A 4FTWA 4XQCA 1QOQB 1QPBA 4UCXA 1FBTA 2HIHA 4ZKDA 1OFTA 5DHSA 2WU4A 4UE2A 2XCIA 5KINB 4KKXB 1SCBA 1ZJ5A 3G9QA 1MRZA 3TXAA 2FPPA 3CUTA 3L46A 4K88A 1U0NA 3DLHA 4GXNA 3REFA 2RHMA 1X1QA 1J2EA 2J59A 5H83A 3NM6B 4Y18A 3UANA 5EXDA 1N3IA 5LP1A 3EXFA 4RH1A 1YS9A 3BGSA 2DQZA 2ZYWX 4K0KB 3ANMA 4MA4A 1QMPA 4GC5A 1NBAA 5DM4A 1W36D 3W79A 1SUBA 1U1EA 1VLJA 4ML3A 4ISCA 2IF2A 3AWIA 1MX1A 4IDGA 3AFGA 2Q28A 4LRSB 1YULA 4QOSA 2Q5OA 5HQJA 2WTMA 3ESBA 3ZV3A 4QX6A 2MINB 1ILEA 4N5DA 3N2GA 3CCCA 1IHXA 4E5SA 3OTWA 5F5LA 3MJFA 5FUYA 1N6RA 4KWCA 1M8PA 4DUYB 1ZJZA 3ETEA 2BTOA 3JZDA 4WY8A 2PMFA 2AOXA 4L08A 2J3HA 2W8BA 2XBLA 2Y05A 2VDNB 2AR7A 1JDVA 3OHMA 3ODGA 1UPTA 3HP7A 3QY9A 3BILA 2COEA 3BEOA 3EFOA 5FOXA 1C7ZA 1MAVA 4CMEC 3A1CA 3DDZX 3QWHA 1GQSA 2P3QA 3OJOA 3FVTA 2FZLA 1X7HA 4J6EA 2GZRA 5LP6B 1NURA 2ZBRA 4C2AA 1ZVJA 1CY1A 2KX7A 5DISB 1KJIA 2RJOA 3ETDA 5HZKA 4ARBA 1GQRA 5HKKA 2JJ1A 3FZNA 3PFFA 3GFBA 3O1HB 5LLDA 1UBLS 2WYUA 1HWYA 3CR8A 3VR4D 4D26A 4F8EA 1NQOA 3X1DA 2PUWA 4XYMA 4KQ9A 3CW2A 4PINA 4HNAA 3D2AA 4EB8A 1QCCA 1G6Q1 3V7WA 3ZJTA 4E0BA 1Q15A 3PX3A 3E2MA 3H9UA 5JADA 3U0VA 3BUSA 4V0OA 4QGFA 1LNSA 2D59A 2ECPA 4UM9D 4PHCA 1KO7A 3B1KA 1ZCFA 4I99A 3DNPA 4JJFA 4L16A 1P2DA 1C50A 1JA9A 1DKUA 2AFRA 2WE7A 3C5CA 4H1VA 2IV7A 4B46A 1DTWB 3R6DA 4QXMA 4D4LA 5EI5A 2IQ5A 1DC6A 2QUHA 4EHAA 3JVEA 5L6MB 4AB1A 1CP2A 4PZUA 1TUBB 4EEXA 3ABZA 2FLVA 3IPYA 1FJXA 5FLKA 1PZHA 3PJRA 4WLVA 4DCCA 4L0QA 5C8VA 3MTJA 3IUBA 4JLMA 1JEYB 3QUTA 1X87A 1E77A 4M1ZA 4WN9B 4YP0A 3SE7A 4A1FA 2VDKB 4EVIA 2WINI 2BF4A 3QITA 2ZVDA 1T0BA 4KR0A 4AIIA 5KNBH 4U7TB 4OHPA 4EAAA 2GN2A 3SC2A 2WR8A 4LHZA 3WAKA 1KK0A 3MWJA 3MJHA 3KVVA 2B21A 1W5SA 1V1MB 2WAXA 3EAFA 1MAWA 2MSDB 1L5MA 3LCMA 1UIMA 1JIVA 3CSUA 3SYNA 3A26A 1RNLA 1GG9A 1MJFA 3MF4A 3O74A 5I9MA 5D2CA 2AVDA 1ZNZA 2X41A 5JLAA 4D9EA 1B1AA 1XZBA 1L7XA 1EWTA 1SQGA 2RGAA 3DMDA 5TC4A 4ZCRA 2Q3EA 5JDIA 5K3OA 1K4YA 4LZNA 3SF8A 3WRYA 3ZBTA 1T3HA 3ADDA 3KRTA 5JJBA 2AL7A 2REOA 1RPJA 1T1RA 5EXPA 3DGEC 4HUQA 1QRRA 2Y0CA 3VU9A 4XLZA 1RXVA 2VC2B 2WABA 4EI7A 1YBHA 2BFEB 2Q9UA 2FSIA 2QSUA 1I30A 5B53A 3MINB 1T3SA 4C3ZA 2PK3A 5IULC 1U4SA 3N0RA 2CLSA 2LKDA 4PLCA 2OHFA 5BQFA 3BE4A 1HURA 3HUFA 1FYEA 5FOVA 4PX5A 2I1WA 2AOWA 3CLSC 3MBIA 3D3NA 1QP0A 1UKAA 3V2HA 1DBWA 2FV8A 4TXHA 5TLSA 2IEGA 3D59A 2JBHA 5ELLA 4CF6A 4D99A 2B61A 4U1RA 2J3LA 1SBIA 4EJSB 3A36A 2HCRA 3QI7A 1KXZA 1A8IA 1Q0ZA 4XQGA 5DVZA 2O59A 5ERGB 1C7QA 1TYDE 3B13B 1NTRA 2GPJA 3CR7A 4EYKA 5JI2E 1GZ5A 2J7PD 2YJ6A 3LUCA 3SVLA 2PUHA 2QD4A 3H2YA 4W7IA 3AK4A 4YDSA 3L6CA 4L22A 4G9GA 3IPRA 4M7WA 4D82A 3KV3O 3K1YA 2O20A 2QMOA 5B55A 3BMCB 3LBYA 3V42A 2OYSA 2XUOA 3I2KA 2VAVA 3P9CA 5FD8A 4P86A 4EA7A 4CQMA 4DPMA 1XQXA 1IJBA 1S8FA 1OXXK 4PAMA 1GP2A 3QVVA 4RA6B 1GU7A 2DVMA 1NQTA 1R8SA 3B1FA 3LCJA 3SM3A 1UQUA 2OA0A 4CKEA 1XTSA 4UEWA 5CGQB 4YJ3B 4D02A 5P21A 3PKIA 4UPEA 5C7LO 3T3OA 4BJ3A 2V7EA 3N8GA 2R2GA 3ICCA 2FPIB 3D7SA 1R3DA 1VKOA 2GAFA 4O02B 3TD6A 4R2MA 2ZJ8A 5DGCA 3UA4A 3GLQA 1NC1A 3HDYA 4KWEA 3AG6A 3C3DA 4FJ1A 4AJEA 2VNIA 2XMCA 3HI4A 3KFVA 4BV8A 3M5DA 1ID8A 2IOFK 1LU9A 2P9GA 1YFKA 4IW3B 2JFBA 1QPGA 4V38A 2Z58A 1LS1A 4PIPA 4DLXA 3AVXA 2IPMA 1SC6A 3JS5A 2YXEA 2GXQA 4FPXA 2H85A 1ZGCA 4X9XA 5GIOE 3E8SA 1Q0HA 3ZGNA 4JS0A 4KZKA 4ZV4A 4KO4S 5HFJA 1T2UA 4IVRA 5DV9A 2GEUA 5BWNA 3VSCA 3B8HA 2XKAA 2QEQA 2E4WA 3PYLA 1J1UA 5F2OA 1KH1A 2B8JA 3IDSA 4XPZA 4ZQFA 3LG2A 5BYKA 2MMGA 4X6LA 4X91A 5EG5A 2BM8A 1EE2A 4YRZA 2X7JA 5JNUA 3UJNA 4JNCA 3KTFA 3WJAA 1ZG3A 4LNUB 4K9OA 4U7GA 2IKQA 4PGMA 3ROMA 3DVRX 5JH7B 4IJWA 3QU7A 4L8GA 1CRPA 1MXFA 4ZI7B 1T36A 2IHTA 1ZHOA 3GRKA 4XUCA 4G1BA 3WQSB 2INGX 4PR3A 2IP2A 2XKJE 4D8TA 5CXSA 1T2CA 1T8WA 4WCFA 1T9GS 1D6JA 4ZVLA 1AMOA 1C9YA 3KJZA 5CFQA 3K9WA 1KY5A 1W2GA 4XUDA 3ISJA 4BXOA 2VQDA 4F96A 3QJGA 4NC9A 3GAAA 4R16A 5K3FB 2QENA 2IYAA 2Y27A 3N2EA 1ZINA 3GJ4A 5EZ5A 4YQEA 3AQ4A 3ZWPA 2W0MA 1H9BA 4MSUA 5FI3A 1WXGA 1EBUA 2CFOA 4MUFA 1IEQA 1RQRA 2A9RA 4QARA 1V6AA 2I62A 4FQ7A 2CXTA 4MEAA 1ZRSA 3DEJA 4P53A 1OD6A 2YWHA 3MJVA 2JH9A 5IW8A 5B3JA 1KDZA 1PW7A 1PV1A 1YFLA 1SIOA 1TMKA 4EL0A 4W5QA 2GZDA 2VPPA 3A1SA 4YJ2B 1KOFA 3R7SA 4CF7A 4KU4A 1NN3A 3DZHA 1ZK1A 4EKYA 1FFYA 3U7FB 2EKPA 3GI1A 2SHKA 1I6MA 4EYSA 5JQGF 4B7ZA 3NRCA 2PX2A 2WUEA 4K03A 4TWAA 3UATA 4AZ3A 1CQXA 4UBLA 4F45A 4YMTA 1T0JB 3F8WA 5I7VA 4Z51A 4X94A 2YDYA 2R7NA 4B43A 4GWKA 1E1DA 3PHHA 3CS3A 2IS6A 1M3SA 3AETA 2G6TA 1EFPA 2YHUA 5JNVA 4NJOA 2L82A 1AGYA 1SG6A 3FYHA 3CZ9A 1QLHA 4WGGA 3T9CA 5ALHA 5F78A 3ZWVA 1H4QA 2IHJA 1M0TA 3C3CA 1JJFA 3RG2A 2YWGA 3ZV6A 2BZ1A 2WJAA 4F3NA 3DZCA 2G82A 4NV1A 4DV6B 3NH9A 1GG5A 4IWNA 2O8BA 1RKVA 1ZBDA 3G85A 3BQNB 4G5SA 1UAYA 3TN7A 2OZVA 1ZR2A 3CG4A 5H80A 3OWOA 3VSAA 1H4TA 2E4YA 1HDEA 4E32A 4M0DA 2RE8A 5AWFC 4UBOA 3V8VA 3QEKA 4BNFA 3HJGA 3LUJA 4KN5A 3DBRA 4O59O 1MH1A 4E1VA 4FGSA 3TFQA 4AKGA 3PD7A 3QJYA 1S4MA 4RPCA 3L0CA 4UEJA 5EWJB 3WICA 4AZ0B 2G17A 3L8CA 2NU9B 2PZ8A 3EDCA 4GUDA 1QNFA 2HB6A 5J5CA 4E3WA 4A6PA 3GVHA 3L6EA 1T9ZA 3A9CA 3IXMA 1XTQA 5BNIA 3C24A 5JD6A 3FWPA 3JR3A 4AWXA 5JAHA 3DFKA 1BGXT 3EEFA 3R23A 4OLJA 3CF6R 4YGXB 2VO1A 1WA5A 3IBTA 1R0XA 2O0HA 3BERA 5HR5A 3QTBA