4FILA

Structure of fhud2 from staphylococcus aureus with bound ferrioxamine b
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
256
structure length
256
Chain Sequence
b'PKRIAVVAPTYAGGLKKLGANIVAVNQQVDQSKVLKDKFKGVTKIGDGDVEKVAKEKPDLIIVYSTDKDIAAYQAVAPTVVVDYNKHKYLEQQEMLGKIVGKEDKVKAWKKDWEETTAKDGKEIKKAIGQDATVSLFDEFDKKLYTYGDNWGRGGEVLYQAFGLKMQPEQQKLTAKAGWAEVKQEEIEKYAGDYIVSTSEGKPTPGYESTNMWKNLKATKEGHIVKVDAGTYWYNDPYTLDFMRKDLKEKLIKAAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferric hydroxamate receptor 2
molecule tags Metal binding protein
source organism Staphylococcus aureus
publication title Crystal and solution structure analysis of FhuD2 from Staphylococcus aureus in multiple unliganded conformations and bound to ferrioxamine-B.
pubmed doi rcsb
total genus 92
structure length 256
sequence length 256
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4filA02
1TOAA 1M34B 1K2VN 4FILA 1G20B 4WZBB 3AEKA 2MINB 3EIXA 1M1YB 1QH8B 5GGXA 3K1AB 4XPIB 3K1AA 4WN9A 1QH8A 4INPA 5JJ5A 2MINA 2OV3A 3MWFA 1PSZA 3AEKB 4MO9A 1M34A 4HMOA 2XQVA 4G07A 4WN9B 3U7QB 4XPIA 2PRSA 4PAGA 4OXQA 5M34A 1EFDN 4B8YA 1M1YA 2XY4A 3AESB 3ZK8A 4UTPA 4WZBA 1KAEA 3PSAA 4N01A 4MLZA 1G20A 2OV1A 3ZKAA 5M2QA 2XDQA 5BVGA 1M1NB 2WHYA 2AFIA 2Q8PA 4H59A 5M29A 5KOHB 4ND8B 1ESZA 1QH1B 2R79A 3R5SA 3TNYA 4LJSA 1L5HB 2XH8A 3AERA 1K0FA 4GICA 1PQ4A 4INOA 4OXRA 2M6LA 2AFHA 2PS3A 3NU1A 3PDIB 2PS9A 1QGUA 2XUZA 1MIOB 4FKMA 4UTOA 5AFSA 4OVKA 3ZK9A 3MWGA 4WESB 5KOJA 5JG7A 3AETB 3MINB 5CX1A 5BVGB 4MX8A 5B58T 5I4KA 1KAHA 4NNOA 2YNMD 4UDOA 1G21A 1H1LA 2OSVA 3G9QA 3HXPA 5KHLB 3AEUA 2ETVA 4WZAB 4TKVB 5HDQA 4LS3A 5BVHB 5JPDA 1FP4B 3AEQB 2PS0A 2R7AA 2WI8A 1N2CA 4K3VA 4IRMA 3ZK7A 3HH8A 4WNAB 4FNAA 4TKUA 3AEQA 1FP4A 4FI3F 5BVHA 4WZAA 4TKUB 4WNAA 4HMPA 1N2CB 5GGYA 1N4AA 1K75A 3MD9A 3CX3A 4NNPA 4UDNA 2OGWA 4PM4A 4TKVA 3TEFA 1N4DA 3AEUB 5KOJB 3MFQA 1K7SN 1G21B 1H1LB 3GI1A 3HJTA 3R5TA 1MIOA 1XVLA 1QGUB 2XV1A 3PDIA 5CR9A 2AFHB 5HX7A 5JOQA 3UJPA 2O1EA 2Q8QA 2X4LA 3AETA 3MINA 5CX1B 3PSHA 4WESA 2QI9F 2RG7A 2YNMC 3LI2A 4H0FA 4M7OA 4MDYA 1L5HA 5FLYA 4CL2A 4ND8A 5KOHA 2M6KA 3BE5A 3TLKA 4DBLE 4HMQA 4BBPA 5M3BA 3EIWA 3AERB 3BE6A 1N2ZA 2PHZA 3AESA 1QH1A 4G09A 3ZTTA 3U7QA 3LHSA 1KARA 2AFIB 1M1NA 4HN9A 2XDQB
chains in the Genus database with same CATH superfamily
2A9JA 4YJ3F 1P39A 4HEJA 3OHMA 3B85A 3H1TA 2O6HA 4FHGA 2Y71A 1FFWA 4MWDA 1Z6TA 4GXRA 3BXXA 2XNJA 3RKSA 4Q3AA 1RI2A 1Z0UA 4J0FA 1H8ED 4W99A 4Y8VA 3RBZA 1J2YA 1O97C 2AXEA 2BCGY 2EYQA 1MAVA 1L4GA 1RMYA 2C5HA 2H5LA 3U0VA 1ITZA 1YVRA 4MHSA 3E9DA 1EVYA 1S9HA 1K88A 2C5EA 1SXJB 2JI4A 4KYIB 4NCAA 3ZDRA 1CP2A 1I1NA 3C1UA 5COBA 1TYBE 3I1IA 1Z4JA 2IEIA 4GEKA 1G7TA 3KB2A 4H16A 3UB2A 2J7PD 2JEYA 2ZIXB 3EQ6A 3Q0TA 2P65A 4W5WA 3IR5A 1LUAA 1CXZA 1VHLA 1WA5A 3HKBA 5AVSA 3S44A 1NFFA 4RWZA 3FOWA 2YNMA 5JNWA 4U7JA 3UC9A 5JJLA 3VR3D 2H7VA 3B3FA 3HR8A 1XC7A 2R6GA 2FPLA 3H11A 1VPTA 4ZCRA 5DK4A 1FLDA 4RKYA 1NLYA 2I2BA 1B8OA 1MO6A 5B1YA 5BYAA 3DHWC 2HMWA 3CMMA 4RHEA 1U9IC 3KYIB 3I62A 4BL5A 2HCJB 3K92A 1C9KA 2OBFA 1E3TA 3RV3A 3A3KA 3A06A 3H5WA 4A8TA 4DUYB 3PUYA 1X7XA 3DQZA 3H75A 4HDKA 3QXSA 4LKRA 5TX7A 4TSFA 4ENSA 2NO6A 3HKEB 4RD0A 1GGEA 4WK2B 4W5RA 3KB6A 3IBTA 3WO0A 1OZAA 3IRVA 2FW8A 4WZAB 4AJ4A 1KZYC 4GW3A 3QKIA 2GZSA 2OG1A 1KZHA 1WXHA 1ZSYA 4PYJA 5T8KA 4KTTE 2F8SA 2LD4A 1WP9A 5CD9A 5DLPA 3BL8A 3VI3B 1XMVA 3K9CA 3O2QB 3B2QA 3FXAA 2H1VA 3OQMA 4KI7A 4Z4HA 1F2DA 3P9CA 4PTZA 5AUNB 5LXTA 2PANA 3CR7A 3S2UA 1NQUA 4ZHQB 2O8BA 2II6A 3QHPA 4O8CA 3ZTWA 1UP7A 3B7WA 3KOZA 4I9FA 5KJCA 5LU8A 4GQAA 3SQXA 5JVDF 2BGMA 5HMMA 5FHRA 1BXRA 3BBPA 1CQZA 1O94A 2YWJA 2AQKA 4PYKA 2BTOA 2HU5A 4FYKA 2O8DB 3IERA 1PNVA 1Z0IA 2DLDA 3UW3A 2EL7A 4GL2A 2R1VA 4QOIA 4NU6A 2X2PA 1Y6GA 2O57A 4J1NA 2ACEA 2HHCA 4MUBA 1E6CA 3K3PA 3OT5A 4Y1EA 4OP3A 2AN9A 3LQ1A 1H2AS 3KJFA 1Q7RA 1KYYA 1VA4A 5GONF 3AK4A 2B8EA 4U2CA 3SZRA 4DAOA 4ZTZB 2ODNA 4L27A 4OU4A 4MLCA 4YCAA 1DHTA 2CV0A 4FBGA 1ZKDA 5CYFA 3GVHA 2VT7A 3EZ2A 1XRQA 2RI0A 5HBGA 2BZGA 5BSUA 4EEZA 3BJIC 3PXEA 3L7AA 1LK0A 4CMHA 2O4UX 1SWVA 2RONA 5KC8A 3NM5A 5FPKA 3SX4A 2QU8A 4CM1A 2WJJA 3HABA 2IUEA 1N5KA 3VX3A 13PKA 1IY9A 3AF0A 5E6SB 5TLSA 2R1TA 1QPZA 4QFBA 1NQOA 3E7FA 4R3NA 1OAKA 1IVSA 2JK1A 2AOUA 2WYOA 1VJRA 3C97A 3CGGA 3PGLA 4DCOA 5AHWA 1WWKA 2OGUA 3DV2A 3M4YA 2CEKA 3GJ0A 2NO0A 2SKCA 5BW4A 1V4BA 5ARDA 2IHKA 4MV8A 5K0BA 4N7JA 1AO0A 1RI4A 1ZCFA 5CDYA 2CWWA 3FF4A 4YQZA 1G8HA 2C0CA 5KYKA 2I6SA 3HLTA 4AB1A 3NMUF 2J4CA 3LT2A 4XPIA 2CF6A 2C3OA 1J21A 5H81A 3NBFA 16PKA 4DYVA 3R7FA 2E89A 2QX8A 4QELA 5IN5A 3WWCA 5IX8A 3IE1A 1GPH1 4Z3KA 1VIDA 4IQ0A 2W2LA 1LC3A 1N6RA 2WAOA 3GAZA 5CTJA 4DCNA 2WC1A 2FUCA 1QKKA 1KZGB 2BH9A 4LSGA 4P2BA 3RC3A 3BMXA 1WHTB 4OATA 4PZLA 1M5RA 2G9VA 3C3WA 2F1JA 3R3UA 1YS2X 1IN1A 3B9RA 1CNEA 3MNFA 4X1KA 5HZGA 1W30A 3BH7A 4QATA 4ZV4A 5AK6A 1A9XA 3C6QA 1R66A 3L8ZA 5IEBA 1Y8CA 3ORRA 4BTLA 4ZYTA 1KKUA 3EOBI 1Z33A 5FKJA 4R6WA 1R0SA 1DJLA 3ED5A 4KQ6A 2I6XA 4LV5B 1EA5A 1MPXA 3LCJA 4J0GA 5E9QA 2XKKA 4NU5A 3SFVA 2KJQA 4ZHQA 5K03A 1VKNA 1FLVA 5JS1A 4C22A 1W87A 5A0TA 3ESXA 2IOFA 4S24A 3T95A 2IWRA 3TAHA 4II2A 3V00A 2WU0A 2NUTB 2L18A 4LF6B 3BK7A 2O23A 2AXPA 1Z7GA 2JFHA 1IY2A 4KXYA 3OJEA 3TD2A 1EUYA 2D54A 2HF8A 1DAPA 1A7JA 2IDKA 3X2EA 3PXGA 2PR7A 3HKEA 1WL8A 1HF3A 3KR9A 1KFCB 1U31A 1UBCA 2RHTA 2EL9A 3GIDA 3R41A 1E1CB 2HJ9A 4HTAA 4EHDA 1FIUA 4QFCA 2LTAA 1IM8A 1X86B 3GRPA 5A2QA 3GH1A 2G5TA 1FW8A 1SVNA 1OX4B 1X1RA 4K9DA 1KBOA 3IO3A 4TXLA 1FUUA 1U28A 3K2QA 2WWVD 2PTHA 5CIYA 3ONNA 3OCYA 3KVRA 3G2KA 3P5BA 5KQMA 1R16A 3MW8A 2ZLBA 3NVDA 3SPXA 3O4IA 3W2GA 2CB0A 4RHTA 3EIEA 4JJZA 4ZGWA 4INZA 4J3FA 4QRDA 1V8PA 1F5SA 4KYVA 1DXQA 2CUNA 5LQNA 1RI3A 1PT7A 4ZU1X 3DEYX 1D2NA 1SUEA 1F2VA 3A4LA 2HREA 2BMEA 4WN3A 1KH3A 1QVWA 1QX3A 3LO8A 2FJPA 4YT5A 4MWZA 1V1JA 2GETA 2H8GA 4Q1BA 3Q11A 4YP0A 3Q6NA 3ZU5A 4AKTA 1TVEA 4ARUA 4B71A 2J4FA 2LPMA 4KO1S 2JGLA 3HWRA 4GLFA 4MB2A 1JG2A 1H8HA 3OOJA 4JQYA 4JFRA 1NHWA 4BPRA 3R6WA 1IY1A 4UREA 5GM2A 5K4GA 1RPJA 3HJBA 4FYVA 3WI7A 3JYPA 3RROA 4UUOA 1JPUA 3ZJ5A 4BAZA 5HIMA 4FWTA 5LC1A 3B89A 2CZCA 3K8YA 1Y7LA 3N2EA 2YJZA 1AE1A 1UM9A 4XWYA 4FFOA 4Q93A 4RTQA 5AW2A 3NNSA 4H6XA 2BM1A 4OI4A 1XQ9A 4L3VA 4Z99A 4TUYF 3RUIA 4NHOA 2F17A 1HZZC 4C5BA 1NVGA 5JXIA 1XU7A 1YJCA 5DNUA 1HG1A 4KQ1A 2GDJA 3JQ9A 1P77A 1WOMA 3NUGA 1YR1A 2YWFA 4ZVVA 3R9IA 3I8SA 5F7ZA 4DDKA 1MC8A 4KIWA 3GFQA 1Q2UA 1WLYA 2W93A 1TMGE 1W4RA 2OHGA 3R5SA 4L73A 4U4AA 5D6NA 5EIOA 4BMNA 5F2KA 1I3OA 3BYZA 3NVKI 1W1IA 1HO3A 2R1ZA 4M1QA 3PQEA 1K6MA 3WLHA 5KYGA 2J32A 2CW5A 3PEUA 3Q7QA 4MI9A 3H9JA 4DGSA 4B6JA 4ZHQF 4BKMA 3AF1A 1T2DA 5FBWB 4OVKA 2CL6X 3PHHA 4G1UC 1KWGA 1VCHA 1AKUA 3QRWA 3WB1A 5IVPA 1HWYA 1NI5A 2FR1A 4TKMA 1FBTA 1GU0A 5DT2A 3DGEC 2QVCA 1PGJA 3QF4B 3B5JA 5J2UA 1DDOA 2NVOA 1EUZA 1PT5A 3KOOA 4MVJH 2D2VA 4Q21A 1IK4A 4OAOA 4J3JA 1P5HA 3TE6A 3JY6A 3PIIA 1AGNA 2V6BA 3T5AA 1ZA1A 3M6MD 5LJIA 3KJHA 3LYLA 1GQOA 4ZANA 4MV1A 1NZFA 3A4TA 5CT9A 8OHMA 3ZK7A 2P5TB 2QRVB 4GKJB 2FPIA 4DXAA 5CMLA 4CVNA 1RWNA 2OEPA 3UV3A 4LOAA 4MEBA 3WG9A 2ATIA 3LQRA 1UBNA 1CEXA 3CW2A 3JTEA 2Q0QA 1ADBA 2PPVA 1FVHA 1E9FA 1PT6A 4ZV9A 4KACA 4WADA 1NSYA 2IGTA 1XMXA 1M76A 2J8ZA 3NS7A 4BGDA 3P9XA 4NE2A 1WTAA 4KPFC 1GFWA 4OQLA 5BR8B 1P19A 3ANNA 3CX7A 4WCFA 3GLUA 3KYJB 3U9TA 1E2NA 2ECPA 5AVQA 1DAGA 2PT7A 1E59A 1SHUX 1SBHA 3KHUA 3I9MA 3TX2A 1CUEA 1Q3KA 5KYXB 1U6KA 2OORA 3L92A 4GFDA 4EA7A 3GUHA 5AM3A 1JN0A 1THMA 2A0YA 2FSGA 2J85A 3PDCA 4RDIA 4YB8A 3TLXA 4DLKA 4KIJA 2G5GX 1ZR2A 3QLEA 1YR3A 4NMWA 3GJ8A 4QHTA 4IEIA 4XIFA 3ZZ0A 1QORA 1FP2A 3ZE6A 1SBCA 5I7FA 2H92A 3VHQA 4N6GA 4GRIA 4MI6A 5AK5A 4EGJA 1EUDA 1O6FA 4LF7B 2UZ1A 1J5XA 3EIWA 4OFXA 1ZGHA 1FNSA 5DYGA 3CVVA 4CT4B 2YXDA 4D9KA 4QWMA 4HGPA 4XDYA 4MGZR 4H60A 3SD7A 4BLQA 4ESOA 1YIDA 3A11A 1FS5A 4JJKA 3DYIA 4J1TC 1H1DA 3VO9A 4Z4FA 3L7MA 2XX3A 3RVJA 4O3MA 3C5EA 3ZWOA 4RAOA 2CBXA 3NALA 4JJ7A 1MRNA 3AUYA 1QO0D 5K1ZA 1UIMA 4UXJA 4W82A 4BAGA 2C9YA 1HDEA 2ZIZA 1FQOA 2PMDA 3RQIA 3RWOA 4B85A 4J0DA 5CA1A 3JZIA 1MKYA 1PL7A 3RI3A 1JXAA 1U6JA 3QOXA 5WRFA 4G2NA 1GKUB 1WZCA 3NO4A 3NHZA 4DMFA 5JJ5A 1EWKA 1DX6A 3CKMA 4HK4A 1B6GA 3V7FA 2PE5A 4KR7A 3ZCXA 2V6FA 2Z09A 1T2FA 1NOKA 2NUPA 1HQYE 2JGNA 4TZTA 4MRVA 3RRFA 1T5IA 3CKKA 4G8DA 4U7HA 3VZDA 1XYVA 2C2YA 1YIAA 1M8JA 4M8LA 3OQHA 4XX0A 5L7WA 3CURA 5ESDA 3DM9B 2C4TA 3ZHVA 3VOSA 3OHPA 3DBIA 1SULA 4PO3X 5IASA 3W5UA 4MMYB 3T5BA 1J4AA 3JQQA 3UT6A 1UMDB 4HVTA 1P91A 3QIVA 5IDQA 5M29A 2JLVA 4RE5A 4KPYA 5LP1A 4B75A 1FFBA 2VDLB 1CUJA 5FLXA 4IXWA 2ZPAA 1PQUA 2XYRA 3GJ3A 4WBXC 4GX2A 2YV1A 3L0IB 4ZVQA 4D5GA 2FWIA 4QSMA 3B6EA 2VTKA 2X0EA 1VCMA 1KC3A 3R0QA 5FCDA 1UOEA 1OLUB 4U2BA 1I94B 4GMKA 3Q8XB 1HE3A 3NC0C 2J5RA 3O74A 1ABBA 5AFSA 2WWFA 1GRQA 5FFNA 2AGVA 1MG5A 4XYBA 4J1QA 2YXNA 2Q4RA 2PUHA 3QE0A 1DDIA 1V3UA 3QXHA 4ME6A 2OB2A 3UMSA 4Z51A 3K9HA 3ZC3A 1Z56C 1SO8A 4HN2A 3AR7A 4ALJA 2ST1A 3DLAA 3G23A 3NWEA 4E2YA 1GVNB 3BGSA 4RORA 1W52X 2X8JB 4JDPA 3VA7A 5IAEA 1T6NA 2I4RA 1XZIA 2C2OA 4QQFA 2ZBQA 2FPIB 4DM7A 1AUOA 1QANA 4IYJA 3FWZA 4JKIA 4QPNA 4O5AA 5ADHA 5F5NA 2WVJA 1AZTA 1A8QA 4DG5A 2Z56A 4FNAA 1KR5A 4DIEA 5EJ5A 4X66B 3OUZA 5IUNC 1RQGA 2CFSA 4UUMA 3M3HA 1Q84A 2PD6A 2J5QA 3DTTA 3HVUA 4HB2A 3TCNA 4NS4A 2QT1A 4NNPA 2V7QA 1QCYA 2PUGA 1QGAA 3K05A 3T9DA 3OBBA 2ABWA 1XF1A 3Q2KA 3D3EA 4G8BA 2D4AA 4II7A 4IIDA 3ROFA 2I33A 3B5EA 4L5BA 3DLPX 1RHJA 4JLSA 4P4TA 4QT0A 4WY8A 5IJ9A 2CE2X 4WKPA 2YRFA 5G0UA 3AY6A 3K5HA 1W5BA 4GUAA 4MB0A 5TSDA 4EKIA 1ZICA 3UQYS 4YAKA 4ZEOA 3CRW1 3FZGA 1Z47A 4G0VA 3EXFA 1E89A 2N3ZA 5DBIA 4ZT2A 2ZE5A 4DJ5X 3OHSX 1TJ5A 2VO1A 4L9RA 3TH5A 3GVCA 1JMYA 3H99A 1LBTA 3L40A 3CUYA 5FUYA 3AX6A 3WTBA 3W6ZA 2XF8A 4UAGA 3JAWB 1JSRA 3NUQA 2F9LA 2KPOA 1O4WA 3C6KA 3IA2A 3T3EA 3FWHA 5CU7A 4EKGA 5BN1A 1S8OA 1OE0A 2WFAA 3ZW7A 2O6LA 3ABIA 5SICE 1J49A 5T6MA 1Z4OA 3SJAA 5IXJA 3M89A 4GPD1 1DC4A 3WBBA 5LDGA 1G3UA 4YR9A 5IZ4A 4P3PA 5DBHX 3SLRA 1ZCBA 3BC1A 1O77A 4ENUA 5HGJA 4CCWA 3O38A 4MK4A 1M1YB 4B7XA 1PJRA 1JKXA 1DIRA 2V45A 2VPWA 3ZHYA 4EDFA 1WDLA 4TYYA 4BJ6A 1DKPA 3FTDA 4TZ6A 1QBKC 4TSFD 3UY4A 1ULHA 2BW0A 2OORC 3DMFA 4IJUA 3ZWPA 1X7HA 2CCJA 2GZHA 3AZOA 3RLFA 5TF0A 4JI3B 1KMMA 2ZM5A 2VHZA 4MW6A 1EFDN 3HRIA 2O8CB 3OP1A 5DIZA 5IJ0A 2XYGA 2IWHA 3ZU3A 1U2RA 1UPBA 4UBLA 4JI5B 5B7NA 3FJ1A 2XUKA 3ITEA 1P0IA 5EPUA 2VHTA 3MM4A 5C5DA 1ZRNA 2Q4EA 2ZATA 4EB0A 2IEZA 2PYZA 5GQSA 3CINA 2LP4Y 1KE1A 1I6LA 1S7GA 2QRMA 4KZKA 3FTPA 1LRKA 1NBMD 3D43A 2FWMX 2JIMA 3RPEA 2IYQA 4S3MA 4P9NA 4DMMA 2QE7A 3WYBA 4C30A 5THQA 3ISTA 2RJNA 2AK2A 2V3VA 2X8BA 2BEJA 4U7PB 4GI2A 2JFNA 1GUZA 4HYYA 1NUUA 2XUHA 4KBFA 3UK1A 3VYSB 1KK3A 5DNEA 5KMGA 2AV6A 2YX1A 3ADBA 4F2DA 3HUUA 1E9VA 4HQFA 4IOJA 4UW9A 4EA6A 5L53A 2LWIA 4MA4A 2I4IA 4FEGA 3MB5A 1DAHA 4DQXA 1Z28A 4MRMB 2VBFA 2H3HA 1N2IA 2L0XA 4QTXA 5KVCA 10MHA 5LIRA 5H59A 5CYPA 4M0EA 2Z8YA 1XTBA 2OOSA 1K86A 1EP1B 2HD4A 1BGVA 2WQZA 4JSTA 3T3PB 4CF7A 5HKKA 2XTMA 1G0OA 4Q4AB 3EVCA 1XZGA 3CPJB 4OA8A 1XDUA 3DE0X 1C4WA 5ARCA 3WBJA 4UCFA 2N46A 2OC9A 3MHPA 1ZM4A 3HUEA 5JXHA 1DIHA 1RKVA 3ND9A 1RQPA 3O7WA 3UUGA 4CL8A 2ILVA 4DW8A 5GZ6A 4F4FA 1AKYA 5CW1A 1M6NA 4AJIA 1E3QA 2QEQA 3D0OA 4ZK2A 3K71B 3JQBA 3M2PA 4MS4B 2F1KA 4FSXA 1KS9A 3OMLA 2ZM6B 1H0KA 3B1WA 3DF7A 5IK2D 1CUSA 2A1TS 4BE4A 1N78A 2DHQA 3JRNA 1OREA 2A5DA 5LQJA 1FEZA 1U5BA 2WA2A 2YZKA 2ZIEA 3HEAA 3ZWDA 3K6SB 1G8FA 4HUTA 2C78A 5TMBA 1H3NA 1U11A 4W8GA 4ETMA 4K6CA 4MUXA 2P6UA 4LE2A 2OFFA 4G0WA 1E9SA 2HOQA 4LDAA 2BF4A 2B61A 3HRHA 3A6LA 4TGLA 4I1YA 2V7UA 5I7OA 1H2FA 5CJPA 1PBNA 2DZDA 3M1YA 4TMXA 1I32A 4Y6LA 5AQEA 2AC2A 3T9FA 1E2JA 3SBXA 5IFLA 2QI9F 1P7VA 3KSBC 4GMFA 1D9ZA 2V8BA 2XVAA 1N75A 3E05A 1U3VA 3IPXA 1DWPA 4OI1A 5FOQA 3CSSA 3M9WA 3ER8A 3CU5A 3D54D 1BQ3A 4G84A 4P6VF 5KOHA 4JC5A 3AGPA 4M1MA 2D8MA 4YEDA 4NEQA 3RB8A 4BFTA 2PX3A 5LMUB 1E2LA 2Q1SA 5HRUA 3FRJA 3KHTA 3QMVA 4Y2SA 5C8VA 3T3NA 1H3EA 1O9GA 2Y93A 4YRBA 2ID8A 4BWGA 5DO9A 1SBTA 3O4HA 1SQ5A 1QIHA 3Q9SA 4N7MA 3GFFA 1XDSA 2C3PA 5IW8A 2XWBF 3NOVA 4H17A 3AHJA 1NE7A 4JI4B 3OMWA 5B2ZA 2WPDD 1NJ6A 2Z3ZA 1YF3A 1DIGA 1I5EA 5LYJA 4YJKA 3B8EA 3GPBA 2E7ZA 2HT6A 4E4TA 1JMKC 2H4XA 4KGXA 2BFBB 1C0KA 3U3KA 1US8A 4K9QA 1NBME 1C8KA 3JQ8B 1UM8A 3PUIA 2XR1A 3NLLA 1F9AA 4IXTA 4JODA 4UHJA 2NUAA 1F8YA 3K0AA 5F76A 5E9AA 1SG0A 4MRSA 4BCBA 1VKHA 1AKRA 2J3DA 2OB1A 2O3TA 4BGUA 1SKQA 3IDAA 3JQGB 4MKGA 5JZMA 1SVKA 1GCAA 1WX1A 5BSEA 4JMLA 4OP1A 1M5UA 2QAIA 3ZI4A 2VDVE 5DISB 1SCUA 3DFIA 4FTWA 4Q9IA 4Z49A 4GVXA 1O6GA 4JEHA 2B6NA 4BVGA 1T6YA 4Q7EA 1OI2A 1H65A 2CLSA 4H1VA 5B1DA 2I1LA 1OGYA 2FU5C 4MJ3A 4EUNA 2IU0A 2Q9BA 1NX9A 3QEMB 1OI7A 3ZZUA 3EHEA 2ZOSA 2HA5A 4LBVA 1NMSA 3IUEA 1XROA 4TMKA 2DQSA 4JXZA 4IX1A 3B9PA 1ONBA 2ZPUA 3EGWA 5EIFA 3JQAD 4WBNF 5EE1A 5IT9A 3DEAA 3IKLA 2GAAA 3EEIA 2A3RA 1RWVA 2C8KA 1P0CA 4OXIA 3UATA 4C20A 2WZQA 1QBGA 2IZ7A 3QFSA 5F4ZA 2H4HA 3Q3VA 1QHFA 3AOEA 3CNNA 5H68A 3CZRA 3IPAA 4A8JB 4PGMA 1HDZA 1X1QA 2BMJA 5TPWB 3DMRA 2XKAA 2OZPA 3K31A 2Y0DA 3WX0A 3MTEA 4R2LA 1F60A 2XCUA 1TD1A 3B6KA 4F92B 4ZEVA 1TM4E 1XRPA 1H4TA 1ZUIA 1P9NA 1E7YA 3PWSA 4JROA 1E1RD 4WEOA 5G4LA 3TR5A 1J8DA 4IJVA 3S7TA 3T34A 2NLOA 4D8UA 3VNVA 2FR8C 4WCDA 4BFZA 4I6EA 1MX1A 3CVJA 4PINA 4UHFA 4M0UA 2QKYA 4TLLB 3WLIA 5I7WA 2Q2VA 4WA7A 2B8NA 3WV5A 2M9MA 4M8KA 4MUAA 4EK9A 1JDBC 2FSIA 1RZUA 2QU7A 4E5DA 4G56A 5GIPE 2HDOA 3H0KA 1FP7A 2WE7A 3LA8A 5JR3A 3FM9A 3GJQA 3VSEA 4I1RA 2IW1A 5C1DA 1HNWB 4WPGA 1JS1X 4U9HS 1EYZA 1GLGA 2VRNA 4RQBA 3DVLA 4EIWA 2QUHA 2CV1A 3D8TA 3WNBA 3IC5A 1U4NA 4DCSA 4RH0A 1E4VA 3HR4A 5AKYA 1BKSB 2WV9A 4KTVE 5FULA 1Y6QA 3T5GA 4LIPD 4NJMB 5A0FA 4V03A 3QPBA 4UEJA 2ZIAA 2FG5A 4YRRA 5LZ9A 4ZZ1A 1MV8A 4XCQA 2X4LA 4H3SA 1G60A 4RVDA 1EA7A 1U1IA 1XL1A 3MTGA 2RSLA 1BGWA 4LHWA 2V1XA 3NWPA 3EA0A 1E7QA 1V5WA 4BV3A 3DTVB 5GAJA 5FI5A 3C3BA 4NENA 4X45A 4WXPA 4WWHA 3SJBA 2JG3A 4F96A 2EBHX 4L74A 4RZHA 1V3VA 3VKVA 2W98A 3STWA 2C2GA 3H2JA 3Q6IA 2GPWA 2ZPTX 4XGRA 5D2CA 1YQDA 1SVMA 4FVTA 5LQCA 4TWAA 3FHTA 1JI3A 3Q8WA 4PCVA 2HQSA 4R69A 3WYGA 4U39A 3VJRA 3LE8A 6ADHA 2PNFA 2DQKA 1XB2A 4P31A 2VP3A 1RAIA 1G4AE 1HG0A 1SA0B 4JLMA 3AEKA 3BD8A 3GY0A 4NYMQ 1UBMS 4JEMA 1A8PA 3JQGA 4L16A 1Q17A 4AQ7A 4L15A 1E3EA 3QNMA 4MHTA 4WSOA 1DSSG 1OQAA 4UHHA 2YCLA 3EVDA 4KQ9A 2GYUA 1EAYA 3AEKB 5EJ2A 3UGTA 5U4QA 3W78A 1QAQA 2WPNA 4UMFA 4MKFA 1QR6A 4I1VA 2FP4B 2WVGA 4JJ4A 1NR5A 5G0VA 3I09A 3RIEA 3HXMA 2PRSA 3PBKA 5KSYA 4KCGA 3TLYA 1IXRC 1UQRA 4NTZA 4WZBA 1B8PA 4OQEA 5IDXA 4E5KA 4LMPA 4BY9E 3UFBA 4UU1A 3SWWA 2FFQA 1N7JA 5EUMA 1KEWA 1HUQA 1E2QA 2GAOA 4U7FA 2QE7D 1T9AA 3EEBA 3EFOA 2B5OA 3DTYA 4E6EA 2MYTA 1J90A 1OWLA 2EKBA 3IURA 2LVBA 4DMHA 4RD4A 3L6RA 1MZPA 2JPDA 2O0HA 4GLBA 3CJQA 1CY1A 4RJIA 1K6EA 4Y2RA 2AFVA 3W4JA 4Z4EA 3PVSA 1QJ4A 1L7QA 4OFBA 2YIMA 4EYGA 3NKVA 3SHQA 5BW5A 3FPFA 4DR6B 4LMAA 5IARA 1TUEA 1JR2A 4V1CA 3I37X 3GLHA 3GJ7A 2PZ8A 4YROA 5IAOA 2FKNA 1ISHA 2VNJA 2CK3A 2G4CA 1N6HA 1XEWX 4BQSA 2JD2A 2CDCA 2ZU6A 4P53A 3CIOA 4OQNA 3PVZA 4GF5A 5EWLA 1LV8A 4LDQA 1PFKA 3VU8A 4BXOB 4P3KA 4IO0A 2GM9A 3DS8A 2D5IA 1OI3A 3Q72A 3BTVA 4I19A 2R6FA 1IZ9A 4GL4A 5IJZA 1OHHD 1X3SA 3LY5A 3OJ0A 1JLRA 4RY8A 4EJ6A 4RK6A 1ULBA 1P45A 2EAUA 3MCTA 5AICA 4AK9A 4F0JA 1IJKA 2F1RA 2HSWA 4U6QA 1GITA 4A15A 4B48A 4O63O 1NIPA 1OGJA 2AB0A 1I01A 1EFRA 1QTRA 1SPBS 2JKZA 1I4DD 5A02A 4IUYA 4EPXA 4FYWA 1BIFA 4D3DA 1SVIA 2X5NA 2OBBA 2F7SA 2YQ4A 3KB1A 3QBTA 4DVJA 4HBZA 4PIMA 4Z7NB 4WDRA 3R8XA 3HYRA 5IT5A 4QUDA 1UDCA 1SD1A 2YMLA 1PS8A 4G63A 4M46A 3NJ8A 3NBAA 4S12A 5JATA 4B3FX 3LZDA 4JEIA 2WKRA 1QS0A 1P7PA 2G17A 2JLBA 2Z08A 4KZPA 3Q85A 4AMUA 2FPOA 4RDXA 1LEHA 1W5FA 2X13A 2A30A 1JEAA 3DJYA 3KSRA 3HXQA 5AYVA 4KNVA 3K6KA 4IIJA 4ZRNA 4ZODA 2D1TA 5JCJA 4US2R 4OLBA 1DO0A 4YH1A 4KP7A 1L4YA 5E2AA 2Q0SA 4F1KA 4C4OA 4ND8A 4WKBA 3MG9A 3KJQA 5H4HA 4EHNA 1NI4B 3WIEA 2V4MA 1SCUB 4GNKA 4Q3OA 4DLAA 1N3YA 4YUZA 4C2BA 3NX4A 1JA1A 2W2VA 1EX7A 3AEXA 1HE4A 3QLTA 4LK3A 1C9DB 4E5VA 4F11A 2XXAA 2I4LA 1NF2A 4RFSA 3EISA 3I39X 5C8DA 2KBEA 3RHZA 1GXSB 4O0MA 4D3ZA 1DEAA 1I1HA 5BN3B 1OH6A 5LFAA 1EUQA 2P3OA 1LS6A 1HEUA 3H0EA 4E14A 2GYYA 3DOEA 5LLTA 3UG6A 3FIJA 3L0OA 4HLNA 4CEIA 2WAYA 4EBFA 2W2MA 1VGQA 2V9PA 4HB0A 4URWR 5F73A 4EDHA 2OHHA 5KNCD 1V96A 2XRZA 5ICMA 3DZCA 3KUXA 1R6BX 1T8WA 3SVLA 4Q7QA 4CKWA 1EXDA 1BH2A 4IDEA 1Z4QA 5EE9A 2HV9A 3ZGLA 1ISJA 1PGQA 4GE0A 2WM3A 3GLFB 1BOOA 2AYXA 1RZ3A 3R5KA 4G5RA 4IHJA 4XD7A 1E79A 1RIIA 2DWOA 1MQAA 4ERNA 4ER0A 3EPLA 3ZLBA 4OX9Y 3HO1A 1RCTE 3KALA 2FN9A 1CYEA 2ZI4A 2OVBA 4B3JA 5FD8A 1UP4A 4I08A 2CHGA 2SCUA 3D0QA 4L0CA 5FBVB 3ETLA 2BGIA 1J0XO 1V45E 1J2RA 3HFRA 1NOJA 1Y37A 1NP7A 4NAVA 1UFVA 1SZDA 1UBKS 4ZOCA 1Y4ZA 2HXGA 4RIGA 3VYRB 1WHSA 5CEJA 2Q9UA 1P9OA 1DPFA 3ABSB 4QAQA 2OM6A 3TIXB 2PVPA 3AWIA 3M4JA 4RACA 5LU9A 3I61A 3P4UA 1OXMA 3IEKA 4A2WA 4UOEA 3W8FA 4MX8A 1EDBA 2VA9A 5JNRA 3DLBA 3TW8B 1AV6A 3PE6A 1EB8A 1M66A 2BUAA 2O48X 3E2PA 1A04A 2P9YA 2Z6VA 1UC5B 1BN7A 2NSJA 1ZNQO 1DRKA 2X1VA 3A9SA 3OKCA 1GZSA 1IUPA 4IKEA 4YAGA 1QF6A 2RAUA 3AUUA 3BZWA 3NXSA 4W6QA 2P2SA 1EX6A 2VAMA 5ALWA 2EKDA 4XTCS 1FS4A 1Y9JA 3B7GA 2QAGC 2VJMA 2WI8A 4REMA 4GRAA 3ANXA 3WFZA 4IMRA 4DB4A 2PTGA 4LYEA 4ZVUA 1KOJA 3VJLA 5JH7A 1JJVA 3B1KA 1T0IA 2VJDA 4PYRA 5DHPA 3FOCA 1YR2A 2X9GA 5EL0A 3PNQA 2XXJA 5CEFA 2A1TR 3GARA 1U81A 3O31A 2J6IA 2I4OA 2H6EA 4OP2A 2AJLI 3IESA 3UXYA 4X44A 2MWMA 3R1IA 4NXMB 5D51S 3I6MA 2HXSA 3PZRA 2CSUA 5BNWA 4BO7A 4C01A 1BCSA 3MOSA 4JELA 2X6QA 5JC8A 3GNLA 3NRJA 2WTUA 2AFHB 3DDUA 4RH1A 4CDNA 2O1EA 3M7IA 5C0OE 3GA0A 1L7BA 2ZYDA 3F6YA 5CLGA 2D59A 3SKVA 3NPMA 3TR6A 2AD1A 1TEVA 1H2XA 3F1KA 2VYND 2WWXA 4M7OA 5ERGB 2E49A 2JAPA 1XTVA 3EGEA 3OG9A 1VYHA 2HHAA 2V5UA 4MUJA 3DEHA 3QE3A 2V55B 1MJGA 5THKA 2C7RA 3PPIA 1NVMB 3VNSA 1RPTA 4GP9A 4QPCA 4R71A 3C16C 4MVJD 1E5TA 3QPDA 3VVBA 5CFNA 2CZGA 3KC2A 3OC6A 4P2GA 1IPFA 1MOQA 4G0NA 4L0MA 4IICA 2C8JA 1I7QB 1R0XA 1O4VA 2IOHA 4CQNA 3QV1A 3ICVA 5E1DA 3LDFA 5FBZA 4UJ5A 3T12A 2CBGA 1TT5A 2XZLA 4URVR 4DUGD 3QBVA 4URXR 2JZOA 4QU9A 1JDTA 1VHQA 3BSWA 4BLWA 1ND6A 4R5MA 3V32A 4N12A 5AW0A 1MW8X 3GRFA 4Y9RA 2B9VA 2BZ0A 1YZ3A 3Q7TA 1UFKA 5CA1F 2JBAB 2NADA 2BFEB 2PUVA 2YHIA 1KIMA 2PWBA 5AVJA 3MUOA 5TRTA 5E6RA 4XVCA 3DPSA 2G1UA 2QRGA 2OXTA 1XXHE 1TZCA 4XI9A 3CONA 3VI4B 1G4HA 3C1TA 3TG8A 1QLHA 1CUFA 4FDLA 4FR0A 2PGOA 4BZZA 3KZ1E 3Q7EA 3UWSA 4PAGA 4RDHA 1XCOA 5FOXA 3UAXA 5K8JB 4II3A 1W0JD 5EAIA 3RS4A 2JAXA 3QU7A 1ZXBA 1X2EA 4H7IA 3PXXA 4UUBA 4N5HX 3WL4A 5EE5B 4CQMB 4F9FA 1A3CA 1EUCA 3OQIB 3U7JA 2BKLA 2QTVA 4KXUA 3NT4A 2EXXA 4ZT4A 3W9YA 2O2HA 2QP9X 4AKGA 1ZSVA 5EXDA 3KQUA 4U63A 3ZXSA 1EM8B 3KIPA 4YJ2A 2GZ2A 4DUPA 4F3CA 5KYYB 2V4ZA 4ZKEA 1SFRA 5JCOC 5IXYA 3AJEA 1PWYE 3NV7A 1RRVA 3U4CA 5FJIA 4DCMA 4QJIA 3KAJA 1G7RA 4G41A 5F2EA 3PNKA 2ZBRA 3EH1A 3LFHA 4N40A 2XT6A 4B87A 4EG1A 5A5DA 3P0RA 3EY4A 3AGQA 1Y3CE 1RYYA 2Q5FA 5DSXA 3W2TA 1L6IA 2IHJA 4Y2YA 3BAFA 1G16A 4QUEA 3AVXA 2YRXA 4KSCA 1PW5A 1Z8NA 5EY5B 1NJ1A 1CZUA 3D4BA 3HBLA 4UVGA 2GN9A 1AKVA 4RNCA 1T9HA 1AM4D 1S3GA 3LG2A 2D00A 1NI3A 4IHAA 4TV9F 3WGLA 1FYXA 2WTXA 2Y1OA 2HYDA 2Q3JA 3AQIA 1E96A 3E9ZA 4HZUB 3EZYA 3ND8A 5DLDA 4AUEA 4B3DA 4DSUA 4QM6A 1J9ZA 4IGKA 3EUEA 2RIPA 4HGQA 2RHHA 3K20A 3FPBA 4PZ0A 3ADCA 1S3FA 3K2IA 4MS1A 3LQYA 3D1LA 4XDZA 2TSYB 2B4YA 3W6UA 1JQLB 3RQSA 1YVDA 1APBA 3W9UA 1YS4A 1VDMA 1NJ8A 2H4FA 2HA3A 2QJWA 3C24A 4KUEA 1EHIA 1KI8A 2BEUB 1EJ0A 2Q07A 1GG2A 2Q5QA 1TQHA 3BJRA 3EXIB 4JP8A 4YCMA 3W5CA 1IVNA 5LZ7A 2D7DA 1VTKA 4FX2A 4JCOA 4XVRA 4PM4A 3O03A 3Q3EA 1PS9A 2IL1A 5EP3A 1RBQA 2WUEA 3AY0A 2WSBA 4K7JA 4UUPA 3IVMA 1FUYB 4OREX 5J2UB 1B4DA 1YR7A 4Z0TA 1DRJA 3KR2A 2WKSA 1E2UA 2ZCVA 1ZVVA 4DADA 3TBFA 4DN6A 1Q6YA 4EVRA 2VYCA 2QTBA 2ZUCA 5BYJA 3S2EA 4D0SA 2AFRA 2GD1O 3JR3A 3W3AH 4GLLA 3HHPA 3MTBA 3GFVA 3W3ZB 4AS2A 3OI7A 3QMPA 2OE2A 4CR7A 4CIYA 3K9QO 5M04A 1FW6A 2CLMB 2GR9A 1BXGA 1GTL1 4CF5A 1UPAA 3FA2A 1BS9A 4RJ2A 4AP6A 1G63A 3DZIA 3D6JA 3LUJA 3PNMA 5FH9A 2R6HA 4MW1A 1GGKA 2D7JA 3DR5A 4G09A 2YKGA 3ON5A 3JD1A 4QDUA 3D2LA 3RTCA 3X1YA 3ZW8A 1BX0A 2RCYA 3LL4A 3HJNA 8ADHA 4NCBA 2DPMA 1NXVA 5BPHA 3CISA 3EARA 1GQ2A 1YL6A 1PUIA 2DUNA 4GRDA 2KX7A 1CSEE 4KXMA 2QZSA 5F35A 3TW6A 1VKRA 5IVKA 3IT0A 4WFJA 4AWBA 2CV2A 1W49A 3G88A 4QJBA 3ZUPA 3IEVA 4P36A 5IDYA 4W7SA 4ZIRB 1PI3A 2XTZA 1V16B 1PDWA 3BORA 3LXRA 3TIFA 3BIOA 1UBEA 4L9SA 1M8KA 2DFNA 1OTHA 3N0WA 4DCVA 2PKRA 1NDUA 1FU8A 3KQVA 3KM0A 1U8TA 2EIXA 2VJNA 3O6VA 3OEHA 4MR8A 4P4SB 4Y9TA 2XDWA 2YMQA 1B16A 1TB4A 4LMBA 2HZBA 4JBHA 4P5DA 3ZWQA 1TA4A 2DQYA 2B82A 1AHNA 1HE2A 1XE3A 2VHJA 3ENWA 1S2IA 4UVIA 3RUDA 2AQ8A 2NV6A 3L41A 5CCBA 3SKXA 4M8NE 4HGNA 4O4HF 4TWIA 1I3LA 3LT1A 1CR1A 1R64A 3RUHA 2O8EA 4AUMA 4BNVA 3UBMA 2W22A 3GUUA 3V3KA 4NH4A 5JWRA 1HXHA 3QA9A 3SYLA 3U4AA 3HYSA 3QTLA 1XLUA 3ZE1B 1EG7A 4PRLA 3E9RA 2Q62A 1Q3HA 4AJ9A 2CVHA 1J7KA 3ITNA 3O3CA 3KPYA 1QRRA 2FN8A 4ZOLB 1DBIA 1D2RA 2DKFA 2GD2A 3BCRA 4FHCA 3S1LA 1ECBA 2JFGA 1Q20A 2I2FA 1MDFA 3IB6A 3WC4A 1PJ3A 3QKRA 4XGKA 3MWGA 4S1TA 2OOKA 3ZH9B 1O9HA 1AMOA 4JXXA 4KFSA 1ZRMA 1UBGA 3A04A 1XZMA 2LXNA 3PF8A 2VPPA 5TEWA 4AIIA 2MSCB 3K0CA 3A7EA 2QWXA 4E2FA 2R65A 2ZI7A 3RUEA 5C46F 2YJGA 3KTAB 2OHXA 5IH7A 1E79D 2WWGA 2WYWA 1FP4B 3U26A 2DFVA 3RLIA 4ZGBA 4OKNA 1GSIA 2GZMA 3H2BA 1JYSA 3N8HA 5I9MA 4PHFA 2QUAA 2C9ZA 2GJSA 4KSBA 7ABPA 1I7PA 5FUXA 1U94A 5JASA 5JYCA 1NXSA 2WNHA 2OZLA 4OHUA 4IZOA 1Q6ZA 2W71A 1G9XA 1BHSA 4WNAA 3E7XA 2PQMA 3SF0A 2EIHA 1DX9A 3FYDA 3ZDAA 4G01B 2LDBA 4B6SA 1AQJA 1V4NA 4KMSA 3TLGA 3ACDA 3REOA 1AKMA 1MNQA 1U2SA 3AM4A 4PTLA 1GNSA 3FE2A 1DBWA 2PFGA 3W06A 2BI7A 4DM3A 2BEKA 5SY6A 1ORTA 1UANA 3C3AA 5A3JA 3X1MA 4YJFB 3PKJA 2ODWA 1QYDA 1U3WA 3NXKA 3U13A 1A77A 2I65A 1M54A 3RVLA 2Z83A 3E23A 1NWCA 4PSCA 1GV1A 3NDBB 3UB3A 5K51A 4B44A 2M2IA 2NXEA 1UT5A 3HXOA 1HA3A 3WHIA 4YJ2B 2DTXA 2Q0XA 3KWFA 2FXVA 3TVDA 3OSUA 5AW5A 5LA6F 2FOIA 1KMHA 1DRVA 3N3AC 4FOPA 3ZU4A 3AHFA 1FYFA 4F6RB 5JJKA 3D9QX 5E3HA 3B3GA 1P9RA 1XP5A 1EUCB 1SEPA 3OQIA 4CL0A 2AG8A 1CLEA 3QUTA 5DEOA 1PFWA 1S8AA 3W79A 1OFTA 5EQTA 3Q8MA 1DQYA 2YVKA 1UBFA 5JSKA 2KE5A 4H1HA 3VPAA 3E7DA 2UYOA 2X5KO 4ERXA 5JNUA 4GOXA 4E70A 5FWAA 5DMXA 2WWYA 1WCYA 4H3KB 3IMGA 2FPUA 1D6SA 1F6DA 1QHXA 2QQ5A 4F6CA 2PGDA 4EY6A 4ZZIA 2JAQA 4RTJA 1ZD8A 2A88A 2G8LA 3F74A 3K0FA 4KODA 4OHFA 2A7QA 4JJ8A 3SCZA 5BSVA 1FYVA 1XGKA 1G5FA 4W5OA 3DZKA 1FP6A 2DTDA 3LF2A 3OPNA 4Y7DA 2YUTA 5DW3A 1T24A 5JCJD 3IMCA 2NPIA 5HF9A 4BWYA 5DLEA 4CEIB 2JI8A 1WVMA 1SZJG 3U40A 3WGQA 1LFDB 3EAFA 4JBYA 1GTMA 2XGMA 3NHMA 2JJ2D 3LP5A 3JQ6A 3LUGA 1NDQA 4QDJA 1W85A 2BJWA 3EIHA 3RUCA 4Q9LA 5F3DA 3KXKA 1RYEA 3KE9A 4NI5A 1O95A 3AT1A 3SEZA 1KTVA 3F3YA 1K6IA 1H2WA 4H59A 5IYZF 4I1OA 3KOXA 5E6SA 4EF6A 2AOTB 4COOA 1KEEA 1OBFO 3L7BA 3PJGA 1R2QA 1J97A 5J4HA 1LWOA 3W5IA 1ZJJA 3DZFA 4ZI7F 4DQVA 1OXKB 2EWVA 1SK8A 1U0TA 3K09A 2HTEA 2VQDA 1T43A 4KFUA 2B2NA 4UTOA 3R74A 5I7VA 4KVGA 5GIOE 2ONJA 1QGZA 5KB3A 3O4VA 4MMXB 1Y7PA 4UTXA 3N0TA 1R0ZA 2BMFA 2QGFA 4JU9A 1E7MA 2AFHE 2W6CX 3SR3A 5HKOA 4JB0A 5JQGF 5LWQA 2CXRA 2PSDA 2QMYA 1E98A 3B20A 2WUGA 1G2IA 1BROA 2GJAA 2O8DA 4W1QA 3WGNA 2CC2A 5E1OA 3HCFA 2H9AA 5KTTA 4EB6A 3O83A 4RK4A 3WIDA 1N2CA 1JHMA 2AC7A 3CRRA 3RIMA 1Z6GA 1TQ4A 1Y48E 2QE6A 3JR7A 4OMUA 2H5EA 4UVHA 3AWDA 4G5FA 4KXNA 3WVNA 1Z75A 3C7DB 5LP6A 1CE8A 2X0NA 3CNOA 2ZE7A 1CCWA 2FSUA 3O4FA 2OV4A 1FSSA 3RS8A 3BD7A 4BP9A 2IHVA 1JIJA 3OZRA 4FYYA 4HFNA 5GGYA 4FB5A 3IP3A 3AHDA 5CG2A 3PYXA 4W5TA 4BECA 7ADHA 3V1KA 3VYVA 1LBQA 3TTTA 3THWA 4ARVA 4CLEA 3RIYA 1MOSA 2OCPA 1KVRA 1BXZA 1VECA 7REQB 2AYZA 2FOXA 3F6SA 2D2IA 3BMQA 3MWLA 2CSXA 1WY7A 3ZN2A 2WIBA 1DQPA 3ID6C 3VR5D 5ULLA 3RHSA 5TQ0A 3F67A 1F06A 3PWZA 4KV9A 2IOQA 2RAFA 1S1CA 4MDYA 1GQFA 4C7OA 3NATA 1IB0A 3B9QA 1AMNA 3DWFA 2CMGA 1OFGA 4E7PA 3FY4A 5KOYA 5BWBA 1C1XA 2FW7A 3M4ZA 2B37A 1TE2A 3KLPX 4D81A 4G0QA 1V11B 5FOVA 1B6SA 2GYWA 1XZHA 4PZ9A 4AJPA 4YRGA 2HA2A 1XI2A 5KYNA 1N2BA 2F00A 3EMKA 3C5VA 3H1PA 4TLEA 3AR8A 4DZRA 2WSSA 4PAQA 2JH8A 5KI6A 4L95C 4CKEB 5CT5A 4L51A 2OCAA 4Z0PA 4OSOA 4B0PA 4MZXA 4D9BA 3QEBZ 1WXGA 3F6RA 3QEJA 1ZM9A 1H2YA 3RBAA 2QTFA 2HK7A 1T4MA 2W0MA 4Q4JA 3TXYA 1BVRA 5EQDA 3B70A 1WBBA 5IT0A 3GFPA 1YB1A 1PHPA 3ADOA 1S2NA 2CXSA 3K4HA 1QZTA 1RAHA 2GCGA 3D2BA 3KR0A 3ZYCA 5K0GA 1M2KA 4FXOA 4M0CA 4KHZA 4OB8A 4Y2VA 4EPWA 4A6EA 2XVMA 1KOGA 1ISRA 4AZ3A 1YDMA 2ATEA 4DQLA 1NJ2A 3HU3A 3PJFA 3PQ6A 4A0FA 2JATA 5KWSA 1GQSA 2VRCA 2CJPA 1MVOA 1IN8A 2J30A 3GLIE 2JFUA 1CBUA 1XHFA 3JYLA 3OE1A 4D57A 4GOMD 2Y9PB 5JTTA 3P9PA 1O94C 1PDVA 2JIBA 1YZUA 5AVWA 3SS8A 4MWOA 3R3JA 3WYFA 2Q5JA 2WTEA 1XYGA 4JVLA 4NBLA 2ODEA 3GNQA 1K0FA 3FSEA 5DU2A 1PD1A 3HG7A 1HI9A 2WM9B 5B37A 4JHXA 3NGMA 1PU2A 1PSWA 3NTOA 4M9RA 1UWLA 1B3BA 5J2TB 1Q83A 1QS0B 2I3ZA 2VHXA 3KZKA 1YQXA 3C74A 5J5AA 1N5OX 1AXEA 3VNQA 5JISA 3DUFA 4IWYA 4P5EA 1Q50A 4C1BA 3EJWA 3LTNC 2PCLA 2AF3C 2GKGA 2XDAA 4PSAA 3UWPA 4JYMA 4D2IA 1NLMA 2GBPA 1LS1A 4BLRA 4LZOA 4Z5XA 1QX4A 3MBKA 3HB0A 2V74B 2EKZA 1HM5A 5EE0A 2F43A 3B9BA 2QXYA 4IIHA 1WKCA 1U4SA 5F9MA 4BEBA 5EIEA 2PUCA 1IUOA 4N5DA 2WKQA 5LXTB 2FPRA 4LOLA 2R5WA 1X7ZA 4OQZA 4PBRA 4YA6A 5GWXA 5KHAA 1M0SA 2G63A 5KQGA 3X0DA 2XNDD 3SK0A 4IXNA 2VEOA 4X97A 4OHCA 3NHUA 1L5NA 4UBNA 2ZJOA 5LJLA 1L4LA 4HXEB 3L7NA 4GR9A 4HDNA 1E9EA 3GL9A 1KDOA 1KPHA 1Q1ZA 2ZT7A 3LVBA 3VNRA 1JNXX 3INNA 3JWIA 5AH0A 4ND6A 4KL8S 2RG1A 1R7RA 1XTQA 1RJDA 1KR2A 4UBJA 5DVZA 2QN3A 5HEKA 2FMUA 3HDHA 1G5PA 4OKIA 1K7SN 2C2HA 5FADA 1JBQA 3U5ZB 4LJ5A 2ZB8A 3K8QA 2RC6A 3ENZA 3ORFA 1QZZA 5A5GA 2IZ0A 1OCEA 3FR7A 3TNLA 1T26A 4QM7A 3AH8A 1AD2A 1Z0JA 1FPMA 1YI1A 1KQNA 4BNMA 3GPLA 4WESA 1SD5A 1KKLA 1P0QA 4LSZA 1EGMB 3TSYA 1CUWA 5ALNA 3KDSE 1EHYA 2UU9B 4FW8A 2P9ZA 2WR8A 3V2UA 2O0KA 2BFPA 5ALLA 3DOFA 3LZ6A 3STUA 4N47A 1RYHA 1YJAA 2WIDA 4OJNA 4OK3A 5CPFA 2PGLA 1B8NA 2R48A 1JDSA 1YD7A 3BE6A 3OCCA 3QEMA 2IDZA 1YRWA 2WE8A 2HUNA 1QC5B 1A69A 3IVAA 4EPRA 1KHTA 3H5VA 4JJ6A 3ESCA 4DLTA 4B6OA 2DPGA 3V1UA 1P9LA 2Q3BA 2B35A 4QOJA 5JS2A 4KLZA 4BX0A 1P44A 1PYOA 5HJ5A 3LHDA 1QPBA 3P26A 2CDAA 4GX1A 2AS0A 2B7CA 4MRRA 1SQ6A 1HQKA 1RI5A 3A0RB 3HB9A 1ID1A 2GNOA 2SHKA 2XMQA 3PGXA 4MAMA 4CN8A 1EJ6A 5IYZB 4YP9A 1MTZA 3LIIA 4WN9B 4UEQA 1AHIA 2LCFA 1ZLYA 4E6PA 5EHZA 3L1HA 2JFZA 3LUBA 5AKLA 4W5HA 2QJRA 2C9BA 3EODA 1TO2E 4ISBA 1SQ0A 2NMVA 2GD6A 2C82A 3KFXA 2DAPA 5C8YF 1T0UA 4X1IB 4RABA 2GJKA 3HZHA 3T35A 4Q3KA 1GPAA 3V48A 4DABA 4EWLA 1JQDA 2C00A 4N3CA 3UOAB 1G7SA 1FFXB 4BRZA 2QRKA 2ZRBA 4BAUA 5KYWA 1M0WA 4CMEA 3OQOA 5CITA 1GNVA 1V5EA 1R1DA 5FR1A 4GWGA 4BKRA 4REQB 2BKVA 5LQMA 1EGQA 4P3OA 3HCEA 1D4FA 1PJQA 3TZLA 2DG2A 3LSTA 2DBZA 3G89A 3HCDA 1AVTA 3PT5A 4F56A 2D5BA 4PNEA 4CRWB 1TC2A 1FMJA 3TCKA 2HCBA 3UJ3X 3GZ4A 4JGBA 3L1JA 4TWRA 4H1UA 4MW5A 1ECPA 1I4EB 2F9MA 2DU8A 2GPAA 3PPVA 4B3HA 5FAKA 9ATCA 3LDHA 4P7GA 3ZCSA 3U7EB 4YAWA 4BUCA 2Y4OA 3K5PA 2WWIA 1LI5A 1KZ7B 1SQSA 1Z0DA 4P80A 4YI3A 5SZJA 1SKAA 4C06A 3QI2A 2PEYA 1KVUA 2HA7A 3G02A 3U44A 1GIAA 1N2JA 4RY0A 2WB2A 3WK6A 1HOTA 5CBPA 2OHVA 2Z4SA 3DEJA 4WE3A 4KYUA 3F3KA 4IRMA 1LPAB 4OJTA 3LMKA 1LZKA 3KKEA 2G5CA 1WZUA 3WYDA 1AU9A 3MVEA 3R3HA 1ZHFA 3PDJA 1EK5A 2PFSA 2FWAA 4UJ3A 4B5KA 3HVHA 2B34A 1TVKA 4G0MA 1NNUA 4EB6B 1R3UA 2AVNA 3IOMA 4M54A 5HZHA 3G1UA 4F6RA 2DP4E 1EESA 4D0NA 1FRQA 1EVQA 4KMOA 1L4HA 4MXDA 2YY6A 3B13B 3WNQA 1QP4A 2OBMA 2CMFA 2WA1A 1P1FA 2EG9A 2B7BA 4HL6A 4G65A 1XVUA 4IQGA 1H3FA 2SICE 1V1RA 1XCBA 4WXHA 3X1JA 1UBSB 1YU6A 1KDRA 5CX1B 3UUWA 1N5JA 2P2NA 3HXLA 4ZD6A 3FB4A 4ZI7B 5B57C 2ZRIA 4X1YA 2WHQA 1TYCA 4FEEA 4R3WA 4K8OA 3VH1A 5DYIA 2QR3A 5BQPA 3L43A 4N0PA 4AVYA 3SXJA 4XFJA 1FVXA 3ESQA 5DHTA 4UC0A 1YGYA 4E5NA 1IAVA 3PYLA 1WV0A 2HCFA 4G1BA 4ITUA 3GGCA 2HMUA 4O4JB 5DTMA 3UHPA 3D7SA 4MCAA 1KPIA 2ONZA 3F6CA 2PLAA 1BE8A 1NYTA 3UMFA 4A03A 2YBDA 5TDHA 1MDBA 1K89A 1WMBA 4F4DA 2WG1A 1TOAA 4PANA 4DBLC 4E2XA 3EXHB 4RVSA 3L9WA 4J7AA 3KV1A 5AOVA 2Q7OE 4BP8A 2O8CA 4JLDA 1VCIA 2BLNA 5JSHA 1IM2A 1J8MF 1CJSA 2YV4A 2MT9A 5DLQC 3TQTA 1C3OB 2FAXA 5TARA 4BASA 1YMVA 1I2BA 4FOLA 2D7CA 5DCYA 2W37A 4CIVA 2W8BB 4C3VA 4RFSB 5FBRB 1VP9A 5FT9A 4AG3A 3G0DA 3IHTA 4AZTA 4O4HB 5IAAA 4IGFA 3KU4A 2NU9A 3HBNA 4QRIA 1CVLA 2HA6A 4J76A 4L5IA 3T7KA 1MQ9A 4J0CA 1EQ2A 2J6BA 2ZROA 1BVUA 2YWRA 4WKNA 4BQOA 5J4VA 1N2CE 2FSFA 4KWIA 5FOUA 5FQNA 2R86A 3FN4A 1XZAA 5C1IA 1ESEA 4YXWA 1VM6A 5I9IA 4GBJA 4IFBA 1PR4A 4KN9S 4NRDA 3W1EA 3WK4A 2JLWA 1ZK2A 2PG3A 2AZMA 1DJOA 2IEAA 3ASUA 4HAOA 4JLBA 4EM6A 1CDOA 4G0OA 4PZAA 4FSHA 4Y6SA 3GEPA 4L85A 1KI2A 3EC1A 1GQYA 1ZJZA 4BQFA 1ZOLA 1JJBA 3QXJA 1E2HA 4P33A 3BXFA 2NG1A 2XUZA 1LVHA 1BXKA 4HAVA 4XOIA 4DLPA 4OLAA 3ANYB 3SNHA 1JKJA 3OQ6A 3W6OA 5KSOA 1OLOA 1PIWA 1W4CA 2J5XA 5IMBA 1B2RA 3FMPB 1D1TA 1MABB 2EV9A 2GXQA 3WKDA 4WUTA 1YE5A 4IV8A 3VYUB 3BCHA 3L0DA 3DB2A 1QV9A 1Y80A 2EJBA 3QLVC 2Z1MA 4JD5A 4BJ5A 1PX2A 2NOAA 5IJ9B 2Q1UA 4OI0A 2D1RA 2P91A 4BJ1A 2VJAA 4PSVA 2QLLA 5P21A 3S2IA 4DMUB 2HWUA 3PXCX 4EELA 3IP5A 2PRYA 3CEMA 4LY9A 4F21A 1N3LA 1NMXA 2I7XA 4KQMA 2O0MA 4IR7A 1LBEA 5G0WA 3IMFA 3ZOKA 3CFYA 4JLWA 1ZVQA 2O2ZA 2PBZA 3H6GA 3I52A 2QM0A 1E18A 4WASA 1HFJA 1D4ZA 1NW6A 3IAS6 1OVGA 1KE2A 2HR1A 1PBTA 2ZRGA 4ZPJA 2QVBA 5EEHA 4JKYA 4HDSA 1Q91A 1IZZA 4IIYA 2M1XA 4W9NC 2IEDA 1B42A 2Q2OA 1T5HX 3E18A 1QG2A 1R5BA 2YVAA 3H2SA 2ZT8A 3M49A 4YDSA 4F38A 1E8DA 1NLZA 3TAUA 1G1MA 1WSAA 3FZQA 5JAOA 1KJNA 2QF7A 3COWA 4LFCB 4BWVA 4QNNA 4FNGA 3PP8A 1JKJB 3DBOB 1KJZA 1QWSA 2FVYA 3HZZA 2YICA 2DKNA 2XIJA 1WDKA 3EYWA 3I0MA 1FFXA 4ECEA 2I6UA 5C7IO 2G3YA 5HWSA 1U3FA 1COZA 5DNVA 1FU7A 4P84A 1ZMBA 1JBEA 4PLTA 5F3WB 3IT3A 2DT8A 2VYVA 3LA6A 3DW1X 1UXIA 3GJZA 4Q00A 3SVTA 3H3JA 2DLNA 4DUZB 3FMOB 1IWOA 3I28A 3A4NA 4CLRA 3FRHA 1HT1E 4L5CA 4OAQA 2GN0A 4BNNA 5BVGB 1J2JA 2UUBB 4CKCB 1TFUA 3AIIA 1XZQA 2MYUA 4U3JA 2WRZA 4ZQBA 2ISCA 3TXAA 2VJCA 2FLKA 1V8DA 4B8ZA 1L4BA 3PR3A 2CMDA 1CUAA 3K6JA 4LZAA 3VR5H 1ZM7A 5ICGA 3UMYA 2VP6A 3GOQA 4ASUD 1Y42X 4KN5A 4DJDC 5MF6A 1UWKA 4RK0A 4ZALA 3I2YX 5KWIA 1VFPA 5D5QA 1B41A 1AZSC 3GD5A 4WZZA 2QPTA 1Y4AE 3D0RA 4R8VA 4MV0A 1QC5A 1Y33E 1I9CA 2C4UA 2IXBA 4WIAA 3UJAA 4DY4A 5CCEA 1F8GA 3C41J 1DJMA 4F2HA 5HSGA 2RGEA 2O4CA 2R7MA 2PD3A 3EMDA 1E63A 1GEGA 3H3FA 3C98A 2H08A 3JAKA 3RU7A 3SFZA 5JZSA 3MGCA 1ESZA 3DMTA 4OFWA 5HTOA 3GRRA 4BDSA 3OT4A 4MB6A 4JX8A 4L8WB 1YQWA 2IIQA 4I5IA 3T0FA 4B3IA 1KYTA 3NC1C 3ZU2A 3UTDA 3LP8A 2FVXA 3U0BA 4JWKA 4TYPA 5LNK6 1A2BA 2PKQP 3CNBA 3GDOA 4Q3CA 4YJFA 1HSZA 1R9GA 4DT1B 5LBUA 5EEGA 3EWSA 2ZJ4A 5KNBD 1RWMA 1FS6A 2N75A 2WKWA 3M6IA 1V25A 5ELLA 3B3AA 4K86A 5AKHA 4CNBA 4PO9A 2W83A 4FJ0A 4YAIA 4RS4A 1IN4A 4LJ8A 2BFCA 1QNFA 4EG3A 4ZTBA 2I91A 4ZCSA 1IVYA 4GE3A 4XDGA 4CMIA 3D2AA 3E48A 2FGJA 3P9KA 3V4OA 4C05A 3I1FA 2PVSA 5J1SB 4LS3A 1XWWA 4CWAA 2ZRLA 5ALZA 1H05A 1QG0A 2C88A 1Y4DE 1H2RS 2WOOA 3LPDA 2PX5A 4MKZA 4NCIA 3RTAA 4A6PA 4TS1A 4CKXA 4CM9A 3A1WA 1Y1QA 1D3AA 4Y3UA 5C31A 1B8VA 1FP4A 3FVQA 4DEYA 2ZRJA 3TMAA 3ZI7A 3AMVA 4HDCA 3E27A 5BRAA 3DSRA 3LJKA 2PZBA 2VNAA 4TYMA 1YIOA 5E7QA 3RSLA 3HSSA 4MGHA 3RU3A 3N74A 4Q02A 5FRDA 1RHQA 5AM5A 5CLFA 4PIVA 2C61A 2E5FA 3THOA 4YUAA 4RLQA 2GWRA 4DYDA 3W2EA 5JAMA 2I4MA 1WOYA 4LBZA 4M4SA 4MVJI 3T3IA 3BSYA 3IIMA 1YRBA 3PWTA 4W1RA 2PSHA 5FA8A 3UQZA 4YAJA 3I9NA 5BV8A 2CNBA 1WQ4A 2E48A 3QF4A 1NONA 3QLUA 2V7PA 3FZEA 4M38A 4F1JA 1OZGA 4OHYA 1U5CA 2Z95A 4HAXA 4ER5A 2BAGA 4NZOA 2AJCA 2IHYA 4BQPA 1Z88A 1QFXA 2EFCB 4JT2A 4DLWA 4DJAA 2ZDQA 3T1OA 2H16A 2ORVA 3GVIA 3T54A 3EFEA 1PFYA 3Q0EA 5T57A 3IHWA 5CA0A 2J3JA 3E22A 4KFTA 2E82A 3TRKA 2R96A 1OLSB 5KREA 1GUYA 1SNYA 4HH4A 1N7HA 3F8WA 4WKCA 3ROEA 3EAGA 4FR2A 1QH1A 3D4PA 3WLJA 3ZDBA 3MJHA 1UEJA 3ECAA 3O94A 2IQ5A 3U37A 2A5JA 2XRFA 3L8CA 3JQ8A 3L1UA 4CQMA 1VL5A 3P2MA 4B8WA 5JANA 4FNOA 4HYEA 1ZL2A 1F14A 5I5GA 2FUKA 4EJMA 2C94A 4V24A 3SVZA 3I83A 3LM8A 2O2CA 3GROA 1YJ5A 1UM9B 2ZYRA 3M33A 4HTFB 3RWMB 4D43A 4AFNA 5FBQB 3C3DA 1RDFA 2A3NA 4AS1A 2XQVA 4FMBB 2JCYA 3SBEA 2PX8A 2REBA 1HY3A 1J06A 1KYQA 4NIMA 5MHTA 3H1EA 3MHTA 5JQGB 1Y8AA 1JKIA 5FNZA 1M10A 2QD1A 3M4NA 3QYPA 3WLMA 1VG9B 4BV2A 5HQ3B 1N5DA 3TFQA 4E1BA 3PSAA 4NOMA 2ZAIA 2UZ0A 4LJ9A 4H0CA 421PA 2FZGA 3JQDA 2XB8A 4CV1A 2JHCA 1KJWA 5CVJA 2I55A 4RHCA 2HQBA 2C29D 2ZB2A 3QOWA 1VPWA 4ML3A 3L04A 4A6DA 1GSAA 5B1EA 3CRZA 2HMSA 3NAMA 4RK1A 1HMPA 3JARA 3OCXA 4U2DA 1P5ZB 4A5OA 1SXJE 3SEAA 4DLYA 4QFMA 2UXCB 4JLJA 3O1JC 5JH7F 3HA5A 3E4CA 3I9FA 1Z7EA 4Z9YA 2D3TA 4XKJA 3SSMA 1PKEA 1YC5A 3BMQB 5JE8A 1TU0A 1LI7A 4J4HA 1DV1A 4BB5A 2A0FA 1RCUA 1JSCA 2WWWA 5JSYA 4P58A 4BFXA 2XGSA 3F5MA 5E8RA 4ZVLA 4ZJUA 4ZEMA 4QZVA 2NO4A 2OD7A 2OPBA 4OBBA 3EPJA 1I7DA 3OT1B 3PC4A 2XE7A 1A9QA 4YQEA 3GXBA 2WU1A 3VAZA 2ZDHA 3MBIA 2O5RA 1AGPA 1E1CA 1VLLA 3GFBA 1CZRA 4V3CA 4CV2A 2W2LD 2ZYSA 3GPCA 4C6RA 2VRCD 4ZYVA 5KWEA 2CLCX 1E3IA 3I6ZA 1ZM3A 1T29A 4JC0A 2YHBA 4PYOA 3AFGA 1QQ7A 1TZKA 3E1GA 3M4XA 5C7LO 1ZONA 3CUEF 3FBGA 4N8SA 4B32A 4C0QC 4DG8A 1TRKA 3V46A 5CYGA 1GL3A 5JH7B 2QA5A 3VKGA 2RKOA 3MXTA 4IDOA 1FRVA 4EHLA 5LB2A 1T13A 4L08A 4MZDA 1MZVA 4J16C 2PT9A 5FYDA 2D0PB 1A27A 4AWAA 2WY2D 4DTIA 1RHKA 1L8OA 2XJ4A 5ITSA 5IK2A 2O5CA 3X1DA 4WFKA 1M7GA 4UNSA 4KRYA 2QLBA 4XQ0A 4XH9B 4RTKA 1CJCA 1W47A 1KEKA 4B9AA 3HJRA 2ZVQX 3WXMA 1N36B 3NTRA 1XJCA 2BDEA 3ZE8A 1BS1A 3FW1A 4LQ4A 3KVNA 3F9CA 2G40A 4YV2A 2XUPA 3RSOA 2XYVA 2REQA 4OXNA 3QBDA 1P5RA 5A71A 4UTNA 5IZCC 3KUKA 1PL6A 2ZYWX 4MS3A 4FC6A 1Q15A 1L4MA 3H2IA 1F48A 5AVRA 3HADA 4C0HA 2NZ8A 5JEEA 4RKFA 5M3BA 3HUTA 3MUFA 1IEWA 1K3TA 5DI3A 4X95A 3AFIA 3LWZA 4GDFA 2PKXA 4FB4A 1U8AA 2VTDA 2G1AA 2YR0A 2WUVA 2YFYA 3QV2A 4OHOA 1JALA 1U0FA 4PBTA 2BHRA 2WFZA 4J7UA 3DBRB 3NHSA 2P0EA 5D7BA 1A82A 4C5CA 1EIWA 3LBFA 4RF5A 5K4HA 4HGRA 2MHCA 5K3FB 2W58A 3L1VA 3OLVA 5K0LA 5C1PA 3BF8A 2GDZA 3F7TA 2QUBA 2XKBA 1UQUA 4QBKA 5EMMA 3EUFA 4NE9A 4J7CA 2V97A 1A9PA 2AQHA 2BKUA 4TTRA 1SUDA 3IXQA 1T9DA 5B6JA 1TMYA 4XSHA 2HMTA 1M5TA 3VRHA 1U2EA 5CCXA 1FTGA 1WQ3A 4CV0A 5AOBA 1GKKA 4G9BA 3TSWA 2DOKA 2QG6A 3DLIA 1TIBA 1YOBA 4L07A 5FP0A 5B3AA 4ZQHA 4PV7A 4US0R 2JGFA 3OCVA 3U56A 4OGWA 1ECLA 4UULA 4F4IA 1QU3A 1R4AA 4HY3A 4QBHA 3AJ9A 5FB3A 3WB0A 2H1WA 3GCWA 3QFFA 4E31A 2IXDA 3LC7O 3KTOA 3H5OA 4WINA 2C0QA 3UWKA 5GADl 3MT9A 4C0XA 3GFRA 2HF7A 2H2FA 4BHTA 3ZLUA 3IP7A 4KMMA 1UAAA 4HWSA 1JB1A 1FFHA 1C7ZA 1T91A 3FYSA 1EFRD 2VJOA 3GO4A 3NI2A 1A9OA 4EW3A 2BGGA 2X86A 1TJNA 3Q3GE 1C7JA 2PXXA 4RA9A 1MIOB 5DV9A 3N0VA 3ESZA 5ALDA 2HKIA 1BYUA 2H4ZA 1JLLA 3G2PA 3KSMA 1MX9A 2JGDA 3KETA 1FDUA 2EU8A 2ZBVA 1JA0A 2QN8A 3R0ZA 4MVJF 4QYIB 3RVSA 4EGFA 1SY7A 3R09A 2JA1A 3ZWAA 2Z2IA 1DCTA 3IT1A 2HIMA 3Q5EA 4QEDA 3VKFA 5IC5A 3CRMA 3N7TA 2OLJA 4MQLA 1Q1GA 1R5JA 3THWB 2VDWA 1Q5PA 2ZKIA 5E4FA 3IUBA 5BSFA 4C2TA 2OL4A 1M2VB 4XJSA 5EZ5A 1PV2A 1XZJA 4ZCPA 2CVPA 3NT2A 3WJ7A 4EB8A 2GVZC 4LSMA 1K68A 3G0HA 2NN3C 4TKUA 4JJAA 2C7VA 3ZXXA 1LDGA 2MIIA 5CH5A 4ZCIA 3ES9A 3F4BA 1MJ5A 4F71A 3SZOA 3MAAC 3GDHA 3JD2A 4O8ZA 1F3LA 3ISVA 5EWMA 4YPOA 5CNIA 3TW8A 3T4EA 4TPKA 2F48A 4P86A 1NKSA 2O59A 5AI9A 1FSPA 1AUVA 2OV2A 4Z4IA 3EIQA 4NV1A 4KV7A 2P2GA 3NP7A 3I4FA 4NDAA 5EWLB 3F8TA 2ZIVB 4M0LA 3L4BC 4BNZA 5KQSA 4QQRA 1CVRA 3CH7A 3GJRA 1CHDA 2DM6A 5MN4A 4QUAA 4KAAA 3JZFA 2P9GA 3AF2A 3HDGA 4TYNA 5F9HA 5HQJA 4FOOA 1C30A 2OP0A 1AS2A 2OP1A 2EATA 3GLHB 3HO6A 4C14A 4F5YA 2HA4A 4WI1A 3ZZTA 2YNMC 4EQ6B 1QHGA 1XVVA 3DHEA 2NAFA 3WGTA 1ZJWA 3GZNB 4WFQA 2OCDA 1R8SA 4JI1B 1QXSA 1ZL0A 1UEXC 2A14A 2NQ2C 3L8GA 3VNAA 1SH7A 2WD7A 1PN3A 4GGPA 4DJEC 1Q1AA 2IT1A 3AHHA 4BMYA 2EKQA 4XIYA 3SC2B 4EZEA 1L7XA 1VE3A 2LIPA 5CURA 4UBOA 3OZAA 4LC9A 3TBHA 3S81A 2CVOA 1RPNA 1GAQA 4MARA 1DBRA 2I2CA 3I2IA 2VQ6A 1DQNA 4EHAA 4LX8A 4URUR 4PR0A 4CMJA 1W85B 2NV2B 4RADA 3TDKA 3GUYA 5DCUA 2MMGA 3T3GA 2MU1A 3FH0A 3TQQA 1C4KA 3RASA 4M9QA 1GTSA 1CUIA 4EMUA 2I2DA 4O4LF 3TUZC 1L4EA 4X85A 2WAXA 4RGVA 2RJOA 3OIFA 3NNNA 1Z68A 3P0HA 5MN6A 3L18A 1SCQA 1E1NA 1SAYA 3IQZA 2YN4A 2VATA 2BKEA 3OCJA 4QGFA 5HIKA 5HKAA 1WV1A 1PZMA 1Z0KA 3AHIA 4HR7A 2ZT6A 4ZAYA 3W90A 3BA6A 4F9GA 1ZVJA 5GJCA 1AKQA 1DEKA 2R60A 4BATA 2WQ7A 2WHYA 3MWKA 1P4JA 5CB8A 3T9EA 2VFAA 3U4HA 3THYA 3RS5A 4ND8B 1QUFA 3DE7X 3HJAA 1D0SA 2QUZA 2R79A 1LJLA 1VI6A 3E81A 1IIBA 2XA2A 2ZIWB 4HAWA 3I32A 4A16A 4OQYA 4K2HA 3ZBPA 4M87A 3JQ7A 1R0KA 2GQ0A 4CPDA 3E2IA 5JCXA 4YMSA 2C77A 3H17A 4FZ3A 4M83A 3RRZA 4NENB 3B5IA 2WFMA 3Q12A 3BMCB 2R1VB 2BFWA 1XTSA 1TDJA 3DKRA 2ZS9A 4JZYA 5T4FA 3W05A 1WU7A 1A7UA 4PHHA 3JX9A 2P40A 1TQ6A 3KL4A 3KPUA 3MSXA 3PC6A 1J00A 1WMDA 1ZK4A 2HRZA 2NUBA 4Q4LA 1BH6A 1GSOA 5AKGA 1IXYA 3RRMA 2P78A 3MJ4A 2P7HA 2HSZA 1TC1A 3L9XA 4N7BA 4UTZA 2B5VA 4WXRA 5DXAA 1Z13A 3ILSA 3AM5A 1C4XA 2QG9A 4HRYA 1COWD 5EJAA 1LF0A 2ZJ0A 4D41A 3DC2A 3NNDA 1DQRA 1FVFA 1YL7A 3SQOA 4BN4A 4OQPA 4D9JA 5ENZA 3ETHA 2QPAA 4X60A 3VU3A 1QYWA 4WZ6A 3N6VA 5J2UF 2WM8A 1O96A 1OAOA 3KVYA 2QS9A 1MOPA 2KLHA 2YY7A 4IQ4A 5ECDA 4Q3BA 4LBYA 2F1OA 1KMCA 2E4AA 2IYUA 2QD3A 2X41A 1YA4A 4HDMA 4ONEA 4ZOLF 1G8KA 2W6QA 2Z8YM 1K75A 3IP6A 3WSVA 3UMVA 1OYOA 4A0QA 1XDZA 1IDOA 1Z15A 5B55A 3STYA 4L7VA 5FL7A 3KTAA 1JGTA 3KOUA 1ACMA 5CXXA 1L4NA 5KQLA 5FEUA 5FDFA 3PCRB 2V0GA 9ABPA 2QX6A 2MTBA 1XSEA 4LX0A 3HRKA 4V39A 4C4ZA 3QNUA 1V2GA 3L8FA 5ECGC 1MXFA 1RWXA 4N54A 3C3KA 4AECA 4FWIB 3UK6A 1E7RA 3N7AA 1MP0A 1KDPA 2RGWA 1LQUA 5KTMA 4NKRA 3EEYA 2Y1EA 4QUKA 3NCHA 2HJHA 3IXMA 2KYRA 1UKYA 1X9HA 5LBIA 1XFDA 2CDBA 3R0VA 4TYWA 4X00A 3O75A 4H08A 3ZW9A 2J9ZB 1R8JA 3JQ7B 1XN1A 5DDIP 4EYOA 2VHUA 3HDTA 3GDFA 4GYJA 3NM6B 2WU4A 1DTWA 3ZY4A 2DEUA 4I6JA 1ATIA 3FMGA 2QRZA 2PL3A 2O8EB 3DG9A 1RZRD 1EFVB 1L8LA 1OXVA 1V37A 3U7QA 3OIGA 4YY3B 4PYLA 2G8NA 1GPKA 1I3KA 2E87A 2GARA 3A1NA 3LC0A 2XAUA 1V6CA 1ZHHA 1RXVA 3FNIA 2PKCA 1SGWA 1VLQA 3NHJA 4GKVA 4BZQA 3DFZA 4GSYA 4O4JF 1KNQA 1PR3A 1BD4A 1ZC4A 5J47A 3VSCA 3DO5A 1Q1EA 5ALRA 5E1MA 5K4AA 2EP8A 3P9YA 4REOA 3NH9A 4MO9A 3RT9A 3DXXA 3T52A 1T5BA 1Z16A 3ETEA 5LZ8A 2ECQA 2J1LA 5JO0A 1FNDA 2JEOA 2VDQB 1TT5B 1VE6A 2VUSA 1FUIA 2YC4C 4JSYA 4LYDA 1RLTA 5COQA 3V2IA 2VTBB 5JLJA 4DMGA 3SP1A 4ARZA 1UXHA 4AN0A 4NZ9A 2JFBA 3FLBA 1UT6A 5D7NA 3BT7A 1EEHA 3AB3A 2AJBA 3L6DA 4CKEA 1NR1A 1MORA 2D2EA 3J7TA 3NAZA 1QRTA 1Y0BA 3CEPB 2VJKA 1ZMRA 2IIBA 1QIGA 1T2VA 2IPNA 3TR0A 1A97A 3ZIDA 1DKQA 1EXMA 1JJAA 3BGOS 4CCAA 1VBFA 4L8LA 3SEFA 1LJ8A 2QAGB 3OZBA 1GPJA 1MN6A 3E22B 4UUAA 1NVAA 5DHFA 1G7CA 3TQRA 2C9MA 3QH4A 2JFVA 4OQMA 1UC8A 2PWPA 2BE7A 3AF4A 5AKIA 1K9VF 4OUDA 4PC6A 2HCRA 2XNKA 5EIBD 1PJ8A 1PR6A 4BQIA 4ETNA 4FPXA 5LLDA 2RGAA 3TQOA 1VL8A 4UTVA 1E60A 1VCOA 5K9ZA 2AW3A 3OZIA 5G1PA 4OA5A 2REXB 3OFKA 4KRFA 1MRSA 5D86A 3TM4A 4A3SA 4L4YA 1VJDA 2DWPA 3DF9A 3EXIA 1I9GA 1E58A 2HAEA 2I7CA 1H23A 2NZUG 3RVOA 4ZDKA 2Z6AA 1K63A 1R4NA 3GA5A 4IVRA 4P81A 1GNQA 3TMKA 3TZEA 3HK2A 3SMVA 4MSUA 1TUBA 3HN6A 1PNOA 2G9UA 4TKUB 1IHDA 4MLDA 3RAFC 2B99A 3TZHA 4M6WA 1LBIA 4RWEA 1NBMA 3N07A 1ODCA 2QORA 5LBTA 1FE8A 1E3WA 5IT4A 2GSDA 2A78A 4XFDA 4I50B 1U2TA 2MSWA 2IQIA 4XWTA 5LZ2A 2EJUA 1FTNA 1NAHA 3DFFA 2BHLA 2BTQA 1XVLA 1MB2A 1EK0A 2GCOB 4X71A 1Q0UA 4IFIA 3R3WA 3UBTA 2HO4A 5L7TA 4HDOB 3KT6A 1QNLA 2ZAMA 1RC0A 4HLCA 3T7TA 4C3OB 3O9ZA 1NW3A 2RG7A 3SX2A 3ZXYA 2QN9A 2CYBA 3MIZA 3ODGA 5HJ7A 3HY4A 4C3UA 1PSDA 3VH2A 2JW5A 4JB3A 1A0OA 2JFPA 2R6AA 1BKDR 1XUOA 4YECA 3IDFA 3OE7A 1X1CA 3WBFA 4F60A 3Q3HA 5K0SA 3RGWS 2O8FB 1UBOS 1XO1A 3UC5A 2BBOA 1VXRA 2QTVB 4HWRA 5CIQA 4QQ8A 2G72A 5JNTA 1T2EA 1EWQA 5ILGA 1OMOA 2C83A 2OHJA 3UMMA 4MVJM 4IWNA 4OYLA 4RESA 4F12A 4W7IA 1I2DA 1JDBB 3FSRA 1VOTA 2ZJZA 4KYTA 4R2KA 4R4JA 3X2SA 5T8KC 4LEIA 1E4EA 1E8MA 1QVZA 2GXSA 3AFMA 3OFSA 2QLTA 4G07A 2FEOA 2H59A 1E2PA 3AKDA 3WWDA 2C9CA 2Y92A 4E4RA 1YS7A 5I7EA 4D42A 4MYCA 2CLHB 2VVTA 3VC3A 4D44A 5TGDA 1U3GA 2WIJA 3E84A 4B45A 1DDGA 4IEEA 5ES3A 4CKCA 2VF2A 1PFQA 4LGCA 4G67A 1LLQA 4ZVOA 3WL5A 3FUTA 2QN7A 3BOSA 1V2HE 1C1XB 4UQPA 1EXVA 1BCRB 3ZCPA 2C2WA 2HEIA 3T1TA 1LWNA 1BRMA 1U0OC 2QYOA 4B1FA 1WPQA 3GCXA 3HCRA 4DE5A 1N32B 2VQSA 1KMNA 4LJSA 3HLYA 4A8JC 1A2OA 2VDUE 1Z0ZA 1E9DA 2PMFA 4BO4A 4E0BA 3EZ7A 2GBLC 1KY2A 2PEZA 4NQRA 1X70A 4KGZA 1GAXA 4GBMA 4U2EA 1GZ5A 4DLUA 3VR6A 4YR7A 3X43A 4PZDA 2W6NA 4EI2A 3PC8C 4ID9A 3AVTA 2PGIA 1ZUD1 1HDOA 5AK3A 3AETB 1K06A 1ZJ4A 3TSAA 4EEXA 1OA0A 4CM8A 1JL3A 1OWOA 3NTQA 5LXTF 4TXHA 4DNPA 4HXGA 4ND7A 6AT1A 4EJ2A 3TD9A 3VVCA 5EZYF 4MPPA 3ZNPA 4QJ3A 4DLBA 1U28C 3HFJA 2FZCA 1MPTA 4HDSB 2CE7A 4X63A 2HU8A 1EFUA 4LTNA 2BGUA 3N8NA 5H16A 4D96A 2DERA 5K20A 2G9ZA 5NLLA 3SZLA 1YOVB 3SJUA 3SXUB 5CM8B 1TI7A 4RV4A 3ROTA 3LP6A 1UBHS 3PHLA 3EGXA 4LMRA 4P4NA 5EXPA 3L82B 3T99A 4D6XA 2IPMA 4JKOA 3KZOA 1XTUA 2W2KB 3L6UA 2AH5A 1JT9A 4CQLB 4D9EA 4WZAA 3F73A 1CKEA 3EW9A 1V3TA 3GJ5A 5JSFA 1JECA 2A67A 4R3UC 5DNCA 2A9KA 2HWKA 3GHHA 2WHEA 3FTNA 3DDZX 3SIXA 4EFLA 2Y2UA 4EKDA 5TJHA 1SHKA 2GCIA 5JMTA 1CR2A 4X0EA 1II0A 3OT1A 4ZOEA 1G21B 4UM8B 1UDXA 1UMKA 4Z8YA 1MO3A 4D4IA 1ZGBA 4UMDA 4Z53A 2GXUA 1NXQA 1ZCZA 1JEYA 2J9XB 4G8CA 1U9CA 1P33A 1TO1E 4B79A 1KYIA 3BXHA 3QVTA 1ZXLA 2C2XA 3BWCA 4GI7A 2IV2X 4D4LA 5AW1A 4NEHB 1L7EA 3ZEAA 3WMGA 1DFGA 2ZWMA 2I6GA 5JALA 1Z74A 1GPYA 4L4ZA 3VPGA 2IJGX 4KXXA 4LDRA 4YRMA 2C1ZA 3DYVA 1EVZA 4MLPA 4O4LB 3NHPA 2OK8A 4Y9UA 3R75A 3G9ZA 3JARB 4JCCA 1W5TA 121PA 4YRAA 2CYCA 3UVEA 1PYDA 4RK5A 3KKMA 2FRXA 4R2JA 3JVEA 4L76A 3RFXA 1FQWA 1NVKA 3MJFA 2IS2A 2ZU0C 4K9MA 2Y6VA 3HU5A 3EVFA 2XIQA 2ICAA 1Q7GA 2VTEA 1NVVR 3V80A 1USVA 2E4UA 3O5AA 3OX1A 4O6VA 4BX8A 3TUJC 2ORYA 1IJBA 5DHUA 3QP9A 4HPJB 4MV9A 4C7VA 2XCSB 3EX7C 1QTQA 2IS6A 1IHPA 4LCJA 3RSHA 3SSOA 1PVOA 2QMUA 3A6HA 1OFUA 1Y9ZA 3NGXA 5C8YB 2QW0X 2YL2A 2Y2VA 3W5JA 4CE6A 5CB6A 3VZQA 2VT3A 2GMWA 5PGMA 3AI1A 4NVRA 1EP9A 3W8DA 3HJFA 1JE0A 5DGIA