4FILA

Structure of fhud2 from staphylococcus aureus with bound ferrioxamine b
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
256
structure length
256
Chain Sequence
PKRIAVVAPTYAGGLKKLGANIVAVNQQVDQSKVLKDKFKGVTKIGDGDVEKVAKEKPDLIIVYSTDKDIAAYQAVAPTVVVDYNKHKYLEQQEMLGKIVGKEDKVKAWKKDWEETTAKDGKEIKKAIGQDATVSLFDEFDKKLYTYGDNWGRGGEVLYQAFGLKMQPEQQKLTAKAGWAEVKQEEIEKYAGDYIVSTSEGKPTPGYESTNMWKNLKATKEGHIVKVDAGTYWYNDPYTLDFMRKDLKEKLIKAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferric hydroxamate receptor 2
publication title Crystal and solution structure analysis of FhuD2 from Staphylococcus aureus in multiple unliganded conformations and bound to ferrioxamine-B.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Metal binding protein
total genus 92
structure length 256
sequence length 256
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4filA02
1MIOA 4TKVB 2OGWA 5CR9A 4INPA 5KOJB 4FI3F 3TNYA 5BVHB 1N2CB 2X4LA 3CX3A 4ND8B 4IRMA 2M6LA 2WI8A 3PDIB 1QGUB 3TLKA 4HN9A 1M1NB 3AETA 1M1YB 2Q8PA 4TKUB 2WHYA 3ZK8A 1MIOB 1TOAA 3TEFA 2M6KA 3PSHA 3HXPA 3MWFA 1XVLA 5BVGA 3BE5A 2XUZA 2YNMC 4LS3A 1G21A 3GI1A 1ESZA 1K75A 3U7QA 3AETB 2R79A 2PHZA 4TKUA 3ZK9A 4BBPA 3PSAA 4WZBA 1K2VN 3MFQA 4NNOA 5BVGB 3AEUA 4XPIA 1K7SN 4CL2A 1G21B 3U7QB 1KARA 3LHSA 4GICA 4PM4A 4UDOA 1N4DA 5KHLB 2XY4A 3ZK7A 4WZBB 5JOQA 3EIXA 4M7OA 3AEUB 2MINA 2QI9F 4OXRA 4WN9A 4XPIB 5KOHA 4INOA 5JG7A 2PS3A 2Q8QA 5FLYA 3MD9A 1PQ4A 4PAGA 3EIWA 2OV1A 3ZKAA 3LI2A 1KAHA 4MO9A 4OVKA 2OV3A 1FP4A 2AFIA 4HMPA 4UDNA 1K0FA 3R5SA 1H1LA 4G09A 3NU1A 2MINB 5GGXA 4WN9B 4WESB 5KOHB 4HMQA 2PS9A 3MINA 1PSZA 1EFDN 5CX1A 3G9QA 1KAEA 1FP4B 1L5HA 4WNAA 2AFIB 2YNMD 4FNAA 1H1LB 2AFHB 4MLZA 1N2ZA 2XQVA 4WESA 5JJ5A 3HJTA 3MINB 1N4AA 4H59A 3AEQA 5M2QA 5CX1B 5M29A 5HDQA 3BE6A 5AFSA 3MWGA 1L5HB 3AERA 4WNAB 3AEKA 5M34A 5GGYA 4FKMA 1G20A 2RG7A 1QH1A 2AFHA 4G07A 2XH8A 3K1AA 3AESA 2PRSA 4DBLE 4WZAA 1M34B 1QH8A 4LJSA 4K3VA 3AEQB 2XDQA 2ETVA 4OXQA 5B58T 4UTPA 3R5TA 2O1EA 4TKVA 3ZTTA 3AERB 5KOJA 3AEKB 5M3BA 5BVHA 1N2CA 1G20B 4FILA 4ND8A 4UTOA 3HH8A 1QH1B 4B8YA 4N01A 4MDYA 5JPDA 2PS0A 3PDIA 1QGUA 2R7AA 3AESB 3K1AB 4HMOA 4NNPA 4H0FA 3UJPA 4WZAB 5I4KA 1QH8B 2OSVA 1M1NA 1M34A 1M1YA 5HX7A 2XDQB 2XV1A 4MX8A
chains in the Genus database with same CATH superfamily
1Z2DA 4FFOA 3BXOA 4TKVB 1T5BA 5FNVB 1GN8A 1QV9A 2G1PA 4C5BA 4KIWA 3CUVA 4HEQA 4GVPA 2GESA 1QTQA 4KNWA 2H16A 3A4IA 3O0DA 2A9KA 2FLWA 5T64A 5DULA 3V1NA 3G2MA 4DLAA 2WTMA 2V9PA 3MELA 4EPWA 3HEMA 1JN0A 5G41A 4G36A 4Q7MB 5BWLA 3HUDA 5SV2A 1KOFA 5JYEA 1IBRA 4GOKA 4OFXA 4X71A 1J6UA 4R16A 3M1LA 4LC9A 1QIEA 3IT0A 6LDHA 4CQLA 3L46A 5IP5A 2P0YA 4XSGA 5ALUA 1YR6A 1AXEA 1QSGA 1HNZB 3L8EA 2E37A 3M81A 4EMTA 4IY1A 4NJOA 5IAEA 2NO1A 4XX0B 3HDVA 4ZVMA 2YV3A 3ZHSA 4HNVA 3MJRA 4KCGA 1USWA 4PNHA 4A2PA 2IIBA 4FOSA 4ZI7A 2FQYA 1RBQA 1ZLYA 3E82A 2Y2UA 2YDYA 4W8GA 2VS1A 2F3UA 3PIIA 5JD6A 4BQNA 1HMYA 4YAEA 5HTKA 3VFDA 4WBNF 4LI3X 5DXAA 2JLVA 2AEJA 2WYHA 1EWYA 1RRPA 2DPXA 4GICA 4YRAA 3V9AA 2BAGA 1JA9A 2CYAA 3OESA 1SCNE 3AT1A 4A6PA 1VL6A 2IZ6A 2VQ3A 3FZEA 4E15A 5AD1A 5K3OA 3EC2A 2BT4A 3DAOA 3RU7A 4XPIB 1G8AA 3QI7A 1IN8A 4Y6RA 4MRAA 3IAM6 2O2DA 1O3YA 4LJLA 2CFSA 1L1RA 4UULA 3C3YA 3VO9A 2GEFA 4JX9A 3ZGVA 1XLTA 4XVUA 4V24A 4RZ2A 2PCLA 4YRKA 5E1BA 2G9NA 1ULAA 2B5VA 1I0IA 1N2IA 2W6NA 4N9QA 1RFLA 3NANA 4KSYA 3QZUA 3ADPA 3BTUA 1VKHA 2GBLA 3HA5A 3KUUA 5EYPB 3NS7A 2WPNA 3GVXA 4IJWA 1DLJA 4BKMA 4QDTA 4RSGA 3HMQA 2VF5X 3F8WA 3FOEC 2QJRA 1J09A 2J5KA 2CSXA 4NTZA 1TRKA 2AE2A 2GFHA 1W4CA 2GZHA 3RUHA 2QUIA 5B7QA 3DKRA 1KY3A 1FLVA 2HW8A 1YV9A 3QU5A 1A9ZA 2XITA 2HLDA 2FUG1 3KT3A 1IY0A 1BU8A 1PGJA 2PT5A 3F8SA 3KZNA 4ZALA 3UGKA 2QL6A 4A4DA 1SEVA 4E03A 3ZLUA 1EUCA 1LI4A 1E20A 1RAAA 1LWOA 2I2BA 4K6OA 4QSMA 1DLIA 4XGNA 5THKA 5B3KA 2FPIA 3DM5A 2ZUUA 3GB9A 1BDJA 2Y0EA 2AB0A 2PYZA 4PZAA 3RSQA 3S1AB 4R71A 3FJYA 3BIXA 4M38A 1LLDA 4ZANA 3H5AA 3JQ8A 1AUXA 2WYUA 5ERYA 4K03A 3AVUA 5JD3A 2CC2A 2PWZA 2B9VA 3KSMA 3O1HB 3F98A 4GC5A 2XB8A 3IAXA 4CL8A 4RLQA 3RSOA 1TGVA 3P1JA 1D2GA 1SY7A 1PJBA 1H93A 1DTWA 2XUQA 2YW2A 3AUUA 3FYCA 3K1AB 4NEQA 3QXCA 1EEXB 5JO9A 2NIPA 4FZJA 4IEEA 3ANYB 1GQ2A 2IYRA 2JLSA 2X14A 4I50A 3ZWAA 1H9BA 1MMFB 1R6XA 3IR6A 3P0JA 3H7AA 4LX0A 3V1LA 3WDSA 2ZR0A 5AVJA 4RTKA 3OQNA 1P5RA 3CB4A 4L15A 4JNCA 1JDJA 2OV8A 4KAAA 4IIHA 3W8RA 2M6LA 1PLJA 2HU5A 4AUNA 3SYLA 4FWTA 2H4HA 1O1YA 5LYJF 1OYVA 3VKVA 5JAHA 1YCHA 4FYIA 4JLMA 1XMPA 2QRNA 3ZK8A 1LRJA 1QCZA 3H9EO 1H6BA 3KB6A 3SPXA 4RJ2A 4MA5A 2X0DA 2PZFA 3VZRA 1G0NA 1U3DA 3EGCA 1D2RA 1T91A 3H1BA 4GMGA 4K9KA 4KQ2A 1YMVA 2C57A 1ADYA 5GP1A 4NBNA 3RI3A 1KTIA 2Z0MA 4IUDS 3MMSA 5PNTA 4BCBA 3ZNPA 2CSUA 4F5ZA 2H8KA 3JATA 4DUGA 5ILOA 2IDZA 1VLQA 1DWPA 3O8QB 1FA9A 4FN5A 4WCDA 1NYQA 4ZV4A 1CK4A 2FSGA 1KEZA 3DVAB 4OXYA 5KNBD 2WSYB 1OFUA 2C0PA 4JJ7A 2XWSA 3V8EA 2YVQA 1M54A 1T5IA 2P8SA 2YYAA 1G64A 5LYJB 3TG8A 4GPZA 1C3OB 2B4KA 2FK8A 1XTZA 1JT9A 1GWNA 3NBAA 1ZICA 3W78A 4B0PA 4EY8A 3N8KA 1T4BA 1H22A 4JC5A 3LHSA 3GLVA 2ZZNA 2R85A 1ST2A 2W6IA 3F9RA 3H7IA 3MD0A 1P5FA 1L7PA 2AOWA 2CXOA 4TUYF 4X93A 3K71B 2JVKA 4CT5A 3A9UA 2PX5A 4RTJA 1NW9B 4Y6SA 1SCUA 1TQ8A 1JR2A 4GKBA 4HKTA 4RESA 3B52X 5BYAA 2PQMA 2ZYRA 1NRIA 3DMNA 5J4LA 3ZN2A 1UDWA 4YA6A 4ZAVA 5ESDA 2PZJA 4AJPA 3ANLA 1R4NA 3ZVKA 3L8MA 4JI7B 1V39A 5EXEA 1E2DA 1QQ6A 2YUIA 4AMGA 4DSTA 5DGXA 4N12A 1Z63A 3NG1A 1TYCA 2YXLA 1XXLA 3EA4A 2ZIGA 3I58A 3IOEA 3M6AA 3MJDA 4G2TA 4TUYB 3RYIB 5JSZB 2VUTA 2L17A 2SCUA 3VDXA 3EWSA 1J8QA 5IH3A 1MJFA 5EQJB 3SHFA 1YVPA 1N25A 1E58A 2Q41A 5HMLA 1S5PA 3RJTA 1BWPA 4L95C 1SUSA 5IG2A 1CE8A 2HDOA 5AFSA 1A76A 2C7VA 3GNQA 3I4CA 5LLDA 1H5QA 1PQWA 4MUHA 3IUYA 1LLCA 1U7TA 1WLYA 1NYLA 4DJTA 2BTQB 1E60A 3EGIA 1PG2A 1F1JA 2PZEA 3IQXA 4WZAA 3ZCXA 4DSNA 3SSMA 4F7WA 1TQ6A 1N9KA 1UPTA 1H42A 1I51A 3SIRA 4UU1A 5L3ZA 2XNDD 1CFJA 3CISA 1IN6A 2GKOA 1R66A 2JFHA 2OKGA 1EZZA 1RAIA 2HA0A 2QMYA 4ZO6A 3O8NA 3L6DA 3STTA 4BZQA 4CTJA 3BEDA 3CURA 2BMWA 3RADC 5HSGA 1G18A 3UYKA 1RC1A 3BH0A 1ML4A 1KRHA 1X15A 1QHNA 4IQGA 3RAGA 2W2VA 3BGIA 2IYEA 4PZCA 4JLAA 5CXUA 2IZ0A 3FLBA 3QYPA 4EH1A 2IYVA 4M0CA 5IARA 2A5YB 1BU5A 1VYTA 1MRZA 2KB0A 5JR3A 3GLFE 1GZ6A 1QK4A 1XMXA 4NZPA 5JLJA 5KJCA 1BGXT 4IIFA 4KRFA 1V3UA 1D07A 2GPJA 2O2HA 2O1SA 3H1TA 3KUDA 5DNVA 3ZD8A 5B58C 1SCQA 1U2GA 3TNJA 5AUNB 1PF7E 3WDLA 2Q1YA 5BMVB 3RJZA 3H4TA 4BKRA 4Z1OA 3USES 5TMBA 5ED0A 3WWDA 4BVAA 5L3QB 4IH1A 5IJ0A 3KVNA 5LZ8A 2IV3A 3ZZUA 1CZHA 3IB6A 4HYYA 2C7RA 4M7PA 5AHKA 1RE0A 2QX8A 3C45A 3ENWA 5D00A 1W94A 3QU2A 5DCLA 1WCIA 1S1CA 1RI2A 3V2UA 3AETB 2HSJA 2YJ3A 4D82A 2C5HA 1AKUA 5F1OA 2H4WA 2BFDB 3CRMA 1SXJB 4F85A 2IYQA 5GZ1A 3DBRB 3RT1A 3D31A 4BZPA 4K1LA 3ZDYB 2VSNA 2R6DA 1DKQA 3QV1A 5ELMA 2FFBA 1A7KA 5AKKA 3UXHA 3X43A 1E8NA 3INTA 4JZYA 3W8FA 4B6OA 1SUFA 3K0FA 1PUXA 3QPCA 4IGIA 4EJFA 5KNLA 2WQ7A 5KSYA 3G2IA 2G09A 3ILYA 3ZI0A 4MWCA 1OWMA 4P53A 5G0SA 4KQWA 3ACCA 2WM8A 1A9QA 2QZJA 3IO3A 4G0PA 4I4TA 2R1TB 3Q7QA 1M2HA 3QKTA 4ABYA 2G63A 4JYPA 1TU0A 2D5AA 5B1SA 3SQOA 5BWCA 3F9CA 3ACBA 4Q9LA 5G40A 5CYGA 3O4VA 4F5DA 3V7WA 3CMCO 4YAWA 4YV0A 4A23A 4KK4A 5JRJA 2LW7A 4MWTA 2NNWB 4INJA 3BAZA 3ANNA 3CZAA 4GO1A 4JXKA 2BGLA 3FI0A 3RRZA 3CVVA 3KUKA 3V3TA 3IDZA 4FYMA 5C81A 1X14A 3F6YA 3ZXYA 1MEJA 3H9UA 1VE5A 1X42A 4LCJA 2A5GA 2FB9A 4K7JA 5JJLA 1YZFA 2GHIA 2BY4A 2YNMD 1SOWA 3ZIUA 1V45E 3ESZA 3KWLA 4QQKA 1NR5A 3PNLA 3W79A 1O87A 2O2SA 3BRWD 5ALKA 4H4EA 1DADA 5CDFA 1C7RA 2C82A 2VT3A 1PJ3A 4GP6A 3VDQA 3C4JA 4C7VA 1XCBA 2ZIXA 2J3EA 5IW8A 1NHWA 2IUYA 3KQOA 3I04A 2UXDB 1ISMA 2AKAB 2D5BA 4G9BA 5IABA 4BYMA 2AHRA 1JXQA 3C6ZA 2QMHA 1MT3A 4O2AA 4U3JA 5F12A 5BW5A 2IDJA 3P20A 4OJQA 4OJNA 4P3PA 3TH5A 3A05A 4Y7CA 5TGTA 3UN1A 2BC9A 4XQGA 4IUCS 1CQIB 1MN6A 2ODQA 3IPXA 3LWNA 5CJPA 3CUYA 2P6MA 2GPWA 4HAYA 1E7WA 4C4RA 4EPXA 3K92A 1LDBA 1IHUA 1FFYA 1OTYA 2I2DA 3E9RA 1P4GA 1WUKS 4PANA 1E1NA 3IPRA 1Z0IA 3MGAA 1B1AA 2MSCB 2ODEA 4DLLA 2YQ5A 1YQQA 4J0FA 4KI7A 4BC1A 4CM6A 2LNDA 1OFIA 1EB9A 4LGCA 2ZBRA 3U7JA 2H5JA 4I2VA 2WHEA 1X1EA 3DEIA 5TNXA 2GM3A 4PLFA 1ZUNA 1NVEA 1Z12A 5DBIA 1QPZA 1LPAB 1XFDA 4U7WA 1T0HB 1KP9A 4CTMA 2PYIA 4CR8A 2VPIA 3PC8A 1SXGA 2I2XB 1S4MA 1SKQA 2ID9A 1CVRA 4LECA 3VVMA 2IHBA 2R1VA 4MR7A 3AVPA 5JNRA 4MH0R 2FZVA 3AWIA 4WSOA 2HLPA 2YS6A 4ID9A 1EE9A 1ABBA 2X3FA 3EUEA 1TZCA 2WF5A 2NG1A 1AZSC 3IEXA 3OO0A 3AWDA 4C07A 2Z5VA 4RF3A 1E9DA 3B3AA 2A7XA 5LC1A 2X0FA 4DN6A 2NZVG 4XGKA 1EFLA 3JSXA 4PAWA 4U6SA 1FDSA 5ALMA 1P7VA 5IZCC 3LCCA 5DVZA 5T7BA 1Z34A 2P3LA 4D45A 5AVSA 3HRHA 3VU1A 3NCHA 1X9HA 5CM8B 4QYXA 3TTVA 3I9JA 3M49A 1SCIA 1G21B 1J8DA 1XD2A 2VH2A 3SM3A 3HY4A 4F4UA 1WSAA 3ZV4A 4NU8X 2FPGB 1FFDA 4FYHA 3R8FA 2LIVA 3V1MA 5CITA 4JFAA 7REQA 2V54A 2V74B 2DXIA 2YYSA 3K9CA 4YJKA 2JANA 1RRVA 2AEFA 2C8JA 2XCOA 4B76A 4RJLA 1I4TD 3JPYA 1QIMA 4AQDA 4WLOA 5LMNB 5M04A 4J75A 1J07A 2R7LA 1E5QA 1UK6A 1AUQA 3MTIA 3N07A 3N3AC 2HV8A 4FMDF 2O50A 1X8JA 1YS2X 2DU8A 3K05A 4GC9A 1ZEMA 3MT7A 1E94E 4R1PA 5ICSA 1R8QA 1E5VA 2Q7XA 3C16C 4KI0A 1SULA 5TMEA 5HQTA 1NVBA 4MVJG 5JVDA 1SIWA 4E2FA 2PKXA 1BW9B 1J49A 1P1HA 2W11A 2ZGVA 4O5AA 1JL3A 4K86A 6ADHA 4L7VA 3ROFA 5KYUB 4CM1A 2V3VA 3OFND 1ZRNA 3VV3A 4C9BA 4HUTA 4D8WA 1Z2PX 4A82A 2WSIA 4YECA 1UJ4A 2CLIB 3ND6A 3O0TA 4MGIR 1XDUA 5HOQA 5T3YA 1C7FA 1PX0A 4DCMA 2VH1A 4LXUA 5BT8A 3ZGZA 1S96A 2XMCA 3VVBA 3HJTA 2PBFA 1L4FA 4JXZA 1D2MA 4HATA 3STWA 3A3KA 4IDPA 2D2FA 4YV1A 3R09A 3QYJA 4GGPA 3GJ6A 4C4TA 4ZYTA 5H82A 2ZT5A 1SJ9A 4I4CA 2NTNA 2J59A 2P5TB 3PUXA 5JWOA 4H1WA 2PT6A 2YRFA 1R0BA 3M1YA 1MD9A 4X20A 4MEBA 4ZQIA 4NATA 1O6FA 4IYJA 1FMCA 1NZDA 1MOZA 3TKLA 2XDQA 5CEEA 1KOLA 4JLDA 1QBKC 3LAWA 5D51S 8MHTA 1CT9A 2PJZA 3DAHA 3EF0A 3VPHA 4NFHA 3L3BA 3DOJA 3PG5A 3ESXA 3LP8A 4IWYA 4MKZA 4M89A 3OWOA 4N3AA 2O57A 1QGUA 1U7WA 1K88A 2AG0A 3IUQA 3QEJA 2FZ4A 5EMNA 1RKXA 4MI6A 3RGWS 3UC9A 5CLJA 3ETCA 3W6NA 2X0EA 1XRLA 2Q2WA 3LUJA 3AR3A 3D8TA 1JMKC 4U2CA 2VP3A 3JQAA 3P5BA 1JMVA 1K8ZB 3U7GA 3ONVA 2YMMA 2FZCA 2PX0A 1L4UA 1SUAA 2MOKA 3AW8A 3FYUC 5L7YA 5A9SA 4GR5A 1Z7BA 4R9UC 2IEAA 3MOSA 5G3YA 3CW2A 4BVHA 5JASA 2WZQA 4P4SA 3G82C 1Q91A 3MAGA 3N6VA 1LTKA 3MJHA 3WK9A 2QR3A 5EIAA 5F76A 3B1VA 2JW5A 4LYEA 3OZSA 4UEQA 4EX6A 3JQ9A 4PGFA 1N0IA 3O47A 4FX2A 1CG6A 2A84A 2GJ4A 1FUEA 1G9SA 3M9WA 3T3GA 2YV2A 6PFKA 2YC4C 1FU4A 3S5UA 4I6GA 3QWFA 4AULA 3TIIA 2UVPB 1Z5OA 4CF3A 2RGGA 2FJPA 5WRFA 2Z09A 3G17A 1GTL1 3GVCA 3JWIA 5F78A 3AEUA 2V7TA 2B30A 5EP3A 5BSVA 1P2GA 3GCZA 3NAMA 5JPIA 4N7MA 3EGWA 3EVGA 3OE1A 2A30A 1UAAA 1EJ2A 3SJAA 2B2CA 1C8KA 3WHPA 2HPAA 2R7MA 4IGAA 1PZGA 3RRJA 3N2KB 1DQYA 4K88A 2ZBDA 4IAOA 1UANA 4XX0A 5I5GA 1TZBA 5FWYA 1NXPA 3CGGA 1XQ9A 5AKGA 3D4NA 3OLXA 1OYYA 3FWZA 2AI1A 3KWJA 3RU9A 1YF3A 1TAUA 2Q0SA 1TMGE 3DYVA 4ZODA 3G79A 5K3DA 1FZQA 5CT4A 4EBFA 3ABQB 5M7EA 2G07A 2G8LA 1Z6XA 1L5WA 1PIWA 3FJOA 2DHRA 2QBYB 2Q4EA 4KN8A 3AEZA 3P0HA 2JAOA 1QTIA 2JD1A 3R6TA 3TZCA 4MKHA 4MQFA 4P54A 4U1RA 1PZHA 4US2R 4FDVA 3WIDA 4ESHA 1AQUA 1VHLA 3N8GA 4BL5A 1MV5A 4JI1B 2R44A 1JQKA 3ICPA 3HZOA 1YMUA 4TX1A 3NAZA 1OW3B 5AW8A 5IUNC 1SB8A 1Z0SA 3SMVA 5JBNA 1BKSB 4CMKA 5BW4A 3MRTA 1W44A 2TMDA 4WXEA 4AB1A 1X7ZB 4J0DA 3K2BA 3LW8A 4RKRA 1LLQA 4EJMA 2B83A 4RTPA 3IQWA 4D26A 5DM60 3S8MA 2GPTA 4KQHA 5F33A 3WGQA 3MCVA 1AIPA 3MRXA 4TWZA 5E6UB 2R8XA 1PKXA 2A9OA 1XKLA 1MF7A 2ATEA 1AO3A 2XGGA 2AK2A 2VF7A 1LBIA 4BV9A 3DMTC 2XYRA 3OLCX 2NXEA 1XJQA 4C04A 4FTWA 5CTAA 3IUNA 1P91A 1XTUA 3A1NA 2VQSA 4PC1A 4KIGA 4PICA 2NZWA 3CWQA 3D7SA 4BMYA 4JOCA 3BMNB 4DB4A 2EP8A 1G8JA 2JBHA 4OP3A 4RL6A 2JJ1A 1J2EA 2FWMX 1QH1B 1SBYA 5LCXA 4HH1A 5ARDA 3X1JA 3EA0A 1G98A 4EHLA 1GITA 2W22A 1L8AA 3WNZA 4D02A 5HKBA 1BEZA 1GRVA 3R40A 5AOVA 1TUBA 2FK7A 3D6NB 3O2SB 1DCFA 4OMDA 2DUMA 4M1MA 2UUPA 3N74A 1X1RA 3QXSA 4YP5A 1Q6YA 2OZVA 1GPBA 3ZHYA 5AVWA 3KEGA 4LNHA 3C5EA 4B43A 2MYTA 1E2KA 2JEZA 3E48A 3QVLA 4YACA 5DB4A 3U44B 1R0CA 1R88A 1GPKA 4TTJA 2I2AA 1BX1A 1EM8A 1NV8A 1ZXBA 3DYIA 3PPVA 4RADA 1R6VA 1QWOA 3NWEA 4XDGA 4DA7A 3ESYA 3OZCA 4BO3A 2E55A 1OLOA 3GGSA 3EZGA 2Q27A 3OE5A 3WAKA 2EFGA 2GHQA 4IXWA 1OBVA 1IVNA 1WRBA 2VC2B 3G9XA 4UU8A 2BIFA 4V39A 1N2CE 1A2OA 2YNMC 4CKCA 1GKIA 2W2MA 5JSHA 4F1WA 4M1SA 3EPJA 1K7CA 2H7XA 1CUWA 1AQ6A 1DBRA 2R6FA 3RROA 5BUSA 1I2CA 2I6XA 1KGSA 3OIDA 4ZEXA 1HYQA 3K30A 4RCVA 4DABA 2BEVA 3SG0A 4EY6A 1YUMA 3ETJA 4E21A 3B7WA 4UAGA 3R6WA 3VPBA 3KKOA 1VCMA 3PYLA 4AZ0A 5HGJA 4W63A 1HKHA 1RIFA 2BEJA 121PA 4IR7A 5F5XA 2XBLA 5IAGA 4DT1A 1Y42X 3PPIA 5A06A 4DG8A 1G60A 4RH1A 2G4VA 4IGFA 4E70A 5BXQC 1WL8A 2WJYA 3D4IA 4DBVO 1N4DA 1HXHA 2NVUA 2P2SA 3SSOA 5JSYA 2J0UA 1ZH2A 1JHVA 4UPDA 5BO5A 3BAFA 5HCUA 4IHQA 4DVJA 1KU6A 2FGJA 4Z2AA 5AVTA 1QCCA 2EIHA 3ZJYA 5KWVA 1QDEA 3KK0A 3M6LA 4FEEA 5EN4A 3PVCA 1IOZA 4KZKA 4LW8A 3IALA 4RZQA 1BXZA 4BMZA 3Q9UA 4MGKR 2NSHA 4DHEA 2COUA 4R1TA 5C32A 1V6AA 3A2KA 4M6WA 2JKYA 2CHFA 3FAKA 4URFA 2I55A 1C9NA 4W5HA 5DASA 3H11A 6REQB 2JGEA 4XXHA 3IIMA 2PLWA 3NHBA 1ZIPA 4LBYA 1ZI9A 5EQFA 1JNXX 1GAJA 4HPWA 5T6BA 5LQAA 2FRDA 1W36B 2YVUA 1RABA 1CNMA 2C4KA 1KZYC 3DVLA 3L8FA 1JHYA 1Y1TA 2DRIA 2QVCA 3UC5A 3WGMA 4TYYA 2OVBA 1JDBB 1XZKA 3UWMA 3UJAA 8LDHA 1GU1A 3EPRA 3FNQA 4DPKA 3PPYA 1LC0A 1ODKA 3S6JA 2R751 2HIHA 1G291 3T52A 1SBHA 3RS9A 3I8SA 2YS7A 4H6WA 2CNDA 1TJYA 2P78A 4F06A 2XXJA 3QJGA 3X0DA 1Q21A 4LKOA 3HCOA 4FBMA 1KY2A 5E4FA 5KTYA 2G36A 4HAUA 4ZAXA 1WDMA 3WGLA 4AD8A 5FUVA 3ETDA 1GG8A 2V6IA 4IIGA 1Y34E 4XOUA 3CVJA 1DIGA 2PIAA 3DNMA 1QDLB 3B2QA 4YALA 4E11A 1VL0A 2AR0A 4EUSA 3BE4A 4CLHA 4L5YA 3UM9A 1OXBB 1SU8A 2XIQA 4H3KB 2JBAB 3IEPA 4W5WA 3OLQA 4CUKA 1AT1A 1XZBA 3GEIA 2KLBA 2P4QA 4PFKA 1XTRA 3ITDA 2X76A 4AKHA 4IKPA 4Q18A 4WEOA 4E32A 1M1ZA 1UOPA 5EIXA 1DDGA 3P9PA 1GZDA 4LMPA 4ZVNA 1CETA 1T4DA 3HUUA 4IHJA 3QX3A 1M5TA 4A0GA 3AIOA 3RRXA 5HRUA 1TYBE 4ERNA 4MQBA 5HQ3B 2IUUA 3D59A 2WKWA 7MHTA 5L3RA 1UBOS 5FAKA 5IJ9A 1C8BA 2AUMA 5CDUA 3DKPA 4XR4A 1NJ1A 2Q8PA 1U3GA 3F67A 3IAS1 1F3LA 2WVGA 4LDPA 5IUKC 3RKRA 4D25A 2VWHA 4MW5A 1HE3A 3U0VA 4OUDA 4QDZA 3ID6C 4IDEA 3V80A 4RXMA 3WLJA 1G55A 3F5QA 2CF5A 1GYQA 4C3VA 1EKXA 1JUDA 3H18A 1DRUA 4ON9A 2REBA 2ECFA 2EQBA 2P2CA 2JPDA 5CYPA 3FDXA 5IS2A 4IOJA 3MIIA 1QQ5A 3PX3A 4I5FA 4UHHA 4E5PA 1BFDA 4G0XA 4BDSA 1X1TA 4EG6A 2PL3A 1QE3A 1L4KA 1VIMA 1ZS9A 2QN3A 1U99A 3ZVNA 1AHPA 3VYVA 1SZDA 4M53A 2IDMA 1YZHA 5FDFA 1QPGA 3AUJB 1DEXA 2EZ4A 4GVLA 2OQ2A 4HDNA 2GT1A 3K94A 3NTVA 1XHFA 5FWAA 3FCOA 3HU3A 5EIEA 4V3CA 1N7JA 3R9IA 1HTBA 2YHIB 3RQIA 3WLTA 3EDOA 4WZBB 3TUIC 2BFDA 1RAEA 1ZD1A 3L1VA 5K0FA 2J6BA 3IMGA 1OASA 1ZH6A 5KTOA 4JSRA 4YJ3B 5A6SA 4URHA 1T2NA 4QUAA 4ZI7F 3ZQUA 4GSLA 1MEOA 2B78A 3AIKA 3V4ZA 2OC9A 3BG5A 3BK2A 4C4YA 1YVRA 4JASB 2ROQA 5ITZB 3C8ZA 4UNIA 2XWQA 4JC8A 3S1SA 1JG7A 1LTHR 3CO5A 3TTTA 2H0AA 3M8KA 3PHJA 4EZIA 2NV0A 1IRIA 4KQMA 4Q3NA 2JKVA 1FJ2A 3OEHA 4Q1AA 2BM0A 3A70A 4RDCA 4WN9B 1U90A 4B5LA 4LWQA 4S3MA 4B35A 1KVUA 3OT5A 1FC0A 2R6GA 1G5PA 4KL8S 1J56A 3SOZA 3O8RA 4ZMSA 4ZOLB 5K0SA 5J2TA 3BXZA 4MYCA 3QEKA 3EH1A 1N7GA 1YQUA 2QVLA 3ABRB 1JMYA 4RHFA 3UK2A 1C0KA 5JANA 3CG0A 4F1KA 3AKZA 3W8EA 3THOA 5KNDA 3PI7A 2E3JA 3AIMA 4A27A 2J3JA 4C3ZA 1WXEA 2X13A 4B79A 5JH7B 4M37A 4CMCA 2QJWA 4OHYA 2F3PA 1JLMA 3GRRA 5B37A 4ETMA 1JRLA 1Y89A 1ZC4A 3GEPA 4DCUA 1CSEE 5T8KA 1NT4A 3PRKE 4D8YA 1H85A 1E9CA 1NXSA 5AHOA 3BT7A 1QIJA 1RLTA 2F8MA 1YK1A 3OCXA 3UT6A 2ZR7A 2AMFA 5DHQA 1GTG1 2XDYA 3E61A 4TPKA 5REQA 2X6QA 5DTJA 1K8XB 3GP5A 3ZS8A 4E5YA 4JV5B 4N0PA 3A1FA 2JVIA 1QFXA 3C6XA 3EEFA 4JSYA 5C34B 2K5UA 4NEGA 3TGWA 4B8ZA 3U61B 2ATVA 2QJOA 4YX9A 4BNHA 4BN4A 3IJ5A 5LB2A 4CLOA 5CTJA 1OFTA 2WFLB 3TOSA 2XT0A 2AKYA 3NWPA 1QV7A 3LWBA 4KH0A 4MUMA 4LQCA 1L5KA 4B7ZA 3UMYA 2NP7A 1YDMA 1ARZA 1H8ED 1IH8A 2CLCX 2ZJ8A 4HMOA 4QNNA 1QHEA 1ONOA 1B2LA 3U0BA 1WSBA 4LGMA 4DLUA 1YR3A 2MWMA 1GL9B 1RJGA 3T06B 1NLMA 2EFEB 4C1BA 3P2YA 2GO7A 3KJXA 2F1RA 4M1OA 2QQGA 1X39A 3LBYA 4YWJA 4W4TA 3I8OA 3WSTA 3U4MA 1YT5A 3EGXA 3JZMA 1RU3A 2A92A 4PS1A 4L0CA 3SFZA 1Z5PA 5E3HA 4JJGA 3LJKA 2O8CA 1PGPA 3NWJA 3BHMA 1JFFA 1C50A 4O2BF 3ZE6A 4D56A 2C58A 4AZ3A 1GTMA 5JZSA 5L6LB 2BW0A 3D4PA 2O8DA 1BCRB 4R8RA 2C9CA 1PQPA 3RE1A 2IQ5A 1XA3A 4XB6B 5PGMA 1BFKA 1PBTA 1TF5A 1LPOA 1OWNA 2P69A 3KBOA 4EUKA 3UQZA 2O0HA 4O1MA 4Y67A 4AG6A 3TW0A 5BOSB 4HN4B 2O8FA 5ECDA 4CQJA 4F97A 5I9NA 5JCZA 5KS2A 4CKBB 5ITWA 4FOLA 1SVOA 4CFYA 1Q1AA 5B1DA 1GPUA 4IJ5A 4MV8A 3FSEA 1NLUA 1OILA 2VYCA 4KWEA 4XD7D 4ARCA 1EGHA 2IC5A 4EK9A 1OSNA 1UBMS 2WILA 2QAJA 5AJZA 1NXTA 4GX0A 4KIJA 4L4YA 4O2BB 3H2KA 1IWOA 4L2IA 2X7XA 1NUTA 4I55B 3WOVA 4UQPA 2ZDGA 1PTJC 1BDHA 5JZBA 3RBAA 4YS6A 3O8OB 2OB1A 5KMGB 1UUFA 3HBMA 2RKWA 2ZSFA 5FBWB 1IN7A 1PJ2A 2QHXA 3PXUA 4LF9B 1Q7RA 4A2CA 1GG9A 1S3FA 4HWKA 3SR3A 3CLSD 5FR1A 4BFYA 3FRHA 5DGIA 4MO9A 2P11A 2PN1A 3AKCA 3GLGB 2Z5LA 4F3YA 4H7DA 1MHTA 5A5FA 1NPTO 2CFIA 2ET6A 1HYGA 1X1QA 4F56A 4FGKA 5KYXA 3VUEA 2JGDB 3ZE1B 2DC1A 5B1HA 4IYRA 1B42A 2DFPA 4GIBA 3ZGLA 5KOHB 2XDAA 4GS5A 4O33A 1FZTA 1X9GA 3EVBA 5AK3A 1FYDA 4ZVRA 1NC1A 1YS7A 1UKYA 3FWYA 2B2NA 3GEHA 1PDOA 1X13A 2A0XA 1RZ3A 2JFOA 3BFXA 1URPA 2R2GA 4XI9A 3LUCA 2WAMA 1X7DA 1T3TA 2WAXA 1WF3A 3AVXA 1XQ6A 4DUZB 5LD2B 2VG8A 1OH8A 2VYNA 1AQLA 1FFEA 1KAOA 2H31A 2XJ4A 1UWKA 1A4IA 2OFWA 3CH7A 1V8DA 3CT6A 2P9BA 4MWZA 2WT9A 3UXEA 3T5BA 1UFQA 1U1GA 2CXQA 3FDIA 4M21A 4AKIA 2JEYA 1AGYA 2DKFA 1NE7A 3JALA 6NULA 1XMOB 3LXUX 5K2MA 1GTRA 1QM5A 5K0CA 1W52X 4V2UA 4DR5B 3MTGA 5BN4A 5CLHA 5L9AA 1QLWA 2ARKA 2WKRA 4EATA 3OBIA 1BVHA 1ZIXA 1ECLA 3CUWA 1L5FA 2JIBA 2QM0A 1GEEA 1P5ZB 4HVAA 4LK3A 1Q6ZA 4LRUA 4MPPA 5AM5A 4BO2A 4F3NA 3R5TA 5IN5A 4P0QB 1Z75A 1VLLA 2GYUA 3PFWO 1Q7CA 4TMKA 2HHAA 5L3SA 4F11A 5DBEX 1MIHA 5ED4A 1MO6A 1CQXA 2QRUA 1W5SA 3CJTA 1N6PA 1LDYA 3ZCRA 1I6MA 4Y3UA 1OWOA 2RAVA 3PXCX 1ISGA 3S7ZA 4R1OA 3RUDA 4GE0A 4XM1A 2DWUA 4L6IA 4BIIA 1M8PA 3ROMA 4ZGWA 1FNBA 3HUTA 1KS2A 3KQVA 3N3BC 2XTZA 3QLUC 1E1YA 5KOJB 1QQ7A 5FXMA 2I1WA 1M6VB 2Z1NA 1BXGA 2G3YA 2Q0XA 4FOOA 1Z47A 1DG1G 1Y3CE 2F6RA 2GARA 2Q1XA 1YE8A 4OBXA 1DMSA 3LZCA 4AWXA 4GRIA 1FTYA 1M1NB 2B6NA 1FYFA 3CXUA 2G06A 4KAFA 4BMPB 1YGYA 2ORYA 4XEHA 4RV9A 2JLAA 4OK6A 1FRVA 4NZZA 4GBMA 3MLBA 1PS9A 3WQSB 2D7DA 1ESMA 2O7NA 5F52A 3PJRA 3GRZA 3TEJA 5DHPA 3U09A 2R9VA 1RJFA 1JYFA 3C4VA 4PRYA 4AJEA 2FN9A 5TC4A 4P33A 4QGAA 3HCCA 3SQMA 5FPTA 1UC4B 4MV0A 4HHEA 1RM5A 1K7XB 2EV9A 3ADKA 4CKEA 5DP1A 5ARCA 4F6CA 3TBHA 1FVXA 5H80A 3JV7A 4BMDA 1LJUA 2C96A 1RI3A 3DDUA 1A5TA 3G9UA 4NHEA 1GGKA 2VTDA 3OE7A 5F2EA 3W2IA 2YXNA 4EO9A 4HYQA 1TA9A 5HM6A 3IVRA 2ZROA 3TMYA 2UZ4A 4YRRA 1UXJA 2V6MA 2AN1A 4BFCA 3O75A 3I5XA 1EQAA 4B3TB 4EYSA 4WCFA 3AIIA 3MMZA 2RCNA 1ZCFA 3JARB 1H2AS 3K09A 1KSFX 5B7PA 3GVPA 4KPEC 4BMXA 3LGXA 1ZJJA 3AF4A 3HXTA 4JP8A 4KFUA 4BLTA 4H1TA 4F5WA 1CULC 4ZHQB 3P71T 2W42A 4BEWA 1YJXA 3PD1A 4NOJA 1KJIA 1NDHA 2O05A 1M73E 3DH0A 3OLWA 2F2TA 4C2AA 5B12A 2J3HA 1WCV1 1SB9A 3UJCA 3ZOKA 3E4CA 3N2KA 1SA0B 4U2EA 4JGGA 3CH5A 4ARZA 1NTOA 4FNGA 4S2UA 4CMEA 3KR9A 4CXMA 2WF8A 4ZAFA 1P44A 4K05A 2GPYA 1NQTA 3I2YX 3SCZA 3T7EA 2QG9A 3ZDZB 2RD2A 1U7OA 2BUCA 5K05A 4IILA 4MVYA 3LYAA 5KDLA 3WKAA 1EFPB 2O20A 1WO8A 4I4TF 2OFXA 4D0GA 2CJWA 2P35A 4PC3A 1JAHA 1TQHA 1ZC3A 3LT5A 4J1SA 1ZPDA 1HFWA 2I2FA 3AY3A 5LBIA 1SZJG 2HJVA 3PEFA 3H1GA 2ECKA 3G1TA 2XB2A 5DN6D 3S8YA 3OUTA 3S2SA 1PWYE 3QA3E 2HPHA 1C29B 3CNOA 3WLOA 5CBPB 5DN9A 2JLQA 1Z5WA 3BBPA 3O6VA 4IGEA 4J0QA 1HSZA 3NALA 5HBGA 3LX8A 1R5JA 4MQ6A 1Z4JA 5JS8A 1ABEA 3L7DA 1I4LD 2QRLA 3FZGA 3JQBA 4JZKA 4Q15A 2AX4A 2PD3A 3CONA 5EXPA 1PFUA 3QBJA 3V8PA 4M60A 2QKYA 2C9MA 3RU2A 1NVGA 2Z9DA 5L7WA 5DBHX 2H7CA 3IOYA 4WOCA 1NQUA 3RFTA 3PUYA 3RS0A 2R65A 2K7FA 2A94A 1K5GA 1WCXA 1F06A 3TW8B 4F21A 1YCDA 3CWZA 1CUBA 1C80A 3HKBA 3OU7A 4CPDA 5LZ2A 3ER9A 2IGTA 2QYSA 3DZDA 4LTMA 1U8ZA 1VMAA 1DKLA 3MGBA 2OQIA 4KLZA 4LJ9A 2AC2A 4BCCA 2D1TA 5JEEA 3S3TA 3LUPA 2WE7A 5E6UA 2G1JA 2QUKA 2OXEA 4KYUA 3FB4A 5EVCA 2IKQA 1EJBA 1FYEA 5D84A 4K28A 3GP3A 1N5MA 3TIGA 2R62A 3QVSA 4B9AA 4BBAA 3JASB 3X1KA 4GKKB 3FUWA 2EFYA 1PVOA 2ZTMA 3F3YA 1V3VA 1XP5A 3QKSB 1GPH1 3ND9A 5ANRB 4AF7A 2Y66A 4M4SA 3EG5A 1WUHS 2C9YA 3KU4A 3J7AC 2HXYA 4X94A 1M7HA 1W581 1PR4A 1CY4A 4KDFA 3EXFB 3SXJA 3DPSA 4II7A 1Q14A 5AKLA 3TGPA 4F3CA 1NJSA 3IE0A 2HD4A 3DP9A 1AK9A 1QC5A 1QFJA 2V8OA 3O4GA 4PVCA 4YMIA 1O5IA 2QQ5A 3U1VA 2NXJA 1U2DA 1NRWA 4MGZR 4GHWA 4P3KA 3JRXA 2XB9A 3BC1A 3MWFA 4OP1A 4PTLA 5B3JA 2Z5GA 3BE5A 5D3MA 4EYEA 3TEMA 2X0KA 3WSWA 3D6VA 3KD3A 3DEAA 1UCFA 4BN0A 1TCUA 4QOSA 5GV8A 5G1OA 1F2DA 2JGLA 4GLFA 2JRCA 2BJVA 1K8QA 1ZJZA 3GC6A 1WW8A 3RH0A 2JNWA 3LQ4A 1P3DA 4RPKA 4X1KB 3ZZMA 4MICA 1ZHOA 3IPCA 2MSNA 3NHLA 2X6TA 1TLTA 1ZOIA 5JTTA 4P2GA 3BCSA 3WNCA 1Z0ZA 3DL4A 3DR3A 2Y0DA 1M9NA 3IA7A 5AVXA 3FFBA 1QRAA 1DVRA 4P22A 1U3TA 1LZLA 3UV7A 1PLLA 2A2ZA 3D3QA 1EH5A 4J6FA 1TX4B 1J2YA 4JBIA 4LDAA 1GSOA 5LB4A 1VIDA 1W0KA 4GR9A 1U1DA 3AR5A 4Q93A 4DPMA 2C2BA 1GEGA 2VPZA 3CPEA 3G7NA 4I3FA 3CHYA 4U39A 5T4FA 1C9KA 1FSSA 4IF6A 3Q9SA 5COQA 3GT4A 3OP1A 4MYUA 4JI2B 1TUGA 5F9HA 4CJXA 2ZRIA 4MQLA 1OLSA 2BWJA 4PLVA 3ZV6A 1Y7LA 2WNIA 1Z2CA 3WE7A 4G8BA 5D1NA 4KPUA 1RXWA 4OP2A 1Y37A 5KEIA 1T1GA 1YHNA 2FOXA 5K3CA 4W5NA 2XCIA 3G2JA 2CHVA 3FG9A 4TYNA 2BZ1A 3Q1KA 5CIYA 3T5CA 1QMPA 1B6RA 2XZTA 1YZYA 2QMUA 4JC4A 4HQRA 2Z98A 2I7TA 5JVDF 4P7KA 1CJMA 1W96A 4UEKA 2PV0A 1G1MA 2IOYA 4WVLA 4EFNA 1NMYA 3EYAA 3H4MA 4DNQA 4N5NA 3NXKA 3EZ9A 1VE6A 2FP3A 1EG7A 1AS3A 1E9BA 1FS6A 2NO9A 4HGQA 5F7JA 5FI3A 4W9NA 1EGMB 3CEHA 1R9JA 1VA4A 4MCAA 4O3MA 3T38A 1IY8A 3H9GA 3ESRA 5BV8A 1OX6A 4KFSA 3H2YA 1XKXA 4KQ9A 4LJAA 2Z83A 3NRJA 1KU0A 2HQBA 4G81A 4JLUA 2P2NA 1U28A 1X1SA 2EWVA 3HWRA 3VJMA 1JS1X 2P65A 4WW0A 5GY7A 3ZDDA 2H4ZA 2KLHA 4P5PA 3SZ3A 4KOAA 2DHDA 3JAWA 3N05A 2GBCA 4I1YA 5AM1A 3O93A 3N2NA 4IZHA 4L1KA 1Z6ZA 3ICWA 3S1LA 4V1CA 4EI7A 1VXRA 3OCCA 1EK0A 1OLUA 5FO0A 1A9TA 3S0JA 1P73A 5K09A 3EEOA 4KE7A 3E7PA 1MX5A 4CCAA 2W0SA 3AOGA 5JADA 1QAQA 4XVRA 1TFUA 3LHIA 1E7MA 1SCBA 4RH3A 2YWGA 3TZKA 3A4NA 3AEXA 3AR2A 3KLBA 3ZU5A 3N9IA 1AY0A 1YZNA 2A1IA 1VLHA 2C5AA 3FCEA 4B4WA 2FZGA 4X6YA 3PXEA 4FQ7A 2GN8A 4O8CA 4EI9A 4RHXA 3D3NA 2K2WA 3PGLA 4QG7A 1J20A 2WJGA 4HG2A 4HL6A 3M82A 2C2XA 4K6HA 3IMCA 4H3SA 4M83A 2HNKA 4Y1RB 3WGGA 3GI1A 3L7BA 2C88A 1XLWA 4HFNA 4J1TA 1R15A 2R4UA 3KQQA 1T3GA 1TM1E 5A4AA 1HT1E 1JPVA 4GPBA 3FDZA 5HP4A 4JJIA 5A5DA 2ZU6A 1OROA 5JNTA 5BVGB 4FW9A 2VXOA 1QG0A 2BKUA 2ZVQX 1NBEA 1IZYA 3GLSA 3HJFA 4IDNA 1B7GO 1JFTA 3KALA 3NWBA 4QXOA 1ZA2A 4J7CA 1MG0A 3WMEA 1MGPA 1QGYA 1W5BA 1LPBB 3F7NA 3PQ4A 4RHYA 3ADCA 3EJWA 3N7AA 5FYQA 3UUWA 3L0YA 2ZUBA 3TSZA 3U62A 1LK7A 5FL7A 3IHTA 4MCHA 2MSWA 1V71A 3GFVA 4KDRA 3OJFA 3IQIX 3F78A 4KMMA 4WZ6A 1US8B 1OJLA 1R8JA 3FSJX 4QREA 5FBLB 4PN3A 1ATIA 2X4GA 3ZKAA 1NXQA 3ZUPA 4EGJA 5F1YA 1L7QA 4OYRA 1T2FA 1TEVA 3IERA 1QAOA 1XYYA 4B3GA 2BP7B 1VPWA 3ON5A 5JI2E 1JECA 1C1XB 1C7JA 1TTPB 2ZJ3A 2ZOSA 1ZD8A 4L4ZA 3RYFB 4O4LB 4FGWA 4YJ3A 4GDFA 2RSLA 1N6NA 3IUBA 4M9CA 4W1RA 2OC4A 5DP2A 1P7ZA 5A3RA 5CDYA 2IVZA 5TB5A 3QMVA 5C5EA 5J47A 2IDKA 2J6IA 3PNBA 4YBRA 3TRDA 3IV6A 2QAIA 3ZKWB 4DB2A 3Q8KA 2AVNA 1LFDB 3TQFA 5AW7A 5AKXA 1ZGCA 4FR2A 1LB1B 3EODA 4N3NA 5CA0A 4B7UA 1NF8A 2Q9CA 4CDMA 4RYLA 3ZCVA 3VI4B 2H2IA 1CUCA 2R2AA 4RX1A 1U7ZA 4Y2HA 4TV9B 1TZKA 1Z0AA 3AHEA 3NO4A 4FZ3A 4M54A 1OV6A 1L5RA 3STXA 3VTZA 5LMZA 2RKBA 5CDTA 4D9BA 2RG7A 4DUGD 2VF4X 4CBVA 3VPGA 1QNFA 1OX4B 4IQ0A 5E7JA 2D2VA 2GVZC 2NM0A 4KHZA 4EW6A 1U2RA 4YUWA 2E0IA 3CF4G 3CTPA 1XD9A 5KTSA 3FFWA 3N2YA 1RE1A 5P21A 4YT2A 2VPPA 1DTSA 1I4WA 3J7TA 2C5FA 2ZFUA 4ND8A 4KR2A 2YDXA 2D4AA 5E6SB 4NAHA 3SLGA 3LA8A 5IWCA 2QDKA 4RW0A 2W6ID 1N33B 5AR1A 3B3JA 5GVRA 4OLAA 4YAGA 1PD0A 3F1KA 5CW1A 3WFJA 4YJ2A 1JEYB 1AHIA 4HTFA 4ALMA 2Q7OE 2PTHA 3M9XA 1VE1A 4BPBA 2EFHB 1CDEA 1A9XB 4XWKA 2BCEA 4UQLA 2D5IA 1G20E 4KWHA 2W48A 4EJ2A 4I1IA 1CUIA 2IQIA 1A5ZA 2VK4A 4D6XA 5LNK1 1NN0A 2RH5A 4QYIA 5AKZA 5JW6A 1YFZA 3WJAA 1YZVA 3UWOA 2GEUA 3FWHA 1WV0A 1KYQA 4B82A 3QKUA 3GFTA 4G4GA 4MW6A 3WWPA 2WSMA 4NPAA 1HFJA 1ISRA 1GKUB 4G1BA 1EZ1A 1EEHA 1CUHA 4GF5A 3TD2A 4RS3A 2WINI 3CCFA 3LHDA 4B6RA 2C8LA 1ZVKA 1MCZA 4HQNA 4PZZA 1NMQA 3JQ7B 4ZPJA 2O8EB 4C0WA 1FFWA 2P40A 1O95A 1GSIA 1Q0ZA 2ES4A 3BIJA 2HGZA 3G5MA 3I5MA 3N6RA 3OA0A 1Y9DA 3T9FA 4FFSA 4WASA 5ALJA 3W2EA 4ZYYA 1KJ8A 5ADVA 1R0SA 2UAGA 4WAUA 5FPHA 5DNCA 2Z8ZA 1L0BA 1YZTA 2BGKA 3HLKA 4IEFB 4OGGA 2Z2IA 4Q3LA 4CTNA 5LQUA 3RYCB 2ZU0C 1V7CA 1Q12A 2DQZA 2VK8A 2VHTA 4FT4A 4UM7A 4DE5A 5I45A 3ZBQA 3ESQA 4JWTA 4QBHA 5F73A 2HWKA 3DWIA 4BX8A 2Q5HA 2G17A 3FVTA 3WLMA 2O0MA 3KYJB 2RGNA 5HKKA 2VHZA 4U6QA 1U2ZA 1KPHA 1UZLA 5AI0A 5F51A 3W7VA 1NXXA 4BVKA 3WBKA 2X58A 1PQ4A 4N3GA 2CLSA 3LKBA 2Y92A 5EZYB 1LLFA 4I55A 3TLGB 1Y3DE 3VHXA 3EBOA 3HSYA 1KZ4A 3IAHA 3L1JA 4QJIA 4HWRA 4YUVA 5KX5F 4F60A 5EZSA 4MAAA 5K4AA 1TYEB 1V7ZA 2B4AA 2QROA 3RAPR 5IYZA 1UDAA 2VQDA 1TC2A 2DFVA 1V26A 3P0FA 4U0KA 1JHDA 4HY3A 4DLXA 1F7VA 3UGQA 1CUSA 3G49A 5EHZA 1M2WA 1NU6A 1WA5A 1P1IA 2PS1A 4OHUA 2FPWA 1CF4A 4QASA 3KQPA 2EKBA 1LU9A 1GRRA 2JFXA 3EBPA 4QPPA 3GLGA 4BNIA 2Y6VA 1IQPA 1XZLA 2OECA 3EBLA 3C7TA 3LUKA 3QLVC 3W5UA 4EFMA 1EFHA 1OI7A 3EARA 4G5XA 2GEBA 4JK3A 4N5MA 4ZC1A 5DCUA 1VFPA 4M49A 1VKRA 3OOEA 4II3A 4A5OA 4EG7A 2G77B 1A4UA 3C43A 3K0CC 3F46A 4MB6A 1GQSA 5F2NA 7AT1A 5KX5B 4DR4B 2EF0A 2C7BA 2EL9A 2ZRBA 3BWEA 3FKQA 5BN5B 4RO0A 4Y6PA 1T8PA 1U0HC 4ZHSA 4G23A 1FLAA 4TMZA 3ZGNA 1N6HA 1N5OX 4L8WB 1WX1A 1JZTA 4QTZA 3KYDA 4IHAA 4C6HA 3FTNA 4LHWA 2ID4A 5EGNA 2HCBA 4DXDA 2VHJA 2WOOA 1I2BA 3C97A 1G4HA 1U0GA 2WZBA 3BHJA 1G7SA 5DCYA 1XEWX 3L92A 2ZYUX 4LJSA 3T7CA 2WU4A 4CMIA 5FFNA 2A9PA 1C1DA 1EXVA 3PUIA 1WG8A 3BXGA 4RTMA 3BWDD 3C6BA 3HDTA 2R00C 1XZGA 1XZNA 1B8NA 3LKZA 4NYJR 3F90A 2ZT6A 1CZUA 5TPWB 2BZGA 3H9CA 3S7TA 2NUAB 4N03A 3EH2A 5DNEA 1PN3A 4C0AC 5J40A 3DPUA 1BIFA 3OOJA 2E9SA 2ZREA 4MVJM 3IOCA 3IDOA 3Q2KA 2X40A 4HUQB 1T3SA 3EFEA 3O74A 1PEDA 4BVFA 4DCCA 1TFRA 5F98A 3DXYA 2OBFA 1HL7A 2X5JO 1S9DA 2XWPA 1L4NA 1TC1A 2G1UA 1Z08A 4MMXB 3GFGA 1DAHA 2ZKIA 4LKRA 3VM6A 1WHTB 4BNYA 2COKA 3I2JA 5LA6F 1O5OA 2CVOA 2PA0A 1K5HA 2DFDA 2VEDA 4Y9TA 1EX9A 1Y80A 3OU6A 4EFLA 1D9XA 3RYHA 3TM4A 1GAEO 3UNXA 2JGRA 1VJ0A 2LXNA 3DCNA 4UHJA 1OLXA 3LBNA 1I7PA 1DKUA 3C7CB 4P2BA 3P2KA 1PL8A 5GM2A 3R6GA 1P39A 5A71A 4QAJA 2P6RA 1W5TA 1QYIA 1NU8A 4HI0E 4R8MA 421PA 2RHDA 1AKMA 4FDTA 1M34E 2IW1A 1ORDA 3ZYZA 4A2WA 1V16A 2P6NA 2QX7A 3GMIA 5I7VA 5EE0A 1KDRA 4JQOA 1CJBA 1V41E 3UEOA 2YVAA 5LA6B 5GJCA 1QFMA 1UKZA 2N75A 3SYMA 5IF9A 3QE9Y 3SKYA 4QM6A 4EZBA 5HKLA 1F4LA 3KOYA 1KXJA 2EX4A 1PG5A 2ADFA 4N0DA 3P9RA 1KZ1A 1DELA 4ERXA 2I4RA 2F9FA 4LQDA 4BNJA 1Z6AA 3LPMA 821PA 2XKKA 3V7FA 1C9EA 4KYVA 1MHPA 1NONA 5SYAA 5BNWA 3ZY3A 4QPJC 4Q5IA 5LQCA 4OMFG 4J0CA 5AK6A 4OI1A 1E3JA 7MDHA 2WLSA 3WZLA 1RI5A 4KR3A 3EVNA 1JLSA 4CM4A 1XTIA 2ZE7A 4KUGA 2FOIA 4QQ8A 4ARAA 2IY9A 1G16A 1XI2A 1M72A 3AF3A 1BMFA 2GR9A 1QIGA 1D7OA 3KTFA 3WGNA 2ERXA 1RYFA 4EGAA 1BO6A 5KU7A 3F3MA 1XLTC 4ZHQA 4JBGA 1KH1A 3KE8A 2F67A 4PYMA 1OVGA 1SG9A 2F17A 4QT0A 2A0KA 1A5AB 5H70A 3L9WA 3SOPA 2QK4A 4I08A 2H0QA 2PA3A 1CNEA 1DQPA 1FOEB 2AUNA 2GN9A 3NDPA 4M0MA 4DMKA 4ENVA 2G4LA 2ZATA 1XFAA 3D3JA 5H9VA 4CCYA 1G5IA 2WWTA 3ZVMA 1N1EA 1A9PA 1UT6A 5IHXA 2ENWA 4ANFA 4AS3A 4CKWB 2VBCA 2AVDA 4LXTA 2PBRA 1VQ1A 2GZ2A 1D4ZA 4Z4HA 1D4FA 3TNFA 4I6JA 2YMPA 3DAPA 4CL0A 1XU9A 5D2CA 3BMCB 3KTAB 2YJ6A 5FF9A 1F38A 2E48A 3O91A 1CZLA 3ESCA 3KZMA 2H2AA 4LBZA 4Q9AA 4GPAA 3KVRA 4TGLA 3I6ZA 5CBPA 3LFTA 1CR4A 3JZDA 3KRTA 1E9AA 1X87A 3BKWA 5EPEA 1JBEA 1DCMA 1PK7A 3SAJA 5L95A 2XODA 4FNOA 1JLLB 3W5JA 1QPBA 2IH4A 1PEAA 2BFFB 3OX4A 1FJXA 4BRWA 2FG5A 1USKA 1CHNA 5CXXA 3ANTA 4ZTZB 2YIDA 4IRXA 3JQDA 4B87A 4BLOA 2WNSA 3WKEA 4J9VA 4PG8A 1M0EA 3FF1A 4QUJA 3P5SA 1ZH4A 1TJ4A 5ALGA 4M86A 1DUVG 2CZQA 1Y63A 2VUHB 1L2TA 3PE4A 3Q6MA 4A8JC 5K8JB 1Z25A 5AM4A 1DCTA 5A0TA 4OQXA 2M9MA 1OU0A 1KOJA 4YRIA 4Z3KA 1FB5A 3PFHA 4ACAA 2DY1A 3OCYA 4AUMA 2C9DA 4G1CA 1I7SB 4FQ8A 1DC5A 1IBMB 5IT0A 3SM9A 4G0UA 1TOAA 5JNWA 3MEQA 2DG2A 3OUUA 3NOQA 4J2HA 4P32A 4R0VA 4BNXA 5BSHA 1V3TA 3T9CA 1PQYA 3BDAA 3HCPA 4X0EA 1TJPB 2BLNA 2KM1A 3R3SA 3LC0A 1WB4A 3AYZB 2O06A 3DZJA 4J49A 2ZZMA 3UT5B 5A03A 1YI0A 2AGVA 4GKAA 4J6EA 2YFYA 4EVQA 4YP7A 1WB9A 5LOVB 1JEQB 3VI3B 1J1ZA 2WIFA 4UTZA 16PKA 1R8SA 1S3GA 2OQVA 2G76A 3IPLA 5JECA 1T1SA 3KFLA 4NOLA 3NKLA 4Q1CA 3X1DA 3BRCA 2I6UA 3MFYA 5IK2A 2O7RA 1ZSNA 1YBHA 2WYWA 2GEDA 4UCFA 4BB9A 2PK3A 2YWDA 2D74A 2VDWA 3LNCA 1P2FA 1Y8RB 4K9RA 4MW4A 4WL0A 3ZNQA 1VRCA 2RK4A 2XHZA 4RVDA 4EHJA 4HDKB 4UMFA 1VJ5A 4UD2A 1JQ3A 1XK6A 2PRJA 2WJ3A 1IB6A 2C4VA 3F6CA 2OFFA 2K2QB 3Q72A 1XMIA 4XJTA 1PGOA 4BRSA 5MFPA 3PR1A 5DM70 5CURA 4XVHA 2BHTA 3L0IB 3PDCA 4L6AA 3TQQA 1N57A 4OX9B 3WGIA 3JQAD 2Q4BA 4H7HA 2WVAA 4CDGA 1XCMA 3LDGA 4H77A 5AI4A 1JE0A 1WMEA 2GKSA 2AE1A 1MOPA 1AUPA 1CS4C 1NYTA 4N8DA 5T3UA 3NEAA 2FFJA 1OKKA 2IK8A 2ACVA 2GWHA 2LD4A 2OCPA 2IZ1A 3L7LA 4FNAA 4N1AA 1ISIA 3U4HA 3NIBA 4R3WA 4EA7A 4AJHA 4L9RA 3WMWA 1WETA 4YMSA 3HY6A 2AOUA 1P4HA 1ZGGA 1W49A 3NIDB 5JJ5A 3I76A 4NCXA 2Y93A 2HRBA 1ZI8A 1FP1D 4PRLA 4F96A 1KMHA 2IEGA 1ZKDA 4ZQBA 5FD8A 3EQ7A 2C7PA 1I8TA 1T29A 1ZGHA 2JCBA 4UPEA 1Q1BA 1SXPA 1PJAA 4BFLA 1VGVA 3GV0A 2H3EA 3OHMA 4PG7A 4EAAA 2CYBA 4S1PA 3I5UA 3IUPA 4D4HA 1OPXA 2UYOA 2WZCA 2J6CA 4QU9A 1BWQA 3OX1A 4EWLA 5JJBA 2Y1OA 4RLSA 4WN3A 5L8VA 4EHIA 4LZWA 5KYVA 2FVYA 3KQUA 2DKNA 4X1YB 2KS6A 1Y5NA 1P0MA 4OHOA 4HAZA 4B81A 1ORIA 1XEXA 2AD1A 4G5SA 2GRAA 1V8PA 4IZ6A 1KO1A 4MINA 3PEVA 1GNTA 2H18A 4BCDA 1WWKA 3N0TA 2I8CA 2JAQA 3M5DA 2ZCVA 3AR8A 1X94A 2TMYA 2ZDHA 4J90A 4XH9B 3ZBTA 3EIUA 3PL5A 2H4FA 5BNFA 2GUGA 5JDIC 2VJCA 5A9TA 4OATA 1NY6A 3UUEA 4J0EA 4MHSA 2Y67A 1E3SA 3KB1A 3KJFA 1JPUA 1F8XA 2P8JA 2VJAA 1S0UA 5EXSA 5HBRA 5IM5A 2VAWA 1CQJB 1JF8A 1FFCA 3BX1A 4TMFA 4WXHA 5FA5A 3TEFA 4L5BA 4ENSA 1V11A 3G2HA 5HJEA 1RI1A 4FJ0A 1QVZA 1JH8A 1LSSA 4ILKA 2HCRA 1F9AA 4GM4A 4HDSA 2QXUA 3P9KA 1T8YA 2EAUA 1MGOA 1ZH8A 4HFMA 5FAXA 3UHJA 4Q9IA 3LH5A 3ADDA 1C41A 1N0UA 5A7HA 4AXXA 4I46A 5FL3A 5BWNA 1ML3A 2PX3A 1GZ7A 1KPGA 3C3XA 3QH4A 4Y6LA 1ZJ6A 2OZEA 4FN4A 3GFFA 4YO8A 2RHGB 1PT9A 1PV4A 2IBTA 2FXIA 1V9CA 1PV2A 4PPFA 3GLUA 2HK6A 3K5PA 1PYGA 1E4VA 4IIJF 1VSQA 4URYR 1VL1A 4XRGA 2FKNA 3CKMA 4R8LA 3IIIA 3CJRA 3HA3A 4QT4A 1HR0B 1ESCA 4D9KA 4INAA 5EWMB 5MGBA 4Z9AA 5JY1A 2OBMA 1AUVA 3RBXA 3TTYA 1RBMA 2ERCA 4K5QA 5JYBA 3H8WA 2QV0A 3NHJA 2XGSA 1JJIA 3DLPX 1I2MA 1IAQA 2CBZA 2WD9A 2Z4RA 2B1QA 4WI1A 2HC9A 1CUAA 2QE7D 2JJ1D 2Q1TA 1TIPA 1K5DA 3E2PA 4UMVA 5FWXB 4KQEA 2R0QC 2AQKA 2IP4A 4BFXA 3DO8A 4E51A 1ITZA 2CNNA 1BROA 1IZ9A 2CL5A 2ALJA 1VPVA 3VVCA 1WTCA 3ECAA 3NU1A 3CNNA 1LQ2A 2QRKA 4ROTA 3VRHA 3EPLA 3KJGA 2QNIA 3GA0A 3BB1A 1N0VC 4HBZA 3WXBA 3GXOA 3PHHA 5AW3A 3RJMA 1WAMA 3CEAA 3DXZA 3I52A 1ZNXA 2IELA 4NJEA 2F64A 4BB6A 3TKAA 1PDWA 1PVDA 2GAJA 2NYUA 5FB3A 4OGKA 3U4AA 5KQSA 1C0PA 4GXRA 2DPLA 4RSMA 2V3CC 2BP7A 4FNMA 4WRRA 1C1XA 3CYFA 4MYRA 2WJPA 3B9RA 1SK9A 5BUCA 3T61A 5B6IA 4RIIA 3AUKA 4K8RB 2AN4A 2YKGA 4UQOA 4D2IA 3IQFA 2REQB 5U9CA 2J30A 4LZLA 1GG2A 2FJ0A 3AFGA 3DONA 4Q3DA 3AG6A 4U7TB 5CA1B 3OLVA 4OHZA 1OIVA 3H83A 1O5TA 2D00A 1NW5A 4LRQA 2A9FA 5LQSA 4ADSG 4TROA 1NXWA 4TQGA 1NW8A 4QOIA 2Q6OA 4HPXB 4WKGA 1SWWA 1WZNA 3T0GA 1GGJA 2QJFA 5DW0A 3VOSA 3T3NA 3AEKB 5EUCA 4LPSA 2GF2A 3FZYA 4H7IA 3BB3A 3E84A 1A2BA 3AI3A 3KT8A 4I2NA 5HS4A 2E6KA 3HRKA 1V5EA 1YE3A 4XCVA 4PNEA 3UATA 1YDWA 1TO1E 2BBWA 2VHXA 1HGXA 1QIHA 3AY6A 1QVWA 3I45A 4LY3A 3SZLA 2WD7A 5HX7A 2OG2A 4M0PA 3RABA 3D5TA 2G1KA 1XZIA 1H65A 5FTJA 3UANA 2PLRA 1ECCA 2GKGA 2ZW9A 4E6PA 4QECA 3RK0A 3CSSA 3FNHA 4WNCA 4D44A 2FXVA 4H08A 2XA2A 3IS3A 1QIDA 1RM3A 3CIOA 4G97A 4BE9A 1XDWA 3QF4B 5IMBA 5FV4A 2I1QA 1L5VA 2Y27A 1U0BB 1PUJA 4EPTA 3U1BA 5JNSA 2WMNB 4ZT7A 1JEYA 5BUZA 5KWIA 4E4RA 4O5OA 1AS0A 1V1MB 4ZVPA 2FQQA 3ESAA 5K20A 1E0KA 3PDWA 3PC8C 5LPNA 2BGGA 2O4UX 4KPGA 1B0UA 3L93A 4R6WA 5AI9A 4YRCA 4XB1A 2P3SA 5ALWA 1K63A 3ESBA 4WPGA 5AKIA 4RPHA 4D9NA 3NBQA 4I5DA 1JZQA 2I34A 3EF1A 4JBLA 4U2GA 3SIPA 1EXNA 1VIYA 3R7WA 2MSEB 4B3HA 4YJGA 4DIDA 4FYPA 5TF0A 1D5CA 2RH4A 3RUEA 4D9FA 4YPOA 2H1OA 4CGZA 1KYTA 4KWTA 2GX6A 4UNQA 1ODIA 2G40A 4UD6A 4B83A 1ZNWA 1C30B 4PPGA 3U31A 2AS0A 1XQYA 3R5JA 3O8LA 4ZN6A 2H00A 3A9TA 1C5KA 4OLFA 1JHUA 1Y1SA 4RC9A 5DWVA 1RPTA 1YB2A 4BMOB 1UFKA 3FCSB 2PJUA 3QPVA 1NSTA 1K6JA 1NI5A 3S70A 4D9IA 4A8TA 4DMLA 2DP4E 3GY0A 4CWAA 4B71A 1AKWA 5HE9A 4MTLA 1Q7GA 2VJQA 1DO0A 1SIBE 1C4KA 2G71A 3FNGA 3ZHZA 3RVQA 4ZOQI 1D1SA 2RIRA 2GD1O 1VE9A 2B1GA 3GLHE 2BHSA 1CB0A 4QA9A 4GDMA 1Y9JA 4ND1A 5H8WA 4PSVA 1P29A 1M2VA 2JFZA 3SDZA 5JC1A 1OPRA 3F6EX 2NQTA 5B1IA 2HRDA 3RS2A 4ZKEA 2BGTA 1ZYUA 3ZHXA 4G8CA 4PN7A 1G3UA 1BXRB 3U6KA 4K40A 4FBGA 1H2FA 3R41A 4UTRA 2XCRB 2EXXA 3JAMA 1PT8A 4IVQA 3I5YA 2FEXA 3WA7A 4FM9A 1DX9A 2CHUA 1LVUA 2FDXA 1H66A 1GHTA 1OXTA 2QTHA 1ODSA 1RVV1 1ZBQA 3IP6A 1I1NA 5FOXA 3VR2A 4A2QA 1T2DA 2VDVE 3R4CA 4WKBA 2HNBA 4IH4A 3RD5A 9LDBA 4KQ1A 3MTBA 3PHLA 4OBBA 3HSSA 3LKVA 4O59O 2CXTA 4UVIA 3LY8A 3WYAA 5LWQA 5LP6B 1O94C 2BMEA 3CZPA 4WLEA 4CU2A 3NPMA 1RJEA 1E3WB 2H07A 3U4GA 4B80A 2O5VA 5KTTA 4E08A 2H0RA 3WLKX 3GLRA 5KSOA 2BFEB 4QU5A 1YRQA 4BYGA 1IM2A 3FTFA 4GMFA 4O4IA 1TNDA 1RTKA 2QS9A 1J5XA 1QGDA 1T1IA 3QPAA 1IOWA 2WY2D 3ER6A 4BX0A 4HGOA 5MN4A 3A0RB 3A1CA 3GLFB 3DE3X 4PSKA 3WYGA 1JA1A 2CMKA 2YASA 3T4XA 1ULHA 5DX1A 1VI6A 3V2GA 1XE3A 3JU3A 1GUFA 1E1CA 1VB3A 1UBTS 4MYHA 2WKPA 1BH6A 1TJNA 2W6CX 3QYAA 5DHTA 1Q7EA 2G9VA 1J42A 3P9NA 3REGA 5BV1A 2WTNA 9ABPA 3DE4X 3GT3A 3CNHA 3NM5A 1LBSA 4FK8A 4Y2UA 2OHIA 1GPMA 1YIDA 4G5QA 3MWDA 1BX0A 3Q7RA 1S9HA 1KGDA 1YQGA 1P2VA 5K3FB 1Q22A 1LVGA 2PFGA 2ZTVA 3LOPA 5TPWA 2D2XA 1E0AA 3HBJA 3PGA1 3WGKA 3GAMA 3KKNA 1IRXA 1FMLA 4PSUA 4YMUA 1MAAA 2VOJA 4HUQA 1FDUA 2JATA 5K4GA 2BKAA 2HQOA 4C3UA 1BEEA 2BEUB 1LWNA 3WGTA 3N75A 3NVKI 4XAQA 4LHYA 4RFSB 5H3HA 2BE9A 3BGWA 5DH9A 4LSWA 5FTNA 2VHEA 1Z2OX 1DAPA 2V0NA 3T1OA 5A1TA 3J81k 1NOKA 2H1RA 1VGRA 4B7XA 3GH1A 4QQNA 2BGRA 2YYYA 3AHGA 3OQ1A 2YQZA 3PP8A 4RKFA 1NW7A 4OB6A 1AS2A 3FVQA 1WLSA 3DPIA 2PKCA 2VT2A 2J5QA 4WV3A 4K9SA 4MROA 4O8ZA 2Y6UA 4FYWA 1IHOA 2VCHA 4ZQFA 1GL6A 4LV8B 3A9WA 2RHBA 4JX8A 1LBHA 4RD3A 2Q4TA 4PPQA 3WMRA 1A7AA 2JIOA 3HKCA 1JWBB 4IIBA 2FRVA 5DXJA 4CG3A 1CX9B 4KR7A 5I8WA 2EC5A 1E6CA 3TYXA 2Q2VA 1KARA 1JKXA 3A25A 3CQ9A 4Z99A 3WJ7A 4EB8A 3PKIA 2H3HA 4OCZA 3CLRC 1D03A 5FPQA 4GRAA 3VMFA 3NHFA 1XPOA 2VPYA 3A1VA 5J63A 1BE0A 4PHTA 3CN7A 3MCTA 2O8BB 1XO1A 4CN8A 1U02A 3AM3A 3GJ7A 5T41A 5DT9A 2H11A 2QUAA 4XE5A 2PU5A 1SAYA 4KV9A 2HPZA 4WT7A 1SVNA 3GAAA 1SKUA 1VYUA 3G1UA 3AFOA 4OHWA 3RSLA 5TSDA 1QCYA 4F04A 3L2OB 1JJBA 3KPWA 4KITB 4ZVQA 3E22A 4L08A 4NDZA 4XTRA 4JQCA 4NG5A 4GZ6A 1CUVA 1S1MA 4OM8A 2IXGA 3AV3A 1CRQA 3P96A 4KXLA 1T3LA 3U7FB 3BL5A 2VO1A 3HJAA 5IJZA 3QU7A 3QXJA 4O4HF 3SS8A 2OM6A 1KDVA 1Z36A 1Z4LA 4HGNA 2YTZA 3CX6A 5IVPA 4CFZA 4ECAA 4MKFA 1SCAA 3OZGA 1EPUA 2Q99A 2WIKA 3W90A 2HWUA 4AZTA 1IDN1 2VP2A 3RRYA 5B4VA 1NX9A 2FPPA 2R8PA 3KTOA 3OTGA 2HU2A 2IPAB 3KWFA 2QNBA 4ER0A 1J5EB 3JYLA 1KMNA 2H51A 2XEXA 1VSBA 1HE5A 4O1HA 1N5DA 1PR3A 1UMKA 5ALNA 4ZU3A 1AH2A 3G6WA 4CN9A 3IOMA 4K0RA 3PUHA 2A78A 4IIUA 1HEUA 3R44A 2YIVX 2QTCA 2XUGA 4QO8A 1H2WA 1UM9B 3QJYA 3E1SA 4K2AA 4LGVA 3IUMA 1U8YA 2QTNA 3CT4A 3KQYA 3UB3A 5E4JA 1WQ1R 3P2JA 1MH1A 3FFAA 1X7WB 4WWHA 3NFYA 2PJRA 4ZVUA 1RAHA 2D2IA 1E3MA 2P41A 2QGFA 4ZI2A 5C2JB 1YVEI 5DU2A 4ZU6X 3D2BA 3SF8A 4LVCA 5CFPA 2C54A 4XCXA 4GW3A 5T4EA 3V6MA 4JJ4A 1Z82A 1DC4A 4TS4A 3PFGA 1K98A 3OIUA 1GFWA 3U9LA 4DCGA 3ZIAD 1U5BB 2CV1A 2ZRLA 3B1WA 3DKVA 1KO8A 1IZ7A 2PRKA 3BMQB 1NGSA 1TL7C 2QR5A 4NWIA 4E46A 2B7CA 5KYWA 1W7AA 4MLPA 4X66B 1WY5A 4BY9E 1WPRA 3FM9A 1POWA 2YY5A 1JLLA 3JY6A 4MLDA 4YROA 4ZCRA 2WIDA 4L9SA 3RYTC 1G3QA 1R3UA 4LNUB 3W4JA 3PRJA 1BEUB 2AFHE 3JSAA 2ADOA 5A4JA 4IZOA 1M8FA 2XOKA 2E82A 3ITKA 4ND6A 2PD6A 1KI9A 2UVDA 2YRWA 1AGNA 2WJHA 4G24A 2VRWA 4U7HA 1DOAA 5DW3A 1II9A 1QIKA 2VDQB 4MOWA 3GWZA 5H16A 2Q3MA 3PX2A 4D8XA 4YJ2F 2IS2A 3FVVA 1OI2A 2B3DA 2FSPA 2ZI4A 3Q2OA 4JC0A 2GD2A 3ZZ0A 1OT5A 2C2MA 2IE0A 3GRUA 4R2KA 3CV3A 5JRZA 5IC4A 4NU6A 3C6QA 4HNTA 3LP6A 3T54A 1E6WA 4QU0A 1T6ZA 5JXWA 1WMDA 2J9GA 2VYND 3N8HA 4HDRB 3PE3A 4CDNA 4D0RA 2IIVA 3F7TA 3I1IA 4S12A 3HVRA 3HCNA 5G0UA 5TEWA 3COYA 2GDJA 2NVWA 3VX3A 4G2NA 3CF2A 3LC2O 3OEYA 3SDBA 2OKCA 1GIAA 5HJ2A 1RBZA 1UWLA 4RULA 3N8DA 4FFBA 1LF5A 2VNJA 3ZEIA 2HGSA 1FEZA 2XY4A 2IYFA 4BNUA 4Q4HB 3ZTYA 3R9KA 1Q17A 5AVZA 4CRWB 2QZPA 2DFLA 3UMJA 4FC6A 5J23A 1RADA 3I0NA 2GZSA 3G5UA 3K6RA 4ND4A 4A03A 5INTA 1Y5RA 2WWGA 3A3PA 4DLVA 1KKUA 1KAQA 3I30X 5J1TB 3SZUA 2O9JA 3L0PA 4REMA 1ZJYA 4FX5A 2NQ2C 3L18A 5GM1A 1KHTA 1RKVA 5G0WA 4F2PA 2EGUA 1IVYA 4H18A 3TJMA 3DT6A 1XYGA 2H2WA 4X8HA 1I6LA 1MA3A 1ONSA 4KR0A 3CA8A 4CLRB 1W5AA 5CM9C 2W2KA 3HFRA 4YRZA 1IAVA 2DJIA 3WWZA 4RQAA 1W4LA 1HDOA 4W8HA 1JXMA 2NO7A 5KCZA 3FKJA 3H6KA 2GA9A 2FCAA 1CTQA 2V7WA 1V7PC 3FBWA 4ZAZA 1SGWA 4S35A 3MT8A 3ZLJA 2AOTA 3RC7A 4DCPA 2OXCA 1JR3A 1L4LA 1B14A 1N5LA 3IBGA 2F1HA 3X2EA 3K3PA 3KIPA 3TNLA 4Q3KA 1EYZA 3BD8A 1VC2A 2E5FA 3IP7A 4CM8A 3AI2A 4C7XA 1EUZA 4AWBA 1B0ZA 1I14A 1RSZA 4Y1FA 4ES6A 4R1MA 3CVWA 4RD6A 1IUNA 1QKKA 3KQNA 2HZBA 2IZ5A 4RPGA 4XZ3A 3ROKA 1UP6A 4YCSA 1A7UA 1J0DA 2WU0A 2D7CA 1L6IA 4HNSA 4URUR 3R75A 3OE7D 1YB4A 1GUYA 4LHVA 2NUTA 3ZQKA 4DV1B 1S2IA 2G08A 1U0OC 2BBSA 2J9FB 4I1UA 3AZPA 3CSUA 2AD5A 1UC9A 1WDLA 2POCA 2XHEA 2XZLA 3JD2A 1RYYA 5TF4A 1V8ZA 1RP1A 3GOQA 3KSDO 5C46F 1QF6A 1II8B 3IBCA 4E0BA 2OXFA 5JNLA 5JSQA 1T8TA 1L8OA 5KYNA 4FGJA 3OM9A 3ONFA 3AY7A 4I99A 2W0MA 4HNQA 3ETHA 3SEAA 3DFZA 1IULA 3KZKA 2GM5A 3SC3A 3H6GA 3AJEA 1G5RA 3LECA 4FFMA 4FKBA 4NOKA 5CJ2A 3H5OA 5DYYA 4I9UA 4MB0A 1GAXA 3PQ6A 2FH5B 3AKYA 1V4VA 2A35A 1R7RA 2GBFA 3OOHA 3VZCA 5J5CA 3EC7A 1MO3A 1AZTA 2QRVB 4DIOA 4Y2YA 4R69A 2WWVD 3WL8A 4FZRA 4RU1A 1FS4A 4YXFA 2RFLA 4ER5A 4DLWA 2ZJ4A 2J9ZB 3BKXA 4EB0A 3WYCA 3TPZA 1MDBA 4CL3A 1YJCA 4UHDA 1ENOA 3Q9NA 3TZEA 1ZP6A 2Q5OA 3MN1A 2ECOA 3BXXA 2LRHA 4JH0A 4PZEA 1THGA 1XB2A 2E4XA 3NLLA 4OXNA 4X62B 1ACMA 1E2QA 1JHOA 2UVQA 4Q24A 4CEJB 3UH1A 1SU6A 2E49A 1E2EA 1K8RA 2VUUA 4KQ6A 4BJHB 3EFBA 2OYSA 2FSVC 3AJAA 1PT7A 3WL3A 3FPGA 3VZQA 1K86A 1MAVA 5A4FS 4IZIA 2JFYA 2CKMA 4TM7A 1ENYA 3LGSA 3OPMA 2ZYVX 5KHAA 2RBKA 3TK1A 5A4KA 1HDCA 1KJZA 2IHZA 3KOOA 4YT8A 1YOBA 2ZAYA 2PKYX 2R5NA 1VFNA 3I01M 3MQFA 2B94A 2QTRA 3T3PB 4DEVA 4LK2A 4M98A 2H29A 1YC5A 3BTSA 3H16A 4LXIA 5DWDA 1UT5A 2CK3D 4CEHA 4JBNA 5A5EA 3AFHA 1SXJC 3CF6R 2L19A 2OCIA 1N9ZA 1ACLA 1OXKB 2AZTA 2MSLA 2NPIA 2X7HA 1Z7YA 3UHPA 1H1LA 2AHOA 2QYTA 4G4IA 4RA6A 2RMKA 1FF9A 1EX7A 5ALZA 1KJJA 5I7SA 1WDTA 3GCGA 4W5RA 3DBIA 3T7AA 5IFLA 3Q3VA 2FPSA 3EUWA 1W75A 3BH6A 2IS6A 4NS4A 2Y4NA 3GZNA 1Y5LA 4DDKA 3CUKA 1QR2A 1A95A 1GTJ1 3ONDA 4EW2A 2FWIA 5J3JA 2VIIA 5HKAA 3EFOB 1L5OA 2ZAOA 1T4CB 2XEDA 3O83A 1ZNYA 4CV1A 2LKDA 2XMQA 5LU8A 1A4RA 3K5WA 1JU4A 4I81A 4INZA 1QIIA 1CZKA 4G3XA 2BI7A 4TLCA 4OHKA 2JAHA 4KTTE 2HJSA 4EQ6A 3RBVA 5H59A 1UBRS 3WGYA 3QX8A 1X0VA 4RXUA 4YHBA 3DV0B 1ODJA 4ETNA 2JH8A 1D3AA 4DQVA 2RHHA 3MMNA 3QVXA 2QTAA 1F6BA 2ZSJA 3L6BA 4BX9A 3A4LA 4D99A 1WZIA 1CQZA 3UIEA 3M9LA 5B6JA 3O2NA 5T8KC 2ZJ1A 2HMWA 1PGNA 3AEQB 1IBKB 3ETEA 1MVOA 3NFRA 4HXYA 5JAZA 5L53A 2LUOA 1JLRA 2WJZB 3KKKA 4IBOA 4MI3A 1D2EA 1F2UB 4NG4A 4QRIA 1WNTA 2F3SA 3CUUA 3M7IA 1OUMA 2QMOA 4XDHA 4EARA 1GM5A 1DZ3A 4GFDA 5F9FA 3LNTA 2BEWB 3U3OA 3U3DA 2G0AA 1UAGA 3B6ZA 3M6WA 3ENNA 2QPAA 1WEKA 2FQXA 4MW0A 1RCTE 3ZDXB 1G8YA 4B3CA 2QRHA 3DFKA 1G41A 1FTNA 1N7IA 1N2CB 1W0KD 2XMGA 3B9BA 4E88A 3L5KA 1CP2A 1S8AA 2XNDA 1DZIA 4OL0A 4BWVA 3B1KA 2QUJA 1EU1A 1ABFA 4HXFB 2P62A 1OMOA 3AO0B 3ADOA 1PJCA 2X9NA 4DEXA 2OENG 2R5FA 3EDYA 4GMXA 3WWEA 1UJMA 3CRQA 3DNPA 3ZHVA 4U2FA 2PWPA 3RUPA 4DNPA 1JH9A 3H99A 2M6KA 4B6FA 3DBLB 3L02A 4KUHA 1UBGA 5BPFA 3ND8A 4RXTA 4X63A 3KQMA 1R4AA 2DULA 2BH9A 2XUOA 2HJ9A 3WQRA 3TG2A 3WMFA 4TN1A 1Z8HA 3AGPA 1V5GA 2CLMB 3IBSA 3IILA 3UAWA 4A5SA 4UEJA 2NU6B 4B3DA 4DEYA 1FIUA 5K8VA 2FFAA 5HIAA 5C3MA 1W36D 4ETWA 2RJ3A 3HJUA 1PKEA 3KJZA 4JEHA 4Y2VA 1UMBB 1IFXA 4GYKA 5FTMA 3OFKA 3D8SA 3R3VA 1YOVA 4BKPA 2Z2YA 3AHHA 2ATCA 4C6TA 5I7OA 1O0CA 1MW8X 4PIVA 2JI6A 2HLNA 4EKDA 4ZYWA 1KL7A 5J59A 1PFKA 4MUAA 1ZN8A 2C0QA 2IUEA 5D1HA 1ZO8A 3KOXA 3E5HA 5JV5A 4AUEA 2XZDA 4KN5A 4TSFA 5K6AA 1E1RA 2I2WA 2QT9A 5DI9A 3KQHA 2EGGA 2FDRA 3W5VA 3HJCA 3DMTA 4FOTA 4I5GA 2VBIA 3TI7A 2FN3A 3HYRA 4OYYA 1RKQA 2OYCA 1CY6A 4BHTA 2J0SA 5J5AA 2CV2A 4IOLA 2XPCA 1RYDA 5JBIA 1T0JB 4RSHA 2WF9A 1W0JD 2IV2X 2WJIA 2A5FA 1M76A 4ZJPA 1XTPA 3T5PA 3ORRA 4WKNA 3F5MA 4M36A 3OHSX 1HSOA 3H6HA 2QN7A 1P45A 2NV6A 1X1AA 3VR6A 2VZ8A 2B99A 1IPFA 1SUDA 1U65A 2G7ZA 4LQLA 3HCBA 1KDYA 4BNFA 4EA9A 1Q1NA 2VNKA 5DF1A 3G7SA 3K16A 4BDTA 5I9IA 2WJAA 1R74A 4B6SA 2WMYA 4RK7A 4FE7A 3IE2A 4DRZA 4ENUA 5H7XA 1T8SA 3U2QA 2KQUA 1Y1QA 4P9NA 3ZWVA 5BV0A 4YNBA 3L84A 1T5OA 4CEIB 1BXRA 3GBVA 2GN4A 4LDRA 3SGLA 1P8JA 2HF9A 1JB1A 2NU7B 4FSDA 3T0FA 2W43A 1MX3A 1H2RS 3NQ41 1R64A 4BKOA 1IC6A 3H1FA 4B74A 2Q5QA 2ZE5A 1H5NA 3FBGA 3H5LA 4V1CI 3HTXA 3NBZC 4YCMA 5BQ3A 3G6KA 5C8VA 4MIKA 2RDMA 3JQGA 4OOEA 5TE9A 3KHSA 1XDDA 5CIQA 3FPJA 3ZY5A 2GCOA 4YHHB 1B6SA 3AC0A 3FDFA 3SXUB 1XXHA 2HDWA 5EOVA 1UJBA 3GJTA 4UAJA 4UNNA 5IVDA 1BE1A 2R1ZA 1EVZA 1DQRA 4HRYA 4KR6A 2WAYA 4WK6A 5E3JA 2CMFA 5ALPA 3VR5A 3L6OO 4XGQA 3TZHA 4ZRDA 1VJDA 2Q6LA 4GGOA 1U0TA 4IFEA 1UINA 4UHEA 4UXIA 5FL7D 4P80A 2CDRA 2FW7A 3HL0A 2FN8A 3VH3A 5IANA 3QU4A 2XNSA 3ZW8A 3P19A 5EIOA 2FHPA 1X2EA 3PNVA 2ASEA 3BQ9A 3HFGA 4MR9A 4QC2A 4YJDA 4OF4A 1WNFA 3TSCA 1BQEA 3N58A 5KJEA 3L0OA 3U3ZA 4DJFC 3ZDRA 2C03A <