2MSLA

Solution structure and chemical shift assignments for the apo form of the receiver domain of nitrogen regulatory protein c (ntrc) at 35c
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
124
structure length
124
Chain Sequence
MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Nitrogen regulation protein NR(I)
publication title Free energy landscape of activation in a signalling protein at atomic resolution.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 19
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2014-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2mslA00
2IOYA 2JK1A 1PHRA 7ABPA 3LUHA 3KHTA 2IPMA 4KVFA 5TE9A 3T38A 3IPCA 1YS6A 4LZLA 2IDMA 5JS1A 2L18A 4XASA 3O2QB 2LBPA 5HQJA 3QX9A 1QMPA 3CFYA 4F06A 4RY8A 2PL1A 3Q41A 1YVUA 1T34A 4N03A 3KKEA 4EGSA 2OQRA 3CG4A 1DBQA 2QV0A 3E61A 3H5LA 4MR7B 4GPAA 4YP9A 3OQNA 5T3YA 5B3JC 1HEYA 4MRMB 1H9CA 3F6CA 1A0OA 4IMIB 5IEJA 2GKGA 2R4QA 2WMYA 4G97A 4QPJC 3LUFA 4ETNA 3HXMA 3SNKA 2IKSA 4LDZA 3UUGA 1B00A 2L19A 3FFTA 5CNJA 4MS3A 1DZ3A 4TMYA 1Z2EA 4QYMA 2R25B 1QP7A 4H60A 4WT7A 1A04A 3H6HA 2QXYA 4NQRA 4RS3A 1VKRA 3RQIA 1SXGA 3LKBA 3LFTA 3GA5A 3OM0A 5TQ0B 1Z25A 4EVRA 3RVPA 2HPHA 3N0XA 4DN6A 4KREA 3MM4A 4LX8A 3FMVA 2HQBA 4Z4HA 1YIOA 3RVQA 2CHEA 4S04A 3P9YA 1DBPA 2FKAA 4LRQA 2FN9A 1TMYA 2NUBA 1YTUA 1F51E 1PUXA 4RZSA 3RVOA 3CKMA 1TVMA 3I09A 2QVCA 1MIHA 1VLZA 3OMWA 2IPNA 3MQ4A 3C97A 3QX8A 3SM9A 2VUIB 2PUAA 4W5OA 3CU5A 4GNRA 4N47A 2FEWB 2MSWA 1JFVA 1M5UA 1NXPA 1ZITA 1U2PA 4HYEA 4MS4A 4PEVA 4Z4FA 5EWLB 3HUTA 2KYRA 2L2QA 2NZUG 2PMCA 2GI4A 3Q15C 3QK7A 3LKVA 4MS1B 3QELB 5DGCA 3H6GA 2PUCA 5PNTA 4OLBA 3ILYA 1DCMA 3T6KA 1ZGZA 5DCLA 3T8YA 1EHCA 3EQZA 4YGXB 3M6MD 2FW0A 2R47A 1FSPA 1EWKA 3JS5A 3LUAA 2PUDA 5JNRA 3N53A 4EVSA 2FMHA 1D5WA 4MR9A 1SD5A 1JYFA 3Q7TA 3FFWA 2AYZA 3DGFC 3KJXA 5HM6A 2VUHB 1OXKB 3MYYA 2ZWMA 3OLXA 5DKFA 5FBHA 3I45A 1E6KA 4MQEB 5DLEA 4F12A 5FWXB 3Q7RA 5B3JA 1GUDA 5C5EA 1C4WA 1EWVA 2TMYA 2PUGA 1J56A 1W9HA 2CD7A 1JL3A 3FDFA 3HZHA 3IP5A 4ZYLA 1P6QA 4WUTA 5CNMA 2FSPA 2FMFA 4N76A 1DCKA 3RVMA 1ZDMA 1AB5A 4QICA 1ZESA 3H5TA 4OG2A 4YLEA 1AB6A 3KYIB 5BRJA 4D6YA 4W5RA 3C3KA 3MA0A 1JDNA 4MAAA 4EYQA 4L85A 3HK2A 3VNBA 3HDVA 3QLUA 4MR8A 4ZPJA 2ID9A 4UHJA 5BR1A 5KI6A 1K68A 2E4YA 3QLVC 1JDPA 2HQOA 2A9PA 2MYTA 2ID7A 1LK0A 3GYBA 3OO1A 1XHFA 3HM9A 9ABPA 4O1HA 4Q6WA 3B2NA 4L4UA 1MB3A 1YK1A 4G0YA 5TQJA 6ABPA 3LUCA 3F6PA 4KQ9A 3D8UA 3CG0A 3N0RA 5TPZD 5FWYB 5JNVA 5KQPA 3OLVA 2L17A 3LUKA 3K4HA 1M2EA 3LMKA 3I42A 4Z0NA 5I4CA 5TPWB 5IX8A 4F11A 1IIBA 1OXBB 5BRAA 4Z4CA 1KRWA 4IMJB 3SQNA 4MRMA 3UK0A 5KQLA 2MYNA 1Y1LA 1USIA 3ILHA 1EWTA 3QLTA 3R0JA 4MLCA 4Z4GA 1ZH4A 4Z4EA 1MB0A 4Z4IA 2JBAA 3O1JC 3TMYA 4H3KB 4JB0A 3LTEA 3A3KA 1RXEA 1DRKA 3O1HB 4LE0A 5IC5A 3QEMB 1JF8A 2M1ZA 4G0ZA 2GX6A 3I5AA 4G0OA 5D2CA 2NT3A 4RWEA 1RZRD 3LUGA 5TQ0A 5HSGA 4IF4A 3RH0A 2PAFA 1NXXA 3N75A 3L49A 1CEYA 8ABPA 1L5YA 5ED4A 4KZKA 3EGCA 2FVYA 3GBVA 3N8IA 3OLWA 3OM1A 4Z9AA 5TPZA 4E7PA 1YMUA 4KPYA 2LP4Y 1U8TA 4UHKA 5EWMA 3URMA 2MYUA 3LUDA 2PKXA 1U04A 4EYOA 1CHNA 3TO5A 4NCBA 2H0AA 1Z26A 3W9SA 3QLVA 5E3JA 5IULC 2RJOA 3H75A 4ETMA 5HKOA 3HJFA 1BDIA 1P6UA 4KK3A 5EWLA 1WETA 3OLZA 2CWDA 2QVGA 4YV7A 4CBVA 3RVRA 2MYPA 1Z17A 4YS6A 4G0XA 5CNKA 3RVSA 3CZCA 3IP6A 4WWHA 1GCGA 3OMXA 1QKKA 4B09A 2VK2A 1JHZA 2YHBA 4OATA 2V0NA 1EAYA 1FFGA 4JAVC 2B4AA 1D1QA 2VYCA 4LE1A 1KRXA 1C0EA 4JB2A 4Z9BA 1QP0A 2FTKE 2OENG 4EY3A 1RZRA 3O74A 1PEAA 3DBIA 3H1EA 1LBIA 1LJUA 3JPYA 3O1IC 1JFTA 2PUFA 4MQEA 3RVNA 4ZJPA 3M9XA 5FWXA 3SY8A 1LBHA 2HSGA 2PL9A 1Z13A 3G1WA 3OO0A 3K9CA 4KK4A 4RXTA 4XXHA 2H3HA 1Z2DA 2XDYA 1USGA 4MLDA 4YWHA 4DADA 1DBWA 3BILA 4FE7A 1FFWA 3H1FA 2F8SA 1YS7A 5JNUA 1QQAA 2JRLA 5F64A 4JA2A 1MAVA 4IRXA 1DC7A 1GUBA 4FE4A 4G0PA 4KRFA 3CRNA 3O2JA 4EVQA 2FLKA 2I6FA 5ABPA 1ISRA 5EWJB 1DRJA 1M2FA 2FMIA 1XWWA 3KYJB 3HEBA 1JWLA 3JY6A 2QSJA 4MS4B 3SG0A 1BAPA 2JVKA 3O21A 4Z99A 4XARA 4RK6A 4W5QA 3N0WA 4RK1A 2E4ZA 3Q9SA 5KC8A 3MMNA 1TJYA 2GBPA 4W5NA 4YRZA 3HSYA 1CYEA 4HNSA 4PICA 3DZDA 1Z12A 4O1IA 2B1JA 3IP7A 2P4UA 1JYEA 2FEKA 3BRQA 5TQ2A 2FQYA 4MR9B 4ZMRA 2IPLA 2W42A 3H1GA 1XHEA 1M5TA 1SXHA 5TPWA 1ZGGA 4JOQA 2DRIA 3KCNA 4KMRA 3A0RB 1UDRA 1DP4A 3NNSA 4N0QA 4WXMA 3NHMA 2P9HA 1ZVVA 3BRSA 2QR3A 2FQXA 1DG9A 1A2OA 3A0UA 2LPMA 4EUKA 3CS3A 1VRVA 5KC9A 2RGYA 1ZHHA 5T7BA 1L5ZA 1NY5A 1URPA 2J48A 2RJNA 3EODA 4KQCA 4KV7A 4JASB 4MR7A 3ROTA 4FB4A 1PNRA 2NZVG 5JS2A 1YMVA 3KTOA 3M9WA 1QO0D 3HCWA 4YCSA 3IP9A 4RDCA 5CHYA 2FMKA 4MR8B 4MYRA 3C3MA 2JB9A 3CTPA 3G85A 3F73A 1W25A 4PE5B 1USKA 3HDGA 2IYNA 3RVJA 4RSMA 3CNBA 2MSLA 3HUUA 5GOTA 1NXVA 4S05A 1GCAA 1RXIA 3T95A 1DJMA 4WXEA 3IPAA 2FLWA 3C3WA 2PUEA 5IEBA 2ZAYA 3H5WA 5C5CA 1JX6A 1NTRA 1I3CA 4MQFB 1APBA 3KLOA 4TLLB 1SRRA 4Y9TA 3ROFA 3GL9A 4N41A 3OLYA 3HV2A 4HNRA 4F3TA 1BVHA 5IUNC 2WJAA 3BREA 2IPAB 2WRZA 1RPJA 2YHAA 5IUJC 1PNTA 3HO1A 4G0MA 4ETIA 1EFAA 1E6LA 1D1PA 4PZ0A 4KNYA 1FFSA 1NXWA 3KSMA 4F8JA 4EYKA 5GQSA 3EJWA 1QO0A 2JBAB 4NICA 3NNDA 1E6MA 1JBEA 4RXUA 4XAQA 3HS3A 4MS1A 3QELA 2LUOA 3DLHA 1MVOA 1S8NA 1ZY2A 3E3MA 1ISSA 3DGEC 3Q7SA 1VPWA 2E4XA 4D74A 3HVRA 1QQBA 3SAJA 1QP4A 1ABEA 3JTEA 1K66A 2R48A 3QLUC 2HJ9A 3TX6A 2BGGA 3GT7A 4MGEA 1BDJA 4H3HB 2M98A 4D6XA 4JP1A 4MS3B 1E2BA 2WY2D 1U2QA 3TB6A 2QW1A 2E4WA 1FQWA 1GLGA 1U0SY 1P2FA 3NNNA 3OQMA 3EQ2A 4YO7A 2PUBA 3EULA 4Q7EA 1F4VA 3LOPA 3VNAA 5BQ3A 4RK4A 2E4UA 4XFKA 3H5OA 5FBKA 4RKRA 5EWJA 2JCGA 4RK7A 5EWMB 2MSKA 2FQWA 3GV0A 3DLBA 1JFSA 4RXMA 3RVKA 4RV5A 4RK5A 3GRCA 2FN8A 3NBMA 4LE2A 4G86A 4TN5A 1YK0A 6CHYA 5JNTA 3H5VA 5JNWA 3O75A 4WZZA 3JPWA 4P1ZA 2F8TA 1QNLA 4ML3A 4NV3A 3EDCA 3C6QA 4RY9A 1NXTA 1ZAYA 3L6UA 4N0PA 4PYRA 1JLKA 1DCFA 5IBQA 4O5AA 2NT4A 3BBLA 1Z15A 3D02A 2WJWA 1BA2A 3F7NA 3EAFA 4RK0A 3CHYA 2AYXA 2PE5A 3CLKA 4XLTA 4ZMSA 3FFXA 1PEYA 4MPTA 1SXIA 2A9OA 4HNQA 3KS9A 5DTEA 2JVJA 4QYWA 5FWYA 2WWVD 4G0QA 1Z16A 2X7XA 4E7OA 2HQRA 3NHZA 4Q6BA 1Z18A 1KMIY 2N9UA 2QZJA 1LJLA 3LUJA 3O2SB 2A9RA 3A10A 4RY0A 1P8AA 1ZH2A 3JVDA 1NATA 2O20A 3GWGA 3N6VA 4P98A 2JVIA 2RDMA 4LDAA 1ZN2A 3RVLA 1BDHA 1NXOA 3MF4A 1ABFA 4EYGA 3S99A 3IDOA 4RU1A 4DQDA 2WB4A 3CZ5A 3JVIA 2LIVA 1NXSA 2QU7A 4NCAA 1RNLA 3QEMA 3OQOA 2FEPA 1D2AA 3KLNA 4M88A 5KQGA 5KWSA 2PJUA 3TD9A 4W5TA 2Q5CA 2A9QA 4YR7A 2PLNA 1R8JA 3MIZA 4MQFA 2CHFA 3H5IA 1QPZA 5JNSA 3FGZA 4OTZA 1JH9A 4KFCA 3KG2A 1TLFA 1TM2A 3GBPA 1DC8A 4OLAA 4IILA 4IGAA 5CNIA 3QEKA 2E4VA 1KGSA 5TQ2B 3UKJA 4RKQA 5IUKC 5KQMA 1D4ZA 4TLMB 4OBBA 2FXIA 2GWRA
chains in the Genus database with same CATH superfamily
1S89A 2JK1A 1JYSA 1JSXA 2WZBA 3O1LA 3EF1A 3K5HA 2B1RA 3PEUA 4Q05A 4RIEA 4C07A 5JAHA 2EKLA 5JWRA 3PCXA 3OH8A 3ZEIA 2NTVA 3DEJA 1AUVA 1I80A 2Z30A 1N2ZA 1QMPA 4D9KA 2DR2A 5KZMB 4MX8A 1KAMA 3V97A 1VI6A 1YBVA 5BN4A 1W8IA 4QTUB 4ZYTA 4EGSA 5KVSA 1VJTA 4U6SA 4YK7A 3CG4A 3E5NA 4O02B 4NABA 3U61B 3HLKA 1GSAA 4GPAA 3HXKA 3OQNA 4FW8A 1IG3A 1Z2PX 3PP8A 2WUDA 2IGTA 3AB7A 2FDCA 1F3OA 2QTWB 2WMYA 5FBLB 3IPLA 2FP4B 4ZOEA 3QTTA 1REQB 3KVNA 3O90A 1N5MA 3Q87B 5FADA 4Y2SA 3UUGA 1GTSA 2L19A 4WKBA 1YQWA 3UAXA 3DTVD 5B6JA 1XXHB 1NUSA 2FPPB 1ECPA 2FA9A 2V6GA 3IR7A 4QYMA 2OPBA 3KQNA 2GUGA 2WU1A 4BX9A 4Z7OB 1F5SA 2YHUA 4DVGA 2XOXA 3MHTA 4HTFB 1BFDA 3LBYA 4HO1X 4HDCA 1P2GA 5GJCA 5TT1A 4G07A 1FLAA 2O5CA 1OBHA 2XZTA 4EVRA 2AF3C 2DUWA 2PH3A 2PSDA 2ZU0C 3MT9A 1OLUB 2VZEA 1JEOA 1BX0A 3WRXA 1KWGA 1TJPB 5D5HA 1RQLA 1BHO1 1PL8A 4CKEA 2FF5A 221PA 1PL6A 3A25A 2CNOA 4ZRNA 4MKHA 4YBZA 4QDZA 1N2GA 1J1ZA 1PUXA 2AJCA 3A58B 1DAEA 1RD4A 3NOVA 2DHQA 2Y66A 2X8WA 2UZ3A 1C7FA 4MV0A 3T52A 3OMWA 2CZGA 4RFSA 2WU8A 2IPNA 1HTWA 1KEUA 4W6QA 3AY0A 2JW5A 3LCMA 4BO8A 1GNPA 4P83A 2GBLA 4XJTA 1T8TA 1LPNA 5DLYA 3TUIC 2DH6A 1FNSA 3DE4X 3QELB 1V8DA 4RZIA 3E8XA 3FDZA 1QHGA 1QORA 1KJZA 1RQPA 3T6KA 2VT2A 3F6YA 3A4NA 1K63A 4CI0B 2QI9F 4F2DA 2OZVA 1ACMA 1K06A 1L6IA 1L5LA 2ODQA 4IIVA 2JHFA 1HF3A 1XROA 4XGIA 3RU9A 2R4UA 3TRDA 3TTVA 1W4AA 4FGSA 3I23A 5BO5A 5BYAA 3P0FA 1TGYA 3Q9UA 4YJDA 5ALLA 1GL9B 3S6JA 3FUUA 1OBOA 1ECCA 5FR2A 2FFAA 4DCUA 1QBKC 4TWIA 1M74A 3ECSA 4KV9A 4CWAA 4YMHA 5DLEA 3LXUX 3HRIA 4MW7A 5CT8A 3WIOA 4AUNA 3QSYA 3T5AA 1UBLS 2PZJA 1O94D 2H51A 2KS6A 4CG0A 1KIMA 2CJWB 3N39C 1N5IA 1Q74A 5A4KA 4DG5A 2QG4A 2FG6C 1A4IA 1FUUA 1L5RA 2IOQA 3OKCA 4PYLA 4R1SA 4V0LA 3K53A 1S2OA 4WUTA 3FF1A 2G1JA 1NBMA 2FMFA 1KJNA 1UBEA 2D1YA 2HK9A 4I4TB 5DZSA 4DNFA 1UWKA 4DV1B 2JIPA 3WKAA 1MXFA 4F0JA 1IPFA 3U9LA 2A14A 3WKBA 4JNCA 2I7VA 3CEPB 2NSJA 2RK6A 3FLEA 3GRRA 4L85A 4EPYA 5I6DA 4R0NA 3CONA 3ZH2A 2OBXA 5CEEA 3ABOB 1DTWA 4ND2A 1I7SB 2BCJQ 4JQCA 1LF0A 4YUWA 1K68A 2E4YA 2H29A 1P80A 3AEXA 3CH6A 1WP4A 1AQNA 3H11A 2WIFA 3R4VA 2O2SA 3A4YA 4BN4A 3ONWA 3E9QA 1V8OA 3O8LA 4MUXA 2CBXA 3DQPA 4OJMX 5I47A 3DF9A 3SHTA 3T3IA 1MOSA 3ZGZA 1M3SA 3HYCA 4IMRA 5ALXA 5JFGA 1T2UA 3B2NA 4CLOB 5FPPA 1IEWA 4ZI7B 5KTOA 1W5AA 2IEAA 2WVAA 4WZ6A 2SBTA 5E9JA 1HZJA 4KQ9A 2JAHA 3N0RA 3VR4H 1UP4A 5TPZD 3WISA 4DM7A 1I1NA 3D64A 2IZ1A 3OLVA 3PWZA 3K6KA 4IH9A 3BCUA 1Y1RA 4HAVA 4AS3A 1WDKA 3G2IA 4EK9A 3IAXA 3Q4GA 5TPWB 4WJZA 3TIGA 4NBTA 1YVRA 3SQNA 5JSZB 2A84A 5KQLA 3SVZA 3I04M 5HWSA 3CGWA 2B69A 4JBYA 2O05A 3C3JA 3D7SA 3B5EA 5JU6A 5FBRB 4DB2A 4ZYVA 3DQZA 3ZIAA 1OE0A 3WGOA 3VHXB 5BNTA 4GD3Q 4WDRA 2WIJA 1RI2A 1TL7C 5LQKA 1RAIA 4PXAA 2ZCJA 4M1SA 2IYUA 2CMHA 2BGLA 1W85B 2EU8A 2H1FA 2NT3A 2P35A 1U4SA 3A6EA 3I0NA 2V9PA 3E9YA 1BWPA 1NVAA 1OYOA 4IUYA 2HCTA 3OT1A 4RGBA 1LTHR 1VHTA 2HC9A 5DTJA 2CV2A 4BS9A 2GN9A 1T8YA 4H35A 4N6OA 4OYYA 1TQ8A 2UUBB 3L01A 2WC1A 4C06A 1QF9A 4YMVA 1O5OA 5F1OA 3WGTA 1EVZA 5JISA 1GGFA 1XRSB 3V3KA 3ZWOA 2RC5A 4E7PA 1OAAA 3G2HA 3OM1A 3LOQA 4GMFA 3T3DA 1OJ7A 3Q2OA 3V32A 1MQAA 5B57C 3WE7A 3MTBA 2P9YA 3TI7A 3W9SA 3OEWA 1QHXA 1UIRA 2Q6IA 1V1RB 4M9RA 4KSCA 2AKAB 3X1KA 4PONA 3G0DA 2AJ8A 2D4HA 4HEJA 4AL4A 1Z68A 1Q6YA 4RJLA 3OJEA 5K0EA 3GLVA 5HX7A 2MYPA 1GQRA 5F7OA 3HYSA 3HN2A 3QWHA 3PFKA 5CNKA 4B09A 2WFAA 3B6IA 4Y8VA 3V4SA 1CD5A 3F98A 3GJ7A 2R00C 1R5OA 4A82A 3E2MA 5A5DA 3W6UA 3C85A 5CK5A 1AQYA 3HKCA 3RU2A 3LK7A 1FFGA 4FOPA 3HSKA 4LE1A 2IX3A 4X1IB 4B73A 1Y8QB 1P2BA 3I8XA 4FHEA 4NE2A 3I64A 4QD3A 5BT9A 2C03A 4JLDA 1ZMXA 2V65A 4P58A 4D4MA 4YV1A 5CA0B 2P2SA 3HJHA 3QLEA 4BZXA 2ZJ6A 3P27A 2HSGA 4URFA 2V7VA 2ZAIA 2QRVB 1FMJA 3A1CA 1Y6RA 4R1NA 3NDPA 2Z9DA 1U0BB 2Z2ZA 4REOA 3KQHA 3LBAA 1Y8RA 4DKXA 5EMHA 2AI3A 3KPYA 5IVHA 4OHVA 2VTKA 4BVEA 2RB5A 3QMWA 1XA3A 4PW0A 2XQFA 4OFBA 1BD4A 2V1UA 1FU8A 1Z5NA 2HV9A 3JARA 1XC7A 4MEBA 5EIHA 5EZ6B 5EZYB 1JHRA 1AKRA 1AO3A 1KA9H 1O6ZA 2C3MA 4ZRDA 4D9NA 3GP5A 4EVQA 4Y2YA 2D1RA 5ABPA 2V7GA 4HN9A 4QG7A 4CM9A 1XTIA 2CXSA 3ZD7A 2C7BA 3EWIA 5EC8A 1JLHA 2A58A 3U1BA 1J0DA 3EEBA 2B2CA 2XWSA 1UFVA 3TIIA 3FSJX 4HQ6A 5G0WA 1WMSA 5MF6A 1CUZA 2H5EA 1EP1B 4GM1A 1DKOA 4KNWA 4CI9A 2EJVA 1DX4A 2HU7A 2P6NA 4EHAA 1OZFA 2COKA 2HRDA 4FQ7A 5ALWA 4C29A 1I4OA 3OZFA 4IGIA 5JBIA 3HBFA 2ZXUA 4I6GA 1ZK3A 4KIUA 2IPXA 1F20A 4WEQA 3UAVA 1P0CA 5A0VA 2YW9A 3IP7A 1A1SA 1WZCA 1JYEA 3OP1A 1PV4A 2ECKA 4EABA 4CTMA 3L3BA 5HRUA 1BROA 1LBTA 3CXUA 4ZYZA 3B9RA 3H1GA 2NVBA 1M5TA 1BMDA 4UQOA 1XCMA 4HLUC 3RASA 2QN2A 4XX1A 4OQEA 5KYYA 4W5HA 4LXYA 1DLIA 2FOXA 4N01A 4N0QA 5CGZA 4Q1FA 1TDJA 3E35A 4JT4A 4RAOA 1OX4B 4LJSA 3U7EB 3FETA 3GJTA 3VH3A 1F0KA 4PX9A 1H6BA 5LKRA 2FW1A 1WLSA 4M3NA 2C2GA 4HXGA 2FGKA 3AVWA 3FM9A 5F51A 2Y0DA 1KK2A 1OHHA 1P29A 1O95D 2CLDX 3C4JA 4JB3A 4KGVA 4RV4A 3OSZA 3G59A 3BF8A 4IKEA 1X1BA 3RAPR 5C4MA 3ZX5A 3C1AA 2O4UX 1KK3A 1LPAB 3HCWA 1EM8B 4ZV7A 5J5VA 4E3ZA 4ENTA 2V7QD 5C0OE 3SXPA 1YHNA 5H7XA 5CEJA 2DPHA 5HHTA 3EDRA 3KSAC 1QYRA 2VUUA 1RZ3A 3PDHA 2G9RA 4LMAA 3V7WA 4MHSA 4PSDA 2DHDA 5SZKB 1F17A 2BGUA 3JD0A 3DCIA 3HM2A 3R4CA 4HUJA 1C0KA 3EMVA 2ERYA 4ZT2A 2Z83A 3UJNA 3PL1A 4YRLA 1Z0IA 3PXBA 3WG9A 4XCQA 5CVUA 1DHTA 1TM7E 5ALUA 1MTZA 2FJPA 4MOWA 4XYMA 4BY9E 3ESAA 5L6LB 4XWAA 2NU6A 2Q62A 4X1KB 1PS8A 4MQFB 4XRGA 3AFHA 3P9ZA 2FWNA 1Z7GA 4FJ2A 4YRMA 2GPTA 2IEDA 1Q15A 5TRTA 3U1VA 3JWEA 4KI7A 1BMQA 3H8SA 1EVLA 3TVYA 5IVPA 3HWSA 1ZNZA 3IOMA 5AW9A 3VPGA 3E8SA 4O0LA 2WJAA 1RRGA 1C3LA 1LRKA 4FEGA 5DOZA 2HR1A 2I7DA 3NOXA 5DK6A 2JGNA 2XECA 4IXNA 1OB5A 1PNTA 1S4QA 2B6NA 2ORWA 4OHPA 3HO1A 4B3DA 4EHJA 1DUSA 2R1VA 1QXSA 4INAA 4EDFA 4F8JA 4NBKA 3K09C 3OF2A 1YF3A 5EKXA 2IBTA 1QO0A 1RFLA 3AY6A 1YH3A 2OFXA 2WDPA 2H2AA 2Z1NA 4YJ3B 3H86A 4F84A 2HMUA 1DAOA 1T2EA 3BWXA 4PS1A 1S8NA 4L74A 3AR2A 1USWA 2PKCA 2ENWA 1O08A 1SULA 3DHWC 1VKOA 2DUMA 5DWDA 1KR2A 3HWX1 2ZBFA 4B6RA 1Z2CA 2QL6A 1MAHA 1FRZA 1EUDB 1AXEA 1A9SA 1FTYA 2HJHA 5EXDA 2FN3A 2NV6A 3T4PA 1M2HA 3PVSA 2QOEA 3V8NA 2ZSEA 1YVDA 3EDYA 4H0CA 5E6SA 5M5BA 5LA6A 3CRVA 1Z4MA 3E9MA 4V0RA 2PPLA 1E2PA 2X1MA 1X80A 3L79A 1DL5A 1R6BX 4XFKA 5EMKA 3ASYA 1O77A 1XELA 1Q12A 4N6GA 2ODWA 3CSDA 3G49A 4HFJA 3DLBA 4K46A 1I0LA 1ZCJA 3OECA 1CQJB 5PGMA 4BZWA 4BWGA 1UXOA 4RK5A 3IQFA 3INGA 1DBRA 3SZLA 5LZ9A 1ZD2P 2GVDC 4X71A 4II3A 3DV0A 4PX2A 1U0JA 1T8UA 1TAQA 4A8TA 3TH5A 1V7PC 1GCIA 1JPJA 1VIVA 2DFVA 2W6PA 3B13B 4P82A 1G6KA 1ATZA 4PYRA 2QLJA 1JLKA 2EV9A 4B3MB 3LVQE 1V39A 2VH1A 5D3ZA 4HH0A 4LECA 1PFQA 3ETGA 4IRMA 5TARA 4R98A 1JSCA 1EA7A 2RHBA 1SPXA 1N1DA 2AR7A 2WJWA 4JCCA 4R7ZA 4WY2A 3ACCA 2BIFA 3UWKA 2BFAA 4ZMSA 1MO6A 3I5MA 1XZQA 3B60A 2GKSA 3H2ZA 2JLVA 1Q11A 1SZCA 3FW1A 4Q01A 4ZQBA 1G4HA 2F43B 2VDOB 2QBYB 2VQEB 5DTRA 1ZD5A 4TLEA 5JVDB 3X1YA 2XNKA 1B0AA 2I67A 3KXPA 3H3JA 3KYDB 4G0QA 1OXTA 2A0XA 3A9CA 1N5KA 2PD6A 3L6DA 1XZHA 3O7WA 1I7LA 4M0DA 4OEHA 4AAYA 3HBJA 5D6NA 3LECA 4NHEA 5A04A 4K05A 4YYZA 3L1JA 2Z9BA 1B23P 5TMBA 2P2CA 2YINC 5EG5A 4RY0A 4FX5A 4JH0A 3RUAA 5H8WA 4MKGA 3CX3A 5DFAA 4EMSA 4ZO6A 5CLLA 5ITVA 5HZKA 3E05A 4EW6A 2JVIA 1FFXA 5DLQC 3RRZA 4LSWA 4RPHA 1LC0A 3GUUA 3NOOA 3PFNA 1MT3A 5F9MA 3WRXC 4TLAA 2PH5A 1F38A 4QZVA 3JCZA 5CX1B 2YY7A 1HL7A 2EX4A 2D06A 1YNOA 1HDEA 3CZ5A 4AFNA 2QU7A 3MTJA 3WGHA 1RNLA 1TD9A 3W34A 3GRZA 1G3IA 1D2AA 1JXOA 2QV7A 2OSBA 4RIIA 4WNAB 3KAKA 2JGIA 3EUAA 1VIDA 3K6JA 3LM8A 1JJAA 2R87A 3FNHA 4AMBA 4W5TA 1YBAA 4J90A 3D3JA 4OHUA 2IY7A 3F5FA 4H9GA 1G6HA 4ASUA 4V0MA 2O2GA 3FGZA 4OTZA 3WKDA 3O7MA 3RAEC 5JDIA 4BAUA 4PSUA 4E5KA 4BKUA 4FVTA 3ZJTA 3PFIA 1A88A 3R7NA 4YPFA 3KQTA 2ACEA 2BN4A 4BOYA 4S1OA 3OQIA 4URUR 5CBPB 3S2GA 2GM5A 2I3AA 1RM4A 1J49A 3BXHA 1SVWA 3KFVA 4K26A 4L5YA 5J40A 1BKSB 2PX4A 2JGEA 4XJVA 2IZ6A 3WVNA 2D7DA 1HEUA 2XXAB 3O3CA 5AK0A 5TE9A 2R6JA 3IPCA 1J70A 4XASA 3MPUA 1D1TA 1GUYA 2JFBA 3F49S 3O2QB 1RQ7A 3P4XA 4JDUA 5JI2E 4BKMA 4WBXC 2AYYA 1N25A 4G4SO 4TL6A 2R751 4EB3A 4E51A 1YVUA 2XYRA 4PWZA 4U3JA 1NAHA 5IAKA 1M67A 4D45A 1XEAA 2G76A 3L07A 3LDAA 4BKPA 2BHNA 4HATA 3M1AA 1EJBA 4MRMB 1ISGA 1GEEA 3CF6R 2CUKA 3NGXA 2JI4A 2A9VA 3PHLA 3KETA 1E9FA 1NUQA 4WAUA 1TKAA 4GZ5A 1QE5A 1H4TA 4R05A 4PFSA 1J8VA 5F7JA 4IHQA 1SQ5A 1R0ZA 1UMKA 3RIYA 3SD7A 2IHUA 4YWJA 3HCDA 2UZ4A 3H6HA 2P9EA 1CX9B 3I61A 4DV3B 3UUFA 1ZSYA 2B8NA 2E6KA 2WIBA 4ZQEA 5EGNA 4X8LA 4EG6A 1TZKA 4F4CA 4U7JA 3TZHA 3H2KA 3O4VA 2V0CA 2FRDC 3FF4A 4TKMA 5JWHA 1M6VB 1LEHA 3LL4A 2AN9A 1L8OA 3C0KA 3V7NA 1KDPA 1SBNE 1F6BA 2XGMA 1FTWA 3D59A 4F96A 3V1KA 4YNBA 2FN9A 1QNFA 4HFRA 4UAJA 1P73A 3BH7A 1EFPB 3LGXA 2HSDA 2C92A 4MGHA 4XQEA 5LQJA 1MC5A 1MXHA 1VI5A 1RPAA 2B9EA 1KI7A 1NBMD 5T6MA 5HR5A 3HGTA 2GH1A 2JKZA 3LT0A 3BD6A 3D4NA 2ZIVB 4TMZA 3RGWS 3V4RA 1C9DB 2LTAA 1A98A 2FEWB 4BXOA 3CRQA 4X84A 4GGMX 4XIGS 3ETDA 5TLSA 1Y80A 3AMVA 4NYJQ 4UFNA 3NQ41 4YAWA 2W48A 3OPQA 1FJGB 2C3YA 4PLZA 3N0VA 3UQZA 1ZA1A 1ETUA 2IHYA 5GJBA 3EGEA 2A3NA 3MOSA 1I5OA 4UCWA 1MH9A 3CZ4A 2IYRA 4LVUA 4ARBA 2VDMB 5A4FS 3HMKA 5F33A 4UTOA 2AJBA 2GLUA 3PGVA 3TZEA 2ZRJA 3CNOA 4F3CA 3U60B 1GZ5A 1CIVA 3BGIA 4QDUA 3VMFA 4E13A 4QYIA 3ZJVA 1CYDA 4NFHA 1GNLA 3N2KB 3VR2A 2O8CB 4HAXA 5EMNA 3KSBC 3TUZC 3A26A 4PLGA 4H7FA 3REQA 5B1IA 2CD7A 1EGHA 1ODKA 2I2WA 3FYUA 3SC2B 4ZZ3A 3HZHA 3CR7A 3IP5A 4Q9NA 4ZYLA 2I76A 1EK6A 4TX1A 2ZE5A 4H7IA 4IXWA 5K3SA 4KJZA 1TT5B 5CR9A 2FEXA 1JLMA 3A04A 1YZLA 2E21A 1X77A 1EUCB 2B2XA 2IYYA 4DZRA 1R5BA 1XCLA 3ZIAD 3QYPA 4DPMA 3W3AD 1I36A 1IN8A 3AVYA 2Y67A 1QVRA 3DZIA 2E5FA 2EXXA 2IUSA 4MR8A 4A5SA 2D2IA 4IWXA 5JRJA 2VP3A 2WP8J 2CMFA 4IOLA 1HURA 2GZHA 1X8KA 1WXXA 1BKYA 4DLRA 2YDYA 1O7JA 1RJEA 2BSAA 5A4AA 4R81A 2GAOA 3FVTA 2KM1A 1LK0A 4K3VA 3GU3A 4QX6A 5CB8A 2YWBA 4G01B 4TQAA 2HCRA 4C7BA 2AKEA 1UXGA 2TYSB 1X7HA 4ME6A 4Q6WA 4R0VA 1X70A 1YK1A 3HB1A 3QFRA 4IW3B 4PZZA 2WILA 3UWDA 1NR1A 3IQWA 1ZGAA 2WHPA 1KE2A 2AOUB 3D8UA 1JHVA 2UVDA 3CX7A 3G8AA 1FEZA 2HNBA 3ZLBA 1JEEA 3OZGA 1Y7TA 3SLRA 4MV1A 1PLLA 4DRXA 1RVV1 3CMMA 3VZDA 4X3PA 2RGXA 3B36A 2HA6A 5ALFA 4G0UA 1VE3A 5TC4A 3L8EA 5DHFA 3FWKA 3G8BA 3CZMA 4QPDA 4AZ0B 2O52A 4QDKA 3NIBA 5K8IA 3W2EA 5CD9A 1GN8A 3JZIA 2N3ZA 1LX7A 4AZ3B 4TZTA 4JVMA 3K1TA 3ND8A 2GJ4A 2AKYA 4QEDA 3B12A 3ANMA 1T26A 4KR6A 1OV6A 4BU1A 2J8ZA 3HI4A 6REQB 3BBPA 2XCUA 1SVKA 2XODA 5H80A 2VVTA 4YDHB 4M8SA 3UJHA 1EH5A 5LZ4A 4IO1A 3I5UA 2ZBVA 1BVUA 4D97A 1YR2A 1L5NA 3T5GA 4ABYA 3DDSA 4FDLA 1DAIA 2PAFA 4H16A 3TZQA 3WBKA 3KR1A 3EIOA 4A6EA 3A3NA 4BP1A 4DZTA 3B1JA 4LX0A 4ZARA 5EE9A 1H66A 2FFRA 3EGCA 3PR1A 2QWXA 2R84A 4GSYA 4WK0B 5TEWA 3RJZA 1ZIOA 4GBED 1VLQA 3RRJA 4QHYA 1BGVA 1UMBA 2VQ3A 2C7RA 2WQZA 2Z3VA 1DKMA 1DJQA 3MJVA 4P4UA 2RC6A 4D9HA 4G4JA 1L7PA 1SVMA 2Q07A 3PPXA 2DZDA 3FOAA 2PKQO 3AONB 1K8XB 3T34A 4AB1A 2J3MA 3UNXA 2EZ8A 2DPLA 4ETMA 2Q1WA 3AVPA 4DJEC 3EIFA 1P6UA 5EWLA 3ZBUA 4B0PA 2WUWE 2OUIA 4QL3A 2FZ4A 4CM9D 2BH9A 4GWKA 3UG6A 4JVSB 1NJ1A 3BH0A 2PBLA 1MP0A 4F9GA 2XT0A 2ZIUB 3R7FA 2YRFA 4HV4A 1G9XA 5DH9A 5MGBA 1Z0KA 4RELA 2FOIA 4CN9A 2EZUA 4BVAA 1WUKS 2GLXA 3NHSA 5TT0A 1KRXA 1YDWA 2GFHA 1DIHA 4AS1A 1MIOB 2YH2A 2OENG 3PYMA 1SIWA 1DDGA 3U4QA 3EXG2 5F4BA 4BUZA 3O1IC 2W43A 4EHHA 1ZIXA 2Y77A 5BQFA 1YGYA 3FPEA 5A9RA 1WS6A 1K4KA 4P34A 3K9CA 1W1IA 3QU4A 3K9LA 3PQEA 4FNAA 2YASA 3K6SB 2HMYB 4RMJA 2J87A 3OI7A 1ZD1A 4L73A 2M2IA 3H1FA 4RKWA 5SYNA 1P75A 1ELOA 2H5IA 1PKXA 3CRW1 3ZCPA 3RHZA 1G4UR 4Q9JA 3T54A 1X9GA 1GUBA 4KRFA 1RHUA 5HIMA 4EHLA 4NZZA 1FQKA 2WJIA 1DWPA 4DIDA 1SVNA 4E0BA 1YA6A 5KTPA 2OBMA 1FVFA 1I2CA 1QV9A 4IUBS 1NE7A 1Z38A 2ZVJA 2D3WA 5JAZA 1J2TA 3DVAB 5A7GA 1MQ8B 2QSJA 3FGNA 1NNI1 4PC7A 2HCFA 3ZHOA 3B6ZA 4XOIA 3ZD8A 4Z99A 4CKBB 2EZ9A 5C9ZA 1SUSA 1F2UA 2VP2A 3GPDG 3PC3A 1UDXA 3O8QA 4QC2A 4OGKA 4QQKA 5DYIA 4FUTA 2WFMA 1G5IA 1OREA 1TJYA 2DTDA 3A9SA 4W5NA 2A0KA 2C5FA 3AW9A 5DX1A 4ITRC 4PAGA 4PICA 4W8GA 3QVUA 4BO2A 2PBFA 4QXMA 5HE8A 4FILA 2FEKA 5K3BA 2ARKA 1E2EA 1KZ7B 4AWAA 3BM5A 2W42A 1KU0A 4FZ3A 2VO1A 4EBFA 1PFKA 2QRUA 3W5SA 4HWPA 3W04A 4L72A 4RD6A 3ZXIA 4JI0B 3A0RB 5A4DA 5L3SB 1G3QA 4FHZA 1WHTA 4M46A 4MXDA 3I73A 3KSZO 5JR3A 2VTBA 3RIHA 2X9NA 4JGIA 4EJ0A 5DWQA 4UTPA 3DE7X 1CJSA 1XDSA 2RGYA 5COQA 5AVTA 4RTRA 1A5AB 3WHKA 2VYNA 5TEVA 3IXMA 4H4EA 2NACA 2WWYA 3HH8A 3UPUA 2C98A 4YROA 4MYTA 1TZCA 3T9BA 1YU6A 3STUA 1QO0D 2H31A 2R85A 4OI1A 2Z04A 3ILVA 3PK0A 4MKZA 5ANRB 3GFPA 5C2JB 4ZRMA 3U62A 3QWBA 2VXCA 1HTBA 3QA3E 4EO9A 3HYNA 4D8VA 1R4NA 2P40A 4YQYA 5FUXA 2F9LA 5JSUA 4H7HA 4J6FA 4F2WA 1E77A 1W0JA 3BTOA 3F8SA 2EG9A 2QGNA 3QW4B 4V0QA 3AUYA 1WXHA 2O8BB 4HAOA 4JJZA 1OWNA 2ZTLA 3B1FA 4G1VA 3T99A 2VBIA 3V4ZA 5ITZA 1T3SA 3V1MA 3G5TA 4DLNA 4AY6A 2W6IA 2B8EA 4H7EA 3FPBA 1YR9A 4FU0A 3BJRA 2IZZA 2WVHA 4IIJB 1QQTA 3JYOA 4LZOA 3KQUA 4RSRA 5G1NA 5IAOA 1AK9A 1MF7A 1D09A 1Q0SA 2IF2A 4BNVA 3ZDAA 2X9LA 1E1CB 3C3YA 1PR1A 2CXNA 2VJCA 1FB5A 4BB9A 1BVHA 1E0DA 5IUNC 3BREA 4M1OA 5CITA 3PNQA 2N1BA 2D1QA 1DPFA 2Y1OA 3IPRA 1L5HA 5EIXA 3EC7A 1N2IA 1Y82A 1V5GA 3I1IA 3LPNA 3SJBA 1IK4A 3TOCA 5JHHB 4EYKA 4W5JA 4HS9A 1EUQA 5GZ3A 3HRKA 2HHHB 4BVBA 3FJOA 2XMZA 3E82A 4UUPA 1PJBA 3DLHA 2HJGA 4ZXPA 3PTZA 1G3UA 1YOVB 2OT3B 2WJ4A 4PY2A 4ZAFA 2FYTA 4ARCA 1UC5B 4RJ2A 2EP5A 3HKEA 5DNEA 3TTTA 5HIJA 3MOGA 4JK3A 4KBFA 4V0OA 1YAHA 3WYFA 3C15C 4OHWA 5K0TA 4LGCA 3W5AA 4H08A 4HZIA 2LIPA 5H82A 2C54A 4U1RA 5B4UA 3ZNOA 4KLRA 5BNZA 2AOTA 3KQWA 3OIWA 2ZJ3A 2ZYSA 5FWDA 3TNYA 3TLYA 3WJ1A 2H1SA 3EQ2A 4XH9B 4UUNA 1H5NA 1SBZA 1KO8A 2FWAA 3LP8A 2R6GA 5DBIA 2PA0A 4C3OB 3MJTA 4ZYXA 3MLBA 4N5DA 1FYVA 1W1WA 1QK5A 3FWNA 2R44A 2IWHA 1KY5A 2A5GA 2HJVA 2OHVA 3K0CA 4PC3A 4RQTA 3RHSA 5AW1A 2JLWA 4BO9A 2AZXA 4G37A 2C88A 4XFJA 5JDIC 1Y1TA 3U19A 1U8UA 1D4FA 4RV5A 1E6EA 4QFBA 5BWOA 3K0FA 1JE0A 1JU9A 4C0SA 4E03A 2HH9A 2ZSAA 2AC4A 3BK7A 2BUBA 3FN4A 3QRWA 1YAJA 1UKAA 1VPEA 1QB7A 2QVBA 2IZ5A 3PV0A 5FQOA 2DFPA 3GO4A 4R41A 3RFUA 5IJ0A 1LRLA 3C6QA 3WP1B 3ZYZA 3OJOA 2YIJA 2VRCA 4Q24A 2CL5A 4RETA 4MCAA 2HMSA 1CIJA 4KN8A 4LRXA 4P4LA 2G5PA 3UFXA 1MO4A 1SC4A 3HB7A 5HG0A 3VGPA 1IEVA 1QF6A 3E3LA 1E1LA 4PG8A 4BX3A 2RGWA 2V58A 1G8SA 3S2SA 1TC2A 1AHIA 3GZJA 4KWHA 2D5IA 3JWGA 3HVUA 2AYXA 3TFQA 1MX1A 1OQAA 2ZRAA 1VL2A 2XUZA 3CWCA 3HFSA 5H9WA 1HX7A 5EP2A 3RHFA 5CXXA 5HIAA 3DTVB 4GDMA 1ACJA 1WEHA 4H7DA 4WW0A 3GPBA 1VPDA 2IHVA 2GM4A 2WJ3A 1SCUA 5ERYA 5IMSA 2FV8A 1M76A 5KJCA 1NKSA 2BGRA 3TXXA 4AJ2A 1G20A 2G04A 2YJZA 3ENWA 1MG0A 3T9FA 5I8ZA 1JU3A 1XL1A 1YE8A 4G25A 1KKLA 3QPCA 3OT5A 2WV7A 2G1PA 3GQBB 1TM4E 1D2GA 4JUAA 2OFOA 5BV7A 4P2GA 3Q7QA 4KWIA 3RS0A 3VPDA 3BJMA 3VPCA 5JROA 2DX7A 3OZWA 4D8XA 3N6VA 4IDGA 2JFOA 1EGMB 4KIJA 2YWHA 2J9ZB 1T2NA 2QTNA 3O91A 2JLZA 3KKNA 3D6MA 2F55A 1L3CA 3AV0B 2XI4A 3IBTA 2GN0A 1A7AA 2WKPA 3PNYA 3QU5A 4Z8YA 4YRGA 3FBGA 4WVLA 4DJFC 4YA6A 2CSXA 1ANKA 1FX0B 1M66A 1C8BA 4NCXA 1GRQA 1E9BA 3C5CA 3PUKA 4D02A 5LQMA 1M72A 2VHXA 4EWLA 4KLCA 5NLLA 3HYTA 2A94A 4IV0A 1DC8A 4RMIA 3IQXA 4HQFA 1DFIA 2AQHA 4AZWA 2E4VA 1OGIA 1KIFA 3L7OA 1Z75A 2FPRA 2WT4A 1N5RA 2ZR0A 3HJUA 5KQMA 5C3UA 4OBBA 1BIFA 2FXIA 4HFNA 2IOYA 3U4CA 5A02A 2EFCB 3EPLA 5K3AA 4OLHA 3GVHA 1XDDA 1T4CA 3K0SA 5HIIA 3ZDCA 1JV2B 2ATXA 2EFGA 4R9VA 1OBVA 4IXDA 4GVPA 3ZE1B 1L1QA 5JS1A 5D3QA 3LO8A 3A3YA 4F06A 5LZ5A 5AM0A 1E9AA 1JKJB 1KVSA 2EQ5A 2PL1A 2W6JA 3PXAA 1ZJ6A 3KR0A 2YN4A 1T34A 4GPTA 4OB7A 4PQEA 2EIXA 2OQRA 5BMOA 3I53A 3T7KA 2ZQZA 4E46A 5IXJA 2ZIFA 4RPKA 3RYTC 1XYVA 1VSUA 3O84A 1PLKA 1WUTA 4HI0E 4PGFA 3E6AA 4JODA 1RAAA 1E4YA 4L5JA 3SC4A 2ESRA 2JLSA 3UJ7A 4BGIA 1PX2A 3HCNA 1E0JA 1HRDA 3EPKA 3TL2A 5AW5A 3ZUPA 1DZ3A 4PQRA 1KJJA 4J0GA 5ECGC 2W9XA 4INPA 4JXJA 2EFDB 3C8ZA 2RHTA 2H1RA 3HUFA 4TPKA 4B9EA 5L53A 1AV6A 1OFIA 1V7CA 1M2GA 1M6NA 2HNKA 2QXYA 3DFIA 5AJWA 5EE1A 2RH4A 3DF7A 5T41A 4E2WA 2VOJA 4TKLA 1RYHA 3GBSA 2IXAA 1W88A 5KYVA 2X86A 4KX3A 1VL1A 2ENUA 2ODBA 3GA5A 1DRUA 1ZU4A 3MYRA 1LPBB 5AKGA 5TQ0B 3FJYA 2MT9A 5D7NA 1VYHA 1DTEA 2DTEA 5GV8A 1COWA 3B51X 2XIQA 4V38A 1U0LA 2NV2B 3VR2D 2PRJA 5EUCA 5JW6A 2OV6A 3GFOA 1DBPA 2GD0A 2I7XA 4LRQA 5IT9A 1IAVA 2NU8A 1Z08A 1TNDA 4RZSA 2QTFA 2YZ7A 3SBEA 1T10A 3P9CA 4MI6A 4PPFA 1AZWA 1DXYA 5E7MA 1D6JA 2NPOA 3UWPA 4BV3A 3T5MA 1ZO8A 2IC5A 4RBNA 3ZNPA 3ANTA 1XVLA 3IIEA 1DO0A 5ENVA 2OV4A 1T4BA 2MSWA 5LYJB 4NBNA 4O08A 1O0CA 4BEJA 3LVBA 4JMLA 1FRQA 1KAEA 1EFVB 2JLXA 2G17A 1JA0A 2B94A 3Q15C 1HNNA 5DGCA 4QJIA 3R0VA 4REMA 1KP2A 4BWYA 3FPGA 4YJGB 5B1SA 1P4AA 1FVHA 2GA9A 1ZG3A 2YS7A 3AHFA 2HREA 3OPYI 3C14C 4HDNB 5IBRA 1D2MA 5HYVA 3UAOA 4PZCA 3WTBA 5BXQC 2G7ZA 2XRZA 5D3KA 4YJFA 3ADPA 4BNTA 2VDWA 3O8RA 1IK6A 2YYAA 1NF2A 1BU8A 3TQSA 4QM6A 3BMOA 4Q4JA 1JYFA 5C8DA 4NEHB 1MHTA 3GLFB 1FFYA 4KQHA 1FNNA 3DYVA 3UUEA 5BSFA 2BTQB 1G63A 3HFRA 1XNJA 4PZEA 1E6KA 5ALVA 3SICE 3K6RA 5FWXB 1NI4B 3CX8A 1CDZA 1UM8A 1GAJA 1LSUA 1CZLA 2VR1A 3GGDA 4FT4A 4JEIA 1GUDA 3H2SA 4IYJA 1C4WA 5K01A 3AL0C 1Q0ZA 2O59A 4HNAA 1IG0A 4A8JC 4A2CA 4C2AA 1PSZA 3O4IA 1X92A 1JBKA 1ULHA 1XNHA 4RD2A 3UJDA 3O8CA 3QLJA 1YJ8A 3GPLA 4N76A 1DCKA 2XPCA 2KJQA 3DZFA 1ZDMA 1IU9A 2RAUA 3THXB 1U28A 5IM4A 2YX1A 1SM4A 4HVAA 3SN6A 1GFZA 4AJ1A 1AB6A 1Y3DE 4B2IA 4R5HA 4IO0A 1ESNA 4JL6A 2Q2WA 3OX2A 4Y0NA 4BZPA 5CB6A 1DIRA 4CIYA 3FIUA 2C2MA 4CQLB 5JEEA 2Z1MA 4RA9A 4U7PB 4LJLA 5ELMA 2PX5A 5GVRA 3TEMA 2ILTA 3E2PA 1QDEA 5FA5A 3TW8B 2HHCA 2RHCA 2GILA 3LTNC 4YQFA 1DWOA 1RLTA 4ZVOA 2NO9A 2PCLA 2JANA 4OOFA 1SBTA 1XTQA 5DF1A 5LQRA 5LR6A 2ZUFA 4G0YA 2GETA 2WG0A 4EJMA 2R8XA 4P2BA 3KM0A 4I8DA 3BICA 4HX2A 5B7NA 4YV0A 7REQB 4CXMA 2G4LA 2XGOA 3CG0A 1W96A 3HCRA 1GITA 5T4HA 1HLGA 3NM4A 4GPIB 1LLQA 3KT3A 2HY7A 4HB0A 2VDVE 2JPDA 3FCAA 4O2AF 3SR4A 3I6ZA 1TXGA 4N1AA 1ISFA 3PX7A 2VAXA 2ZBQA 1P9LA 2ONYA 3IAHA 2OBNA 1KPGA 3UH1A 4DCTA 4C7OA 3QLTA 1EWTA 4HT3B 4I81A 2Q7XA 1W9MA 4K8RB 1K86A 1H1DA 1A9XB 2H2WA 3EVBA 2AFRA 1D5CA 1T8RA 1SBHA 2DH5A 2HPVA 2PIAA 1Z4OA 3PQ6A 3RAGA 2RHRA 4OQMA 3LI2A 1NM5A 5AIBA 3DZGA 3HBMA 5LL6P 1DNPA 4B44A 3WAGA 4F38A 1DRVA 1V3QE 1J8MF 3VNVA 2H17A 3L6EA 1NVTA 4FJ0A 3VVLA 4ON9A 2BOVA 7ADHA 4MWCA 4CLDA 5T4BA 2DY1A 2GQ0A 1U8YA 3LXMA 4TQ9A 2RKBA 5A1TA 2XCSB 1UBUS 1V9SA 4XX0B 1NF9A 3FDIA 4JEMA 3KK0A 2FZ5A 4M9XA 4RYDA 3QEOA 2PFSA 1Q92A 2ZRGA 4KZKA 5KVCA 1THTA 2IOHA 4ZAXA 3ORQA 2HU2A 3IPYA 1HUQA 3UK1A 4ER3A 1KK0A 4MV5A 1R50A 2HIAA 3S29A 1HFKA 2G0NA 3QFCA 2VQDA 3FTDA 3P1JA 1I3KA 2QVLA 4DDHA 4DLXA 4IH1A 1B43A 2W5UA 4N3AA 4JLPA 3WOHA 2ZDQA 3QYAA 3FRIA 4KODA 4MO2A 4PBSA 5DTIA 1U0GA 3PQFA 4B43A 4E30A 2AF4C 1KEWA 4KTVE 1HE3A 3EXEB 4G2TA 1TK3A 4L0QA 5DOVA 3RVRA 2DWQA 1VPLA 4X95A 4LRSB 2C9CA 4X6YA 4L8YA 2FPIA 3QSGA 1E3SA 1A77A 3TAUA 1ZC4A 4XPIB 1E3LA 1RWBA 5M04A 5DXFA 2ZIEA 2J4DA 1OXUA 2GGSA 3AEQA 3H3XA 3VNQA 4UUMA 4KLAA 3CVVA 4R8MA 1HDYA 1IBRA 1MR3F 1Z6XA 1A8UA 1G8HA 3EMKA 1JVSA 1LBHA 2P9TA 3I04A 4LOLA 3L8YA 4YRKA 4X92A 2PL9A 4WBNA 5AQ1A 1PK8A 3G9XA 3KU1A 4AJIA 4EFDA 4DBVO 3WKCA 3DUFA 2DLDA 3K0AB 1NSYA 2QTHA 1UBGA 4RM2A 2BP7B 2YBDA 2I8LA 2W8BB 5A9SB 1T9HA 2C1EA 3TOSA 2C2HA 4CIAA 1RADA 1XD8A 1A5TA 2WD7A 4K40A 2HBYA 2PY6A 2AUTA 4IRXA 3KTFA 1T9AA 3UHFA 3ZHSA 1U0RA 3KVRA 4CNBA 1SIBE 4BTVA 3FNQA 2Q8NA 3R6WA 3L46A 3LPAA 1G6Q1 3DBRB 3OCWA 2GK4A 1U0OC 1Y1SA 2ZU6A 4DC9A 2VTVA 2VYND 5K0JA 4QPPA 3SJ7A 1WB4A 4HOYA 4F7DA 5KTNA 4JBHA 5KNLA 5BUCA 3I2YX 1BCSB 3UWMA 1JWLA 5HVNA 4D25A 3EUEA 5L3ZA 4WJKB 4IJQA 3AC0A 3O21A 4GE3A 4XKJA 1N33B 4ZZIA 2IV2X 4TL9A 1VB5A 2FUCA 1MEEA 3D6UA 3EIEA 3JQPA 3M6IA 2IHZA 4QBHA 4RK1A 3ME5A 1UMDB 4MPPA 5AJVB 1PBTA 1UP7A 3DZDA 1FZTA 1YS1X 3ET5A 3S28A 3CUYA 1HM5A 2WMOB 3WBBA 3THWA 2QTZA 5E8JA 5EGSA 2IPLA 3VZPA 1Q57A 2HA2A 7YASA 1CRPA 3AEKA 3JYQA 3A2MA 4RF5A 2ATIA 5L6MB 5BSVA 4KR2A 4KO1S 1F8GA 3DOUA 1Q0QA 4JROA 5EUMA 4RGQA 3IIJA 1RM3A 4INZA 4NX2A 2BGIA 3AUKA 4U39A 3KPVA 3QU2A 4LXIA 4BCBA 1TM5E 4G1EB 1PGOA 1TECE 4UCFA 4AKSA 2CVPA 1KMQA 2QDKA 4BNLA 3R5JA 5JYBA 2ZI4A 4MR7A 3NO4A 2BGMA 2P11A 4M36A 1FVXA 1BQ4A 1U2GC 3HU3A 1AKYA 2HUNA 3GF4A 4E14A 2EGUA 4A91A 1X0XA 1TJ4A 2BVNA 3SKVA 1WB6A 4RABA 3A2LA 2ZR7A 3EFEA 1NW5A 3QBVA 4B34A 4NONA 3QHQA 3DZKA 2NUAA 2YJ6A 4Y1EA 1UOOA 2P5TB 1C4XA 2X5OA 3JZAA 3RODA 2ZZNA 1B74A 4D2IA 1WQ4A 4Z6KA 1PS9A 1PJQA 1Y0BA 2VAPA 5AKIA 4MUMA 1XJWA 1SUDA 2ZREA 1SB8A 4HQRA 3VJMA 3PCTA 3VOTA 3AGPA 2PKEA 1XA0A 1YZYA 3H5WA 4PVCA 2YZNA 1TLTA 1UPFA 3OOEA 1RWNA 1ZOSA 2XQJA 1ZRNA 4Z8XA 3MWDB 3KPWA 3EF0A 4BLVA 5AW3A 4C4TA 2OZKA 2J5KA 3B8HA 1OYVA 3CW8X 1E8MA 3MT7A 4HLNA 4FMDF 4LVCA 5FULA 3UF0A 8GPBA 2AT1A 3JALA 5KTRA 2AG5A 1U9CA 1PR3A 2DHRA 4ARIA 4YCLA 1T25A 1YCDA 2WRZA 4FD2A 4NBUA 4WXHA 4ZEWA 4OQXA 3QVJA 4ILEA 4EEKA 1YQQA 3M34A 4OQYA 2P1RA 2QRGA 4ZYYA 4PZ0A 2G9NA 1NXWA 1D7OA 5FFNA 5K6AA 4LDNA 2AN1A 2WE7A 3BH6A 3EJWA 2O7NA 6AT1A 2XDWA 4LJ4A 2PT6A 1U3CA 1FS6A 1N7JA 1X7XA 2OV2A 2I4MA 1E6MA 2QE7D 2VRCD 3VTKA 5BN4B 3ABSB 1OI7A 4GP7A 4YRDA 3CO5A 1BMFA 1N1GA 5AJUA 2I2XB 3W0LB 2PJDA 3Q7SA 5KQRA 4KP7A 4NAHA 4ACBA 4KYUA 1H05A 1SG9A 4ZAGA 3RRXA 2XUQA 2NTNA 2QZZA 1JT2A 5BQ5A 3DYBA 5HKLA 5F1YA 4BASA 2W2KA 2XAUA 1YBFA 3FA2A 4PLHA 1S3GA 4YMTA 1QPGA 4BE7B 1ONPA 1E7YA 1P1CA 2WY2D 3DCYA 5F12A 4DIMA 2IKQA 5TNXA 1MX3A 1B15A 4FFSA 2I2BA 4R9UC 5LQAA 5A3SA 1E2NA 1SURA 4F04A 1QTQA 1YZHA 3DMRA 2PV7A 3K1JA 3A31A 3TEFA 4I36A 5J2UB 4QUJA 3WNQA 4E6EA 3MJ4A 1JAYA 5DO9A 1K0FA 4RKRA 4BGVA 4D4LA 4L50A 2DKFA 3OPYA 3I8SA 1T1GA 4RXMA 4PPGA 4Y2JA 2HNAA 4C4OA 2WG1A 5FOTA 5CCEA 4UTNA 1SK8A 1PT6A 1S8OA 1TU4A 2Q99A 3FSEA 3DAPA 3KXIA 5FD8A 2MOKA 4ZCLA 4CKEB 1I9GA 1XN4A 3A2KA 5K0CA 2KSQA 3FRHA 4FCCA 4PU0A 2FH5B 3L1HA 4PFJA 3W1VA 2W2QA 3TGPA 2GT1A 2QRKA 4DJAA 4RFSB 1DCFA 3VTFA 2FZWA 3L8MA 4AJEA 4C76A 2CXHA 4YECA 4R3NA 2LW7A 1VECA 5KCZA 2YJGA 4X45A 5KWEA 1H2ZA 4FI3F 4K9RA 3CPSA 1Y3BE 4FFOA 4QYXA 4UBJA 3DVRX 4R2LA 1EIZA 1HDXA 3U31A 2PE5A 5MFPA 2UXDB 4GLJA 3FFXA 5JC8A 3DBVO 4D4KA 4I50B 1KFBB 3SCZA 3NKFA 3V42A 1AMOA 3IQEA 3WYGA 5AM3A 3GJ3A 3U4GA 1IPEA 3N2ZB 4U4AA 2WU4A 4L16A 1UANA 3CSUA 4EHKA 1V8ZA 1RHQA 3NXSA 5DGIA 4XLLA 4IAOA 2W22A 3RC3A 2FP3A 3LFHA 3EZGA 4W4TA 1O2DA 2RGCA 2QF7A 2PLAA 2WABA 5TMDA 2A0FA 1SUIA 3H1TA 4CIBA 3UCXA 2AWOA 4J0FA 3DMTA 3IP8A 4NJOA 2JZCA 2HRRA 4FMDB 1MG5A 1IUOA 2W6JD 3E15A 1XBTA 3S1AB 1I1QB 3FYSA 5GP1A 4CVNA 4LDAA 5AHOA 4IDEA 4UNNA 4CKWB 4YR9A 5M7EA 3L02A 2PM8A 3WK9A 1J97A 2WJYA 5FP0A 3ZDFA 1RQNA 5KPDA 2I1LA 5GONF 3KKOA 1Y7LA 4R4JA 4QRHA 3QPVA 2GXSA 3GRYA 3JYPA 4JYPA 3UAZA 3CVXA 1DJOA 1EDOA 4MI9A 5AKLA 1G64A 1QANA 1NN3A 2C4WA 4E1VA 1IVSA 2CHUA 5FPYA 4IZOA 1C81A 2JFPA 1KFKB 2PNFA 1RRCA 1J00A 3MIZA 1KJ8A 1DTWB 1S6YA 4JA0A 4NENA 4ENPA 4M1EA 1TYAE 1TLFA 3SI7A 1H85A 1IUKA 2C9OA 2HM7A 3H11B 4KAFA 4NR0A 3L1VA 2RARA 4I55B 5DDIP 4JVOA 2GPAA 1V25A 1T0JB 3GDGA 2A1UA 2PTHA 4P8RA 4TN1A 4YMWA 5LFAA 1A8SA 3ER6A 5ESDA 1GCOA 1D4ZA 3M9LA 4J0DA 4W9NC 5C1IA 1CHDA 3UYLA 4DYDA 1AA9A 2RE8A 1PHRA 2V7EA 2FWIA 3LUHA 1ZD4A 3BIFA 3U7QA 2B4QA 3U0BA 4KVFA 4M9UA 4P5DA 5U4XA 1GSHA 4AP9A 4I1PA 5K0GA 3EJ6A 4JFRA 5EXXA 3YASA 4Q7MB 1IB0A 5MHTA 3V4PB 5L7YA 2Z6QA 4LPKA 3OZAA 1TJ5A 4RLSA 5ALTA 4Z9FA 4HRVA 4DJTA 3FUVA 3KKEA 1UDBA 2MSNA 1DSSG 2BGNA 4QJBA 4CMAA 4F2PA 5LPNA 4JWTA 3QJYA 2BFFA 5T3YA 3HA5A 4J03A 1KYZA 1QPBA 5FPQA 4AJJA 4AW9A 4DIEA 1FXWA 4IZHA 4BNUA 4ZJZA 4ZTUB 2AOXA 1RRKA 2XF2A 4YBRA 1U98A 3VX3A 3MJSA 4HXYA 4ETNA 4W9MC 1P6XA 1DEOA 2IKSA 3DOOA 5ALOA 1B00A 3W1EA 2ZJ4A 3DHNA 3K4PA 3L8FA 1Y5NA 2XHEA 3TQCA 1K2VN 2IPOA 4W6ZA 1KR5A 1U28C 4NFLA 2HN9A 3VTZA 3W3ZB 4PAOA 4DIOA 1VFNA 4L8VA 3CB4A 4H60A 4AJNA 1YACA 4MB0A 4TYNA 1FTQA 5KYTA 2GEJA 2JFHA 1Y1QA 5DJ5A 1CERA 1C9JA 1H4QA 1SXGA 3TXYA 2X76A 5JDCA 1G7SA 5AKHA 4OHMA 1UP6A 3TPCA 3ELDA 1P7ZA 1QG4A 1QJ4A 4UUQA 3BZBA 1K7EB 3MJCA 2VATA 4TV9A 5GPBA 2AG8A 4DN6A 3AGQA 2WD8A 3FMVA 3B48A 5G4LA 5HF9A 1KAGA 5C4GB 1SKBA 1V47A 3PFCA 2H2HA 4HHEA 4M6WA 1I3OA 5E1BA 4MHOA 2ES4A 4KBYA 1GZ7A 3W79A 2H2FA 1VE6A 4ZOBA 5B3LA 4P5PA 1JSZA 1WW8A 3CNQS 4C6HA 5AKXA 1HQDA 4GC5A 5IPFA 3EK2A 4IDPA 4PCUA 1B93A 1EE2A 5TXGA 1B41A 5C32A 3VKHA 4MS4A 1UKZA 5AFSA 4J1QA 4JIMA 1TM1E 1IMJA 3TUJC 4H2DA 4EG4A 3FTPA 3LRTA 4R51A 1UM9A 1Q22A 5PNTA 1TVEA 1KQOA 1J5EB 2I54A 2BYTA 3MWKA 3LAWA 1NMEA 4Y3UA 1TK2A 4OXYA 4YDSA 2H8GA 2IHBA 1CY2A 3GOHA 3L0CA 5K05A 5CA1A 4DJ5X 2PGXA 3HKCB 3DEFA 4JHLA 3AI3A 1SK9A 1I0ZA 2P9GA 3KBBA 3TVDA 2YR0A 1ZRMA 3CF4A 1E2GA 1G3RA 4NV1A 1Q19A 3NP7A 4WOJA 5AJHA 3VXKA 1NYLA 2IOFK 1XDUA 3JQ6A 3PC4A 4HBZA 4QQRA 3BXXA 4ZFNA 2QP3A 1SCNE 2VDUE 4MITA 4JXZA 2EYQA 2H85A 5H3LA 4JLJA 5D01A 5LD2C 4B6OA 1TRKA 1GYRA 1IHYA 3D5EA 4UU8A 4E4TA 5AUNB 5KYWA 2DLCX 3F6RA 3MJDA 4B2YA 2AQIA 2IYTA 3HE3A 3MT8A 4OK3A 4R16A 5IG2A 2IU6A 2QTTA 1IXSB 3C7KA 3EZYA 1FVOA 121PA 1JAZA 4PAMA 4C2TA 1HSOA 4TMWA 3KKPA 3JARB 2AN3A 4BQQA 3AYZB 4M60A 2AG1A 2QN9A 2Q1YA 1PZNA 3SHFA 3V8QA 4TQGA 1E58A 4QVGA 2YMPA 1F6DA 3S27A 4BNKA 2GXAA 1Z5WA 1EFCA 2ZTHA 2QSZA 3VNBA 2I0FA 3UANA 4OX9B 1AUOA 4GWLA 1YZTA 1P7YA 1ZAKA 2OILA 3WADA 3AJ8A 1YFZA 4NFYA 5TMPA 2AR0A 3T3GA 3SZOA 4DT1B 2B0JA 4GWGA 4LZZA 1E92A 4M0KA 4FE3A 1ESEA 2Z4SA 4AJLA 4CU2A 4CEJB 3GYBA 3LLMA 2Y27A 5K4GA 5KNCA 3KT6A 2ZE6A 3QKSB 1M75A 1XZEA 2Y0EA 2ZAOA 4IQ8A 4O2BA 2A3RA 5EAIA 1CSEE 1CNMA 1JFLA 1JMVA 3BHNA 5AM1A 3S2EA 3F6PA 3HR7A 1DU4A 3PEWA 2OZEA 2JLRA 1KH2A 2WW8A 3PSAA 1T13A 3R0IA 3TNFA 4KYVA 5LA6F 1NJ8A 4EHBA 3GCWA 4WOBA 1AQJA 1OH6A 5I4CA 4DGSA 1E0AA 5JQGA 1SC6A 3AESA 3Q8KA 1LLCA 3U6BA 2NZ8A 2GHTA 1FDVA 2VZ0A 4YFVA 1TVKB 5GTDA 3EFHA 3TIXB 1B7GO 3IUJA 3SF8A 5JJBA 2H0QA 4GRDA 1KVQA 4U6NA 3MAJA 1RC8A 4Z4GA 1KEZA 2CDAA 4HLDA 2FR1A 1YSCA 3OE4A 4YAOA 2GN1A 5HS6A 4Z4IA 1XD2A 5CH8A 3I6MA 2UDPA 1QK3A 2RHMA 3KYCB 3N7AA 2AXPA 1J0AA 1DRKA 4UDNA 4Z4QA 2B92A 1OD6A 1WZ2A 1JFRA 2X2PA 4NVRA 1LSOA 4URZR 4JYZA 3D4BA 4TTIA 2QT0A 4MVJE 2ACVA 5EIWA 3CEAA 2DVMA 2HCBA 3RH0A 3SMVA 1E69A 2VPZA 3OSUA 1NJ6A 2DFTA 1GG8A 3V9AA 2X3UA 5LP6A 3VVCA 1ORRA 2J6CA 5AW8A 3OTWA 1IHDA 4DMHA 4HKTA 2GPJA 4RPCA 5FOVA 3TDNA 3BUSA 1RLOA 3HO6A 1KJIA 4JN6B 4REQA 1JDUA 4NE9A 2RD2A 2B3TA 2VHTA 2Z8ZA 4TVSA 4L6IA 1H2FA 2G08A 1MC8A 2Z43A 3RYFA 4NCBA 5KYGA 1DWQA 2JFZA 3ER8A 3WLPA 4EUSA 1X7ZA 3QLVA 5GJVC 1DIAA 2Z08A 5HKOA 5IULC 1SXJE 3C3CA 2H1CA 1GPKA 1MO3A 3A1VA 3OAAD 4CBVA 1DC3A 3SKYA 1M0WA 1NI3A 3WO1A 4G0XA 3VAZA 2A67A 1RMQA 2NSDA 4XJXA 1NW7A 3NR2A 1ZH6A 3OOSA 3PB3A 5HCNA 3EGXA 1PKEA 3IR6A 4BTEA 5LBTA 3COWA 4AJ4A 2AXEA 1YQ9A 1AGRA 1GGJA 2VYCA 1POWA 3B53X 3DO6A 3LWBA 4HBGA 4J16A 3WDKA 3D6VA 3OU6A 1RZRA 3OLCX 2J45A 3R40A 1YT5A 2DGDA 4ZVMA 1H0KA 4OJKA 3TCNA 3TL3A 4G4IA 4DCOA 3I9OA 3EDOA 2H48A 3BSSA 2O07A 1AUXA 1YZUA 1ND6A 3ESDA 1QKIA 1L1RA 1WCIA 3PVZA 3PWTA 4JUCA 1XLUA 4XIJA 4E4YA 4F6RA 1B73A 3EARA 2H4WA 4DB4A 3RD5A 4EMTA 4FE7A 4QJ5A 1FFWA 3ZE9A 1GR1A 4FGWA 4QRIA 1LTQA 5DIZA 3S5UA 3T0IA 4BC0A 2BLLA 2EWVA 4KVZA 1TIKA 1RRVA 3DEYX 2N47A 4PRZA 3PHBE 3D8NA 4FE4A 1ONOA 3O8OA 2G6TA 4J2OA 1A97A 1UMCA 2PTGA 3O2JA 3PI7A 2QRQA 3H3FA 3V7UA 4DA9A 4R69A 1DRJA 2PWAA 3ED1A 1SOVA 1FJXA 1TRHA 1TF2A 1JHOA 3FUXA 5CJPA 2IP4A 1W5FA 1NPDA 2CLIB 1KEEA 5FJIA 3USZA 1XAIA 2Y4OA 1WCWA 4WLUA 3AKEA 3EXHA 3GIDA 1BFKA 1Y7HA 1CLEA 2W00A 1YMQA 3GN1A 4RK6A 5CH3A 1XF1A 3PD7A 2QLFA 3NHFA 1H0RA 1I2ZA 2Y1DA 4LRYA 3G5UA 1SHTX 2BW0A 3NMUF 2OCKA 3IIMA 1L4GA 4YLGA 1V95A 4R0MA 4HNSA 3S8EA 1II8B 5J63A 1ZOPA 4O1IA 3LS2A 3X1JA 3NAGA 2F3UA 4Q39A 4YJHA 2K4MA 3G1TA 1XXHE 2JCSA 4OB6A 1H3NA 1CUJA 2EARA 3SEAA 4CKCA 3VHLB 4XVHA 4NBRA 1FQJA 1MPTA 4IVQA 4YRQA 3T4EA 3HCPA 3KCNA 1Y34E 4F4HA 2UXBB 1AT1A 2NVWA 4I0WB 1UDRA 1DP4A 2B30A 3NNSA 5JXJA 4LF8B 2IX9A 2VHWA 2X1LA 2ST1A 3NHMA 3ZS9A 3OFJA 2Q2QA 4N48A 1BJKA 1SUCA 1OXSC 1WMFA 2GEVA 3BRSA 4IOKA 1JE1A 3L0IB 3N05A 2V54A 1CUVA 3E22A 4JHXA 3A4TA 1XDGA 5JWOA 1LVHA 2H2GA 3VO8A 2FHPA 2Q21A 5IKPA 3FAKA 4KX5A 4IJVA 4BLUA 1ODJA 2W6ZA 2BMEA 3JQBC 3RTAA 1ACLA 1ST2A 5K20A 5JS2A 3TLZA 3EEIA 2DJ5A 5KX5F 1XRLA 3QUAA 3ONDA 1L4HA 3GMSA 3KTOA 5I9IA 3QEBZ 2FSHA 4R01A 1LDMA 2OGTA 4QE3A 2FMKA 1O0SA 2R3SA 2YW2A 1AHHA 3LX6A 1XMPA 4RDCA 1FFXB 1EUYA 4KO4S 3FHTA 1BMFD 1WKBA 2F1KA 3AW8A 4P53A 4QEZA 1R0WA 3CLTD 1XK7A 3D0RA 2QRHA 4I1IA 5K6TA 1P9RA 4MV7A 3BD9A 1BQ3A 2WTNA 1Y42X 3C6ZA 3DZCA 3EFBA 3FB4A 2C8LA 3GCGA 4KJXA 1O1YA 1W5EA 2MSEB 1UXJA 1PO7A 3HUUA 4MINA 1XQ6A 3THYA 1GCAA 2KMLA 2AMVA 3ZCUA 3WSTA 4JP2A 2Q3EA 5IAGA 4OCZA 2HA7A 5E1MA 4F45A 1MH1A 1CZOA 1GAEO 4PWYA 5M34A 3IKTA 2R79A 1LDEA 3L5OA 4UU1A 3ZBTA 4H3SA 2HSEA 3C7DB 4GSKA 4N41A 2A9KA 5DEIA 1B8OA 2IPAB 3DWGA 2BKUA 5JLAA 2W8ZA 2JLAA 4MUKA 3E7DA 1VL6A 2LVBA 3MD0A 1T1SA 2DMRA 3P4UA 4KWEA 2PXCA 4KNYA 4L0DA 2I5PO 4R2WA 2ALJA 3QF7A 4N0EA 2AOVA 1RJ9A 2QJWA 2JRCA 2JBAB 3G23A 4L9RA 4XAQA 3CUEF 3AHEA 3MS2A 3UA4A 3FH0A 3JVUA 3OIGA 4CTKA 5CDYA 1GNVA 3STWA 3ZYCA 3AHHA 3WY9A 1JHQA 3PWKA 3DXFA 3C24A 4EJSA 1UBMS 3EAGA 2CNKA 2R65A 3K96A 4L0MA 3RRNA 2PRYA 3VYUB 3WAJA 2CLMB 3CEHA 3MJRA 1E2DA 3RTCA 3GMTA 5I4BA 4Y6GB 1JJFA 4JP1A 1YO6A 1Z56C 2PH7A 2X8AA 5DBHX 4BZZA 3ZDRA 1ENPA 3W5BA 3DC7A 5MN6A 2GCOA 1F8FA 2ZJFA 1GGEA 3FVWA 2OLJA 3ZHYA 2X8BA 4EG5A 4EM6A 5BPHA 1IQRA 4UARA 3WMRA 3K8QA 4M0EA 5KOYA 5FPKA 2D2EA 2V6FA 3ANXA 4K9PA 5FBKA 5DI9A 2AK3A 3JAKB 3VNRA 5JPCA 2ZUTA 1O9GA 4P4TA 3DUWA 2WF9A 4JLKA 5L51A 2P2NA 3HSSA 3THSA 2P3LA 3GRCA 3NBMA 4RTQA 4K88A 2AEJA 1VYTA 3DPIA 4GLBA 5KOJB 1Z0DA 2HUPA 5HM8A 3A6HA 3HN7A 4ABTA 1GVHA 1YASA 2E5LB 4DLPA 3O75A 1WEKA 3J7AC 1P9OA 3EFOB 3SYNA 4QGHA 5BVGA 3H19A 4C03A 1OI2A 1NXTA 3T0FA 3N3BC 5JMOA 4HSGA 4ROSA 3ILSA 3T5TA 2GOYA 3NWBA 1GJRA 3DW3X 3RQSA 1DGQA 1RE1A 4JEHA 1W59A 2FSFA 3BJZA 4FEEA 2W37A 4Q3OA 4PRYA 1RYDA 4LHXA 4B84A 3ZW8A 2JG3A 1BJRE 1SKUA 3OHMA 2E49A 2IYFA 3D81A 2UYGA 1CG6A 3O4GA 4MUFA 4MYHA 4PIVA 2G0TA 2OK8A 1EX6A 4GKKB 3QHPA 4NY1A 4UXJA 1CY7A 1M1YE 1P3JA 2QJTA 2BMFA 2B1QA 4IMPA 2PGAA 3IR5A 5DTEA 2QD1A 2EG5A 1UWLA 5K7SA 5E1DA 4RA6A 3ETJA 4CM6A 3U44A 4DWJA 1B3RA 3GJSA 3ON5A 3ORYA 4EI8A 4FUQA 4AZVA 4Q6BA 1HETA 4KACA 2FJUA 3ISVA 3AK4A 3WNVA 4LKRA 3PQ2A 2Q49A 1QGUA 1RZVA 3KB1A 4QYIB 5JD3A 1X7WA 6ADHA 4ODIA 1TB4A 1QHHB 1BNCA 2Q3HA 2QM8A 4V3CA 2WMNB 3P4YA 1KO4A 1U5BA 3WP0A 1E9DA 1VLMA 3HLYA 5I7HA 3RTBA 1ZN2A 2ODPA 2VJNA 4EG1A 4MUIA 5AR1A 1IMOA 1ABFA 5D86A 1VMAA 4HDMA 2WB4A 4UHDA 3ESYA 2GCNA 4UDOA 4ZT3A 3IE1A 3WKEA 2UU9B 4YP1A 1Z47A 4HX9A 3VVMA 1X13A 3OCCA 2NNWB 2A7QA 4J4TA 4WXPA 3LHSA 4ZU3A 3G2JA 3KZMA 1A5BB 2HA0A 2WA1A 3C70A 5AI9A 2PMBA 5LVAA 2I4IA 4TWRA 3KG2A 4B5KA 2BI7A 4Q3DA 2K2WA 1LPOA 1ORWA 2YIDA 3KJFA 1KGSA 1TYCA 2J5RA 3HWRA 3T35A 2AG0A 3OU7A 4RKQA 2X41A 4WQMA 5HILA 5BMVA 4LTDA 3DHVA 5C1DA 1QMGA 2ISCA 4DLLA 2ICAA 2OBBA 1M0TA 5GZ1A 2BKAA 3OICA 2BFDA 4YRPA 4CCYA 4YRNA 3PU6A 5K4HA 1WPXA 2LR0A 3W8FA 3T1NA 3QMVA 1RMTA 2LBPA 2I78A 3NH6A 5KOIA 1GQSA 3CFYA 5C3MA 4DLAA 1H65A 1C8LA 2CHVA 3MCTA 2VF7A 1AS3A 5LMZA 4P3YA 4PQFA 1KVRA 4GPZA 4DRXB 3LPCA 2HU5A 2GCEA 3AILA 2FW6A 1W35A 1PNVA 1HPLA 3CURA 4RSHA 5CRIA 5I5EA 3SNKA 2DPMA 4OUDB 5CLGA 2ZBDA 1Z3CA 4L4ZA 2C7OA 1E79D 3PNSA 4E08A 2BM9A 4YRRA 1Q1EA 2B1IA 1PX0A 2PH1A 4EJFA 3MFYA 2XD9A 3OFVA 1Y6JA 4A0RA 3RVDA 1AN9A 4R8KA 2HJRA 3I3SR 4ZEMA 4YMSA 3AJ9A 3QFTA 5JD4A 1QFXA 1CRLA 2C5BA 3A06A 3P0RA 3S2ZA 2J3HA 4A8JB 4CR6A 4AWXA 1C2TA 2HPHA 4OH1A 5IP5A 1GKIA 2WYHA 3EBLA 1U8CB 3MD9A 1WBBA 4AKHA 4EDHA 5BY2A 5GY7A 3DMFA 5F7XA 2JAXA 4KZPA 3R8XA 3C7AA 1EE9A 2OM6A 1L7BA 1W0KA 2YWGA 3ET4A 4B4KA 4NC9A 2Q4OA 4CF6A 4NE7A 3H16A 1ZHFA 1GG5A 1TOAA 1M8JA 1B3BA 1PJRA 1VQ1A 3G3EA 2WMDA 3GCDA 4URWR 3SX0A 3WZMA 1R00A 2VUIB 5A2GA 5KYUB 2QIOA 3VISA 3HV0A 4ZODA 3Q85A 3PXXA 4M9ZA 1NXPA 2NTJA 5EWLB 2X40A 2KYRA 3EVGA 1XXLA 4TQUS 2YRXA 1TUBA 4QYSA 1JEQB 3I5XA 5COAA 4YVFA 2JAOA 1KZ4A 5JPDA 1WOYA 2W6NA 3IA2A 2YVAA 3EQZA 4IDNA 1JEYA 3H99A 2QMOA 1FMLA 3ZKAA 2Q6TA 4OI4A 1FSPA 3P96A 1YVEI 4MYDA 3Q10A 4X8MA 5DHPA 1ZH8A 1LZKA 5JNRA 5KNCD 3PQ7A 5AJZA 2FMHA 2Q4BA 4G9EA 1RFGE 1JU4A 1WF6A 3ZLUA 4F4DA 1CR4A 1T91A 2XJ9A 4HNGA 3FTNA 3H9EO 1M1UA 1O8BA 4ZCTA 1L1EA 1QKJA 2AYZA 2E89A 2GJKA 1TQ6A 3FFWA 4J0EA 4OBXA 1L1FA 3WRYA 1DIGA 2ECFA 2HA5A 1QTNA 4U63A 1V16B 1A8QA 1WP9A 3EQ7A 3Q7RA 1S9DA 2DFLA 2OHFA 5B3JA 4B3GA 1FOEB 3L7CA 1A71A 4O2BB 5JAOA 2CF5A 3WYDA 2BT4A 4MLZA 3OPVA 4DPLA 4ZO4A 3QOXA 1HT3A 1A5ZA 1RQRA 2FSPA 5ALEA 2H5LA 2D3TA 3W7VA 3M81A 4ARZB 3VAAA 4D0SA 3EIUA 1IM8A 2YNMA 2ZYIA 1O54A 3H5TA 4OG2A 1QTRA 5CMLA 3BA1A 2AEMA 1FYFA 2Q28A 1N0WA 4TMTA 3FYDA 1JDNA 3K5PA 3SS7X 5JZ9A 3F3MA 1RWOA 3SBXA 1NONA 1YB6A 1UCFA 5C80A 3HDVA 2R5WA 1ZD3A 1QS0A 3W2GA 1W48A 5AHWA 1GOTA 2VDKB 3G68A 3IB3A 3QLVC 4QOGA 5KJEA 3S0JA 3ZTYA 4YY3B 3NALA 3L0BA 2NXWA 3ECCA 2ZRHA 4J29A 1OPRA 3VH1A 2O6HA 5LJIA 3K9FC 1IQUA 4RD0A 5DV9A 3OO1A 2J0EA 7MHTA 1QIJA 3FNEA 1BHSA 2DWOA 2X5JO 3RI3A 3MWEA 2OLKA 2AZDA 2W11A 3GOQA 3DE1X 2C29D 4MVJM 4TS4A 1ABBA 3S68A 1ADBA 2HF8A 1VJ5A 3LSYA 3W4IA 3ZWVA 1FS5A 4J16C 5SZIA 5JATA 1PJ4A 2Q6OA 3UB2A 4U7FA 3ODPA 4KI0A 4DBLE 4CIWA 4M54A 5DP1A 3UT5A 2Q2VA 4K9KA 3V33A 1CTQA 4Y2PA 4UEOA 2OZLA 2I3ZA 2PQ6A 1JQDA 2ZYWX 4E2FA 5J2TA 4FQ5A 4Q3NA 2V6IA 4YT2A 4HDRB 4PSVA 1XGKA 1ODLA 3AR6A 2EP8A 2KX7A 1QIKA 2FZVA 1KZYC 4FMPA 3ZXUB 1I6MA 1A3CA 2ODAA 2D2VA 1FW8A 1Y9EA 5BORA 3O1JC 2XRMA 4U00A 1PTJC 1LLUA 2PKQP 4PHHA 5FPTA 1CY8A 5LSAA 1P4GA 2RGUA 1VLVA 5ALKA 5SZHB 5BUQA 3A3KA 5C1PA 1YDFA 2PSHA 2FVXA 2R7KA 2ZYRA 3AUJB 1SVLA 3H4TA 2H1HA 1QX4A 1SAYA 4YXWA 3CQ9A 4OSPA 4EHFA 2M1ZA 1IE3A 1F7VA 3VYTB 3C8MA 2ZUCA 3S2UA 3S1SA 3BAZA 1RZRD 2B4YA 4ZKEA 1O6GA 4LJ8A 4Q00A 1AF7A 1W29A 1V45E 4N0DA 3VH4A 4G65A 4YB8A 3S7ZA 3ZWYA 3DDWA 3Q98A 1WZNA 1RWPA 3QPUA 3QIVA 1C7RA 3ZCSA 1MTOA 4BNXA 1WPQA 3DVLA 2IUTA 3G2MA 3PPVA 3SSMA 4K81B 3EXHC 4KC0A 2IW3A 3L77A 1WU8A 3PQ3A 2RHDA 5AMXA 2ONJA 3OLWA 1KDTA 5EIBD 3GGCA 2VL7A 1Z8FA 4R31A 5JARA 4Q9HA 4DAOA 4KPYA 5ALNA 1T36A 1V43A 3IGFA 5ITZB 1ZJYA 1T5SA 2QN3A 1GSOA 1U3FA 1U04A 3A4MA 1L5SA 2HRBA 1YRQA 2KLHA 2IITA 2AOWA 1I4TD 2QZ9A 3N2GA 2ACWA 1F1BA 4N7MA 4CLRA 5KINB 2NXEA 3I0MA 5E3JA 1RJGA 1BDMA 5IF9A 1XMIA 2XNSA 1QFYA 4JLSA 4GEGA 1Y7IA 1TQHA 1YUNA 3S8MA 3UGKA 3G6WA 2OWDA 3MPOA 4G36A 4ZDKA 2GF2A 1M2JA 1SOAA 4NI5A 4BQRA 4QOIA 1JHZA 3KKLA 4OKIA 4Z86A 4IHJF 2XTAA 3CO0S 2BKVA 1QYXA 3R7BA 3SGLA 3BE4A 3T7EA 1NYQA 2INGX 4JAVC 3GJ4A 4DMCA 3KR9A 2VT7A 3NM5A 3R23A 2Q1UA 1JEJA 4MW6A 5KKAA 3IULA 1DLJA 5AVWA 1BSVA 1M8GA 2EFJA 1LJUA 1JFTA 4GYJA 4F3NA 3SY8A 3TQHA 3FMOB 1G8PA 1XTSA 3KJHA 3BKXA 3LCCA 4LN1A 5LXTB 2EJCA 4PRKA 1FBTA 1I33A 4V24A 2D74A 1J0CA 2WYIA 1XNRB 1GA6A 1Y5LA 4UEQA 1M8KA 4P0QB 1KGDA 1QZXA 4W1RA 5BWBA 1SUPA 3BKWA 1M1XB 4AY2A 2Y93A 3AI1A 3F6BX 3IBYA 3CH4B 1M7BA 3RBXA 1YRWA 3P19A 3H8VA 1ULUA 4JI4B 1WSDA 1DKRA 2CDNA 3ZHBA 4D7AA 4DCVA 3FOFC 1OYYA 2PG3A 4TTJA 5EHZA 2VQFB 1DQYA 1Q21A 4KDEA 1EDZA 1GXSB 4Q19A 3U39A 3FUWA 2VP4A 3CINA 2GM3A 2VQ6A 3LVRE 1BW9A 3G0IA 1BTOA 5CCBA 4H0NA 5CH5A 4CEHB 2ZRIA 1R4MA 1W75A 1IWBB 1WMBA 3K0FB 4FOTA 4IIYA 3SDSA 4ENVA 1P5ZB 3WL7A 5HK9A 1H3EA 2VJPA 1RBZA 3QF4A 3O47A 2NP6A 3HKBA 4I9UA 2I1VB 3ANSA 3QV1A