2MSLA

Solution structure and chemical shift assignments for the apo form of the receiver domain of nitrogen regulatory protein c (ntrc) at 35c
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
124
structure length
124
Chain Sequence
b'MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrogen regulation protein NR(I)
publication title Free energy landscape of activation in a signalling protein at atomic resolution.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transcription
total genus 19
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2014-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2mslA00
4Z4EA 3KLOA 2VYCA 4XARA 2PUAA 4O5AA 4EVRA 5T7BA 3CZ5A 2IOYA 1ZY2A 4RV5A 3HXMA 4G0MA 1BAPA 3TO5A 1LBIA 5IC5A 3F7NA 3SM9A 5KQGA 2ID7A 4NICA 4G0ZA 4JASB 3JTEA 5FWXB 4IGAA 2JCGA 4D6XA 4G86A 1K66A 3FGZA 3QX9A 4JB0A 5KC8A 2PMCA 3LUKA 2MSLA 3GT7A 4KQ9A 4E7OA 5HKOA 4KNYA 5IEJA 1H9CA 3GWGA 3P9YA 4HNSA 4WWHA 2E4UA 4Z9BA 3HCWA 4MR7B 2CHEA 2R4QA 4JP1A 1D2AA 5FWXA 3JY6A 2WWVD 9ABPA 1ZH2A 2L17A 4OBBA 2J48A 5TQ0B 4RU1A 1NXTA 5EWMB 1JFSA 2OENG 5D2CA 4MYRA 3NHMA 3TX6A 1ZVVA 2NZVG 1CHNA 4P98A 3F6CA 3GBPA 3CRNA 1YMVA 4O1IA 1Z2EA 2JBAB 2QU7A 3EAFA 4MR7A 4RS3A 4FB4A 2ID9A 2IPMA 1USKA 4RKRA 3S99A 2GI4A 1EWTA 3SG0A 1C0EA 5TQ0A 3EQ2A 2WJWA 1ZAYA 3NNDA 5BQ3A 5BR1A 5EWMA 5GOTA 4M88A 1DG9A 1VPWA 4H60A 3JPWA 3HVRA 2GKGA 2H3HA 1JBEA 2IPNA 2RJNA 3BILA 2PUGA 3HEBA 4XLTA 3RVPA 3T95A 4Z0NA 2JBAA 2PUFA 1M5TA 2JB9A 2FTKE 3M9WA 4EYOA 4EYKA 4F8JA 2QV0A 1JHZA 5B3JA 3F73A 3QLVC 1MB0A 4MR8B 4MAAA 5JNSA 4RK0A 1JFVA 5IEBA 5IX8A 3GL9A 2N9UA 4KPYA 4F3TA 1GUDA 3LFTA 1F4VA 3FFWA 4N41A 3N0WA 1PEYA 2MSKA 2JVIA 1A04A 4ETIA 3RQIA 1LBHA 2PL1A 1NXOA 1RXEA 2TMYA 3C3WA 3LMKA 1E6MA 2X7XA 4RXTA 4RSMA 2FXIA 1S8NA 4GPAA 5T3YA 1L5ZA 1YMUA 3URMA 4F06A 5BRJA 1A2OA 2A9QA 4TLMB 1JX6A 3C3KA 4IILA 1BA2A 2FEWB 3N53A 3HDGA 2L18A 5CHYA 1LK0A 2IPLA 3QELB 2P4UA 2FMHA 3LUGA 4N0PA 2FMIA 2HQOA 3HV2A 4IMJB 4H3KB 3MA0A 1U04A 2ZAYA 3GV0A 3E61A 4XAQA 2HPHA 3LUCA 2A9RA 1TM2A 4LE0A 5TPZA 1OXKB 4Z9AA 1BDJA 3OO1A 3MIZA 3QELA 4Q7EA 4NCBA 3CTPA 4PICA 1YIOA 4QPJC 3HJFA 2CHFA 4WZZA 2A9PA 3F6PA 3KLNA 4MS4B 8ABPA 3H75A 4KRFA 4LE1A 3DLBA 7ABPA 4O1HA 2PUBA 1NATA 4DQDA 3H5TA 3N75A 3QEMB 3DBIA 1W9HA 3ROFA 2MYUA 3N6VA 2MYNA 5DKFA 1DCKA 4D74A 1QP7A 1M5UA 4MS4A 1Z17A 1SXGA 1QO0D 2MYTA 3T38A 4EGSA 3A10A 3H5WA 1FFWA 1ZITA 3QX8A 4EVQA 1PEAA 4HNRA 3QEMA 4OTZA 1Z26A 1QPZA 3HK2A 4W5OA 4MLDA 3SAJA 2FEPA 3H1EA 5KWSA 4NV3A 1T34A 3W9SA 2IDMA 2RDMA 1NXXA 1GLGA 2WRZA 1DBPA 4YGXB 5IUKC 3DLHA 3VNAA 4RK6A 1C4WA 3RVMA 4Q6WA 1TVMA 2DRIA 5FWYB 3CNBA 3DGEC 1QMPA 2PJUA 5FBKA 3EJWA 2NT4A 3HM9A 3OLWA 4LDAA 4KREA 3C3MA 3I09A 4Z4HA 3LOPA 4B09A 1F51E 2WY2D 2FN9A 2I6FA 1U2PA 4WUTA 3IP6A 5KC9A 2PLNA 3H5VA 3SNKA 4EUKA 2E4VA 4OATA 6CHYA 5FWYA 5IUNC 2ZWMA 3QLTA 4F11A 1JLKA 1KMIY 3G1WA 3L49A 4GNRA 1EHCA 4ZPJA 5PNTA 3RVRA 3FFTA 1USGA 2KYRA 1GCAA 1SD5A 3O74A 4KMRA 4ZMRA 3Q7RA 5KQLA 4IMIB 1FSPA 2FQYA 3D8UA 4MQEB 4S05A 3N8IA 3EQZA 4G0PA 4Y9TA 3CKMA 4JA2A 5JNVA 4RXUA 2FKAA 3O2JA 4JB2A 4MS3B 4KQCA 4UHKA 5CNMA 1J56A 1DC7A 2HQRA 5B3JC 4FE7A 3EGCA 1Z2DA 4MQEA 2MYPA 1DBQA 2B4AA 2QW1A 3E3MA 4NCAA 2LPMA 2R47A 1P2FA 2WMYA 4L4UA 5DLEA 1QQAA 1AB6A 2LP4Y 1RZRD 2QVGA 3QK7A 4MS3A 2CD7A 4G0OA 1FFGA 1PUXA 4QICA 3QLUC 2M1ZA 4OG2A 5C5CA 3CS3A 3RVQA 4ZJPA 1ISSA 1Y1LA 1U8TA 1NTRA 3LUHA 3O2SB 1KRWA 3L6UA 1D4ZA 2RGYA 2JVKA 4RY8A 2F8TA 2XDYA 2H0AA 1QO0A 2IKSA 2FEKA 2M98A 3KJXA 1QKKA 1EWVA 3HZHA 3H1GA 4ML3A 3MQ4A 2QVCA 3CG0A 3RVNA 3BRQA 3N0XA 1Z16A 1JF8A 4Z99A 3BRSA 3HO1A 3CU5A 3NBMA 2WJAA 4PE5B 1BDHA 5CNJA 3EULA 1B00A 4RK7A 1YS7A 1XHEA 2JVJA 1FQWA 4LDZA 4EYGA 4MLCA 4RZSA 3OLVA 1QQBA 5I4CA 3OLYA 3QLVA 3SY8A 4IF4A 1WETA 2NZUG 4F12A 2LIVA 1DP4A 3DZDA 4EYQA 1R8JA 3OQOA 1E2BA 4TN5A 4Q6BA 2RJOA 5TPWB 1I3CA 3NNSA 4PZ0A 5ED4A 1QP0A 2L19A 3ROTA 3OM1A 4N0QA 4RWEA 3OLXA 5EWLB 5FBHA 4NQRA 2B1JA 3KG2A 3C97A 1IIBA 2AYXA 2FW0A 1MIHA 5KQMA 1URPA 1BDIA 1TMYA 1Z12A 4EVSA 1MB3A 3LTEA 3O1HB 1EAYA 2FMFA 2QSJA 4D6YA 5TPWA 5TQJA 2VUIB 3M9XA 2O20A 1W25A 4RKQA 5EWLA 2E4WA 4W5NA 1RXIA 3LKVA 3KS9A 3KTOA 2VUHB 3UKJA 4YCSA 2LBPA 1QNLA 3A3KA 3I45A 1JDNA 3LUAA 4CBVA 4MQFB 1M2EA 3KSMA 1U2QA 1U0SY 4YO7A 1ZESA 3IP9A 4KK3A 4RY0A 4ZMSA 1XHFA 1ABEA 1QP4A 2GX6A 4G0XA 1VLZA 1RNLA 2FVYA 3BBLA 4WT7A 3RVSA 1ISRA 1ZDMA 1ZGZA 3K4HA 4YLEA 4KV7A 5TQ2B 4MQFA 3KYIB 4OLAA 4LE2A 4YR7A 2PKXA 1E6LA 3OM0A 4IRXA 3O21A 4RY9A 4Z4IA 3HS3A 3VNBA 2NT3A 1CYEA 1M2FA 3C6QA 1L5YA 2PUDA 4RK4A 1DJMA 5JNRA 1DBWA 4G0YA 4QYMA 2HSGA 2R48A 1JYEA 1USIA 1NXVA 5TQ2A 4PYRA 3RVKA 3CZCA 4G0QA 2JRLA 2YHBA 4MPTA 3G85A 2GBPA 3DGFC 3O75A 1NXWA 3UK0A 2QZJA 3T6KA 3TD9A 4S04A 3OQMA 1JYFA 3TB6A 3MF4A 1Z25A 2HJ9A 1SRRA 1VRVA 2MSWA 3H5OA 2R25B 3KKEA 1DCMA 3NHZA 3Q7SA 1JFTA 2PUEA 3JPYA 3IPCA 3ILHA 1Z15A 1DC8A 1JL3A 3FFXA 3RH0A 3NNNA 4JAVC 5TPZD 4JOQA 1DZ3A 2IYNA 1RPJA 1TLFA 3H6GA 4WXMA 5KQPA 1GCGA 3CG4A 1K68A 3CLKA 1VKRA 1JH9A 2FLWA 4QYWA 3RVLA 5E3JA 2FMKA 3LUJA 3O1JC 1PHRA 3OMWA 3M6MD 1ZN2A 4W5TA 1NXPA 2PL9A 3KHTA 4OLBA 1YK1A 1AB5A 5HQJA 3IP7A 3ILYA 1YS6A 4MS1B 3RVOA 1BVHA 4TLLB 3JVDA 3B2NA 4FE4A 5JS1A 2HQBA 3FMVA 3OLZA 3GA5A 4YP9A 1NXSA 1PNRA 3QEKA 2P9HA 5DCLA 4WXEA 3IDOA 2FSPA 1APBA 1YK0A 2FQXA 3HUUA 4ZYLA 3MMNA 1Z18A 4L85A 3TMYA 1GUBA 1P8AA 4MGEA 1DCFA 4MS1A 4W5QA 1D1PA 2FN8A 1EFAA 3FDFA 1CEYA 3CFYA 4Z4FA 5GQSA 4H3HB 4YWHA 2A9OA 5BRAA 2NUBA 3BREA 3Q41A 3RVJA 5JNWA 1LJLA 2OQRA 1MAVA 1UDRA 3OMXA 1D5WA 4MR9B 2F8SA 3I42A 1OXBB 2QXYA 3CHYA 3D02A 5TE9A 2BGGA 4XXHA 1A0OA 3H5LA 3IPAA 5DTEA 4RXMA 4RK5A 1ZHHA 5EWJB 3JS5A 4Z4CA 4YRZA 3QLUA 2W42A 1SXHA 5IULC 4LZLA 4N03A 2QR3A 1P6UA 3A0RB 3GYBA 4MR8A 3K9CA 4DADA 1JWLA 2LUOA 4MR9A 1ZGGA 2YHAA 2V0NA 2IPAB 5CNKA 5CNIA 5JS2A 3HDVA 2E4YA 3LUFA 4N47A 2FLKA 1ZH4A 3LKBA 1TJYA 2JK1A 4KK4A 3H5IA 4TMYA 4YS6A 5EWJA 5JNTA 1DRKA 2E4XA 3OQNA 1HEYA 3H1FA 1EWKA 4ETNA 1MVOA 2L2QA 2PE5A 4KZKA 3Q9SA 1E6KA 4RDCA 1XWWA 3UUGA 3T8YA 1ABFA 1Z13A 5HSGA 3JVIA 2GWRA 2PAFA 4KVFA 5DGCA 5KI6A 3GBVA 1D1QA 3O2QB 1LJUA 3Q7TA 3R0JA 4KFCA 5HM6A 1JDPA 3O1IC 1SXIA 3KYJB 4LRQA 3MM4A 4MRMB 3EODA 4N76A 3N0RA 2VK2A 1RZRA 3I5AA 4Z4GA 4ETMA 5JNUA 2PUCA 3EDCA 3H6HA 4RK1A 1YTUA 3Q15C 1KRXA 4W5RA 4G97A 3A0UA 6ABPA 5IUJC 4XASA 2CWDA 3HSYA 3OO0A 4E7PA 2Q5CA 3SQNA 5IBQA 3GRCA 1NY5A 1P6QA 4XFKA 4LX8A 4UHJA 2AYZA 4MRMA 1FFSA 4P1ZA 3KCNA 4PEVA 4HYEA 5F64A 3MYYA 4EY3A 5ABPA 2WB4A 1PNTA 3LUDA 4DN6A 3IP5A 4HNQA 5C5EA 1YVUA 1DRJA 1KGSA 2FQWA 4YV7A 2E4ZA 3HUTA
chains in the Genus database with same CATH superfamily
4XARA 3NWEA 4CI9A 1G5TA 1P1RA 1TZCA 2X0JA 2HK6A 2XNDD 1N5LA 2Z2IA 1QGDA 1DJPA 4BO3A 1XNGA 2XCQA 1GAXA 1LLDA 2CLMB 5HDQA 1CLUA 3B78A 1F48A 1BH2A 1STOA 1TKRA 2FYTA 3FDXA 4FFPA 4NICA 1G4HA 2AZDA 1W4BA 1S0UA 1NJSA 5K3CA 3TVDA 5E95A 3QY9A 4WV3A 3KHKA 4GM4A 4IFIA 4R05A 5GVRA 3UHAA 2RHDA 5FAKA 1FX0B 2HSJA 2ZCUA 3Q10A 4LCBA 3VPSA 5KS2A 2I22A 4Z7OB 1G4AE 1KQOA 1KI6B 3N2LA 4P7JA 4ZDIA 3S1AA 1SXJC 1XZNA 2PUTA 4JJIA 1Z4KA 3DM5A 1IHUA 4TS1A 3H1PA 1XQXA 4E5NA 1CG6A 1CS4C 2YN2A 5K20A 3FI9A 2ZRAA 1FFXB 1QH0A 4NYJQ 4PSCA 4JC4A 4YAFA 1DJOA 1XJCA 3BMCA 4EKDA 2B99A 1PGJA 1N34B 1Q0UA 3RKRA 5IARA 3CLTC 4CKCB 3ZLTA 1E1KA 3X3HA 2EZTA 3SC3A 1VPEA 1YZNA 3DXZA 5ESWA 5EE5B 2O23A 1ZVVA 1ZC3A 2O2HA 4GLBA 4OGKA 5JD3A 3M1YA 1XZAA 2PZBA 3IVRA 5A3JA 3CR7A 2EKBA 3NH9A 2F48A 4C0BA 2C96A 2OCYC 3HC7A 4FP9A 2GI4A 4IH1A 4PTYA 3RAJA 3NC4A 3WLRA 1J6UA 2LDXA 3HKCA 1UWKA 4Q21A 3WTBA 3LZ6A 1VIVA 4X95A 3ENQA 1GZUA 3S68A 4ZV7A 2P69A 4GI7A 1VPWA 1VLQA 5M29A 3FIUA 5DYWA 2VPIA 4Q7QA 3KZKA 1IVNA 1II8B 1AUOA 3FOWA 4W5WA 4Z0NA 3SMVA 3T7IA 5DCYA 2HIAA 5KDOA 1T6BY 2GXSA 2J67A 5AESA 1HFEL 1RTKA 1S8AA 1Y4DE 3EFHA 4TYNA 2CNOA 3PFFA 4FK8A 1DEOA 1QONA 2QI9C 3UV3A 1BD3A 1ISIA 5IX8A 4E1BA 2F3UA 2EFEB 4UE6A 5CYOA 4O2RA 3QBVA 1GITA 1YNOA 4EFKA 3C2QA 5L45A 3U44A 2MSKA 4O4HF 2GWHA 4E08A 3ZWWA 4RAQA 3I01A 3LDAA 2V45A 2VNKA 1SCUB 4RD1A 2IL1A 1L4GA 1U9IA 1D07A 2ZVJA 3KP1A 1VHDA 2Q4RA 4OFXA 4RD3A 4LF7B 4FFDA 1RAHA 4IJWA 3HJCA 5D85A 1FPQA 1BVRA 5BRJA 2A9QA 4ZKDA 1JX6A 4INAA 2J4CA 3BTOA 5T57A 3ZG6A 4RC9A 2PTHA 2VK4A 5AVOA 3WG9A 2WKQA 4B7ZA 7REQA 2IYPA 3QELB 1JE1A 3U39A 1WDWB 4ND6A 1B8UA 3OX3A 4N0PA 2QLBA 4E51A 1EFRA 5IVDA 1UJ5A 5IDVA 1HUQA 2IZOA 5F21A 2GXAA 1M54A 3HRKA 2DY1A 3EF3A 1PN3A 4W63A 4LE0A 4OFZA 1NUHA 2QZPA 4F2PA 3GP8A 4XWYA 5FTMA 4NCBA 3RO7A 3AFIA 4PNEA 1YIOA 2AMFA 1ZU4A 4KXVA 1TVKB 3G49A 2O2EA 2CHFA 3G8AA 3H19A 5CXQA 2Y66A 3KLNA 5EHNA 2ESRA 5K0FA 1QTIA 3VKFA 1WO8A 1V16B 4LYJA 2PUBA 1U4NA 4WDRA 4PX5A 3I62A 1XCMA 3GFGA 4JLPA 4QYIA 3DUWA 1YV9A 4PQRA 4HDKB 4P2GA 2F1JA 2R3SA 1E79A 2O5EA 4YMHA 2QM0A 3FFAA 4WH0A 4IHQA 5LUAA 1DCKA 4LNHA 2HRCA 3RGWS 4BS9A 2VZLA 3K32A 5A03A 4H1TA 1TF7A 3OEHD 3T38A 3MJVA 4YPOA 3MAAC 5C80A 5CYGA 5DXFA 3ZWAA 3IT1A 2ZFUA 1E98A 1ORDA 4MV8A 3ER9A 1DAEA 2ZU6A 4UTRA 1QHHA 3E3AA 1WL8A 4BATA 1AMOA 1IWBB 1UIRA 2Z8XA 4YJGA 2FEPA 4V39A 1MGPA 4KN9S 1RLTA 2BZSA 3BMOA 1YJBA 1BN7A 3FY4A 3WKAA 4A8JA 2BW0A 3NLLA 5E1OA 4PANA 2W6NA 2ONCA 3CZPA 2OECA 1R2QA 3K8YA 5HCUA 1KYIA 2D4AA 2H29A 2I3DA 3KE8A 2B3DA 4L0DA 2FLVA 4R9SA 3RSFA 4BY9E 5FBKA 2ZRHA 3SR3A 6LDHA 3LJKA 2Q1UA 1GXSB 2YRXA 1DNPA 2XPCA 3FFBA 2BR4A 3GPDG 3IP6A 3PNBA 3BIWA 3GCZA 4ZOLB 2QB5A 3Q3CA 5J43A 4MV0A 2R6GA 1WW3A 2FPMA 1GGHA 4TVKA 5JALA 2J0SA 3R7FA 1WB5A 3LBAA 3K1AA 1GPYA 2AZ4A 3PGA1 4L2IB 3RVRA 2NYAA 1KYYA 3TRDA 2D1YA 4DHWA 4JV5B 4FW8A 3U9TA 3U1TA 4YJKA 3K0HA 1E20A 3B51X 3RRBA 4DBVO 4RWZA 3RCBA 3WWCA 4CFZA 1U1GA 1P2VA 4J0HA 4MJXA 5ARBA 1O95C 3BSSA 1R6DA 4ZYWA 1HA3A 4W6ZA 2YV4A 3C6BA 4B3SB 2O3TA 2QIPA 1A82A 2I91A 2BKEA 3O2JA 5JHHB 3U9SA 4FFWA 1GR0A 1ESDA 3OZUA 1KFKB 4JQSA 4NOMA 5LDGA 2K6GA 4YPFA 2XLBA 3ZW8A 3SZRA 4YDQA 1DDGA 2HMVA 1X2BA 1AN9A 3OEEA 4UU1A 3KLPX 2Z83A 1QQAA 5L3RA 2IP4A 4GPZA 4D99A 1JPVA 3T99A 4EPRA 4KR6A 1V5WA 2ZBDA 3P4YA 4LZZA 4MICA 1DOZA 3SXUB 4YY3B 1DWUA 4OMFG 3VPFA 4GKJB 1E9RA 3G9XA 1FQOA 3QLUC 5GJVC 5GY7A 4RX1A 5KAPA 1ISSA 2VZ8A 4U1RA 1YZKA 3MWYW 1BQ4A 1T8WA 4N5HX 5IC4A 2J33A 2H0AA 3F4KA 4NVRA 1J25A 4WSOA 1QDLB 3G6KA 3NVAA 5CLIA 3ZHUA 2JGJA 2VWGA 4CIXA 4QUJA 1N5KA 4OU5A 2YZ2A 3QFTA 3QFHA 2YYZA 3UNXA 1IIRA 5KSOA 2JD2A 2XQKA 1BEZA 3STTA 3HZHA 4BNGA 3O1LA 4NS1A 3G7SA 1SG0A 1IM8A 4WOPA 4BDTA 5AQ1A 4IV0A 2Q5JA 2NSJA 3N0XA 1FZTA 4ZC8A 2BKVA 1NJ1A 3R3HA 1RHQA 1ZYUA 3QWBA 4U9IS 5D1HA 4ZK6A 3JZAA 2JI9A 4URFA 1P7CA 1SC6A 3EVFA 3K2EA 5B5SA 1R8SA 5CG1A 1JR2A 2QP4A 1DEHA 3BC1A 1YC2A 4CR7A 1VHLA 1AKVA 1PL8A 5I4CA 4L5IA 2C2BA 1X77A 5K6TA 5CVUA 1D8AA 4KQGA 1RJDA 1F0NA 4PO9A 2AW3A 2IBMA 1I01A 1L5WA 2F43B 3NVMB 3HB1A 1E8DA 1P9LA 2J30A 4OHUA 2VDVE 1JRLA 3TLYA 3AVTA 3ZQUA 2EJTA 4TN5A 2C5EA 3PJGA 3HYCA 3OCZA 2W8BB 3L06A 4GKAA 1E89A 4DUYB 5D86A 4U2BA 1QP0A 3R6DA 2EQAA 4G09A 3EYWA 2JIOA 3INGA 1FDTA 4C2AA 2G72A 2QJTA 3RJ5A 2H5JA 1F6DA 4YQEA 1SVMA 3U5TA 2HN9A 4H7PA 3T1QA 1EX9A 4JUCA 2HMSA 4JOCA 1ZRNA 5E2IA 4DMLA 2WD9A 1KY3A 2C5FA 2OYCA 3OCWA 1MB3A 3R75A 1NNEA 3LTEA 1ODLA 4FLFA 2ZYWX 5LP6B 1EP1B 2D8MA 3D6TB 3QEJA 3Q4GA 2DZDA 3A4MA 3OKAA 1PYDA 4YCSA 2DWUA 1QFYA 3CZQA 2RHCA 1UADA 4O4HA 5ALJA 2PSJA 3SHVA 3ETHA 4TQ9A 3WBJA 2C3OA 2EGGA 5CFQA 5AVQA 5DRYA 2HT1A 1IAQA 1QGZA 4Y67A 3GW8A 5DIFA 2VSNA 1R5NA 3PQ6A 4BVBA 1PZFA 4IDDA 4AWBA 1G0OA 3LQRA 3GJ0A 2BI7A 3ZDEA 4ENTA 3QMWA 3BSWA 3MIIA 4MVJH 4XIJA 5A0VA 1G19A 4B76A 1K7XB 3U62A 3WKEA 2B7BA 4HX5A 4KQFA 5F5LA 1E5LA 2A0FA 3N39C 2PKXA 4LY9A 4JI3B 1N0HA 1QB7A 2OAQ1 4HWGA 4QFBA 5DSZA 3VNQA 4AN0A 5B2EA 3AJRA 1NJ2A 1HTWA 1UXHA 2C5LA 1PAUA 5GOZA 4DUGD 5KQRA 3OE7A 2R7KA 1FSZA 3BMQB 3DZKA 4O4JF 1A4RA 4DANA 4L78A 1J07A 1OLOA 5ERGB 2HSGA 4BP8A 1PR6A 3BE4A 1IULA 1IAVA 4G0QA 1MFPA 2Z95A 5BSUA 2JRLA 1C4XA 3ZQJA 1B76A 1ONPA 2FUNB 2V6JA 2BEVA 4QOSA 2BKXA 4RQUA 4EW6A 5BT8A 5JUWA 4V3BA 2HK8A 3GGCA 1E1MA 1EFDN 2PZ8A 4L5CA 2HJ9A 1SRRA 2J6BA 4JYCA 1MH9A 4MWGA 1GNPA 2NZWA 2WVHA 2HCBA 5F5NA 3LXXA 3K96A 3IMGA 1BYUA 1W59A 3L7BA 1BXGB 3V48A 4UTNA 3U60B 3QWIA 1W1UA 2A1UA 3HCBA 4R9VA 2WF9A 2WIJA 1J2JA 3CPHA 3LA6A 4HATA 4IRMA 1TM7E 2JAOA 4RF3A 2IYNA 2I4TA 1A9YA 1EZ1A 1IZ7A 5CB6A 3F8SA 2W2MA 2XJ9A 2BCGY 1VKRA 1X7WA 1K6IA 2FG6C 1RJGA 3LFHA 4XQ0A 5K5EA 4P3YA 1V41E 3I8OA 3I30X 1CUZA 3BERA 3F3MA 3G0CA 1K97A 4OXYA 5JCOA 1XDZA 2VNHA 2R0QC 2A0WA 2AG6A 3H9EO 1QFSA 4RA6A 1T0HB 1YK1A 2G9VA 2DBRA 3IP7A 4H7DA 3EEFA 1GG5A 4MS1B 1H9AA 3DCIA 1QH1A 1M6YA 1TW2A 4FE4A 3JQCA 4OSOA 4B8WA 4DMKA 4EHDA 2GSWA 4Z54A 2VKQA 3TW0A 4LMPA 4DRXA 3HA5A 1OB5A 4URWR 1SWWA 4RJKA 3I9LA 1OQAA 3GN2A 4WXEA 1WU7A 4GLOA 4PLHA 4J0IA 1YZYA 2AFHA 2ZK7A 1YTLA 3UQZA 1OYVA 3T15A 3DG9A 1CYEA 1ZJZA 2J08A 2H4HA 2C9ZA 2QL9A 2H1HA 3FF4A 3JWIA 2BDTA 4M49A 1L3BA 5KJEA 3U31A 3ZHYA 5DHQA 3P0IA 1PSWA 3TLAA 3A6PC 3MGCA 3H87A 1JWBB 2YQZA 2GN6A 2QTGA 2G5CA 1UFQA 2VAVA 3U4HA 4BWFB 5BRAA 2EW2A 3CXRA 4UE2A 2IHJA 1VKNA 2J0UB 2QTLA 1R9GA 2GCOA 3D2AA 4UJ3A 2F8SA 3A28A 4KE7A 2Y0CA 3R0QA 4FM9A 3R4CA 5BV1A 2YWHA 5DTEA 3OZEA 1LF5A 4R2IA 4PAOA 1XUOA 2Q3FA 3WGVA 4GDMA 4YRZA 3HA3A 1BCRA 2HYDA 3NBKA 3E6AA 2OGWA 1N9KA 3FD8A 4QXOA 4U39A 3RG8A 1LJ8A 1V71A 1K7CA 2Q9AA 3PFIA 3QJ5A 3EGXA 1PL0A 3IELA 4LPKA 2QEQA 1GWNA 5CLGA 2W6PA 4JUAA 1WRBA 4NCJA 2V03A 3LUFA 1EZZA 4Y9DA 5JQGB 3VR5A 2BIFA 1VTKA 4U7GA 2XB9A 3G2QA 1Y8QA 1BFUA 3R3WA 3EMBA 1YR8A 3GVIA 1A8PA 1DELA 1A5TA 3GR6A 3NUZA 1E6EA 5G2OA 1MORA 3GGGA 1VJRA 3U3JA 3W9BA 5K8LA 2F67A 1T91A 3UJ3X 1XZHA 4C29A 3BXXA 1V4BA 4RDCA 1XWWA 3VU1A 2H4FA 4HAUA 2QBYB 3H11B 1VJ1A 3WA6A 3BWBA 2H7YA 1Z5PA 5SY6A 2AFVA 4JOBA 2ZUEA 2VIIA 4QG7A 2GCEA 2R96A 4UHCA 3OU7A 4ZVPA 1RAGA 1E7MA 3GBVA 3IKMB 3FOEC 4EKYA 3T7EA 3AI1A 4RTPA 3R0JA 4HADA 5LOVB 1EG7A 3MWKA 4FMCB 4A10A 4PNPA 1F7VA 1FDIA 2PMBA 4QT4A 4DCSA 4TTJA 3O8OA 3IQDB 2F17A 2VK2A 4JQYA 4L02A 4YFVA 3ZDZB 3D3EA 1A9SA 1Z0JA 1JHPA 1OFTA 1Y7LA 3DMFA 3H6HA 4PLGA 2EF0A 1E5VA 1WA5A 1SBIA 2WT9A 2XD9A 3UWDA 4W5RA 2EZ9A 4B73A 4RLHA 5IJZA 2YV5A 4GQIA 1MIOB 3LT2A 2XDWA 1NY5A 1QYWA 2EX1A 4MCIA 2QN9A 1UIMA 5EGSA 3QY0A 4PG8A 5J47A 1XTBA 3GFRA 2WYUA 3I8XA 5LC1A 3PVZA 1KZHA 4C30A 2REQB 4YONB 3RYFA 3HCDA 5BSFA 4N5IX 4IJQA 3NP7A 1DRVA 2G1JA 3SDZA 2C3UA 2WT4A 1E1DA 3N7AA 1QKIA 4FYKA 4TKVB 3D6MA 3FTFA 4ID3A 5E7IA 1XMVA 4Q82A 1UZAA 4DKJA 1MO3A 2ZUTA 4H77A 5BVHB 5KKNB 1HDYA 3L8FA 3GU3A 2ZP1A 3TO5A 4JEIA 1C1DB 4TL8A 2CNNA 4KNVA 2Y1CA 4HDMA 2P11A 4UHHA 1Y8RB 3C3AA 4G0ZA 3OVMA 1FTQA 3IVAA 2O6HA 2MCFA 4MULA 4DA7A 4LTDA 1HNXB 4JB0A 1XA0A 4LF6B 1F5SA 3AEUA 1SCQA 2GNOA 2PMCA 2UZ1B 2NPFA 1CQIA 3CUUA 1VBNA 2E4UA 3L3BA 3JQ8B 2ZJFA 3U6KA 3JY6A 3P97A 3D6NB 5F23A 4BGVA 2ZSAA 2BJHA 2XRYA 4IGFA 4DIKA 5ITWA 4PIMA 3BGVA 1H8ED 3CLVA 3RARA 4I1RA 2E87A 4ACBA 3VH2A 3E5RA 1UOPA 2NZVG 4R5MA 4Z4QA 3TQFA 2Q5FA 1O57A 2OCIA 1K5PA 2QW0X 4P84A 3AJ8A 3FGOA 1E9VA 2ZIEA 3CWZA 1YHNA 3V7UA 4D43A 1EWTA 2B92A 5AVSA 1Q11A 5ED0A 3GJSA 2H92A 1RC8A 4MHSA 1HLGA 1R8QA 4BV8A 1F8UA 1PJQA 2AOUA 1ZD3A 2YIMA 4JIGA 1RLMA 4RD4A 1RWOA 2RGNA 4O4JA 1D0VA 1N0UA 3PFWO 3R0XA 2AUMA 3GDWA 4W99A 1WPQA 2G36A 2HY7A 4IWYA 4EI7A 5IVHA 3CSUA 3ZI4A 3NTUA 2PUFA 2FNAA 2BFMA 1CKEA 2ATVA 2QTMA 1W52X 2QV0A 2UVPA 2NP6A 2NO5A 1J21A 1JMYA 1FVFA 1NVBA 3GLUA 3G0BA 3QU7A 3UAYA 2VDWA 5KQSA 5J2TB 2VNJA 1Q7GA 2NTYC 1P0FA 2G25A 3QOXA 4NU0A 3JQBC 1WJGA 1M8FA 2VA8A 3I32A 1RWVA 4EQ6B 2Q99A 1Y80A 3IVCA 2G0AA 5EPUA 4BKMA 1T1EA 2Q0HA 4CL8A 3OC6A 1W85B 1L7PA 3EJ6A 2ZKLA 3WYGA 3ZWCA 1UAAA 1N5RA 4W82A 1U3GA 2ATIA 5CITA 2V55B 1A04A 4H18A 4YMVA 5BSEA 1RLJA 2H48A 3IUNA 2GPJA 4C0QC 2CNLA 2FXIA 5IDWA 3AVXA 1NVVQ 4WINA 1YMUA 5A7HA 5IM4A 5EHQA 2RHLA 4UARA 1KI2A 1NNUA 4EITA 4DJDC 1GFSA 1UK6A 1RRCA 1H85A 3ZUPA 5CHYA 3ODPA 1D5CA 2VS1A 3AB3A 1Z7EA 2PV7A 3BD7A 3GDGA 4WLOA 1P1JA 1TZMA 2A58A 1FP4A 1ZRHA 3D0QA 4IMJB 4H3KB 3LQ1A 4QTTB 3RIEA 1NW3A 1PKXA 3DE6X 4UU8A 1N78A 2FI1A 3GG2A 4JWKA 1D4FA 1WZIA 1YKGA 3MUEA 1ZGHA 4U5XA 3WRYA 2R6CA 1R9MA 3DEIA 1DX9A 3QOWA 1J9EA 2ODNA 4M99A 3INRA 1PQPA 4U4AA 5BSKA 1G8AA 2FCAA 4L8GA 5EJ4A 2FPUA 2AX3A 5EZ5A 4WA8A 2GEBA 3QBJA 5DM60 2D1SA 4U6NA 1D04A 1MXFA 4MUGA 3BFKA 2P2SA 3I6YA 4LWOA 1J23A 3A4IA 2NV0A 4D3YA 4DQDA 3EFOB 1K8QA 4YUWA 4JYAB 3MWEB 3DBIA 3NV7A 4YRRA 1PFQA 3PHCA 4ZV9A 3SHTA 2QLNA 4TRNA 2QMUA 1CR4A 3FPLA 3C4JA 4GOJA 1I32A 3JQAB 5HR5A 4S2UA 3I53A 1TFUA 5I4KA 1E77A 1SXGA 4O8CA 3MRVA 5IKMA 3ZXUB 3EEYA 3FKSD 1R74A 1ZITA 2WILA 3E7FA 2QMZA 3GOQA 4N3AA 1DIOB 4CLRB 5IABA 4FUTA 2FW7A 1FNSA 5LBUA 3WWPA 4DZTA 1YF3A 3UMGA 4LNUA 1TL7C 1DC6A 2FPWA 3K70B 4L7QA 4X1KA 3KZVA 1PR1A 3WDLA 1ZUIA 2VJDA 1EINA 2WRZA 3TW6A 4MHOA 3SSNA 2RJ3A 3GEDA 2XE8A 1IZYA 5KNLA 1YDHA 2FR0A 2N46A 1OLXA 2D0OB 1MQSA 3UGJA 2NT4A 1KDPA 4JUFA 2V7GA 1YFLA 3KPUA 1NF8A 1X39A 4S35A 3V7YA 4DDMA 1C4OA 3AK4A 4KOEC 3RS2A 2DTDA 3JWEA 3X1KA 4JI2B 3OOEA 2AJ8A 3IOYA 5H02A 3ZXIA 1OH7A 1UMKA 3VKHA 5BQFA 5CA1B 3H2SA 5GMOA 4E2XA 1EVZA 1H2WA 3QUCA 1IHDA 4YQFA 2VQ3A 5K9ZA 2J9XB 3L49A 4BJ5A 4E0BA 1GU1A 4YBZA 1USGA 2VQ6A 2ZJ8A 3MGBA 3REQA 1XJ5A 3ESAA 2R6HA 3DMNA 1ICIA 3BIFA 1S1CA 1EI9A 3K15A 3Q7RA 2AF3C 4JBIA 1EJ6A 4WNCA 3F2IA 4ZQGA 3S28A 1ND6A 1T3HA 3ME5A 4HQOA 3VUFA 1ZKMA 4XSGA 4POOA 4KIGA 3G5LA 5IJAA 4II2A 2XCRB 2H1SA 3ESYA 3JVUA 2RHRA 3CKMA 3LO5A 3PGXA 2B36A 1GKKA 2ODPA 3VHQA 2BSXA 3I2IA 3WV5A 2X1VA 4W1SA 4UVHA 2AB0A 1RXYA 2XDQB 3UMMA 2XGOA 4NX2A 3DBRB 2NSDA 1R66A 3WGKA 1RBMA 3M5WA 3HE3A 5K0JA 2I62A 2QNIA 3E8MA 1SZPA 1SOVA 3N28A 5K6AA 1QE3A 2LP4Y 3E9YA 4J91A 2C9BA 3LLVA 1V5EA 2GK3A 3CEMA 5FOVA 3UYLA 1JDSA 2GZ2A 4YNBA 1UXIA 1DXYA 5LZ2A 1LLUA 1QSGA 1G20A 4PSKA 2F1HA 1KMNA 4KHZA 5DHRA 4K87A 3OE5A 1UWVA 1BCSA 1GUZA 1Q7RA 3A70A 4UATA 1CY2A 3O2SB 4KR2A 2VA9A 2LTAA 3L6UA 1US8B 5LLDA 3AU9A 4DWOA 3WGIA 2WJVA 4M6WA 3OEHA 3P20A 2VJKA 1U81A 5HE9A 4GECA 1P1BA 2G77B 1QKKA 2XUDA 2FK8A 2BJWA 3EF1A 2R4TA 1IZZA 2G06A 2KX7A 3EQ7A 3TSWA 2XQGA 1RBZA 9ABPA 2XVXA 3ETGA 3N2GA 1G1MA 2NPOA 4GVXA 4D9EA 4RPJA 2NO7A 3T5AA 2PSFA 1E9BA 4O4LB 3HO1A 1G18A 2YRFA 1S2NA 1EX7A 4UXHA 3NDIA 1K75A 4M1SA 1DWQA 1R6UA 2ISCA 3UTDA 4ETWA 4J0KA 1WY7A 3I6IA 3R3XA 2G3YA 1TKAA 1I4WA 1SVKA 2IF0A 3SSOA 5IF3A 2ZCJA 4ZRDA 2QUJA 4EYGA 1H05A 2XD4A 1H69A 1EVLA 1EP3B 1KQGA 1QQBA 4PQYA 2RGCA 3H6KA 3H2YA 3TIFA 2ZJBA 2UU9B 4UUPA 3KZXA 3ITNA 3PT9A 1UBRS 3NI2A 4KQIA 4N12A 1YRQA 3ZU5A 2QRQA 2WK1A 2AR0A 1GTMA 1ILWA 2ZIWB 3GRKA 5KYXB 2C4TA 4JKYA 1WE2A 5T8KA 3TQQA 2AFIA 4IR7A 3DMTA 1G38A 5JLJA 1YASA 1UEXC 4P3OA 4MUHA 3ODGA 1GSIA 2XNCA 1TE2A 2WWGA 4QOEA 3E7WA 4EOGA 3FSGD 2XNSA 1Y63A 3IC5A 3UJ9A 4DMFA 2C2MA 3LS2A 1SVIA 3FZGA 2D4HA 2HMYB 3L82B 2DQSA 5BO5A 1R0RE 3PK0A 3Q87B 3LBFA 3FPBA 4EECA 2QSJA 3GVHA 3LDHA 2X0FA 3E4CA 1KQFA 2LW7A 1J90A 5HK9A 1GQQA 2E9SA 5CJJA 1SUSA 2WMNB 5ILOA 4RTOA 3GLGE 3O0DA 4BNHA 1W0KA 5ENZA 1L8QA 4C21A 1K4YA 3KD3A 3MHPA 1EU1A 2SBTA 2XBUA 3OFJA 2R1VA 4H7HA 4TWIA 4E2WA 5F2NA 1OZAA 2C94A 5M04A 2VP6A 3PC6A 2BTQA 2Q50A 4REQB 1BGWA 2I6TA 1IJFA 2XZTA 3TTTA 2DC1A 4PBRA 4RD0A 2G04A 3ZHZA 4AJHA 2IYOA 1JSCA 3HN6A 3ZLUA 4J2OA 3TL6A 4C4OA 2VR1A 1O9BA 4MOWA 3KV3O 4AROA 1F7UA 3ZXXA 2GTIA 3NU1A 4W8GA 3WIOA 3WWDA 1A9XB 1EVEA 1EP2B 3K0CA 4MQFA 4X1IA 3TLEA 2HCTA 1Z6QA 2BGKA 2IEZA 3C6QA 1VIMA 4C7KA 2I2BA 2G4VA 3BMXA 3PF8A 2AG5A 4J1NA 2GJKA 5F7JA 2PZEA 3NW9A 3R0VA 2I9PA 1M1ZA 1XXHA 3TQTA 1OFUX 5D3MA 4DV0B 4J4TA 3K6SA 4ZAWA 3I1IA 5ULLA 1V43A 3KQSA 4ARBA 2NYRA 2R11A 3E35A 3QFRA 4BV9A 3DM9B 5IYZB 4US0R 2GPYA 3AF3A 4ZV4A 1ES9A 1ZAKA 4FD2A 1G63A 2MSWA 3VSDA 4BLOA 2PUEA 3CEHA 3IPRA 2SNIE 3PWZA 4YR9A 4RJ2A 1P2DA 1NW5A 1TJ4A 5KTNA 2ICAA 5DT9A 1MB2A 3SYMA 4LSGA 3ZIAD 2G0TA 3REGA 3A14A 1DWOA 1U5AA 4D0RA 1ND5A 4CTMA 5A7FA 1B14A 5KX5F 3GLFE 1RC1A 3R5HA 4BLRA 1T5DX 3BX1A 3L8DA 3O1JC 1PHRA 2YVLA 4FKMA 1YGPA 4HRAA 1OYOA 1IN7A 3CNLA 4U2FA 2QN8A 3AQ4A 5CEJA 4M83A 1ZX1A 2GKOA 2BM1A 1M2VB 1YS6A 3KKNA 3SZGA 1H2HA 1V45E 4RE5A 4M54A 3IXQA 4RVHA 1ILEA 5JS1A 2P2YA 2O0MA 1GPAA 2G4CA 3R3JA 1E2FA 1OBOA 1UDWA 5E4TA 2WA2A 4IH4A 1XEWY 4E1VA 5I5EA 5B64A 3IDOA 4M8KA 5D7BA 4OQDA 4DIFA 1G17A 4B17A 3TW4A 1C5KA 1UPBA 4U6SA 4X93A 3ZK9A 4CHGA 1O97D 3BCUA 3T9EA 3HP7A 1KZYC 1LI4A 1SCIA 2FOLA 3QIAA 4IZIA 4XFDA 5TMDA 1EFAA 2ODEA 3NRBA 1DG3A 1G5HA 4C4AA 1L8OA 2N3ZA 2NGRA 4KXWA 5T67A 2IYLD 2ORIA 3LL7A 3VAZA 4FEGA 5FOWA 1O96A 1E9DA 4OL0A 4K8RB 4MR9B 4X8LA 2PGNA 3WLEA 3I9JA 2RGXA 2QR5A 1K92A 4FHDA 4KDFA 4XIYA 3EW9A 4MRSA 4LGMA 4FWBA 3VYTB 4A6DA 3ZZ1A 2ZM6B 2X8WA 3P0RA 4RXMA 3ZJTA 2D1RA 3P8ZA 3HA2A 5EWJB 1Q16A 3OP4A 4GP6A 5HIIA 5HF6A 5C4IA 4PM4A 3SHFA 3C7TA 3KKZA 3U61B 1EEXB 3P52A 4GF5A 5B6PA 3ANNA 1E60A 1X3SA 1CS0A 4H0FA 4UAUA 4ZTBA 3F67A 2ONJA 4B47A 2GEFA 4YRSA 1YDWA 2H1IA 1UKZA 3T9FA 1XBTA 2ORYA 4HWPA 2AC2A 5FEMA 2MT9A 1HEYA 4MLPA 4C7BA 1U90A 4KI0A 1JR4A 2YZ7A 3TB6A 1C8BA 3FRIA 4QYXA 5E1BA 4R68A 1E1LA 1I7QB 5J4HA 3V34A 5IVIA 3VSCA 3BWVA 3PS9A 3TSZA 4F2HA 1N32B 2PUJA 4A2CA 4INOA 1T3TA 2PZAA 3A3NA 4KIFA 2GPWA 3TCKA 1P80A 3P5BA 2OG2A 4LQDA 2PR7A 4BU0A 5L3VA 3JVIA 5LP6C 1Z2AA 4ADSG 4OXNA 3OU2A 2E0IA 2CJXA 1VLHA 4FSHA 4HB3A 4QRIA 1NN5A 3ENWA 2A5DA 4M9UA 4IDNA 3BXFA 3FLEA 4N18A 4L9WA 3Q7TA 3MHTA 2CDNA 3A6JA 1EGVB 2I4OA 3BORA 4B7XA 5KNDD 5JJLA 2O8DB 3CRW1 3KL4A 2BE7A 5NLLA 3CF4G 2RB5A 2I4RA 4JJFA 1YNSA 3L7AA 3PSHA 1OGJA 3ZYZA 1Z4OA 5H1YA 4EHLA 2PUCA 4HDRB 2A59A 4GMFA 4RKEA 4CF4A 1JJ7A 2ZULA 5I01A 3DUFB 3EZ6A 3QMMA 1E7RA 5K1ZA 4C76A 3HSYA 5BOSA 2P6NA 1HDGO 1P3JA 3OQPA 2XMDA 2CSUA 4P83A 1LXCA 5F33A 3EXHA 3J7TA 4QO8A 1XTTA 3V97A 2I99A 3W6ZA 5TF0A 4P1ZA 4UM7A 5G53C 1VPTA 2J9RA 4EY3A 4FGJA 3LUDA 1LBTA 3VC3A 3NYQA 2OXEA 1HURA 4TKUA 4XJVA 4ZI3A 1KSJA 3ZDRA 4XRGA 4YCLA 1BJKA 1YA6A 2IGBA 4P92A 3BCRA 1YCHA 4UUNA 1ZK0A 2RGEA 4QZVA 3A4VA 1AQUA 3K6RA 3S1AB 5DCWA 4MUEA 5REQA 4U02A 2PGIA 4HMQA 1P4RA 4O25A 5C4MA 5JARA 3SIXA 3TX2A 1X86B 5CUQA 5IKEA 3Q8MA 3H9CA 3U7EB 3BMCB 4C7JA 1ZWLA 3LC2O 4KUHA 1IXSB 1YKFA 3FZQA 5TT0A 5K2OA 3ER8A 4BFYA 3QV2A 5J40A 5C8DA 1KO1A 1TM3E 2OD9A 3H2BA 4N7BA 5IEJA 3RFUA 3AESA 3RTGA 3WMFA 2G83A 2YKGA 2VDLB 1SCAA 3JQ9A 4L08A 4Q1CA 2PHZA 3U7HB 4S12A 3TUZC 3ADKA 1QDEA 1DOAA 4TZTA 4PR0A 2IDZA 3HKCB 5J5VA 4HQNA 1O94C 2IIQA 3ZWPA 2A3RA 2RHMA 3GAZA 4YALA 4XWWA 1F2UA 1KMHB 4FSDA 1CUYA 1YB6A 4L1KA 3TX6A 2ZJ0A 3D54D 4EB0A 3M83A 4X8MA 4YIKA 1CHNA 3WGYA 3LAWA 5EXSA 5ALOA 1FW6A 3PB3A 2A1IA 4D25A 4JT9A 2ID9A 1C7QA 4RKRA 4CCSA 4UHBA 1Y4UA 3ZEAA 3GPIA 1U28C 3I05A 3WGZA 1HV8A 3EQ2A 2XMZA 3A6DA 1QNFA 2NM0A 2VWHA 5C7YA 5J4VA 4NL4H 5AI0A 1JA1A 1JV2B 3OE4A 1BWRA 2C59A 1Q1AA 2XWQA 2NZ8A 4FQ5A 1NYLA 4H2DA 3RUHA 4F8YA 2IPNA 4B6GA 3IJ5A 1JBKA 4N5DA 4N5MA 4M21A 4AY4A 1YUBA 4J76A 4B82A 2II6A 2CKDA 2GT1A 2JB9A 2GYYA 1Z0KA 3C48A 4QEZA 4WZBA 4RH3A 5CURA 5K3BA 4EYKA 5KNBD 5DNYB 2YVQA 3U44B 1D0SA 1BJTA 4FFMA 4DOMA 3ZGZA 3BIJA 4RETA 4Q3OA 1MB0A 3RT1A 1NBAA 4GFDA 4INPA 3H42B 3FDJA 5IEBA 3VZQA 4PZAA 2HZBA 4PAGA 4QRDA 2BEUA 5JAHA 3ZJUA 4AKEA 4G01B 1R0SA 1F17A 5F7OA 4EG8A 1K3FA 4JT4A 7REQB 4ZP1A 3LWDA 4BKOA 2JVIA 4KYVA 2WOOA 2ZRIA 4INJA 2BEKA 1SQ6A 2PL1A 4HY3A 3LMKA 1HH4A 4KR0A 1B0AA 4E2ZA 4HSGA 2JGFA 1V6CA 2P2NA 5KX5A 3B36A 3V4VB 5E38A 1NW4A 1TCUA 2AG8A 5C5IA 3SP1A 2XW6A 4IILA 3HKEA 4H7JA 4KFTA 2I6XA 1JLLA 1HNNA 2IS4A 3EPJA 1Z0FA 1PJCA 1XRJA 4M8IA 4AP9A 3IGFA 5FP0A 2BH2A 3L7DA 5KDDA 4OVKA 3QE3A 1SVWA 5U4QA 2NU8A 1I14A 3EUFA 5AYVA 5JZ9A 3H8SA 5ICSA 4WA7A 2ZUBA 3DOEA 5HG0A 5BWCA 2GDJA 2JEOA 3AUUA 5F2OA 1Z9BA 2VTEA 4HGRA 4S3MA 4EA6A 1OXKB 3AOEA 1M7BA 2EFYA 4XUDA 5BSHA 4QYIB 5JS8A 1ZN9A 5AM5A 3DL7A 1BWPA 1TCBA 3A6EA 5A5EA 4G1UC 4DS3A 2GSDA 4R3UC 4F4JA 4BFXA 3HJFA 4MROA 2FSIA 2HBRA 2B78A 1AGXA 3B6EA 1SXJD 4HGPA 2LCFA 4F2GA 3LQYA 4MI3A 1H8EA 2QRUA 3V5NA 4B2LA 2Q5OA 4KMSA 1QHHB 3EIWA 1Z2OX 1Z6TA 3QA3E 4W6QA 3UUEA 4E5PA 4YJGB 5F9FA 1T6NA 3RS7A 3A31A 5DKFA 2Y93A 4JYZA 2KPOA 4EK9A 3CLTD 4LF5B 3SQWA 4MRNA 1PJ2A 2J6CA 3BMOB 3RGGA 1ZH0A 3UJHA 4A8JB 4Q0MA 3EC2A 4LMBA 3EF0A 4LJAA 1FFWA 5HEKA 4OXXA 1CY1A 4ZU6X 4PYJA 5C5CA 2YFYA 3J81A 3N5CA 4XYLA 2KBFA 5FJIA 4CN8A 4D42A 1QPZA 4FOOA 4CKZA 1MV5A 1W30A 4NV3A 4ZXFA 1ZPDA 2R8OA 3ONNA 3W9SA 3RAEC 1E96A 3W2HA 1V6SA 4DL9A 1U2EA 3SK0A 1JIVA 4YGXB 3MCTA 1K27A 3X2FA 2IYXA 3Q5GA 3HXOA 3WIBA 2O1EA 4UTVA 1T2NA 2BEWA 3ELYA 5EMHA 2AEJA 1I4DD 3DGEC 4IJMA 4NTZA 2Y9MB 2PKEA 1EBFA 1DBVO 4PRZA 3N2IA 3HM9A 1QAQA 3K1AB 3D6VA 3ZCRA 5BQ5A 2PKRA 5FNVF 3B85A 3PXCX 4NXNB 4ARSA 4YV1A 2ATCA 2ZSKA 1U6IA 3IAFA 1L4YA 2FN9A 2VJMA 3KZOA 1GFWA 1VLVA 4D41A 1F20A 4XQCA 4JP8A 4OJYA 4QUHA 4JEHA 3B8HA 3SNKA 1WMBA 4LBVA 1TZBA 4C88A 4HXGA 1OASA 2ZAIA 1VDMA 2HV8A 1MC1A 5AW3A 2V7QA 2Z8ZA 2IX9A 1PFYA 3SJBA 4BZWA 3TTSA 2AHOA 2XF8A 2QTNA 4D9IA 4G9BA 3KELA 4NEHB 2PH7A 4UCWA 1W93A 2XZLA 5FLYA 4OH7A 1GO2A 1C1XA 4FFVA 1Z5GA 1KKLA 2RGBA 2W48A 3TRIA 5M7EA 1AY0A 1Q0HA 4CHTA 4EEXA 1QVRA 3E82A 3PNKA 5FUXA 2O59A 1T1IA 4J16C 2XB4A 4B71A 1EDEA 1IOVA 5CK4A 4U7TB 1UBMS 2EFDB 2OP1A 1KIAA 4B3TB 1JHXA 2FE4A 3MXOA 2WP0A 1V7QA 3L7KA 3G82C 3WMRA 4N0DA 4MW0A 4DG5A 1IY9A 3KKMA 4AM8A 1INLA 2QIOA 1WZ2A 5ETJA 3FRHA 1PLJA 3QPWA 3AKYA 3LQ2A 2VF7A 1C7RA 1ODFA 4YQZA 5HFAA 2GCGA 3L0SA 1Z62A 4NOJA 2OCKA 1IEQA 3RC9A 4UHFA 1K86A 3D6AA 5GVSA 1TDJA 3T3MB 2E5WA 2H1VA 4FFOA 1G7TA 2NIPA 1TU0A 1OGIA 4RA9B 3RIGA 1NDQA 2Q8QA 2OB2A 2D5LA 3KO8A 4JI1B 3CS3A 4ZEOA 2POQX 1IM5A 1Y1LA 4ZWNA 4L9AA 1HZZA 4RY8A 4LYYA 4LY3A 4CXMA 2D7JA 5HKAA 1O0CA 1UXJA 3AKEA 5EXXA 1BE0A 3HVKA 3RYIA 2O8CA 3FKSA 3BTVA 3N8KA 1D9XA 1THTA 3K9BA 1GNTA 4KQWA 2Z6QA 3I2YX 1HL3A 4IKPA 1RKUA 3ASYA 4HB4A 3JRWA 3AI2A 5HM8A 2HW8A 3R76A 3BRSA 5AOVA 3PL5A 3MUOA 4I2VA 5J4LA 1SIBE 4DR1B 1CUFA 4V3CA 2ZUVA 5EXDA 3T3EA 1XHEA 1N8SA 1U94A 2GZSA 3JTMA 3MRTA 2D1QA 2GNAA 2QQ5A 3ZEIA 3OD5A 1YACA 3E0XA 1LEHA 3OLVA 4GMGA 1EDZA 1SKYB 3ENNA 2Q28A 2VUUA 3OESA 4DCOA 3U5ZB 3ADDA 1YWGO 2VEOA 5CRIA 1Z56C 2BV3A 3VAYA 3EUEA 3NAMA 3QBEA 2BRUC 1IK6A 4EAQA 1DP4A 1E2GA 4Q7LA 4QTXA 5CVCA 4I50F 4CT0A 5IT5A 5C3UA 1THZA 2W2TA 1E2BA 2RGAA 1EFCA 4BQQA 5L7WA 4N9QA 3FOCA 6NULA 5HRUA 1DIHA 2XUOA 1X14A 2XSZD 3OM1A 2EZUA 3BF7A 4YJFA 1D2NA 3L7CA 4PYKA 3QE2A 3GZTB 3LLUA 1W5SA 3LT0A 3NTLA 221PA 4O4HB 3CEAA 1MIHA 3DAYA 4MUNA 2J8ZA 1KK2A 2HX1A 1URPA 1HF3A 4JITA 4OP3A 1OHHD 5DGTA 1E59A 2HF2A 2P2LA 3LGXA 2GAFA 3KOXA 5TEWA 2IWHA 3U4AA 2HU5A 2DH6A 1ML4A 1TD9A 4QTZA 4MV1A 5HE8A 1OSNA 3OQIA 5IHXA 5J1SB 3EWIA 4IVPA 1MO4A 4QUBA 2IQIA 5DGDA 1LDNA 3UKJA 2X3YA 4G0VA 4PG4A 2FVXA 1Q7CA 1O95D 2X58A 4FCVA 2QYSA 3I45A 1L3IA 2XEXA 1UP4A 2EHJA 2RCYA 5CLFA 1G5QA 1ZN8A 1KL7A 4ENPA 2OPBA 2XA2A 2ZQ5A 3BFVA 3VXKA 2ZETA 4HN4B 3DO6A 1YS2X 3W9YA 3TOVA 5KUTA 3AEQA 4JJAA 4ZMSA 1MENA 1XSEA 3DEHA 4YP6A 1P17A 3LVFO 4G5QA 3A2LA 4YRKA 5BNZA 3M6IA 5EXEA 1Z2PX 1UQRA 1SHJA 4O02B 3KQWA 4RJTA 3T7AA 2KLBA 4RS4A 4WEOA 2C98A 2PO5A 2VP0A 2YXDA 2Z8YM 3SM3A 3WL6A 4UBLA 3KUUA 4ZODA 4A4DA 4MW1A 3T3DA 3FVVA 2BEVB 1J2YA 4P35A 3V1NA 3DOUA 2A88A 3EA5A 3OETA 4OQPA 2FAXA 3FHCB 2FMUA 4WCFC 2XX3A 5K3DA 3WY9A 1YH3A 4FD3A 5A6SA 3BEOA 3BMNA 4B6QA 3QEBZ 1PT6A 2G6TA 1JDUA 3UAOA 3V4OA 2WIAA 3LOUA 4PGGA 1XDBA 1EVQA 2A1UB 1PG5A 4G07A 2XGGA 4HVAA 2HRRA 3OLCX 2P0AA 3IAS6 1FRVA 1TVEA 1V7CA 3R7AA 3NALA 1AT1A 3Q7PA 1D9ZA 2GYVA 1GL9B 1X7WB 4K86A 3C6MA 3ROGA 4W4TA 1TM5E 1LRJA 4DA6A 5E6UA 2Z2ZA 4YP0A 3E15A 4NNPA 1DC8A 1JB1A 1XZJA 2XVZA 4O8ZA 4PCUA 3I83A 2EX4A 2V9PA 2EIHA 2Q6IA 1OC2A 2WYWA 3VDRA 4RA6B 2YZMA 3BEDA 3H6GA 3NKLA 2BYTA 5SICE 3KJGA 1QH1B 3EUWA 3TE7A 3ZV5A 4MVJP 5EQFA 3HJTA 1AK9A 4BMZA 1W5BA 1OH6A 3QEOA 1GSOA 4DRXB 2R00C 2JANA 3NRJA 3ZLBA 3BDVA 3IA7A 1C7JA 1OX6A 2AEMA 3SBXA 3FSGA 1XVLA 2AFHB 2VATA 3TKAA 1YMQA 3D7LA 3KHTA 4EJSA 1HDZA 4K6HA 4Z86A 3DQQA 3V3KA 5GIOE 3MBOA 4GVLA 3K09C 3MLAA 2NTEA 1A96A 4RAOA 3AZOA 2XE7A 4BBZA 3W5VA 1H2YA 4YC7A 4YP9A 3THSA 4WBXC 4ZOEA 3H84A 5FNVA 1KZ4A 4ZVRA 2R6DA 4MRAA 4XB1A 3I5XA 3TIGA 3TIXB 1KH2A 3M9LA 3FYUC 1OKKA 2GCOB 3GDHA 3URKA 3M3PA 4IIVA 4RPKA 2OXIA 3GAAA 5BVGA 1ZISA 2VP5A 2PL3A 1KAEA 3FNRA 3GGOA 3HGMA 3MS2A 5CX4A 5KWEA 3K3PA 1AC5A 1V1JA 2W6ZA 4KQEA 2HA4A 4DLYA 1R5OA 1E3LA 1XK6A 3FSEA 1PK9A 1YR6A 5JDCA 3MWLA 2YIVX 4IJUA 1B41A 1BCRB 1XV5A 1LVUA 2AZTA 2ERCA 2QSUA 3A4NA 3AERA 3LM8A 2D6FA 2VPQA 3LV8A 1JSXA 3EGXB 3TI7A 2EFJA 1FFAA 3RS9A 1EVIA 1XCJA 2JJ2D 3MSCA 4QPNA 1C9JA 1QYRA 1S7CA 3UT0A 3DLIA 2WWTA 1Y8QB 3DFMA 4TV8F 2H1FA 1AS2A 3EISA 1ZJYA 3F96A 2P3OA 2VLIA 3F2VA 2ORED 2PXXA 3HO8A 3MAJA 2B0JA 3RABA 1AK1A 5EUMA 4F86A 1QDUA 4B1FA 4YXWD 4QJ5A 1MU0A 1JWLA 1RQRA 5G0UA 2WFMA 4C4YA 3Q7EA 5F2KA 2JZNA 3BD8A 4KH1A 3O8RA 3UZUA 2R5FA 1PJLA 2R9VA 4JGIA 1AV6A 1CIVA 2QKYA 1X8KA 2XVAA 3C3XA 3MSXA 1UKYA 3T4EA 5F51A 2Y92A 3DLCA 4R2WA 1W5AA 5TDHA 3N76A 4HRXA 5ALEA 1W29A 2V74B 5HUQA 4Q34A 5HFJA 1Y3HA 4I1SA 2JJMA 1HRKA 3RJMA 1I36A 3STUA 2HLDD 1ZGBA 3VH4A 3FTEA 3ENKA 1UZNA 2LD4A 4X3CA 1ODTC 3AMVA 2HQSA 4RFVA 2VP2A 1IN8A 2WNHA 4E30A 3O4GA 5IS2A 2YCBA 1NBMA 4XOIA 3O8OB 4NK4A 2Z2KA 5KOJA 2W2QA 5I4BA 3GCDA 1EXVA 4M9CA 1PJ3A 3SR0A 2C9YA 4IX1A 3H2HA 3ZIAA 5EJ7A 3EG5A 4G5OA 4QQFA 1IY8A 2VJBA 3PHGA 2C5GA 4PZZA 2NX2A 2XIJA 1U0OC 4XWTA 2HHCA 4Y0VA 2GM3A 4DNFA 1RHKA 1RVV1 1L5MA 1PWYE 3EODA 1Y1SA 3NM4A 2Q46A 3RYFB 2BM8A 2GBGA 4QXRA 3HCOA 5AI4A 3LDGA 2JK0A 1LSSA 4L4SA 4A0RA 2WPDD 3V2HA 2G88A 4JN6B 2Y1EA 1TX4B 3WBBA 4C0HA 5IUJC 2V7EA 4GLLA 3T1TA 2ZRPA 4HZIA 2JGAA 4KGXA 4OBXA 1P6QA 2WHEA 1Q22A 2QSYA 3HCNA 4LX8A 3WK8A 4BNMA 1A9PA 1GPWB 5G0VA 3RM3A 4Q4AA 1RD4A 1FEZA 4EF6A 2WB4A 2I6SA 3ZDDA 4HDMB 1UBSB 1YJXA 3D7MA 3GF4A 3P0HA 1EMDA 4HNQA 4UU0A 2H31A 4MKHA 5EA2A 1MMFB 1YU9A 2E4ZA 4I50A 3WRXA 4BVFA 3FR8A 4YN3A 4O5AA 2PXCA 4TVOA 4A0GA 2IOYA 1Q7EA 3DZHA 3MOSA 3FW1A 3UUWA 2J3IA 3AEUB 4OK5A 1HO3A 1PZEA 4L6CA 2DHCA 3ELDA 2BLLA 2FSFA 1CQIB 2QROA 4D4JA 1GZ7A 1V3VA 2MMCA 4TRJA 1V25A 4W1PA 1X7ZA 1O3YA 3KB8A 4IJ6A 3ZYCA 5IFLA 3DE3X 4EH1A 5JJCA 1EP9A 2I2FA 4CTJA 3BXHA 1JS1X 1TQ2A 4G86A 3R7BA 2OCAA 2CVZA 2F3PA 1DBRA 3PE4A 4N40A 4G3XA 5DTMA 1XNRB 5DP1A 5KU7A 3ILVA 3FVTA 3ZZ0A 1UC5B 1C14A 1MRSA 2J85A 2PU5A 4HTFA 2D2VA 2Y1XA 5GGYA 1HYBA 3ISJA 2EL9A 4MI6A 3DZBA 3SJAA 4F4DA 2YFHA 4K6MA 4WKNA 1XRMA 3UICA 4Z9BA 5ISMA 4F21A 3D3JA 5JSUA 2ZYUX 1NE7A 4MV4A 3W2IA 2WUGA 3AUTA 2YW2A 2RBEA 4OQFA 3EZ2A 4MW6A 4X97A 3CNQS 1NXTA 2Q8PA 3QPBA 2AOUB 2W0SA 3R6LA 4MYRA 4Q3KA 2DWPA 4O4JB 4EKEA 5J4YA 3L0IB 4BDSA 3UT5A 5CDGA 3F6CA 5I51A 1M1YE 1WAMA 1II9A 4WRRA 3UG7A 2IF2A 2NVBA 3FH0A 2AN5A 3NC1C 2QYTA 3C45A 3GQBA 3C39A 3OSUA 2QI9F 2R8YA 1TUEA 2UVPB 4DDHA 3FOFC 3TTXA 1CV2A 4MKRA 3SR4A 3F7MA 1OYWA 3C7KA 3INYA 4L22A 2V7XA 2VDWB 2ZIXA 1X74A 5T4EA 1ORRA 4D8UA 5JXHA 1VCOA 4FGWA 2VCEA 1ZJ4A 2RJNA 1KKUA 3N86A 4ZI7F 3JQQA 1Z4QA 1IDOA 1OZFA 5IJ9A 5KNDA 4NV1A 2IXBA 2ADMA 1I3KA 3EPPA 3S27A 2CXPA 2Z58A 5I7AA 2ONYA 4GRAA 3IOEA 5FQNA 1X7GA 4W7HA 4Y30A 2J3MA 5T64A 4QGSA 1JHZA 2MINA 1L1FA 1HLFA 3L92A 3PX3A 1KEUA 3RAPR 2CNKA 1C29B 3IEPA 1XPRA 4NAVA 1TZJA 5I8PA 5JISA 2R7NA 2XADA 4BYMA 1Q91A 4PZ9A 3DC2A 4E46A 5B12A 1G8MA 5AI6A 1GUDA 1PEKE 3LXMA 1NF2A 3WJAA 4CR6A 4WECA 1FYDA 4QX6A 1RACA 1ZMBA 2VT2A 3UHFA 4GS5A 1NIJA 3UQYS 2QK4A 1ST2A 1GZVA 5LQDA 1R37A 2WWYA 2UYQA 1TZKA 2IHTA 1IQRA 2J07A 2VH1A 4Q9NA 4TKZA 1FP4B 2AN3A 3H3JA 4KRGA 4D3ZA 5FDFA 4J49A 3E23A 4L4RA 2O5CA 2PH3A 5EP2A 1SUBA 5JSZA 2R7AA 5FA6A 2X1HA 4P0QB 1NBEA 1AJEA 5U9CA 1SO8A 1PJ8A 3VNRA 5L4NA 2JLBA 1NR5A 1Z06A 2IEIA 2QX8A 4TS4A 5DM4A 1Y4SA 1LK0A 3L4BC 2JKVA 2VPPA 3MTEA 1H22A 1N2CE 2NWQA 4DQ0A 4EZBA 1A8UA 3QA9A 4OI2A 1R4NA 1DAIA 4ECEA 4MQBA 3BGSA 3TEMA 2JFNA 2AR7A 5TLSA 4JJ6A 3L18A 2VRCD 2ZDQA 4GE0A 2A92A 1J8QA 3BBPA 4Q7KA 1AS3A 3IE1A 1JDBC 3MIZA 4GUDA 4ZAVA 3E03A 1UOEA 1VL0A 1O0SA 1Y0BA 2NACA 4N3NA 1MFZA 3WLOA 4QPJC 1HT3A 5K3EA 1BHSA 1EX1A 1A8SA 1T0BA 2XMCA 3K0AA 4XVRA 4B2IA 3HSSA 2XTZA 3ZXYA 2J4DA 1FTNA 3LPCA 3N0TA 2FUG1 4MVJI 4ZVMA 2IIPA 3D7RA 3PNLA 4I5IA 4BIMA 4F04A 1P1HA 4QVGA 1TF5A 1EJ0A 1Y6FA 4ZQCB 3RBVA 1AZWA 3TTUA 3NQ41 1A77A 1O6FA 5K09A 4CL2A 3NOOA 3BT7A 4LNUB 2O2SA 4WFKA 2PWYA 2OVBA 3OCCA 2YINC 4UDOA 4MWOA 4X1KB 3ZE7A 3HDQA 1KWKA 4NBNA 3L05A 4TV8A 4D8YA 1ZNXA 4YUXA 1XN1A 1G3QA 4XQ9A 1J8MF 3H5WA 1BFKA 1R5BA 1LNSA 1HMPA 1LQ2A 3GMDA 3HU5A 2WUVA 3M70A 3EGDA 1OLXB 3PHLA 3Q72A 4GWKA 3RU2A 3WB9A 2VQEB 2ZB3A 1N5OX 1SUCA 3ZE0B 2W90A 3TLMA 2CUKA 1DAMA 4G1VA 1JU9A 4C6RA 4BTVA 2IDMA 6REQA 4EVIA 1U11A 3KWMA 3GRRA 1U4SA 2GF2A 3IJRA 4MQMA 4Q6WA 2NUTA 4FCCA 3U80A 4X0EA 5IAOA 3CRRA 1X8LA 1T2AA 4FLEA 2JLRA 3MD9A 2CHGA 4UM8B 4K6GA 1Z22A 1UJ2A 1UKAA 2WWXA 4BGEA 2IHUA 2COUA 3TD6A 4BNKA 3REQB 4Z4HA 1C7EA 4EL0A 1OPXA 4X62B 4QU0A 3FLAA 4FX2A 2F59A 4DSOA 4RTLA 5JAMA 1XZIA 2HRZA 3PTZA 1ARZA 5FBWB 3S5JA 4TYYA 1CLEA 3TUJC 1KI8A 3E2PA 1Y9AA 2IPXA 3QLTA 4ENSA 5TVKA 2YR0A 3NC0C 1U3UA 3M2TA 2GEVA 5ARCA 3B2QA 1YS4A 1E7YA 3NGMA 4O3FA 1W88A 4KMRA 2CZGA 4H35A 1AS0A 1QFJA 1J24A 4UVDA 2H2IA 1WNTA 4WDQA 1MQ8B 1B6SA 4NS4A 4OHRA 3LC1O 3EVDA 1G5FA 5KYTA 5LP1A 3JVVA 1CQWA 2WJYA 2BUAA 4ZO9A 3VV2A 2P5UA 2WU8A 4ZAYA 3ZD9A 3ABZA 3I2FA 2PD4A 1NONA 1OX5A 1WNFA 3B6ZA 2QLLA 1W36C 2YXLA 4UEOA 4ZALA 1EX6A 5JNVA 3SVLA 1Z7WA 5EXTA 3EVGA 2W2LA 2EL7A 3V8EA 5CNMA 3OPMA 1G20B 1ZW1A 3EXG1 4I66A 4P93A 1BCSB 1QVVA 4HNGA 2B4AA 5HXAA 4B3JA 2W43A 4X1OA 1PYOA 3QP9A 1Z8NA 4M6WB 4UZSA 1SXJA 1UPTA 2PAAA 1RZRD 3QK7A 3GLIA 2CD7A 4MRPA 4ZANA 5F3DA 3Q8LA 4XEUA 2Q21A 3ZBQA 1ZEMA 2C84A 1P72A 3N2ZB 3HMQA 2JFXA 4BE7B 3LI2A 4WXPA 5A5GA 1YE8A 2O0JA 3N2GB 1JR6A 4OQZA 3MUFA 3WL8A 1VZ3A 3RFTA 1KRWA 2ZPAA 2I4LA 4FYXA 4AXXA 2H8GA 3W06A 3A1WA 1Z73A 1Y4ZA 2OKGA 3P9PA 5IAKA 3AUFA 3IXLA 2IKSA 4R3WA 3HJUA 2VAWA 4R83A 4BNZA 4S0ZA 1E3WA 2B2XA 4PO1A 3QXCA 1D09A 2YQ4A 3RVNA 1CUCA 4WL0A 4CIVA 4Q66C 2CXHA 3VR2D 1Z16A 2AOXA 1JG3A 4MB6A 2OGSA 4UBKA 3CU5A 3MWFA 5ER9A 2GEJA 4C5AA 4DV7B 3MCVA 1JAIA 1U2DC 4EHNA 3TTWA 2AFIB 5F5XA 1SQSA 1W73A 1KI3A 4XQEA 3OA0A 3RS3A 5A9TA 4E6PA 4KJZA 5MGBA 3VO1A 5I7OA 2EGUA 4KRYA 4G8DA 3UK1A 1TA0A 2PRSA 1WLYA 4WIAA 4DLXA 3LWZA 4YAWA 4EZEA 4M8NE 4GX1A 4S1VA 2W9XA 2Q9CA 3ZWVA 2QPLA 4QNRA 4HC4A 1RWKA 3C16C 1GGFA 1SUAA 3NHFA 1CW2B 1JR3D 2J5XA 4K9QA 3LOQA 1E18A 4Y2YA 4YFYA 3UWPA 3UWSA 5DASA 1Q83A 2YJ3A 4KFSA 3WK7A 1C3JA 2EFCB 5C46F 4Q9KA 5JC8A 3W7BA 4AJKA 5FL7D 4NMLA 3KG2A 3O4JA 5CYFA 3GIDA 4ZOBA 4B74A 4UAJA 1GUFA 2R1VB 3SOZA 4Z8YA 1BDIA 3V7FA 4HLNA 2BTQB 1B8PA 1JHDA 2DT5A 3MCAA 4K9DA 5TMEA 3S5UA 1DDIA 5KTTA 3DL4A 5TQJA 4GYWA 3HUDA 4Q4HA 4TLAA 2F2TA 5JEEA 1DJNA 2O20A 3M2PA 1U0TA 5A4AA 2VUHB 1WR8A 3EZLA 3IP1A 1H5UA 1C0KA 3OX1A 3KQVA 1QIFA 2FWNA 4FILA 4C0KA 3LUAA 2ZCVA 3I52A 3JD4A 1DX6A 2OQVA 1G6HA 4MQFB 3ZHRA 2PKWA 5DHPA 3B1YA 4DSAA 3GMSA 3OOWA 1LUAA 5IDYA 3R9XA 2COEA 5FBVB 3PCTA 2JF0A 4A5OA 4Z3OA 4G0XA 1PW7A 2HUNA 3U0VA 4OHCA 5TSDA 2FVYA 3U4DA 1FMJA 1X7HA 3PC3A 4L16A 5SYNA 2INGX 3VNSA 2H9YA 4KV7A 4F4UA 1XXHB 5C37A 2Q1TA 5D3MB 3PYMA 3K6SB 1CP2A 4MW9A 2D7DA 1REQA 3GA0A 4YRTA 5BYAA 1OFVA 3B53X 4M1TA 3IDZA 2IWRA 3PC8C 4D80A 2XR1A 3GVCA 4JLNA 3RBAA 2ZXUA 1GL7A 1NMEA 1GG9A 3C3EA 2NNLD 3KSZO 1MUUA 5JNRA 1O58A 1UKVY 4Z53A 4QYMA 2VNSA 4E2FA 1OXTA 4LQLA 2J32A 3H13A 1I0IA 1K5HA 3EDOA 3Q88A 2ZUFA 2WF7A 3T7CA 1OI7A 3K9HA 4V2IA 3IHKA 2GN2A 1FXSA 4HJRA 1XYGA 4EARA 4RDIA 2NSYA 1LW7A 1IPEA 1IC6A 4LV8B 5CB4F 5BW8A 3QI2A 2PSHA 1PDWA 4LOAA 4E1AA 5HIJA 3AF4A 3ANTA 3DNFA 1H23A 2I8AA 3DW3X 5EZYF 4PSAA 4OKNA 1XTUA 3WYCA 4GE3A 4TWJA 1IMOA 3NKFA 2DECA 2Q4EA 3A7EA 3FM9A 5A5FA 4LJLA 5FFNA 1ST3A 4ZT2A 1CJBA 2WUDA 4L5BA 3QU9A 3WLMA 4CWAA 5KQPA 5ITSA 2WJ4A 5JYDA 5A3QA 1PFGA 1U7OA 5DHTA 1FTSA 3PNYA 1Z0AA 4ZQEA 2EERA 4AB1A 1ZZEA 2QRNA 3L7IA 2XSZA 2ZE8A 3LPLA 3T54A 3GJTA 3O92A 3QITA 2RG7A 3SLGA 3EWSA 4FGKA 3HN2A 3PQ7A 2ZYHA 1W75A 3DNMA 3IMCA 3BH7A 3KT3A 5YASA 4AURA 1EVKA 1LY1A 4UPVA 4KLZA 3RC7A 2WAXA 3FJ1A 4DCTA 1CUUA 3ABQB 1XGKA 1LSOA 4BBPA 3FMVA 1UANA 4OHYA 2TS1A 1KJIA 1KJYA 2IHBA 3EG9A 1QE0A 3EN0A 4X8OA 4XQGA 4DV3B 1JUDA 3NANA 1F8FA 1K6JA 1O96B 5FUBA 4J29A 2EEZA 1O95A 4MVJD 4IV5A 4PS1A 5DNVA 4B6PA 4ZYLA 5BSVA 2O7RA 3NONA 3NBZC 4YACA 2PYIA 1DPGA 4M22A 1ENZA 4MGEA 2IHYA 5KYNA 4BB0A 3RLFA 4N8SA 2PS9A 3BXGA 3JAWA 3K20A 5TNXA 3CFYA 2AXNA 5ECGC 4N7RA 4NARA 4UFOA 4YWHA 3NH6A 1U3TA 2A9OA 1RZVA 3W3AD 3U16A 3RANA 4OU4A 2R97A 4Q3BA 5JSKA 1CS0B 1IN4A 3IKTA 4L3VA 4PLPA 3L1UA 5CJ2A 2ENUA 1Z7BA 1ADFA 4AD8A 4B87A 3IPAA 3TJMA 5HUJA 1A69A 2IY7A 1P6XA 4LWPA 4AQ7A 3E8XA 2CXXA 4Z4CA 1U31A 3PUIA 1B2RA 3QLUA 2X2OA 3F98A 3IPYA 3MELA 3AFOA 4ZT4A 2QR3A 5IAEA 3A0RB 2JGEA 1LDGA 3HCRA 3Q6NA 4RHYA 4BNLA 1GT91 1N2GA 1XJQA 2OZKA 2ZVPX 1UMBA 3ETLA 4ONEA 1DE0A 3BHIA 3W2GA 3H1FA 2ZBPA 1H94A 3T7TA 1CY6A 4NJOA 4U2EA 3BZBA 1P45A 3D4IA 3HBLA 2V8BA 2HMUA 3R3UA 4HK4A 2OGTA 4M7OA 4BGDA 4PS0A 4PYQA 2PNJA 2OILA 1N2IA 3UAVA 4RIFA 4HX9A 2JAWA 3H9GA 2HIHA 1QO9A 3FHOA 3FF1A 4G65A 2QD2A 2W2PA 3PICA 2IV3A 3CF2A 2P6PA 3X1JA 1SKAA 3L9WA 2ZPUA 5CM2Z 4L6IA 3MTDA 1JZSA 5BOSB 2WJZB 3A4TA 1Q2UA 2H9AA 4JX8A 4P22A 5JASA 4FJ1A 1SFRA 4W7SA 2O2XA 3MM4A 3CEJA 4EY7A 4YLYA 1T6ZA 2FFAA 3LW7A 4X3PA 5JMOA 4ER6A 4QUKA 4WNYA 1BQEA 1YTUA 2F7SA 4TKUB 3QPCA 1ZNQO 2TMDA 1JJAA 1L4FA 2EJCA 4Q4LA 3EBLA 5HZGA 1SKBA 1CVRA 1LWNA 2WFAA 1ZI8A 4IHJA 4B9AA 4J7UA 4CMIA 2PRZA 2PCLA 1R50A 3AKCA 1NV9A 5REQB 3PWSA 4U7FA 3RV4A 2ZANA 5TY0A 2JCBA 2C5BA 3EOZA 4BRUA 1J5PA 5CDFA 3PQ8A 4N1AA 4F0JA 5JR3A 4KR3A 5IBPA 4KXNA 3TINA 3HUTA 2VYCA 4F5WA 1XRPA 1Z2NX 1ZY2A 3FWKA 4X1YA 2ZIUB 4IPTA 3T4XA 2MSDB 1G9XA 3UMRA 1FFDA 1BAPA 2PS3A 3ORRA 5ANRB 4EGQA 1FCJA 4B6SA 4F4CA 1YZLA 3AVVA 3AESB 3DBLB 4E09A 1SU7A 2AHRA 5AI8A 2JJ2A 1Z35A 1PFVA 5EIEA 4JASB 4EDFA 5A4JA 3FGZA 2HDNB 4ZYYA 2GZRA 2OFOA 5DGIA 2OA0A 5BW6B 4R1QA 1R12A 3SIWA 5F4BA 1V8BA 3M1AA 3RWBA 3VR4H 1F2UB 3KETA 3BICA 2G9NA 5MF6A 1T10A 4NKRA 1RM5A 2QTCA 4YXWA 1LV7A 1T3GA 1TIBA 2J1LA 2XWBF 3L4SO 4XUCA 1O6ZA 4RQAA 4GG1A 4ZYUA 3ZY3A 4HD8A 4AZ0A 3HCEA 2A0UA 1B8OA 4HRYA 4ARUA 2D59A 2PL5A 4CNBA 1Z63A 1C50A 4BECA 2LR0A 3SICE 1ZH2A 5EIBD 3SZUA 2E37A 2HTFA 2F64A 3R3ZA 4Z0HO 3Q7QA 4ZJZA 5LM3A 2YWDA 1KETA 4NV0A 4G84A 4ZICA 1KH3A 5EHIA 1SHTX 3F71A 2GAAA 3NM6B 2HLDA 2RFLA 5CIYA 2VXYA 1YQTA 1BMFA 2ZR0A 2QU7A 3PJDA 4DXHA 4GI3A 4L50A 4X66B 1HDEA 2IPMA 1USKA 1CJTC 4MKFA 4WCDA 4WZBB 1H8HD 3RRYA 4OHPA 1ZAYA 3I5YA 2J3JA 2BZGA 5DNWA 1QP8A 3FMFA 3ICEA 2G09A 4ZQBA 4KODA 4AUEA 1BTOA 2CXOA 2H3HA 1CK4A 3B5EA 2FSSA 2BEUB 3RVPA 1B15A 4A73A 1PZMA 1ZUD1 1WKCA 1JQLB 4B81A 4A1OA 4CYMA 1KJZA 1LTKA 4EYOA 2Q3HA 4M7PA 3LX5A 4LPSA 5GIPE 5HILA 1XMJA 1UJ4A 3E5NA 4FXPA 5CB4A 3VR6H 2WPDA 4BMOB 5K8IA 1RHUA 5LN1A 3DH0A 1FFCA 1DEXA 5G0TA 4DLLA 3JD2A 1FTYA 1QO7A 1QTNA 3H4IA 4KW7A 5KX5B 3IQFA 1V9CA 5EZYA 1GZ4A 4BEBA 1PT8A 2ODQA 3KNZA 3ITDA 4QQKA 3ON5A 3W1WA 3HKEB 5LYYA 4N3GA 3V55A 1JLLB 2YWRA 1DQPA 2QY9A 2VPXA 4LCEA 3TOZA 4R9RA 4XVCA 2QGFA 4KPUA 4C0WA 1XQ1A 1EDOA 1NXOA 4A0SA 3GDOA 4GRIA 5AUPB 4J2TA 3WSTA 1V5IA 4BMPB 3LDFA 1IG0A 1TPZA 2NU8B 1JXMA 3LE8A 4OB6A 2VHVA 1J33A 3AF2A 5GP1A 4IUCS 3SLRA 3IIMA 3ZNOA 3R74A 5GJWC 2X5OA 2DJIA 5C35A 1GG8A 3O6VA 5FKJA 1P9OA 4MMXB 5JFTA 2V3VA 4KSBA 2IPLA 2QA5A 2FMHA 1JALA 1MABA 1Q0LA 1QYCA 1HYQA 4F7WA 2QD1A 2DERA 4Y98A 4XZ3A 1A9QA 5A0TA 1WXWA 2WABA 3FNFA 4NDAA 2RI6A 1SY7A 5GM1A 3LUCA 1QLJA 3TPFA 3JWHA 5TPZA 3FIJA 3KEOA 3IBSA 4ENUA 4NFYA 5AJTA 4URHA 5SZHB 1TYDE 3DWGA 4H1WA 3LCUA 3FOZA 2Y05A 2C7QA 4JJEA 1NR1A 2YUIA 4WZZA 4EENA 4Q1DA 8ABPA 4YQYA 1ZIDA 3ZGYA 2ZRKA 4O1HA 5MN6A 3LY9A 4LSZA 3DL2A 2QM8A 4BNIA 4RYLA 2ISSD 4GX0A 3ROFA 3EBOA 4XD7D 3O94A 2P7HA 3G0HA 3KOZA 3AHJA 4I5GA 2IEAA 1N0VC 1O94D 3V2UA 1AA6A 4J7AA 2P9ZA 3G2PA 1GUAA 3KC2A 3PBKA 4ZRNA 3TJZA 4PTLA 2OCGA 4L74A 4CG3A 4CLXA 1DQNA 1CEQA 1Y1RA 1XJ0A 1ZOLA 2EP5A 2P67A 1XZLA 3A10A 2BEWB 2ZJ6A 2JPDA 3WWEA 1B8NA 1M6EX 1U1IA 2LGJA 4GZ6A 1WMFA 2X19A 2PRKA 1F6BA 3DAHA 4TLBA 1S3GA 5JCJD 4FUQA 2R5WA 2P41A 4ACAA 4QC2A 1CUHA 4HLQB 2VJMB 1TPYA 3STWA 2C58A 1M9NA 1Z5WA 1ULTA 2O5VA 3NYWA 3DO5A 4NULA 1N75A 3FE2A 3RVMA 4D0LB 5JDIC 2RH9B 1H93A 1ZJ5A 2J0VA 1Z28A 2VT6A 2YZKA 4J3FA 4MUKA 4S1NA 3SD7A 3VO2A 4D9MA 5DHAA 4DILA 5BUSA 3IB6A 1ZCJA 4CLHA 2P9CA 1JKMA 4M1WA 1PDOA 2CUNA 1U7HA 3ZW9A 4CKYA 4CIDA 6PFKA 2IE0A 2IBTA 1C1XB 2REOA 2GHQA 2H7VA 1PI3A 4ZYTA 4IYRA 2XUGA 4EUKA 1G2OA 1B0PA 4OP2A 3GIWA 1XB2A 1KS9A 3IKLA 2Q07A 4TMFA 4RSHA 2GM5A 2IU6A 4EABA 4FZJA 4CU5A 4MCAA 4ZPJA 2R86A 2VPZA 2P40A 4CF3A 8ADHA 3OIVA 1NF3A 1SVLA 3O74A 1KORA 4X5OA 3X1ZA 2YJGA 1P5FA 3QV1A 5EI5A 1ULUA 3RG2A 4ZOCA 3BKXA 4WZAA 4CKBA 1QCZA 3LYLA 3TZCA 3BIOA 1SVNA 5FFFA 3PRKE 1U2RA 4GSLA 4L07A 4RPHA 1H6CA 2OGUA 2PMFA 2WTMA 2DPYA 3W0LB 4HN9A 4JCOA 3VJKA 5DI9A 1UEIA 2WWFA 5JT1A 2HCRA 3UHOA 2VRCA 1O5OA 3EY9A 4QECA 3KOWA 4QXMA 3OPYA 5JMTA 4I5EA 1ISPA 4CG1A 1ONBA 1UWLA 3DEAA 1NN1A 1XP5A 4JELA 4MQEA 1GPBA 1ZCAA 2WG1A 5BP7A 1DBQA 1WPXA 3WSWA 2M6KA 2WMYA 5DLEA 5BY2A 5JU6A 1OPRA 1TAUA 2FFRA 3RYIB 2O8CB 1W5FA 2WJ3A 4DSUA 1FFGA 4OHVA 3ZU3A 4FHCA 3QH4A 1EYZA 1FXUA 4EYSA 4BGIA 3R7WA 2R7MA 4YCBA 2X3FA 2PSSA 4JI6B 3U3XA 3RSGA 3WOHA 3OT5A 5EPEA 1KGDA 4GQBA 4GWGA 4LTMA 1BFDA 2QORA 3HJAA 2C9MA 4E4RA 4RM2A 1AQ6A 1LFDB 4FC7A 4RHTA 1KDZA 1FA9A 1GARA 5ALYA 2FV8A 3TSCA 3KM0A 4FCTA 4IZ6A 5F1PA 4ZVOA 4YAGA 4AYTA 5DTJA 3IQXA 2RKBA 1AKQA 4YYEA 4UREA 1FBNA 4NLLA 2M2IA 2X2FA 4Q3AA 4Z99A 2AD5A 2QTVA 1WTCA 1KIFA 4BAUA 5AMXA 1TAGA 2IHKA 1W6UA 3KX2A 3Q3HA 1POXA 4DLAA 4Z7NB 1YS7A 4FGSA 4E12A 1Y9JA 1NG9A 4TOIA 5NULA 3WRYC 4YECA 2BCJQ 1F14A 4DDTA 1OZGA 1VE1A 4I6EA 2CE2X 3MGAA 4WBNF 4YJFB 5AM2A 3GYGA 1P0QA 2XT6A 3QXXA 2EOAA 4MVJF 1B26A 1O9GA 2PQ2A 3D8SA 5I5GA 2M6LA 4MUYA 2VF4X 1H65A 2QF7A 1E64A