2MSLA

Solution structure and chemical shift assignments for the apo form of the receiver domain of nitrogen regulatory protein c (ntrc) at 35c
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
124
structure length
124
Chain Sequence
MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Free energy landscape of activation in a signalling protein at atomic resolution.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transcription
molecule keywords Nitrogen regulation protein NR(I)
total genus 19
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2014-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2mslA00
1YMVA 1LJUA 3EGCA 4NCBA 4S05A 3JPWA 1A04A 1EAYA 1P6UA 1YS7A 3IP6A 5T3YA 3OQOA 2PUBA 3O21A 4Z4EA 3O2SB 4RXUA 3Q41A 1ZHHA 1ZY2A 3JVDA 1BDHA 4P98A 4MQFA 5JS2A 1SXGA 3RVSA 3F73A 1DCMA 2AYXA 5DGCA 4OTZA 5DCLA 5KQPA 4RK7A 1QMPA 1MB3A 1DCFA 2WMYA 5IUKC 4LDAA 1RZRA 3OLYA 1ZESA 4YLEA 2RJOA 1ZGZA 3OMXA 1J56A 1QQAA 2HPHA 2FQYA 1EWKA 4IF4A 1USIA 3LKVA 4ZYLA 4ZJPA 3M9XA 1QKKA 2M98A 3DZDA 3EDCA 2PUEA 3K4HA 4MR9B 1LJLA 1NXWA 3D02A 3MYYA 3SM9A 1NXVA 4WZZA 1JL3A 5KWSA 4EYGA 3Q7RA 1U0SY 5HKOA 5TPWA 1NY5A 1NTRA 3D8UA 1CYEA 3HM9A 4Y9TA 1Z13A 4M88A 2P4UA 2P9HA 2VYCA 2FKAA 4G97A 1VPWA 2JBAB 1DZ3A 4TN5A 5FBHA 2FEWB 1USKA 3CZ5A 1E6MA 1U04A 4EVSA 3BRSA 4IMJB 4GNRA 5TQ0A 1JDNA 1HEYA 4RU1A 3S99A 2JK1A 2FEPA 1JF8A 5BQ3A 1PNRA 3EODA 1DBQA 1VKRA 2PUGA 4JA2A 3F6PA 2BGGA 5GOTA 1EWVA 2PL1A 4LX8A 5B3JC 1E6KA 5HSGA 1QQBA 1M2FA 4RK4A 2RGYA 1YTUA 3A0RB 2WB4A 4JP1A 1ZITA 1D1PA 3Q9SA 1UDRA 4FE4A 5C5CA 2PUDA 3I5AA 4F11A 1TM2A 2WRZA 4LE1A 4Q6WA 1DP4A 1BA2A 2RJNA 2MSLA 2E4YA 3T95A 2VUHB 3H1GA 4OLAA 2JVJA 4RV5A 4O5AA 4XARA 3IP5A 5JS1A 4MR8A 3CG4A 4KNYA 2PL9A 1M2EA 3JY6A 1EFAA 4G0ZA 5FWXB 1GUDA 4G0PA 1ABEA 3T38A 2J48A 3RVQA 4WXMA 1KMIY 3DGEC 5CNJA 4KFCA 4YGXB 4MS1A 3KCNA 1ZH4A 3DLBA 5CNMA 1Z12A 4RXMA 1ISRA 2CHFA 1D4ZA 3OLXA 4KPYA 2E4UA 5EWJA 1GCAA 6CHYA 1E2BA 3O1IC 4YCSA 2FW0A 3QLVA 4N0PA 3UKJA 2FXIA 1DC7A 1VLZA 2FMHA 3CS3A 2H3HA 5FWXA 4E7OA 4EVQA 4ZMRA 2R4QA 3GYBA 1ZH2A 4YV7A 3CHYA 2CD7A 4P1ZA 4Z4GA 1QO0D 2I6FA 2RDMA 3GRCA 2FQWA 3QX8A 2LP4Y 4KQCA 4YRZA 1ZAYA 1K68A 3NHZA 5HM6A 3W9SA 2QVCA 2A9QA 2CWDA 4PICA 3HEBA 5F64A 3LUHA 3MM4A 3RVMA 1NXPA 4WWHA 1L5YA 4RY9A 4D6YA 1ISSA 1TJYA 4XXHA 4MQEB 3GV0A 4JB2A 4Z0NA 2A9OA 3MMNA 2QSJA 3MQ4A 3SNKA 3ROFA 4L85A 4KK4A 3GBPA 3NNDA 2QXYA 3VNAA 4EGSA 2L2QA 3HV2A 4G86A 2B4AA 6ABPA 4MS4A 1ZN2A 4PEVA 1JH9A 3H5TA 1KGSA 2LUOA 3BREA 1H9CA 3BRQA 2IPAB 4EUKA 3OLVA 5KQMA 1QP0A 3EJWA 1NXSA 3FDFA 5TPWB 3KTOA 4WXEA 3H5VA 1K66A 2QZJA 3F6CA 3KKEA 1LBHA 3GT7A 4L4UA 4D6XA 1CEYA 3L49A 4MS3B 3G85A 1FFSA 2B1JA 1APBA 3O1JC 4DQDA 3NBMA 3OO1A 1NATA 1OXKB 3JS5A 4ETMA 3LKBA 1R8JA 3IPCA 3RVRA 4PYRA 3N0WA 1M5UA 2A9PA 1QPZA 4G0YA 2QR3A 3KS9A 1Z2DA 3NHMA 1FFWA 3O2JA 3LTEA 1TMYA 3ILYA 3I09A 1PEYA 1GUBA 1ZGGA 1Z2EA 4FE7A 3O74A 1JFTA 2VUIB 4Z4HA 5IUJC 4QYMA 5JNRA 1DBPA 1AB5A 4YWHA 3Q7SA 5ABPA 4W5QA 5BRAA 3CG0A 2YHBA 5JNWA 4RKQA 5TQ2B 4LE2A 4DN6A 5FWYA 3Q7TA 1OXBB 5JNUA 3N75A 4MLCA 3MF4A 5IBQA 5TPZD 1TLFA 2QVGA 1YIOA 3LUCA 1SRRA 4MR8B 5GQSA 2ZWMA 4HYEA 9ABPA 2JRLA 3CZCA 4KZKA 2MYUA 4F8JA 3QEMA 5D2CA 5KQLA 1KRWA 1JBEA 2H0AA 3HSYA 1XWWA 1A2OA 2OQRA 2WJWA 4ZMSA 2E4XA 1JFSA 1C0EA 1RXEA 4G0XA 2R48A 3KYIB 3CFYA 2NT4A 2JCGA 5FBKA 1YMUA 1DC8A 4H3KB 2L17A 4QICA 2IPMA 2IDMA 2X7XA 3KJXA 1D5WA 4LE0A 2TMYA 3EQZA 3QEMB 4NICA 4EYOA 2MSKA 5BRJA 3R0JA 5EWMB 4IMIB 1E6LA 1JDPA 1P2FA 3N8IA 3RH0A 3RVPA 2XDYA 3LUJA 4MLDA 4KV7A 1XHFA 2ID9A 1S8NA 4KRFA 4B09A 5DKFA 4IILA 3O2QB 3FFXA 5EWJB 1ZVVA 3H1EA 3H6GA 4NV3A 4MYRA 2NZUG 4ML3A 1QP4A 4NQRA 1W9HA 4N03A 1Z26A 2VK2A 4CBVA 3GWGA 4JASB 4H3HB 4O1IA 4XASA 1WETA 3DGFC 1YS6A 5IEJA 4GPAA 1ABFA 2M1ZA 3HCWA 4XLTA 4YS6A 5KC9A 5KQGA 3H5LA 3IPAA 1YK1A 1JYFA 3QLTA 4HNSA 5IC5A 7ABPA 2DRIA 1PEAA 4OATA 2E4VA 3KYJB 3M9WA 1VRVA 4RKRA 1RZRD 8ABPA 3L6UA 3OLWA 4MRMB 5IEBA 3QK7A 2FLWA 4MS4B 4EVRA 1SXIA 1TVMA 2ZAYA 1P6QA 2O20A 3HDGA 2FMIA 1I3CA 3HS3A 1F51E 3DBIA 1L5ZA 1T34A 3TD9A 2ID7A 3LUGA 3H5IA 2PUCA 2NT3A 1EWTA 5EWLB 3I42A 4IGAA 3HVRA 2HJ9A 1YK0A 4W5OA 3T8YA 3SG0A 4MQFB 3C3MA 4EYKA 1KRXA 3FMVA 3JTEA 4W5RA 4WUTA 1FFGA 2L18A 4IRXA 2E4ZA 3H6HA 1Z17A 3GL9A 3O1HB 1FSPA 3LUFA 3FFTA 3OMWA 4D74A 1IIBA 3KG2A 2IOYA 2PAFA 4H60A 2FVYA 4Z4FA 2PUFA 1Z16A 3GA5A 4NCAA 4RWEA 4F12A 3LMKA 1Z25A 5B3JA 5KC8A 5CNIA 4ZPJA 4YP9A 1MIHA 5TQJA 5KI6A 2PLNA 2FMKA 4MR7B 1DRJA 4Z9BA 2QU7A 3T6KA 3HDVA 3MIZA 3RVKA 1D1QA 1LK0A 1C4WA 1NXOA 4LDZA 3UUGA 3KSMA 2FN9A 2HQOA 1GLGA 4OLBA 2CHEA 1YVUA 2PJUA 4TLMB 1U8TA 5JNVA 1SXHA 4HNQA 2JVIA 4MAAA 1BVHA 4JOQA 3MA0A 3TO5A 4Z99A 4Q6BA 4EY3A 1RPJA 4N41A 3CU5A 1BDIA 4JB0A 1CHNA 1SD5A 1DG9A 2FN8A 3N6VA 4Z4IA 2GX6A 5TPZA 4N0QA 4RSMA 2IPNA 4W5TA 1NXTA 1DRKA 1JLKA 3QLUA 4QYWA 4F06A 2LBPA 2E4WA 1Y1LA 3Q15C 4QPJC 3P9YA 4WT7A 1BDJA 3SQNA 1JWLA 3HK2A 1NXXA 3FFWA 4MS3A 3LUKA 4RXTA 4MRMA 1GCGA 4TMYA 4YR7A 2MYPA 4Z9AA 3HXMA 3K9CA 2GBPA 3EULA 3F7NA 2WJAA 3E3MA 4RY0A 4TLLB 2WY2D 2Q5CA 3CLKA 1DCKA 5CNKA 3N0RA 4DADA 3IP7A 1F4VA 1LBIA 4PE5B 4Q7EA 5DTEA 3I45A 1B00A 1RXIA 3H1FA 4HNRA 5DLEA 5I4CA 3GBVA 2KYRA 3KLNA 4XFKA 3LUAA 4RK5A 3QX9A 3HUUA 2N9UA 3OLZA 1MVOA 3C6QA 1USGA 1Z15A 2HQRA 3HUTA 1RNLA 1JHZA 3O75A 4MGEA 4RK0A 5TQ0B 2F8TA 3ROTA 4PZ0A 2W42A 1M5TA 2FTKE 4RK1A 4FB4A 2FMFA 1DJMA 4S04A 3NNNA 3RVOA 5IUNC 2F8SA 4KMRA 4OBBA 3M6MD 5JNSA 1JYEA 4EYQA 3LUDA 5PNTA 3H75A 3LOPA 4G0QA 2JVKA 1XHEA 2FQXA 4O1HA 3C3KA 4MPTA 2JBAA 3RVNA 3H5WA 4G0MA 4RDCA 1P8AA 1QNLA 1MB0A 2GKGA 1JFVA 2PMCA 3IP9A 2PUAA 2A9RA 3H5OA 3QLUC 2FLKA 4ETNA 1PUXA 4KVFA 2IYNA 2MYNA 3RQIA 3G1WA 5EWLA 2OENG 5IULC 3JPYA 3QEKA 5JNTA 2JB9A 5FWYB 3URMA 5TQ2A 3SAJA 3CNBA 5CHYA 4E7PA 5ED4A 5E3JA 3OM1A 4N47A 2QW1A 4MS1B 1D2AA 4RS3A 3TMYA 2FEKA 3CKMA 3KHTA 5BR1A 3OQMA 3A3KA 4OG2A 3RVLA 3N0XA 3TX6A 3VNBA 4XAQA 3OO0A 1QO0A 1ZDMA 5T7BA 2YHAA 3OM0A 4RY8A 1DBWA 2GWRA 3B2NA 2AYZA 2FSPA 4LRQA 3EAFA 3BBLA 1QP7A 1MAVA 1PHRA 3QELB 2HSGA 2QV0A 3A10A 2R47A 2PE5A 2MSWA 3DLHA 4F3TA 3KLOA 3TB6A 2WWVD 1BAPA 2V0NA 4KQ9A 3OQNA 2GI4A 3RVJA 1U2PA 3LFTA 3A0UA 3E61A 5HQJA 2IKSA 1A0OA 2LPMA 1W25A 3N53A 4G0OA 3HO1A 1EHCA 2LIVA 3C3WA 4JAVC 4UHJA 1U2QA 3CRNA 3EQ2A 1FQWA 5EWMA 4Z4CA 5C5EA 4N76A 4KK3A 3HZHA 3HJFA 2MYTA 3FGZA 3IDOA 1Z18A 5IX8A 4LZLA 4UHKA 1JX6A 4MR7A 3UK0A 2NUBA 3CTPA 2R25B 3QLVC 3C97A 4MQEA 2NZVG 3QELA 3BILA 3SY8A 2IPLA 4YO7A 2PKXA 5TE9A 4RK6A 4RZSA 4W5NA 2HQBA 3ILHA 2L19A 1PNTA 3NNSA 4ETIA 3JVIA 1URPA 4KREA 4MR9A 1AB6A
chains in the Genus database with same CATH superfamily
3G82C 3C6XA 3ZDXB 4ZALA 4KSCA 4S05A 3JPWA 1EAYA 3P0HA 2DERA 2QAGC 3VJKA 3JALB 4Z4EA 3UGJA 1ACLA 4IP0A 2G28A 1HG1A 4R9RA 4GX2A 4O3FA 5GVSA 3RS5A 1PL8A 1Y8QA 2R5WA 2BM0A 2HO5A 4FQ5A 4EO7A 2PNJA 2ZRNA 3HPQA 5K8CA 1G3IA 5BT9A 2OHHA 1MNAA 1QVWA 3FW1A 2ORED 3LVFO 4LBVA 1IU9A 4RABA 4MJ3A 4QECA 3SC4A 4CKBB 4CKXA 4GEGA 1PGQA 1CNEA 4OHXA 5EIXA 4C7VA 1VGRA 4B9AA 1GV1A 1KSJA 1Z29A 2WIBA 5EZSA 3OX1A 4AYTA 4ZO8A 2IV7A 3BSSA 3AB7A 4E21A 4D41A 3OE1A 4A16A 2C9YA 1UPBA 2NTEA 4PGFA 1UQRA 4WKOA 1ICEA 4CMIA 5BXQC 2HNAA 5JVDA 2XB2A 5E9JA 2SKDA 2C29D 3U4GA 5IC6A 3L40A 2P4SA 1W5TA 5LKRA 3CINA 1Z4KA 1NXVA 1WOMA 2EF1A 2VRCA 5ITZB 5KWSA 1XDUA 1A9TA 3O8OA 3UCXA 3HNPA 4UXJA 1NTRA 2PSDA 3E7PA 3VR4A 1E7YA 2ZPTX 3E23A 3QPBA 2GUWA 1CZRA 1HSZA 1XU4A 4PLZA 5IFLA 3UQYS 1IY0A 3T7AA 3DR3A 2UVDA 3VR0A 5H3LA 3IH5A 1Q0ZA 5BV2P 3WGUA 3QWIA 3CC8A 3ET4A 3RBAA 1XV5A 4GR9A 4Y2JA 1ZCJA 1DUVG 2FEAA 3CZ5A 4BQPA 1QWOA 5DNUA 1FLVA 1A50B 3WDKA 3MUFA 3X1XA 2Y6UA 5BY2A 3FUTA 3QPDA 1JDNA 3CCBA 5FI1B 4D4IA 2RB5A 2ZB3A 1JF8A 1XAHA 3WYDA 3PR3A 2OEPA 2C4WA 1HK7A 2Y05A 3GNLA 3BF8A 3HB0A 2WIGA 1IQUA 3T52A 2MR6A 3VUFA 1E32A 1GZ5A 1Y3IA 3GGOA 1EWQA 3NG1A 3CVUA 4Q1FA 2JPDA 4BNDB 3OZDA 2BFPA 2PA3A 4REQB 3K15A 1UEXC 4F9GA 3B78A 3DOFA 5FBZA 3ROXA 4KMMA 4K9LA 5EUBA 3A2MA 5JQGB 1Q16A 2NQ8A 3NHBA 3K0KA 1UC9A 4JBGA 4MUEA 5E6RA 1N1GA 1F4LA 2NVOA 3F1KA 1T8WA 4ZIRA 4DBLC 2QBYA 4EELA 2IHBA 4NBUA 1FX1A 3TR6A 4CL8A 2C9DA 2AG1A 4Q3DA 1OI7A 3EAGA 5DFAA 1KO8A 3SEZA 2C4KA 2ZVQX 3GLGB 4HQKA 4MZDA 5L4SA 1UJCA 2QA5A 2DFNA 4WBNB 3AF6A 3ND5A 4R1PA 1MOPA 3EFOA 1NN1A 4QO8A 1F0NA 1YGPA 3OOJA 4YJ3F 5EJMA 2XYRA 1N2HA 2RHGB 3DLBA 3ZDEA 4G5QA 4HRVA 1UC5B 2Q0QA 4ZANA 3TUJC 1YRHA 1HLGA 3HZOA 3S7ZA 3ANYB 2O2HA 2VCEA 4J7XA 3EF0A 4DMRA 1FE8A 2E4UA 4KBGA 5EWJA 4PRKA 3AW8A 4EI2A 4YTEA 2GPNA 2FW0A 2XZPA 2CNOA 2VSOA 1ZK4A 3OEWA 4F9FA 1E3WA 4I3FA 4ZT3A 4WJLA 5EQDA 3LP8A 3FZEA 4TMTA 5AKKA 5AK5A 4DWWA 1W4ZA 1JPUA 3AG6A 2Q5FA 1H1DA 4S0XA 2LWIA 3R8CA 2WMNB 3HI4A 3U7QB 1E9AA 2C84A 2CZQA 4E3WA 1GGHA 3IQWA 3H3XA 2AOTA 4MUNA 3QX8A 1G20B 1BW9B 4DJFC 1Q1ZA 4DLXA 1ZIOA 1PTKA 4LDJA 2PKRA 1NJFA 4W7SA 4FSXA 4WRRA 4EMBA 5GZ3A 2D06A 2Z2IA 4R8KA 2A9QA 3PFBA 4D8WA 1HDCA 2VAPA 3GX1A 1SHJA 1M8GA 5IG2A 3MD0A 3T5CA 4B84A 2ACEA 3B9RA 3LC7O 3OE7A 1JG6A 4DRYA 5B58C 1OIWA 4JB2A 5CYGA 3AL0C 2K5UA 1K27A 2AFHB 1EUDB 5ALGA 4B4VA 2G71A 1EEHA 2QUJA 4JI8B 3ESDA 2DBZA 2QIPA 2IVZA 4M0DA 3VNAA 2VYQA 2C4TA 5G0WA 3NBAA 5F7ZA 1TQHA 4DANA 1WDKA 4ZKEA 3WV4A 4D0LB 3Q10A 4TYNA 3BL6A 5DVZA 3DT6A 1BCSA 1ZN2A 1II0A 4PSVA 4RLFA 1WMEA 3F5FA 1XDBA 5A5DA 2BISA 1KGSA 2LUOA 2E49A 3DL2A 1TF2A 3GAAA 3OVMA 5BQPA 4DDTA 1RTTA 2ATCA 1O0CA 4QLOA 4DZRA 3CEHA 1YCGA 1AQYA 4D3DA 3HRHA 2O52A 3KTOA 1AZLA 2ANBA 4XW2A 3O47A 4BMPB 1ZVJA 2QZJA 4D6XA 2NACA 5AVZA 4PINA 1BDBA 1FFSA 2IHZA 3O6VA 5DXFA 3Q7QA 1APBA 3UAGA 1T4CB 3ED5A 2AR7A 3V4FA 3LWNA 1WVGA 2GYYA 3EVEA 4XJTA 1N34B 2AVDA 3VR2D 1KTIA 2WWIA 5IF9A 2V65A 1RKUA 1R8JA 1FBNA 3B52X 3GJ5A 3GUUA 1W36C 3R3YA 4RQTA 1M34A 4LZNA 3LTNC 4FONA 4GAEA 2TYSB 3VZDA 2Y4NA 4C2BA 2W83A 1FFWA 3STYA 3NVDA 1W2GA 1A9YA 3WKEA 5J4LA 1DX4A 2MDTA 4DMHA 5DWDA 3E81A 4I81A 2XTMA 5GGYA 2ETXA 3VKWA 4GSLA 4Y9UA 4NNPA 1U1IA 1BXZA 1L7XA 2PL5A 1WW8A 3UZUA 4G23A 1O54A 2PCJA 5LQNA 1ZAKA 4K3VA 3BSFA 3JZIA 3LD9A 1MT0A 3NP9A 2SCUA 5FA5A 4YMVA 4B3BA 2BEWA 1PDWA 2WM9B 5CX1A 1RRCA 121PA 1Z5VA 3C39A 3C8MA 3FLMA 3SFVA 2F1IA 3ZV6A 1LUAA 2PVPA 2Z2KA 4JVNA 2E5WA 4ISBA 5KKCA 1NMZA 2KQUA 1POXA 2B2CA 4JR1A 1NHGA 1J2YA 5G3ZA 4M9CA 1H22A 1RXEA 2FPMA 2PUVA 1WU7A 2SECE 4GI3A 1CQJB 4HFJA 2HV8A 4OEHA 1NJ5A 4LYYA 4IIYA 4HRXA 4N5HX 4L6IA 1N7GA 4XB1A 4EY8A 2PD4A 5FWYA 1ECPA 3JVUA 3TZ6A 5DZSA 2HMYB 1EVJA 2IDMA 1KP2A 2O1SA 1LD3A 3GFBA 3WKBA 3DNPA 3EQZA 4R5MA 4V39A 5GP1A 4ARAA 3WHLA 1M2VA 4ZI2A 2W2TA 2HHJA 5E95A 3FH0A 3BGIA 3HB5X 2O7NA 3MMPA 3FKSA 4KV7A 3EUEA 4U2BA 2ID9A 2O3TA 3PGXA 3ST7A 3TGWA 4FE3A 2P1ZA 4ID3A 2WIKA 5IFKA 1GGVA 4OMCA 4FYKA 4DUPA 1UOEA 4TSFA 2Y67A 4LF7B 1QIEA 2AE2A 4ABYA 1R9MA 3NT4A 1A8HA 4ER7A 2FKNA 3GG2A 2WB2A 3LPAA 3A26A 1E4OA 3G5LA 4B4DA 2WSYB 3SJAA 3W1EA 2WWFA 1AF7A 1VBKA 4GPAA 5L53A 3IPAA 4R7GA 1YK1A 4V1CB 1R37A 2IF0A 3P0FA 5HJ7A 3HBLA 1FRQA 3AQ4A 1MJGM 1FP4A 2R66A 2PD3A 3KYJB 1PN3A 4HAZA 4JIGA 3UFXB 4JI7B 2DF8A 3ITKA 1FTQA 4UVDA 1GQQA 3WISA 5E4YA 5KVAA 2FG6C 3OLWA 4E6PA 4MS4B 2R86A 1X8KA 1IJKA 2QN8A 2ZB8A 4D80A 2AG8A 2WW8A 1CB0A 1SVUA 2CF5A 1GYPA 3AUTA 3LZCA 1ULSA 5E1MA 3STUA 1FUUA 1Q77A 1VSVA 2WAOA 4H7KA 2FB9A 1U1GA 2CHUA 3BICA 4G26A 1HGXA 2QM0A 4RGVA 3EC2A 4PTLA 3OD5A 1GQFA 1ENPA 1LS1A 4X61A 3ETHA 1GU0A 3PC4A 4ZEOA 1B41A 5K3FB 5JCOC 4XUDA 4U7HA 4I19A 2VJKA 1J7KA 1KYTA 2G0TA 4X7PA 1KRXA 1R0RE 2GYWA 3PLRA 3K8YA 1XWIA 2B61A 2YXLA 3D5QA 4JSRA 5EY5B 2R84A 4WUTA 3SSMA 5LZ8A 2RKOA 4C0LA 4JLWA 4DZZA 2P0AA 4QYSA 1T13A 1CIPA 1TQDA 4RQAA 5EMHA 3RS8A 4EGJA 5BV8A 5IWAB 3QYAA 2UVQA 2OFWA 1F2DA 4CDRA 4RWEA 1V3UA 3D3WA 1ZC3A 3C3CA 1ISJA 3B1JA 2VUSA 1UM8A 4I9NA 4AUNA 3JYHA 2XNJA 1LI5A 3ZWYA 4ZWNA 3EX7C 4NBLA 1E7MA 3G7SA 5LNK6 4WADA 3TZBA 3H04A 4O4IB 6Q21A 2PH7A 2QRZA 3DWGA 4B4UA 1U0TA 1T4BA 1N57A 1AUOA 3RSSA 1MW9X 2RGCA 1P7WA 1WIWA 2PJUA 3EOZA 2C92A 1JFLA 2WUDA 3ZKWB 1RI5A 4R3NA 2VPPA 1M72A 2JIOA 1ZN8A 3R6LA 4H4EA 5HP4A 3F4KA 4BFWA 1VL1A 4P3PA 4DBZA 3ZVKA 1JHQA 1POWA 1JLLA 4Q6BA 3B9QA 1ZD8A 2REOA 4X1YB 1VJ5A 1MAUA 3CU5A 1BDIA 4U0JA 2ZWAA 4V0LA 2J08A 2ZJZA 3ZNQA 4D7AA 1XTJA 4FDUA 3PHLA 2RC5A 1OV6A 1QVZA 4M99A 4QDJA 1QCCA 2A58A 3K1JA 4L3OA 2IYVA 4UXIA 5HDBB 3W4IA 1G3MA 1BDJA 3BIJA 4D9KA 2H54A 4FNAA 3CVJA 1F8XA 1E9VA 4NNJA 1EQUA 2FA9A 1KS2A 4FKZA 3L93A 4M8NE 4W5JA 3KDAA 5H9VA 2VF7A 3VSEA 1B23P 4RY2A 3T7RA 3K2EA 4RY0A 3WZ2A 2WJAA 2XD4A 1QYXA 2Q1SA 3PLNA 3W0LB 4FIZA 3GFQA 5JS8A 1DCKA 1ZL2A 1IHPA 1GR1A 1JKJB 2HIAA 1CJVC 2OCXA 3E7WA 2F2TA 3BE8A 5IF3A 1LSSA 2W2KB 2P8SA 1GO2A 2J87A 3IOMA 5DO9A 4FNOA 4BMOB 4HNRA 3E3NA 4L28A 2A5DA 5FWNA 4FTWA 5K2MA 5ALOA 5E7JA 2H11A 4EY6A 1F5SA 1UP4A 3HUUA 3DDSA 1NTOA 1ZIDA 4Y2VA 4TQUS 3IVGA 1M74A 4NZ9A 1JHZA 4GMXA 2VDQB 4JGBA 3RAJA 1KXJA 4I5GA 4BN4A 4BVGA 1XB2A 4I99A 4DQXA 2ADOA 4FCCA 5JS7A 2DETA 2ZUEA 2HA4A 5JUWA 1NW3A 3LECA 2R5NA 3RC1A 2ZRJA 4IUYA 3WRXA 1VZ2A 2I76A 3VC2A 4A3SA 3GQBB 2I55A 2NV2B 5TLSA 2E4AA 4NBNA 3NTQA 3ZU4A 3TAXA 4ACBA 3CXUA 5CG1A 2DECA 1F5NA 2IWRA 4C4YA 4QM6A 1H3EA 4MVYA 1WL8A 1AXEA 3C85A 3NFRA 3QW2A 5EE1A 3TOCA 3GA0A 4LV8B 3T3PB 4C78A 4I9GA 2JHCA 5CCDA 3BHJA 4W9MC 1B8OA 1SHUX 4YP1A 4ZDJA 2VWQA 3DL0A 1MB0A 1FS4A 3ZR4B 3GOHA 3AILA 1IIRA 1WDWB 1JTFA 1PUXA 1XRMA 3Q3IA 1FMTA 2XUZA 3HKEB 4RJTA 1NFQA 5IM5A 3RU7A 5IULC 2C2MA 1PUJA 2O5CA 2HOQA 2HRRA 1I3KA 5F5LA 5CAEA 3HTXA 3LWBA 2XLCA 1Q22A 1UF9A 2HRZA 2WM3A 2BFBA 1MO4A 5C8VA 2D8AA 2AJCA 3J7AC 5BSUA 2JFNA 4KR9A 4RAQA 1U3CA 1YDMA 3QTLA 1PDOA 4BQNA 2XRFA 3RVLA 3VNBA 1YDEA 2WMOB 4DILA 4FZJA 2F62A 1W44A 1XT6A 4XAQA 1WZIA 5JJIA 2VOEA 4NI5A 1RHMA 2AXNA 1B2RA 3AFIA 3DSRA 3NHKA 5I7UA 3UOAB 4C6TB 2QL6A 3UJ6A 4F4CA 4PQRA 4MAMA 2PLAA 4OXYA 3OMLA 2AN4A 1C9MA 2FXVA 3CUSA 4GDMA 3RC9A 1NI5A 4U2FA 1NXQA 1VGVA 2BLLA 2CDCA 4LY9A 5AK6A 4DM7A 1HX7A 1CTQA 4ENWA 1E1RD 1VHWA 1LLFA 4G5OA 4JS0A 4UTZA 5LIRA 4WH0A 1JMYA 4M1KA 2GEFA 2XQIA 3K9NA 4IGKA 2Y1OA 5EZQA 3OEYA 2JC3A 3X44A 1AHPA 5AWFC 2B5VA 4WGGA 1CW2B 2BJWA 3IURA 2A0WA 3AM5A 4GG1A 3K31A 5DHRA 1D6NA 1VIMA 2ECKA 4UD6A 3VTZA 2QRHA 5TIIA 3KAKA 3WGTA 3EIWA 3ZQKA 1E60A 1JAIA 1C7ZA 1OVGA 1SIUA 2OILA 3EQ2A 2I34A 2D3TA 3CB4A 3LPMA 5L3ZA 2JAXA 1QYIA 3F9CA 1JLRA 4ESOA 3S2IA 1RJWA 3AERB 3H11A 1WSAA 3KVVA 3P27A 3AM1A 1WR8A 2IS4A 3D2BA 3TQOA 4EHKA 4UMVA 3NBXX 1RRFA 1DV1A 1VIAA 4Q9DA 4RUKA 4E07A 1ZA2A 4L9AA 2WAXA 1GKUB 4UOQA 2ZSFA 4CT5A 5LYJB 5KNBA 5IKOA 4GVXA 3ZU3A 1L5WA 2C9ZA 4X6UA 4NPCA 1Z62A 4CLEA 2HQBA 4HMOA 1BXGB 3DAYA 2L19A 4KFSA 4PWYA 3RREA 1L7BA 2EYQA 2C0QA 4ZA2A 4QXOA 2K87A 1HWYA 4G37A 2FSVA 4BU0A 4KQIA 1G3UA 2VHUA 4BP3A 2P6UA 4LVCA 2WA2A 2FWPA 5HF5A 5KJEA 4DV2B 4U2EA 2I7TA 3HP1A 3OZ7A 4C5CA 4EENA 3AI2A 1FUKA 3B8EA 4XCXA 1VG8A 2Q3MA 5DT2A 2V7UA 5DGCA 3W6UA 2I87A 4FILA 4CCAA 1M2GA 3V3TA 3Q1KA 4M37A 5IMSA 3GDWA 4A4DA 4TV8B 1ZSNA 1A82A 1QH1A 1PX0A 2W5UA 1K5DA 2XWBF 4K2AA 4LDAA 4UCQA 4WLNA 4YLEA 3ZE8A 4CM5A 1JJBA 1FYFA 2VJPA 4P53A 5L3SA 4Y6GB 2YQ4A 1YE5A 1SWWA 3AGQA 3CNOA 1USIA 3O03A 4LHVA 1A7UA 3EGDB 4BUJA 1B26A 1XRQA 4KSBA 5IM4A 3CVYA 2C7PA 1Q44A 1TTQB 4J8PA 1A3CA 1JHRA 1N9GA 3BDAA 4OB6A 4WDRA 1BS1A 2X4IA 1U0SY 4RL4A 3ZTYA 2VPYA 3CUTA 4DV0B 3ZVNA 3S68A 4B3RB 4MB0A 2UZAA 1W52X 4DQVA 3QNWA 2QU8A 3BS4A 2ATXA 2C96A 1U5AA 3JRWA 3LPNA 5I6DA 1MC5A 3HM9A 1N8TA 5JAOA 4U8GA 5IASA 1USKA 2RGGA 2XYVA 3HN6A 4G5XA 4BQQA 5JRDS 3F5DA 3R1IA 4IWNA 1HO3A 2QGNA 2XYPA 1YVRA 4QRHA 3D8SA 2CSXA 1MD9A 2ZQYA 1IUKA 2BGGA 4UOEA 1EWVA 5B3JC 1F4PA 4QBIA 3SX2A 4OPMA 5HSGA 3HO8A 2AOUA 1ESDA 3KTAB 5CIQA 2ZIWB 2H4YA 3TFWA 4FT2A 4DPKA 4LDPA 2APJA 4GXNA 4OL0A 2N0SA 1A8PA 2GZAA 3GLSA 4NYIR 3VV2A 1NVBA 2YWRA 1HG0A 5AM4A 5FUXA 2Z5LA 3TLJA 5C80A 1X2BA 2RJNA 3EA4A 3G5AA 1D2RA 3IT3A 4K46A 4YONB 1T8TA 3DBLB 2VUHB 3VRHA 2H1HA 1OH5A 4MJLA 1W30A 4EABA 1TYEB 2J9RA 3WIUA 3FHCB 2EQAA 2PS0A 1X70A 3MGKA 2OORA 4CJXA 3K0BA 2QQEA 4A2QA 1EWRA 2WTAA 3DOOA 5LJLA 1T2CA 3GLTA 3P9SA 4G0ZA 5SZIA 1UADA 3KSRA 1N2EA 1N9GB 3WRYA 5DXAA 3EZ2A 1RR6A 3MELA 4YP0A 2ZSBA 1E3JA 3UMMA 1PGJA 4YUXA 1CJCA 5BMVF 4K28A 4BNNA 3UWSA 1RLIA 3WB9A 3L7NA 1DAKA 4PV7A 3BFPA 3UT0A 1NYRA 1YKGA 3FJOA 1HQDA 1PP4A 5L3SB 1AY0A 1OTHA 4XR9A 4ARVA 2JIPA 3KE9A 1QVRA 3D8NA 1UZMA 3HDJA 5JHGB 5IU6A 3DF7A 3SYRA 1BXRB 4G84A 4DQ0A 3QFSA 1DWPA 1UK7A 3P9ZA 4FFBA 1DE0A 2BTQA 3C2QA 2HHAA 2VP3A 3MPUA 5HUQA 2YHIB 4JOSA 4KN9S 3I8OA 1M67A 3X2FA 1TTTA 1WKBA 3K8QA 3Q40A 4RIGA 2V3CC 5BWBA 1TO6A 5AP9A 3U7FB 1CR4A 1RRVA 1VRCA 4O2BB 2OK8A 2X0JA 2XXBA 3SBEA 3GRCA 4GL4A 1ZN7A 2W2LA 4EB6A 2VH1A 2ZDHA 1FXSA 4Q03A 1YRBA 1TCVA 4Y0VA 5ALYA 5LFAA 3NU1A 2SBTA 4GRAA 3A1SA 4RH0A 1EAMA 3ZDCA 1NG1A 4DB2A 4KKVA 4F2HA 5CLHA 2XNDA 5LBIA 4CN9A 2WJ4A 3OE4A 5KX5A 1G5TA 5LYJA 1V7PC 3PC8C 4BP8A 1RC0A 4JELA 4D6YA 3DL7A 2GYUA 3INTA 2VEOA 3W2IA 2H00A 4HNTA 3BA6A 3DO8A 2VHQA 4HFMA 1T9CA 3PFHA 5FTKA 5HFAA 5JI2E 3A2KA 2CVHA 2CHQA 3TCNA 2Y1EA 1KF0A 4G2NA 3NVAA 2RCYA 2Y0DA 5A5EA 3HR7A 3HV2A 3DZCA 3EF3A 1N1MA 4LRWA 4A0SA 3C74A 1RXVA 3PJGA 3AF4A 3VAAA 3SCZA 2FQQA 1WW3A 4FDAA 1N33B 5TVKA 1GZUA 2FPKA 1GG2A 2IOFK 3KZXA 3TDMA 4S2EA 1UXOA 1EVKA 1JQEA 4GBJA 4MAFA 4YIKA 2IGTA 4QXRA 4J7AA 3AY7A 1KO4A 4WHMA 1HNWB 2JHGA 5BN5B 2AJLI 3UIEA 1IE3A 2O8BA 4Y2SA 1X6VA 5D3KA 3ISTA 1JIUA 4DIFA 1E1MA 1VMAA 3CPHA 4LWQA 1G5PA 2HLPA 4DQDA 4EJMA 5ES4B 2R1TB 1NATA 1OXKB 1R2QA 1T3TA 2QT9A 2VNSA 3HP7A 1ULAA 1NDQA 1ZGCA 3G68A 2AKEA 1GZDA 3I28A 1UM9A 2J3IA 3MRSA 4BLRA 4QHTA 2FR8A 4GKAA 1SZCA 2GD1O 3H8JA 4A0HA 4BCDA 3D6JA 2O7QA 4C6TA 3HJUA 2VPZA 5K3BA 2Z2XA 3BMQA 3SIPA 3P94A 1K75A 4F2WA 4CLOA 2OC4A 4A5SA 2AEFA 4WCDA 4Z7OB 1RKBA 2JI4A 5FQOA 1W0JA 2EP7A 2Y71A 4G4SP 5DNDA 1RWPA 2XGGA 3FYUA 1K08A 2WPDD 4URVR 2VAWA 4B8YA 3JAKB 4O4JB 3VC7A 4LF5B 4HF7A 3DEAA 4M1WA 4RKQA 4F7DA 3NMUF 2VXBA 1LB1B 3ORRA 3IOBA 2I1QA 3CMCO 3DTNA 3IAHA 3MF4A 1ZOPA 4HG2A 1NUHA 4HWRA 1SRRA 4BCBA 1U28A 5P8WA 4EG4A 2ACVA 1YUBA 1JBEA 2V0CA 5DH9A 1YS2X 1XWFA 1DTSA 2ST1A 3BMNA 1Q83A 3HSYA 3KLMX 5HE9A 4YUAA 5AW4A 4DV6B 1ORRA 3O8NA 4D9NA 1N5IA 1C8BA 3KLPX 5G0TA 4YUVA 1BJKA 1PJZA 4LXHA 1MOSA 1U3DA 3B48A 5G1PA 3U9LA 2P9GA 3MTIA 3TSAA 5JCPA 1DUIA 3O4GA 2AMLA 1USWA 4QICA 1JEAA 1XLTA 1L5LA 3ZIAA 1IBMB 2QENA 3AY3A 2JH3A 2ZBEA 3DLAA 3R0JA 1F12A 4O02B 5EWMB 3V7YA 2COKA 6PFKA 1P2FA 4HQFA 4KRYA 1I36A 3DWFA 3OCXA 1H5UA 1TM1E 1ZEMA 3KB6A 3NIWA 4P7BA 2ZBFA 3KZNA 3MRTA 3PQDA 1O3YA 1OB2A 4OXKA 5FTLA 1PL6A 2NQTA 1ZBQA 2C54A 5EEHA 1EDEA 1KARA 4BJ6A 2QAGA 1U2GA 2A88A 4MVXA 4OU5A 2GDZA 1J42A 3QM1A 4JASB 2AIRA 2Y0CA 3QMWA 3VR3A 2YMLA 2DHEA 4Y8VA 2FPLA 5LLSA 3LVQE 4MWEA 1G1AA 1NNI1 3KPWA 5HS6A 3D4OA 3EVDA 1W5BA 2CEAA 3QLTA 4JEUA 2RKBA 2IDZA 4IIHA 1I9CA 4N3NA 4AP6A 1L7VC 4RKRA 3MGGA 3QU9A 3L6UA 3SYLA 4MRMB 3ZG6A 1ETHA 1V3VA 2IXGA 2OHGA 3L7DA 2TMKA 3E22A 3GCXA 1IDN1 2YWJA 4L8YA 1Z8NA 2VNJA 3KYDA 4M49A 1QZXA 3UK1A 5GJWC 3ETNA 4XUCA 4HH0A 3DBIA 5HRAA 1COWD 1T34A 2Q45A 3HCDA 4KQJA 2C9BA 1I2MA 3H5IA 4Q4HA 1PJBA 3TSYA 4BNXA 2VP6A 4R1NA 1OHHA 4NVRA 4C4TA 4D9IA 1I80A 3VH2A 2VQFB 2ATVA 4U63A 4CMJA 2B3DA 4MQFB 4HN4B 5ICGA 1PD0A 5KX5B 4MEAA 4MKZA 1S8FA 1PFYA 3PFKA 5JZVA 3VX4A 1HFKA 4BO3A 3E9QA 4GMFA 4ZRDA 3GJTA 1O08A 4A27A 2Y1DA 1E1DA 2E4ZA 3AQIA 2BRUA 3KUCA 5J23A 4BQRA 1ZXXA 1FFXA 4P22A 4UMDA 2BKLA 2X1VA 3MVEA 3HWX1 4BZXA 1YOVA 4GX1A 2W70A 5BNIA 4F12A 4TWJA 2BMFA 2X13A 1PFGA 3AL3A 3BL5A 5A5VA 2F55A 4WLFA 1GKLA 3PXDA 5B1DA 1NC3A 3I8SA 3L4SO 4KXNA 1WOYA 2B9EA 2F59A 4Q9NA 1QHFA 1MEJA 4UHFA 2CGEA 3LT1A 4IVQA 3QITA 3RVKA 3B5EA 1LK0A 1IY9A 3RUAA 3NHAA 4LDZA 1UT6A 3I9KA 5A4IS 5BPHA 1U8TA 3CB2A 1Q0PA 4JX9A 4ZCSA 2IYRA 2VBFA 1WE2A 2BGKA 3MCWA 5DCWA 3O7MA 1O9HA 3OQ6A 2GN1A 2DR2A 2XZLA 4MP3A 2H0QA 4XKJA 1QV6A 1J0CA 3QTTA 1FJ2A 1SD5A 3AL2A 1K3FA 1PR0A 3FRIA 4FZ3A 4FYMA 4LMRA 4PRLA 1KYYA 4FFVA 3T7IA 3WGKA 2Q3FA 2VIIA 5GADl 2EFCB 4PC3A 1G8PA 1YZLA 3NH9A 5LD2B 3RYFA 3BFKA 3MLEA 3N07A 5CFZA 1NXXA 1QE3A 1TRKA 3JALA 4DSNA 1GCGA 3GJ8A 3KB1A 3D1VA 2ZTMA 3RHSA 2H4ZA 1YQDA 3CLKA 2Q6OA 4XOIA 4D4MA 3S44A 4I8DA 4EFDA 1LC0A 1XPOA 2VPQA 3C1UA 1K4KA 4MYTA 2QX4A 2COEA 4OI1A 4CR7A 3WK6A 4NU0A 1ENZA 1EUYA 4ATNA 2W2QA 3S28A 4D9EA 2A92A 2HMAA 3BA1A 3FPJA 3O8QB 3U60B 1H5QA 1OT5A 2YC4C 3MTBA 1Z34A 3SEFA 3K2BA 3ZGXA 1MVOA 4QM7A 2HQRA 4I5FA 1EM8B 2VUUA 3QFRA 3S8EA 3P9IA 5DBGA 4DDHA 4J1TA 1JIKA 2FTKE 2NNWB 3ZWCA 1KVSA 1ZVMA 4ZOAA 4J03A 1U3VA 2O2GA 4L95C 3ZZ1A 1U8XX 1TPYA 2FMFA 2I8LA 4I1PA 3A6DA 2PX8A 4O59O 4GR5A 4CQMB 1NVGA 1XF1A 5EJ9A 4R41A 4UPDA 5C1DA 5HR5A 2C9MA 5KNCH 4GC5A 4CNQA 3PQ2A 4EGQA 3DZBA 3ET5A 1QS0A 3H75A 1D0IA 4X62B 4H1WA 4RTQA 4ZREA 4DXHA 1YR2A 4V2UA 3R7SA 2MJLA 1F6BA 1AURA 1LI4A 5T67A 2JJ1A 4B0OA 1IYZA 5LR6A 1FEZA 2AG6A 1P7CA 2QMHA 4ZDWA 4ZOQI 5HRCA 4C29A 1ZLYA 2IU3A 3HB1A 5BR8B 4S1NA 3PEUA 3WGGA 3LF1A 4MKFA 1WPXA 4KTVE 4MV3A 3UHAA 1GQRA 2I66A 4RDIA 3A3PA 1QUFA 1T5OA 4JN6B 2W6CX 5SICE 1W1UA 3SF8A 1X7ZA 1DLJA 4IXMA 3ZV4A 5KTYA 5IZCC 3I4FA 4JGGA 5F5XA 4B7ZA 1N5OX 1VDMA 2Z8ZA 2R87A 2QL7A 2NNLD 2PT7A 4QUDA 2BVNA 2UV8A 4KQ2A 3VR6H 4C6RA 4Z7JA 2OC9A 3CF2A 1QYRA 4KHPB 1D2AA 4I46A 4DPMA 1R0BA 3L79A 4GPIB 3F4BA 2B34A 2HZ7A 1ZM9A 4B45A 3TX6A 5C18A 3G9QA 4FWTA 3DDCA 1QO0A 1V0JA 2V7BA 3PKZA 1RAEA 2FSHA 3JCZA 1II9A 2Q6TA 1HKUA 2I65A 3G7UA 2IEDA 3I9LA 2WZQA 3RS7A 1OILA 3SYMA 4DXDA 1I4LD 2A0FA 5CFLA 3PFIA 4KN8A 4KXFB 1G8KA 4GGOA 3C87A 4XPIB 1EP3B 2NZWA 5GGXA 3VR4D 1C2TA 4MPDA 2OD7A 5B7PA 5JSZB 1UWLA 3TB6A 4ER0A 2K7FA 2AC2A 4F3TA 5C7OO 1JAZA 4AMVA 1BKSB 4O6VA 2BJVA 4ZPXA 4A91A 1NBMA 2RE8A 1H4QA 1WPRA 3R5XA 1YFLA 1CUJA 1P1CA 3E61A 2HRCA 1R00A 1MVLA 3ISVA 3KT8A 2POQX 4DDUA 1H4SA 2JLAA 4C7KA 5CUQA 3KHSA 3GLIE 1PJ8A 2LIVA 3GZJA 4MQ5A 2B94A 1DAHA 4NBSA 5EKXA 3GP3A 1GPJA 3G0HA 2WAMA 1JR3E 1KBQA 1NAHA 2NGRA 1JR4A 3QJYA 1LBSA 2O2CA 4B85A 4GPD1 5REQB 1WBBA 5AESA 3FTDA 3IO5A 4BFZA 1GPWB 1L4BA 2UYQA 4QLBA 3HYLA 1AZSC 3ILXA 1O5TA 3AVQA 3LLVA 4ECAA 1A27A 3OPMA 1O58A 4RHTA 1N6LA 4IIJA 2QPOA 1Q7GA 1QYDA 1SHLA 4L0MA 3VO1A 1WB9A 2CYAA 3UWDA 1KFKB 1N8NA 2VL7A 3LLMA 3UH1A 3VPGA 5BOSA 3TBKA 4KREA 2F3RA 3W8NA 1IY8A 1ZNQO 2Y0EA 3JYQA 4WBNF 4A36A 4KLNA 1GGEA 4S2UA 2AS0A 3BXZA 4J16C 5ILOA 1IQPA 3PPXA 3SFTA 4DG8A 3ZXSA 4F5EA 1JFFA 2H08A 2WVGA 1DCMA 3NWJA 3PZRA 4FN5A 4IOKA 1E1KA 4QLAA 2H8GA 2AR0A 2ORWA 3FDIA 3OOYA 2P2NA 4P34A 4EHAA 1Z4JA 1QO7A 5LUBA 1S2LA 4D0RA 1DCFA 1W4RA 3LCVB 1TADA 3NORA 3FUWA 4IDQA 4N01A 2CUTA 5IUKC 3ROPA 4R5HA 4G4GA 4OX9B 4F46A 3ZWWA 4OJTA 1NURA 1OTYA 4DR7B 3KKMA 1W6UA 2BFBB 3GWZA 3OMXA 1AHHA 5JPDA 2BLNA 2O5EA 3H65A 2I7XA 1QCZA 3DZDA 3EDCA 4EPTA 1O95D 4F2GA 4YJ2A 2WZBA 4O4LF 2BEUB 3HR8A 3K9QO 5GONA 1LKZA 1NXWA 3VHXB 3ESAA 1YL7A 1A2KC 2FG5A 4OLJA 3GLIA 5HKOA 3M2TA 5LZ9A 3ZNNA 1OJ7A 3V34A 2G8LA 4XX1A 3G2MA 3LCRA 1EFPB 1NU8A 3AF2A 1L5NA 4TSFD 4B7UA 1GPH1 2YIDA 3IB3A 1YZKA 2ECFA 3KOXA 3HA3A 1YA4A 4Q3OA 3JD0A 2M6LA 4CV0A 3U5ZB 1OOEA 4R3UC 1XX6A 3REOA 1G9TA 2FEWB 1KAHA 1B8PA 4DS3A 2GZHA 5J47A 1JILA 1H1LA 4ZDKA 2Z08A 4KXQA 3JZDA 4Y9RA 1X7WA 5LXTF 1D2CA 2IYWA 5F21A 1E6UA 1TAGA 2OT3B 5LBTA 5T64A 4DLBA 3QENA 3MTAA 2P9BA 4GE0A 5K7SA 3V4LA 1DJLA 1S7CA 4JA2A 5A6SA 4BLWA 1W87A 3ONDA 4I50A 3VQTA 1Z2AA 4O4LA 4HNVA 3PFCA 1FVOA 4MARA 4F84A 1Z2NX 1QQBA 5ECDA 3H8SA 2ZXEA 4BO5A 1K3TA 4D43A 1YI1A 5MHTA 3DDHA 3NIDB 1IM2A 4IOLA 4FE4A 4WVLA 1L4GA 1WMDA 5BQ5A 4ZHQA 1SY7A 3E05A 5BV1A 1G7CA 1CUIA 1WMSA 3MG9A 5HF8A 4WN9B 3TM5A 2H9YA 2EF0A 2FPXA 1N2CE 3AEUA 4PC6A 4FU0A 1LZLA 2EKZA 2O8NA 5JXJA 4LFCB 1S2MA 2BV3A 3A8TA 3B9PA 4PYQA 3TBHA 4OBWA 5C0OE 4JLPA 1EFRA 1SXJA 2IKQA 1O94D 2X7JA 4JAVC 4XARA 1KE2A 4I4NA 3ZGYA 1E6EA 3CG4A 3KO8A 4L50A 4EI9A 1Z38A 4NFSA 4V02A 4RTPA 1HTTA 4LK2A 5CH5A 4M1MA 1CY8A 2Y93A 4MI6A 3PWKA 3ROGA 5IT9A 3WNQA 2JG3A 4CR8A 1Z4PX 1FNCA 1JQKA 4JOCA 4TXNA 4Z51A 1HNZB 2I6SA 2C8KA 4IIJF 4LUCA 3T0FA 1HDXA 3D6AA 1G5RA 1A9QA 4R2KA 4RXMA 4CLOB 5DBOA 3RG8A 1ISRA 5K51A 1ZOSA 3CVXA 5EC8A 2X5XA 3B2EA 2JIZA 4TS3A 2HU2A 3DB1A 4AMBA 4BO1A 1KQFA 2FMHA 1I0IA 3N2NA 1GRVA 3M4YA 4KX5A 1QJCA 3BGOS 3ESYA 1P1HA 1I2AA 4BB0A 3ZY4A 3VR3D 4TXJA 4ZEVA 3LHFA 4PN3A 1G38A 1JHVA 3BUSA 5K0LA 4CHTA 1M6NA 1ZJZA 2GRAA 4P1ZA 4JP8A 1VBNA 5CB0A 5MDHA 3FKSD 4OQEA 1H3NA 1T5LA 2RDMA 4HEA1 4ZVVA 3RG2A 4FYHA 5IMBA 3H1AA 3PXXA 5B1IA 1KEUA 2IITA 3TG2A 2PBFA 3I01M 4ZXPA 1HQKA 1P2BA 4CKEA 1OX6A 1U0JA 2F9LA 2V9PA 4MICA 4CQMA 1FTSA 2B69A 4NONA 1TW2A 2DY1A 1TW3A 3JW8A 2P1RA 3KWFA 1KMQA 1DAOA 4ZKDA 1AIPA 1NVEA 1S1MA 2EWVA 5DCUA 2OE2A 3EG9A 1UXKA 3VV3A 3QHQA 2A9FA 4CU5A 1JIVA 3FRHA 4FDVA 1VKZA 4CHGA 3P4YA 4MJXA 3RFFA 4HP8A 5KS2A 2OBNA 1JDBC 1WZNA 3Q3GE 4LRTB 1C9DB 2YBEA 1KERA 5KWEA 4UM7A 2RBGA 2E1RA 3EWSA 4EJSA 1EG2A 5JCXA 5EMJA 4F97A 2Q62A 1UBKS 3H5TA 5FV4A 1SXPA 5K99A 4UUPA 5FA8A 1Z0IA 1RI3A 4L4ZA 5JY6A 3P2KA 3GPLA 3G0DA 4ZCPA 4AJPA 4Z86A 1KJZA 4B3XA 1SM4A 4JI2B 2FW7A 3C6ZA 4X9XA 2BUBA 2YZNA 3L49A 4NE7A 1XRJA 4S1PA 5F1OA 4NS1A 3KKLA 5A7HA 1E59A 2WQZA 5KAPA 1KJJA 1Q6ZA 1E5XA 1JTEA 2WF5A 2P9CA 5KKNB 1U31A 1E3IA 2JFXA 3IODA 4MKHA 5B3LA 4J6FA 2WUGA 3VZRA 4R2MA 1BHSA 4FYIA 3O8OB 4AF6A 4ZCTA 4V38A 1TB4A 2JFOA 4HFRA 1HE5A 4ENQA 1XNRB 3U9TA 1OWNA 1W1WA 3ABZA 1QYCA 2PTHA 2YWGA 3NUQA 4X1YA 3TQCA 3L6RA 3LTEA 5CITA 3QQ5A 2Z6QA 4G8CA 4DTCA 3X1MA 4HLNA 3VNVA 2XOXA 1P60A 3FTCA 1Q1AA 3KAQA 2FDRA 4RHCA 5FP0A 2DXIA 1CJMA 3WMFA 3HSKA 4W5QA 2Q2OA 2VJNA 1ETUA 3NUGA 5L3RA 4CYMA 3DMPA 3E2IA 5HGXA 2WTMA 5AKLA 4ABTA 3RT1A 1FZTA 2HA7A 4XR4A 1G3RA 1SH7A 2FJUA 1RPTA 2GGSA 4KYUA 5TMDA 3G89A 3UA4A 1IL0A 4BCCA 3Q6MA 1KI6A 1R8QA 2C4HA 2OHOA 1XXLA 1R5BA 4ZDIA 4G2TA 4UAJA 5EL0A 4I7EA 4PF1A 3B36A 3FLEA 5LB4A 1RYMA 2HAEA 1SKAA 1X14A 5DW3A 1J1UA 2E4XA 4BMZA 1CRPA 4RMGA 1YFZA 4PCUA 4RDHA 5D6OA 3VH3A 4OA8A 2XB4A 1GAWA 3MWLA 4I2VA 4EPVA 5CURA 5ED0A 2SCUB 4MIEA 4B33A 3M6UA 4L3WA 4KNVA 1DBVO 4NZMA 5ILQA 2X7XA 2ZIXA 1E6CA 4M86A 3G23A 1NRJB 4DIEA 3CCFA 4BFVA 3NR2A 5BRJA 3RRZA 2AQKA 2RGWA 3L6CA 4WMLA 3THSA 1RJ9B 2RSLA 1RC8A 3A4TA 5EJ6A 2IU6A 1NFRA 1T2FA 2MSEB 3QYPA 3S40A 3TIFA 5CT6A 1WHSA 1U5BA 4U6SA 3I01A 3SR4A 1FFHA 2G6BA 2XQFA 3QPVA 3HDHA 3HKDB 1ZVVA 4TM7A 1IN5A 4UREA 5K8IA 3I1FA 1NLFA 3H8WA 3I9V6 2I22A 4ML3A 4D3YA 4N03A 2XJ4A 5LZ2A 4FLMA 3PIIA 1KK1A 3ABRB 3N5KA 2X5KO 3LBYA 4QYXA 3IDQA 3DZFA 4HEJA 3C45A 1LTQA 3FD8A 4YS6A 3TQQA 3UK6A 3FCCA 3TECE 1C80A 2GO7A 2GBIA 3F1LA 2JH9A 3IV7A 3UCFA 3TPFA 2XVZA 3FVRA 4FHFA 4LECA 4YK7A 1HZZA 4IBOA 1EK1A 2ODBA 4FGSA 1ZOLA 8ABPA 1E20A 5JANA 1JWBB 4NEHB 4X85A 4J07A 3DO5A 5FNVF 4P3KA 1TQ2A 5BSTA 3RTGA 2PH3A 4C22A 1NF9A 5M04A 1DEAA 1PJTA 3E8SA 3RK1A 1RZUA 4LZJA 4B3HA 3K35A 1QR2A 5EWLB 4YCMA 1VHTA 1H8EA 1LWNA 4OHOA 5ALPA 2Y8EA 4KDEA 5CDYA 4FN4A 2ADFA 3R7WB 3WOHA 5DIZA 1KVUA 1J1IA 2VJYA 3WC4A 1L4HA 1NW6A 1RKXA 3VYWA 1V3TA 3DMYA 3ADDA 1FFGA 3HVKA 3LDFA 4EK9A 1C41A 1OFIA 2PDAA 4L5YA 5JD3A 4Q4DA 3LX4A 4BNIA 5CB8A 1DKOA 4NX2A 4R1SA 4YT5A 2BZGA 1MJNA 3DM9B 2P9ZA 1RACA 1IBLB 4NE2A 1RI1A 3NHLA 4IRUB 5SV2A 3W5JA 2QR2A 5B3JA 4O2RA 3CKYA 4ZFNA 4YP9A 3THYA 3FLAA 2F1RA 4CTOA 1Y1KE 4UEQA 1UANA 3HDVA 4E4YA 1U2GC 3FUXA 1P91A 4IR7A 1KGDA 4C0AC 3DHNA 2HB6A 2BMEA 3FMOB 2HH9A 3FWZA 1YVUA 3IHWA 1VE7A 7REQB 2HJSA 4NYMR 2PVSA 1RVDA 4W1SA 4AICA 4IV8A 5LP6C 3EH1A 2WTBA 5HKKD 3DT8A 1YKFA 3MPOA 4RLSA 4X97A 1EBUA 1PRYA 4Z99A 2OXCA 5LD2C 3QSYA 2BSXA 1V4VA 1ZMTA 3L7JA 3ABOB 1RYBA 1O97D 3AKCA 4GO1A 1PT7A 4O4HA 2NXWA 2J0UB 1IC6A 2XVAA 3RAGA 1DLIA 3M9LA 5B4VA 4GXRA 1T6XA 1Q1GA 1KPHA 1Y1LA 2D1RA 2E4WA 1W93A 2JIDA 2X4GA 2ZJOA 3MINA 4WQMA 5FPSA 4Q4CA 2VYNA 3A6HA 3E22B 1A97A 1V5GA 1Z5OA 1ZQ1A 3DJFA 2R79A 3LUKA 5ELLA 4YR7A 4E51A 1EJ2A 1THGA 2OKCA 3MINB 1YZQA 2GBPA 3DLPX 4CCSA 4PZLA 3HB4X 2Q6IA 4JI4B 1QGYA 1PG5A 1O87A 3IP7A 4OGFA 2CUNA 3GRRA 4RJKA 1XQWA 5EIFA 5IJ0A 4DUZB 2BEJA 2E55A 5EP1A 1NJ2A 2EZ4A 4LNUB 3SYNA 1KEEA 1SVOA 2BZ1A 3QX9A 3IUBA 3H2HA 2XADA 3LYAA 1ZYUA 3R7DA 4S35A 1U4SA 1A5BB 3AERA 5KUTA 1KP9A 4W9NA 4MOWA 1QIJA 5HMLA 4ZAGA 2XEDA 5CB6A 2FOXA 3OM8A 1GZSA 4S04A 5IUNC 3TMAA 2GAFA 3AV3A 3G0BA 2QPTA 2R7MA 4J0FA 3LXXA 2ZYUX 2PGIA 2WJVA 3AETB 4HDCA 1NG9A 3ON5A 1LLQA 1ATIA 5EE3A 2UXCB 2X0NA 3AJAA 4G0QA 3IPLA 4QD3A 3ZUGA 5A9RA 2VA9A 4JZYA 1E3QA 3PKIA 3T94A 3FCSB 1PLKA 1KBOA 3GVPA 2HADA 4IINA 4XIGS 4ZO4A 5DGHA 3UT5B 4M0FA 3ZI0A 1MJHA 3AHHA 4XGKA 2ZUSA 3JVVA 2UXDB 1F3OA 3C6BA 3OIYA 1KAOA 1UKYA 4JLDA 2CW5A 3K2IA 3ZEAA 4BJ3A 1CP2A 3T1VA 1AKWA 2QD5A 2IYNA 1K4MA 3D3QA 4HMQA 3JPYA 3PHJA 2WTUA 2JB9A 4TV8F 1BQ4A 2C2GA 2Q29A 4JK3A 3LY9A 1SUCA 4ZO6A 4TN1A 1QV7A 5L3QB 4HEA6 4RZHA 3SICE 4DMKA 5CFQA 1DAFA 4LHEA 4N47A 3RC3A 3I92A 5T57A 3GEGA 2CXTA 4G24A 1EZZA 2QXUA 4BLQA 3COYA 3VKUA 4DNOA 3N0XA 4P86A 2V4MA 1ENOA 1PVVA 3BMQB 3RSZA 3FF1A 1CEEA 2BFNA 3RC2A 3JRXA 1TU3A 1PS0A 3A1UA 3L1HA 3MN1A 4XGNA 2ZRMA 2PXAA 3O92A 3AI3A 2PX2A 1QBGA 4E5DA 4C05A 1KSFX 2A0YA 5LU9A 4FCTA 2ZGVA 1GQSA 5TXGA 2PE5A 3I2FA 2C7VA 2X77A 4PZPA 5LYJF 2QQ5A 1RAFA 3EWIA 5JO9A 1GTJ1 1TL7C 5IC4A 3DTYA 4UTVA 1TZJA 2JF0A 2R8PA 5FO1A 1MNQA 1C9EA 2ZRKA 1JKFA 3DOJA 1Z4MA 1UBOS 5AJVB 3C5HA 2IYLD 3JR7A 2F3TA 5CK4A 3RVJA 1SIOA 1I24A 3M6AA 4B76A 1Z9BA 2DBVO 4GC9A 3ICCA 4GMHA 3N87A 1EHIA 2BM9A 1BMDA 4M36A 4UEKA 2ZUCA 3BAFA 3CT4A 3E3OA 4JITA 2H1FA 2Q3BA 2Z5FA 3OE5A 1JIJA 5H70A 3DKIA 1TX4B 4ITRC 3CR7A 4LMPA 1DJQA 1AKQA 1L4KA 3OQIB 4OCZA 4RVSA 1BKDR 5HBRA 4DG9A 1TMGE 1ADJA 2ZSDA 2GHRA 3MAJA 3KYCA 4TL8A 1AN0A 2MYTA 2JKYA 3DDWA 5HZHA 1US8A 1ZU4A 2HUPA 3EWAA 3BHNA 2IYQA 1E94E 3H4IA 3LV8A 4IIVA 2FZGA 1Z8HA 3EDMA 3L1JA 4AJNA 3PT9A 5FLXA 2P2CA 2BPOA 4UNIA 3QELA 4LY0A 2DHCA 3IJRA 4KBYA 4OQPA 4RK6A 1X9HA 3U4IA 3TE7A 1NVKA 1QZZA 4YAKA 1PWEA 1B8VA 2RK3A 4JLMA 4N7RA 4DNXA 2IPXA 5JYCA 3ZX4A 5BSFA 4WXYB 2WD7B 1MV8A 1QK4A 1DJPA 1DQYA 1NJGA 2C61A 2IRWA 2G1AA 4OQDA 1YWGO 4QTTB 3M6IA 5ALEA 1DC5A 1GZ4A 3EDOA 3PR1A 1L8XA 2H52A 3QWBA 1SXJD 2ZVDA 1FNDA 3FTPA 3MCUA 1NNSA 3E9EA 4QBTA 4YRPA 4DQLA 4IWXA 5KJ1A 4HQOA 1Q95A 1UWKA 1XMVA 3SIWA 4OTZA 2W93A 4WNYA 4PLVA 3TJMA 3U17A 5L51A 2IF2A 4I4CA 1GAEO 1OLUA 3GJZA 3L8GA 1C1YA 2ENUA 3O83A 1XF9A 1XP8A 3CN9A 2WU0A 1ZESA 2YVLA 4JGIA 1UJ4A 4HGNA 3WLIA 3IAXA 3VVBA 2YVKA 1XZAA 3VPXA 3ICOA 3M9XA 1ID1A 4R1TA 4TL6A 3I9JA 3MCZA 1OLSB 3UMGA 1FU7A 2OCKA 4KFRA 3D02A 4TSRA 4HUJA 2PGAA 1E9SA 1NR7A 4JFAA 3IJPA 1X1CA 2CXUA 5EJAA 3QZUA 5TPWA 2JIRA 4A03A 1NQAO 4RA9A 4NYMQ 2G9NA 3K30A 4UVGA 1E2IA 1OAAA 4XDGA 1DXQA 1R3UA 2CJWB 1SUDA 1ZMOA 3IQGX 1TTHA 4G5GA 1KI8A 3QFHA 1FSGA 3D3WB 2JBAB 4C20A 1IOWA 2VHTA 5EE0A 3LH5A 1AGXA 2PH1A 3D5TA 5COAA 4XWKA 4FGJA 2MCFA 3G17A 4HR7A 5DNCA 5KOIA 5K09A 2OV4A 4LA4A 2B1QA 4M8IA 3RO7A 5EZYB 1M6HA 3RTAA 4NHOA 5A71A 4B6GA 1I6MA 3ZOZA 5ARBA 5D5HA 1K6MA 5DYTA 4ALMA 1R5JA 4X45A 4EY5A 2M1XA 4AN4A 2GFQA 3U3KA 1V71A 3R4CA 1T2DA 1Z7YA 3NKVA 3AUSA 3PNBA 2FGJA 1HM5A 3DKKA 1JXOA 4MUKA 2R9VA 3Q9SA 1QGUA 1QUEA 4JJ6A 1UPTA 2NO5A 3NTXA 3TS1A 1GOTA 2OO3A 3DQZA 3EUWA 1XQ1A 3ABQB 5CXXA 4U9HS 1QHHA 1NQXA 5EYPA 1LFDB 1NBWB 3FNIA 3UW3A 1OUMA 1L7RA 2MSLA 4BO8A 2Y68A 1FCJA 2RH5A 1BZYA 3FX2A 4K8RB 4RF2A 3ZE2B 2O0JA 2ODAA 3P0EA 4Q37A 3E18A 2HN9A 3NPAA 1L7QA 2YHSA 4MYSA 4N9WA 4NOLA 3RIGA 5JFOA 4RPCA 3SBOA 1P6XA 1GZ7A 1XAIA 2HEGA 3V7FA 1O5IA 5LZ7A 1LBQA 5HXAA 2WTXA 3L1VA 1A1VA 1MA0A 1RAHA 2VJBA 3GRZA 4LZOA 2XNKA 4PSKA 4CCYB 1B0AA 1PJQA 2IQIA 2P9QA 3EFBA 1W76A 3KCNA 3NRCA 3KWMA 2IWHA 1ZH4A 2ZBPA 4YRJA 1ZJJA 5DLQC 4KRGA 1QH9A 4IKEA 3W2TA 1X9IA 4OH7A 5INTA 1QYWA 1YRWA 2CHFA 3HVUA 3ERCA 1RLTA 1T5BA 3OZEA 4D9GA 1E4YA 1GNPA 2OOKA 2J07A 3EIHA 3O1IC 5HF6A 4QTYA 5JOQA 3IQDB 4OM7A 1ODCA 2ZB4A 2DJIA 2JGNA 4XDHA 4D3FA 2R6GA 4YRQA 1YB7A 5EJEA 3PJEA 2BN4A 1JR3D 1O1YA 3LT0A 4L07A 2PY6A 1VJCA 2I67A 4BBZA 2VSYA 1U7TA 3BWDD 2GLTA 1KC1A 1U7XA 2A9KA 1VCMA 4G8DA 4O2AB 4O25A 2X1LA 1J20A 1EDZA 2YY7A 2A1UB 4HUQB 3TXXA 4C0JA 1C0KA 1WCWA 3M82A 3RC8A 4PAMA 4CEJB 2HGZA 4MUFA 3BWCA 2O4CA 4WESB 4B71A 1ZAYA 2EGUA 1M83A 3DHYA 1EJ0A 3W78A 3QKSA 2CB9A 4Q7KA 2YV2A 3SZOA 1Y7PA 3T35A 3WADA 2XF8A 1Q21A 1JDBB 1PJLA 4MRVA 3W3ZB 5J2UF 3QE0A 4PIVA 3VDNB 4RIEA 5GWXA 1YOVB 3BPSA 3PQ4A 2I91A 2XUIA 1KEWA 1KZ4A 1YZGA 1H2AS 2G80A 1ISSA 4M7RA 3GV0A 4R4JA 4ZYWA 5J40A 2DAPA 1GGNA 2C4NA 2H85A 2Y4OA 2ZUWA 1D8AA 1H8ED 3QOYA 4S0ZA 5GJCA 3GD5A 3D7SA 1QIHA 3ZZNA 1Z7WA 4IHQA 1D9XA 2QXYA 1JXQA 1LNSA 2TMGA 1G21B 4RESA 2LRHA 3ZDRA 2CMFA 3L04A 2CLEB 3ZX5A 3Q5GA 2AI3A 2QAIA 3OEHD 2NXNA 3RS0A 3RWOA 3T9EA 1FTNA 1N8SA 3K71B 2Q2QA 3IDZA 3PXUA 2H5EA 4NEGA 421PA 1FQKA 4MV7A 2A1IA 4OQFA 4KXVA 1SEVA 2A5FA 2Q99A 4P4UA 1IZ8A 1KJQA 4OFXA 3OP4A 4L4UA 1JMKC 2AOTB 2IUEA 3GEMA 3OH8A 3ZBPA 3KQMA 1P5JA 1LU9A 4M9QA 4Q05A 4AMZA 2WILA 2Z83A 3B6ZA 2LVBA 4ESEA 5KZMB 4JJ7A 4MP6A 4PRYA 3WMXA 3EXG2 1X87A 4ZHQF 5JZ9A 3O3OB 3A4LA 3RIHA 3I8XA 3L3BA 2IBTA 2EBUA 3A27A 2H59A 4P80A 2VBIA 2O59A 4DLUA 4LYHA 1T6NA 4QFBA 2E7ZA 4G9EA 3TTWA 3VH1A 1HORA 3HCFA 4WW0A 2BEVA 4IJ6A 2FDCA 3BGSA 4BKPA 3JWJA 1V45E 2GZ1A 5IJAA 5KNDD 2QN9A 1SBZA 1FXWA 4RVOA 1SVMA 2XYQA 3F2VA 1JPJA 2POCA 4I3GA 1YBFA 4RGBA 2B82A 4E12A 2IBSA 3IKLA 4JIMA 1SXQA 1W581 5M5BA 2EKLA 3RE1A 4JR2A 4QL3A 5I7OA 1WVMA 2VNIA 3ZYCA 4X8HA 3BB4A 3W6OA 5AJXA 4AZSA 4Z6KA 3FMFA 5EG5A 2D13A 5K3EA 4BX9A 2O8DA 1ONSA 2R00A 1IM8A 3F7OA 1GL9B 4G36A 3R8FA 4JLJA 1LJ8A 2GKOA 1I6KA 1YQXA 3SWWA 2ECPA 3KK0A 1A2OA 4DLSA 5GONF 2ZOSA 3QOWA 2ASEA 4YASA 1XZGA 4NMLA 4TMZA 4TRRA 2WWTA 1LLUA 4NAHA 1Z33A 4YECA 3CW8X 3W5AA 2HTFA 2V58A 1USUA 4NJMB 2CV2A 1IEVA 2WHYA 1YVDA 3ZV3A 3IR5A 1WEHA 1CZOA 1C7QA 3LHKA 4EATA 2IZ5A 3REGA 1P9RA 2NVWA 2WKPA 2WU1A 3ASUA 3Q9NA 4BVJA 2E0IA 2RHJA 2P27A 2H17A 2UZ1B 4JEHA 4LSMA 5TJHA 1EJ6A 2HXSA 4RCVA 3OECA 1H2WA 1BE8A 5FO0A 2BF7A 4M21A 5JWRA 2CNKA 2O5VA 4HCJA 3VZBA 4YA6A 3HU5A 3PF9A 2VDWA 3HZRA 1NSTA 3P96A 2ISSD 2RBKA 2OCPA 1KOFA 1TIBA 4R2XA 4WKBA 4TWZA 1NNEA 1W5AA 4NWIA 1D6JA 4IEIA 4IV5A 2OM2A 4I5DA 2DM6A 3HA5A 2I2BA 1IY1A 1HDIA 3HHEA 1JIIA 1ZUWA 1SQ5A 1JDJA 2NU9A 2V3WA 3JQ7A 1FFCA 2E4VA 4YN3A 3L8EA 4P7KA 3WKCA 4KPUB 4H7FA 3LT2A 5CX4A 5EIBC 1SBTA 3BJZA 5A5FA 1TYZA 3U44A 3UPTA 1V2GA 1DKRA 3ACCA 5KJCA 1E9BA 1ONOA 2ETVA 1EEXB 2D5BA 3VU9A 1RWXA 2C8VA 3ACDA 4HB4A 4W8OA 2B3TA 2ZZMA 2GSWA 2ID7A 4O2BF 1VSQA 3F74A 4F45A 1W96A 3NHJA 4IGAA 3PUHA 1E1LA 1X1DA 3KR0A 3HY3A 3CH7A 3IP3A 2HI0A 2INGX 4OQYA 3WK4A 1I94B 4ZEMA 2ATIA 2PT5A 3A25A 2CNNA 4Q3NA 2JFFA 2FN7A 1NT4A 1VJDA 2D00A 2WD7A 2V6BA 1T5TA 2WNIA 5A6SB 4NV0A 1CIJA 3GO4A 1TMOA 5AVKA 4IYRA 3I6YA 1OXUA 2WWHA 2IP1A 3D8TA 1CRLA 5CDTA 4XEHA 4DA7A 4LTDA 1V5WA 1B6RA 3CISA 2FVYA 5DOZA 1Y5MA 1AKTA 5D3MB 5E0OA 1TF7A 1AKEA 5DK6A 2GILA 2QK4A 4I14A 4FI3C 4N8SA 2I7DA 2QMQA 4H17A 5D3MA 2YHUA 4DV1B 3GUYA 5FL7A 5JD6A 1RQRA 1LDGA 2ZIVB 4NMHA 3NEYA 4ZAYA 5ES3A 2WEKA 1FQJA 2JBHA 4MDYA 2ZFUA 1D2GA 5K8TA 4FDMA 2CHEA 3T5AA 4HI0E 1YRAA 4NH0A 3GCDA 4ROSA 5PGMA 1C3EA 4JOQA 2DWUA 2O48X 2OORC 1XC7A 1UKZA 2B2XA 2V98A 3A1CA 1KKMA 3AXSA 4CKYA 1RPJA 2CJXA 4JENA 3G6WA 3U7GA 2DG2A 2YYSA 2VN8A 4NP6A 1YB6A 2XECA 2GX6A 3GELA 5TPZA 1MO6A 1LGYA 3UGKA 1S4QA 3I2JA 2ZK7A 2M9MA 4PGAA 3PUWA 2ZRIA 5F2OA 2ZYSA 3HU2A 1DTWA 2FPPA 4GX5A 1R15A 2ZUVA 2WWGA 3JU3A 4YDRA 3GYGA 1U7HA 4ZP1A 4AKIA 1XMPA 2C97A 1D0VA 2I99A 1UODA 2VA8A 3H2YA 1T10A 3JVEA 4L7VA 3UJPA 1WMFA 1VE1A 2WY2D 3E3MA 1Q57A 3TJZA 3UHFA 1BX3A 3OPXA 1LPMA 3N0RA 3Q7PA 4DT1B 4G09A 5K3SA 1F4VA 2W2OA 5LQCA 4PX5A 1O5OA 2G63A 2OHXA 3IAM1 4O08A 1HT2E 3SC2A 4NDNE 5H9WA 5D6NA 2JLWA 5IT4A 4TZ6A 5U9CA 2BFCB 3HVHA 4RD1A 4I50B 5DHPA 5IM4F 2A7XA 2GB4A 4OP1A 5AI4A 3M6VA 4NDZA 1L5OA 2DUJA 2AGVA 2WMDA 5ADUS 2AFHA 3H11B 1B3BA 3COVA 1FMJA 1SVKA 3BSYA 4BV8A 3KYCB 3L1IA 5BNZA 3TRFA 3E9CA 2W6MA 2WFLA 3CIFA 2O2DA 4O1MA 1FDWA 5D1NA 2R96A 3LRPA 2AI1A 2JANA 3H18A 2A59A 4UBNA 4IJVA 4OHVA 2O2YA 4B7CA 1SA0A 3DVRX 3DD5A 3SJUA 2RGBA 1M2VB 4E5VA 4UNRA 5CM9C 5ESRA 2QAJA 2PGXA 2XUJA 4DJEC 5LWHA 1V11B 2ZR8A 2V7QA 4YMWA 2B92A 3R5JA 3S2FA 2QX6A 4TX1A 2NO6A 3TOXA 4KQFA 5BWOA 1U8UA 5KCZA 1QRAA 2QT0A 3TZHA 4FMBB 1TU4A 3ISJA 3L92A 2PMCA 4DQKA 1E9RA 3LLSA 3SVLA 3DUFB 1V8BA 1Z36A 1YB5A 3ADKA 4BVKA 4H31A 5CM8B 2ERXA 1U2TA 2QRVB 5B1HA 1GCUA 4AY6A 4ZRMA 3QFFA 4XLLA 5JXHA 1OV4A 2VS1A 2OESA 2HSZA 3K0CC 1G3QA 3QEKA 5JI3E 5F7OA 3MS4A 4LJKA 1AG9A 2VYVA 3IVAA 3URMA 5AW6A 3CNBA 3GH1A 4BV2A 1D4OA 3B6EA 3WYAA 4EM6A 2C3MA 1DFHA 3KYDB 4J75A 5SZHB 4B40A 4KO3S 3OOSA 5CVUA 3RJ5A 4C9BA 4PAWA 4LV6A 1LPOA 1XTVA 5G4LA 1T3GA 4J1SA 1ST2A 2QTVB 3EBPA 3LDAA 5HIJA 4HQRA 3SHTA 3UHOA 2PZLA 1PW7A 3S81A 1PHPA 3OO0A 3NC1C 5P21A 4S3MA 1I5RA 4XDZA 2QPAA 2FSPA 1OXSC 4P93A 3STXA 2Z9BA 5BN3B 5BR4A 1PZFA 3FJ1A 4HDRA 1U3UA 1PI3A 4HGPA 4W9NC 3UAXA 5JADA 4D9CA 2PX4A 4L57A 4DGQA 3U44B 4EMTA 3FYUC 3ZGNA 2PX5A 1QC5B 4DBVO 5C7YA 4Y9DA 5IXJA 5KNCA 2PL3A 2P1DA 4MPJA 3I5UA 1S3IA 5CXSA 2WIDA 2JKVA 5E3HA 1FDVA 4OHZA 4QJ5A 1K9SA 2C2XA 3W3AH 1S2NA 2H1OA 3FTEA 4PXSA 3I6BA 4BO4A 1DWQA 1KDTA 2FU5C 4J0HA 1A0OA 4PM4A 4HDMB 4KR6A 2AN3A 4G0OA 4O4LB 4GR4A 1UDCA 4RA6A 4UU0A 4KZPA 1JH9A 5I4BA 1WBJB 3M7IA 2QAGB 1ITZA 1TZCA 5EWMA 3HXPA 3PK0A 4K9DA 2Z98A 5CDFA 3DONA 5JW6A 5K9ZA 4LI3X 1H94A 2VO1A 3DFFA 4H7EA 2YOHA 4D5GA 2ZYHA 1PR5A 2CL0X 2I3GA 3FGZA 4UNQA 4CKCB 2QJRA 2EVWX 2HDNB 4NR0A 3ER6A 1P4JA 1EVIA 2WTNA 3E5HA 1KVRA 3OPYB 4YYZA 3MAAC 3QSGA 2EZ9A 4FMCB 4MYDA 4D3SA 1DRWA 3K32A 3LCUA 2Y0PA 2CCJA 3Q9LA 3FVQA 5FR2A 1ZSVA 2NXCA 1Q0QA 2CFOA 2ZSEA 4KITB 1N0IA 3DMDA 4JXKA 1MHPA 4HV4A 4TMKA 1JW9B 4W5NA 1TKAA 3C41J 5G4KB 4KDCA 4XD7A 4EA7A 1JUDA 2NIPA 1HYGA 1M0TA 4YMLA 4EX6A 3AIMA 3EGCA 4R8MA 3GPDG 2WWXA 1A04A 1HKHA 1NWCA 1YS7A 3L7CA 3F9IA 4IIUA 4YJFB 3AHCA 2D1TA 3O21A 3ASVA 4IIEA 4QKQA 2VRNA 1Y8ZA 1E3MA 1VL6A 2YNMC 3D2CA 3LA6A 3SLGA 4PO8A 4YACA 3KJHA 4YDHB 1M6EX 3LE8A 2GPSA 3F73A 1E3LA 3O3CA 1D2EA 4AP9A 1V95A 3P5BA 3MFQA 5DCLA 4F1KA 4Z2AA 4YHHB 4EO4A 2QSUA 3A4NA 1RWNA 2CXRA 1MB3A 1NN3A 2D2XA 2E89A 2F17A 2PM8A 3O4RA 3GAMA 4GOXA 2DBQA 5AI8A 3SHWA 3TM4A 3HMQA 1Z8FA 1JZTA 1ZW6A 2HIGA 2P8JA 3MMXA 5DYYA 5U4XA 3T1QA 2DB3A 1O0SA 4JV5B 2M2IA 5HOQA 2I7CA 4QOSA 1EWKA 4ALNA 4DFDA 1HT1E 4BNWA 4ZYLA 1P2VA 2AD1A 2JI7A 2VDVE 3E9YA 2ZJ5A 3KVNA 3SS7X 1Z22A 3U39A 4YPVA 5CBPB 3VGPA 3IUEA 1FSZA 2O8FA 1F38A 4EHDA 4R16A 4KQKA 4LAFA 1WNFA 1E9FA 4MJ7A 4YJGB 3RT7A 5EQFA 1PJ2A 3KQWA 3ZHQA 2Y0BA 4MVJA 1LLCA 1T8UA 1XJ5A 3TNYA 2AB0A 2MMCA 5B1SA 3TPZA 4NCXA 4AJ1A 1ZHFA 3F3MA 3IIIA 4QPNA 4TN5A 1WCV1 2HJHA 5M7EA 3RSOA 4Y6OA 2BFFA 4D81A 1VPVA 1KR2A 5JLAA 2GERA 4CMEC 1K0UA 2FEPA 4E3ZA 1MFZA 5C8XA 2QUKA 3FNFA 2HHCA 1PQWA 5ESXA 4BKMA 1MG0A 3MXTA 1PJCA 1XA4A 4Q7LA 5ENZA 4CEIA 2PO7A 4KPEC 1WS6A 1E2GA 3LK7A 1E6KA 1N2OA 3B6KA 3E5MA 2NLOA 3OZAA 4EGCB 5JVDF 4G0VA 4GKVA 5D1HA 4Y6QA 1E3DA 4KAFA 1KR5A 1H3FA 3C3YA 3VI3B 1LSOA 3WWEA 3IRVA 4WY2A 5D01A 5FTWA 1EP9A 2ZU0C 1O2DA 5J2TF 4PGGA 5I3ZA 5GPBA 3DV0A 4DV7B 4WJZA 3EJ6A 3U2QA 4FQ8A 1TD1A 1L1QA 5G53C 2WQ6A 5DX1A 3FG9A 4E2FA 2DPMA 3GGDA 2O1EA 3CWZA 3B53X 5CYFA 1GVHA 2P30A 4AURA 3DH0A 1RVV1 1HV8A 2VHYA 3UNXA 3K8ZA 4PYNA 7AT1A 1NJ8A 1PKEA 3JY6A 4JWKA 5FBWB 1RJDA 3N7TA 4JI0B 2OWEA 2VJDA 3H1TA 1KQNA 1R4ZA 3D7KA 1XD9A 5ITZA 1C0PA 3WIEA 1TU0A 1U1EA 4RLHA 2DCMA 4KFCA 3NATA 4N5IX 5IDQA 1Q3KA 4AK9A 1SAYA 3BCHA 3MTGA 3KTDA 3LGSA 4JI5B 2CMGA 2CLLB 3I37X 4MP8A 2EQBA 4MUGA 1FXUA 5I4KA 4KPYA 3QKRB 4GMKA 1KEVA 1A96A 1E1RA 1KU0A 1U9ZA 3ZWBA 1OLUB 1PEKE 5FWXA 4ZMRA 5A5GA 1TA0A 3A6GA 3RGWS 4AS3A 3BL8A 4LJ9A 2CL5A 1T8RA 3IEPA 4L22A 5JFGA 3T3OA 1EFTA 2B5OA 4ISCA 4XTCS 2GCEA 1VHDA 2X7HA 3CHYA 1ML4A 4FSDA 4M3NA 2FE4A 3ZJUA 1EINA 2TS1A 4DYHA 3DBLA 3CM0A 1EB8A 4U8HA 2CB0A 4BRSA 1LDMA 1V6SA 1Z0JA 4NC9A 1IOVA 4MQ6A 3ZW9A 4RF4A 2ZS8A 5KNBH 2PIDA 1Y42X 4AD8A 3V1YA 1V8DA 4HS4A 2QZ4A 4TYPA 5K3AA 3ZIUA 5T6BA 1MXFA 2C98A 5HG0A 4WWHA 3L4KA 2FZCA 1NSYA 3GT4A 2R2AA 3ID6C 3LWDA 4RENA 5TS3A 3BXFA 4JL6A 4DLWA 3OA2A 1U11A 3H0KA 3OPYI 2B1GA 3PDWA 4IO1A 3IEXA 3KJEA 2WU8A 3HXKA 4ZGBA 4CEIB 1MJ5A 2A9OA 3AESB 3OY7A 3HNRA 3D6MA 4F38A 3EQ6A 2F1OA 3B8HA 2EGHA 3A1FA 3GBPA 1N78A 4GVPA 1XD2A 4NXMB 2JHPA 1H66A 1YS1X 2Z5VA 1ZD4A 2P65A 4G86A 5A0FA 4WLVA 3DHEA 3FOCA 1R0SA 3PP8A 3B3QA 3VO2A 2GN9A 3R7LA 4UPEA 2OYSA 1B4DA 2HWKA 3IKJA 3PDIB 1ECGA 4FEAA 2RJ3A 3DE7X 3TSZA 3KEMA 4GLFA 1K89A 5EESA 2H4HA 3OETA 4KJZA 1MF7A 1X39A 2CXNA 2PSSA 4MWSA 5GM2A 5JQGF 4MITA 4HO1X 4UTXA 2J46A 3FMIA 2OWDA 4GLLA 3A04A 3I64A 2XVMA 3BMCA 4ZYTA 2DBYA 2VATA 2CDAA 4OHCA 1JV2B 3S2SA 2O1XA 2WLSA 3DC7A 3GRUA 2ZWPA 4UNSA 4WUVA 4KQ6A 2ZANA 3LKBA 3RRYA 1EXDA 3IOCA 4MGZR 1CY6A 1MR3F 3RU9A 3HPRA 4L3VA 1H0RA 3FWPA 5CPBA 4C88A 1CEXA 3N2IA 3Q3EA 3DULA 2QR3A 1J5XA 3DFIA 4FX2A 3KS9A 3K4QA 3NHMA 4HN9A 4ITUA 3LQQA 4NOJA 1CERA 1HOTA 1TMYA 3ILYA 3MUOA 3UF0A 2YDYA 2ZR0A 4A7PA 2VK1A 2GEBA 3AUAA 4AJEA 4X20B 2FSSA 1DBPA 1HLPA 3KV3O 5JNRA 4LFBB 4FIDA 1DO8A 1WO8A 4YYEA 5DM60 1KZ9A 2DYKA 2Z09A 4YMIA 4KPFC 4U7PB 3ACBA 5K6AA 4HN2A 3U4QA 2W4QA 2V59A 4L0DA 5TQ2B 4YPFA 4TUYA 1QHXA 1C7EA 3MLBA 1BQEA 1Y81A 3PD0A 3RSQA 2VAVA 3I23A 3JQCA 4Q3AA 3FA2A 3PI6A 4I1YA 3SZMA 5GQSA 2GARA 3ZGVA 4CN8A 2VP4A 4HYEA 4JT2A 2JRLA 4EHJA 1I01A 1T36B 3L6OO 3UN1A 2QYOA 4LISA 1L7OA 4KP7A 4BQEA 3DQQA 1RIIA 2HMUA 3BMOA 1BQ3A 3F9RA 1JEEA 2X19A 3A14A 2DQ4A 4PAOA 3RGGA 1FMFA 1CQWA 4ZI3A 1HY3A 1UMBA 3GQVA 3T5MA 4JD5A 2YS6A 3KYIB 3QW4B 4HMPA 3NIFB 3KOWA 3WJ7A 2AXEA 1XD8A 3HFSA 4PLCA 5K6TA 2L17A 4JVMA 2OECA 5DTRA 3OHMA 3IMEA 1JNYA 2COUA 2G0NA 1FRVA 3FYCA 3OUZA 1P44A 4NIMA 1I7QB 2Q41A 3ASZA 3S55A 3BQNB 3ILVA 4NICA 1S96A 1UBLS 4MVJM 5JSYA 2DTEA 2ZRGA 4EQZA 4IMIB 5B4TA 3AONB 4IMRA 3ZLVA 4FOPA 4I1IA 1Y37A 4TQ9A 4EYSA 1QR6A 5KJFA 2QUHA 5FFFA 2ZYDA 3DZGA 1D09A 4Y1FA 3VYRB 1CFJA 2C94A