4YV2A

Crystal structure of trypanosoma cruzi spermidine synthase in complex with 2-phenyl-1,2-thiazol-3(2h)-one
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
290
structure length
278
Chain Sequence
b'ELISGGWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine synthase, putative
publication title Structural insights into the novel inhibition mechanism of Trypanosoma cruzi spermidine synthase
pubmed doi rcsb
source organism Trypanosoma cruzi (strain cl brener)
molecule tags Transferase
total genus 90
structure length 278
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 4yv2A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4yv2A02
3MB5A 3OZRA 5DM1A 4RTMA 5P8WA 2PY6A 1TW3A 2N47A 1JG4A 4LWOA 4V0RA 4CKEA 5LQAA 3LDFA 3KPYA 4R05A 1YZ3A 3R9XB 1MJFA 2CMGA 1N7IA 3OU6A 2O07A 4PYOA 4ER7A 2ADMA 4BLVA 2VDUE 2WK1A 1PRYA 4PINA 2JHCA 3BUSA 3FPJA 4P7FA 2NXNA 4RVDA 2EJTA 1O9HA 4AZWA 1UIRA 4FT4A 1QAOA 1I4WA 3R6TA 2NYUA 3HA5A 3P9KA 5GINE 3R3HA 3LX6A 3P2EA 3B89A 2QE6A 3V97A 1KYWA 1NV9A 1VP3A 3AJDA 3HNRA 5EIWA 4DCGA 1ORHA 1DUSA 3GRUA 3LCVB 1BOOA 2AOXA 3IHTA 1WZNA 2ZZNA 3SVZA 3B3JA 3VYWA 1QANA 5FWDA 4C03A 4ER0A 4ER5A 4YUVA 3HCBA 1FBNA 5DRTA 1RI2A 4P58A 1P1BA 4CKBA 3LBFA 1JQ3A 5CVEA 3BKWA 3P9IA 2FCAA 5EPEA 4P7KA 5K0JA 2EFJA 1G8AA 2BR3A 3BWCA 4O29A 3HCCA 4ZTBA 2VZ9A 2AR0A 3O7WA 1NW3A 3A7DA 1TPYA 1FP1D 2P3QA 3HCDA 4X60A 4P7GA 3NJRA 4CXMA 5JR3A 5KQSA 2OBFA 3CVOA 4IV8A 1RI5A 2QRVA 1EJ6A 3G2OA 3G88A 4C06A 2PX8A 5KQRA 2P40A 1Z3CA 4ISCA 1PJZA 4AZSA 5LQCA 5M5BA 1QZZA 3NWBA 1N2XA 2ZZKA 3QOWA 3MTIA 5T67A 2QRVB 4RTOA 4C4AA 4DQ0A 5E1MA 4E2XA 7MHTA 3DULA 3KQOA 2NP6A 2QYOA 1XDUA 2FK7A 3EPPA 4KIFA 2V7EA 3CJRA 1KXZA 1O54A 2OYRA 1X1CA 2IFTA 4Y2HA 1ORIA 1R8YA 3ME5A 3HVJA 1R74A 4BLUA 5K0GA 2PLWA 5ERGB 1XJ5A 2KW5A 5K0CA 4PNEA 5LQKA 4PIPA 5DPMA 1P91A 2R6ZA 1WY7A 3KR2A 4QVKA 1XVAA 1EIZA 3EGVA 3P8ZA 5GWXA 3K6RA 3LL7A 3UA4A 5E2AA 3EVAA 2PJDA 1D2HA 3LPMA 3G2QA 3LDUA 3KU1A 4YMGA 2NP7A 4RWZA 3V8VA 3B5IA 3E23A 2YVLA 2OPBA 3KQPA 3CC8A 1VE3A 1SUSA 4X41A 2YXDA 5LR6A 3EVCA 3DTNA 4FP9A 2Y1WA 10MHA 4GF5A 3A4TA 2Z6AA 4NECA 1KR5A 4HGZA 3LKDA 1RJEA 3SMQA 2VDWA 2IBTA 3JWIA 4KVZA 5LQUA 3KQQA 1X19A 4GOND 2V74B 3EVDA 1WXXA 1VPTA 3FPFA 4WXHA 1YFJA 5EVJA 3SR4A 1AF7A 1NBIA 1Q0TA 2G8NA 4C04A 2YTZA 3OZTA 5CVJA 2ZCJA 4BP1A 5D1NA 3HCAA 4EQZA 5DSTA 1JSXA 1INLA 1WXWA 4C07A 3KKZA 4QQNA 2BR5A 4RVFA 1FP2A 2EG5A 2JHAA 3UJ8A 5BW5A 4DKJA 4PGGA 5HEKA 3EEOA 2PBFA 4QTUB 4KW7A 1XXLA 4AZTA 2IH5A 1L3IA 4M36A 5EMJA 3T7SA 1BKYA 5JUWA 2AVDA 3UBTA 3KHKA 2YUIA 4RVGA 3GO4A 3HVHA 3MCTA 5DX1A 2I7CA 5T64A 5E1OA 4KRGA 2K4MA 2PXAA 3GRVA 4R8RA 1P1CA 3SXJA 5K8VA 4OA5A 1YUBA 3NDJA 5DM0A 1SUIA 3DMGA 2OZVA 5EMKA 3OU7A 4IV0A 3TM4A 5LQRA 3KQVA 1Y8CA 3CJTA 4POOA 4ER6A 5CD1A 5DXAA 9MHTA 3FUUA 3PLAE 2OB1A 2Z6UA 3A26A 5K0NA 5C9ZA 2PKWA 4KDCA 2E5WA 2EJUA 2ZWVA 3H2BA 4FSXA 4K6MA 1MHTA 1VL5A 5FA5A 5FHRA 2UYHA 1X1AA 4HC4A 4EVIA 4R8SA 3GRZA 3KPUA 3I53A 2P35A 5F2NA 3KQWA 4XUCA 5DTQA 1ZG3A 2YR0A 3D2LA 2IBSA 1XDZA 3QOXA 2EX4A 2R3SA 1HNNA 1X1BA 5EMLA 3NMUF 2UYQA 1RI4A 4HH4A 5E8RA 4E32A 3UJAA 4RX1A 2ZULA 1KPIA 3MGGA 3EMBA 1L1EA 1SQGA 3KR9A 3L8DA 4KWCA 4XCXA 1R00A 2G71A 3GXOA 2ZSUA 3JWJA 4XUDA 3ERCA 3G7UA 5E9WA 2ERCA 4RYLA 1JR4A 1ZGJA 4EMSA 4BLWA 3R0QA 5LQNA 2CL5A 2XYVA 4B17A 1NW7A 4ER3A 4YUZA 2ZW9A 3I5UA 4QPPA 5DWQA 3EVGA 3JWHA 5K0FA 3RIEA 3OFJA 1ZKDA 1RJDA 2WA1A 2ZBQA 4R6XA 3PFGA 3UJDA 3VSEA 4DA4A 1SG9A 1KP9A 5DRYA 2NNWB 3I9FA 2VP3A 3PB3A 4QQKA 4EK9A 2JH8A 3FPEA 3LSTA 5HIKA 1V39A 2OKCA 3A7EA 1NV8A 5DTRA 3SX0A 3MHTA 3DMHA 3MERA 5IKMA 4RSRA 3EVZA 2FHPA 4YUYA 5GIPE 4BP3A 4XUEA 5D1HA 3O4FA 1NKVA 5EGSA 1UWVA 2OO3A 2AOVA 3HM2A 3BWMA 3NDIA 4GQBA 2YXEA 3OU2A 4DMGA 5EKUA 5E9JA 1H1DA 5EKXA 5HIMA 4IKPA 3TR6A 2C7RA 2B25A 3GGDA 4OQEA 2O06A 1KPGA 1ZQ9A 1KYZA 3AXTA 2ZBRA 1R6AA 3C3YA 3CBGA 1RI3A 3ID6C 3TKAA 3DXZA 4E31A 4OBWA 2ZTHA 1RJFA 2AVNA 4F84A 2XVAA 5ICGA 4YMHA 1YZHA 3EEYA 3M6XA 2HR1A 3PT9A 2NXEA 1YF3A 4KDRA 3KPWA 1AQJA 4YV2A 3HP7A 3NW9A 1NE2A 4R6WA 3THRA 5IH3A 2IH4A 4QPNA 2OB2A 3PVCA 3G5LA 3SSOA 4HGYA 2GS9A 3UJBA 5EC8A 3KPJA 5FHQA 2IH2A 2UYCA 2P7HA 3EMDA 4OQDA 3PX2A 2LD4A 1XCJA 4GBED 3IEIA 4Y30A 1FJXA 3AXSA 3DXXA 1AQIA 3KQYA 3GIWA 1NBHA 3F4KA 4IWNA 4HRAA 2GA9A 3M4XA 5FQOA 4DM3A 3T7RA 1WS6A 4GC5A 3FTCA 4UOEA 1NW5A 1WG8A 3BXOA 2BM9A 1TW2A 3CJQA 3KQMA 2PVCA 1IXKA 1EJ0A 4P7JA 2HMYB 5DLYA 3M33A 5KYGA 2HV9A 2F8LA 3KQTA 2HTEA 3NVMB 5EG5A 3BKXA 2FK8A 3BT7A 4FGZA 3OCJA 2JG3A 3C3PA 2Y1XA 4GEKA 5FCDA 3X0DA 2PX5A 2ORED 2DPMA 5EMMA 1NT2A 2G72A 3CCFA 4V0QA 2P8JA 5HFJA 3DH0A 3EGEA 3IV6A 2AOWA 3GJYA 2PWYA 3I64A 4F86A 3EVEA 3RW9A 1OR8A 2Z6QA 3BWBA 4CWAA 2YX1A 4PYKA 2JH9A 3EGIA 4MIKA 3E8SA 4KIGA 4RVHA 3P71T 3TPZA 1YFLA 1KIAA 1NW8A 3HA7A 1EG2A 3LHDA 3GU3A 2AN4A 1DL5A 3B3GA 3LDGA 3OFKA 1B42A 3FUWA 3PFHA 2AN5A 2JJQA 1HMYA 3REOA 4DF3A 1RJGA 2B3TA 3WSTA 5CM2Z 2PX4A 4E2WA 4E70A 2O57A 5FUBA 1Q0SA 4AZVA 1ZGAA 3O31A 5C0OE 4RTQA 2ZWAA 3TRKA 2NXCA 1F3LA 3BZBA 1P39A 5B1SA 3DP7A 1VLMA 3M70A 2Q41A 2YQZA 2B2CA 1XDSA 3I58A 5DM4A 1G38A 1DCTA 3LKZA 1KPHA 3UZUA 2I62A 1G8SA 4RV9A 2ZZMA 4C08A 4MWZA 2IDKA 3M6UA 3HEMA 2ZFUA 3P9CA 4FR0A 3HCEA 4HTFA 1R8XA 1JSZA 5E9QA 2AOUA 5K09A 3UWPA 4RTJA 4HSGA 2OY0A 4QVGA 2HWKA 4X1OA 2C7QA 2IPXA 1YB2A 1QYRA 3GWZA 3KR1A 4AX8A 5GIOE 1L9KA 1EAMA 2GB4A 3Q87B 4HTFB 2O05A 3S68A 3TOSA 2AOUB 4M37A 3QV2A 3OZSA 4PYIA 4U7TB 5CIYA 5GM2A 5LSAA 1JTEA 5EHGA 2ZVJA 5K03A 4OA8A 1FPQA 2GPYA 3NTVA 5GP1A 2BM8A 4LWPA 4EKGA 3G8BA 3BGDA 5KS2A 3P97A 2FRXA 3NWEA 3ANXA 5E8JA 3T0IA 3KPVA 2B78A 2IDJA 3OPNA 3ER8A 3TMAA 2DULA 1SQFA 3HCFA 1SKMA 4RTRA 5FA8A 3M6WA 2BR4A 4L7VA 1BHJA 2IP2A 5HIIA 1D2GA 3Q7EA 5CCXA 3G2MA 3C0KA 3G5TA 3FTEA 8MHTA 5CVVA 5HIJA 4QTTB 5HILA 3JWGA 4FZVA 5HOQA 3HA3A 5ICCA 2PV0A 3CKKA 2XVMA 3B3FA 3CGGA 3G89A 3G8AA 4GOLD 1JTFA 3UA3A 3GRYA 4RTKA 1KHHA 3HVIA 4PGHA 4E33A 1BC5A 1JG3A 2XYQA 4X63A 3TFWA 3IYLW 5DX8A 2A14A 2B9EA 4ATNA 4RTSA 1I1NA 1EQAA 3R24A 2AN3A 1UFKA 2CMHA 2PX2A 2PT9A 2PSSA 4FSDA 5FQNA 4C05A 3UJ7A 3FUVA 5CCBA 4GOMD 2ZIEA 2CKDA 3TM5A 4E2YA 5ICEA 4PYJA 1VIDA 3FYDA 3G2PA 3FUXA 3EVBA 3UJ9A 4HG2A 2P7IA 2HNKA 3DMFA 1VQ1A 2PXCA 3LBYA 1O9GA 5CVDA 3T7TA 3SM3A 2UYOA 1SVUA 1VP9A 3AWIA 3P2KA 2AOTA 2H11A 2BH2A 1JQDA 3BWYA 3GDHA 3AY0A 4A6DA 2FPOA 3DLIA 4PONA 5E2BA 3PS9A 4JXJA 5DM2A 5HZMA 4YUXA 1XCLA 5DTMA 3ELDA 2AOTB 5K01A 2JHPA 3TLJA 1G60A 3MQ2A 4PYLA 2BZGA 1RI1A 3C6MA 1L3CA 3ER9A 3DXYA 4G56A 2ZBPA 5EEHA 3FPHA 5G02A 4LG1A 3DOUA 5EEGA 3FTFA 2H1RA 3ELYA 3KQSA 1VBFA 3P2IA 2IGTA 2ESRA 2I6GA 4MTLA 5EQJB 3TKYA 3PTAA 1JQEA 1X1DA 2H00A 4E2ZA 2QM3A 1I9GA 2P3OA 5GM1A 2PWPA 2PXXA 3FZGA 2ZIFA 3FRHA 1JG1A 4GC9A 3THSA 2G70A 3FTDA 2GH1A 5DX0A 5FULA 1G6Q1 3ORHA 1ZHFA 4A6EA 3NVKI 3ELUA 3MTEA 3P9NA 2P3LA 3K0BA 3OE5A 2C7PA 4OX9Y 2G1PA 5F2OA 1NW6A 5KVAA 3HTXA 2XYRA 4PYNA 5EOVA 5F2KA 2ZLBA 5K0BA 3DR5A 3B7PA 4FS8A 4QDJA 3SSMA 4CTKA 2ZIGA 5K05A 4RTLA 4BY9E 4DCMA 1G55A 3A27A 3MAGA 3C6KA 4AUKA 4RTNA 5K0LA 3SSNA 3LCCA 4RTPA 3EVFA 2IIPA 4GOOD 4PYQA 2VS1A 5DT2A 2P1DA 5U4XA 3SGLA 4WVLA 3VC1A 5LQJA 3DLCA 4LECA 3UJ6A 3UJCA 2I9KA 1M6EX 3GNLA 4MHTA 1D2CA 2PGXA 2C7OA 5CVUA 2OXTA 3DUWA 4PWYA 3U81A 4CKCA 2GLUA 4M7RA 4GUAA 3LGAA 2O0LA 4PYMA 2ONYA 2XBMA 1M0EA 2WA2A 3M6VA 3BGVA 5FTWA 1R18A 3LCUA 5EIFA 2PT6A 2AZTA 4YV0A 1IM8A 4M38A 5E1DA 5BW4A 3A25A 3ELWA 5C1IA 4YUWA 5GOZA 4PCAA 5MHTA 4EKIA 1U2ZA 1M6YA 2FYTA 3MCZA 4F85A 2UZ4A 4U7PB 1L3BA 3HVKA 2YXLA 4H0NA 5FADA 4OBXA 3FYCA 5EZQA 5ICFA 3FRIA 3E7PA 5CUQA 3RODA 4DZRA 5T6BA 2AS0A 1JG2A 3VC2A 5EZSA 1QAQA 5DSXA 4CTJA 4E30A 5BP7A 5K0EA 5FWAA 1T43A 3KR0A 1F38A 1QAMA 2GAFA 2P41A 2VDVE 3GCZA 5H02A 1XTPA 4MQ4A 5DXJA 2NXJA 4FT2A 3UFBA 3PX3A 1IY9A 4PCLA 4Z2YA 3TQSA 3OE4A 2ONZA 5BXYA 3LECA 1AV6A 5E1BA 5EHIA 3BGIA 3GRRA 4QDKA 3FUTA 1N7JA 3FPGA 4PIMA 4YV1A 3E05A 2QY6A 2CWWA 4X61A
chains in the Genus database with same CATH superfamily
1T0IA 4HKTA 5P8WA 4XRRA 2ZJYA 2UU9B 2HMUA 5K99A 3P26A 1XRMA 4JC5A 2GEJA 4MVWA 4F3NA 2COEA 3DC7A 1SXJA 1UM9B 1XVIA 4R05A 4KR6A 4OMCA 4RKYA 2CMGA 1JALA 1JXAA 2JAUA 3OU6A 4PYOA 2ADMA 4UNNA 5JG7A 4CT4B 3OLXA 4WZAA 1C3VA 1MKYA 1XTKA 2DECA 5BVGA 4FE4A 3R7NA 3BMCB 1MT3A 1C1YA 5HZMA 2POQX 1XTVA 4AMUA 4RBNA 4JIMA 4FT4A 2IJGX 5HXAA 1BTOA 1LSSA 1PJ2A 3NAGA 3PL1A 3RWMB 4R1NA 4AZ3A 4WJZA 2PS3A 3MLBA 2GSDA 3TUZC 1KGDA 4R1SA 3JQCA 1GSHA 3BSSA 1KZHA 4R7ZA 4ZT7A 4CLEA 1SUWA 4O6VA 3ZJ5A 4EFNA 1JJIA 4KCGA 5L4SA 1DUSA 4I6EA 2PEZA 3PUZA 5IYZA 5JS1A 3EWNA 4OPMA 1WETA 4E1BA 4YR7A 3F6BX 4I19A 4BNIA 2QZZA 3FDXA 1XL0A 1CJUC 1FBNA 1NAHA 1SCJA 2D5IA 1CUBA 2G06A 2OV6A 2QSYA 4Q1CA 3AJRA 4L4ZA 3EXFA 3BKWA 5EPEA 4YCDA 3V2IA 1JQBA 3I2JA 3R0XA 2Y93A 2XUDA 3OT1A 3FSJX 1Y7TA 2XRYA 1VE6A 3ZQ6A 5DNEA 2PAFA 3FTQA 4CKBB 5A2GA 3CH5A 3M6FA 1LWOA 3ASUA 2UUCB 2D5AA 2EF0A 1SOVA 3KJFA 4UUQA 3TLGA 3CVOA 1CDEA 3KKNA 3P5SA 4G5QA 4S0ZA 1Z2AA 3R4CA 4X8HA 5A6SB 3VO2A 5KNCA 2CZQA 3W1WA 1SCNE 2C9ZA 1QZUA 3K0HA 5F1YA 2YASA 2Y0BA 4H16A 4IXWA 4RC9A 2I6FA 4U6SA 2IYEA 1XTJA 3PQFA 3Q7RA 3FOEC 4K6KA 5GVSA 1N9KA 1Z4NA 2EQAA 2PVSA 3HCWA 2LCFA 3GLGE 4NCAA 1RQLA 4A6PA 3PI6A 1NATA 1IN6A 3NKVA 5LKRA 1E7RA 1IXRC 1YQUA 3UPTA 1WUYA 3CVXA 1CKEA 1HDIA 4JYZA 4H0FA 2QL6A 3QOFA 3DBIA 3PTZA 1F2UB 2RHTA 1IDOA 3I83A 3RNOA 4BLUA 5ITZB 4DUGA 5EP2A 3OQIB 3U3ZA 1F17A 1WDTA 1KZ7B 5AJTA 3WJ1A 5CYGA 4RHFA 1Q0HA 5ERGB 2WD8A 1RABA 3W2GA 1C9NA 2HMSA 1CU1A 1RXEA 1KVRA 3HSKA 4UAGA 1LK7A 2ODEA 3NHFA 1C7QA 3TB6A 2KM1A 3V7WA 4GO1A 1EHCA 3EGVA 4GMKA 3SIXA 5AXCA 3BTVA 5E4JA 5G4LA 4M54A 3VPSA 1OFUA 4TZKA 1XCOA 4ND8A 4TTVA 4HWGA 3OCCA 3HKCA 4BNXA 3KQPA 2NP7A 5IXYA 1SUSA 2ACKA 3EVTA 2BT4A 3ABOB 2WUDA 3HBFA 4AD8A 1RZ3A 2GNOA 3ZW8A 3OICA 1PGQA 2QT9A 3ESZA 4ZODA 1RJEA 1YZKA 3UKDA 2IBTA 3G2LA 3JWIA 1QONA 4KVZA 3UOWA 2QVGA 4RABA 3GEIA 4WOKA 4E46A 1XL1A 4QDOA 2F67A 4XIFA 2RAUA 4LQ4A 1GQFA 4YJ2F 2JAOA 5LQDA 5T4FA 3NHLA 1QV9A 2PX0A 3W5JA 4BKMA 4C6HA 3D3KA 2WZBA 3RYFA 1IEQA 2VA8A 5HVNA 3HC7A 1IJFA 5E6RB 1OYVA 1EP2B 2OTCA 4PLFA 4YX9A 3EY9A 1MVOA 2XVYA 3AEXA 4UAVA 1INLA 5DSTA 3DMYA 3L4EA 4CL0A 2XCTB 3X1JA 2XDQA 1NJ8A 3OEWA 2R7AA 3AKYA 3L8YA 4RY0A 1X7YA 1J21A 3OZCA 1UXOA 3ROGA 2KI5A 3IBFA 4QL3A 4UEOA 2GM3A 2ZRGA 1MXHA 5DZSA 1I7DA 3KHKA 5LD2C 1GPKA 1WU7A 3MCTA 2AFIB 1GG9A 2XF2A 3AONB 3CV3A 2BFEA 4YCMA 3L05A 2PXAA 3GRVA 3N0VA 3UB3A 1CP2A 4KMSA 1E1NA 1NP3A 4KQXA 1P0PA 1P4GA 3WV4A 4CCYA 4UTVA 1YB6A 3O6VA 1PS0A 3PRKE 1AS0A 5TF0A 4C0AC 5CB0A 2CDBA 3FYSA 5CW2A 5J4VA 3EHEA 1UAYA 1PJ3A 2YFYA 3M9XA 1AHNA 2H4FA 4R2KA 1NR1A 2E5WA 3LQRA 2P6RA 4QHTA 2J7KA 1YKFA 1DXQA 3PC7A 1L5ZA 3Q4GA 3GRZA 3RIMA 1EU1A 1BWQA 1YZYA 4G1UC 5D3MB 2OM2A 1XROA 4UNSA 5L6MB 3DFMA 4LPKA 4PE5B 5KYUA 4Z4IA 4OQPA 2JVKA 1HNNA 1X1BA 1GEGA 3MAJA 3ZCRA 3PD7A 3MGGA 4WKCA 3UCEA 3BWVA 3WK5A 3SJZA 3T4EA 2UXDB 3DHWC 4LMAA 5M04A 1ONBA 4RE6A 2QE7A 3PE4A 3HDYA 4MSUA 2PO5A 2YWEA 4AS3A 1DLIA 2KE5A 3ECAA 3EPRA 3N2IA 1V8FA 3QA3E 4WCFC 1VECA 3TDKA 4CCSA 3LC1O 1QIKA 2HX1A 3BFJA 2AQHA 1K7SN 1V0JA 2EJVA 4IH1A 1FBTA 3MRSA 1Z25A 1V95A 1JHZA 4QPDA 1CPYA 1G2IA 2PXHA 1V39A 4RIEA 1PR2A 5JCJD 2JGNA 1CB7A 4M8LA 3K32A 1J33A 1WPGA 3G1UA 5D1HA 3IVRA 3U19A 3GFFA 1V5WA 1JLSA 2V9ZA 2W2MA 4GQBA 2AW3A 1X39A 5BSUA 1XPUA 3KHTA 3RT7A 4R51A 4RH1A 4BC1A 4BMDA 4QD3A 1W75A 1E9AA 1B2RA 2FPIA 1DXHA 1NZDA 2EZ8A 3PHGA 4YAOA 1JSLA 3QNMA 4MVXA 3T5MA 2ZTHA 2B8WA 1M5TA 3BN3A 2GEVA 4IZ6A 2XNDD 3VKHA 3N8NA 4EB8A 3LDAA 1ZD1A 2I1VB 3C7CB 4OHFA 1KI3A 3H8JA 4N3NA 5LZ4A 1C1XB 1E98A 1AUPA 2WDPA 1EB8A 1XN4A 4MUBA 5JCPA 5KQMA 2XCLA 3JQAB 3L0IB 4HGYA 1EIWA 1Y9DA 1UDBA 4JROA 4RQTA 3DE0X 3RSFA 2UYCA 5GAJA 5KTRA 3BQ9A 3O47A 4XB1A 2P11A 3CH6A 1PJTA 1U9IA 1WXQA 2JDIA 1TO2E 2INGX 3A31A 3PUKA 5EE3A 1C7RA 3OMLA 4F8JA 4G0NA 3BJMA 1CY2A 2J6IA 3DCJA 3EFOA 2O2XA 4H17A 1CHDA 4H08A 4IDPA 4UU0A 1YTUA 1UKBA 2I4MA 2FE1A 2BM9A 4V3BA 1X8JA 1PEYA 1F20A 4MINA 3LUPA 4DZZA 1C2YA 1ZI8A 3HSYA 3PFNA 3O1HB 4LNHA 3NVMB 5AKJA 1RMYA 1C9KA 3BKXA 2CE2X 2WWXA 1Z2NX 4IJ6A 2QPLA 3C3PA 3WWPA 1WRBA 2VK2A 1RQXA 4QJBA 4J2HA 3OEYA 5KX5F 3AVOA 4WXYB 2MYPA 2OV2A 3CCFA 4IIGA 5NLLA 2A92A 4JLKA 4KQ2A 1BN6A 1KU6A 1USWA 4MWDA 5FPYA 4TVOA 3GQBB 3N8DA 2Z6QA 2UYGA 1XZNA 1Z88A 3RK1A 4H4DA 4OSOA 1YQWA 4FFBA 2I6UA 4ODIA 3TPZA 3IBCA 4CMEC 2BSQA 4I1YA 1RYEA 2J9FA 1U02A 2BFCB 1YVDA 3JZAA 4PTZA 4TLEA 1VI2A 1RYNA 1U11A 3I3SR 1LPNA 4DF3A 2B3TA 4KPUB 4E70A 3QEAZ 4NNJA 2ZAOA 5M34A 4UEWA 2Q6LA 2C77A 2FWBA 3BXXA 4HNRA 4KNWA 4NCHA 2ZYSA 3G9ZA 2O6HA 3U37A 1Q84A 4MRMB 3DOHA 4RHEA 5ENVA 3J7AC 3WKBA 4F6CA 1NN3A 4BNLA 1XYYA 1G8SA 1GHTA 1G8GA 1DT5A 2GI4A 2GZAA 2PPVA 1HFKA 3O26A 4PO9A 4C08A 1YZTA 1JSZA 2XTMA 1CE8B 3D2CA 3H5OA 3LP5A 4QAQA 5DBHX 3A4VA 3RRBA 3C3BA 1AXGA 1M0SA 2O1WA 3NIDB 4HLUA 1L9KA 4WPGA 1HL7A 1DC5A 3S2IA 4OOFA 4PNHA 3BMNA 1RFGE 4PZLA 3V4LA 4RY2A 4PYIA 1QHIA 2NZJA 3OOWA 1UBJS 1WEKA 1QU2A 3O94A 4BTEA 4B2YA 4U2FA 4TV9A 3JU3A 3T52A 4CF6A 4JEIA 2RHDA 2I3GA 1QTRA 2XUIA 3CEAA 2H1SA 3FZYA 4ZVSA 5EINA 5IEBA 3TTVA 3WKCA 4HT3B 3W5BA 1GT91 4D7AA 4P1ZA 5AXAA 4ZI7A 1P7WA 2ASVA 2VKQA 3ANXA 4JLBA 4I4TF 3CINA 3KPVA 3OPNA 4TYQA 1RE1A 3A2MA 1Y98A 3U4HA 4BVLA 1TU0A 2JLSA 1OV6A 1QIDA 1P81A 2NUAB 4B83A 521PA 1I4DD 3K9NA 1JIJA 1UFQA 2GTPA 2Y76A 5F98A 3Q7IA 3WIOA 2ZRPA 4HXYA 2AYYA 3H16A 2HBRA 3O21A 2WF5A 5IKPA 1FSPA 5I7SA 4ZVLA 5EXDA 1HA3A 2VH2A 2QL5A 1LK0A 2ID8A 4WK6A 1FX0B 4N47A 2GCNA 2QF7A 3LCJA 2H1OA 1HNXB 1P8JA 1E77A 1GKUB 3H1EA 2BVNA 4Q3CA 2HEGA 2ARKA 5AUOB 1W6UA 3HVIA 4ZEOA 1P62B 1KI9A 1TTQB 3WLJA 3H5VA 5LXTB 3R9XA 1DCKA 2REXB 3D6NB 3NBYC 2H5LA 4ATNA 3K9QO 1DKPA 3CMMA 4GVXA 3OCZA 4IDGA 2PX2A 4UAUA 3PNLA 4HQKA 3LY9A 4MVJE 4ZHQB 3UJ7A 3ADPA 1GNVA 1RJWA 5U4QA 3WL3A 2ZJOA 1LC3A 1ODSA 2Z6VA 5ALIA 3RS3A 1DXOA 3THYA 4IZIA 4PYJA 1HWYA 5A7HA 1DIHA 3WY9A 4QUBA 421PA 3OIFA 5IUJC 4NU5A 3GVXA 2JJ2A 2JK0A 2ZBEA 4PBTA 4QAJA 2ZM6B 4KTVE 1TJYA 4S2EA 4HZUB 4KN8A 3ZE2B 1O9GA 3T7TA 4DABA 1QHHA 3K0AA 4HUJA 2OO5A 4MP3A 2BH2A 4UTOA 4Q34A 3LHIA 3NJ8A 1PSDA 1JV2B 3ZKAA 3F1KA 4TWJA 5H9WA 4TVSA 4U0JA 1QB8A 3DLPX 1KQFA 1IUPA 3QNUA 1CDOA 4KG7A 1CUHA 4J4TA 4Z1OA 2NO0A 3H3JA 1Q1NA 2H1IA 2RKBA 5AH0A 2ZUBA 5ADUS 3IEVA 3JXEA 5L9AA 3RIGA 2EKLA 3CPHA 2RKWA 2IYWA 3BMQB 4LG1A 5DDIP 3TLXA 4ZJZA 1ZSNA 1RHJA 2IGTA 1WB4A 1KIMA 3KL2A 2PT7A 4JGBA 4TL7A 4WN9B 5CTJA 5F51A 1QO0A 5AW0A 3NBQA 2VJOA 4JB8A 3MSCA 4RS4A 2PWPA 3E61A 2JA2A 3JWEA 2E89A 4AKEA 1MIOA 3AR4A 5AVUA 5GGXA 1QYVA 5K4AA 1R0RE 5HG0A 3ORHA 2D74A 3NH6A 4HFMA 1Y48E 2Q5JA 5LBTA 1J1ZA 1L5HA 1ABEA 1R0CA 1RRMA 4FM9A 1BAPA 1XQXA 3EDRA 3T7AA 2QNRA 4UU7A 3RTCA 2OAEA 2ZLBA 4L8VA 4KL8S 3SCZA 1OBOA 1ZCZA 4FS8A 3K9HA 3QRWA 3W7BA 4DR3B 1KHTA 4DCMA 1G55A 3QXHA 4B34A 2GBLC 3VKFA 4CHGA 4DADA 3RQSA 1XAHA 4H1WA 1CS0B 2BJVA 2XUQA 4OBBA 3U4IA 2R00C 4YACA 1GU1A 3PFWO 3G0HA 1SC6A 1VXRA 2YJ3A 3V8PA 2VPXA 1CRZA 4I9HA 2F9MA 3D2AA 4AG3A 3P9ZA 1JIKA 3E81A 3ZHYA 1E4VA 2WQ6A 5C18A 4NX2A 4BN0A 5CX1A 4A2QA 1UJ6A 2JRCA 3OIVA 2EAUA 3D4BA 4MVJD 4PO3X 3BIXA 4ZPXA 4F91B 1PD0A 1M34B 2EDAA 1Z74A 3SHFA 2PT6A 2SKCA 2XX3A 4UM9D 1Z0SA 5HCNA 4JVNA 4DUZB 4CM8B 2VP0A 1WCIA 2GYWA 4BVEA 5ESDA 1NRWA 1ZR4A 5MHTA 3BRWD 1J2YA 2FJUA 5EUQB 1BCRB 4WEOA 5E7IA 5LYYA 1GPYA 1DO0A 3E9YA 5GV8A 1GITA 2UVPA 3LLMA 1RCTE 2ZBUA 1U9ZA 2HV8A 1ML4A 3I9MA 3VC2A 1MA0A 1YC5A 4CTJA 2ZBVA 4GYJA 3O0TA 5BT8A 2RDMA 1GYPA 1GKLA 4MPRA 2EARA 3TAXA 2GX6A 4B9AA 2D0PB 4ZICA 2WG1A 2A86A 3UCFA 5GTDA 1OGIA 4RL6A 4DV3B 1JH9A 1QGUA 4Q7MB 1JEYB 4D3DA 2GD6A 2JC3A 2ONZA 2ODAA 1S8FA 4GLOA 3F98A 3V7NA 4R5MA 3FG9A 1EUZA 2ZS8A 4Y6OA 3DV9A 1Z28A 2QTRA 4Q3BA 5DNAA 3HZHA 5JXGA 5L3SB 4YV1A 1FQOA 3F74A 1UM9A 2CWWA 2B98A 5JVDB 2O8CB 2O7SA 3DHEA 3G1TA 5FBWB 1N2CE 4YH1A 1AGXA 3T3MB 4QUGA 3E53A 2A1TS 1MFZA 2BBTA 3BMCA 3HUTA 5DCWA 4ADSG 2DY0A 1SUFA 2ZI9A 3STTA 3NHAA 1K68A 1TD1A 4ZVMA 1PBNA 4LFBB 3PEWA 2EKQA 4L4RA 1QWOA 2P79A 1NQTA 1ZN9A 2JFUA 2WPDA 1K3UB 3L9WA 3NIBA 1VHTA 1JDTA 5T5QA 3B2QA 4NMLA 3P2EA 2X0IA 5EIWA 2F1RA 1W34A 2V5AA 1E63A 5DSZA 4EG5A 3F6YA 4PZDA 3NYRA 2CLOB 2QGZA 1TVEA 2C58A 3H18A 4X3CA 4IPTA 4I8DA 4NZNA 3TLYA 5ITVA 2G4LA 1CLEA 1YIOA 2C5HA 3CX8A 4GI5A 5KYNA 1JDPA 4CKBA 4HX2A 5BRJA 1QC5B 1F48A 3UAWA 2C5EA 2C2MA 3T06B 1MXFA 1TE2A 1E64A 5DASA 5L4LA 1RVDA 2EFJA 3BF7A 3OX4A 1Z4KA 1EZ1A 4KYIB 5L3QB 1XKQA 2LZ0A 1U1CA 5A6SA 3CEJA 1ESZA 3LWBA 3VNUA 1SUAA 1UMBB 2C7BA 1Z22A 5JR3A 1QJCA 1RJ9B 1IG0A 2JIOA 3X1ZA 1O97D 1QQAA 1HEUA 1J8FA 4FFDA 3H1AA 1DCFA 2P40A 5D87A 1QZXA 3ILVA 2OCKA 4N5NA 3D8SA 3VAAA 1E3EA 3PXXA 1SK9A 4RIHA 5HKBA 4D9NA 2Q2WA 1LGYA 5EPOA 4AK9A 2G9RA 2J9RA 3EZXA 3Q7TA 4DQVA 5KU7A 4INAA 2W6MA 4YP7A 3DULA 5FUXA 4B32A 4BNWA 4EGJA 3AKZA 4WUTA 1F2UA 1HNZB 2NP6A 4X71A 5C8ZA 5ITZA 3EPPA 1G20B 3OQIA 5F5NA 5AK3A 4BNUA 4E5NA 1KXZA 2QLLA 3ZGXA 2YJ6A 1RLIA 1E1YA 3QUSA 3QY9A 5AXBA 3N59A 4G36A 4OM8A 2LUOA 2Q5LA 3MRVA 3HVJA 3VUFA 2GEDA 5K0GA 2LR0A 2XOEA 1TEVA 1QVWA 4Y2XA 2HWYA 3BJZA 4E21A 4BRWA 1PYDA 1RZUA 4OKNA 1IC6A 1JQJC 1P91A 3VHRA 3U62A 4J03A 4B3TB 4OK5A 1A8UA 1GLGA 1GPAA 3D2BA 3IMCA 3IRUA 1ZITA 2P5SA 5E2AA 2HJRA 3UA4A 2R4TA 1MENA 2VP2A 2R97A 3C5WP 3CB2A 4TQAA 1KDPA 4BNTA 5F9FA 1PVVA 1NF9A 1VBNA 4KREA 1RTKA 3HQ4O 4JI1B 2YXDA 3BFVA 3DMDA 4EM6A 4RVCA 3C6ZA 3QX7A 3VH3A 5M2QA 3ZHRA 4P86A 4XEHA 5CEEA 3ZJYA 3LKDA 1TUEA 4F97A 1OZHA 5FL7D 1GNTA 5H80A 3U09A 2VJLA 1G66A 2GZHA 1BJKA 1ECJA 2CBGA 1IXSB 1QFZA 4XDZA 5E6RA 4Z4GA 3EEBA 4DRYA 3IP7A 5KO2A 4X66B 2I0FA 1ZINA 3T7JA 1Q0TA 2VDWB 4W7IA 1KWKA 1P2TA 4C04A 3RV4A 3KYIB 3M6IA 2PMCA 2QD2A 5K2MA 3OZBA 2Y1EA 3RR2A 3ZHVA 4YXWD 5CG1A 3RBVA 1R0XA 3H9GA 2ZT6A 1Z5GA 4OI4A 5DHAA 5JZVA 2OQRA 2QJFA 1FUKA 2YIMA 4L5CA 1GU0A 5KYVA 1XHFA 2AFIA 5IARA 4OHVA 1Z9BA 1BE1A 1XKTA 3EIHA 4OOEA 5EZ6B 1BKYA 3NRBA 5HJ2A 3TUIC 3CNQS 2A0XA 1PR6A 1L6IA 1RRGA 3AJ8A 3D9QX 3DL2A 3DMTC 4H1HA 1L4MA 4X93A 5F73A 4B5LA 4CV2A 4ETNA 4Z4CA 5FEUA 4G5FA 2XB2A 4HL6A 1SN7A 2CJPA 2JFQA 2HJHA 1T2VA 2IYSA 4D9FA 4IV0A 4FOTA 4PU0A 3C15C 1P44A 2C9MA 3Q2OA 5EXSA 4TQUS 5HCIA 4MPJA 4UOZA 2P9QA 1ZPDA 2HRZA 4GBGA 1NONA 1D4OA 2B9VA 2IYPA 2NQ8A 2WJGA 3FWPA 4U8HA 3F4BA 4QXRA 4BB9A 1GD1O 1KAOA 2P0YA 1SCAA 1UBOS 4XQ9A 5D3MA 4B3FX 1MH1A 2CFTA 2Q3BA 4QQFA 2GPWA 4FXPA 4RPIA 3MTDA 1DE0A 3REQB 1G1AA 5BOSA 4TLLB 3C16C 1LDBA 2AMVA 2CY0A 3QV1A 5JV5A 3U3OA 4NFHA 3F96A 4URZR 3A1CA 3RSLA 1NFFA 3D2LA 4MEBA 3G0CA 1ZLYA 2GXAA 2Z1MA 3P0JA 3QW4B 1OI7A 1RBYA 2AXQA 3NMUF 1II8A 1R8SA 5E7JA 1BH6A 3DBVO 3V8BA 2CXXA 2VAXA 3GJ6A 3ETHA 3GFGA 1SQGA 3NETA 2ZB7A 4HRYA 4D92A 2Z98A 1R00A 3DA8A 3HVUA 4WZZA 5CJ2A 3KQLA 3KVNA 2J3MA 4YJHB 5E9WA 5EVCA 3SP1A 2GK4A 3BXPA 3G7SA 2KHZA 2NVWA 4KN6A 5DCYA 2Y4NA 5TJHA 5BO5A 3TTUA 3RAEC 1IJKA 3WIDA 2G1KA 3BTOA 4DIDA 3H0CA 1L4FA 3LW7A 2CLMB 1TQ6A 3TTSA 1V3QE 1YVEI 4PC2A 3AOEC 3EGDB 5A5GA 1WBDA 2QUJA 4MCJA 1L2TA 5EJ2A 2HUNA 1NNI1 3CWZA 2OKCA 3FHLA 4OU4A 3SX0A 4M8SA 1MJ5A 5DTRA 5IF9A 1MB2A 5AVYA 1UUFA 1J9GA 1JJFA 4MJ7A 4BAZA 2D5LA 1N2OA 2I3BA 4F06A 4JLVA 1QR6A 4X65B 2I67A 4K6GA 4ZJUA 3PDIB 1DV1A 1UFRA 4GOJA 1AMUA 5SICE 3TE6A 3MWYW 3NNNA 4UMDA 4M0EA 4RF5A 4UVDA 3QKWA 2AYXA 2X1VA 3B9RA 3FNFA 2E6UX 1LJ8A 1ZQ9A 3GBVA 4TWRA 3VU3A 3BQNB 5K1ZA 2BHLA 1EK2A 2ZBRA 4L1KA 3C3YA 5C51B 1IOZA 2OQ2A 3SC2A 5KYTA 4PSUA 2YW2A 3HZRA 1C1XA 3MGKA 2JCVA 3QHQA 2XVAA 1QOPB 3USZA 1UEIA 2RB4A 3RU2A 4QOHA 3ZGOA 3JQAA 4DC0A 5C1PA 3ZZNA 3M1LA 2PSEA 1G63A 4JA2A 4RD2A 3SJ7A 5JASA 2P4QA 2GZ3A 3G5LA 4ZCRA 5C37A 5EC8A 1ZJZA 4P36A 4N65A 2YV4A 1PTKA 2JRLA 3K1AB 5JRDS 2HH9A 4R3WA 4FR2A 2G1UA 4X7MA 3T3EA 5LMZA 3KKQA 1XTSA 4JYPA 3TS1A 4LRQA 4XDHA 1V5FA 1RKUA 3DD1A 4WK2B 3D0QA 4O08A 4U3JB 1D0SA 3H84A 4BVJA 4PX9A 2WZQA 3F3MA 1SZCA 2AX3A 2XYPA 4UBOA 2A1UB 4ZCQA 3IAXA 5C8DA 2O19A 2ZB8A 3FSRA 2BMWA 2IUYA 3QKSB 1E1MA 4OHPA 4RNCA 3T1NA 1UK9A 5JC1A 1NJGA 3EASA 3NAQA 3NLLA 3JZIA 4GEKA 2W6ID 3GQBA 3IEUA 2ORED 1FDWA 2DF8A 3BCUA 3JQBC 1Y5IA 2JCXA 1GZ6A 2JNWA 3DFIA 3RYHB 2AZ4A 2NSJA 2WJ6A 2AOWA 1K92A 1YD7A 3VBEA 2VRNA 1Q0ZA 3H9EO 4RKFA 4CFYA 5KKNB 4O2BA 1UJMA 1IB6A 2OHVA 1QGDA 4PNZA 4KPUA 4F1KA 1E8MA 2JKZA 3EC1A 3I9NA 4M89A 4MYHA 3LHDA 2P9FA 2P2GA 2RHRA 1T2UA 1VKRA 2AN4A 1DL5A 4I9UA 2WT8A 4OHCA 1B42A 4R41A 3K70D 2XMSA 1X8XA 2K87A 2OGSA 3NDRA 4J3JA 1CQIB 2QPOA 4K6FA 3IAHA 3JQ9A 4WL0A 2A4MA 4IP0A 2XHZA 1CRQA 2QTVB 2WTEA 1VLMA 2XHEA 4AMGA 3LNTA 3IA7A 2HA0A 1CUZA 2V5UA 3LKZA 4RD1A 3E35A 1IMOA 2OGZA 1CE8A 2Z0MA 1V7CA 4K9QA 1T26A 4KZPA 5SZIA 3S8MA 2VPIA 2QORA 3T4UA 1X1TA 3KIPA 4NXNB 1YZUA 2BHNA 3P94A 1U3FA 1KP3A 1XX6A 2EBFX 2OOSA 2Z8XA 4FW9A 2E4YA 4BNDB 2QUIA 5GY7A 1CR6A 3FFTA 3W3AH 1M2HA 3E5MA 3IQEA 1QU3A 2HWKA 2D1SA 2IPXA 3BK1A 3O4JA 4E5DA 4UTRA 5EJ4A 3RDPA 4LKOA 2IOFA 1RWMA 3IUNA 5JAQA 1CCWA 5H9VA 1PZGA 1G21E 3C8MA 4BFXA 3C3AA 4PNPA 2QL7A 3BHNA 2GRAA 2WSIA 2MCFA 2CMFA 2FPKA 5B30A 3WLKX 4QQRA 1I94B 4ZOQI 2V9CA 2B30A 1Y5LA 2BM8A 2Q5OA 2JGLA 3BJRA 4I1UA 1UDXA 1CULC 1TLFA 3CX4A 2YNMC 1GOTA 4UNIA 5JY6A 1JAZA 1PEAA 2CNOA 2I7DA 2NUAA 2XGMA 3LY8A 4IGAA 5E8JA 4X8LA 3TL3A 1Y6QA 5L40A 5H8WA 1YQDA 1TLLA 2AB0A 2G3YA 2VVTA 1FNCA 1OT5A 3JYQA 3D8RA 5EWJB 1C8BA 1C5KA 3D6JA 2ZSIA 1KMCA 3SHQA 3A6PC 2O8DB 1Y6RA 1FX0A 4MUIA 5HIIA 4M7OA 5IBRA 1IJEA 4RQUA 4JBNA 2DSNA 2G40A 2BMDA 4PXYA 3FI9A 5HIJA 5MN4A 3ETDA 4U5QA 1O9BA 1Y80A 4X7BA 5KVVA 2OCLA 1C4XA 1DKNA 3HA3A 5FBQB 2LDXA 3F47A 2XVMA 3W05A 4R1PA 1SBQA 1ZH8A 4GMXA 4JLAA 3ZIAA 1EVEA 3TIFA 1ZIXA 3HU1A 2PHZA 3CCCA 2VT3A 1RM4A 2FSSA 4EKEA 4ZHQA 4ZMSA 2UYYA 4QYIB 2GO7A 1JIXA 3SWWA 1KI1A 4ZVTA 2AN3A 2HFKA 3U49A 1NKTA 4C3VA 3NOOA 3WOHA 1NYLA 5A0VA 2B4QA 2G08A 3ZX5A 1IHYA 4U00A 4JR1A 4YCLA 4FJ2A 4IX9A 3RAPR 4HZUA 3KWMA 4B73A 1U8TA 1S9HA 1QXSA 1C3OB 3JQRA 3M4JA 1JPVA 1WX1A 4UXIA 1F7VA 3H8VA 1AO0A 3LT0A 1AN0A 3V2HA 3CLVA 4DGSA 3OA2A 2ZUDA 2WFLB 4GNRA 5A0FA 3GLFE 3LBYA 1EZ4A 1EE1A 3KAKA 4ITRC 2O2ZA 1PGOA 3FFAA 2P2NA 1SVUA 3M9LA 3P2KA 3PZRA 4L95C 1TKCA 2FZKA 3IJRA 3CT6A 3D4NA 1RLUA 5BV7A 4CM1A 3G5AA 3U3XA 3W8FA 3PGLA 3GT4A 3O2SB 4ZI3A 5KSWB 3BMQA 4INOA 1XCLA 2VBCA 5K01A 2PMDA 2C9DA 3LWDA 3GJXC 4IIHA 2XA1A 4TUYF 4BTVA 5C53B 4BXOB 3L7AA 1K2WA 4WN9A 3DXYA 2AFHB 1GSIA 1D04A 4J16A 2QR3A 5B2EA 3F8WA 3GAZA 1UBHS 2E4XA 4LYYA 1TUGA 2H1RA 2YRWA 4YVFA 5EEGA 4ZC8A 3SXUB 4TLAA 5D5QA 3QG5A 4UFPA 2YWGA 3IIKA 4LJLA 2E1RA 4KQCA 1W4LA 3EH1A 5EP3A 4DA9A 3TGLA 2E49A 4IF6A 2CLSA 2QQEA 5EESA 3LC7O 3GF4A 1KNXA 2IEDA 2IOYA 1ZD8A 3Q6MA 4OSPA 2E4WA 3P9NA 2P3LA 4H35A 4TLBA 2OXFA 4TXNA 2ZSKA 4P9NA 5FUMA 5KVAA 4PYNA 1AD2A 1CS0A 1UDAA 4IILA 3ZXSA 3OF5A 1SKUA 5K4HA 3EDOA 1VCIA 1ZNWA 2VQDA 3SQDA 3QXCA 4AUKA 4OTZA 1BMTA 4GXQA 5E95A 4MIOA 4YJDA 1TEZA 3BJIC 3ZR4B 4A03A 4PYQA 2EWVA 5B4VA 1A71A 3TNYA 4V0OA 3RVOA 1Z75A 3UJ6A 1T6NA 1KY2A 1UEXC 4EDHA 3V3KA 5DCLA 3WMRA 5TEWA 4YCSA 2P9CA 6YASA 4AIRA 4DDMA 1BZYA 2YV1A 3FNBA 3DKKA 1ZRMA 5AJZA 2YFKA 1M34A 1NBOA 2M6SA 3P9QA 2G28A 1SFRA 3RVBA 4CM8A 5DNCA 2F7SA 3ANTA 1FIUA 2OE2A 4BGVA 1SBYA 3IV7A 2ZJ8A 1DZIA 3U7JA 3WK4A 1BCRA 1A9ZA 1NX6A 3BGVA 2FFHA 3DSRA 2DPYA 4C0SA 1T8RA 3UIEA 4YAIA 3QFSA 2CNKA 4CTNA 5GOZA 3IAM6 1E5QA 4XTCS 2DFKB 4AKIA 2G5GX 1OYWA 2H2HA 3DAOA 3DB1A 3IVMA 3LYAA 3LVQE 4JKOA 4ALMA 3O95A 1L3BA 1QG6A 2OK8A 4ITUA 3IX7A 3KOWA 4RF3A 1G3MA 3CFYA 2G04A 4X3OA 4B45A 2ZRIA 1JEYA 1Q1EA 1E96A 3FVQA 1JFVA 3VBCA 4WK0B 3ZWNA 3MQ4A 2PUBA 4KH1A 5H02A 5L3SA 5DXJA 1HETA 5FYQA 4FT2A 4RDXA 1A7AA 1UCFA 2Q9CA 1SKAA 4KLRA 4A0HA 1H6DA 1V4BA 1XEWY 2Y0EA 5DN6A 1MEEA 4B7ZA 3LI2A 4DMUB 3LECA 3W3AA 5BN1A 2FZVA 1QQBA 4FQ7A 3FUTA 3BGWA 5BYAA 2F3UA 1O6ZA 2FOXA 2F3QA 3OZFA 2GQ0A 4HYEA 4CLDA 1ZHHA 3C3MA 2HXGA 4EY8A 4EITA 4RTMA 1XMXA 4M9ZA 4W5QA 3M6AA 1T9BA 4HZIA 2CCGA 2EFHB 3LBHA 1JLLB 3KPYA 3PIRA 1DTSA 2NX2A 1SUEA 1N7IA 4CYMA 4KP7A 1IZ7A 1QQ7A 2G9NA 1NLFA 3NT4A 2X0NA 6NULA 2R6HA 2MSLA 4RJKA 3ZCTA 3I4FA 2ZJ5A 1JB1A 2Q9AA 3I1FA 1CJKC 1WB5A 2BKLA 1F8XA 4HLQB 4JOQA 3I6BA 1QE0A 4C20A 2GD2A 3K20A 3V4RA 2Q6KA 2E5LB 1R4AA 4RZ3A 4MWBA 2PMBA 3B89A 1C8LA 3VTFA 3TIGA 4R71A 5K9ZA 4OQQA 1DU4A 3V4OA 1QO9A 2PJUA 3HGQA 4GX0A 4IIYA 1QC5A 5ER9A 1PJQA 5JHHB 4EMUA 5CA0B 4BNYA 4JODA 2GAIA 5L3QA 2HPHA 3T5DA 4B3CA 4PX5A 4G8BA 5ES3A 4BQRA 5JXJA 4IRUB 1UMBA 2FCAA 1FLNA 2Z5FA 1RJ9A 4I0WB 2PD6A 3FFBA 4DCJA 4NAUA 5FTJA 5KCMA 1N3BA 1JAHA 4O63O 3HCDA 3VYVA 4PWZA 5HGXA 1FA9A 1OWNA 4MUNA 3ENKA 3OX2A 4BFYA 2HXSA 1MP0A 5FIUA 3D0RA 3G9QA 1DBQA 2G88A 3UK2A 2Y1DA 4X84A 2AJBA 2P9JA 3FZQA 4MZXA 5AW2A 5KQRA 5DLDA 5M5BA 3I39X 2R6JA 1YCFA 4NMHA 4BLTA 2R8ZA 1G20A 5T67A 3CUYA 3A9VA 5DKFA 4HNVA 1JZTA 1FXWF 1K6JA 1NQAO 5TMEA 1Z8DA 1XDUA 2X40A 3R6GA 3K05A 4QYMA 1KDZA 2GF9A 4D9HA 2JARA 3D4LA 3QKTA 3DDNA 3QMMA 4P2GA 4Z0TA 3OQJA 2WMOB 3UMYA 5HTOA 3FCOA 2P6PA 4UPVA 1LW7A 3UT5B 1TAGA 3URMA 2HRRA 3GAMA 1P2SA 3TQFA 1C9JA 1X1SA 3WRYA 2P27A 4UAJA 4HWRA 3S7TA 5KWJA 1P5RA 2NVBA 1KK0A 2IZ0A 1UMCB 1ZD9A 1GNSA 4P08A 2PBZA 4G1EB 1SXQA 4ZI7F 4ZFNA 2AR9A 3BICA 4JR0A 1DMRA 4MQBA 1Z0DA 3L2OB 3L8CA 3N7TA 3ZY4A 1N5MA 1HR0B 2REBA 3KC2A 1UBLS 2JCBA 3L41A 3GROA 4PLZA 3VSAA 2Z6AA 3FFXA 1T4BA 2VDWA 3TXXA 3NHMA 2QJRA 1TXGA 2WJVA 4TTQA 1I2AA 3JD4A 2W2OA 4N7BA 3PCRB 2G4VA 2JIBA 2W0MA 3OHMA 3WVNA 1LBQA 1M6NA 3GFRA 5KS2A 2Q46A 1ZK1A 5IKXA 4AG5A 3M4YA 3RRXA 4I1RA 4E94A 5CVJA 1L8QA 3LVRE 3A9CA 3LL4A 4KSCA 4ZO7A 1U1EA 5TQJA 2OD7A 3CUVA 4A27A 2YN0A 3BAZA 4HWTA 4OLFA 3E7XA 1JA0A 1SOAA 2D2IA 1TUIA 1Y1KE 2ORVA 3BXZA 1VSQA 1MCZA 4K8OA 3ZE8A 1NUAA 3MC1A 2P6OA 3DE5X 4BECA 1T5OA 3AZPA 3DM9B 4HAYA 5ESRA 5JBQA 2GA8A 1VFNA 2P6UA 2JFXA 2W71A 4PPFA 3OFNA 3WGTA 3H0KA 4RULA 3UBTA 4QU0A 2DKOA 4UZSA 5JZMA 2I91A 4E11A 1KWGA 3HFGA 2L2QA 2HHLA 2I7CA 2DC1A 3VR4H 4G5OA 4WKNA 5KYKA 1MB0A 1OAOA 1UZMA 1NU8A 1EFPA 2K4MA 4O4IF 5DB4A 4HDSB 3QBDA 1XRSB 1KSFX 2B0CA 2JGIA 3U56A 3GPLA 1DOAA 1PD1A 4GG1A 3HY3A 1PFUA 2FEOA 3KXKA 1M10A 1MG5A 1Y6GA 1T25A 3AVPA 2VXYA 3SI7A 3WLLA 2HK7A 4Q9AA 1AKVA 1DTEA 3NAZA 3O83A 1E1LA 5F78A 3REQA 4V03A 1X7ZB 4EI8A 1NVKA 4LOHA 4P38A 2IZ6A 3H2BA 2IHUA 2R11A 2NSLA 3NS7A 2UYHA 3CKLA 1IBRA 1ZH0A 2YWRA 2ZXFA 4R9SA 5ECGC 4QPJC 4XDGA 2NVUB 2VQ3A 2GJAA 1BYIA 1O77A 2YR0A 3L1KA 4XYBA 5FORA 3KXIA 3UC9A 4EY4A 5KCZA 2WY2D 1K88A 3HGMA 2UYQA 2VSQA 2I9PA 4YJHA 3BL5A 3R76A 3F8TA 3N5KA 1CUXA 1L1EA 3WAKA 3WGIA 5FLKA 4C0BA 4LY3A 4V2UA 3A6HA 2AJTA 3WHPA 1YJQA 2I7XA 4A0FA 3OM9A 4G0PA 1KEVA 2YBDA 1Q83A 1CT9A 1FJ2A 2IYFA 1ISGA 3EGDA 4LC9A 3VJLA 3VOAA 1Y89A 2I33A 5TE9A 3ICEA 1JIVA 2VJPA 3KZMA 3UJDA 3PFGA 2GTIA 5F1OA 5TS2A 2OD9A 4MTCA 1SRQA 3I9FA 3LJKA 1Q7RA 1YIDA 3FPEA 4LN1A 5CAEB 2W6PA 1DJMA 4RETA 3NHYA 5A3QA 4COOA 4MARA 3PDIA 2G36A 1E89A 5I7WA 5I7VA 4Q7JB 4ME6A 1YRHA 3RARA 3A6DA 3UUEA 2ROQA 3L9XA 4C1BA 3EXAA 5D7NA 1L1FA 7REQB 4HGOA 2W0SA 1AQYA 3CB4A 3ECCA 2XYHA 1J5PA 3HL0A 1H1DA 1TAHA 5EKXA 1WXIA 2OBBA 2R1VB 1C81A 4L8WB 3OIGA 3ZCVA 3KEFA 3RKRA 1WTAA 5KZMB 3KHUA 4MX8A 2F1JA 2YVAA 1YSCA 3E4CA 4MROA 4P92A 1WMBA 1U0SY 1A27A 1II0A 4M1SA 4MQLA 2V7QD 3JYHA 4OHUA 4QUIA 2QY9A 3WWYA 1FFAA 3ESDA 2BEWB 3LUCA 1GQYA 3PT9A 3GUUA 4K81B 5DGTA 4X00A 3U48A 5F2EA 2HR1A 3KPWA 1P0MA 1XYGA 4EB0A 2EHJA 2IH4A 1JDZA 2C61A 4O02B 2NOAA 1G5FA 5AVKA 3K1AA 7ADHA 4WKPA 1P45A 5DEIA 4C0WA 3A1FA 4JGGA 1MAHA 4CW7A 1QGYA 1HL3A 2Y99A 5JJCA 5HQJA 4PQFA 4DG5A 4JVLA 1X15A 4U3JA 4CBVA 3TPCA 3C8ZA 3Q9NA 4BKRA 1J8QA 2C7GA 1NBHA 4BUZA 1U81A 3NUGA 4RELA 4BMYA 5L7TA 1WSAA 2A1UA 1SKQA 3RGWS 1WIWA 4DDKA 1P5ZB 4MPDA 3H5WA 5MFPA 3SJAA 2X3UA 4LJSA 3PDHA 2HV9A 4BU1A 4S04A 2PGDA 2XRFA 1VLZA 1JHMA 5J63A 3RYHA 1EH5A 2JW5A 3GRFA 1IHUA 2IZOA 4OHBA 4RENA 4K46A 1VMAA 1CY0A 4LJAA 4NFLA 1NNUA 4E4TA 1OI3A 1NT2A 5ALKA 1AURA 3GJYA 3CVUA 1QKJA 4P3OA 3H4IA 3ZFPA 4I55F 2IS4A 3NBAA 2PU5A 4LYAA 4Q4HB 1Z62A 2AEEA 4IOLA 3JD2A 4GYYA 1Z17A 2HPVA 5LBUA 1CQIA 2WYUA 1JQKA 2CSXA 1N8TA 3AUYA 4CL3A 2XE7A 2QTVA 4LNAA 4MO9A 4FC6A 1OAAA 3D0KA 4J0JA 4W7SA 1C4KA 2WKQA 1T8PA 3TCNA 4AYWA 3TNDA 1W1WA 1I36A 3CSSA 3Q88A 1U90A 3AL3A 1Y3FE 5AOVA 4BNDA 5AUNB 1P4HA 4HNAB 2AMYA 1KC3A 1M75A 3RJTA 1FEZA 3VR4A 1HDGO 2ZRKA 2TRSB 1YBFA 4IIVA 2QV0A 1Z18A 3VO9A 4BP9A 2F55A 1VI5A 1OGYA 3R3WA 1U7OA 2BGIA 2C8VA 2QW8A 2JCGA 2C7QA 4JMPA 2BD0A 3KE8A 3KR1A 3C8HA 2FWPA 2GB4A 2IODA 1Q6ZA 2YRFA 3IAUA 2HGSA 2ATXA 3UKJA 3DVLA 2FG7C 1U8ZA 2OHFA 5GM2A 5JEEA 1FCJA 2NZ8A 1VRWA 1OA0A 2I03A 3HDHA 5IM4A 1M6WA 1VL2A 4JQSA 2CL6X 4X7RA 5KTYA 2O6LA 3QX8A 1JG7A 3R8XA 1VCNA 5ETJA 4CM9D 4JOBA 4WCVA 1Z0AA 5ALQA 4PLWA 1X87A 4RORA 5EWJA 4TN5A 1QNLA 4MB0A 1FMJA 3QX3A 2O8DA 2FRXA 3T0IA 1G2PA 3VZSA 1V48A 4TWBA 3A1VA 4PS1A 5ITWA 4NKRA 3TD2A 3KM0A 1U0RA 1T91A 1O89A 3OOEA 1ACJA 1FZQA 4IIXA 1KS2A 2YWFA 1BW9B 3TRFA 1WOYA 3P4UA 1Y3CE 3TPFA 3R4VA 4CMBA 4BO2A 3V6LA 4YT2A 5CVVA 2LP4Y 2LCIA 1GAJA 3B6KA 5IAOA 4FWIB 5MGNA 3OTIA 3WYCA 3ZY2A 4BGUA 2W4MA 4QYIA 4OV6B 4RDCA 3U7HB 1VDZA 1ADYA 4RTKA 1JF8A 4HGQA 3PNOA 4PGHA 2FW7A 3RYCB 4R68A 2A9FA 2GFIA 4HUTA 5CT8A 5FWNA 2A14A 3WGLA 3BGOS 1ZM2A 1ODJA 1NSTA 1ST3A 2JEZA 4HB4A 1C3OA 5THQA 4Y7CA 4YQZA 4B35A 3ZQKA 3LWNA 4MQ6A 5K0TA 2WFLA 1ZA1A 4AN0A 5LCXA 1GCIA 3CM0A 1JXOA 2B36A 3E6AA 4BE7B 4AUMA 4H18A 3EVBA 2J0VA 1OWPA 4EBBA 4HG2A 4RY9A 3QLVA 2HNKA 3O8BA 4L9AA 2PEYA 3EN0A 2G1AA 4WW0A 3SOZA 2C4UA 1Q7EA 1G0NA 2BMEA 3NB0A 2JFZA 4AS2A 4DAOA 3K9FC 3GDWA 2XY4A 4N5DA 1PBTA 1M1UA 3DHYA 1RADA 4BFUA 1JQDA 1MVLA 1XZ8A 3F2IA 3NPAA 4C0JA 2Q6IA 2ST1A 5CDYA 4BXOA 4CIBA 1F3OA 2AFHA 3AEYA 3HGTA 1DBSA 2ZBFA 4RU1A 3SXUA 1N78A 1D0VA 3ZCQA 1SXJE 5JDIA 1SIOA 2OGUA 3HKDB 3CLUD 1L3CA 4YT5A 5C4IA 3LH5A 3UWMA 1OZAA 4G56A 1SXGA 4GAEA 5CURA 1D6SA 4WZAE 4YLGA 1V25A 2DQZA 2QK4A 4CHTA 1JQEA 1I2MA 3BM5A 1GGMA 1UBRS 2QM3A 4BMVA 1K63A 1QTNA 1QFMA 1KAHA 3C7DB 4N9QA 5EXXA 5G53C 4UTPA 1EFRA 7ABPA 1BXKA 3WQQA 2X5OA 5FULA 1GSAA 2OGTA 1E2MA 3V1YA 1OZGA 2IELA 2QKYA 4ZCSA 1DQRA 1Y81A 1EWKA 4OU5A 5ECYA 2W6JD 3ICPA 3H7AA 3KFVA 3LVBA 2QJOA 1Y3AA 3MCVA 3MSXA 4KVAA 3Q1KA 3B36A 3ZS9A 4TTJA 1MO4A 4GOOD 1P5FA 1T4DA 2H18A 1M2JA 2P2YA 1DRVA 4MR8A 1QQ6A 3L6BA 1YK0A 4OREX 4RMIA 1EWTA 4X1IB 5DBGA 5HKAA 4WBNB 1O94A 3DAHA 1QHEA 3MILA 2PQ0A 1EHYA 4NJEB 1N6KA 3ZC3A 1M6EX 3PFBA 4A26A 3R09A 3IELA 3B51X 3R3VA 1KR2A 4OFWA 2K2QB 2PGXA 1KJZA 1GYRA 3LXRA 4X44A 2HK8A 3AVYA 4PWYA 4LVOA 2AJLI 2C92A 3NBMA 2ZYHA 4JL6A 1OVMA 2ZS9A 4B6FA 4PYMA 3ACCA 5AOAA 2YDYA 4AP9A 2PUJA 2CXOA 3K09C 2ZJ6A 4Z86A 4C7OB 4X20B 1DJLA 1B93A 1G16A 1RWXA 1ZP6A 4GKBA 3EMVA 1O03A 5HQ3B 4EKIA 2RIRA 1I2CA 1H9BA 3Q3VA 2PKQP 3KXDA 4GI2A 3ZDEA 3L1JA 3IOMA 4QJ3A 3DC2A 3OPYB 4DEXA 3QEJA 1PT8A 1ZJ5A 1O5OA 3U9TA 4LMBA 3D6FA 4WDRA 2OVFA 3ZIUA 3RWBA 3U80A 1VB3A 1HSOA 1XMPA 2GAFA 2P41A 3CSUA 1EI9A 3NHJA 4KFRA 4LQCA 3W0LB 2NXJA 4D43A 1GL3A 1SXJD 4B09A 2Y27A 3TYXA 3TB4A 1M8KA 1PHPA 4PO8A 3HU3A 1GIAA 2XW6A 1DRKA 2FCRA 1FTYA 2MSDB 4HMQA 1JLLA 4B6QA 2OC9A 4HDOB 5CB6A 2XADA 2R96A 3EULA 2PY6A 3O3CA 4G8JA 4BNHA 1NG9A 4V0RA 5LQAA 3OOHA 3JQEA 4OAPA 1H2XA 2DLDA 3E4DA 3GCGA 4Y6QA 4Y2QA 3HJUA 1EG7A 3CZPA 2BEVB 3AIOA 1VL1A 1POXA 3CUSA 3DWGA 1WZUA 3A4NA 1K86A 4D25A 5B6IA 4XCQA 1T5SA 3PHIA 1UPXA 4KBGA 2Y92A 1NN0A 4GECA 1EVKA 3IPCA 2JAWA 2ZE6A 4AN1A 2KBEA 3ON5A 1V8DA 4KMMA 4J90A 3HBJA 5ELLA 1I4WA 1WCXA 4FCVA 3MXOA 1RLTA 4HDQB 4IJMA 3RLFA 4AB1A 4EX6A 1JN0A 3QLUA 5CA0A 3EUWA 4K87A 1MEOA 4FDUA 1DAPA 1VJGA 3HNRA 5IC6A 4CM3A 5KOIA 3WNVA 5G4KB 1YJ8A 4BB0A 3DFKA 1DRWA 1WQ3A 2J7PA 1ECGA 2W48A 2DUNA 2YOFA 2RHOA 1W36B 2FUEA 3T3HA 3K53A 3A36A 4NMWA 3NCTA 1DP4A 5C80A 4LCEA 1N0IA 2PMEA 3HDVA 2E2WA 5KWEA 3CLSD 1KOLA 4LYFA 2X19A 5HMLA 5K45A 1FFXB 3RPEA 1ORTA 3KOMA 1FYXA 1V2GA 3T9CA 5JZSA 1G7TA 3RTBA 3F6PA 2FWJA 4ZTBA 3O7WA 2H5EA 4AMVA 3BPSA 2P3QA 3CG0A 4BKPA 3FNHA 4DFDA 3FHTA 3O3NB 1A98A 1FUYB 1WMSA 5CXQA 4LV6A 1TJ4A 1E2GA 1R4ZA 2WWFA 3HJAA 2BE7A 2KB0A 3L8GA 4MQUA 3KUUA 1Y5NA 3COYA 2WUGA 1ZZEA 3BHMA 4LHXA 4K0KB 5JANA 1QX3A 5LOVF 1KE1A 4PHCA 1GUAA 3OJLA 1K5PA 3ZY3A 4DUGD 2H6EA 4ACAA 1RMTA 5AVTA 1BVHA 1FUIA 3VZPA 2CEKA 3PC6A 2BBOA 5G1PA 3RD5A 3UT5A 1U0NA 3ZY5A 1RPAA 4RPJA 5ICMA 3HN7A 4B46A 2H57A 4E5PA 3AZOA 1W19A 2VDKB 1TX4B 3JASB 3MFQA 1Q14A 5AKEA 1O97C 4FBMA 5DO9A 3A3OA 4F1JA 1F0YA 3TLEA 2MMGA 1LDYA 1UMCA 2X4DA 3H8SA 1L4EA 4AMBA 4QUDA 1MQAA 3DL7A 3QIVA 5BYBA 3DV2A 2QW1A 2GBCA 1CX9B 1N2EA 2MHCA 3OJFA 4Q3NA 3WB1A 4K9KA 4CKZA 1U2TA 2Q1TA 3T3IA 4Q9NA 1ZD5A 2ZTMA 1G8YA 4A2PA 1K0UA 3EGWA 1EDOA 5CB8A 3LDUA 1HT2E 4K26A 2HMTA 1ZOIA 1ZUD1 3CKMA 3HJCA 2ID7A 5DIFA 3FH0A 1FNBA 1Z39A 4LFCB 1E2PA 2FR8C 3CC8A 2IV7A 4EEKA 2HMWA 3DWFA 1ADFA 1U7UA 3EAQA 4F4JA 1LBHA 3DTNA 4FP9A 2Y1WA 4JKYA 3TOZA 3A4TA 10MHA 3D64A 1I7QB 1HDEA 3SX2A 4MGZR 1BEEA 2GJKA 2EYQA 4BQQA 2F3PA 1KERA 3IHLA 3PJGA 3L0SA 4UFNA 1T29A 2AQ8A 5BSKA 3J7TA 5EHZA 2FZCA 5LXTF 4UHDA 3USCS 1CERA 4QSHA 2X14A 3GNTA 1CFJA 1QFJA 5KBYA 3R5FA 5EKSA 1JI0A 4XGNA 4DCNA 1Y9ZA 1YR9A 2ZJ3A 5DM4A 4ZHQF 4C29A 4BP1A 5K6AC 1KSJA 3V8QA 4JB2A 5CDFA 4CKWB 4BGEA 2RCYA 1Y82A 1E99A 3FYUB 2BR5A 2V58A 3T41A 3OLWA 2A5FA 4N39A 1D5CA 2VDJA 4G0YA 3Q5GA 4DMKA 4BZZA 1Y4AE 4QTUB 2D5BA 2GZMA 5TR9A 3S5JA 1XXLA 3ECSA 3ZV5A 1EINA 2OENG 4HDSA 3A28A 4U9IS 1IK6A 4ZO8A 5ULLA 1WDWB 3RS7A 2EBUA 4C6RA 5KJ1A 1CUFA 1U3CA 1H2WA 1LSOA 3GO4A 3K35A 5J4YA 5TMPA 4OH7A 3N53A 5EA2A 1FTQA 1J06A 1FSFA 2W6ZA 2JJ1A 4IIUA 5F9MA 5KJ6A 2VYQA 4CMIB 1N57A 4DM7A 5JWHA 1X3SA 1P77A 5KVCA 5BN4B 1ANKA 3L1VA 1X7ZA 2FZ5A 5EMKA 2W6CX 2NM0A 3SXPA 3NH9A 2YY7A 4YREA 4KQKA 4ER6A 4QUHA 4NABA 1ZMRA 2Q99A 4KV7A 4ZCIA 1ZD3A 4HD8A 3KO8A 5HJ5A 3GHHA 2NVUA 2NQTA 1PAUA 4K6MA 2Y67A 3PHHA 3GJ5A 1MW8X 3PA6A 1J23A 4JT8A 4BQSA 2R9VA 4AY2A 3V1MA 3C87A 4YIHA 4B4KA 2HIMA 1EE2A 2J3QA 1QFSA 5I8ZA 1UWLA 1CF2O 3ABZA 5DTQA 2VJKA 2HREA 3O9ZA 2JEYA 3H04A 5DJ5A 2P9BA 2PS9A 1X70A 2R4QA 3F5MA 1I2DA 2JIZA 2A4KA 2R3SA 3H9JA 4MO2A 4KUEA 4AYTA 1OA1A 3L8FA 4HMPA 5E8RA 3S1LA 1YMQA 4MZDA 4PZEA 4ENUA 1YR2A 3GLQA 4P4UA 2YYSA 1R9MA 4KX3A 3A1TA 1X14A 3DZCA 3BILA 721PA 4EKYA 5AIBA 3G7UA 3RO7A 1OD6A 1E1RD 5G1NA 3PQ4A 1G8FA 2I2BA 3ESRA 3OBIA 1XPJA 1U99A 2TMYA 2AN9A 3FCCA 3NHKA 4NOKA 4WXRA 1BO6A 4S1WA 5B7GA 2GCOB 4CRWB 3C4JA 1WP9A 5CAEA 1L5MA 1ZKDA 2ZBQA 1SQ5A 1KRXA 1RRKA 1FQKA 1RW4A 1XZFA 3X1XA 1DLJA 1PT9A 3E7DA 1Z6AA 4QZVA 3DAFA 3GFPA 1HE1C 3UY4A 4C14A 3FXAA 3E15A 4UHBA 2B5VA 4E09A 3S2YA 1PIWA 4O4LB 4OP1A 4PBSA 3W1VA 7REQA 1AKRA 2FKNA 1U2GA 2JFNA 4N3CA 3VO8A 5IHPA 4B6PA 5CBKA 4NBSA 3ZVNA 2R8EA 4XUEA 1XKXA 1UIMA 1I7NA 4IXDA 4OHKA 5EGSA 1OFTA 1UWVA 2C00A 3NHZA 3CPEA 4YRAA 5IABA 3FDZB 1U4OA 1FDUA 4HADA 2ILTA 1FRQA 1IUNA 1U6JA 5HIMA 2C7RA 3G2NA 3VR6H 1VYUA 3CNNA 1LV7A 2BEWA 5DT9A 1L0BA 3BXHA 3QLJA 1IBSA 4OBWA 1RAFA 2XGGA 2N46A 3GH1A 2JDID 3HBLA 3FPLA 3VR2A 1I3LA 3IHWA 4RD4A 3UUWA 3WFZA 3L0DA 4C7MA 1EWRA 3CW9A 3ZIDA 4BMSA 4EUFA 2X15A 5AVJA 4JR2A 2BKVA 3JQQA 5HF5A 1B8UA 2AK3A 3FYHA 4FCWA 3T94A 5JVDF 4ZZ2A 1A4UA 1U7DA 3OLYA 4NCXA 1C3LA 1NPYA 3MCWA 2OWEA 3HDGA 2PZLA 4OJQA 1E62A 2LD4A 3TQCA 2A88A 1I4TD 4GWGA 5BV2P 3OO0A 4GR9A 4G97A 1XZKA 4RLHA 5A4AA 3Q10A 1U2SA 1JHAA 3FHOA 1P29A 4U7GA 4WFKA 1Y7LA 5B4UA 5KUTA 2AT1A 2DPGA 3GEEA 2O2HA 1WUIS 2H65A 2WKPA 1NW5A 2XQJA 3L0BA 4P3PA 1T8SA 1Y1LA 1P2BA 1A8PA 3UAOA 1IY0A 2FWRA 5EWLB 3U60B 3B2NA 3RSZA 5ILGA 2QVZX 5HM6A 2QG9A 2GBPA 4L07A 2DUJA 4MDYA 4MRMA 4NPHA 1TD9A 4D9JA 1N2HA 4CG1A 2Z2ZA 2QZ9A 2B4TO 3BL6A 4HPJB 5DM70 2J0UB 2ZTUA 4B7XA 4LQDA 1WPQA 2GNAA 4JQYA 4Q4HA 4DT1B 1XR3A 1Z5WA 1SZJG 4OYHA 5TQVA 3A6LA 4ALLA 3O84A 4P82A 4Q7LA 3M1AA 4TKVB 4YTEA 4WJLA 1ENYA 1RBQA 1YH3A 3IHKA 5IDYA 3DTVD 2CL7X 2I29A 3T5AA 3T3NA 2DG2A 3U7RA 2QNIA 4KIGA 4W6QA 3HZOA 3UYKA 2B1QA 3SDSA 4BBJA 4D9KA 3AF6A 3IDQA 3KVRA 1E3LA 4BZXA 1NXTA 2Q4EA 5K8LA 1JLHA 1N2JA 3KT3A 2JJQA 1T2AA 2HYDA 4OMFG 2PX4A 4PZYA 3V9PA 3FIUA 4HNAA 2QTCA 4URVR 1BVYF 1UT8A 3V4VB 4QNMA 1A95A 4D6XA 1H2RS 1PEDA 2GFHA 5F33A 5JD4A 2VDQB 2HJ9A 3STWA 4I2NA 3VI4B 1ZN2A 5JFGA 1Z6XA 2ORYA 1K8QA 4DNQA 2BF4A 3KHSA 4LXGA 3RTDA 3NXSA 4TS3A 1ENPA 4EIWA 1WD7A 2IDKA 1AKWA 2O1XA 4FR0A 3R74A 1YR6A 4YONB 5K09A 2Q5EA 3K70C 3HO1A 4LRYA 4RXTA 1QRRA 2FFJA 4B3RB 3AHJA 3FNRA 1HLDA 3N0TA 4X1OA 2CC2A 5FTKA 4ZZIA 2CF6A 2WHYA 1IY2A 2A5LA 2QB5A 1QHYA 1P6XA 2HLDA 1PUIA 3S68A 3SC3A 4U7TB 3WK9A 2QTWB 1Z4LA 1ISIA 2VIIA 5EJFA 3ZWQA 4NK5A 1R6UA 4LWPA 3QVWA 5HFNA 4IBOA 5FPQA 1JECA 2ZYUX 4UTXA 4P98A 1BW9A 1KI7A 3NWEA 3KYJB 1X0VA 2FQQA 4QJ5A 4PAGA 4QXMA 1ILEA 1YJBA 3CUKA 4L6CA 3A9SA 1E3DA 3Q2IA 3ZWWA 1ZICA 2CLKB 3HS3A 4HN2A 4OXNA 1MU0A 1WNTA 1Z07A 3H3XA 2ZE8A 4TMKA 3GEHA 4HDAA 1CQZA 1G2QA 5CHYA 1EJ2A 1ABFA 1A5TA 4DY6A 4UTNA 4V0KA 2ISSD 4WQMA 1AO3A 2ISQA 1H42A 1TMGE 2Q29A 4Q9HA 3TW6A 3TXYA 1CR2A 3RYCA 3AB8A 3DYVA 4TMZA 3VVBA 4BZPA 2CFRA 4EG6A 1P4RA 4GOLD 1U2DA 1KHHA 1U04A 2XCUA 2YMMA 4P31A 3KSZO 1QSGA 1UPCA 2QLMA 3ZXUB 1PFVA 2IPOA 1X9HA 3D6MA 2UZ1B 2JJ2D 3R24A 4LHWA 3LUBA 1DELA 2PUVA 3QSYA 4HVLA 2E7ZA 1U4SA 1KQPA 4NENB 2PANA 3I12A 1MZVA 4LV5B 5BSRA 3TEFA 1EX7A 3RVMA 5I9SA 2XB4A 2XMDA 2XMCA 1XQ6A 2JLAA 2VH1A 2HEIA 5EUCA 2Q3MA 1A97A 2ZANA 2I6QA 3NEYA 1HT0A 1MA3A 1QIJA 3H1PA 1YE3A 3OQ6A 3HKDA 1Q92A 5FUYA 3QKIA 3BE8A 3D5QA 3HCOA 1B14A 3ELDA 2JIMA 1X42A 3DEKA 3GT0A 1E9BA 4XR4A 2JLZA 4PG5A 4G86A 4MUGA 2PFKA 5G02A 1I4LD 5ALFA 4FWTA 4OX9B 1FYVA 1OPXA 5BQPA 3TKYA 4AKTA 1XLTA 4HYYA 1T34A 1W4CA 1UBMS 2H31A 2J9GA 2WU1A 3EUAA 1KZ4A 3F3YA 1RWOA 3CXUA 4PLTA 5BSTA 3VZQA 3C5CA 1SHZA 2J3HA 1Y6ZA 2HD4A 4NF2A 4AJIA 4GZ6A 2M1ZA 2RONA 2Q7OE 1BFKA 2NUBA 1BRMA 4BNFA 4EMBA 5BSEA 1Y1PA 3PT5A 3TG8A 2H2IA 3T95A 3INGA 5BMOA 3L4KA 3RYTC 2C7PA 1YJCA 4A0SA 4GMGA 3UMJA 3QI7A 3RANA 4AG6A 4TMWA 4X1IA 4TZ6A 2R6GA 5DE3A 2NXWA 1GPWB 2Q7XA 4WBNA 2JEOA 1VRCA 4NJEA 4YAEA 3AIIA 3ORQA 1RYYA 1HTWA 2G09A 1W5TA 1FL9A 3F5QA 1EDBA 3REGA 4DDHA 5AW9A 5HM8A 1O6FA 3PU6A 1TTPB 4AJ4A 4L0CA 4F4IA 5DYGA 1X86B 2N75A 3U4MA 3WRXA 4KQGA 2DLNA 4UBLA 3CPSA 5CVUA 2OXTA 3SHWA 4C7OA 2V6IA 3C8UA 4LX0A 4X20A 5FFNA 3SQOA 2QD5A 4KR2A 3EEQA 4D0GA 3E22B 3CRZA 4JLSA 1RAEA 2AEJA 1F8UA 5HQ3A 4FYVA 3M5DA 4ZV7A 3PRHA 4K6OA 1TKAA 2FPXA 2AJCA 2DUWA 1DB3A 3SAJA 3C41J 3VM6A 4NE7A 3W79A 3BE5A 3N8KA 3ZX4A 4DLWA 4EHDA 2PSHA 3D3WB 3S40A 3IL2A 1RXVA 3CRMA 1BS9A 3OPYA 2ZAGA 5HSGA 4BFCA 4JP2A 2FPSA 3V00A 4ND1A 4BYGA 3GD5A 5FADA 5BVHB 1U5BB 1UEJA 3BIWA 3PTLA 5EAIA 1FW6A 1M2KA 3ORYA 2GN6A 3DKPA 4HLDA 3JALB 1Q1GA 3TLAA 3OJCA 1YS6A 5T6BA 1T5IA 3F73A 3RS8A 1MR3F 1DEOA 4BS9A 1VCOA 4FBLA 5JVDA 2GVDC 4HR7A 1USIA 5IAAA 3GRAA 2QR5A 2LKDA 3DJYA 4ACBA 1H85A 1NVGA 1QZ3A 2DHRA 3ICCA 1AV6A 3LP6A 1TYDE 3FMFA 4OJKA 3TF5A 2H8KA 3OHPA 4MS4B 1JR3D 4DGQA 4PZCA 4NZYA 2BEVA 1X94A 2WPDD 1S2GA 2YS7A 3KB6A 2FFRA 3LQ1A 3P27A 3E9EA 3KEGA 2AK2A 1FTWA 5KDDA 2ODPA 5AQ1A 1XJ0A 4NMMA 1U9JA 4MA4A 4X64B 2V7GA 1MMFB 2CKMA 4JS0A 4BLVA 4M6WB 4PINA 2QQ0A 3KKPA 3E9DA 3GW8A 1E0DA 5CG2A 4F9GA 3ETCA 2A0WA 2EJTA 4NY1A 4YRLA 5CEFA 1CRPA 2YYYA 4MDHA 2QRLA 5FBKA 3X2FA 2NYUA 3EY4A 5G4KA 5CP8A 1P4SA 3ORSA 4KEAA 5HQTA 4WNYA 2BW0A 3AJDA 3QHPA 2IIVA 1BMDA 4NQRA 4GYKA 4UQOA 5FPPA 3ZD6A 3EGCA 2COKA 1PQYA 3LCVB 3WMWA 1G7RA 2AFIE 1WZNA 1FFXA 1GTMA 1ZNQO 4JLPA 4A2WA 3ZHUA 4PZ0A 4ER0A 5AVWA 3NZEA 3VOBA 4HVCA 3SIWA 1MH9A 5AW5A 3NBZC 1TF2A 2WKSA 4IXMA 1X0XA 4MV7A 2Q1YA 4NESA 5CVEA 1KDYA 4EGCB 4O4HB 3SMVA 1GAXA 3QU9A 2JVIA 3GJTA 1VM6A 2ZGVA 2G82A 3TIXB 1RXCA 2Z1DA 5DW0A 1PR5A 4HFJA 5DMXA 1OBHA 3QVUA 1KI4A 3AI3A 4MITA 3U4AA 3UXHA 3HDJA 3L92A 2D6FA 2QRNA 4P7GA 4MI3A 2XEXA 2JFVA 4JP8A 4JNKA 4AY6A 2OBFA 1R5OA 3WLHA 3WLEA 4KQEA 1GCUA 4F98A 3OTWA 5JECA 1ZH6A 1S01A 1E3JA 4TMYA 4U7HA 1H2ZA 3VGPA 3V9AA 1FSGA 1A8QA 3E84A 4BAGA 5JNLA 3B5EA 5FLXA 1OZFA 2CCKA 2QDKA 4B40A 1FDOA 1QOQB 3JASA 3E2MA 4GBMA 1XLVA 4QOFA 5IBPA 2HPZA 2DYKA 1J2UA 1KDTA 1V1JA 1BEUB 2C5LA 2PSFA 3ER6A 4B8WA 1DWQA 2ZKLA 4Q1VA 1C9MA 1C7FA 3ENWA 2BGLA 3SS9X 3DYBA 1N0WA 1U98A 4BE9A 1X1CA 3WIVA 1HE3A 1ZMTA 2IKSA 3WLOA 4EVRA 4EI2A 2J0QA 3K0SA 5AKXA 5H4GA 2P1RA 5EQDA 3DBOB 4GR4A 4NE9A 3DW3X 3SVTA 1XVUA 3E7WA 5AVOA 3TZ6A 1MX3A 4A0RA 1OZ0A 2FUG1 3P8ZA 4G4GA 3AUJB 5MGBA 1E3MA 4IDFA 1RT9A 2E4UA 4QREA 3UMRA 1U8AA 3FNGA 4LRUA 1XAIA 3ORRA 4Y3UA 2ZUVA 3WS7A 3FPCA 1GCGA 5LQMA 5CW1A 3LUDA 3PFFA 1V16B 1E5LA 1FFGA 2PWZA 4YCCA 3E27A 1N1DA 3ZV6A 4JJFA 4X6XA 4KI7A 3MJ4A 4PANA 1RKVA 5J59A 2NU9B 1ZOOA 3CEMA 2Q3EA 4GPTA 1XMVA 4YFVA 1GGNA 1ULTA 1Q2UA 2JKVA 2XUHA 1DRUA 4TKZA 5HX7A 4MWGA 5CPFA 1MRNA 3QQ5A 2PUAA 1SEVA 3SR4A 4CKWA 3HCPA 1R5JA 5KWSA 2ORWA 4BVKA 3FYUA 3CF4A 2KX7A 3WWZA 4YT4A 1FZTA 1LD3A 3K0KA 5KPDA 1QLHA 3BE4A 1CUGA 1WXWA 5FR1A 1C0KA 4ZXFA 5KQLA 4EJSC 3DZJA 2OEPA 4LF9B 1EFCA 2V0GA 2V6BA 3L7MA 2BMAA 1XB2A 2PRZA 1X92A 4TWAA 5ER6A 1HYHA 4Z6KA 2PBFA 3GJQA 2BMVA 3PF8A 1LBEA 3PC2A 5EMJA 4EGAA 5ALPA 3SJCA 4CMIA 5HKKD 2EL9A 2GJ9A 2YUIA 5ICSA 1FYDA 4RVGA 5D3ZA 1T13A 4F1WA 1SVLA 2MR6A 5DK6A 1Y6FA 1IFXA 4IJVA 2IDMA 1P6QA 4ZAYA 3T1HB 4RYDA 1JDSA 4KX5A 4HAZA 4YPVA 1AQLA 2FR1A 4OLAA 2O4UX 1YUBA 3NDJA 3ZZ1A 3KBBA 2XJ9A 2ZR8A 3AHDA 1KMNA 3O1JC 4Z53A 3B9PA 3K15A 1W4BA 3O38A 1XA3A 3HJBA 1V1MB 3O4GA 4ZCTA 3OQHA 2GPTA 2QRHA 4B7CA 2VAPA 5TQ0B 5LDDC 4JXXA 2QSJA 2DAPA 4MNTA 5LL6P 4GMHA 4EEZA 1NP6A 1NRXA 2A94A 2ZB4A 1NASA 4B5KA 2WUWE 2P9EA 1KETA 3KT0A 1N75A 1U7XA 4IFEA 2X4GA 3FDFA 3IT2A 4N6GA 5B1IA 1SOUA 3LAWA 3S4YA 3ZNPA 4KFTA 2EX1A 1UXKA 1ZNZA 4I81A 5F2NA 2AHRA 2MU1A 4AYXA 2UZ3A 5HS4A 1PZNA 2EX4A 2A84A 4WIAA 3HVRA 3I61A 4LDNA 1XMIA 1UINA 4LY6A 2IV2X 4BVHA 3AL0C 3UAGA 1KDVA 4FB5A 2ZULA 4F8EA 1XEWX 3TNFA 3ZE9A 2N42A 2YQ5A 2W00A 4XCXA 1ISSA 2SNIE 2GCOA 2HN9A 3JWJA 1I3NA 2ZSAA 4WA8A 5BOVA 1T2NA 1GZHB