4YV2A

Crystal structure of trypanosoma cruzi spermidine synthase in complex with 2-phenyl-1,2-thiazol-3(2h)-one
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
290
structure length
278
Chain Sequence
b'ELISGGWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine synthase, putative
molecule tags Transferase
source organism Trypanosoma cruzi (strain cl brener)
publication title Structural insights into the novel inhibition mechanism of Trypanosoma cruzi spermidine synthase
pubmed doi rcsb
total genus 90
structure length 278
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 4yv2A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4yv2A02
3FUTA 3CCFA 5K0GA 2PT6A 2ERCA 4YUXA 1ZG3A 1ORIA 3DLCA 5K0LA 2QYOA 5LQAA 4K6MA 3R24A 1P91A 1JTFA 2OBFA 3HVHA 4IV0A 2QM3A 3KQOA 2I62A 5DX1A 2JJQA 4GOOD 3REOA 4GC5A 4HSGA 2PGXA 2P41A 1Q0SA 1YF3A 2BH2A 1IY9A 1I9GA 1NBHA 1YZHA 5CVEA 5HIIA 2ZFUA 1JG2A 4LWOA 3UJ6A 5K01A 4F85A 5EIWA 4EMSA 3P97A 4NECA 3P9CA 1JG4A 3I64A 3A7EA 4RX1A 5KQSA 1ZGJA 5EQJB 1NV8A 4R8SA 3SGLA 4EK9A 1EJ0A 2O06A 4LECA 4B17A 2IH2A 3NWEA 2PLWA 3KQTA 4P7FA 5E8RA 1P1CA 1QYRA 2GS9A 3TQSA 5BW5A 5MHTA 4GQBA 4PINA 2IP2A 5CIYA 3DULA 1NW8A 3CJTA 4DCMA 2XVMA 3L8DA 3R0QA 5CVVA 4FSDA 5HZMA 1VIDA 3UJAA 2ZVJA 2ZWAA 3GO4A 3GRZA 2VZ9A 4QQKA 5GOZA 5GWXA 1FJXA 2Q41A 4C08A 3LBYA 5EIFA 1NW6A 3V97A 3E7PA 3KR2A 5K0EA 1WY7A 4YUVA 2PJDA 4GEKA 3I53A 4KRGA 3TFWA 4F84A 1NW7A 3I9FA 3SMQA 4E2ZA 1WXWA 3BUSA 3IHTA 2HTEA 2R3SA 5E1OA 2IBTA 3OCJA 9MHTA 2B2CA 3BGDA 5EZQA 2PX2A 3P2KA 4QDKA 1JG3A 1WXXA 5ICEA 1TW3A 2QE6A 3KQQA 3EVZA 4CWAA 2R6ZA 1R8XA 4V0QA 4ER7A 4X1OA 4KVZA 2HNKA 1UIRA 3KU1A 5CVUA 3UJ9A 1NE2A 3HA3A 1JTEA 4E32A 5K0JA 1KPGA 2ZSUA 3FZGA 4GUAA 4PONA 4PYOA 3EMBA 2PY6A 3G7UA 1B42A 2XYQA 5GM2A 4BLWA 3NDJA 2QRVB 4FZVA 5K0FA 1AF7A 3AWIA 1SUIA 2O0LA 1V39A 4R8RA 5DWQA 2PWYA 3X0DA 2PWPA 4OA5A 2HMYB 1RI3A 3ELDA 1IXKA 4KIGA 5CM2Z 2NXNA 3G2QA 4HTFA 5E9JA 5T64A 5GM1A 1UWVA 3U81A 3HEMA 3UJCA 2QY6A 4DCGA 3DR5A 4P7KA 3M6UA 4C03A 4E2WA 5KYGA 3LKDA 3AY0A 3T0IA 5ICCA 4CKEA 3LECA 3FUXA 5DM1A 3HM2A 3IEIA 5CD1A 1ORHA 2NXCA 3PB3A 5GIOE 2CMHA 4A6DA 1T43A 2XYRA 3BWYA 3KQYA 3R6TA 5DM4A 4DA4A 1XCJA 1RI2A 3DMGA 3HA5A 3MB5A 2GAFA 3ME5A 4QVKA 3OPNA 5LQRA 4C06A 1OR8A 1I4WA 1VP9A 1X1CA 3HCDA 1VE3A 2BM9A 3EVFA 3EVGA 3H2BA 3OE4A 4FT2A 3ELYA 4PYJA 3DP7A 1G55A 4MTLA 2PXCA 4XCXA 5CCXA 5CUQA 1NKVA 4C4AA 1TPYA 1O9HA 2P40A 2AVNA 10MHA 2EX4A 2NXJA 4R6WA 4QDJA 2YX1A 3SM3A 4ZTBA 3VSEA 5FTWA 2PXXA 3DXXA 5FADA 4U7TB 2I7CA 3LCCA 4M38A 3TKAA 5DSTA 3PS9A 3CBGA 3GRRA 3ER9A 4PNEA 5EEHA 2IDJA 4KDCA 4RTKA 3FPFA 5FUBA 4EQZA 1NW5A 3HVIA 3LDGA 2ZCJA 2AS0A 4PYKA 4Y2HA 1XDSA 3P2EA 4P7GA 3WSTA 4EVIA 3I58A 4RSRA 1Z3CA 2A14A 5K09A 4DQ0A 3T7SA 1EJ6A 4KDRA 5HEKA 3GWZA 3SSNA 4CTKA 2O05A 4RTJA 3Q7EA 1KP9A 2WK1A 2VS1A 3QV2A 1XVAA 2Y1WA 5BW4A 4ER6A 1SUSA 1YUBA 2ZIGA 2P7HA 4KIFA 4MQ4A 5H02A 2ZBPA 2C7PA 3AXTA 1FBNA 3GRYA 2ZW9A 3HCAA 4GF5A 5DXAA 5F2KA 1JG1A 3UJBA 1SQFA 4GOMD 4KWCA 1AQJA 1XDUA 3MTIA 4PYQA 1VPTA 5DLYA 3EEOA 3A7DA 2Z6UA 1L3BA 2NP6A 4YV1A 2OZVA 1XXLA 5EG5A 3LBFA 2HV9A 5DRTA 2AN3A 3M6WA 3LHDA 5EMJA 1N7IA 3LKZA 4Y30A 3OFKA 3HVKA 3G2MA 4HRAA 2H1RA 5LQUA 1DL5A 5IH3A 3HNRA 3MGGA 5HFJA 3TOSA 4RTOA 1O9GA 4FT4A 3Q87B 5CVJA 3CC8A 3PLAE 2PT9A 1ZHFA 1O54A 3P9IA 3GGDA 2YUIA 2BR5A 2KW5A 3NWBA 3UFBA 4RTMA 3M70A 3CJRA 4FS8A 2ZTHA 3G8AA 1WZNA 5GINE 3EVEA 3FTDA 3HP7A 3IYLW 4YMHA 3QOXA 2ZIFA 4HGZA 2IH5A 3KPJA 3A4TA 1EAMA 3ER8A 3HTXA 5LQCA 5D1HA 5T67A 4YV0A 2VDVE 3FUWA 2H11A 3O31A 1KPIA 3KQSA 4OBXA 3G89A 5DM0A 2G70A 4OQEA 3BXOA 5LSAA 4MHTA 2IH4A 1BKYA 2XVAA 4XUDA 5DXJA 2Z6QA 4E70A 3SXJA 2GH1A 1KIAA 3O7WA 4PCLA 2B9EA 2YXDA 1BOOA 2IIPA 4E2XA 3TMAA 1XCLA 3E8SA 3KQWA 5K0BA 4FGZA 1JSZA 1DCTA 3E05A 1L9KA 3UBTA 2IGTA 4LG1A 4X41A 1WG8A 4BLVA 1NV9A 3PFGA 2C7OA 3B7PA 5E1BA 4DM3A 2ZBRA 3M6VA 1M6EX 3R3HA 2PXAA 3EVDA 3FTFA 2JH8A 2CL5A 2HR1A 5F2NA 3SSMA 1BC5A 2AVDA 5E1DA 4C07A 4RTSA 5DPMA 3LGAA 1D2GA 5LQNA 1X1BA 2P3OA 3BKXA 2ZLBA 4PYLA 1G6Q1 2FHPA 1SKMA 1F38A 1RJDA 5FA8A 3NW9A 3VC2A 4WVLA 3LCVB 3OZRA 2EJUA 3EGEA 4YUYA 2I6GA 3EGVA 4X61A 2I9KA 1R00A 3G8BA 5K0NA 1L3IA 1ZGAA 3I5UA 2P1DA 5P8WA 3RODA 2YVLA 4ATNA 1KYWA 1VP3A 2DPMA 2FRXA 1SG9A 4G56A 4M37A 3EGIA 4PIPA 5DRYA 1D2HA 2ONZA 2P3QA 1INLA 3BT7A 3FUVA 2K4MA 5LR6A 3GJYA 3R9XB 3BZBA 4GOLD 1RJEA 2UYOA 3KHKA 5FHRA 4CKCA 5IKMA 5DTMA 5EC8A 3BWBA 3BWCA 2OO3A 3GDHA 3NDIA 3UA4A 3UA3A 4UOEA 4X60A 4RV9A 4M36A 3T7RA 3UWPA 4GBED 2O57A 5K0CA 5DM2A 3KQPA 4PWYA 1QZZA 4OBWA 3IV6A 4DF3A 3PX2A 3BGVA 4CXMA 4PCAA 2CMGA 5FHQA 3TLJA 2C7QA 1SQGA 3CVOA 4WXHA 5G02A 4MWZA 3RW9A 3AXSA 2PX8A 4DMGA 3G5LA 3OU6A 4R6XA 3FUUA 5C1IA 1RJFA 3SX0A 2IFTA 3BKWA 3ID6C 3HCEA 3JWHA 2EJTA 4QTTB 2FCAA 3D2LA 1R8YA 2IBSA 3NVKI 3FPHA 3P2IA 2ZULA 4ISCA 1R74A 4L7VA 3LSTA 2JHPA 2PV0A 5F2OA 5T6BA 1NT2A 5M5BA 4PGGA 4AZWA 5DX0A 1G8AA 4QQNA 1L3CA 3KPUA 1ZKDA 4YV2A 1EIZA 4RTPA 2ONYA 4RVHA 4BY9E 1JSXA 1WS6A 2AN5A 4XUCA 5C9ZA 4U7PB 2P3LA 3FYDA 2XYVA 3TKYA 3MCTA 3NVMB 4RVGA 5ICGA 3KPVA 1NW3A 3DTNA 5CVDA 2AOUB 1ZQ9A 2B78A 1EQAA 3EMDA 3LL7A 2AOTB 5DTRA 3HA7A 3TRKA 2WA1A 1Q0TA 4R05A 1VLMA 3LDFA 3E23A 3ELWA 4QTUB 2OY0A 5DT2A 3V8VA 4E33A 5EVJA 2B25A 3EPPA 2FPOA 1AQIA 5EMMA 1UFKA 2F8LA 4Z2YA 1M0EA 3FTCA 3THRA 2P35A 2UYCA 1YB2A 4YUZA 3MERA 1G38A 3B3GA 1DUSA 2B3TA 2E5WA 3PFHA 5EHIA 4RVFA 5C0OE 3C6MA 3NMUF 2O07A 2GPYA 5K8VA 3ERCA 4AUKA 4V0RA 4OA8A 2Z6AA 4RTNA 1FP2A 2OYRA 5BP7A 4FP9A 1U2ZA 5HIMA 2V7EA 3C3PA 3G2PA 4POOA 5ERGB 1QAOA 1XTPA 2ADMA 5HIJA 2ZZKA 3GU3A 4BP3A 5K05A 3KPYA 3FTEA 3CKKA 1R6AA 2BM8A 4GOND 4PYMA 5EKXA 3LDUA 2PKWA 3JWIA 4PIMA 2AOTA 3HVJA 3T7TA 4QVGA 3VYWA 3GRVA 3B3JA 1KXZA 5EEGA 1YZ3A 3FYCA 3LCUA 5EPEA 3UJ7A 2JHCA 3EEYA 4EKGA 1NBIA 3K6RA 5FQNA 3FPEA 2OPBA 1KYZA 3KPWA 1VQ1A 2H00A 3MCZA 2NYUA 5FULA 3DOUA 1MJFA 3UJ8A 3PX3A 3HCBA 3P9NA 3C6KA 4PYNA 1KR5A 4P58A 1N2XA 4ER3A 3KR0A 8MHTA 3O4FA 2AZTA 5DSXA 5JR3A 1HMYA 1RI5A 2YXEA 3DMFA 3P8ZA 5E9WA 1X1AA 2YTZA 1YFJA 3KQVA 4HC4A 4IV8A 4MIKA 1P39A 4EKIA 5E8JA 2QRVA 4HGYA 2PX4A 4PYIA 5E2BA 2NNWB 3UJDA 3EVAA 1VBFA 3C3YA 1QAQA 3QOWA 2G8NA 2N47A 4KW7A 5EZSA 4C05A 2AOVA 4HTFB 4A6EA 4AX8A 5U4XA 2ESRA 3A27A 3MHTA 2OKCA 5FQOA 4YUWA 2OB2A 3PVCA 3B3FA 3GNLA 2VDWA 4CKBA 4DZRA 3B5IA 3M33A 3MTEA 1JR4A 4LWPA 3NTVA 2IDKA 4ER5A 3TM4A 5KVAA 2P8JA 3A26A 4E2YA 2UYQA 3MQ2A 3GCZA 5FCDA 2G71A 5EMKA 3FRIA 3M6XA 3P71T 3RIEA 2JG3A 5HILA 5ICFA 4RYLA 3PT9A 2CWWA 1L1EA 5JUWA 2OB1A 3MAGA 3ANXA 1HNNA 2P7IA 1FPQA 1G8SA 1P1BA 2GLUA 1X1DA 3DXZA 5FWDA 4AZVA 3OFJA 3OZSA 5GIPE 3PTAA 3FRHA 2ZBQA 2DULA 3JWJA 4QPNA 3GIWA 5EGSA 3DXYA 3GRUA 4IWNA 2CKDA 4QPPA 4YMGA 2ZZNA 5EHGA 5CCBA 4HH4A 2JH9A 3JWGA 5HOQA 1RJGA 4X63A 3A25A 3AJDA 3SSOA 1BHJA 2C7RA 2AOUA 4F86A 2UZ4A 1H1DA 4OQDA 5B1SA 3KKZA 5KS2A 3F4KA 2PBFA 4XUEA 4H0NA 5LQJA 2EG5A 1F3LA 3S68A 2XBMA 2PX5A 1XDZA 2AN4A 2GA9A 3ELUA 4E31A 3SVZA 2AR0A 1JQEA 1I1NA 5EOVA 1QAMA 4JXJA 3LX6A 2GB4A 2IPXA 2ZZMA 3THSA 1PRYA 1KPHA 5BXYA 3TM5A 3VC1A 1TW2A 1MHTA 2JHAA 3HCFA 2AOXA 4GC9A 3KR9A 2NP7A 4RTLA 1FP1D 4RWZA 2YR0A 5DTQA 5GP1A 3DMHA 3GXOA 1SVUA 4O29A 3HCCA 1JQDA 1XJ5A 3G5TA 2ZWVA 4ER0A 3EVBA 5FA5A 1JQ3A 7MHTA 4C04A 1YFLA 2YQZA 2OXTA 5LQKA 3OZTA 2PSSA 3NJRA 3DUWA 1M6YA 4DKJA 2FK7A 1PJZA 1KHHA 1Y8CA 2VP3A 3LPMA 1AV6A 1RI1A 1VL5A 3CJQA 3M4XA 2FK8A 2BR4A 1EG2A 1G60A 3TPZA 4AZTA 1X19A 3C0KA 4BP1A 5EMLA 3KR1A 2AOWA 1D2CA 2G1PA 3K0BA 2NXEA 1R18A 5KQRA 3OU2A 2Y1XA 4HG2A 3FPGA 3FPJA 4PGHA 2WA2A 2YXLA 3G2OA 2BZGA 3SR4A 5K03A 3ORHA 3BGIA 3UZUA 4OX9Y 1IM8A 2V74B 5HIKA 4AZSA 5E2AA 5DX8A 3CGGA 4RVDA 2PVCA 2ZIEA 4CTJA 3BWMA 3DH0A 5E1MA 2HWKA 3OU7A 5EKUA 4FR0A 3KQMA 3DLIA 2FYTA 3G88A 5D1NA 5E9QA 2EFJA 2G72A 5FWAA 4P7JA 2BR3A 3P9KA 4M7RA 3TR6A 1RI4A 4E30A 3OE5A 4BLUA 2ORED 1N7JA 4FSXA 1QANA 3B89A 4IKPA 4RTQA 4RTRA 3EVCA 2UYHA 2LD4A 2VDUE
chains in the Genus database with same CATH superfamily
5TGDA 2ASEA 4K3VA 3D8UA 4LYHA 5EWJA 1YR1A 5FXMA 5G3YA 1CDZA 2XWPA 3GOQA 3HRIA 4PBSA 1UDXA 4X1YA 2PPVA 5IHPA 3ORFA 2D2FA 4II3A 2EOAA 5F5LA 3DYBA 5BMOA 4ZC1A 4KVGA 4DJ5X 4Q4JA 1GGMA 1NPTO 3K20A 2FUEA 3FG9A 4YCJA 3CEAA 1JIJA 5EP1A 1PFGA 5HX7A 1CQWA 4NZPA 1JJ7A 1YGYA 4C4TA 3P9QA 4CR8A 4EVQA 4U1RA 3NTQA 3EIQA 4E6PA 2AHRA 2SKEA 3HU2A 3TNYA 2B36A 4DUYB 4ZDJA 4KQFA 2J3KA 1MH9A 1GV0A 2HV8A 3BTVA 3MGBA 1BE1A 1ISIA 2E4AA 3AEQB 1ZXLA 4GMXA 3SK0A 2WUGA 1WLSA 3NVAA 4PHCA 1Z07A 2CN1A 4HDSA 3T99A 3GGPA 3T1QA 4ZQHA 3R7SA 3F3SA 3V33A 1DEHA 3W90A 4D5EA 2IHZA 4DUPA 4Q3DA 2KBFA 1H05A 2BEVA 3DULA 1E1CB 4JJ8A 1KMIY 3UMMA 4UHBA 3OE7D 4RPCA 1UC8A 3WXMA 1I2MA 5CVVA 2YRFA 1WA5A 2D3WA 1XOIA 2Y1OA 2ZT7A 4MRPA 4NAVA 4DREA 2Y2UA 2R6CA 4LQLA 3K5WA 1JDUA 1KP2A 2BUCA 3HMQA 1TM3E 4OAQA 1X8XA 2Q3JA 3HY6A 3CLRD 4BQNA 3ZYCA 4G5QA 4IX9A 4NAHA 1I01A 2I1VB 4X3OA 5C53B 1EJ2A 1GYQA 3P27A 4XB6B 5HK8A 4YPOA 4E5PA 1ORVA 1WXWA 2XKAA 2P30A 2VWHA 4LXTA 3TLZA 2BCEA 3AV0B 3F5SA 4I5DA 3SE0A 2BFBB 2MMCA 5K3CA 1FFSA 1A04A 2HQRA 4QDKA 2GYWA 3E3MA 4B3TB 2G7ZA 2WAXA 5EJFA 1GUAA 4L2IA 1SIWA 2F64A 2H63A 3C7TA 3RUPA 3PXDA 1R8XA 3NBUA 3U7QB 2V0CA 2WEKA 5DHUA 1TMKA 1TCVA 2W2OA 4CIWA 3AVWA 1H2HA 4DLPA 2GPBA 1JKFA 3BTSA 3GV0A 2IF0A 1ZC4A 4PAMA 4M8SA 4CFSA 1B2LA 4PYOA 1DI0A 3DD1A 4MR8B 1ZN2A 4QJ3A 2FSPA 4WESA 5J23A 2FA9A 1JV2B 1XXHA 4JP5A 4TN5A 5F2EA 3WZMA 5J2TA 2PR2A 1LPOA 5JCOA 4ZV9A 3DEAA 1E32A 1UKBA 4XIIA 4RDXA 2XE4A 4M8IA 3WGVA 5KSYA 1PLKA 3UO8B 3MN1A 1PD0A 4P4GA 5IZ4A 1ZXXA 4JLDA 2N75A 2JFGA 2VT7A 2H2DA 2HA0A 2Q3EA 1GQYA 4PG6A 4DM7A 2ACVA 3N8IA 3DG9A 5AT1A 3LECA 4DLTA 3BWVA 1YKGA 2QTMA 5BOSA 2BFDB 2O8CB 2VJOA 4FYHA 4I8XA 3LQFA 4I1VA 2W8BA 4PO1A 2ROQA 4YMWA 1WCIA 5HW0A 1CZHA 2AJCA 1Y3AA 4HD8A 3RKUA 3L43A 4G1VA 1UMCB 3EASA 3I52A 1GG8A 4QNMA 5HJ2A 3OPNA 4HB0A 4FC7A 4PZEA 3PC6A 1EBBA 2FP4B 1ZUD1 4BEVA 1N5OX 1E6UA 4HL6A 5EIOA 2AH5A 1Z8DA 1HNWB 4GZ3A 3TB4A 5CUQA 2WU0A 1UJ4A 1XMSA 5TGTA 4C4AA 3GP3A 4TRJA 2EGHA 2B6NA 4JN6B 2Y1CA 1TIPA 1OFUX 3EBLA 3ZOZA 2VA8A 3UHPA 3MS2A 1QHFA 3U26A 1C1DA 4AKIA 1W4ZA 4MZDA 4PLHA 1WMEA 2WZQA 2WSLA 3ZTWA 1LVUA 2BKAA 4YJ2F 3DGFC 1EEHA 1AIPA 1BDJA 1FPMA 1ZONA 4PNZA 2OAGA 3C3XA 1OFTA 4R1OA 4EJ6A 1R4NA 1VCOA 2AS0A 2D8AA 2Z4RA 3LW8A 4Z4HA 1XZCA 2GN9A 4HTAA 5ENDA 1UF9A 4MVXA 3CVXA 1S8NA 1YR8A 1HFJA 4DDHA 1Q5PA 1U7DA 2QUKA 1O8BA 4UU1A 4QOHA 2C2KA 1H6DA 4O59O 4D8WA 4D4GA 2IEBA 4IH4A 3NB0A 1E1CA 2JNWA 1W0KA 2ZS7A 3V2IA 1XZAA 3TZKA 5J47A 1KS9A 1RWKA 1FFDA 1Z7EA 2D4AA 2M32A 2VRCA 5FBRB 3UJBA 1HQCA 3RADC 4YLEA 3RFTA 5A02A 4OH7A 4LJAA 3EEOA 3DAOA 3PFNA 1L3BA 3USCS 4LISA 1FU8A 3NKVA 3AVQA 4BFLA 1H2XA 4ILEA 4WZAB 1HK7A 4JHXA 4RXMA 3UH0A 2DTEA 4Q0MA 1KH3A 3WLMA 3C3MA 2VEOA 4EY4A 4X65B 4Y30A 4B3HA 4MRAA 1G7SA 4B34A 5CPFA 1G59A 4HRAA 4W5OA 2VJBA 1E2DA 3QVKA 1ZJ4A 1DZIA 2J85A 4YRCA 3UICA 4CLHA 3ZW8A 3IE1A 1CF9A 2YYZA 3EXFB 4J1SA 1R0KA 1ZL2A 4URYR 3R6WA 4D0GA 1E7YA 1RM4A 1X0XA 2DR3A 3D2CA 3FWYA 2AE1A 3L4KA 3NBFA 4Q47A 4UAUA 3VZDA 3LV8A 4WXYB 1GOTA 4H1HA 2RH4A 4RD1A 2Q9UA 3ET5A 1LJUA 1IXRC 4JMLA 3ETDA 1YB1A 4P4SA 4LKRA 1HE8B 1XVUA 2XRYA 4LDRA 2JLBA 3WGHA 3QTLA 1H3FA 2VAPA 3EZXA 1OX5A 4LJRA 2P8SA 4ACBA 1U7PA 3H11B 3AKYA 2AF3C 1EVKA 2XQIA 3O8BA 1T5OA 1YBFA 1ZQ1A 4LFCB 1JSLA 5JOQA 2VNHA 2WV7A 3EOZA 3HPQA 1XCLA 3EVTA 3KQWA 3O8OB 4FPXA 1PFVA 4NKRA 3MRVA 1QRTA 1ATIA 3U4IA 1DQRA 2PMFA 3LUKA 4QVIA 1CUVA 4HKTA 2E5LB 3HBNA 4YCDA 5JMPA 1VJGA 4BP9A 4DV0B 3T5AA 4AW9A 2Z4TA 1FLAA 3JYPA 1IJKA 2HCRA 3Q8XB 4LN1A 4C4SA 3QKRB 4J4TA 1QBGA 2OXRA 3T1OA 2CDNA 1GDTA 2E1RA 2YHIA 3AB8A 3VSDA 4UPDA 4UTZA 4PZPA 4CV1A 4RIFA 1OH5A 1G8FA 4YMSA 4IVPA 1RYMA 4AQDA 1UBKS 3DJYA 4MDYA 4FM9A 1D2GA 2H0AA 2VAXA 2J6BA 2ABWA 3PUXA 3CF4G 4GECA 4WPGA 5FIUA 1F38A 3SDBA 4OB6A 1QFYA 1MNAA 5KHAA 2W0MA 3R74A 4HAUA 3CTMA 1H3EA 1RQ7A 3OZDA 1KEEA 2RJOA 3W5CA 1QTIA 2VOJA 4E07A 1Q0LA 3T7CA 2XMRA 4I9GA 3UGKA 3JY6A 3V2UA 1VDMA 1P2VA 3SYNA 2XODA 2BMAA 1JN0A 2VJNA 1E6LA 1W5EA 2Q1TA 1QG4A 2GTIA 2RC6A 3A3KA 2YN2A 3R3JA 1DUIA 1U2SA 2EQ5A 4PLPA 1B2RA 1TYAE 3VZCA 3GEIA 3DBRA 3BRQA 1KYYA 3NHAA 3NTRA 4UZFA 3CKYA 5BN4B 1QQAA 3B38A 1OWNA 4TWZA 4M89A 4RV9A 2HK8A 3I76A 3IQWA 4JI1B 3OPXA 3UWPA 3ZNQA 4AIRA 5JANA 1TO2E 2JCVA 2XB8A 4PEVA 1C3EA 5EJ7A 2DLCX 1VKHA 2EKZA 2C7QA 3W3AD 4UU7A 1Y1KE 3SF0A 4DM3A 3ESXA 3BL8A 4MWZA 3RW9A 1BJRE 1QHIA 1YQGA 5GY7A 3E1KA 3G5LA 3L9XA 5EJ2A 2XZOA 4KXUA 2O0HA 1E1MA 1KSGA 1Z6AA 1G5QA 1E1RD 3G1UA 4R16A 3CLRC 4LRXA 5JWOA 2X5XA 3ONNA 3I6YA 4ZVRA 2FPGB 1Y81A 2SICE 3RVDA 3MEQA 2PV0A 1X9HA 5F2OA 5ADUS 1ZIDA 3X2FA 3WRXC 1CS0A 3RTBA 2PE5A 3JTMA 3GFQA 4MRSA 2VHQA 3VR6H 1IBSA 4UHCA 4XJXA 5IYZB 1YVUA 5D7BA 5IZCA 5JTUA 5CU7A 3M6MD 3SZLA 2MR6A 4XGQA 1OYYA 3NAZA 3KBOA 1NXPA 4MYTA 4DOMA 2F00A 1YDFA 3P9YA 4N7JA 3ZFPA 4QOJA 2QE7D 4K81B 1MAHA 1ZQ9A 2QLBA 3LVRE 4Z7OB 4B3BA 1HSZA 3ZWAA 2HSDA 5KNDD 4R05A 1ZW6A 4QTUB 2IUYA 4EDFA 3TW6A 2PH3A 3IDFA 1ZH4A 3A06A 4H9JA 5BW8A 5J3JA 1RM3A 3B48A 4Q9NA 2FXIA 2X5OA 3JATB 1KBQA 4X84A 1BE8A 4JQOA 2OMKA 1DUSA 3RS3A 1OGIA 2HUPA 3L49A 4IIEA 4Q3CA 2VNJA 3N7AA 5GMOA 4QYTA 1EVIA 4DDVA 2ADFA 4V0RA 4H3VA 3GGCA 2P2DA 3C70A 4H7PA 2GCNA 1G20B 3ET4A 2ONJA 1NZDA 3GGSA 3HFJA 4BLTA 1XHFA 4R1SA 1FFBA 5I9TA 2Q1YA 4RIIA 3AM1A 2FR8A 1B73A 5KNBD 5EQDA 3LFUA 2F1HA 2O2HA 5IVHA 5K05A 3NC1C 4OKNA 4OHZA 2X8LA 3EN0A 1JXOA 5BUSA 5B3LA 4PPYA 1T6ZA 2ZR9A 3Q11A 2VP9A 1D03A 3ADKA 4D0SA 2EKBA 4ZOAA 3MSCA 4QVGA 1T5SA 5IVIA 1Y34E 3ABSB 4IHQA 4K2AA 3AL2A 3QMMA 3EEYA 1Y7HA 1VHQA 4I4NA 5J4LA 1SU7A 2OCXA 2WTEA 1PTKA 2IIVA 4R8MA 2XCTB 3I6QA 1Y6JA 3R40A 3O0TA 5EUMA 3U7QA 3TF5A 1WSWA 2IU4A 1U2EA 3UJ8A 4JYZA 1EHCA 2VDJA 3P9NA 4LFAB 2QVXX 4JOSA 4EJSC 3V3KA 4EG5A 5JAIA 3EFOA 3H9BA 3B7GA 2JFNA 5I9MA 4JCCA 2XXJA 1QG6A 1V2GA 3H1AA 4IV8A 1SHZA 4B3DA 4IKOA 1FIUA 1ZITA 1P2SA 3BQNB 4JJFA 3D6TB 3DBHA 2BFPA 4PYIA 4DQDA 3FCOA 1QAQA 2G8NA 2NTEA 2JFXA 3CNOA 3KZVA 3U40A 4W8HA 3D2BA 6ADHA 4A6EA 2ORYA 3NWOA 4MV5A 1H0SA 2PO7A 5FQOA 3PTLA 4MGEA 4KSYA 3NHPA 4KYVA 3LUBA 4P4TA 1IZ9A 3AFNA 1XKQA 1NYTA 4ZHQB 4J29A 1RFGE 1YCFA 2BFCB 1OIVA 1NJFA 1YS9A 4MP3A 2J5BA 3ZX5A 1F2UA 5F76A 2GWRA 3THYB 5FWXB 1JF8A 2JLRA 3IQHX 4DRYA 3F8WA 1QRAA 2NWQA 1SG6A 3VR0A 2E4UA 4R9RA 2HBQA 3DXZA 1PDOA 1A71A 1CS0B 4L0CA 4WFQA 4BVGA 5C80A 2EW8A 1SA0B 3PQ6A 2OLEA 1V4NA 2A35A 4AN0A 2OQRA 4FHGA 2QMHA 3GJ3A 1T3SA 5EXDA 4BQOA 1Y8ZA 3RBAA 1AKYA 5HJ7A 3EDYA 1N3LA 2I87A 3E9CA 1JAIA 2XT9A 3AJDA 4E4YA 2O0MA 3L8EA 1Q19A 4PZCA 3IOMA 5E7QA 3F5QA 4QBFA 4EW3A 1R12A 4KLZA 1M0SA 3N74A 1C0EA 3P0FA 3O4IA 4NOLA 3ZJ5A 5FEMA 3REGA 3ACCA 3GMIA 2ZPTX 2ZTLA 2P90A 4FKZA 4H0NA 4LXIA 3WGZA 4J0QA 4LOIA 1MJNA 1O4WA 2WYUA 4TLMB 4F9GA 1QH0A 3DHEA 3QIVA 1JR3E 1R3UA 1XZQA 3W8EA 4IDNA 1G17A 2VRWA 1Z4PX 4JXJA 5JAPA 1UBMS 1U8EA 4CDRA 4JI7B 2FEKA 1YZGA 2FMHA 4QUDA 3CSSA 5FBKA 2P27A 5JYDA 2FZEA 2JANA 4XVHA 5HGJA 3TSCA 5DGIA 4IRUB 5LQSA 4B0OA 1X3SA 1R0WA 1V9LA 2WSSD 3L8FA 4GX2A 2QQGA 1I3NA 3G6KA 5HE9A 1JDNA 1CQXA 3AJ8A 3H5LA 4JUAA 4IJWA 5PGMA 4BDTA 1KMHA 1JQ3A 5FTJA 1KSJA 1V26A 2JFYA 4RFVA 5DEOA 2GZSA 5LQKA 3A3OA 4FE3A 3L0PA 1OFIA 1SUCA 3PFCA 4LHVA 3QXSA 5A3VA 3GRCA 3ZE9A 1XZLA 4DMRA 1KMCA 3FDXA 4QUJA 2OOSA 2X4GA 3QXXA 2LIPA 2QMUA 3MWEA 4PHHA 3WYFA 1U5BB 4WH0A 3O3OB 4OIMA 4UDYX 3F2IA 2KPOA 2NXEA 4RS4A 3QPUA 4UE6A 3AG6A 1V6SA 3UW3A 3VVCA 3SWWA 1CNEA 2ATEA 2AX3A 2W11A 4G86A 2IYPA 4NBWA 3SR4A 4ZHSA 1AXGA 4YJHA 3OWXA 2FKAA 2HXSA 1LCIA 1R5BA 3QBEA 5DHSA 3TIFA 3RSOA 1ZMTA 4X44A 4P4SB 4A27A 2Q5JA 1XCBA 1E3TA 3ANYB 4PX2A 2CLLB 2P0AA 4BMZA 4M76B 1YTLA 4I1IA 2G72A 2HI0A 4J0EA 4K8OA 5JRDS 2AIRA 3LE8A 3FY4A 4XH9B 3BGSA 3VO9A 4CEJA 1YRHA 4CLOB 2I7VA 5CA1B 2ERCA 2UXDB 1A4XA 2Q5HA 2ZDGA 4MW9A 1U7TA 3TZEA 3GCGA 1A1SA 3DCNA 4K6MA 1Z29A 4FX2A 3F6BX 3E2IA 3LM8A 1VBMA 3BOSA 3BPSA 1PGNA 1W581 2I62A 3DUFA 3RU2A 4ZHQA 4CL8A 4HVCA 4ZO7A 2XWBF 2OCBA 3I28A 3ICWA 3TAUA 1KZGB 4UQLA 1UK9A 2PGXA 3AHHA 2BH2A 2JFOA 1I9GA 1M72A 1MCZA 1B76A 1Z37A 1DXHA 2E5FA 2QJWA 3LXXA 2I2FA 4X93A 4EHHA 4Z54A 5K01A 1UWLA 4UASA 2DSNA 3CQ9A 5EIWA 2EZUA 2H92A 4NS1A 3ZVKA 4P22A 1FE8A 1IN8A 1PV2A 1WW2A 2XOKA 4MR7B 2OLJA 3GUVA 4WHMA 4N7RA 5EQJB 1OI3A 4ZVMA 3SGLA 3ST7A 3HWSA 4YHBA 2H1IA 4U9IS 4TYQA 1NBWB 3VPCA 3EGDB 2QZ9A 3BILA 3EHEA 3KQTA 4YGYA 3NKLA 5DLQC 3MAJA 2O3RA 4P53A 4Q15A 1YK1A 3AGQA 3H9UA 1P62B 3CJTA 1TJ3A 3I2GA 4U7GA 2HCFA 1J9ZA 2WKSA 1QVRA 4BKUA 2DWQA 4RETA 3WRWA 4C01A 3LUHA 4D0RA 1Y6ZA 1E96A 3RAPR 5HZMA 2C5AA 4DNOA 1OXTA 1YZUA 3W2GA 2ZVJA 1EHYA 4K7JA 4UU8A 5GOZA 1FQOA 4EHDA 5HWSA 2JD2A 2OFOA 2IKQA 2B1JA 1IN1A 2BKUA 3K5HA 2WSYB 4IVNA 4NQRA 1HGXA 3HJUA 4JP8A 3GEBA 1ZVMA 1CZOA 4IJMA 4NFHA 1XELA 1ZO8A 2VBFA 3U1VA 4BXOA 1BMTA 1XU4A 4JQSA 2HHLA 3FH0A 1KZ9A 2JGFA 4M1WA 4U5XA 1HWYA 2B34A 3IHTA 3ZUPA 3SIRA 5B64A 1AN9A 5E1OA 3EXIB 4C2UA 2EYQA 1ESDA 2B2CA 2WJGA 4IEFB 4EJSB 2JI8A 3P2KA 2MSKA 1YVDA 5DWDA 2Y76A 4I66A 1IDN1 2GEUA 2IHYA 4OP3A 4XEHA 3UMJA 2QRQA 4H0FA 5AD1A 3DVLA 4L6AA 1WMFA 4ZANA 3EH2A 5CVUA 4NESA 5DGCA 5A9TA 2Q6LA 4ILKA 4R31A 1VSVA 1KQGA 2EARA 2ZSUA 3DHVA 1IEXA 1WULS 3EC2A 1QP0A 4BVAA 1ZH8A 1KI8A 1X92A 2VHVA 4LW8A 1SZJG 5F3RA 1TVEA 4AS3A 2WZCA 3U80A 7YASA 5FI5A 3HN6A 3ZY3A 5IYZA 2PUGA 1F60A 2AEMA 1GQFA 2OHGA 3NDBB 3X0DA 4MHOA 3DT9A 4FDVA 1OASA 4KIGA 4ARZA 4EGJA 1LRJA 1Z6QA 3QQPA 3NTOA 1K7XB 3UJPA 1NI4A 1UWVA 4G9EA 2Z56A 4JR1A 1JMVA 1QQTA 4RLHA 5DGDA 3UJCA 2W6JD 4QZVA 4W1QA 3R8CA 3D8NA 3LKDA 1PJ8A 2BGIA 5BMVB 1GZ7A 2XQJA 2D0OB 1Y5NA 3NNDA 1TZCA 4GO1A 4ODIA 4RY0A 3VTZA 4PG7A 2XYRA 1ZJZA 1OIXA 2DUNA 2MIIA 1T2CA 4KHZA 1L5HB 1PQUA 1PU2A 4PYRA 2QZJA 2CFCA 4YMUA 1PD1A 2GO1A 3L6BA 5ALWA 1CQZA 1OXVA 1HA3A 3EVGA 3N8HA 3WQRA 1VC2A 3OE7A 3FKQA 3GFPA 1NKVA 3L0IB 1YI0A 3EUAA 5AOBA 5FBHA 5I9SA 5ECDA 2A7XA 2QTHA 1TB4A 3A4YA 4HMPA 4NV3A 3ZJTA 3GT7A 4LEIA 5TF0A 4TLCA 4Y1EA 3TQOA 1EFCA 2RBGA 4MGKR 5FTWA 3PC3A 1KDZA 3DKPA 2P78A 3ZWNA 1DKNA 4NPHA 1JQKA 1NBAA 5CTJA 4YQEA 4BMPB 5ED0A 3UM9A 3VISA 4N5NA 3PSHA 4G26A 2RONA 1ULBA 3MIIA 2VK8A 4N3GA 4E21A 1FVXA 1L7DA 4L4ZA 4WECA 5FRDA 1A4UA 1FMJA 1TT5B 1XDSA 2O2EA 2XAUA 3KWFA 1C29B 2GBPA 2IU6A 3GZ4A 4Q4JB 1CB7A 1DOHA 1E4EA 1EJ6A 4CTKA 4AYXA 1RMQA 1EFLA 1MO5A 3JQBC 1N6PA 3BH7A 4YFYA 5BW4A 4ER6A 3HKDA 4Q1CA 1HDCA 3CZRA 2OCYC 2E4XA 4R2XA 5DNDA 5H02A 4MQ4A 5JWHA 1OA1A 1K97A 5MN4A 3WV4A 2WWXA 2ZYHA 3E61A 5E4YA 4B8YA 3H7IA 1SCQA 4K46A 4EB6B 4GOMD 3GJRA 3VDRA 3B9RA 1OBFO 2FMTA 2ZUEA 1T9GS 2AN9A 2ZPUA 4KRFA 3RBXA 3K70C 2QRLA 3CF2A 3G0GA 4FFLA 3W0LB 3WDKA 2JGMA 2R7MA 3KZOA 1ZD1A 1XF1A 3GEMA 1AMNA 3P0IA 3ICQB 2GLTA 1KI7A 3WQSB 4HH1A 1XDBA 2BC9A 2R00A 4X7RA 2GMWA 1X7DA 3MHPA 3V32A 3DGEC 4F97A 1UMDB 4X6LA 5C34B 5A03A 4GZLA 3FGZA 3ED5A 3D3WB 3EXIA 3R3YA 4G5SA 2RHLA 5CG2A 4ZVLA 4PLZA 1TJNA 3RYIA 1ECPA 4TSFD 3DKIA 2KW5A 4I50F 2CXRA 1L7XA 1NLZA 1SUDA 4JBGA 4L1KA 1H8EA 1GPH1 3DPSA 3GB9A 4FS8A 2ZATA 4PNHA 4YXFA 3W6NA 4JJ7A 1AZTA 2HA2A 5ER9A 1T5IA 3VVBA 5JXIA 1V4BA 5BR7A 2FWMX 4R5MA 4MEJA 4UKDA 1U2QA 5ELMA 1JZTA 3ER8A 1VMIA 4GX0A 1GGNA 4ZT2A 5F3WB 4FYWA 5FP0A 1FUYB 1U9ZA 2F1OA 1M3SA 3COYA 3F71A 5DLEA 3OM8A 4OI0A 5LSAA 2CNDA 1AS3A 1ZI6A 1DC4A 4HDRA 2IYYA 2D2EA 1B1CA 3A9RA 1UT8A 2ZTUA 3KM0A 1E3WB 1QX3A 4MQFA 5KB3A 1TEVA 1VSTA 2IK8A 2LZ0A 4YX9A 2YXDA 4KN8A 2C98A 3C3DA 1EWTA 3CZCA 3ETHA 2H7YA 5IWCA 5KREA 2FAXA 5TQ2B 4H7EA 2XSZA 1NA5A 1SCNE 3H9CA 2I2DA 1UDAA 4P81A 4JIGA 4FMCF 4EYKA 1LBTA 4LRQA 4GOJA 1SJ9A 4TL9A 2F67A 2J3JA 3K5IA 3OKPA 3R3ZA 3BH0A 4M1KA 4RPLA 5HZKA 1RJ9B 2IEYA 1RZUA 3TUZC 1SO8A 2GPAA 4FGJA 3L6EA 3LQ4A 4D46A 2CFRA 5C7LO 3PDWA 1NNI1 1T5BA 2ON6A 3AB7A 4KR2A 3DE7X 5L95A 4QGFA 2LE0A 1TUGA 3AF3A 2C4VA 3OAAA 4PYLA 4WJZA 3R9IA 2ZLBA 4NYJQ 5J5VA 2FSSA 4C1NA 3K15A 3BG5A 1Q20A 1X39A 1J8FA 1E1QA 2LXNA 2V3WA 3FJYA 4HQLA 1Y37A 3FETA 3EC1A 4CM9A 1CUJA 1UKYA 2JIMA 2ZI5A 3S2ZA 4M87A 5JQGA 1I94B 4ALLA 4FUQA 2DPXA 4JYBA 4Y6GB 3GMSA 4R5HA 2H16A 4X85A 3HR8A 4TWRA 1HX7A 3T41A 1A0OA 2A1UB 1ZP6A 2F1RA 3RC9A 2XH8A 2IUTA 4UUOA 2P5SA 3OJLA 1NBEA 3N6RA 4G56A 3TAXA 3UFXB 1WPXA 2WPDD 4QQ8A 2HMWA 4JBXA 4IIJA 5AVZA 4Z4CA 3UATA 1JZSA 3FUVA 2QR5A 3LBIA 2J87A 3BZBA 3CFYA 3MWJA 1YQWA 3E9NA 2C54A 3N28A 4FYXA 4R84A 3OO1A 1IY1A 1KYTA 3P9PA 4L9WA 2ENWA 2DFTA 4FGKA 2PNJA 1RHQA 5I01A 2BGNA 3MWYW 3FYUB 2NUBA 1GPJA 1YHNA 2Y93A 2ZU0C 4X60A 4RQTA 1R6TA 3RYFB 2O48X 1U0GA 4OF4A 4C7VA 2Y9MB 3WWDA 5FPSA 4PWYA 1YDMA 4OBWA 2JLWA 1BU8A 1NTRA 1YC5A 1E2KA 1P75A 2VWPA 4L3VA 3SP1A 3EISA 1ZGBA 1W5SA 3NGLA 4KAJA 3GUHA 3IEPA 5IDXA 2I5PO 5D3MA 3SX0A 1L7VC 3UANA 4C76A 2R8ZA 3DBLA 2W2PA 1T9ZA 5REQA 5DBFA 5CAEA 1X1EA 4J7UA 1ESCA 2GARA 4M8LA 4UM9D 1AQYA 2XTAA 2X15A 5T6BA 2EW1A 4EBFA 4YO8A 3RS0A 5EJ9A 3K9FC 4PGGA 1N6NA 2RH5A 2KJQA 2O5EA 4OBBA 1L3CA 3TLBA 3NPMA 4XARA 2EBUA 2ZVPX 1NRIA 5JZMA 1P5ZB 1V8OA 2DTXA 3HR4A 1DG9A 3K2IA 2D1QA 3HZOA 3LX8A 4JQZA 4M9ZA 1JJAA 4Q7JB 4QGAA 4XDZA 1JKJB 4RVGA 4LHEA 3KS9A 3FPCA 3L7AA 2YWJA 3QLVC 4ZA2A 2P9ZA 3N0TA 4Y6PA 3DMTA 2O8NA 3CNLA 2FFQA 3DEKA 1DO2A 2A67A 4OI4A 4Q7KA 5K51A 1LI7A 2JL1A 4YK7A 1HH4A 4K6KA 4I55B 3RAFC 3OLWA 1EVEA 5ALLA 2EP7A 3A2MA 1JS1X 5T6MA 4LGMA 3FCAA 2LW7A 3PXEA 3THRA 2UYCA 5JS6A 2WE8A 4OIFA 2G5CA 2RG7A 3G0CA 2QU8A 4M0EA 2AG8A 4F5EA 2J7PA 1NXQA 2PYIA 4HPXB 1Z35A 3U3JA 5JZSA 4HNAB 4QOSA 2P6MA 1YR6A 1C9YA 3IAAA 2A5JA 2RK3A 4C43A 4I1OA 1EVYA 1DTWB 1UOEA 4I9FA 3S2IA 5JS8A 4JZYA 4DZZA 2OA0A 1XTPA 2Y9PB 2C8VA 2ZZKA 1YOVB 1N6HA 1YZVA 1ZU4A 2VYQA 3I4LA 1U2DC 1MZVA 3QU2A 3QUTA 1I2AA 2IYXA 4LF4B 3V4OA 1UPTA 2BM8A 3VNAA 3KKQA 1J9EA 2GD6A 4OQLA 2X2FA 5GV8A 1JEYA 4PIMA 5C46F 5TY0A 3T7TA 2IT1A 4RORA 3VYWA 3TH5A 1WD7A 3EW9A 2JIDA 4C4PA 2CYBA 1UBUS 4O1MA 1JE1A 4IIJF 5DYTA 4Z0HO 1Z6TA 2VVTA 2YN0A 3LVQE 4M22A 4UAGA 1EGQA 3L0YA 3LY9A 1E1KA 3UV3A 2H00A 1S96A 4HZGA 5DN9A 4QGSA 1ORWA 4GLJA 2I2WA 3TZ6A 4UMVA 4KDFA 4RFSB 1XC7A 4N4AA 2AN1A 4F4UA 2UV8A 4RENA 4FOLA 4J7XA 4EPVA 1W0JA 4WBSA 2CYCA 3P4YA 2AZTA 4X97A 3TIXB 1B93A 5K6TA 2YTZA 3KQVA 4HC4A 4L8WB 2QQEA 1YQXA 3WGIA 2R65A 2Z8YA 3H05A 3JZDA 2DBZA 4C0SA 2HCBA 4ROTA 2RH9B 5JAHA 4U39A 3VJLA 2DPGA 4BVHA 1YK0A 1YQDA 5DP1A 2PPLA 2BRUC 4K8RB 3VJMA 1OC4A 5I3CA 3NUQA 3NHUA 3OC6A 2V4UA 1G7TA 3A1FA 2EF1A 2PSFA 1OF1A 3CR3C 5HKLA 2Z5GA 2YXBA 2G04A 3VDXA 3FVVA 3GCZA 3I6IA 1PS8A 1KQFA 2F59A 1P2BA 3FPKA 2FMIA 3Q2OA 4HLNA 3M6XA 4F1WA 5KQGA 3WL5A 4IIGA 4QECA 5F51A 2H31A 4DIUA 3FR7A 2J5XA 4L51A 4QBGB 1T5DX 1L1EA 1OLOA 4M9UA 3RKSA 4J0FA 3RQSA 1QHEA 2G77B 1GD1O 1UK6A 3S2UA 2FJ0A 1UJ2A 2D54A 5F5NA 1XIVA 3WFIA 4I4TF 1T9BA 4QPPA 1NIJA 4N12A 5I7HA 1HG0A 3KK0A 5EHGA 3RVNA 4JI5B 3U3XA 4EG1A 1GCAA 1NIPA 1II0A 4URZR 4CT5A 2WHEA 2YWXA 4L8LA 4QUHA 3DKKA 4BBAA 4A16A 1NC1A 1LTHR 1SOAA 4I50A 4MR9B 4PWZA 5KJ1A 1M67A 1KAQA 2PUAA 1G5RA 3PJRA 3RC7A 3R1IA 1FX0B 3MWGA 4HQOA 4A0FA 2WFMA 1PR0A 3QVTA 3PWZA 1RYNA 2WPNA 3U16A 2Q9BA 1CRLA 2Z57A 2G4VA 2XDQA 1R10A 4EY3A 4ENPA 1IHXA 5A4DA 1TK9A 5BN5A 2IPXA 1FRNA 5EIHA 3SIXA 4M9CA 2MMGA 3WZ2A 1IY2A 3D7LA 4FGUA 1N25A 2C5LA 2H4ZA 4KDEA 5EJGA 2QJTA 4WKPA 1GPKA 1E9SA 1T15A 1CIJA 4RWZA 2ZDQA 1Z38A 4AT1A 4ZCRA 1D6SA 1K5PA 3GXOA 3J81k 3E53A 5CCEA 2QM7A 2QKYA 2VJLA 1M8KA 4QXPA 1S4MA 2EBHX 2AG5A 1ISSA 2R1VB 3ZY2A 1EFRD 4JBIA 1U90A 4RWEA 4GYYA 2NXWA 4D81A 3KKPA 1PL0A 2YFYA 3FDZB 1F6BA 3AVTA 1XJQA 1QHGA 2M9MA 3DPUA 1MP0A 1XCOA 2YIMA 3HB9A 3IB6A 2QB5A 3V7YA 5KHOC 2FRVA 2QU7A 2BFDA 4TLDA 4MJLA 2A1IA 5DK6A 1AKWA 3GA0A 2IHKA 1KZ6A 2B7BA 3A31A 1QDUA 3F7MA 1E2PA 3FPGA 3JQGA 4MKHA 5D8DA 5EIBD 3V48A 1ZN9A 5LYJF 3UZUA 4ZOLA 5AW7A 4X7MA 5GOTA 5HIKA 1K4MA 1Z62A 2PVPA 3T5MA 4JUBA 3KQMA 1G8HA 3DLPX 1S01A 1GUDA 2JDID 4Z9XA 4ZJPA 1E5LA 3WRYC 3IIKA 5D3QA 4RELA 1B6SA 4MYHA 5IVPA 5KX5A 3OE5A 3WHPA 2B1QA 5E3JA 1Z0IA 2X9NA 3NU1A 4TXHA 2TECE 3N0RA 4WBNF 1I5RA 1EGAA 5JSFA 1U0FA 2VDUE 2O3SA 3ZLBA 3WNZA 2RHTA 3UKOA 2FDRA 1E3IA 5FUMA 3CUYA 1P4AA 2E21A 4QTZA 1P91A 3HEAA 3TVDA 1A9PA 3GFTA 5K7SA 1FYVA 4AJKA 1WHTA 1MQ9A 4GSKA 1P7ZA 3FWNA 3GRAA 5H70A 3Q9LA 2FR1A 3OX2A 4FDLA 3REOA 4ENTA 4DC1A 5AK3A 5A5GA 1RFLA 3LT0A 3BJRA 3DBIA 3T5TA 4BGIA 4I2NA 1DXQA 3PYLA 4WBNA 5IDQA 1QS0A 2D0IA 1OI7A 2FDXA 3GNQA 4YLYA 3DDZX 1P0MA 3DEIA 3MS7A 1EWVA 4DNQA 3I32A 3D3NA 4DFDA 1QK5A 4MVJG 4YMVA 1NVMB 1VL6A 5TMBA 3ZU4A 4E15A 3OBBA 2IF2A 1PWYE 1W30A 3IT0A 1NF8A 2PN1A 1GZSA 4O6VA 1WUKS 4R2HA 3WLAA 4DYVA 1OYWA 5E8RA 2GS9A 1KFCB 4A0GA 3OZEA 2PD6A 3QYJA 1TM4E 2XVMA 1T4CB 5JY6A 4P3XA 3M9WA 1M34A 4R2KA 3ZFUA 5CNJA 4ENRA 1J5PA 1AKEA 4LOHA 4UQOA 1MB9A 4QOFA 5BVHA 1G5TA 1U0HC 3ZZNA 1NW6A 5AM3A 3PXXA 3ZU2A 2P5UA 4DJAA 1CXZA 4JSRA 1UPBA 4KEAA 1HTTA 4KRGA 3TFWA 4F84A 4G37A 1G21B 1E1LA 4QO7A 5AK0A 5BMVA 1XWWA 2JJ2A 3AR9A 4IVRA 4M86A 2WUWE 2IYFA 2P9HA 3C5HA 4KCGA 1K3UB 4DQXA 1QP7A 1QO0A 2G80A 1S5PA 3GROA 3DEJA 3C3CA 3N0WA 2FQQA 5FOXA 5TSDA 5J2UA 3KQQA 2BEKA 2R6ZA 1RQ2A 3ZWKA 3IIJA 2P4QA 4DS3A 2HLHA 1QGAA 3AOGA 3FSEA 1JHOA 1KZ4A 1ZSVA 2GN4A 2JK0A 4Y2XA 3ZE2B 4D8TA 3HNPA 5DGTA 3EFEA 1NVBA 3HLYA 2ECQA 2A1TR 3EQ8A 3FNHA 2RHWA 3KVVA 3PR3A 1J1UA 1FTQA 3OQIA 5BXQC 1SBQA 1GGHA 4EEZA 4ZALA 1F8XA 3GR6A 7AT1A 3AM3A 3STXA 1XTQA 2VPIA 2X8WA 5MGBA 1IXKA 3QKSA 1Z83A 1ODJA 4B71A 2VPQA 4UHKA 4B46A 2I67A 2B83A 1B15A 3H2HA 1O8CA 4FJ2A 1SXJD 4DCGA 5JQWA 2Q9CA 2XF2A 4NBTA 5ICSA 1IUNA 2WD7A 1H2AS 4DR6B 2UKDA 3BRWA 4EUNA 4KQIA 4LFBB 1QSGA 4TOIA 3VZQA 4MGIR 4Y9SA 2X0EA 1C7FA 3BD8A 4NMHA 4RMJA 1ORHA 2C7BA 1C14A 4GQAA 3A3YA 4QBIA 5LYJA 5TS2A 4ED9A 3TG2A 2BHLA 1GN9A 2XMBA 1XAGA 4IS3A 4AY2A 5IC4A 4ZK2A 1Q84A 3AUAA 3WIOA 1X2BA 4EG8A 5A4JA 2MYNA 3W2FA 3BBPA 3HU3A 4JQCA 4RGYA 2H7XA 4PYJA 4J07A 5K3BA 3NYIA 2BAGA 2I7XA 3MLAA 4EUKA 2KB0A 2JGNA 5G3ZA 2CB9A 1CUYA 1QIKA 4PQFA 4R6WA 4YRJA 2ZM6B 3WWEA 4AQ7A 2BONA 3DXXA 2VKTA 4YYZA 4LZAA 4KE9A 3PE3A 4DLRA 2Z4SA 3FXAA 1DVRA 3N2YA 3MT8A 1W1UA 5F21A 4N6GA 4LVCA 1P9NA 4HVAA 5FUBA 4EQZA 1D2MA 3DZGA 1H2ZA 4KU4A 3G9TA 1YASA 2FW7A 4QXMA 2ZITA 2D62A 5D85A 5BSVA 3LNTA 1MB2A 3SSNA 2I33A 4QXOA 3Q7EA 5D3KA 1NZJA 2AFHA 3G0HA 2YJGA 3RYTC 2E1PA 4M1SA 3KJHA 3PZRA 2ZIVB 1K0UA 4HQNA 4MDHA 5CW1A 5EZ5A 1AA9A 4DAOA 2XUGA 1JDJA 2HJHA 1GCGA 1QTRA 3EGCA 4BKPA 4UPEA 4UJ3A 5MN5A 2GRUA 2W00A 3E5HA 3QHQA 1U4SA 3MTIA 3JQRA 2CFIA 2CXXA 4CQJA 1UPXA 2OZVA 2G9UA 3LGSA 3NIBA 2G67A 2IUEA 3PE4A 4LGVA 4QIHA 2C84A 3CZQA 5DRTA 3ZJ4A 1KAMA 4E1BA 3COJA 2W4IA 3LC2O 2XOKD 3COSA 4R3NA 1EVQA 5C31A 1DKPA 1IM5A 2EX1A 5DU2A 2RGBA 3N2KA 3PDCA 5AMXA 3HCNA 3S2YA 4Z1MA 3TTVA 2WT8A 3JAKB 5HFJA 1N5LA 4KMOA 4AKEA 5J4KA 3RTDA 3FHTA 3CLTC 4URWR 2J67A 3SHWA 4I3FA 5HG0A 4ZRNA 1KVRA 3VU9B 3VPDA 5DW3A 3RT9A 4HWGA 1OTYA 5B7NA 4XWGA 1K7FB 2FW1A 2HU5A 1FZQA 3QFSA 2RBKA 2VSFA 3IUJA 4GP6A 4QHTA 2V8OA 4R1MA 4WQMA 5COBA 4LOAA 4YMHA 2PUBA 3DS8A 4DXDA 4L95C 2IH5A 4RIGA 1W35A 1YR7A 3HXQA 4R83A 1WB4A 2FVYA 2X4IA 3F6EX 5D1HA 5LQCA 1C50A 3WHIA 3H6KA 2HEGA 2EW2A 2VT2A 4HEA6 2QX8A 5DM0A 4QEZA 1U9JA 2BWJA 1JSCA 1MOPA 4XB2A 3U56A 3L7MA 5DXJA 4DRZA 1Z7YA 2Z6QA 2ATIA 4KR7A 3NHFA 4QRHA 2OQIA 3E84A 2VF4X 1ZJ5A 2EEZA 2MINB 5ILQA 2H2AA 4YS6A 3AG5A 5CM8B 5LZ2A 2FPWA 3OQPA 4NCBA 3H04A 3DDOA 3NLLA 2EX0A 3OZVA 5ARCA 1AUVA 2CKMA 3MTGA 3QJGA 4YDSA 4Y9UA 5HQJA 2HZ7A 2VYFA 4MRNA 2WYHA 4ALKA 4ZP1A 3R77A 3DDHA 4PPNA 1FX0A 5LIRA 3KE8A 4JC8A 1Z6YA 1KZHA 3ZHSA 4BQEA 2AXPA 2HMSA 2Q29A 3JD2A 4G5RA 3V4ZA 4IF4A 3GLVA 5E4TA 2GPJA 3ZCXA 1VJ5A 2HLDA 2W4MA 2BFWA 5LJIA 1BC5A 3BTOA 3U3DA 3OZUA 4LOKA 1WUYA 1P6UA 3DTVA 4AKGA 1X1BA 4K9KA 5AXBA 1QC5B 2GBGA 2FHPA 3KJZA 4POOA 3WP1B 4DDTA 3QLUC 5C3MA 2YXNA 2ZR7A 5IDWA 1QMGA 2O52A 4WVLA 3TINA 3QPAA 3ROPA 2YQ4A 1N2IA 2X5JO 2ETVA 2YVUA 3LYUA 1A2KC 3K0AA 1OVGA 4OJYA 1I3MA 4KLNA 1ZOSA 5K0NA 2HJ9A 4B80A 4K9PA 1M7BA 4KIWA 5F33A 5P8WA 2CMFA 3TQTA 4D82A 2GZHA 4IDEA 3DOEA 3WKCA 2NZWA 3E58A 2HA6A 3OT5A 4F5ZA 3IBSA 1LTKA 2V9PA 1X7GA 1IUKA 2NU9A 3OPYB 4Q1BA 5K8UA 3BQ9A 4IUCS 3GDWA 5IKMA 1B26A 1ECJA 1KDTA 2GNOA 1Q1AA 1QYDA 4NLLA 3BWBA 1BWRA 3GDHA 3UN1A 4MIEA 5JC1A 1Q1GA 4B7AA 4GLFA 3NNNA 2B4AA 2ZRKA 2O57A 1W4RA 1TEXA 4QOEA 1Y1LA 4L3OA 5HCUA 4ZVPA 1KU6A 2O7QA 2HLPA 3TTXA 1WV1A 5EINA 1SQGA 1JU9A 1V8BA 5JCZA 2AKYA 1BAPA 4L2IB 1W47A 4PFSA 2OR3A 5AK6A 3HG7A 4DDUA 1LS6A 5KX5B 3KEMA 3O4VA 1UQRA 3BICA 3F9RA 4N8SA 1HYBA 4O3FA 3KSBC 4YVFA 4DA0A 3AFMA 5A2QA 2BGGA 2FMUA 3CT4A 3P2IA 4F06A 5AHXA 4ABTA 1ZGGA 2ILVA 5M5BA 3I9V6 2VF7A 2I9PA 4UAJA 4MR8A 4QQNA 2V7QA 1GTMA 3E6AA 1PKXA 2ONYA 4RD4A 4EYGA 4N9QA 4F8JA 3OTGA 4BY9E 4U7PB 4BLRA 4PX3A 5JVDF 5JS7A 3IMEA 4LZWA 3U4GA 4PLVA 3D5TA 1IFXA 4OP2A 4UE2A 2O8EA 3U3KA 1KJIA 1WRBA 1NDQA 3PWSA 5BSHA 4Y9RA 5F4BA 4QYMA 3G5AA 3HZHA 4II7A 3L7OA 5CFMA 3ZFRA 3TSWA 4OQXA 3ELWA 4NI5A 5KYWB 2PGAA 4ML3A 4E4TA 3JVVA 3RI3A 4EW2A 4YONB 1JUDA 2F8LA 3GEDA 1K08A 4PQYA 2XCLA 2JFWA 4NICA 1Q15A 3VX4A 5KNBH 3PFKA 5KC8A 1HZJA 2ZJ2A 4CNBA 5B12A 1JA0A 3W4JA 5IG2A 1UMCA 5K8LA 2V0GA 4JELA 5HZGA 1NUQA 1Z5WA 1HLDA 1TQ2A 4QU0A 4RZUA 4UFPA 2VJMB 4JI2B 4BB9A 3M6AA 3N58A 4QG7A 1P7WA 4H77A 3OIVA 4ZTZB 2XWSA 4N7MA 4N3NA 4KUGA 4WK4B 5BQOA 4AY5A 5BORA 4IRMA 3AEKA 3H5OA 4MA5A 1PJ4A 5HIJA 5MF6A 1SXJC 4K6OA 3D7MA 3M6FA 5EKXA 2I3GA 4O2AF 4EUEA 4DMCA 4Y8VA 1NN3A 3L5OA 5DCWA 1H6AA 2DBVO 1YONA 2FUNB 1M8PA 2NVOA 3TFOA 3EIEA 4DEYA 3M1YA 1ODLA 1Z82A 4RUKA 3BD6A 3OQHA 3JQ8B 4YH1A 1R4NB 3LCUA 2MYPA 4F5WA 2JHCA 1KRHA 2FSUA 2BHRA 3L82B 1JEJA 2PZKA 2XCUA 2BP7B 4R3UC 3RS5A 4O5OA 5E7IA 2XTMA 4L3WA 1APBA 5EIBC 4TT3A 4MPJA 1Z15A 1LH0A 2HQOA 3GBVA 4HDKA 4YAWA 3WBFA 3WNCA 4EKEA 4B85A 5H8WA 4U2KA 4Y6QA 4KAFA 4G81A 1X7XA 3D0OA 2E4VA 1MC1A 2C88A 3CWZA 3I6ZA 1IXYA 3THXB 4O63O 3ETCA 2RD2A 1VL8A 4Q4HB 1WCYA 3DUFB 4LTDA 2OSVA 4AK9A 3HB4X 4BV8A 4D80A 4NOKA 3ZZ0A 1ETUA 1CQIB 5CG1A 2OTCA 3TK1A 1KJ9A 4D5GA 2WJYA 3AJEA 3EZ9A 4LBYA 2ESRA 4Z0TA 5KI6A 2MSDB 3HDGA 4O08A 3SHOA 3W3AH 5KJEA 1S2IA 5CFLA 2X0NA 1ZUNA 4I55F 4CQMD 2OCLA 1XZFA 1K0FA 3A26A 3A6KA 5AM5A 5IJ0B 3HADA 2OO5A 5G1NA 3U4CA 1Z9BA 1EUQA 1VBNA 2UYYA 2ZBFA 2MSNA 4J4BA 5EGNA 1UBFA 3TQIA 2HO4A 2Y66A 2WG2A 4KRYA 3VYRB 2YYSA 1BGXT 2C3YA 3MAGA 1W25A 1HNNA 3LRTA 3PGMA 4N3CA 3SYKA 1R0SA 2NACA 3MJCA 3SX2A 3IL2A 1F9AA 1UJCA 3PTAA 1PVOA 2AFVA 3JWJA 2CCKA 3NGMA 4QPNA 3WSVA 4F7DA 5MN6A 3R7NA 2QD2A 5JU6A 4MKRA 1U28A 1RQRA 4YJFB 4M0KA 5CAEB 5REQB 1YBMA 1NNUA 3PDJA 3A25A 2R4UA 2YICA 5A6SA 3RWMB 1BHJA 2XHEA 1WUTA 2BEVB 3K32A 3S81A 4MLDA 1W36C 2BGKA 4QDXA 5HKKA 2GZ1A 2JZCA 2QBYB 4XVUA 4URFA 3EZGA 4IH1A 3T0FA 3PXCX 2R11A 3UT5A 3S68A 4IFTA 4LNAA 2BE9A 1LDYA 3K6SA 2ERXA 1OXXK 5G40A 2YHIB 5FPKA 3R5FA 2M6LA 4IUYA 4W99A 4JVNA 5DISB 5EOVA 2Y0PA 4Q9IA 4URXR 3T1YB 4FGWA 5IANA 1N3YA 1LD3A 4NZMA 5JMTA 3SMVA 1N8KA 2VSOA 3DZFA 5C8YA 4ZN6A 1XEAA 3BXZA 2BFBA 2WYWA 1MB3A 2GHTA 2IUFA 1I14A 1LK7A 5J40A 2BVNA 3SNHA 1D7AA 3JATA 3VVLA 2J0UA 3EQ7A 3OIFA 3V2GA 3LT5A 1TQ4A 2IYEA 3EXAA 1GTJ1 2ZRIA 2VKQA 4WL0A 1R5NA 1WJGA 4UD6A 1B6RA 1EEXB 2W71A 4UEQA 2C94A 5EZYF 1YCDA 5SY4A 5KVCA 1WMBA 1KHHA 4BEWA 4WFJA 3PNLA 4KL8S 4UVDA 2C2OA 1FVFA 2XUOA 3STYA 3WGYA 1EDZA 3SHQA 5EMLA 1EFUA 1C4XA 1NUAA 1TAHA 4Q1EA 3QNMA 4CIYA 1J8VA 2JIQA 3N05A 4HG2A 2PTHA 2WJIA 4XM2A 5CM9C 1QS0B 4KPFC 4B6RA 1V11A 2FG5A 4EEXA 4RSHA 2WLTA 3BJIC 2LUOA 3D8BA 4KR0A 1P18A 3ZX4A 2HNAA 3CGGA 3ZU6A 2GPSA 4QPZA 4X90A 1KJZA 3GWGA 4EA6A 4I08A 2E6KA 2NO1A 3G88A 4Q4HA 1ADGA 5KWSA 4M9SA 2TRSB 2BR3A 4CR6A 1THZA 2O6LA 1J2UA 4K6FA 4BLUA 3DZBA 3V1NA 1NJ8A 3H2GA 4ZZ2A 2WTAA 4S24A 3K5PA 1U0SY 4CDGA 5I7UA 2PT6A 2FP4A 1U0RA 3IJEB 3U7JA 4DWJA 5L8VA 3WK7A 1T0BA 5IARA 5A7GA 2P77A 3E3LA 4BWFB 3RSLA 3SS8A 4ZOLF 4QHSA 1XTZA 4DQKA 2BDTA 4EECA 1VI5A 1SXQA 4HZUA 1P8AA 2XMDA 3PNMA 2F3SA 1F14A 4IQFA 4LRWA 4LVOA 4BYMA 4RANA 2I4LA 3FSGA 3DVSX 1JLSA 2PBRA 2WRZA 3LCRA 3O3MB 5HUHA 3HA2A 3F3KA 1A8PA 2RGUA 4TTIA 3VJKA 1THMA 2ZI6A 1M1ZA 2R5NA 3OFSA 2IS1A 4LS3A 5B2ZA 1QKKA 3Q5DA 3ABZA 3L4EA 1AGXA 4QODA 1NJ1A 5FKJA 3UPTA 8AT1A 1ZHHA 3GJ0A 1GQOA 4K9MA 4I8IA 3MLEA 4A1OA 3RUHA 4QYIA 5G0VA 3PJFA 2J09A 5CB6A 2HHJA 4OYYA 1A7JA 1T2UA 1EJBA 2J9FA 3UAZA 4DLKA 4AF6A 5BWBA 5CIYA 3AVXA 3OM1A 3NIGB 4JA2A 2C1XA 2ZBVA 3FYUC 4DL9A 5ED4A 2YDXA 3DAYA 3ZDCA 2L69A 2ZYGA 1V43A 5KZMB 4D98A 4KFSA 2ZCVA 2HF9A 3E9DA 3RYIB 2YKGA 4BMXA 1IBRA 2OHXA 4IG4A 4DLXA 4C08A 2KBEA 2R00C 2RGGA 1E9RA 3HV2A 4MJXA 4OQNA 3RUDA 3SF8A 4F6LA 3DV0A 1YIOA 4KR3A 3GJXC 3WOVA 1ZRNA 3P9XA 3AK4A 4ARUA 2V54A 2PKCA 1J24A 4K9SA 3IP8A 3TO5A 4ETIA 5ITVA 3DFKA 3BM5A 3IS3A 3D1JA 2WAAA 3ZWYA 1PFUA 4GKKB 2QMEA 1SHUX 3F90A 3TVTA 2NVUA 4FD2A 2O2JA 1FS6A 1KE1A 3OJWA 2BGUA 1Z33A 2N42A 3FFTA 3SSAA 4REQB 3RYHA 1X8KA 1UXHA 2R96A 1WSDA 3DLTA 3EVZA 4RK6A 3RFUA 5JTTA 3WB9A 5BN5B 1V5FA 4Y3UA 3ON5A 4J75A 4MWSA 1ZUWA 1EUDB 1JHAA 1TJ4A 2ERYA 2R751 3MTAA 1KPGA 3PNBA 1Q1NA 1A8QA 1J7KA 3R3WA 4X1KB 3TYXA 1PJBA 3PNSA 3A58B 4EY7A 4DV5B 4E5YA 1SC9A 3PEVA 5A4MS 4ZYLA 3PI6A 4NDAA 3SQOA 1ZGZA 3FMGA 1HDGO 4W63A 3WDLA 3W06A 3WMRA 1T2FA 1G3RA 4D6XA 2HREA 2P2YA 2UU9B 4YYEA 2AMYA 3A6ZA 4EB0A 3VR3D 1NQTA 7ABPA 3K31A 5JATA 5AVSA 1RRGA 3HEMA 1VE6A 1DIRA 2ZSBA 4LK3A 3ROFA 5C7OO 4QNNA 1Y1SA 3UIEA 3GFOA 1Y7PA 4HLDA 4UM9B 3NAQA 1JJIA 3WBJA 3E22A 3L8GA 1R15A 3HUMA 1TFUA 3A0RB 1YUNA 2R7AA 2EV9A 4MAMA 1G3UA 2H4JA 3HM2A 1W85A 4ZT3A 1NYQA 1JEQA 3TI9A 5CD1A 2CMHA 2BMWA 4PQEA 4U5QA 4GBMA 2VWGA 3KVRA 4BO2A 5IK2D 4DBVO 1XCJA 4DLVA 5BMVF 1LPMA 4I81A 3NT5A 1PAUA 1VMAA 1GUFA 2HXYA 2DCUA 2WUFA 3HUEA 1N2BA 5KSPA 2YS7A 4V02A 3H2BA 1PR5A 3E0QA 4YDQA 1OLUA 1Y5RA 4LF5B 5JNWA 2W43A 1P1HA 2PANA 3L6OO 3RSSA 1TPYA 1MJGA 5DK4A 1S6YA 3N2LA 3PQ2A 4MV8A 4L78A 2VQFB 5JAQA 3SD7A 5L3QB 2CLMB 2NXJA 1YRLA 1ZMXA 2W70A 1W59A 4N5IX 4D96A 5ITSA 1EIWA 4H2DA 4DDWA 2J08A 4G4JA 4KI0A 2WHYA 1ODSA 1GR0A 4J1TC 2FEXA 5ERYA 1FW8A 5DWVA 3CBGA 4YHHB 2Q0SA 5KOYA 1H1LB 3UYLA 2CV1A 1YMUA 3OLVA 4K0KB 2ZWPA 4KVFA 2BTQA 5AKGA 4BQFA 1PFWA 3FOFC 1GGKA 1IQUA 4M0PA 1I5EA 3Q4GA 4DQ0A 3T7SA 1P5FA 4TVBA 4V1CB 1PV4A 1D9XA 3ICVA 2VPPA 4F3NA 3G9UA 2CVOA 4U9UA 2QD3A 1YACA 4FDTA 2D3TA 2WU8A 1CUUA 3CVJA 2C3MA 3QRWA 2C1ZA 4ONEA 1J0CA 1YJAA 3EXEB 2J4DA 3K70D 1IJBA 3INNA 4B7ZA 2Q4RA 5KOIA 3AGPA 2GXSA 5CA0B 1QWSA 4OQFA 1LQUA 3A7DA 3GT0A 1KY3A 5FWYA 1PWZA 5I47A 4FKBA 3EGDA 2HV9A 2OM6A 1RYZA 3VJRA 5JNUA 2FRDA 3M6WA 4MLZA 3WJ1A 2O2SA 3A28A 1BO6A 2IXGA 1CRZA 2PBZA 4MKIA 1E64A 5H80A 3AIIA 2CZCA 3E2MA 3ROEA 4Z1MD 1W52X 2WYVA 2OL4A 4PO3X 2H51A 1SD5A 3B60A 5JSYA 1YL6A 4XPZA 3AFGA 2EJVA 2PH7A 4ND3A 4Z3OA 1DFHA 1GZDA 4G23A 4D4MA 8ABPA 2JIBA 3G8AA 2JI6A 3NHWA 1HXHA 4KAAA 2Y0EA 2BGMA 2V3VA 3BULA 5GZ6A 1J7JA 3DSRA 3NAMA 4J94A 3IMFA 1NVTA 4QWMA 3E3OA 2JVIA 3RARA 3OCWA 2Z8XA 1DRJA 4RK5A 4XDGA 2R0QC 4G0MA 3IT2A 2CLKB 2YS6A 1HPLA 3DC7A 1UBLS 1SD1A 1PQPA 3K35A 3PUYA 1RT9A 1VHDA 3IDSA 1ADJA 2Y68A 3X43A 1HT1E 4PCLA 4B75A 2PR7A 4W7IA 2WWHA 4FBLA 5JHHB 4Q82A 1OB2A 2ZAIA 3EAQA 3G0OA 4C7KA 1MEJA 3K9GA 3PK0A 3VKGA 2VPXA 3AVYA 1XD8A 3WR5A 2D06A 3ONDA 4K6GA 1II8B 4BJ3A 5JH7A 4FCVA 3F67A 1NV9A 3PFGA 3OPYA 4XPIB 3P2MA 2NU9B 5ARDA 2XRFA 3BA1A 5LYYA 9ATCA 2WKWA 5CK4A 5L3RA 1PJSA 1XJ0A 4N49A 5JAOA 2JH8A 4F98A 3KKOA 5FB3A 4U0JA 1RYDA 1M2VA 2FUG6 4RC9A 1KA9H 4RFSA 2AI1A 2R8OA 3QFRA 5K3DA 3T5DA 3VVMA 4C07A 2QP4A 4E22A 1FFAA 4YY3B 1R4ZA 1DKQA 1BKSB 2JGDA 3J7TA 5BQ5A 4Q1DA 5IU6A 1L5RA 2QR3A 5A4FS 3QLVA 4HV4A 1G2IA 2CLOB 3CXUA 4JJZA 3L18A 5DN6A 3HKCA 4C9BA 1Z6ZA 4FW9A 2JJ8A 3G5UA 3O92A 5J58A 2UUPA 4HNQA 4TMZA 4UNRA 1NWCA 3HYRA 2NZYA 3GCXA 4DCCA 3U7FB 4WZAE 3RODA 2IEAA 2W58A 3IP3A 1R0LA 3SBOA 3IXQA 4OKIA 3BAZA 5AI5A 4BBPA 4EZBA 1GPLA 2P6PA 4LNUA 4O4JF 1MB4A 4ND7A 4BO7A 1M6HA 2GBFA 4DPMA 1NVAA 3IVRA 2WJVA 3ZZMA 1WEKA 5LR6A 3JYOA 2DUJA 4LMRA 5FHRA 1PVVA 1EDBA 1UBGA 4NP6A 2P75A 3KTFA 3NPAA 4NULA 1KMNA 4EQ6B 2QTTA 5HHTA 1JPVA 3NUZA 4DLNA 3HKEB 2YV5A 4RVNA 2LTAA 4IR7A 2P68A 1R8JA 1DBWA 2ZUBA 4DF3A 3OJXA 3T3DA 3BGVA 4CHGA 2QQ5A 2I7TA 1K4YA 3DL4A 5D01A 1K1EA 2O2ZA 5FHQA 1XLTA 2ZBEA 5G02A 1DKRA 3TCNA 3TW4A 2QVGA 3ESDA 1MF7A 5AJVB 3WNQA 2ZKIA 2OD2A 3EUEA 5EIFA 3CUTA 3KB6A 4CLXA 1PI3A 2AFHB 3AX6A 2YJNA 4FD3A 3QWIA 2P9FA 4H9KA 3KUKA 2FCAA 3FSRA 4FR2A 4YCMA 3SIWA 4AJ9A 4I46A 4NCXA 4ND4A 2QTCA 4TTTS 3CVUA 2II6A 3K09C 5KAMA 1LF5A 2I6SA 3KEFA 3AEKB 3CONA 4GX1A 5CJ2A 1JBKA 1NL3A 2GRJA 3G7NA 2FF7A 1I8TA 3HXLA 3CF4A 1QIDA 3M4JA 1KAHA 2C2GA 2BI8A 5BQPA 5JCXA 2C3UA 1JTVA 1ULUA 2YOFA 3RNOA 5J4HA 3EMDA 4KRXA 5LBUA 4FHCA 2G07A 4F2DA 3IR5A 1U1DA 3KQUA 1TAGA 3K6SB 1TCUA 2O2CA 2KX7A 1HE5A 1AGPA 2AEEA 4W5NA 1FW6A 3NM5A 2QZ4A 1G38A 4JIMA 2H3EA 4QBHA 1EA5A 1NUUA 1XRRA 2HFJA 2XB9A 4BE7B 4E1AA 2G88A 1YS7A 2FX2A 3THWB 1S2OA 3GIDA 1J8MF 1KORA 4EA9A 4RIHA 5KQMA 1C8LA 2PGDA 3SX4A 4K1LA 4PY2A 2JAXA 3IDZA 1M9NA 3WV5A 2OHVA 1BQEA 3MJSA 2H1WA 3AETA 3NX4A 2IU0A 4OHUA 4QFBA 4XASA 4E94A 2ANBA 4MQFB 5CXSA 4EG4A 4CIXA 1G0OA 1QMPA 1DIBA 2FZCA 5AI0A 1R6AA 3QELB 4G07A 2VH5R 3A9VA 1YS1X 5KUTA 4UM8B 1HL3A 1COWD 2RI1A 3H86A 5JVDA 3LO5A 4CFZA 1DO8A 2UZIR 1NC3A 4WA7A 4E03A 1EAYA 1QBKC 1JR3A 1CP2A 1QV6A 2ODBA 4MUGA 4Q3BA 3AW9A 1L7EA 4D41A 3HABA 4N5MA 1P31A 3M89A 1P5HA 4PO8A 1MVNA 2R62A 4O2LA 5HCIA 1FX1A 4BNDA 3OQNA 1RLTA 2A1TS 2WWYA 1EVZA 4C7MA 1NRWA 3HCBA 4GDFA 3RG8A 1IZ0A 1M8FA 1PK7A 2PS1A 2VYND 5KDDA 1SU6A 2JEZA 2VDLB 3KR0A 1H85A 2IY7A 5HDQA 3P8ZA 4YPVA 4ZZIA 5CFRA 1PFQA 3LUJA 1V35A 4R1UA 4HNGA 4HAZA 4Q66C 5DCLA 3G3EA 2DLNA 1K9SA 4JC5A 1OXSC 2NNWB 4U7DA 1GFZA 1S9DA 2LCIA 4E5MA 3C97A 1IMOA 2R8XA 3R7BA 1XMXA 2X4DA 3AKDA 3KKEA 3IRVA 1VIMA 1DBVO 4BFXA 4MV6A 3NI2A 4FQ7A 1JEDA 4JWKA 1MW8X 2RARA 1HYGA 3FN4A 4MW0A 3A6JA 3RG2A 5K8IA 2D7JA 1GY8A 1M8GA 2P8JA 2PZJA 5FH9A 1XZPA 2J0VA 1NZFA 1YJCA 1PX2A 5CK5A 1W85B 1OI4A 4KWIA 4PC7A 1L9XA 2Q3HA 3DONA 1JILA 4LJ7A 3AQIA 3LHFA 3C6YA 3EBPA 3G9ZA 4FBMA 4YRQA 1GZ6A 5HQ3B 4YECA 3Q5EA 4EATA 4WZ6A 3CLUD 4K40A 1DADA 2ZJ5A 2A5DA 4UMEA 3WLIA 2CKDA 2BFFB 4H6VA 1H5NA 3KELA 5CCBA 3GT4A 5CNIA 5DM60 4N6OA 2Q3MA 1Z25A 1UODA 2B5VA 4G4SP 3A1WA 4BZPA 3ZE6A 3VKHA 2GSWA 3MYRA 1T34A 4J0KA 3RFCA 2CLCX 2IPMA 3RT7A 4B4OA 2CLHB 1V8PA 2VHTA 4M1OA 3OAAD 1RKVA 1U5AA 2CW5A 2RI6A 3D02A 4XIFA 3NBKA 1U6KA 2C2WA 3A6DA 4UE3S 3ZV3A 3D3JA 2C5HA 4GR5A 1CK4A 2J4FA 2HPVA 3ELUA 3MYYA 1TM7E 4ARCA 3HXOA 3E1SA 1NBOA 4G6ZA 4BO8A 2J0SA 2V6MA 2AHOA 3QE3A 4W7SA 2R48A 3M1LA 4ARAA 5K0ZA 3WDMA 3SQWA 4HZIA 4B43A 1WF3A 2M1XA 1Y3IA 2C1EA 1F0NA 3A37A 1XL0A 1PFYA 1RQNA 4RTLA 1NF3A 1RPAA 2FWAA 5I4KA 1Q0UA 2WHXA 2ZWMA 3LWBA 4ZVUA 4BZQA 1HDIA 1RHRA 4W9MC 1WHSA 2C5SA 4TPKA 2AFHE 5FWYB 4ER0A 3N2ZB 4CL0A 1W19A 3BD9A 2WR8A 2NT4A 2GCOA 2IOHA 4IXTA 4JOCA 2A5YB 5D7NA 1Y1RA 1QIGA 1QYCA 2V7VA 3NAGA 2PSSA 1CRWG 2GAAA 2XW6A 2ZJ3A 4P80A 1QGUA 1X7WB 5EZYA 1ZH6A 1YS2X 3LPNA 5SZJA 1Z7GA 1Z7BA 1HLFA 3M4XA 2NYRA 4OYLA 4TV9B 4YMTA 3AR4A 4D3DA 4M83A 1QPZA 1ZK2A 4JJAA 3C0KA 1IEQA 2FPUA 4FNGA 4QFMA 3CLHA 2BJVA 2AR9A 1F2VA 3D0QA 2GHIA 4HNHA 4U6SA 5F73A 2Q5FA 1G4HA 1R18A 4CNQA 1N2CA 3CW8X 2CNLA 2EKQA 1GSAA 1W6UA 1AURA 1ZW1A 2DUWA 2FW6A 5ALGA 3VSCA 4XW2A 1RC1A 2H0QA 3K9BA 4MYCA 3ORSA 1XO1A 3HXTA 4YRKA 4CTJA 2WE7A 3U09A 1I4EB 3TD2A 2PL1A 3H13A 1CLEA 2YJZA 3GDOA 1QGOA 1R6XA 1H9AA 5T5QA 4R0MA 2GILA 4QYIB 1GGVA 3MJEA 2YV4A 3C8ZA 3EVCA 4KOAA 2P6NA 4MV4A 3QHAA 1JIIA 1WIWA 3V7FA 1ZG3A 4I36A 3GZJA 5J2TF 1WB9A 1BGVA 3E3NA 1JFVA 3WB0A 3AP3A 4BE9A 4JB8A 2AYYA 1G8YA 3PXAA 1ECGA 1BWQA 4GOKA 4JGBA 1CY2A 1U9IC 3F6YA 2QPAA 4L4SA 5DX1A 4CYMA 1ARZA 4D4KA 3CUWA 5FOTA 2HU7A 5IJWA 3DAGA 1VPVA 3VPGA 3LFTA 1IY9A 3MMXA 5L3ZA 4AWXA 4NCJA 2E89A 3B6MA 5CVEA 4CJXA 4LWOA 13PKA 3R2JA 4G4GA 4NEHB 4OQMA 2PS9A 2CY0A 2I2XB 5EJAA 3TW0A 2IQIA 3SS9X 3ZNNA 4ERNA 1CYEA 4QPDA 3VNBA 1KIFA 3LYLA 1ZGJA 1SCIA 3JASB 3V8QA 2BYTA 3CCCA 2ZXEA 3J80A 1CR6A 2WSBA 1F2DA 2GRAA 2J8ZA 1CUHA 3U9SA 1UAAA 1W2HA 5CFOA 4LCJA 1IPFA 1ZAKA 4Q01A 2Z58A 5AO9A 3O26A 3SR0A 2ES4A 4OXKA 5AYVA 1P9LA 1QRDA 4RD0A 2L42A 4M46A 5D87A 3QBTA 3L2OB 1A9TA 4LC9A 4NYMR 1KO5A 1ZBDA 3KUDA 2VQEB 3I9JA 2EATA 4NHEA 2D8MA 1JECA 3MW8A 2HYIC 4Q7LA 3JAMA 1N57A 1VIDA 2YV3A 3FZQA 5FNVA 2WVGA 5FD8A 3GO4A 1UM8A 4AY6A 2AW3A 2XCIA 2E55A 4F2GA 4TZTA 1GKYA 2R87A 4M99A 2QNIA 5A6SB 5K0EA 4BCDA 3BRWD 5ADVA 4G97A 1KY2A 3BE8A 4E2ZA 2ZBDA 3KT6A 4CI0B 4B7XA 4RBNA 3OCJA 2J31A 3MMSA 4Z4QA 1PNRA 3CBQA 4U6QA 3DE2X 2LV8A 3FKSA 3OUUA 1AM4D 3BMQB 4FTWA 4QREA 4YFVA 5JT1A 1ZEMA 1JEQB 3VM6A 2O3TA 3PQCA 5B7GA 4O4HA 3ADBA 2BDUA 3IAXA 4KQHA 5ICEA 4QO8A 5JI3E 1RU3A 1FJGB 2EFHB 2MSWA 5KTOA 1G98A 1XQ6A 1W2GA 4E2FA 1OMOA 5FTNA 3ZKAA 2HIMA 3R3XA 4HAWA 5K6RA 4AYTA 1GTRA 4GUAA 1BQ3A 1TO1E 3FDIA 3IHKA 1WW3A 5B1YA 5ITZA 4BFSA 5FNZA 1Q0RA 5ENVA 3KLOA 1GZ4A 3K6JA 4G67A 3TOCA 3K1TA 4QM7A 4WWHA 1EK2A 2NXNA 4TTSA 4LUCA 5GM1A 4I4CA 2WVJA 5TPWB 2Z09A 1DKLA 1ANKA 1FK8A 1H6CA 1NFFA 1U1GA 1UPFA 5KYGA 2BTQB 4LYJA 4I6GA 4W5QA 3AR6A 1NR1A 4U2DA 5B4TA 2A58A 3E4DA 1TJPB 4IJ5A 5DM1A 3W2EA 1Q7TA 1FLDA 1E5TA 1N2SA 2BUBA 3OOSA 4EF6A 1EFTA 1L4YA 1GG5A 1LSJA 3F6RA 3CUVA 3E8XA 3PB3A 2ZG6A 4JOQA 4ZPJA 3UG7A 4ZJUA 5C51B 4DG8A 4FUTA 2G0AA 3NG1A 2KYRA 1I4OA 2H65A 5LQRA 3ER6A 3PEFA 2QTNA 1E89A 2IXAA 2MJLA 2V6BA 2WTNA 3ULKA 4DZTA 2OZLA 3VC3A 1OH8A 2B92A 3BF8A 3GPBA 3CRQA 3VU0A 1Z2DA 2P9GA 2W42A 2IP1A 4C30A 4DCSA 2XITA 3QE2A 1O9HA 4YASA 2ZJ4A 4IGAA 3NRCA 3QPCA 4PX9A 3VSEA 3P2JA 1QU3A 1L4EA 2PWAA 4H7HA 3VHQA 4D9EA 4K2HA 4BFUA 2I7CA 3OQMA 1QR2A 1GPUA 1SUAA 2NVBA 1OC2A 2EBFX 4IHJF 1U0OC 3WWPA 1NUSA 4B4KA 1HNZB 3FRJA 1HFWA 4PNEA 5F23A 2ZUFA 2G0NA 2IDJA 5DGXA 2ZB7A 3A6HA 3NEJA 3HWX1 1PYOA 1UKAA 4V0NA 1WZEA 4PYKA 1CIPA 3A10A 3ENVA 3HZRA 1NSFA 3WTBA 1LDBA 2ZCJA 2QX6A 1RQPA 4NJOA