4YV2A

Crystal structure of trypanosoma cruzi spermidine synthase in complex with 2-phenyl-1,2-thiazol-3(2h)-one
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
290
structure length
278
Chain Sequence
ELISGGWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Spermidine synthase, putative
publication title Structural insights into the novel inhibition mechanism of Trypanosoma cruzi spermidine synthase
pubmed doi rcsb
source organism Trypanosoma cruzi (strain cl brener)
total genus 90
structure length 278
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 4yv2A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4yv2A02
4PYMA 1RJFA 3EEOA 3ER9A 5HIJA 4DMGA 5DRTA 2ZWAA 5C9ZA 4YV2A 2NP6A 1RI5A 2FK7A 3DMGA 1VPTA 3G8BA 3ORHA 4QPNA 3RODA 3FZGA 2C7RA 4OQDA 3BWYA 3HNRA 3T7RA 3FTDA 4GOMD 2WA1A 2Y1XA 3LHDA 4ZTBA 3KQVA 1YZ3A 5GM2A 1WXXA 1O54A 2YTZA 3U81A 2IDKA 3GDHA 5JR3A 2AOUA 5U4XA 2PJDA 3ELDA 4RVDA 2OO3A 1VE3A 1R74A 2ZLBA 3GRZA 5LQKA 5K0EA 1XCJA 5FCDA 4RX1A 5K0NA 4GC5A 5HILA 1F3LA 4AZWA 5C0OE 4CTJA 2PXCA 3KPVA 3LDUA 1XDUA 3FPHA 1D2GA 3OU2A 5FADA 5KQRA 1ORIA 4HSGA 1M0EA 3UA4A 5IKMA 3MTIA 4C03A 3PFHA 3AXSA 3G2MA 3BWMA 3P2KA 4QVKA 1DCTA 3BZBA 5HIKA 1EAMA 3HCEA 3G5LA 1RI4A 2YR0A 3UWPA 3FUXA 3G7UA 1SQFA 5GIPE 1R6AA 4M38A 5K03A 2A14A 5DTRA 2QYOA 2BH2A 1WXWA 3R24A 4G56A 3GJYA 1X19A 3HCAA 2IH4A 2XBMA 1QANA 5FWAA 1ZGJA 1WZNA 3BKXA 4BY9E 2AS0A 2NYUA 3SSOA 1NKVA 5EVJA 3KR0A 1XTPA 2OBFA 4LECA 5FA8A 3UZUA 4PIMA 4HGYA 2BR4A 4BLWA 3NDIA 5DM0A 4KRGA 4WVLA 1XVAA 4PYNA 4E2XA 3EVFA 3GIWA 1MJFA 3R6TA 2BR5A 3HCCA 5D1NA 5B1SA 2PBFA 3FTCA 3MCZA 4DZRA 4OX9Y 5HEKA 1VLMA 4Y30A 3HA3A 3KQMA 5F2OA 1FP2A 5CIYA 3KPWA 3DLIA 1NV9A 4LWPA 4C06A 5KQSA 3BGVA 4RTKA 1VBFA 4QTUB 1IY9A 1VIDA 3P8ZA 4EQZA 1NV8A 3ER8A 1JG1A 1WS6A 3JWIA 2XVAA 3TR6A 2JH9A 4AX8A 3FPJA 2PKWA 3FRIA 2HWKA 5DSTA 3ELUA 1KXZA 5GINE 2I6GA 4F84A 3EVCA 1ORHA 4H0NA 5LQRA 5K0BA 2I7CA 2QM3A 2KW5A 1FBNA 2PV0A 5FA5A 3MAGA 3VC1A 3DTNA 3KQPA 3LL7A 4ER6A 5EMKA 4LG1A 1O9GA 2FHPA 1N7IA 2YQZA 4M7RA 5DT2A 5EEHA 2PGXA 3MCTA 4PNEA 5LQCA 4V0RA 1U2ZA 1KYZA 4M36A 5DLYA 2B3TA 1KIAA 2G71A 1NE2A 3A27A 3BKWA 4QTTB 5EHGA 1D2HA 3MB5A 2HMYB 5DM1A 3GRYA 2B9EA 2H1RA 1JSZA 2EG5A 4QDJA 4EMSA 1KPGA 5E1DA 5DWQA 4EK9A 2VS1A 4HRAA 3S68A 1NBIA 2I62A 3PFGA 4FT4A 2OZVA 1IM8A 3KQYA 3E23A 5ICCA 4MQ4A 3DXXA 1SUSA 4RTPA 2XYQA 4U7TB 1I1NA 3AWIA 2YXLA 4BP3A 1PRYA 5K05A 2O57A 4QPPA 1YZHA 2Q41A 3E7PA 1YB2A 4X60A 1ZHFA 2B2CA 5CVJA 5E2AA 3LKZA 3IHTA 4KDRA 4PGGA 5CVEA 5K0CA 5DX0A 3OE4A 1DUSA 3O7WA 1L9KA 4KDCA 4YUXA 5CUQA 3GRRA 3FYDA 1RI2A 4OA8A 5FHRA 3CVOA 1VP3A 2OB1A 3KQSA 3A7EA 2IH2A 4C05A 3KQTA 4HC4A 3KHKA 1FJXA 1NBHA 4PYQA 3EVDA 5K0LA 3DMFA 4FGZA 5EKUA 3SGLA 3DOUA 1WG8A 3HEMA 5LQNA 1G55A 2BR3A 1RJDA 2R6ZA 2Y1WA 1KHHA 3KKZA 4IKPA 3PX2A 2HV9A 3VYWA 4R6WA 3B7PA 2ZBQA 3C3PA 3HCBA 2WA2A 3DUWA 3RIEA 4UOEA 5KYGA 1EJ6A 4MIKA 3OZRA 1R8XA 4RTLA 2PWPA 1ZG3A 3CJQA 3D2LA 3NWBA 2NXEA 3GWZA 2R3SA 4RYLA 3SXJA 1G60A 3DR5A 3FYCA 3GRVA 3M4XA 5DM2A 2ZBRA 2IBTA 2YXEA 2ZZNA 4GEKA 4RTNA 5FUBA 3BWBA 4HTFA 3RW9A 4AZSA 2GB4A 4GOND 2JG3A 1Q0SA 2DULA 2ONYA 5EC8A 5GP1A 1QAMA 2PT9A 3EMDA 3THRA 3C6KA 3T7SA 3WSTA 2FPOA 3G5TA 1NW8A 2AN3A 1EJ0A 1I4WA 1O9HA 2FCAA 2P41A 2PVCA 1TW2A 2QRVB 4CWAA 3HVJA 1VQ1A 5EKXA 4E33A 3IV6A 3EGVA 3UA3A 4YMGA 3LECA 4HTFB 4FSXA 2IFTA 1PJZA 1RI3A 2G1PA 5E1MA 3MHTA 1T43A 3NW9A 2ZBPA 2G70A 1JSXA 3CC8A 4M37A 1QAOA 5C1IA 4YUWA 4XUCA 3FPGA 4HG2A 3I5UA 4V0QA 5K0JA 2IH5A 1X1DA 2IP2A 5DTQA 3MGGA 2YVLA 5CVUA 3THSA 3UJAA 3FRHA 2OPBA 4KVZA 1MHTA 3KPUA 5EZSA 1R18A 1KPHA 2AOUB 4P7KA 1FP1D 5LSAA 4DA4A 5GOZA 3TFWA 3BWCA 2IPXA 4OBXA 2YX1A 2IBSA 1XCLA 2ZCJA 2PLWA 1HNNA 4RV9A 2I9KA 3C6MA 3L8DA 7MHTA 3V8VA 2JHCA 3REOA 3K0BA 3T7TA 2ZULA 3BT7A 2JHPA 3I53A 4KW7A 5G02A 2IDJA 3DP7A 3DXYA 3DXZA 5EGSA 2PX5A 3GU3A 3R3HA 4RVHA 4WXHA 2GS9A 3DMHA 4A6DA 4C08A 1D2CA 3M6UA 4EKGA 3M6WA 2NXCA 1OR8A 2NXNA 5FULA 4RVFA 3C3YA 1EG2A 3AJDA 1VL5A 3JWHA 1BKYA 3G2QA 2G72A 5DPMA 1KR5A 3EPPA 3CKKA 4PINA 4PYKA 3UJBA 4R8RA 3KQWA 1P39A 4P7GA 5T67A 2GPYA 3ELWA 3EVZA 5EQJB 5BW4A 2PXAA 3KR9A 2AOWA 4YV1A 4ER5A 2H11A 3X0DA 4FS8A 1BC5A 4EVIA 2JH8A 9MHTA 3GRUA 1FPQA 5D1HA 2PWYA 5E8JA 4BLVA 4RWZA 4C04A 3OCJA 1R00A 1JTFA 5BXYA 3BXOA 3ELYA 3F4KA 4ER7A 4RTQA 4YMHA 2PT6A 3FUUA 3PT9A 4FSDA 1B42A 4U7PB 3MERA 5LQUA 2C7OA 1JR4A 1P1CA 4PYLA 4XCXA 3B3GA 3O31A 2NNWB 4Z2YA 1EQAA 3CJTA 4R6XA 3OPNA 4PCAA 1RI1A 3DLCA 4DQ0A 3PVCA 5DXAA 4GOOD 2ZZMA 3LKDA 3UBTA 2O06A 4AUKA 2VZ9A 2QY6A 5CVVA 3B3JA 3KR1A 3LBYA 1KPIA 2P1DA 3MQ2A 5CD1A 1Q0TA 1AF7A 3LGAA 1QZZA 2VDVE 2ZWVA 3B89A 3GCZA 5E8RA 5F2NA 1L3BA 3G2OA 4PONA 5ERGB 5T6BA 2PSSA 1VP9A 3CCFA 3HVIA 3BUSA 3LBFA 3KR2A 4ATNA 4PYJA 5CCXA 4QQNA 1AQJA 2FYTA 4RTMA 2OXTA 2N47A 2P3QA 2VP3A 5HFJA 4F85A 4LWOA 4MTLA 4P7FA 1L3IA 3CGGA 4E2ZA 2P3LA 2ADMA 2ERCA 3NDJA 2NXJA 2ZIGA 2AOTA 2DPMA 3G88A 5EHIA 5EIWA 3AY0A 5KVAA 1NW6A 3GGDA 1DL5A 4PWYA 5HOQA 1M6YA 4E2WA 3KQOA 4X63A 2CWWA 3NVKI 4O29A 4AZVA 5K0GA 1AQIA 2ZIEA 1P1BA 2H00A 3EVAA 2BM9A 2VDWA 3UFBA 3HVKA 1BHJA 4XUEA 3KPYA 1UWVA 1N2XA 3FUWA 4KWCA 1JQ3A 3UJ6A 3LSTA 2ZZKA 2ZTHA 2B25A 4BP1A 3FUTA 3OU6A 3OZSA 3OFJA 3VSEA 3P9IA 2EJTA 3G8AA 3LCCA 5ICEA 3JWJA 4GC9A 4FT2A 1JG2A 5DRYA 1SUIA 3UJ8A 5P8WA 2GH1A 2AZTA 1TW3A 4GOLD 3QV2A 2AOVA 4ER0A 1SG9A 3A25A 4PCLA 3DH0A 3V97A 2WK1A 1YFLA 2GAFA 3CBGA 4DCMA 4A6EA 2ZFUA 4CTKA 3DULA 2QE6A 1RJGA 2O07A 1TPYA 2BZGA 4L7VA 4CKEA 2PX8A 3IEIA 2AR0A 3LCVB 3UJ9A 4YV0A 1L3CA 4DF3A 3SR4A 1IXKA 1KP9A 2GA9A 1G8AA 1Y8CA 2HNKA 4MWZA 2JHAA 3H2BA 1RJEA 3QOWA 4PYIA 4RTRA 3LCUA 1H1DA 3E8SA 3NVMB 2AN5A 3I9FA 2PX4A 5E9QA 5HIMA 3TKAA 1V39A 3B5IA 5K0FA 4IV0A 4GBED 3T0IA 3K6RA 1INLA 1UFKA 4YUVA 5EMMA 3GXOA 5HIIA 4RTOA 2ZIFA 4P58A 5E1OA 2PY6A 3EGEA 3M33A 3OE5A 3P71T 5DX8A 5E9JA 2CMHA 4EKIA 2UYCA 4CXMA 4HGZA 2C7PA 3GNLA 3GO4A 3A4TA 4X61A 4OBWA 1NT2A 4DCGA 3LDFA 5DSXA 3NMUF 4RVGA 3ANXA 2UYOA 4PYOA 2B78A 2G8NA 5MHTA 1N7JA 3P97A 3HCFA 1G6Q1 1QYRA 4F86A 2C7QA 3PS9A 5FQNA 4PIPA 5EEGA 4XUDA 4KIGA 1SKMA 1UIRA 1JG4A 2CKDA 3BGIA 4FR0A 1JTEA 2BM8A 3SVZA 3ME5A 1ZQ9A 4NECA 3HA7A 2P3OA 4ER3A 5BP7A 5K01A 5EMLA 2P8JA 4P7JA 3NJRA 4E31A 2YUIA 3EVBA 5CVDA 5FQOA 3LX6A 3A7DA 3UJDA 2XYRA 3P2EA 1WY7A 4E70A 2IIPA 2Z6AA 2E5WA 2AOXA 4R8SA 3P9NA 5DM4A 3NWEA 3LPMA 3TKYA 4IV8A 2O0LA 3TM5A 4BLUA 3SM3A 1P91A 5JUWA 3KU1A 5LR6A 3BGDA 5EPEA 3M6XA 1G38A 2Z6UA 3UJCA 3IYLW 2V7EA 2P7IA 1X1BA 4OA5A 3TMAA 3HP7A 4ISCA 3HA5A 3UJ7A 5GWXA 3G2PA 3TPZA 3B3FA 2OB2A 3P9CA 4FP9A 2OY0A 1XXLA 4X1OA 3FTFA 3OFKA 4CKBA 3FPEA 8MHTA 3ID6C 3P2IA 3SX0A 5T64A 5F2KA 4GQBA 2XVMA 2PXXA 3SMQA 4B17A 4E2YA 1QAQA 2FK8A 2ZW9A 1XJ5A 5GIOE 4PGHA 3OU7A 2P40A 4RTJA 1X1AA 3A26A 3KPJA 5LQJA 2OYRA 3PX3A 5IH3A 3HM2A 5E2BA 1L1EA 4DM3A 5K8VA 3SSNA 2FRXA 2GLUA 1ZKDA 4AZTA 2ONZA 10MHA 4JXJA 2Z6QA 1JQEA 5DXJA 2AVDA 1BOOA 2NP7A 4YUZA 2F8LA 2P7HA 1HMYA 4GF5A 5CM2Z 2AVNA 1Z3CA 5H02A 4R05A 4E32A 2YXDA 4QDKA 4C4AA 1EIZA 4RSRA 4QVGA 2O05A 3HCDA 4HH4A 2JJQA 3PTAA 4IWNA 4MHTA 3HVHA 3FPFA 5HZMA 3E05A 1YF3A 3R9XB 4Y2HA 1ZGAA 5EOVA 3I58A 1SVUA 3EEYA 3P9KA 5DX1A 2P35A 4E30A 1F38A 3SSMA 5GM1A 3PLAE 4YUYA 1X1CA 4KIFA 5ICGA 3ERCA 3PB3A 4FZVA 5EZQA 3CJRA 1SQGA 3EMBA 2UZ4A 3VC2A 1NW5A 2ZSUA 3TRKA 2PX2A 2EJUA 2HR1A 3C0KA 3JWGA 3EGIA 2AOTB 2AN4A 1JG3A 5EMJA 3TQSA 5CCBA 3Q7EA 5FTWA 2UYHA 4OQEA 4X41A 5DTMA 2ORED 3NTVA 5M5BA 3G89A 3TM4A 3MTEA 1M6EX 1NW3A 2EX4A 2OKCA 3HTXA 3M6VA 1XDZA 1G8SA 1I9GA 1KYWA 3KQQA 5FWDA 3TLJA 4DKJA 2V74B 3R0QA 5ICFA 2LD4A 3TOSA 1NW7A 4POOA 3I64A 3O4FA 3EVEA 1R8YA 2EFJA 3LDGA 3M70A 5FHQA 1YFJA 5E9WA 4CKCA 2ESRA 3FTEA 1AV6A 5LQAA 3EVGA 2ZVJA 2XYVA 3FUVA 3OZTA 4GUAA 2CL5A 4C07A 1XDSA 4QQKA 1JQDA 2CMGA 5E1BA 1YUBA 2K4MA 3Q87B 2HTEA 2QRVA 2VDUE 3QOXA 5EIFA 5BW5A 5K09A 5KS2A 4RTSA 2IGTA 4K6MA 5EG5A 3AXTA 2UYQA
chains in the Genus database with same CATH superfamily
5ALYA 4RH0A 4AF8A 3AI1A 3I9JA 2VHVA 4XWOA 1BXRB 2G06A 5GVSA 5DRTA 1FSFA 1KZHA 5KQPA 1ZO8A 3PFNA 3QUAA 2Q2NA 1H2XA 4PAMA 4ZQGA 3BWYA 2A9KA 2FLWA 1W4RA 3H5WA 5L4LA 5J2UA 2VVTA 3R7FA 1GU0A 3WLIA 4MQFA 3NM6B 1FFSA 2BWJA 1MAUA 2COKA 3U81A 2C0QA 2Y2VA 3Q41A 5JR3A 4FZ5A 2Z4RA 4U3JA 4A26A 2WOJA 2VT7A 2OO3A 4RVDA 4AK9A 4DCUA 2ZLBA 4UUNA 2F1HA 5C5IA 1GN9A 4JI0B 2Z4TA 3LUJA 4M1YA 3D8HA 1EM6A 3R3ZA 1PR1A 1Z15A 2WT9A 2XDQA 4P3NA 2B1GA 4TM7A 2QDXA 4TSFA 5I4KA 3ANNA 1IOWA 1MHPA 3AXSA 3HB0A 2FEMA 2PLRA 2C8JA 2H18A 3BWMA 1LK0A 3EIQA 3ETJA 3H4TA 4R1QA 5LZ9A 1A9SA 1QO0A 3G5LA 4UARA 3OBBA 2QGFA 1SEVA 4HVTA 1SC6A 3QLUC 1MG0A 1RAFA 1XDDA 2A14A 4TX1A 3VO9A 5CDUA 4TUYF 2CF6A 3D5TA 1L5OA 2AS0A 1Z0ZA 2ZE6A 4KIUA 4CR7A 1ZVQA 4XVCA 2FMIA 4CTJA 5BMOA 4XIIA 3LS2A 5DYNA 1PNVA 3PNQA 1GTSA 4I08A 3NDIA 4INPA 4TTRA 2BFCA 3SLKA 3LPCA 3TLAA 2X19A 1ODIA 5GZ6A 1U5CA 3FTCA 4OB7A 4TTTS 4BNVA 4MUKA 1HNZB 1YS2X 2C07A 1NTOA 4H16A 4Y2GA 5JJIA 3G5AA 1OZHA 1ZK4A 3SYRA 1ISFA 3VYVA 1O2DA 2DWQA 2C8KA 3ICCA 3BTUA 2WAMA 3LWZA 4QTUB 3FWHA 2FPWA 1G6KA 5BUCA 1Z4QA 4JIMA 3R5SA 2AJBA 2H5EA 3ITKA 1FZQA 1VFNA 3FPJA 2CD9A 2OCLA 2QU7A 3THYB 1G9SA 4XUGB 2XAUA 1R10A 1OTXA 2NADA 4CDRA 4YRCA 3ANTA 3BMNA 1J06A 5K0BA 2WG1A 1P44A 2ZJBA 4QPDA 2BTQA 4DV6B 2XAAA 1W9MA 1U0LA 1LW6E 5C31A 4QDOA 1MR3F 4LG1A 1N9ZA 4JI1B 2ZUSA 2FSVC 3GJ6A 1XZKA 3I04A 3U7JA 3C1AA 1ESDA 4DDHA 1NJ6A 3PHIA 2B3TA 4NEQA 4DCSA 3C3AA 3P4XA 4QXMA 4INZA 4COOA 1XP5A 2EWWA 2GYWA 2WG2A 1SXJA 3AJEA 4MR7B 4G1UC 4I5DA 5EXXA 4HNTA 1ZH8A 1DUIA 1PS9A 1RWQA 2PLAA 2RB4A 4W5QA 1SOAA 3RS7A 3DBIA 1NBIA 1KSFX 1UMDA 1W85B 3QFHA 3ZCSA 2C1EA 2OCGA 4HLNA 4KUGA 1CBUA 1XROA 1DMSA 2OZVA 1QRTA 4WCVA 4EVRA 2VJCA 3IUNA 1L8AA 2HLPA 1GT91 1NBEA 1V4VA 3CGWA 1TJYA 3N2IA 5K05A 1T4CA 4FMCF 4GHWA 3RUEA 3ZHBA 1RYYA 2WC1A 1RBYA 1U1EA 3A31A 3FNIA 3SAJA 1OFTA 2AIRA 4UREA 2AKYA 2DUWA 4NE7A 4RKEA 5FPSA 2IPNA 4U00A 2ZXEA 4YUXA 3LF1A 4U0JA 4N39A 2QN6A 1M2HA 3GBSA 3UVEA 2WZDA 3CVOA 4LJ7A 4KO2S 3L1HA 3KQSA 1MA3A 5DNDA 1P9OA 2R1VB 3QLVC 3ESQA 2FFHA 5I5EA 2CE2X 4RVOA 5DHFA 1TF7A 4GZ3A 1ODKA 1XKTA 2J3QA 4WOCA 4UUBA 2C5LA 2EZTA 1S01A 1ZWKA 2ZB3A 4RY0A 4PX2A 4X1KA 3TE6A 2REQA 4W99A 1GUBA 3DZJA 2Q1SA 3TZEA 3AEQB 1DBRA 3JYPA 4Q01A 4FQ7A 4G84A 3WFZA 1JR3A 4JROA 1XYVA 1A9RA 2PSHA 3D2LA 3NM5A 3NWBA 5FTKA 2QLJA 3UUFA 2YV1A 2V7WA 2WWXA 3RTAA 3JPWA 2WM3A 2H7YA 5IMSA 3RSGA 2JFVA 2RIRA 1JPVA 3A1NA 2XB6A 4HNVA 1DO2A 3DFMA 5JAPA 4MO2A 1YAHA 3I28A 5BYJA 1JZSA 4DIFA 3OWOA 5C8DA 2HN9A 4ZRNA 1FQOA 3ASYA 3N2ZB 4MV4A 3T7SA 5TS2A 1H8HD 2VK8A 3HSKA 4CWAA 1P6QA 3DKVA 5ESDA 3WKAA 1RWVA 2OAQ1 2RH5A 1DC4A 1WUIS 1OMOA 1IJBA 2GBPA 2G1PA 3A6LA 4X97A 5E2IA 1T43A 3BK1A 1YZKA 4LE0A 4JYMA 2AI2A 3IP1A 2FPPB 3LUBA 3KXIA 3E5NA 5C8YB 2JZNA 2EAUA 1QAOA 3HKCA 1TVKA 1ZUHA 5GQSA 3CWCA 3A3NA 3O8BA 3TXAA 1A9ZA 3ZI4A 3L9XA 4YCJA 5KTSA 4NQZA 1Q15A 1N6LA 4FIDA 3KYCA 4LXUA 4NCXA 5FPQA 2J3IA 1E2DA 1DP4A 2ZROA 4QFMA 1VKNA 3DL0A 1K3UB 4XR9A 1FUIA 1AUOA 2BDUA 2QTWB 2YN2A 3PIRA 1TM3E 3PJGA 3BPSA 3L79A 2Z43A 5GOZA 6GPBA 1A9YA 3BWCA 2YY7A 2II6A 3EIOA 4RBNA 1J22A 4HTAA 4GZ5A 4PGAA 1ZL0A 2OV6A 4J2TA 3OQVA 3FYUA 2VPTA 4O4LF 2WT8A 4J9VA 4S3MA 3ROQA 4DYHA 1UXGA 4A27A 2NZXA 1B73A 1MO4A 4EGSA 5JCOC 7ADHA 2EF0A 4IFBA 4XD7D 5CHEA 3BT7A 5HPYB 2F1JA 4AZ0B 1UZAA 3ITNA 4F91B 1IBMB 5AOVA 2VSNA 4G4JA 5AXAA 4MGYR 3R3HA 1JI3A 2AKAB 2FPKA 4E5SA 3TSCA 4DUYB 5EIOA 3B9RA 4GQIA 1TOAA 4EDHA 4ZAGA 3QJGA 1E69A 1FOEB 3VMMA 1QG2A 1OR8A 2YHUA 4QTXA 5FORA 4MJ3A 1XTRA 2VOJA 4CMIA 4W5OA 1L7MA 2HK6A 5A7GA 3OKPA 1S7GA 4C6RA 5AI0A 3UJBA 2OLKA 2CLEB 4ZPXA 3SZUA 3LKVA 4UQLA 4AY6A 3ELWA 3C5VA 3GFBA 1T8TA 2Q5LA 2ZS7A 1ZD5A 4GX0A 2WNHA 4LMPA 4Y2XA 2CL7X 4DE5A 1FPQA 2IK8A 4OHOA 2HSDA 5E8JA 4BLVA 4A8PA 3HB9A 1PK7A 2FPIB 1U3FA 3H9UA 3PHJA 2ZJ0A 1LEHA 2PYDA 3IBYA 1RLOA 2YYSA 1SVOA 3DYBA 5BSKA 4R54A 3IPLA 1M2OA 1BE6A 3U62A 1SO8A 4Q66C 1RM5A 3ZU5A 3EPJA 4N41A 3CBQA 4XCXA 2QLNA 4JI2B 2ZDQA 3SN6A 2DFTA 5CM9C 2G82A 5KDLA 1WZ2A 1ADCA 2CZGA 2PH5A 2PUVA 4QXRA 5DK6A 3BCUA 1UUFA 1Z2DA 2VZ9A 3OWXA 1BU8A 2I1VB 1XU9A 1PNTA 4DLSA 1OASA 2XGGA 1OTHA 1PJ2A 4GR4A 5D3MB 2C3OA 2BBTA 4BO9A 3LLVA 1EMDA 1E6LA 3FCCA 3CUUA 3F5FA 3G49A 2IZ1A 3PQ3A 4AUEA 4KAAA 3AWDA 1GKIA 5ERGB 4YR7A 1M1NB 3AF5A 2TYSB 3KZ1E 3B38A 3UB3A 3UWDA 4ZI7F 3HVIA 2R97A 7AT1A 3UB4A 5FBZA 3ZQ4A 2K5UA 5AKXA 4HV4A 5HA5A 1KEEA 1I2BA 1I2CA 4WA7A 3IB3A 4KIJA 1IN7A 3GFTA 4RTMA 5EZYF 2I0FA 3WMFA 4J6FA 5IPFA 1QDUA 2XEDA 5ELLA 5DJ5A 1U65A 1UDBA 4IM7A 3WHIA 2RCYA 1ILEA 3T3GA 4ARUA 1MO5A 2ERCA 3KV3O 4O02B 3FJYA 5EHIA 1E9VA 4F9TA 1ZH2A 1XNJA 3DVRX 4JC4A 3KKPA 2OBXA 4NE9A 3LT2A 2B8NA 5HQ3A 2NV0A 2IY9A 3O8CA 3NVKI 3B53X 3FTPA 2ZJ7A 3ZQUA 1SD5A 4B83A 2MIIA 2VPXA 4FU0A 3DOFA 4BMOB 2OYCA 5FPKA 5L3SA 2VDWA 3ANMA 1BHJA 4DRYA 1PJSA 2C8LA 3ASVA 3KTFA 5A0TA 1RXSA 1J0BA 1XQ6A 2CLIB 2VSYA 2WKSA 4RCYA 3ZU4A 4BATA 3K9CA 3PNMA 1X7WB 1R0XA 4CUKA 1N2SA 2C58A 4B8WA 4Z4GA 3VKUA 1P5JA 4E5MA 1CUCA 1NVKA 3K15A 3MN1A 4M46A 4Y6QA 3NBAA 2XUAA 5HTKA 3WL8A 2WM8A 3ZC3A 3RC8A 2AEEA 2OL4A 1KF0A 2PIAA 3HKEB 4RXUA 1TW3A 3L7YA 3DDSA 5SYAA 3N2KA 3RK1A 2R6JA 4YT4A 3R3VA 3ZHCA 5J4YA 2RHHA 3P9XA 4KCGA 4K8OA 2P1RA 1KSHA 3JQPA 3MT0A 2ZFUA 3UW3A 1CEQA 3QBVA 2VWQA 3TLGA 3MT7A 2V5AA 1KFEB 5HM6A 1P7VA 2DXIA 5BN3B 1J4AA 1R9NA 1R8SA 3NVMB 4ODIA 3IXMA 1FFXB 2AG1A 2YYYA 3T4UA 4IH1A 5DYGA 1I01A 1V5WA 3VU1A 5AW8A 3U7GA 2OCAA 4G5XA 1FW8A 4LRXA 2DY1A 3B5EA 3G9QA 4FN5A 5E9JA 1N6OA 5AW1A 4FBGA 3T3IA 4EM6A 1E1LA 2X6QA 3A4TA 4ZQHA 1CUEA 2XEXA 2P9EA 1X7HA 2A0YA 3SJUA 4BEVA 4YLYA 1G4UR 1F7UA 4E22A 1SKBA 2N75A 3DCJA 4M0FA 3VX4A 4C7BA 3ZWPA 2R79A 5IHPA 1PNQA 1Z4PX 2VAXA 2PIDA 4EI7A 1QRRA 4HDOB 1FBTA 3CT4A 3D7MA 2CV1A 4HN9A 1IM2A 5DMXA 2HK9A 4GR5A 4KITB 4F72A 1UIRA 2CKDA 3MPUA 4HNSA 1L4UA 1S9HA 4J4BA 4L9WA 4QLBA 1T2AA 2QAGA 4AJPA 3LUDA 3G2JA 1JHDA 2BF4A 3IBSA 1U0BB 1OVGA 1O96A 4AKSA 1WV0A 3M9WA 4CIBA 4G5RA 5F98A 3A7DA 4E7PA 1HWYA 4LCEA 4ZU3A 1F48A 5ESWA 4Z3DA 2W8BA 3HR4A 1THZA 1AXGA 3VVMA 1MJGM 1U0HC 3BVPA 3RU9A 4B87A 2CXUA 5JXJA 1A2QA 4JBNA 1CW2B 3M49A 5GGXA 4J4TA 4B7AA 1RXIA 3FPKA 1N2IA 1VPEA 2P7IA 2OFXA 4J3JA 4ISCA 2PZMA 1LLCA 1V5FA 4ZZ1A 4DDVA 2QLBA 3A9UA 2G0NA 2FOIA 3IVRA 2YFHA 5CJJA 4AY4A 3ZXXA 4DWVA 3CVJA 2PQ0A 3TH5A 2HK8A 4TL9A 1AIPA 4UUMA 4CT0A 2ZVPX 4WKCA 4X66B 4B17A 2EW8A 1KFCB 3I76A 3LT5A 3DAGA 3I39X 1XJ5A 2AK3A 4OM7A 5DIZA 3UKOA 1E3IA 3ZTWA 3PEYA 1REQB 1P1HA 5EY5B 3FCOA 1LI7A 1VYVA 4GYJA 5A4MS 1T9HA 1PBTA 3SHQA 4QUKA 3IQXA 3TUIC 2MU1A 3HPQA 3ZVRA 4UASA 1ZW6A 2KYRA 3K72B 3HVUA 1A50B 1XCBA 2IUTA 4ZKEA 3PLRA 4TSFD 3WHKA 1UWCA 3C3BA 3MPOA 2VH2A 2H1LA 1T2EA 2NP7A 1RIFA 2AC7A 2BEWA 2VDRB 2F17A 4CN9A 1ZN8A 3UK7A 1UK6A 4Z9FA 1XJQA 4LTDA 5I48A 3VTAA 2YXDA 4GNRA 4C7OB 1EFLA 3KZNA 4F4DA 3QITA 4D9JA 2FDXA 3FCAA 3FYTA 3IFSA 4MVYA 1PFWA 2JJQA 1RYEA 3JQ6A 4O3FA 4WGFA 4GDFA 4PSUA 1UK9A 3E05A 4U5XA 3URKA 4DQDA 4Y2HA 5LU8A 3IOMA 2NUAA 1MXFA 2UVQA 5DHQA 2VR1A 3I58A 5FBQB 1T2FA 3L8YA 2CZQA 4PS0A 2X0FA 4PS1A 1DG3A 3K4HA 3SDBA 2RK4A 4FC6A 1UDWA 4OO3A 1YKSA 3F96A 5FI3A 4ERNA 4KQGA 1NJSA 4I4TB 2UUCB 4L3VA 4QJIA 1NP7A 3QZUA 3TIGA 1ODSA 2RH9B 3KFVA 2JIRA 5IZCA 2B6NA 4FJ0A 2EQ5A 4JNKA 5ETJA 1F9EA 3ZBPA 4BWVA 3W6NA 1DC5A 5KYXB 1WPXA 2GAJA 3MEQA 4N8SA 2F67A 4U63A 4JBHA 3UJ3X 1V7PC 4PV7A 1S6YA 4CMEA 3GMTA 5AO9A 1JG3A 1POXA 4U4AA 1SCJA 3Q7EA 3I5MA 1WEHA 4X41A 4K9LA 1EI9A 1KI4A 4PSVA 3TEJA 1M6EX 2NYRA 2P4UA 4WDQA 1VYUA 5LP6A 3HL0A 4CKWA 1PWXA 4IDGA 4JUAA 3TG2A 2XVXA 4QYMA 4X54A 1MUUA 3KO8A 2PKEA 3FHOA 4K9NA 4RFLA 5L7YA 4AYXA 1UKEA 3OJFA 5F76A 2C78A 4POOA 1ZRNA 3M70A 3LDGA 3UEOA 5UKDA 4Z9YA 1V11A 2DPHA 2XYGA 1KRHA 4B3RB 1EG7A 2ZYRA 1GUYA 3OZTA 3NPMA 1XDSA 4HN4B 3NGMA 4JK3A 3GLFB 3OUTA 3FDIA 3PEVA 4ZIRA 5J2TA 3L9WA 1SXJD 2HTEA 3UGTA 2ZSAA 2UXDB 3TBHA 3TBKA 3TINA 5EG5A 4ZQIA 2CHGA 4QT4A 4BNZA 1C4OA 1MOPA 2XE8A 5KOJB 1KS2A 3DDUA 3S29A 4XM0A 1RJFA 1N2CA 1ISIA 2GJKA 2XYHA 3GMSA 4NBVA 3ER9A 3QEAZ 1DCTA 3CF4G 2GN9A 3L0DA 1KTVA 4G9BA 1HDGO 1LZLA 4WCFB 1SK9A 2H31A 4ND3A 3LUAA 4H6WA 3HNRA 3FZEA 3FTDA 4GOMD 4X91A 2Y1XA 1TVMA 4OIFA 1FDTA 1E3WB 5H70A 3WMWA 3WWOA 1KIFA 4RZHA 3P7MA 1WXXA 1O54A 1CDEA 4YP1A 4NBRA 4AZ3B 1JGTA 4WE3A 2FSSA 4IUCS 1DFGA 1Z68A 1KU6A 1VE3A 5JECA 5KSYA 3UN1A 1SB9A 1KH2A 2WR8A 4MQ6A 3FZQA 4H9GA 2VC2B 2O3SA 4U7FA 1UEIA 4WZBE 2WFZA 3WLAA 3DHNA 3UHOA 5LD2C 3EIWA 2VSOA 1ORTA 3G2IA 3NG1A 3PGA1 5J58A 4AB1A 4MYHA 2FGKA 4HOYA 2Y6VA 1Z6AA 4XLTA 1PVOA 2G9UA 3V1KA 3JW8A 4D9HA 1U3GA 4ETIA 3ZFUA 1B6GA 1P8AA 2NGRA 5LYJA 1JR3D 1WB9A 5JALA 4LN1A 1C8LA 1Y9AA 4PG5A 1GZDA 1WU8A 2VF5X 3KXPA 4P31A 3EDMA 1IXSB 1P31A 1T5SA 3PHCA 4M0CA 5EE1A 1J0AA 3T3HA 4HH1A 2AN9A 1YULA 5JW6A 4KQXA 2JDID 4C0AC 1QONA 1QLWA 4KKVA 2EDCA 1YACA 3HCOA 3WK4A 3KC2A 4DANA 3UNXA 2ERYA 2IRWA 5I7SA 4DGSA 4HRVA 2OHJA 1LJUA 4HUQB 1YR2A 1SBTA 1ECPA 1RC0A 3OZWA 1J5PA 3FX2A 3SKYA 1TK3A 4HB0A 4ZRMA 2P4QA 3ZGLA 4LE1A 2VCYA 1CUJA 5H59A 3N58A 4KE6A 5D5HA 3LM8A 2NV2B 1J0CA 4JYCA 2HWKA 1L4HA 3GAMA 3INNA 2I6GA 4EG4A 1NR7A 4XWKA 1UANA 4MJXA 1OW3B 2VSXA 4XVRA 2OVBA 2YJ3A 3R3XA 1U2EA 4KIWA 4KNVA 1RADA 2ZJFA 4KO3S 4NG5A 4R40A 4Q39A 3OTOB 1G6HA 3DTNA 1FFGA 3IQWA 1P73A 1PR3A 1Z3IX 2VJQA 2FPXA 3OT5A 4UVIA 3SIXA 4ALLA 2PPLA 4JB0A 4ZU1X 1ZM4A 4PNEA 4A5OA 5FKJA 3TX2A 2Z04A 3QBEA 1Z63A 3IAM6 2O59A 1WBJB 3NTOA 2RG1A 2E5FA 5KSPA 1TMKA 4B4VA 4DFDA 1I8TA 5MDHA 1NYRA 4EY5A 3HB4X 2IS6A 1Q1EA 4FNOA 3TECE 1RYBA 2OD9A 4EHHA 4H77A 3LX8A 5A62A 4EUKA 4C0HA 4V0LA 3ANSA 4Q15A 2JVKA 4O2AB 3DXXA 1SUSA 3VR2A 4C4TA 1Z62A 2V7GA 4J0DA 3MW8A 4TSKA 4D2IA 4CJXA 4B32A 1C3OA 2AYZA 4XA8A 2K6GA 2WQZA 2ZP1A 3DFFA 3O1IC 3PKZA 3QEOA 4QPPA 4LGYA 1P29A 4A0GA 1RNLA 5A0FA 5BWMA 4F9GA 1FDOA 3Q5EA 5C2JB 5CAEA 2V9ZA 1M0SA 3Q8LA 1L9KA 5JXGA 1H4QA 5HKLA 3K8OE 3RTGA 1VJGA 2CFOA 1TFRA 5KKCA 3U7EB 3FLMA 3RANA 3O93A 3OF3A 3DBOB 5ILQA 3ZKWA 2B4TO 2PCJA 5EKUA 2CXXA 4LY9A 3SC3A 4A0QA 3RYCA 3EZNA 4XPZA 2OK7A 2VUHB 2YBDA 3PC2A 4B46A 2HV9A 3OWHA 3SE0A 2ZBQA 4RD4A 4CIYA 1QLJA 2WA2A 4HB4A 2JFNA 1YJCA 3IAM1 2B7LA 2Q7OE 2C31A 2ZT6A 4AJOA 2PWPA 3IODA 4YRGA 5I4CA 4KPYA 3KKQA 1GPMA 1Q1AA 1K06A 1FDVA 3GRVA 1G1MA 4G5FA 2V0GA 3JQFA 1KGDA 4UUOA 5AXDA 4BV8A 2QTVA 2J41A 3ADKA 3EXEB 4KOEC 1GCOA 2IBTA 3VFDA 5JAIA 4RPHA 4D98A 4GBMA 4RSHA 3J80A 3IDSA 3THRA 3GFFA 3ZVNA 3PEWA 4HUTA 2HWXA 4DBLC 2WWVD 2W2TA 1JFLA 2DFLA 5CEFA 3ZLJA 4TVKA 1MC8A 1QHHA 1GCAA 2Q4OA 1U2SA 2XRMA 3GXBA 4LI3X 4QOSA 4CQJA 3EG9A 3KT6A 2CVOA 2DT8A 4LZNA 1II8B 1V1RB 1PGNA 2W6OA 4DJ5X 1KVSA 2PS3A 2ZBPA 4F3NA 1IEXA 1LFDB 3QIAA 1V8BA 4NPHA 4IXWA 4R5HA 2DUNA 1QFYA 2FZ4A 1KO7A 1ZIYA 2DFKB 2JIZD 3NVAA 3KWLA 4GQAA 4X44A 3TW6A 1MORA 1AZSC 5HBGA 3VVBA 4TYYA 3GWGA 2JCYA 3ISJA 3MGGA 4ZVRA 1Q2UA 1U9IA 1QGED 3C70A 1M8FA 3LC2O 1G8YA 1L5MA 3IT2A 2JBHA 4AJKA 4CI0B 4ZOAA 1G16A 3ZXIA 2NO5A 4P7KA 1IFXA 1JALA 1QF9A 2ZQYA 1GZ5A 1FP1D 3MINA 4E2FA 1Y89A 3HFGA 1OBCA 3O2SB 4QOIA 4BMSA 1JHVA 1GL9B 4IRMA 1Z7BA 3JVVA 4S1TA 2ZUDA 2C1ZA 3W5VA 2IBSA 4NU6A 2ZS9A 3C16C 4ICIA 1T4BA 2WWTA 3EXFB 1Y34E 2YV2A 1P61B 1FMLA 2JFPA 2X3YA 2YOFA 1BXKA 1ENZA 1BCRB 3I1IA 1OYVA 4HEHA 4PF1A 5FPTA 3T4EA 4CT4B 2YZMA 3TQTA 3EXG1 4CHGA 1JDTA 3I6BA 4EHKA 2WHYA 1QKIA 5EJMA 4X62B 2W9XA 3PFCA 1N8SA 2VHWA 5E3HA 2L82A 2FQYA 1HZZA 2LNDA 1NURA 1DINA 4OKIA 5EERA 4ZCMA 1WHSA 2E2WA 4J16C 1TU4A 5CIQA 5IC6A 1QK4A 1U5BA 2NXNA 4Y0NA 4CLXA 4P1ZA 3EJWA 4Y9SA 4YP9A 4E6PA 5IKOA 2GM9A 1V35A 2QTRA 3IHLA 4X64B 4PYKA 5AQEA 2EC5A 9ATCA 1XTQA 3GVHA 4RPLA 3GCDA 4YCAA 4CCYB 1E89A 4FPXA 2WSMA 2Y2UA 3GLHB 4CM4B 1LQTA 1WZIA 4XEHA 4PLYA 2OZLB 4MUMA 5G0UA 2O8DA 4AMUA 3ELYA 3F4KA 4I7EA 5KIAA 1BEZA 1NUAA 4TMTA 4YMHA 1N9GA 4DT1A 3EUEA 1X8XA 1CFJA 2JCGA 1YQXA 4PCAA 1KDVA 3PI6A 4JJAA 1HYEA 4PM4A 4TT8A 5G4KA 1BS1A 1KI9A 1XLUA 4KQ6A 4PAQA 4GRIA 1NT4A 1MZVA 2CFTA 1ZUNA 4DLUA 5CA1F 3SF0A 2Z1NA 3DKKA 3U37A 4H1VA 5J2UF 2AK2A 1HEIA 1Q0TA 1Z75A 5D5QA 4QGSA 3DZDA 2BW0A 2OFWA 4RD6A 1EUDB 2GRUA 4N7RA 3U56A 4XDZA 4RELA 3KB2A 4IDNA 4MS3B 1A96A 4YGXB 1WU7A 2QY9A 1ZJZA 1PN3A 2CUZA 3ZR4B 4PYJA 2RGUA 5C18A 2ZSKA 3K4QA 2FKNA 1Y1LA 5DGXA 3GEHA 1V8PA 3T35A 1ZD2P 1W36C 4LWOA 4MWDA 1ZXLA 3D6HA 3EQ6A 3IOCA 4QGAA 3U4AA 3TLYA 4BO6A 1M2VB 4HYQA 1YB4A 3VI4B 4RWEA 4DR3B 1F2TA 3H8VA 4KHPB 1RPTA 4NICA 5EIWA 3BJRA 2ZWMA 3N75A 1XJWA 1YHZA 3RG8A 3RRZA 5JD5A 1SCQA 2ORYA 3FBGA 2J6HA 1S5PA 4BTLA 1XQWA 3FWZA 3ZIDA 4L5IA 3E3MA 3DO5A 3IGFA 1I0ZA 3QKRB 1SRQA 2P5YA 1OH8A 3GNSA 5ALXA 4M2LA 5EMHA 1CRZA 4RY8A 4C4XA 5IVHA 1UR5A 2QN8A 1TXGA 4XPIA 4M8KA 4O4HB 1HKUA 1AX9A 4TUYB 2ZZKA 1RHJA 4D8WA 4B0OA 4C4SA 1MTOA 5BSRA 5BQPA 4XX1A 2A3RA 4MV9A 1Q7CA 1SKYE 2ROQA 2W4MA 4IOJA 3VSEA 3C3KA 4NV0A 3LCCA 1VHWA 4EENA 4Z4HA 4K9OA 2RAPA 3W5JA 1M2WA 2VAWA 3FVQA 3H04A 1EP3B 3FOZA 4C3ZA 2AEFA 3VPFA 2WUEA 5C1PA 4NMHA 2EJCA 5B37A 1BS9A 3Q9SA 6NULA 1PZFA 4M9SA 3HO6A 4KXQA 2HRRA 4W82A 4YAOA 5AJZA 3Q7SA 2J0VA 1WL8A 2R84A 3HADA 5L3QB 5JH7A 4J7AA 1SQ5A 3HO1A 3TD2A 3K73O 2Z3ZA 2ZRMA 3P96A 3A2NA 3ZJ5A 2XMBA 1GYQA 1KFKB 1H5NA 4HUJA 1INLA 4MLCA 4DSUA 5BMVB 1YB1A 2GZSA 2FN8A 1VC2A 1ZH4A 3OE5A 3SQOA 5DIFA 2P9CA 3CLTD 5LOVA 1VI2A 3CLKA 3MJFA 2JJ2A 3DDOA 3UKJA 3HFSA 3IB6A 1Z38A 5DW0A 4DAEA 3ET5A 3QFRA 3TVYA 1U6JA 3PQ8A 1XD2A 3BCHA 5EMNA 1XQXA 3K70B 1GRRA 2G8NA 5J5CA 1QP7A 4E2WA 4ZVPA 4EW3A 5BVHA 1IULA 4MV5A 2FVXA 3E27A 4BZWA 1KOFA 4F8EA 3ZHZA 1DSSG 5EINA 2H2WA 3ZD8A 2W93A 4XUDA 5IJ9B 1SKMA 1QFZA 3LUGA 2P0YA 1Q14A 3JQGA 4YJHA 3W5CA 3ME5A 3OM9A 1W4BA 4ZO7A 1Q44A 1TF2A 1JG7A 1QUFA 5LUBA 3TXXA 3WZ2A 5KX5B 4B2IA 4BB9A 4PZZA 1NQAO 3UMBA 2BI4A 3BJEA 1NUPA 2E5WA 2FF7A 1V2HE 3CURA 3L05A 4L4YA 3R7NA 2HYIC 5C5DA 2GBLA 1DAIA 5K9ZA 1Y5IA 4DMHA 3UJCA 3QU7A 3HGTA 5CK4A 1Z08A 4BB5A 1T3GA 4BASA 1V8OA 1G20E 1SN7A 2VQFB 2F43A 5TF4A 1CF9A 1E5XA 1VMEA 3CW9A 3V7YA 2JLYA 1NUSA 2OB2A 1OV6A 3AUYA 4LYFA 3ASUA 4TMZA 5CW2A 3DC2A 1E32A 5EE0A 5T64A 4EPTA 1SBYA 4N0MA 2B8WA 2EBHX 2FK8A 1SVIA 4JI8B 1G9XA 1U99A 1WXEA 2C2GA 3OPYA 5DLQC 1S1MA 3JCZA 1NLUA 1CJSA 2NM0A 5EYPA 1SXHA 2O2ZA 2NAPA 1AU9A 3I4FA 3LYUA 3OEEA 4FKMA 1Y8RA 3CPHA 4L8GA 4PICA 4XGIA 3ZK8A 4DY6A 6YASA 1Z6QA 2ZAYA 2JCSA 3KHTA 4A5SA 4V2IA 3O4IA 4IXMA 5JMWA 2X7JA 2E6UX 1R4AA 3PXCX 3D0QA 2PK3A 1E9CA 1BJRE 2HA2A 3R3SA 2XGMA 2QMUA 3R44A 3E03A 4G9GA 4PQGA 3WO1A 1J00A 2X0NA 2X8BA 3HU5A 5T3UA 1LFAA 3PRJA 2RI6A 1VLLA 1RRGA 1Y9EA 5FL7A 5KYYA 3MJDA 3NDPA 4EFNA 3QLUA 4GMGA 1YAJA 2FSFA 4HH4A 1UMCB 2VDPB 1T34A 2RGBA 3QXXA 4MHTA 1MO3A 3QKUA 3P1JA 2C4HA 3DFIA 3ZU2A 1IUNA 4QASA 2QTFA 4DR2B 1AB6A 3L6RA 3FOCA 2ZRPA 4FYJA 1CRQA 2OQ2A 5JD3A 4BAGA 1RPZA 4EO9A 4HB3A 2WTBA 4EKEA 1XTSA 1CDZA 1Y5MA 2CXPA 2A33A 3DDCA 4LRWA 4QBKA 5CBKA 3COSA 2ECKA 2DHDA 3Q7IA 4MCAA 3ZJYA 3WGLA 3DA8A 4L6IA 5BN5A 1I94B 1EGMB 1T6XA 4G2TA 3HRKA 3UHFA 2O8BA 1DFIA 4LEIA 3WQBA 3ZJUA 1EE9A 3NJ4A 4HNAA 4M6WB 3RGGA 5GJVC 2A5DA 3W5BA 4O4LB 2DUUA 3GZNB 4MS4B 4K5QA 2ZI5A 3EUWA 3NHJA 4C20A 2QVZX 1D2MA 3HTXA 5BV1A 1I9GA 3NS7A 1E60A 3COZA 1CLEA 1I1HA 1ODFA 3P5SA 5DNEA 3ZBQA 2HU8A 1NVBA 2GAIA 5DNAA 2DAPA 3RDPA 2HT6A 5A05A 5EGNA 5DU2A 3U7HB 3E1GA 4RHCA 3TIVA 1YFJA 4YQEA 4R9SA 1UJ2A 2H8KA 2BSAA 3QYFA 3AVWA 1EHCA 3PQ6A 3VR0A 2W6NA 1IK4A 2J4DA 1JQDA 3MMZA 4U2EA 3EEFA 4UVDA 5CIWA 3WZLA 3H99A 3OCVA 2H9YA 4EAAA 5C8VA 4D79A 1SD1A 5H5JA 5K09A 5KS2A 2ZIZA 2OSVA 3F7OA 5CTAA 3PUXA 3AXTA 4OMCA 4PYMA 1GDHA 4UFOA 2I6SA 1W47A 2ID4A 2UVPB 4UBIA 5AJXA 3JQDA 3RUDA 1NPYA 2ODNA 4M83A 3D6JA 3VR2D 3LTNC 4ZI5A 2J59A 1LKZA 1US8A 2FK7A 4R51A 3A58B 3BXHA 1BVUA 1OLXB 3LA6A 1KWGA 4ER0A 4QYTA 4ALKA 4MQEA 4A6PA 3OTGA 4D46A 2D4AA 5FI5A 1WCV1 2XNSA 3SEZA 3JARB 2FDCA 1H2HA 3M0EA 4NPAA 1G5HA 2MSCB 3URMA 4WFIA 2ZVDA 3N7AA 4RJLA 1JWBB 1EFVB 1T1RA 3RSCA 4NE2A 2Q6TA 2A6PA 2PMEA 3K0SA 4PNZA 1HDZA 2HBYA 5E6RB 3QLVA 4DRZA 3NX4A 1KGSA 4QECA 4EFLA 1D09A 1D1QA 1LB1B 2RJNA 1VRVA 4PLFA 3M3PA 4L57A 1W5AA 4E03A 1OZ0A 3S6JA 3QXJA 1FPMA 1HSOA 4BJ6A 1NF8A 4TTIA 3WGHA 4JLOA 1UOPA 3AHJA 4LBWA 4QRHA 2PTGA 2C0PA 3VNAA 3NBMA 4XTRA 4ZOEA 1DELA 3AF0A 4UMDA 5JO9A 4FGUA 4WN9A 2HF7A 4OI1A 4CM6A 2FX2A 5EJAA 1Z2EA 4GH5A 3ZHVA 2C88A 5BVGB 5BV7A 1SVNA 3STYA 5HZHA 1CDDA 1LUAA 2F1OA 4FNMA 4I8DA 4ZT7A 4GKAA 1LSJA 1QE3A 2A9JA 2JGKA 1HZJA 2OFPA 3AG6A 3VR4H 4B74A 1ZI8A 3QBJA 2OV2A 4BRSA 1TMYA 4JBXA 3OZBA 1L5LA 1EDEA 1AK9A 1WXHA 4IDCA 1GG9A 3RS0A 1C1HA 3TWOA 3TTWA 4YUAA 4C06A 1NV9A 3A2LA 4RH3A 2NO0A 2JVIA 2VG8A 2R8PA 3SXUB 5B7GA 1D6MA 5JC8A 5JYEA 1JJBA 1JHZA 1KI3A 4NAHA 2Q2OA 3V5NA 1WZUA 4A8JB 4IIHA 3IUPA 5FLXA 5JSQA 5A1JA 4LK2A 4YRSA 2RGDA 3ELUA 3QVSA 4ARVA 5B2EA 4MX8A 2FR1A 3NC0C 2VBCA 1K6MA 1FUEA 2FQQA 2OPHA 1H2ZA 5IN5A 2QI9F 2V7QD 4GPBA 1K5DA 3DP9A 3LL7A 4D7AA 1MNQA 4UOZA 3FOBA 4I1IA 3VR5H 1OKKA 5AUQA 1H9AA 1MVLA 4M36A 2O2YA 1QFXA 3PGJA 3A27A 4FFBA 4TWJA 3AM3A 1LPPA 5AI9A 2XTMA 2PBZA 2RC5A 4E5YA 4EVSA 2YHAA 5IG2A 2OAGA 4DA6A 3HBLA 3LP5A 3I04M 3T6KA 5KOIA 2C3PA 2VTEA 4HRAA 4J76A 5BV2P 3W90A 5CB4B 2JB9A 3JVEA 1Q7BA 4LKRA 1RP1A 3RFFA 1EYZA 3CX7A 3YASA 3R0JA 2VNKA 3GROA 5JCOA 1KFBB 1Y3DE 4V39A 2OCDA 2FP3A 3AJRA 3AWIA 3HY3A 3I9NA 3QPDA 2V7PA 3GQBA 1UPCA 3AKDA 2YBEA 4F12A 3IHTA 1QH0A 4II7A 3M6FA 1EEXB 3A3PA 4X3PA 1ZCZA 2XWBF 4QQ8A 1R1DA 3CLSC 3T3DA 3TRJA 4Y2QA 2UZ1A 4TMWA 1A4IA 4WVFA 1G4HA 1NVVQ 4IV5A 3T7CA 2IOYA 3WYDA 1UBUS 4MGKR 4BE7B 1SOUA 4DLYA 1DJOA 5FYQA 2QIPA 4OVKA 3HKDB 2IX9A 1UBEA 1WX1A 2GZAA 1DTWB 5E0OA 3ZJVA 4B48A 2CXRA 1UDXA 2QN9A 3AUJB 1XTJA 1GVNB 2Y1WA 3V2UA 4IKPA 4CF5A 3RU2A 4HATA 1NX6A 3LBAA 4R6WA 3B7PA 3ZKAA 5IANA 4UMFA 2UZ0A 3MGKA 5IX8A 2KX7A 4Y9RA 4AICA 5EJ2A 3RADC 1A9TA 4PQFA 1WLSA 2RGYA 2VQSA 1D4FA 1ZGCA 5K3CA 5LMUB 1IEWA 1HQCA 1PGPA 3GFSA 1P74A 1M2NA 3EUFA 3KSDO 3L6UA 4BVBA 3FPLA 2ZBRA 3QVXA 2JD0A 3H1TA 5AHXA 3CVXA 3ZDZB 4IJWA 2JG3A 2ONYA 3H5IA 4C4OA 4EKDA 3DTYA 3HV0A 2XODA 3PSHA 1WCWA 4BUCA 4CKCB 1H6CA 3EMDA 3X1DA 1CUFA 3C6KA 1Z88A 1FX1A 1XZLA 2CXNA 2GHIA 4Z4FA 1ONOA 1EJ0A 1Z0SA 4X20B 4H7DA 3SJBA 1PL6A 3G02A 2EIHA 4RC9A 1FL9A 1YRBA 5C1OA 1CY0A 1J70A 3FOFC 5JCXA 1IHUA 1IWBB 1KJZA 4O4JA 1BGVA 1GNLA 1RYDA 3TLKA 4ZCQA 4CIDA 3D64A 3RSHA 4KJXA 3N0VA 1X7YA 2CCKA 2I7XA 3QFSA 2H2HA 2F00A 3FWPA 1E3EA 2IP2A 2ZBVA 3QSGA 4JLAA 5DHUA 5JPIA 2IH5A 1YUNA 3CTMA 5ALRA 4RK0A 3SYMA 3UOGA 1N5RA 2G09A 3H2IA 4AY3A 5A7FA 3KPUA 2VXBA 5TQ0A 4GXQA 1DEAA 4W5JA 2QLFA 2HM7A 1ULTA 2QPAA 2R00A 3KSZO 1CQIB 3MQ4A 5GTDA 1DRWA 1J5EB 3FMFA 4D97A 1T8WA 1TEVA 4S24A 3QELB 1VLHA 3BYZA 3W78A 3FVVA 1E6WA 4IDAA 1VJCA 5AI6A 4PPFA 3C6MA 1E6EA 2JVJA 2QRQA 3L49A 1FLNA 2NOAA 1W5TA 1QU2A 4BZZA 1QFJA 2ISCA 2XTJA 4Q1FA 1VM6A 2IEZA 3S1LA 5J63A 4LHYA 1EFUA 4PC1A 1KJJA 4DIKA 3GA7A 3WNBA 1IVYA 5JBNA 3RRMA 4EWLA 4X45A 3NJ8A 4TROA 4DAOA 4MRSA 3M6UA 2OGTA 1OH7A 4IHKA 3QUQA 3ZZTA 4D9CA 5KC9A 3QKSB 2VUTA 3H87A 3MRVA 4RLHA 1GSOA 1CDOA 1ZYUA 2QX7A 5ALDA 1TYAE 2I91A 5LP6F 2OWDA 1P5RA 3O8OB 2I4MA 5ESRA 4EPWA 1TLLA 3NI2A 4HNGA 1I2MA 3EPPA 1JBKA 3KQWA 4H7FA 4IOKA 4D0NA 3ZQJA 4YJGB 4YV1A 2JEOA 3X0DA 2FN4A 4UUQA 5CJ2A 3UXMA 1QZUA 3FNEA 2X86A 3OOHA 4JUIA 5CDFE 2WNSA 5IH7A 3U44A 2HRDA 3EC2A 1H2RS 1TJ3A 4XQCA 2MYNA 3GT7A 4HLUC 1Y4ZA 3LMKA 2WAXA 1AMOA 1B23P 2QWXA 1SRRA 3CZAA 2JJ2D 4GYWA 4J2HA 1B42A 3OJLA 3RC3A 1GTMA 2OHFA 5LA6A 3BZUA 4PYLA 2N1BA 3GBVA 2WF7A 1AQ6A 4MLZA 3HN2A 4FGWA 1L5HB 1R8QA 2VJMB 3DLCA 1YCDA 5HCUA 3VYUB 4G0OA 4BNLA 1L1FA 3W3ZB 4GOOD 4ARCA 2UZIR 1G8MA 2R8EA 1A4RA 2OILA 2YZ7A 1UC9A 1R0CA 3OJOA 3DV0A 4JP1A 1Z5ZA 4B1FA 4F3YA 1H2FA 1NM5C 3TTSA 1AGNA 3I32A 3ZW7A 1RAIA 1AO3A 4Z8YA 1OSNA 1PV1A 3QNMA 5I4BA 3HUMA 1U28A 4BKRA 3ZJ4A 4ZHQA 5EI5A 3OFSA 3HJTA 3OMXA 5FOXA 4U2GA 1ZJ4A 1T0UA 4HNQA 4J1SA 4LF9B 1BYUA 1YZQA 2P3QA 4GWKA 2C7BA 2PGOA 4MTLA 3DE3X 4DC1A 1H8EA 4JZKA 2RJOA 1JIJA 5C32A 3AQIA 4EA9A 1YA6A 2G83A 4YMUA 5J47A 1RQXA 3W3AA 3EWSA 4LFAB 1FS5A 1P9LA 3CKLA 4TMXA 4MIYA 2Z1DA 4R7GA 2JAWA 1T2VA 4CGZA 3FPBA 2QV7A 2YWBA 1L5FA 2R87A 2VJNA 4FQ5A 4ED9A 1P18A 2ZIEA 3I52A 1UOQA 5BOSB 3AVYA 2D59A 1MPTA 4BNWA 3EK2A 3VNSA 5G4LA 4KPFC 4HMPA 2IIBA 5TB5A 3ZGNA 4ECAA 1WY5A 1I6MA 3FUWA 5ALPA 5LDDC 3O0TA 4BFWA 2CJFA 2D1FA 5LZ4A 3OIVA 4KK4A 3OAAA 1A69A 4HGPA 1AY0A 2JHGA 1YDGA 3KETA 3I62A 2J5QA 2QZZA 3R9XA 1ZMXA 4IWYA 3BORA 4KYUA 4DCOA 3B52X 2C92A 1R16A 1PKXA 4D8UA 3SK0A 3PIIA 4F6LA 7REQB 4IGEA 5DI9A 2X2OA 1FYVA 2WZCA 4QELA 4XGKA 3UAWA 2OZPA 3CINA 3X3HA 2DR2A 2C2OA 1MB4A 2QN7A 4DHEA 4FXPA 1PQYA 2O7NA 2YIVX 2QE6A 3KJQA 1A82A 2J48A 1TPYA 1WAMA 2PX3A 4FOOA 4EEKA 1ZWLA 3H9GA 4U6QA 3SR4A 4WPGA 4BCCA 2BM1A 1XL0A 2WMDA 4MWZA 1U4SA 1YHYA 4I9GA 1DKQA 1QOZA 1T5LA 2WIGA 4W1RA 3AY6A 4MUYA 3AFHA 4IV0A 2LW7A 4QUIA 2JLZA 4E88A 2WICA 3K6RA 1TM4E 4BGEA 4A9AA 4HDSB 5HIIA 2B5VA 1JH8A 5DT9A 1U8FO 4ZO8A 2VUUA 1OIVA 1X9GA 1XTIA 4KXNA 2NZWA 3GO4A 1RWBA 2LCQA 3UGJA 1GLGA 2JI7A 4LBVA 3RIXA 4BDSA 1JFFA 1YVUA 5D51S 1AN9A 3THOA 1Y4AE 4EPVA 3C7DB 2XA1A 5F1KA 4CV1A 1OT3A 1S2NA 1J0EA 4M86A 3P9YA 1RYNA 2AEJA 2P6OA 1MDFA 4Y1GA 1JBQA 2GNAA 3QUCA 1U2RA 4J0JA 5HCIA 3QVGA 3UPDA 1E2IA 2XHEA 4Y3UA 1K86A 1N7HA 4PZ9A 1H2WA 3ZWOA 1QIHA 2KMLA 2XCLA 2A57A 2P6PA 3Q6NA 4JBIA 2XW6A 1W48A 3GUUA 1NASA 4BWFB 1DPGA 4OJNA 2X8JA 1E99A 3OPXA 1EXMA 5NULA 2GSWA 2PH1A 4IZIA 5A4DA 2Q8PA 2OCKA 3SHTA 2VJOA 3QRWA 3O2QB 1BWRA 1X1EA 2B4QA 4PHGA 5P21A 5JI2E 1F0NA 3P9NA 3IAUA 1MEEA 3CH7A 3AZQA 4I36A 3SM3A 1WHTB 4LQCA 2B8JA 2F6RA 2W4QA 2XF8A 3K2IA 4BCDA 4EB6A 5I8WA 3DMYA 4AJNA 5BPFA 2QTTA 2ONKA 1UBRS 2GJAA 2Z9DA 2BP7B 2F7SA 2A1UA 1E4VA 4RIIA 5CBPA 1XZMA 4BNFA 2X8WA 3TPZA 5ESXA 4OHFA 4Y9UA 5B1DA 3IIJA 4K2AA 2VHXA 3CE6A 4BMVA 2XLBA 1Z6TA 3EZFA 2W6PA 1ECJA 3TZBA 3EWAA 4E2YA 4NG4A 1FK8A 3CLUD 1IZZA 2A9QA 4I3GA 5T57A 1RWXA 2Y1EA 1X1AA 3ETCA 2W37A 3N8IA 1N8KA 2IUEA 2XCIA 2ERXA 4G0XA 1KOLA 5I01A 1APBA 4UDNA 4MITA 2IY8A 1YOVB 3K0FA 3PDHA 4IGKA 3D81A 4OXRA 2ZEJA 3A36A 1ZNYA 3W6UA 4KP7A 4P5PA 3G7NA 5F7XA 1BOOA 1YDFA 3OKAA 1O6ZA 3UMSA 3L7KA 4KSBA 1HMYA 1M66A 4EFDA 1JE0A 5BT8A 4WCFC 1Z3CA 4G0MA 4RULA 1VGQA 5BSMA 3U7FB 6LDHA 1BD3A 1NRIA 1C7RA 4YRAA 1AM4D 1PHPA 4EX7A 3AR4A 4QVGA 2I5PO 2O05A 4HAWA 4GLOA 5M3BA 3RYIA 2ZREA 3ILYA 1PGJA 2KSQA 5BN1A 2HCJB 5HZMA 1YF3A 2D7JA 5IBCA 3JYOA 4PSAA 2RH8A 4E21A 4E6EA 4GNKA 1T1GA 4Q7QA 5A5GA 3KEOA 4F4FA 1KNQA 1P0CA 3PB3A 3FDZB 4WLFA 2FP4B 1QYDA 2EHDA 1OJLA 3DKRA 4LYGA 1M2GA 5CG2A 2W48A 2ETVA 3H8WA 4HJXA 5FJIA 3AEKB 4AWBA 2BGIA 1Z47A 4PC7A 1YKGA 2AOTB 2MMGA 4JP3A 2AN4A 2JFXA 2VDQB 5KYTA 1Z8NA 3DOCA 3K0EA 4LZAA 3VKHA 4K46A 5CFZA 5D7NA 1JDJA 1BMTA 1YNSA 3AVVA 4L8FA 3M6VA 1VE5A 2ADOA 1CR1A 1GRQA 1T5IA 2G0AA 2NUTB 1WP9A 2HQBA 2LD4A 2P91A 3D6NB 3RVOA 1WDKA 3I64A 2PJUA 1QHSA 1S0UA 3IKLA 3P2JA 5GONF 3X2EA 5B57C 2IOHA 2ZBDA 1FUUA 1KEUA 2ESRA 2HDHA 1OKKD 1P2SA 2P9HA 3HE3A 4M49A 4EI9A 3OLWA 3GLFE 3NDBB 5CG1A 2ZM5A 1K3TA 2FUG1 2H2FA 2F1KA 3NXSA 4BXOA 4XDHA 4MQBA 1IB6A 4R16A 2FLKA 2WMOB 2W83A 4GZLA 3LNTA 5B3LA 1ZK1A 4F5ZA 3LYLA 4JMLA 1OZFA 3R7AA 2VFAA 2ID9A 3LSYA 4FHFA 3W9SA 1ECBA 1FTSA 3WG9A 4RQAA 1XYGA 4DB4A 4OQDA 1BDIA 1E79A 4G8BA 2OGUA 4LPKA 4CV2A 2WHRA 3H83A 1XMOB 1U7HA 1PX2A 1YGYA 4ZT3A 3S5JA 3T5PA 4GZ6A 2DTEA 1XMSA 2H0QA 3OZEA 2FPRA 1PG0A 3L5OA 1PS0A 5CLLA 2OZKA 4GC5A 4PQRA 1XU4A 1H69A 5EP3A 1MENA 3WDMA 5H4GA 1L4EA 4CQMB 3FPHA 2V7VA 2V3WA 4BB6A 5CA1B 1TYBE 3BD6A 4JL8A 5AM1A 1GFZA 2CBGA 1DCKA 3UUGA 5LKRA 1KXJA 5JZMA 2DRIA 2D5CA 1EVZA 3JYNA 4Q4DA 4XYEA 3W4IA 3RJ5A 4I19A 1B0UA 3HKBA 3QA3E 4FDAA 5EUQB 3EX7C 5KJ6A 3FTNA 1PR5A 3LV8A 1KZ9A 1X19A 5CDGA 4P92A 4MS1A 1E59A 5FWAA 5DWDA 4CIWA 2NYUA 2PL1A 2R6R1 1EJBA 3WK8A 5A9RA 4Q6BA 3CNOA 1UAAA 4EA6A 1PWZA 2GSDA 1N2GA 1ZJWA 4BLTA 4WVLA 2CLOB 4HNRA 2W0SA 2A92A 4OFXA 5CRIA 4YRLA 3QPUA 3W9YA 3HCCA 4WKBA 4OX9Y 2DPGA 3QJYA 2PL9A 1PJQA 3HA3A 1EM8A 1FP2A 4IUYA 4JQSA 4MWOA 1OA1A 4OTZA 4P4SB 2ZJOA 1DV1A 2HQOA 3UC5A 5KQSA 4MDFA 4OGGA 1YIAA 1A1VA 4XE5A 1MABA 3NEJA 2QW8A 1UBCA 3AYZB 1OYOA 4Q02A 1RP7A 4NJMB 4KREA 2X9LA 1PFKA 4REOA 4B5LA 2PKWA 3ZV6A 1LJ8A 4BO7A 1QV6A 1DQNA 2EW1A 5DSTA 3P0EA 3I3OA 2E4VA 3AUTA 4FEGA 4XVQA 5LQRA 2IV3A 4MMXB 4YAUA 1UWLA 2NU9A 2QM3A 3L8EA 1FBNA 1P8JA 4KMSA 4W1SA 2V98A 3QJ5A 1BZYA 3R7DA 1DTSA 4FYIA 1QVAA 3GEBA 4D9BA 1RC1A 4Y6PA 4DV5B 2WRZA 1I6WA 1ADBA 1EP2B 5JH7F 4DM7A 2LKCA 3UGKA 1ZGGA 4TKUA 4PLTA 3DR3A 2B35A 4YCMA 2JAHA 2VSFA 3RTCA 1GDTA 2XUQA 2Y9PB 3T3EA 1B14A 3UPTA 1P62B 1W73A 1XNGA 3AKYA 1RWKA 2VNJA 3HBAA 3QEKA 2BTQB 1ZMTA 3O73A 1ZL2A 1BXGB 1T9KA 2X13A 4FHCA 1Y5NA 4HPJB 3SF8B 4MXDA 4HVLA 5I9BA 5HKKA 1CR4A 1P6UA 1YIDA 3RS8A 1MF7A 4DEYA 4BV2A 4QPCA 4U7TB 1II9A 3UGQA 4BBAA 1UJ4A 2WB4A 4PPGA 1FFCA 4HMQA 1CZOA 2P9YA 4NWIA 3VYTB 3ZWWA 2DKOA 2G7MC 1DLJA 1QP8A 3C6YA 4J0KA 2DHCA 5DX0A 1YVEI 3ZEIA 4KDCA 1U6KA 1V5GA 3LXXA 2YZNA 4KQHA 1A72A 2NZYA 4BZXA 4DIUA 3LVBA 5DZSA 1AQNA 2PO7A 2IYFA 5B53A 3FNRA 1W6UA 1M1YA 4U7HA 3L4EA 1U98A 4LOIA 4RQTA 3SGLA 3JQ7B 4FTWA 3WLOA 1M6HA 1XVTA 5A6SB 1EWQA 3LPAA 2R6ZA 3I9V6 3OQJA 5TVKA 4EBFA 1PF7E 5IRCD 2NACA 4OJYA 5THQA 3UAVA 3L8HA 5KYGA 2EJVA 1EUCB 5KJ1A 4G1MB 3KFXA 1GLNA 2WJWA 2ZXFA 4A7PA 1F5SA 2Q5OA 3F90A 1TRKA 3CJQA 3W9BA 3ZBTA 1SC9A 2JHFA 2JH3A 1S8OA 2NTNA 3D3QA 4KMMA 3TAUA 3WL6A 2HNAA 5BSWA 3M4XA 3UM9A 3ANYB 5DM2A 1K5HA 1RYMA 3VPSA 2OAP1 2F3RA 3IPCA 1GR0A 2NU8A 1J7JA 3O21A 3RRNA 1UIMA 2PZEA 2IDMA 3NRCA 2CV2A 1H2EA 2R1TB 1L4KA 3JWEA 2J3EA 1QAMA 4MLPA 5AK0A 4C3UA 2QDKA 3VISA 4YDRA 4RH1A 4B09A 1CVLA 4ZYYA 1G0NA 3PBKA 2WPNA 3R75A 4UCQA 4ARIA 1DG9A 1UPAA 4HZIA 3ADCA 5FAXA 2ZS8A 5EAIA 3LECA 5U4QA 1K7EB 1LH0A 2GN0A 3M4YA 2IPMA 3I0ZA 1QGZA 4MEJA 4KO4S 1IXYA 4AU1A 4M37A 2CYAA 1H8ED 1GUAA 3L7MA 3TGWA 1GQYA 2CVQA 3VH2A 3TUZC 1T29A 4HG2A 4MI1A 2OP1A 3LZ6A 1VL6A 4UTOA 2P9ZA 5KAMA 3EPLA 2YDXA 2OPBA 4BN5A 3USZA 2BI7A 5C81A 2RHMA 3I9V1 1RACA 2AOUB 3E9ZA 4M22A 3B13B 4EJSA 2VPYA 3TFWA 3ICVA 1H6AA 3BIFA 3E48A 3TZHA 4WK6A 3IP6A 2KS6A 1QHEA 2O3JA 2I9KA 2O0HA 2KI5A 4PR3A 2GO7A 7MHTA 1PW5A 3V48A 5HTOA 5BNZA 2O8EA 4JB2A 4LJSA 1E6MA 2ZULA 3MA0A 4DQVA 1Z0DA 4JGIA 4YACA 1RW4A 1C3VA 1G7SA 3EVTA 3KDPA 4GPTA 4WN3A 1RE0A 4W7HA 5H81A 3BWEA 4RVHA 3UMYA 7GPBA 1PZHA 2AB0A 2WJAA 1C7QA 3DMHA 3H1AA 4H0CA 4OHRA 2BEJA 3VKWA 2GD0A 5IN4A 2OCPA 4NJEB 2ZGVA 2XIQA 4MGHA 1UBSB 4GT1A 1X3SA 1D4OA 1JI0A 5T4HA 1ZITA 5JDIA 2DE0X 5K5EA 2PZKA 5TGDA 3C3YA 4ENTA 1ID1A 1I5OA 1Y9JA 5K8JB 1G8KA 1XXHB 3WNDA 2O2SA 4Q34A 1P39A 3SHFA 3IEKA 5CCBA 4QUDA 1K7SN 3GLHE 4IG9A 1PSZA 1U8TA 2NU6B 1DOHA 1VKRA 2FX5A 3BWXA 4EVIA 1BC5A 5K2OA 2GZ3A 2P4EA 3PEUA 2WWIA 5BRJA 1B93A 1WA5A 1GPUA 2HJRA 2GF9A 2ZRFA 4RZIA 3WGTA 1FNDA 2HO5A 1DXQA 2FF5A 4I81A 2J9FA 1R4NB 5IEBA 2R86A 2MINB 1IN4A 2P2GA 1EQAA 1WDLA 2I1WA 2NO6A 2ZDHA 4O8CA 3ZY4A 4BBZA 2EIXA 4ZTUB 4F1JA 1J7KA 4PN3A 2I76A 2MSLA 2Y1KA 3WL7A 4XSHA 1Y5RA 2BKVA 1UBLS 4FFDA 1E0SA 3UG7A 4URVR 3LBYA 3AGPA 3E2IA 4XJTA 5AICA 4J0HA 3DC7A 5JATA 4GKJB 4MV3A 3QVWA 1CNFA 1MQ8B 4OLHA 5A9TA 1J42A 1VLQA 3O94A 3G2OA 1WXDA 4D80A 5AXCA 2V3CC 4Q1EA 3DFKA 5EE3A 1D03A 1YU6A 4EYQA 1C9KA 3EW9A 1G2PA 3GJ3A 3KE8A 4MV6A 3OIDA 4P54A 5U1PA 1DWQA 4RJJA 1B6TA 5BV8A 2VP3A 1A8QA 1I9CA 5HFJA 2UUBB 4X84A 3K70C 3O8RA 4N03A 1FJGB 2OGSA 4DMFA 2P3LA 3ZOZA 1NL3A 2BGRA 2D3TA 2Q3LA 2G40A 1GZSA 2VQDA 2CDNA 1OX5A 2W6MA 2XWQA 5FEMA 1O6FA 4DNXA 2YXNA 3A6EA 2COEA 3B70A 3BDVA 4LHVA 2EEZA 4UBKA 1GSHA 3S0JA 3TGLA 4OLAA 4NZYA 1WWKA 4HQ0A 1IPHA 2VTBA 2BM9A 2J08A 3JAWA 5AW2A 2W6JA 1B4DA 4QPJC 1F9AA 2PMFA 1IXRC 2WZQA 2GQ0A 4FZ3A 1JQ3A 3H2YA 3FYHA 1W5FA 1Y6RA 3WBJA 1OLOA 2A0XA 2R85A 4NESA 4R69A 4BIIA 4F3KA 5EHXA 2B8TA 3CKMA 2XF2A 4F38A 1A4XA 1YZNA 3W8NA 2C9BA 5DHRA 2W90A 1YQEA 4CF7A 4CKZA 3UH0A 2V5VA 3LKBA 4F5YA 4X7MA 3ZGVA 3PQ4A 5DGTA 3LW8A 4URXR 5HNKA 1CUAA 4GC9A 1JG2A 4MZXA 1I33A 5DRYA 2M6LA 2GH1A 3KD2A 1UT5A 3UJ8A 4AQ7A 2D8MA 3ON5A 1M0WA 3QV2A 5GOTA 1SG9A 2X9QA 2HEGA 2Z3WA 1BXRA 3DWFA 4P0QB 4YT2A 2WK1A 2XMQA 1IDOA 4C9BA 1TMOA 4NZZA 4IFEA 4DCMA 3DULA 1RJGA 3LO8A 2RHWA 4GFDA 2NPIA 1U8XX 4QPZA 4Y6GB 5ADHA 4P81A 3VH1A 1G8AA 3EXAA 1OZAA 4QWMA 5A9SB 3CS3A 3H4IA 1G2QA 4ND1A 1CY2A 1WDWB 1H1DA 5DASA 1NSYA 2AN5A 1ODLA 1CB7A 2FXIA 2O3TA 5FJJA 5REQB 1V3QE 3GYBA 4QXPA 4DV1B 4OYLA 5HW0A 1V8DA 2A7XA 1W0KA 4BIMA 5FOUA 5M7EA 2IHUA 2VQEB 5E1OA 1KI7A 2A86A 2OHHA 3HQ4O 3K71B 3ZQ6A 1TX4B 4DMKA 3DDZX 2PUDA 1WF6A 2Q6OA 1GAWA 2P6UA 3LDFA 4CNQA 4ZO9A 3NIGB 1GZ3A 2ZKIA 1TLTA 2JAQA 3ANXA 1F14A 1Q1NA 2P2SA 2UYOA 2XNCA 2RBGA 4DA0A 1U0SY 2Z57A 3PT5A 3UYLA 3A1WA 3D2CA 4E1VA 1FNNA 3BSSA 4KC0A 5FPPA 3U3MA 4ZYLA 5LDGA 2V1UA 3B2EA 1YC5A 2O7VA 4HS4A 4PIPA 2VKQA 3CUWA 3T9DA 2C7QA 2PS1A 2BFEB 3LP8A 4ZODA 1CY4A 3T5GA 1A04A 2QD2A 5A06A 3NAZA 4TTJA 1IPFA 2W11A 1L4BA 3LL4A 1KK2A 2PRSA 1RLUA 4EB8A 2RHBA 4FYYA 1V25A 2YDYA 2DH5A 5F1YA 1GITA 3FOEC 3OCXA 4YN3A 4B3IA 1HLFA 2IIPA 2SICE 3CRNA 3QY0A 2EFGA 1M54A 1JDSA 2O0LA 2QG4A 4IP0A 2WSYB 5DDIP 1AKUA 4RZ2A 1N25A 4G24A 5E4TA 3WRYC 4CL2A 4ZOCA 3AHFA 3KAKA 2EYQA 3D8SA 3G8YA 1QK5A 4YALA 4D1YA 3UTDA 4KAJA 5B6IA 4YDQA 3JSXA 3UPUA 3T7AA 2W00A 5JNRA 5CNJA 2A78A 3THYA 3BFPA 4R1PA 3ICWA 1FFBA 4BE9A 3CWZA 4X1OA 4B3HA 4DC0A 2B2NA 5IC5A 3B2NA 2JGFA 5KTOA 3ID6C 3SX0A 3ZHUA 1CULC 1R0WA 1XCOA 1E79D 2XVMA 2VH5R 3PXDA 3SM9A 1OH5A 3GJ5A 3H1GA 3SWWA 3WK7A 5B7QA 4GWGA 5F5NA 5ALMA 4PGHA 3EDCA 4MUIA 3TTTA 1HEUA 4NOJA 4R83A 3ZWAA 1CYDA 1CZHA 3LGXA 3OO0A 4BFTA 4ND2A 4TL7A 2BMWA 4NF2A 1M2JA 2R60A 5EWJB 3M6LA 3BTSA 2JPDA 3V32A 4KV9A 4MR7A 3A2MA 2XUGA 3LHKA 2I54A 2OLEA 2DETA 4P0PB 2D5IA 4Q7EA 5DXJA 1EBFA 1W85A 4V3CA 3E81A 1QU3A 4GE3A 4LUCA 1D7AA 2A4MA 4JBWA 1OZGA 4DWJA 4O4JF 1ITZA 1W9HA 2DBYA 1JLKA 1E9SA 1NW4A 1RLJA 2KWIA 2NQ2C 2L17A 1JRLA 2PSJA 1N5KA 3C5EA 2NYAA 1NMZA 3H84A 4CBVA 4NU8X 4QE3A 4E32A 3TRHA 1VLJA 3EIFA 3HCDA 1MD9A 4GVXA 1LRJA 4NZOA 3A4YA 4F45A 4MMZB 4MWTA 4CV0A 1ZK2A 2BEWB 2QLLA 2R1VA 4LDRA 4I1PA 2VWGA 3WMXA 3M1LA 1OXUA 4UEQA 1X1CA 2W98A 3NWJA 4D9FA 2DBVO 1LJLA 3LVRE 2VTVA 4FZVA 4D4IA 3BSYA 1V4BA 5I7AA 5SYNA 4MVJA 2FZCA 4AVYA 4IICA 1MAVA 3MJTA 3ENQA 3FWYA 4I1RA 4L9RA 2C57A 3DAFA 5CNMA 1NOKA 2PGIA 4UM7A 5EVCA 3DPUA 4B6OA 4E4RA 4ZCRA 1AKRA 5I3ZA 3AHDA 4R8MA 3AEQA 1KAOA 4ZA2A 2BY4A 3RT1A 1QCZA 3REQB 5K20A 1XCMA 1QB7A 2Z5LA 2RKWA 3ZS8A 3RUIA 3KEFA 2JA2A 3NM4A 1QFSA 4BVAA 1NLYA 2HZBA 3JAMA 1X74A 4E4YA 5FWDA 1XDZA 1GZHB 1DB3A 2Z2KA 2O2IA 4IZOA 3V4SA 5CXXA 3X1XA 5A4KA 1J2EA 3B6KA 4OBEA 3F7NA 3MBOA 1R7RA 4BL5A 1AV6A 1G1AA 5AW4A 3FBWA 1ZHOA 4QQKA 2QOEA 3TCXB 3WWPA 4CF6A 2I29A 4IVPA 2BKXA 1OI2A 2PGDA 3QOXA 3T5MA 5BW5A 3RRYA 1P9NA 1E1RA 1UAYA 2P6MA 2PM8A 2NVUB 2IYTA 4C3VA 5AUPB 3OSZA 4A8JC 2IYUA 3O84A 4CMHA 3D8NA 3DZFA 2PJRA 4R1SA 3NTUA 3TSAA 2O2JA 1JP7A 4JJ4A 4ZU6X 4LXQA 4YBZA 1IEVA 2Z9BA 5HKKD 4OQPA 5C8YA 2FPPA 3ZZMA 4L51A 3E6AA 2BISA 2OA0A 3CPSA 1MOSA 3NOOA 3LFTA 4UU7A 5ALJA 5AESA 1SB8A 3IL2A 4YT5A 3BA1A 3JZDA 3T5AA 4IEEA 2PUAA 1UJNA 3QTTA 4P3YA 4MCIA 2Z8YA 2GKGA 2PJZA 3IA7A 2ZWPA 3LHIA 1WW3A 4YMWA 4ZMSA 4PIVA 2G9RA 2Q62A 3H5LA 3LYHA 2E82A 4JEMA 2BL4A 1STOA 3ELDA 3KXDA 2M6KA 5HCNA 1RKVA 1TKBA 1P2TA 5FCDA 3EFHA 4WEOA 3VV2A 1BQEA 1ESEA 2Y0BA 1ISGA 1EFPB 2FMTA 4JJ7A 4MI6A 2GERA 4EPYA 4JQOA 3K8ZA 2QYSA 3DLBA 3H3JA 1FYXA 3RUCA 5JNSA 5M34A 3Q3EA 1P2BA 3B9BA 1EKXA 2AG6A 3BMQB 4IQFA 4ARZA 4AZ0A 4BO8A 5TE9A 5TGTA 3MLEA 3WB0A 4P2GA 1LNQA 1T1IA 2GJ9A 3PQDA 2BSQA 1DARA 1TNDA 1AS3A 1DIBA 3BBLA 1RXCA 3R8XA 4CIXA 1L7AA 3LYAA 2L42A 1RWMA 2JIQA 1UEJA 2AR9A 4LVUA 1XPRA 3GEIA 1EVEA 4BGVA 1TEHA 2BR4A 2ZYAA 1DWUA 1F0YA 1KO4A 1VDMA 4KRGA 5B6JA 1YA4A 3CVVA 3COWA 2I71A 4BEWA 1AHNA 1X1TA 1H23A 2ZJ8A 3O3NB 4X7RA 3KQMA 1C9JA 4KXFB 1CUBA 3DQPA 5DNUA 3IOYA 4KQCA 1E3JA 2FPIA 3M8KA 4B3JA 5CDFA 2BFMA 4JFRA 3VDQA 1E18A 2WWRA 3GCGA 2X8LA 4IQ8A 1PWEA 1T24A 2JH9A 5K4AA 3O47A 3A4VA 4MQUA 2WVJA 1YQQA 5C80A 1BTOA 4BNTA 2F3SA 4IIGA 3SOZA 4JP2A 4QFDA 3GD5A 2QG9A 2DJIA 3W2EA 4CDNA 3UUWA 5L7WA 4XEUA 1N6RA 1SZJG 3ZWNA 2F3UA 3PXBA 4POAA 1WCYA 3G2HA 3ZVMA 4OL0A 4UAGA 3QTBA 1QC5B 2YQZA 2DFDA 2EKBA 4HQLA 1Z5WA 2NG1A 4E7OA 5D3MA 1U3UA 5EHGA 3VR3D 3V33A 5CFMA 1Q83A 5TY0A 2HMYB 5DM1A 5HQJA 4EA7A 4IF6A 1SUAA 1M1NA 4UE6A 4D25A 1BWSA 4H4CA 5HF9A 3O8LA 4JCOA 1KDPA 1NFQA 3S68A 1NXOA 3PLNA 3FCYA 1YRQA 1J33A 4JBGA 4KWHA 5JPDA 5FDFA 3R4VA 2V1XA 5J23A 4ZEMA 4IGAA 3AL3A 4J0QA 4D3SA 5H3CA 5AHKA 4AN0A 4GM0A 4WBSA 5E38A 1VSVA 5L53A 4OIMA 4H1HA 4FHZA 1YB2A 3L6OO 3A4MA 2ZUCA 3OZCA 1T25A 2RGGA 3N8HA 3QUTA 1KJYA 3FI0A 4RJKA 1TL7C 2IUFA 3D3JA 3NHPA 5FO0A 4N5DA 3WLTA 5J1SB 4W5RA 1PTJC 2JFHA 4R3UC 1Q12A 4H7JA 3MFYA 3BIOA 3DTVB 3R5FA 4DMUB 2Y0PA 2JLWA 3KXKA 4L5BA 4G8DA 3QY9A 4YRDA 3RD5A 1MN6A 3VBCA 1NBME 4QO7A 1LSSA 1MOZA 1MIOB 1N6IA 4PX5A 1DX9A 3RFCA 4Z7NB 1X7WA 1Z6PA 2GXQA 3Q3IA 3IRVA 1C0LA 3QLJA 3L18A 1OCEA 3PX2A 1YB6A 4DCPA 1VE1A 2CJXA 4IGIA 1RXYA 3RIEA 1LNZA 2IC5A 1C9DB 4HLUA 3HKEA 2AR7A 1VL2A 1CV2A 5EUCA 1ZG3A 2WT4A 4MV8A 4P84A 4AF6A 3MWFA 3ZWYA 1QGUB 3DR5A 2ZTUA 3WOVA 4RSGA 2ATCA 3QW4B 5D86A 4L1KA 3JQBC 1ZR2A 4HTFA 4DQXA 4JYBA 2WP8J 3N59A 1BOFA 2R7MA 5DOVA 4GOXA 3T3MB 5CYOA 5BN3A 2B4YA 3D4OA 3X43A 1ZH6A 3UC9A 1FFXA 1NM5A 1M0TA 2WU3A 4XRRA 3G5TA 1SULA 1HLGA 1JQLB 2VWHA 4GYKA 1L8LA 1Z18A 1RKQA 2JL1A 3IV6A 3LXRA 4M21A 2O2XA 4RF2A 3E9QA 4R8LA 4X7PA 1HETA 1RI3A 2QTMA 1U1CA 4HVCA 3NW9A 4OHKA 1E2GA 3K8QA 1RHUA 1OI3A 1VHDA 4K0RA 2FZVA 4RD0A 1Q1GA 2D13A 3NNDA 1RVV1 2R8OA 4ZVNA 2ZIVB 3I83A 1J9ZA 3V9PA 4O8ZA 5FB3A 3OFNA 4U2CA 1ECFA 4KVZA 2R47A 2HIGA 3A9SA 2Y6UA 4Y2RA 1S2OA 1PGOA 2O7SA 2QE7A 3K1TA 3PR2B 3EG9B 3RHFA 3RJMA 1JB1A 3T7DA 4F46A 1LDMA 4HN2A 4OL9A 5F3DA 1AGXA