4YV2A

Crystal structure of trypanosoma cruzi spermidine synthase in complex with 2-phenyl-1,2-thiazol-3(2h)-one
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
290
structure length
278
Chain Sequence
ELISGGWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the novel inhibition mechanism of Trypanosoma cruzi spermidine synthase
pubmed doi rcsb
source organism Trypanosoma cruzi (strain cl brener)
molecule tags Transferase
molecule keywords Spermidine synthase, putative
total genus 90
structure length 278
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 4yv2A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4yv2A02
2Q41A 3KPJA 2H1RA 5E2AA 4U7PB 4R05A 3UJCA 2AN5A 1DUSA 3OCJA 5FA8A 4AUKA 3KPWA 3KQWA 5HFJA 4YUVA 4EK9A 3THSA 3OZTA 3QOXA 2AZTA 1L9KA 2CL5A 3NVMB 5BW4A 2AN3A 2PX4A 4B17A 4PYJA 4YV2A 3FPGA 3PB3A 1D2GA 3A26A 2NNWB 3EVZA 4M38A 2AOVA 5DSTA 3LDUA 2EFJA 4YUWA 2PXCA 4DCMA 1M0EA 4QDJA 2AS0A 1XVAA 2NXNA 3G2MA 3UA3A 1KP9A 5DLYA 1KYWA 1R74A 4C07A 5EHIA 5FTWA 5LR6A 3KR1A 1PRYA 3DR5A 3LSTA 5K0LA 3G5TA 2PT6A 3FRIA 3I53A 3FPFA 2EX4A 5E9JA 5KS2A 2OO3A 4ER7A 3KKZA 4WXHA 1EQAA 1SUIA 3G8BA 4DKJA 2ZTHA 3TLJA 4MQ4A 1U2ZA 1Q0SA 4ZTBA 4V0QA 2ZIGA 4IV0A 3TKYA 4FSXA 1G55A 3SX0A 4OA5A 3BWBA 1XCJA 2VDUE 1L3BA 1ZGJA 3OU2A 4IV8A 5M5BA 2VDWA 2YX1A 5LQRA 1Q0TA 2ADMA 5HILA 4AZWA 1VQ1A 3C0KA 4PCAA 3SSNA 1R8YA 3EGEA 4KW7A 2YXLA 4GC9A 2ZZMA 3EVCA 2UYHA 1TW3A 1N7JA 2PLWA 5DRYA 5HIMA 4V0RA 5EKUA 5CVVA 5ERGB 4HGZA 3DUWA 1BHJA 1G8SA 2I9KA 3JWIA 5MHTA 3LBYA 2P7IA 2PWYA 5CIYA 3OU7A 3AY0A 4QDKA 3P2KA 4YMGA 1ZQ9A 4OBXA 3HVIA 1XXLA 1H1DA 3M6UA 3OE5A 3R0QA 2G70A 3MTIA 4DA4A 2GLUA 4EKIA 5E8JA 3EMDA 3GRZA 4P7KA 3SR4A 3UJ8A 4DM3A 4FGZA 3BGVA 3HA5A 4KVZA 2C7PA 5EHGA 2PBFA 5BXYA 5K0BA 1KIAA 3AWIA 5LSAA 1QYRA 3E05A 3ERCA 3FTEA 3P9CA 9MHTA 5DM2A 5K09A 1BC5A 4PGGA 3R6TA 4MWZA 4WVLA 3LPMA 4CKCA 4ER3A 5EMKA 4AZTA 5FQNA 10MHA 5EMJA 1NE2A 3P8ZA 3ELYA 3HVJA 2HWKA 5HIJA 1IXKA 2UYOA 3G88A 4OBWA 2IBTA 3FRHA 2UYQA 2VZ9A 5E2BA 2IBSA 3HNRA 2HTEA 3HCAA 3P9NA 2OYRA 4C04A 2BH2A 1ORHA 2G8NA 4H0NA 3CJRA 4C08A 2IH4A 2YVLA 2ZULA 3DH0A 2PXXA 5EQJB 3I64A 5JUWA 5ICEA 3EMBA 1R18A 3OFJA 3BWCA 4QTTB 4FP9A 3FUXA 1FBNA 5C1IA 1VP9A 1KHHA 3KQMA 4X63A 1RI3A 2EJTA 4GOLD 5HIIA 3THRA 4E2ZA 4XUDA 3H2BA 3BKWA 5CM2Z 1RI1A 3KPUA 5K0JA 3K6RA 1SG9A 3UJAA 3IHTA 5DWQA 3DXZA 1XCLA 2PX8A 3NWEA 4ISCA 5K05A 2WK1A 1RJFA 4DCGA 5E1OA 3ER9A 2P41A 3A7EA 5E9WA 4CTJA 3G89A 1SQFA 3HVKA 2QYOA 3SM3A 3FZGA 4YV1A 3DMHA 3O31A 3PX2A 4XCXA 2I62A 2FCAA 5LQJA 1TW2A 3HVHA 4GOMD 3HTXA 3LECA 4NECA 1VL5A 4Y30A 2AOUB 2B78A 1G38A 2O0LA 5DM0A 2R3SA 2R6ZA 4C06A 3O7WA 3D2LA 2V7EA 5E1MA 3HCEA 5DSXA 4X60A 4GEKA 3ORHA 3OU6A 4GBED 4GF5A 3LL7A 4A6EA 3SSMA 3HA7A 4MHTA 5EZQA 1O9HA 2PV0A 3PFGA 1L1EA 5EEHA 3TMAA 4F85A 2GH1A 3QV2A 1R00A 1IM8A 3FUWA 3KQVA 3RODA 4MIKA 5K0EA 4PGHA 1MJFA 3BKXA 3G2OA 1R8XA 2VP3A 4RTRA 3FTCA 3L8DA 5EZSA 5EG5A 3CKKA 3A27A 3HM2A 3R24A 4AX8A 5ICGA 5DT2A 1N7IA 5G02A 3KU1A 3T7SA 3GIWA 1YZHA 3GDHA 2CMHA 2B9EA 5ICFA 4YMHA 5LQAA 1G6Q1 1KR5A 4EMSA 2O05A 1NBHA 3UWPA 2IDJA 1NW6A 3M6XA 2CMGA 4CXMA 2OY0A 3GU3A 3TM4A 2C7RA 3E23A 1EJ0A 1XTPA 3Q7EA 2JG3A 1RJEA 2PSSA 2QY6A 2P3QA 3DP7A 3M70A 4HC4A 1OR8A 2XYQA 3B3FA 4PYMA 4DMGA 5BP7A 1NW8A 4E32A 5E9QA 2HMYB 3MHTA 2PWPA 3OE4A 3KQSA 1JSXA 4XUEA 1X1DA 5DXAA 3TQSA 4GOND 3EVFA 1M6EX 5C0OE 4CKEA 2BM8A 4LECA 2AN4A 1YZ3A 2AOUA 3CVOA 5GM2A 3LDFA 4FT2A 2YXEA 3CGGA 4E2WA 2K4MA 5T6BA 4RTLA 2JHPA 2NXEA 3X0DA 3UJ6A 3G5LA 3JWGA 2C7QA 2JHCA 2O07A 5EVJA 5EKXA 1JG2A 3PVCA 1RI4A 5EIFA 1QANA 2IPXA 3JWHA 3EVAA 1YB2A 3ME5A 4PIPA 4AZSA 2I7CA 3KR0A 1JR4A 1INLA 3LCUA 3JWJA 1VE3A 1VPTA 2BR3A 3MQ2A 4E30A 1P91A 1B42A 3CJQA 1DCTA 4BLUA 5IKMA 4RTKA 4U7TB 4RYLA 4K6MA 1RJDA 2HNKA 2ONYA 2PVCA 3EVDA 4M7RA 3BGIA 4R8SA 3U81A 4AZVA 4EQZA 5GIPE 3KQTA 2XBMA 2Z6UA 4PNEA 3UBTA 5EMLA 1JTEA 1JQEA 1O54A 1VP3A 2OB2A 3DXYA 3T0IA 4RTJA 3HP7A 5FA5A 1AV6A 2IH5A 3KQYA 3MCZA 4QQNA 2AVDA 3EGIA 4F84A 2IFTA 3EPPA 4ER5A 1T43A 1WXWA 2B3TA 3KQQA 5EMMA 4XUCA 5E1BA 1UFKA 4BLVA 1QAOA 4PYKA 5T64A 2ZZNA 2FK8A 3A25A 5DTQA 5BW5A 1NKVA 3KQOA 1P39A 3NDIA 4FS8A 3HCBA 2YUIA 4C03A 3A4TA 2B25A 1N2XA 2PY6A 4PYNA 3LCVB 1JQ3A 5HIKA 3B5IA 5D1NA 5FWDA 4R6XA 4HGYA 1XDZA 5GIOE 1R6AA 2P7HA 3GXOA 2IP2A 5CUQA 2JHAA 7MHTA 4ATNA 4GUAA 5H02A 2B2CA 1ZGAA 3Q87B 4OQEA 3TPZA 3KR9A 2YXDA 3EVEA 2ZW9A 3ID6C 3WSTA 1JG1A 2VS1A 3I5UA 3BUSA 1XDUA 2CWWA 3SMQA 1I1NA 2LD4A 4RTQA 5K0GA 3F4KA 3DLIA 1VIDA 2P8JA 1VLMA 4DF3A 4HTFB 4BLWA 2IDKA 1X1BA 1JTFA 4A6DA 2PJDA 2BR4A 3PT9A 1EG2A 1KYZA 3CCFA 3GRUA 3M33A 4PYOA 4RVHA 4X61A 4IWNA 3MCTA 4KWCA 4RTOA 4HTFA 1NT2A 2JJQA 4PYIA 1X1AA 5EOVA 3VSEA 3AXTA 1NW3A 1QAQA 1Z3CA 5GOZA 4E2YA 2H00A 2ZBRA 4FR0A 5CCXA 3R9XB 2P1DA 3LBFA 1YFJA 5CVJA 3ANXA 1NW7A 1UIRA 5K03A 3FTFA 1HNNA 3P71T 2YTZA 2IIPA 1M6YA 1F3LA 5HEKA 3DTNA 3TM5A 4E31A 8MHTA 2HR1A 3V8VA 2P40A 5F2KA 5DX1A 5DPMA 3GCZA 5FWAA 4YUZA 1PJZA 5KQRA 3T7TA 3NVKI 1ORIA 4UOEA 2AOXA 2XYVA 3HA3A 1FP1D 3MB5A 3UZUA 4E33A 5KQSA 3PX3A 4R8RA 5CVUA 2Y1XA 5B1SA 1X19A 1D2HA 3KQPA 5KVAA 4GQBA 3IYLW 2OXTA 2PKWA 4HH4A 1XJ5A 4OA8A 3EEOA 1QZZA 1SVUA 5DRTA 3CC8A 1NW5A 4RSRA 4POOA 3BZBA 3GO4A 3LDGA 4LWOA 1I9GA 2FHPA 4RTPA 3A7DA 1NV9A 1AF7A 1F38A 1I4WA 2XVAA 2YQZA 5CVDA 3HEMA 5LQNA 3M6VA 3KHKA 1AQIA 2ZIFA 1MHTA 3V97A 2ZBPA 1AQJA 4RTNA 2PGXA 1Y8CA 3M6WA 1D2CA 2AOWA 1ZKDA 2QM3A 3P2IA 4RVFA 1L3CA 3GRYA 2QE6A 2I6GA 3C6KA 2ZLBA 4R6WA 1VBFA 1NBIA 1WXXA 4HSGA 1SQGA 1X1CA 3AXSA 3DMFA 4P7FA 2V74B 3DMGA 3MGGA 4CTKA 5EGSA 4PIMA 3EGVA 2GS9A 2ESRA 4PYLA 1SKMA 4PINA 4RV9A 4GC5A 4BP3A 3T7RA 3GRRA 4Y2HA 3IEIA 5GWXA 2ZBQA 5EEGA 2ORED 5IH3A 2O57A 2NP7A 3MTEA 1WG8A 2A14A 1ZHFA 2ZWAA 5K0NA 4PCLA 1EAMA 4PONA 5E8RA 4C4AA 1RI2A 2XYRA 2ZFUA 3BWMA 4QPNA 4KDCA 2NXCA 4QTUB 3G7UA 1RJGA 3GGDA 4M36A 5FQOA 3VYWA 5K0FA 4QQKA 4RTMA 2HV9A 2UYCA 3G8AA 3OPNA 2PXAA 3DOUA 1FPQA 2AOTB 3ELDA 3HCDA 3KPYA 3BXOA 3CJTA 5DX8A 3DULA 5F2NA 3B3JA 2H11A 2G72A 3C3PA 5ICCA 4X1OA 4KIFA 4G56A 5JR3A 3TFWA 2NYUA 3GNLA 1P1CA 3R3HA 3MERA 3LCCA 2P3OA 4JXJA 4X41A 2AOTA 2PT9A 3E8SA 5CD1A 3S68A 1FJXA 5GINE 2AR0A 4KRGA 2XVMA 2PX5A 2ONZA 3GWZA 3LGAA 4IKPA 2VDVE 3PFHA 4EVIA 1DL5A 2Z6AA 1KXZA 5C9ZA 2P3LA 3TRKA 2IH2A 3RIEA 2GB4A 4M37A 3PTAA 1G60A 3UJ7A 1JQDA 3FUUA 1L3IA 4F86A 1WY7A 3P9IA 5DM4A 5FCDA 1NV8A 1O9GA 2YR0A 3C3YA 2OZVA 4L7VA 5K8VA 5E1DA 3HCFA 4CKBA 1JSZA 3FYDA 4P58A 5P8WA 3UJBA 3B7PA 3GRVA 1BKYA 3SVZA 4YUXA 2QRVA 3I58A 5FHQA 3GJYA 2E5WA 2GAFA 2ZZKA 3FTDA 4P7JA 4BP1A 5U4XA 2OBFA 3HCCA 2OKCA 5DXJA 5FADA 4QVKA 3PS9A 2NXJA 3P2EA 5LQKA 4YUYA 1SUSA 4PWYA 2IGTA 3NDJA 3EVGA 2JH9A 3O4FA 4C05A 3NWBA 2FPOA 2ZIEA 4RTSA 3ELUA 2FYTA 3AJDA 1G8AA 3C6MA 5D1HA 1HMYA 4Z2YA 3KR2A 3BGDA 2EG5A 3ER8A 3IV6A 4LG1A 4LWPA 3VC2A 1P1BA 4FZVA 2QRVB 2FRXA 1KPHA 3CBGA 4QPPA 4RWZA 3LX6A 2Z6QA 2F8LA 3QOWA 4P7GA 4ER0A 4EKGA 5DM1A 5CCBA 3NJRA 5EPEA 1KPGA 3P97A 5FULA 1YFLA 2OPBA 2CKDA 3KPVA 1IY9A 1YUBA 3SXJA 4E70A 2C7OA 2ERCA 2G1PA 3TOSA 3NMUF 3G2PA 1TPYA 1BOOA 3BWYA 3UA4A 5LQUA 4HG2A 3TKAA 2AVNA 3BT7A 3PLAE 3OZSA 4RVGA 2GA9A 1KPIA 2PX2A 2Y1WA 2WA1A 3M4XA 3K0BA 1FP2A 1JG3A 3OZRA 3NW9A 3FPEA 2DULA 4FT4A 4RVDA 4YV0A 4BY9E 5EIWA 5K0CA 2UZ4A 3EEYA 1RI5A 3I9FA 3LKDA 2EJUA 4FSDA 4HRAA 2N47A 3ELWA 1QAMA 4O29A 5GP1A 2ZVJA 2G71A 3OFKA 3UFBA 3UJ9A 2NP6A 5GM1A 3VC1A 3FPJA 5K01A 2O06A 3SGLA 3E7PA 1EJ6A 4RX1A 4DZRA 5LQCA 1YF3A 2DPMA 4DQ0A 4KIGA 5EC8A 5DTMA 5DX0A 2ZSUA 3FYCA 3UJDA 4CWAA 4E2XA 4PYQA 3SSOA 1UWVA 3LKZA 3MAGA 1ZG3A 2ZCJA 5HZMA 3NTVA 4GOOD 2JH8A 4ER6A 1EIZA 1WZNA 3TR6A 3B89A 3DXXA 2ZWVA 5FUBA 1XDSA 3RW9A 1JG4A 3P9KA 5FHRA 3EVBA 2BZGA 3G2QA 5DTRA 5HOQA 2GPYA 2KW5A 2WA2A 5F2OA 5CVEA 2BR5A 3FPHA 3FUVA 1WS6A 4MTLA 2OB1A 4OX9Y 3FUTA 4QVGA 1V39A 2BM9A 3B3GA 3LHDA 3REOA 4OQDA 3DLCA 5KYGA 5T67A 2P35A 2FK7A 4KDRA
chains in the Genus database with same CATH superfamily
2Q41A 1SKYB 4MIEA 4KR9A 2DFDA 3HVRA 2F62A 4MA4A 1NHWA 1XVTA 4IMPA 1GNTA 4NEQA 4OFZA 1X1QA 2DUWA 3J81A 2FKNA 4XIYA 3KBBA 4XXHA 2Q4BA 5J63A 2UYGA 2D1RA 3N8IA 2MSKA 2QVYX 4KH0A 4EB6A 4PF1A 2GUWA 2R85A 3ESDA 4J2HA 1L9KA 1UMKA 3ZGYA 4BLSA 2N1BA 3N5KA 3SF8B 3TQQA 4O8ZA 4CW7A 3H11A 4OLAA 3ZWAA 3RJZA 1ZEMA 1OFUA 1A97A 2PXCA 3I2KA 1T2FA 3LDUA 3PITA 4YQFA 2PS9A 1XVAA 4ZFNA 3JRXA 5JJKA 4EYSA 1TAUA 4CMGA 2PRYA 4FHEA 4ZO6A 3EA0A 1T8WA 3KR1A 5KMGA 5EXXA 4DILA 2WD8A 3DC7A 2YWGA 2R4TA 4P3YA 4F5ZA 2VXOA 1R9JA 1E6CA 3SBXA 1TQ6A 5F7OA 1RC1A 2ZIGA 5AO9A 3JYOA 1UBMS 2GTPA 3KTAB 4QDUA 3TZBA 1NVAA 5J2UA 4JROA 2B4QA 5HTOA 1A98A 3QHAA 3IOYA 4I4NA 1ZGJA 1UDXA 2YHAA 4IV8A 2OD2A 4G0QA 2J1LA 2QAIA 4Y9SA 5AM4A 4ZOQI 1RLJA 3D4BA 4OHKA 1VQ1A 2XOKA 3KOYA 1PI3A 1A7UA 4PCAA 1LQ2A 3MWEA 1QTNA 1X38A 5F9MA 2EIHA 2NWQA 3RKUA 1YRYE 3LHKA 1Z18A 1PHPA 1CUFA 4XPZA 5DRYA 1PD1A 1YU6A 4GHWA 1CZKA 4UE6A 5JATA 2YOHA 3D0QA 4QHTA 1P2TA 1G8SA 1ZWLA 2OFWA 1C3EA 1T91A 1J8QA 3DVAB 1M2HA 1O2DA 3WV4A 4WNAA 5JQGA 5DYNA 2QX4A 3OESA 1EBFA 5IJ9A 1O03A 1OIXA 2FWJA 1H1DA 1P4JA 1ZH0A 2QU7A 5LP6C 1YRQA 2G70A 3HYCA 2A33A 3SKYA 4EKIA 1ADJA 2IYAA 3IIKA 1IQ0A 4PRKA 3D59A 4DDMA 1QK3A 2BFDA 5AXDA 4TVOA 4IHQA 1WAMA 3ZBPA 2I22A 3CLTD 3KL4A 4ONEA 1UOQA 3BTUA 3GGCA 1N92A 9MHTA 2GJ9A 1RYHA 3VH1A 3RUDA 1BNCA 2WU0A 3F6CA 3MXTA 3UK0A 3EUFA 1KORA 4KQHA 5H9WA 3RTBA 2QQ5A 4H35A 4LTDA 2XQGA 2VNSA 4GDMA 1P7YA 3CLKA 1I33A 2XSZA 4FS3A 2CE2X 2G0NA 2ZBVA 4EG4A 2IBSA 4Q7KA 1KH2A 2RCNA 2GK7A 2OYRA 4HNVA 5A05A 1MG5A 3NHZA 4DMLA 4PPYA 1Y48E 2QW1A 5HBGA 2YVLA 4UU0A 2GHTA 2PX0A 2Q4EA 2PX6A 4HR7A 1RMTA 1TEXA 1AX9A 3DT6A 3TTYA 5BNZA 3LC0A 3JQEA 1JU3A 1SHTX 3NZEA 4B76A 2VPZA 5B1YA 4BNDB 2V8OA 1GPUA 3T1QA 3P9YA 1SVNA 4XUDA 3H2BA 1YRBA 2BJVA 4IIJA 4JXZA 2W6PA 3EZXA 3U6BA 1UJ6A 1YR6A 3NDBB 1KJWA 1O95D 1MEOA 2YHSA 2Z1NA 3MQFA 1IBRA 2ZDHA 5AVXA 2WK1A 4BPBA 4IBOA 4DCNA 3UXMA 2XUJA 1YQTA 4B6RA 3TXAA 1FL9A 3OTGA 5AQEA 1ZX1A 3R8XA 4ZT7A 3TSYA 3CRW1 3N0VA 3WP0A 7MDHA 1U0FA 1JBQA 4QQRA 1WU7A 4EIWA 1XZIA 2IU4A 3D8NA 5D87A 2RC5A 5DE3A 5LUAA 1AH2A 3LX4A 4FDLA 1CUXA 1XHFA 2HM7A 2A5GA 3EAFA 4FJ0A 2AFIE 2VP6A 1DI0A 4NONA 1ID8A 2MSLA 1F5NA 1NJ1A 2BMEA 1Z7BA 1ECCA 2Q9UA 2V7EA 3GFVA 4IF4A 5AHOA 3ORHA 4BGIA 5C8XA 1RRGA 2ZAOA 1M8FA 3EQ6A 3ZDRA 2W0SA 1O6FA 5DGTA 3RUPA 3NO4A 3O83A 3AY7A 2RGGA 2HGZA 1KMMA 3CRNA 3DE5X 5DI3A 2ZRMA 3WJAA 4MDEA 1EFUA 1UBHS 3HJUA 2O5CA 3TR5A 3PDJA 1WDTA 1ZNQO 1TYAE 2CBZA 2IUYA 2IIVA 2YJ6A 4WZBA 3TMAA 4OYLA 2PAFA 2ZI7A 3HXMA 1XTVA 2QEQA 3RODA 5C8VA 2AX4A 2HUNA 4NNPA 1K06A 4N47A 3KOMA 3NATA 4MW1A 3FTCA 4RHEA 2NUTB 1QQTA 3R24A 5KJFA 4L0MA 1RXUA 3D0RA 3TZ6A 1FYDA 1T0JB 2ZBGA 4ETMA 4F2HA 3TQHA 2B9EA 1II0A 1G6Q1 3DZJA 2ACKA 2HC9A 4HWGA 1W25A 2XJ9A 1NW6A 2WSMA 3MWLA 1D5WA 3T3IA 4NU0A 1SEVA 4B7AA 4W9NC 4EY7A 5LN1A 2JG3A 5D84A 3G6WA 3D2CA 4HDNB 3P9XA 3G0DA 4AKSA 2Z98A 3WGGA 3L7JA 2RHHA 1DWQA 3PNSA 5G1NA 3ZI7A 4ALMA 1IIRA 5L7WA 1W36C 4DV1B 1P8AA 2JBAA 2XGOA 4FI3C 3RC3A 5F1YA 1WKBA 3IOMA 4XVCA 2PMCA 3QBVA 3UF0A 3U09A 1ZI9A 4OKIA 2CHEA 1F8YA 1YL6A 3OUTA 5DYWA 1H9AA 4WFIA 5IC5A 2G4VA 2XQJA 2PGIA 5F1PA 3CPJB 4E2WA 1LD3A 1JH8A 1EFRA 5TSDA 2VQFB 4TLAA 4HNAB 5DTEA 1QV9A 1W44A 2QPLA 1UPTA 3BIXA 3RLFA 4JJZA 3FRJA 2AYZA 4MVJM 2FPSA 2QNRA 4KHZA 4TMWA 4AIRA 1H9BA 2QPOA 4WNCA 5B64A 1W5SA 1R0SA 2NSDA 4KI7A 3KQHA 2G1JA 5JSHA 5IG2A 3RV3A 4B3CA 2HLDA 3H4VA 1XF1A 4AX4A 2HNKA 2PO7A 5DIFA 1N2BA 5JG7A 1EDBA 4AZVA 3WNVA 4HB0A 1Z45A 4LX0A 4RY9A 4KQWA 1G17A 4XWTA 3L6BA 4LF5B 5CA1B 1VP3A 2E4UA 3DXYA 3OX1A 4WKOA 3ZTTA 3ZDZB 2OECA 4DY4A 1MB4A 4RE5A 3ZW8A 1KEKA 3MCZA 4BL5A 2FWBA 1N2CE 5FJIA 5JASA 1PGOA 1YIAA 2B0JA 2WYOA 1GHTA 1KP2A 1IZ8A 3MJHA 1Y7PA 3ES9A 3PWTA 3H6GA 1G6HA 3C5CA 1TO6A 1FPMA 4PVCA 5AI4A 2XODA 3UTDA 3W9SA 5CH3A 3M8KA 3KRTA 3KVVA 1KDZA 1HX7A 1G41A 2L0XA 1WVGA 1MC1A 3F98A 5TJ9A 1SCNE 2O3TA 1R8SA 1C3OA 3LCVB 4GS5A 4IXTA 4W8OA 1U81A 5U9CA 1IBCA 2D2VA 4KIUA 3MAJA 4GLLA 1LI4A 2TMDA 4HGYA 4MI9A 3IURA 4RGQA 1E0SA 3R9WA 4Q3OA 3OA0A 3PUZA 6Q21A 2B2CA 4I1OA 4OIFA 3EG9B 3I04M 4OUDB 2OAGA 5JH7B 4AURA 2L82A 3N0XA 3IDQA 2QRUA 4OJTA 2OFFA 5BPHA 1XDUA 4KXVA 2WJIA 4CDRA 1FRFS 1W1IA 1S5PA 4JSTA 2ONJA 3I4LA 1KE1A 4X20A 1KK2A 2Z83A 1PFWA 5KYWB 4MDYA 1Y5MA 1ULUA 3N05A 4MV5A 4BNMA 5G4LA 1IZ9A 1CJTC 1LW6E 2X6RA 1SRQA 3ZLTA 4GD3Q 1TZCA 1R50A 1BS1A 1IB0A 1ZLYA 1P72A 1A2KC 2XMCA 4RVHA 1C9NA 3MCTA 4N5LA 2BHSA 1W46A 1CP2A 4O5OA 3URMA 3BMCB 2GERA 3VSEA 2QR2A 4DYDA 1SPBS 1E7SA 1ZW6A 2VHYA 2I1VB 4JLVA 4H1TA 4LHSA 2XRFA 2CVHA 1SZJG 1RQGA 3ZXSA 1SELA 1VKHA 4P32A 3QHQA 4QHYA 2NZWA 2Z8ZA 3ICCA 5T4BA 3TM5A 3ZW7A 5HEKA 5DNAA 2XAUA 2YZ2A 5A06A 5AKYA 2P40A 1DFGA 3NHPA 2L2QA 4KQGA 4QGGA 3BJMA 1N7GA 4KN6A 4U6SA 4LF4B 5IAOA 4RJKA 1ORIA 3ROQA 5L51A 1YCHA 2QTVA 2P5YA 3GXBA 1PJ2A 2IEZA 2VT6A 4IUDS 2Y1XA 4P3KA 5JD3A 1RWWA 1QIKA 3NBMA 3TZCA 2AMYA 3H9GA 4OA8A 1COWD 2J3KA 2CVZA 4HWPA 4C3UA 3PSHA 1C8KA 3H5TA 3U31A 5T4EA 5DASA 2JVIA 4QUBA 1U7XA 1P2SA 2Z3WA 2PZBA 5A04A 4GBJA 1NVKA 2WIBA 5FUVA 2PRKA 3WG9A 1U8UA 1QIIA 4LCEA 1JDZA 2ZBPA 4NVRA 5T3YA 1CFJA 3V97A 5IZCA 3KYDB 5ECDA 7ABPA 1L3CA 1MAHA 1TA9A 2V03A 4M9CA 1N8NA 3PFBA 4RY8A 3Q8XB 2I1LA 3IKVA 4F4HA 3ZFRA 2VXBA 1GPKA 1H4VB 3ILVA 3EGVA 2GS9A 3NBKA 3UWKA 3GLIE 1SKMA 2I29A 3U39A 4KAXA 1U2EA 4EY8A 4EBBA 1KFBB 3WGVA 4U4AA 2QTZA 3LNCA 5GJWC 2A78A 3KB8A 4C2BA 1BXGB 3ZIUA 1XP8A 3QVTA 4PONA 3H2GA 2WV7A 4W1QA 1HNXB 4QTUB 1Z12A 1I0ZA 3FGNA 4B6OA 2FZWA 2WM8A 2DFVA 4GU5A 5TQ2A 5B4UA 2UYCA 3OEWA 1Q21A 3HEBA 4ZJPA 1B1CA 1ZIDA 3Q10A 4X84A 4CKZA 2NZ2A 2WTUA 1GPYA 1UBUS 3WWZA 1O6CA 4KIFA 5JS2A 4BV9A 4EUNA 2CNDA 2M1XA 3A58B 1AKWA 3VHLB 1EMDA 4YAUA 2QQ0A 3OCXA 1ZQ1A 1JLHA 2GN8A 4JASB 4CMBA 2QRMA 5B1DA 3DEFA 4R8KA 4II2A 1RQ7A 4ENQA 1J0DA 2QM0A 2AR0A 3A2MA 5DHQA 2Z6AA 1E2UA 1PQPA 4GZ3A 2RCYA 2P1RA 5BYJA 2P2LA 3K2EA 4UUMA 4CF3A 3DFZA 3WXMA 2IH2A 3M4YA 3CNLA 2GWHA 4CE6A 3ZFTA 1QFXA 2C03A 3PRHA 1VJ5A 4R84A 3GQBB 4O2AA 3ZY2A 1OLUB 4R5MA 4PXYA 2QRZA 1JSZA 1XMXA 1PGPA 2CWDA 3OTHA 2FUEA 1LLQA 1AM4D 4JB3A 4KYTA 5K0TA 3PFNA 5JISA 1TL7C 2HRZA 2HU8A 2MSEB 4EG0A 5BN1A 3ESBA 5IJAA 4C78A 4JLPA 2JJYA 2F1IA 3RYIB 1TAHA 2HDWA 2OD9A 2I4LA 2OOKA 1GU1A 1GQSA 3PD1A 5F4BA 1OASA 2PKEA 1NMEA 3LO5A 3EMVA 3N8HA 3NDJA 3PC3A 4LYFA 2OYCA 4YK7A 5CA1A 1DQNA 3BWXA 3QKSB 4EFKA 4ILEA 5CPBA 2X9NA 3FVWA 1E2MA 2Y2VA 3BHIA 1G5RA 2X8AA 4P33A 3SQOA 3TOZA 1M34B 1V16A 1ENPA 3IV6A 4TYPA 4B4DA 1F0PA 4GKVA 2XVXA 1TC1A 5SICE 2QTCA 4UVEA 5C52B 3HABA 1W2HA 4UM5A 1L5QA 3NWOA 4AJKA 4YCMA 1TZ2A 4TN5A 2PHZA 4P7GA 3IRUA 1NXSA 4DDKA 2R68A 4Q48A 2OHFA 4V38A 2EFHB 1AO3A 2IW1A 2XZTA 4NHOA 5AJWA 3VQTA 1E4OA 1V4NA 2I8LA 4CV3A 5DI9A 4YY3B 1JKIA 4ID3A 1OQAA 1DWUA 3W8NA 5A0VA 1JILA 2XEXA 4HB3A 2P8SA 2PMEA 5AT1A 4MAFA 4GMDA 3QKWA 2F2TA 1L6RA 1OMOA 3FSRA 2B9VA 3M4NA 5CDFA 2XGSA 5JWRA 3A3OA 1RZRA 4CF7A 2HDNB 1H94A 2GA9A 2F64A 2O19A 2R00A 1E7WA 5K99A 2J5KA 2Y1WA 1DP4A 3EZ2A 1RBYA 1Z36A 1P0IA 4Z4EA 2B1IA 2GJSA 2LUOA 3OZEA 2VZ0A 4G1EB 4Q9DA 2FLWA 3FOWA 1DCFA 5TV2A 4KR3A 4MWGA 5FYQA 2XKKA 2CLOB 5JXGA 2TS1A 4Q1FA 1D09A 3K73O 4WLNA 1C9JA 5HX7A 3A1NA 4MV7A 3VV3A 3CM0A 3LLMA 2ERXA 3ZY4A 5L40A 2F8TA 3D4LA 4OHPA 4J0CA 1TQ4A 4UREA 5C5EA 1DAHA 1N2IA 1U8AA 1YB5A 1BMDA 2H0AA 5LZ5A 1UKBA 4OXRA 4EA8A 4EL5A 1Q84A 1JEOA 2QAGA 5TXGA 4JNCA 4ZVKA 3ZV3A 3LXXA 3BCSA 3KLBA 3FCUB 3P96A 4JIMA 4ZN6A 1U3UA 1KARA 1JEQA 1TIKA 2WRZA 4X24A 1E3DA 2FE1A 4MDHA 4JU9A 1SHZA 2NO4A 2X23A 4MKXA 3B6EA 3FJOA 3KXIA 3ZHUA 3VBCA 1F8UA 5MF6A 5KCMA 4Q1VA 1U7UA 2D0OB 1HZJA 2B1JA 2YC2C 1A96A 2BZGA 4X94A 4BZXA 2PKQP 3AETA 4OH1A 1L4LA 3H87A 4LIPD 5DTRA 2IWHA 4KO4S 3ZE1B 4AUNA 3T1TA 2W42A 5A5VA 5F2OA 4Z53A 4LZJA 2FZGA 5GWXA 1DAMA 3FPHA 3IPXA 4UTVA 3BF7A 4HV4A 3KFLA 2INGX 3KC2A 1Z38A 4UOZA 2VDMB 4R4JA 3B6KA 2FKAA 2OHOA 1JE0A 3JVDA 3LHDA 1M8GA 1VG1A 1R5OA 1Z2OX 4GYWA 2OZLB 4ZT5A 4Z0NA 4IJUA 2J41A 5LZ2A 5JYEA 1ZC3A 2DWUA 4S1NA 1PKXA 1V3TA 2DPGA 3GZTB 4HH3C 1BFKA 4K9KA 3CA8A 4Z99A 5E2AA 1RLTA 1YBAA 3BDIA 2WDZA 3MF4A 5E6RA 2FWMX 5KYVA 4R1PA 4PQEA 2EX0A 3EDQA 1VLJA 1O95C 1I4TD 3U5TA 6NULA 4DRXA 1A9TA 4FC7A 4O2BB 3T1VA 2PX4A 5BQPA 1UP4A 4MCAA 4ALNA 2I03A 4KK4A 5FNVB 2QZ9A 5TPWB 2YBDA 4NCJA 4QUAA 2CV0A 1M0EA 4LRTB 1TYDE 3DWEX 1EP9A 3G2MA 1YHZA 2NVUA 3VI3B 2QSZA 3I8OA 2HJGA 3H2KA 4LHEA 3LSTA 2WKWA 5TGDA 2LBPA 1XDWA 1T29A 4LMRA 5L3RA 2NZ8A 3WIVA 3FPFA 2B30A 3GN2A 3NHWA 3FLMA 4YRDA 5HHTA 3I9LA 3U16A 2Q4TA 2ZTHA 4H0CA 1W8DA 4Q4LA 3PFWO 3S1SA 5EHQA 2E89A 1NUHA 5D5QA 1JXAA 2ODWA 5EMNA 1IEWA 4ZAXA 5DLQC 1G55A 4WNIA 1PJBA 4IJKA 3QVJA 2H2FA 3V46A 1C30A 4I55A 2YH2A 4P98A 2GOYA 4YRFA 2YIMA 5H16A 2GHIA 4AZWA 4RK7A 5DNEA 2H2AA 4YBZA 2J59A 1R8YA 3NAGA 1MT0A 4RQTA 1J2YA 3G1WA 4KW7A 2IX9A 4KQ9A 4GLJA 3WV5A 3ZVLA 2X7HA 3KKMA 2D0PB 2F1OA 2PUHA 4CT5A 5CD9A 2ZZMA 4Q4HB 5FLYA 3NU1A 3F0TA 1UM8A 3C7TA 1YRAA 3WRVA 4B73A 1KI7A 1YCGA 1UMDB 2YMQA 5LBUA 2VAPA 3F9CA 2I6UA 5BR7A 3IUMA 4EDFA 1HA3A 3MWDA 5CLLA 1WVMA 3NTRA 4K6FA 3G7SA 3MJCA 3HVIA 2H9YA 3QSGA 3DOFA 3KTOA 2FR8A 3R0QA 2GUGA 4ND2A 5A1JA 3D7MA 4KQ2A 2A9QA 1JFFA 4IFTA 2YJ4A 2HB6A 5L4SA 2O8EB 3OI7A 2ORWA 5EHGA 5K0BA 3IVMA 4FE4A 5TS3A 2VDRB 3JQCA 2COEA 2HK9A 3U37A 2YV4A 1BC5A 4E11A 1XFAA 1E89A 5G0UA 1NXWA 4MWZA 3LPMA 1P74A 4DR1B 1IM2A 4NZNA 4ZPXA 1DKLA 1U04A 4KDFA 1XTKA 4U8HA 4FCCA 2VAWA 3G88A 2I2BA 3CTPA 1XEWY 1L4GA 4BNLA 2FPLA 1IUOA 2H1SA 1MIOB 1EK1A 2NSJA 4M98A 3VISA 1KO7A 1M2OA 1Y8RB 2W48A 4ARSA 1S8NA 3BF8A 2IHTA 3O8RA 5FPQA 1XT6A 2AI1A 1BS2A 3KLMX 4G86A 3RARA 4TS1A 3HC7A 2HX1A 4Q9JA 3EE6A 4J6EA 2PH3A 4FP9A 4YAEA 1ZNXA 1JJVA 4OVKA 3V4RA 1O6BA 1U5AA 1S6YA 2EJCA 3DUFA 4HVCA 1MMFB 1VP9A 3ZNPA 5AM0A 5C7OO 1A9XA 1RTKA 1XYYA 4OGLA 1CX9B 3K6RA 4D4IA 3QUTA 1GSIA 3FOCA 3VJRA 4Q19A 2GXUA 4J1NA 1KH3A 1E5QA 1YVUA 3IMKA 4XIJA 3A7EA 4GZ6A 4I9UA 3ROEA 3UCEA 1KSFX 4A92A 1Q0ZA 1ZRMA 3K7EA 3W6ZA 4BB9A 2C9YA 4M7PA 3MT9A 5LU8A 3CZ4A 2RONA 4ARVA 2I62A 2JCYA 4F11A 3RADC 2GCPA 2F3PA 5FPYA 5I9SA 4X92A 1QRUA 1DJMA 4NECA 4EB3A 4GVXA 1KI3A 4HT3B 4MVJF 1YD7A 3M5DA 4UCWA 4ZYXA 2O0LA 4Z1OA 2EATA 2R3SA 2R6ZA 3DMTA 2XD4A 4MGZR 5E3HA 4WZBE 3JPYA 1GQYA 4YUAA 3QG5A 2ZRCA 3PIIA 2YWRA 4HS4A 1Y9JA 4WE3A 1JAIA 3RFCA 1V6SA 1KL7A 5LJIA 1C0LA 1SZDA 1SVOA 1FF9A 1XRSB 2DLNA 4GF5A 4C7XA 1WXFA 3N8NA 4BMCA 3HY3A 1P5RA 1ULHA 1SUDA 4FUTA 5FX2A 3BIFA 3MRSA 1TRKA 2F1HA 1FUKA 4C1NA 4NYIR 1P8JA 1A77A 3DL7A 4RLQA 4WH0A 4JHXA 3JQRA 1H93A 1SY7A 4ZT3A 3RR2A 2VYND 3PRJA 4G01B 3LOPA 3LNTA 4DSZA 2LCFA 3FM9A 1L1FA 4RTRA 3D9QX 4M8SA 3T15A 1Y63A 1DQYA 1KO4A 3FUCA 3TVYA 3CKKA 4BJ3A 1X0VA 2ZE7A 2DR2A 2QRJA 1UZUA 3T95A 3RK4A 4EGAA 2VHZA 3G5MA 4QNNA 3ONVA 4G9GA 2BFCA 3L9WA 1DJQA 5B4VA 1D8TA 4I5IA 4EOGA 4EJ2A 3ANLA 4QEZA 3ZFQA 2XUOA 3N9IA 2DM6A 3Q2KA 4OAPA 4PBRA 2CNLA 5BRJA 4PYMA 3UHJA 1OR8A 1SU7A 2BGMA 4NHEA 5I9BA 5JNUA 2ZUEA 3MS7A 3SS8A 3S2FA 4AVYA 3QX7A 3W6NA 4C5CA 2HMYB 1EZ1A 3ZQ6A 3L05A 3OE4A 4PV7A 5CIWA 3NTQA 4YRBA 2OENG 5JNVA 2ZJZA 3OF3A 5HJ7A 3VR4H 4HX5A 4JBWA 4NBVA 2WUFA 1ADCA 3INTA 2EKQA 2FOLA 3CCBA 3WOHA 2WPNA 3Q7PA 4NKRA 5FUXA 3UUFA 4RTLA 5JCOC 4DA6A 3TR0A 2B4AA 3BS4A 2FUNB 1VJRA 3F6RA 5H81A 5EQJB 5JAHA 1X42A 2IDZA 3H6KA 4TLEA 1ODSA 5I7AA 4YT4A 1RI4A 4J3NA 2JL1A 2XH8A 3LDHA 5C1PA 5TQ2B 5LZ7A 3TSWA 1A8SA 3V6LA 3ROPA 1VPTA 2HXYA 1FTYA 1XU4A 3U2QA 3V4LA 1PFVA 5HYVA 2JGMA 3L77A 1URPA 3PGMA 2R1TA 4YECA 3KJEA 4B82A 2BZSA 2QD2A 1HDCA 5ALMA 4N6NA 4L95C 4IIJF 5KNLA 3UT0A 5HS6A 4R0NA 3R9KA 3PC4A 4BX0A 1OILA 2WHRA 2OK8A 4F9FA 1NDHA 4YXWD 4ZMSA 3MN1A 5ESDA 4B3MB 1WZUA 2R84A 4BVEA 2Q8NA 1FXWA 1LU9A 3Q88A 4HDMA 3VVBA 2C61A 2C5EA 2B3TA 3LOQA 2F3SA 2Y1LA 3G2KA 1EJ2A 4M1YA 2GFHA 2WIJA 4LAFA 4MQFB 4B33A 3I42A 2XNHA 1LW7A 3SM9A 3C5WP 2XMZA 2BAGA 5KQMA 3T5TA 1H22A 1HRDA 2O20A 1E98A 1JDNA 3DCYA 1OXXK 5A5GA 5ITZB 1OFVA 3IV9A 3ZVNA 4EJ0A 5FWDA 1GARA 2VYVD 1UBRS 2B1QA 3MLAA 2ORYA 4J7UA 3ZC3A 2BGWA 3L9XA 1O94D 5F1OA 4QEKA 3WK5A 5L8VA 1Y6FA 1Y1QA 1TJYA 2IVFA 1M5UA 4P4SA 4N39A 4WERA 4MCHA 4EECA 5CXSA 3PDIB 2EDCA 3WDKA 1JG1A 3WSTA 4G25A 2PL1A 7REQB 3DP9A 2W2MA 4KUGA 2NMVA 1IRIA 5H4HA 1NMZA 1E7YA 1XELA 4YJHA 4HXGA 2CWWA 5I7RA 5BMOA 4HVLA 1P7WA 9GPBA 3EDCA 1W96A 2FRVA 1FUEA 4HTFB 5AOCA 1SRRA 4PFSA 3FKJA 2RFLA 1REQA 3L7CA 3HZOA 3KEOA 1CHDA 4OFBA 4A6DA 4D9IA 3OMWA 1X3SA 3KELA 1LLFA 2CD9A 1ETUA 3PT9A 1RWKA 2J0VA 3FOEC 2J4DA 1BVRA 1L7BA 1QFYA 1Z0UA 2I2FA 4UAUA 1Z4MA 2C29D 1K68A 2FFAA 2JJ1A 2SECE 3P0RA 3QI7A 2ZWPA 3NIBA 3LT5A 4PG6A 1L5KA 4FMDB 4F5DA 5JC1A 3FCYA 4AQYB 1NW7A 4E21A 3A05A 3KHTA 2VRBA 1ISHA 1U02A 2WHYA 2VK4A 4B43A 5AH0A 1ORTA 2IIPA 3WIBA 1ZAYA 3AB7A 1NGSA 2CDRA 5FA6A 4DB2A 3WR5A 1VM6A 4LZLA 2YFKA 3DNMA 3IAM1 2H9IA 1ZA2A 2AR9A 1NKSA 5JZ9A 5JS1A 1RABA 3WIDA 1TM4E 4BATA 3O0DA 5F51A 1QONA 3TLGB 4D4GA 3NEPX 1B23P 1MIHA 3PDCA 1EQUA 1CT9A 2GGSA 1GZVA 4RMIA 4FR2A 5GJBA 1W47A 3GDFA 5AUQA 4GOXA 4BHTA 2F7SA 2C07A 2F48A 5T4FA 1NW5A 2PA0A 2WF9A 3HGTA 1FP4B 3BXXA 1WXEA 3LDGA 2Q4RA 5D86A 2WWIA 4P92A 3B78A 4Q4CA 2Z3ZA 5CBPB 1K7XB 3HEMA 2HIGA 2D06A 3P2MA 4X00A 3ZDCA 3RJMA 1IN7A 1AQIA 4ZRMA 2RHJA 1QHEA 4BO3A 1KJJA 3C3WA 3L84A 1YDFA 1WE2A 1GRNA 5L45A 4J0QA 5K8TA 2QE6A 4OPMA 5DCWA 1KJNA 3RUAA 2ZLBA 4R6WA 3S8MA 4DSAA 4H7KA 5I5EA 2XB2A 1V45E 1SXJD 4TKZA 3IDZA 3BMNB 1OC2A 3RFUA 3R9XA 5IRCD 4PIMA 2HO5A 2H1FA 2QL5A 1HF3A 3ANTA 3BCHA 3WBJA 3G9UA 4KE6A 2AN1A 2WI8A 3HU2A 2QLFA 1XZDA 1Z0KA 3ENVA 1CY6A 2OBBA 1I30A 2WE7A 4R81A 4LFBB 1U1DA 4N76A 1FTNA 2NU6B 5LIRA 2ZFUA 3TD9A 2EJVA 4TKVA 1KEEB 3DAOA 4L4XA 4RA9A 1ECGA 4Z8YA 1C1DB 2NVWA 3FI0A 1DC8A 2ICAA 2IU3A 3DOUA 1FPQA 1MV8A 1N1MA 1SR8A 2PNJA 2GHRA 3CJTA 1T4CB 5DX8A 1D6NA 3QLUA 4I6GA 2A0YA 4QGBA 5DNDA 1R5JA 3YASA 1W75A 4CM4A 5IC4A 3UXHA 4HEHA 1DTWB 1ZH4A 4PC1A 5A4IS 3P5SA 3C85A 1QQAA 2P3OA 2QSJA 1E2QA 3OJLA 1ONSA 1ZNYA 3SLRA 3MTBA 3OC6A 2HRDA 5LD2B 3N8DA 5DP2A 2XT0A 4H4DA 2CCJA 1Z63A 4IX9A 1VGRA 1VLVA 3UT5B 3LBIA 3SJ7A 3R3JA 2H4JA 4LHYA 2X2EA 4OHFA 3D4PA 2VPIA 4MRVA 4ND6A 3LTEA 4ZJYA 3CZCA 4K1XA 2YR0A 5K8VA 3DV9A 4FKZA 4M1SA 4CKBA 4DG8A 2PVSA 5AXBA 5AW5A 2ZYUX 4YNBA 1QP0A 3FBWA 5JCXA 2GAFA 2ZJYA 3EA5A 2ASEA 4CHTA 3I2JA 1DBVO 1M7HA 3HCCA 3QEBZ 1ILWA 2XCQA 3WJ7A 1EFKA 1VSBA 2QD4A 1TF5A 3H3XA 3DBRB 2K7ZA 3I6ZA 4WW0A 4ETIA 4CIBA 2RI1A 1O1YA 1QVVA 2GF9A 3W4JA 5C5CA 1E6MA 1LTKA 4A73A 4TZ6A 1ZH2A 4IS2A 1J70A 3KBOA 4AJNA 4PW0A 1VE6A 2K7FA 4ZCMA 3PQEA 5K3AA 2PQ0A 1ZIXA 5DVZA 3UMVA 1TU4A 2JLBA 3TRDA 2Z6QA 1N9KA 3R23A 3KB1A 1DBQA 3G13A 4YQEA 5CXQA 3BFXA 2R4QA 2DVMA 1XJQA 4IYJA 1A9ZA 1N6NA 4Y6SA 2X7XA 2MSNA 2R1VA 5FULA 1H8HA 5C3MA 5AW0A 4WBNF 1M6HA 3FB4A 3ICWA 3I28A 1NRIA 1ADBA 1ISGA 4YAKA 1CZNA 1T6ZA 2JBHA 3QK7A 4ZP1A 4EJ6A 1QX4A 1O96A 1C3XA 3UA4A 3EVTA 3T5DA 4JBIA 4KSYA 1IONA 1XV5A 4LOIA 2H51A 1QQ5A 4V2IA 3B9RA 4MKRA 5HUJA 3OQNA 1U5BA 4FWIB 2GM4A 4R2KA 2ZSJA 3K70C 3K0BA 2YRFA 3L0BA 5JLJA 3PI7A 3W5AA 2J9XB 2EQ5A 4MO2A 2F6RA 2ZJ7A 2CNWA 4ZOLB 2HKIA 1ENOA 3COWA 1NUTA 5MN6A 3GP8A 5CXUA 1MJGM 3N28A 3UIEA 5A5FA 1D3AA 1NSYA 3IJPA 3UYKA 4RMGA 2CNNA 3E9DA 4GWKA 4MRAA 5M34A 4CIXA 2QN6A 3N3AC 3E4CA 3CF4G 4IPTA 1BGXT 3GFFA 1U0NA 1BQ3A 4E94A 3HLTA 4CMJA 4CCSA 2V7PA 2LRHA 1JPVA 2NO0A 3EA4A 1V6AA 4B3HA 2BFEA 4R1LA 2R8RA 2XA2A 2FWIA 4KMSA 4FYIA 3E2PA 3P9SA 4JI5B 5ALOA 4QOSA 1JHVA 4PRZA 4E5KA 4EAQA 3QXHA 3WMEA 3ZN2A 1LBIA 1W1UA 4GI3A 1JVNA 3S99A 3ZJ4A 1JSCA 1J2JA 3R5JA 3RK1A 3NBAA 3BL8A 4PZEA 4Q4DA 2JATA 3WTCA 4V24A 3RW9A 3MJRA 4O0LA 1QZXA 4CR8A 1U2GA 3GRAA 1I13A 1A50B 3ZI4A 1YJ5A 4MS3A 1LV7A 2GN1A 2QWXA 3PKIA 1FNBA 1EZZA 3OWHA 2IPMA 4KFRA 2GLXA 4G0YA 1PV4A 3WLQA 3MJDA 3ZVMA 5HJ5A 5DN6D 1XFDA 3BQNB 1Q1GA 1X77A 5BW6B 3ZTYA 5KDDA 1LPSA 3L7IA 5CDHA 1CUBA 1D7AA 1AZLA 1EXWA 2BM9A 5J4YA 4WA8A 1VRVA 5T67A 1A9OA 3I5AA 4RK1A 4CM1A 4EMUA 2EHJA 5IUKC 2N46A 4K6CA 1NUAA 3PENA 3ZWCA 1W6RA 2P9QA 2ROQA 2DHCA 4NG5A 2D6FA 1KYQA 3EWNA 1AN0A 1FDOA 2Z57A 2ZJ2A 3OZTA 2BRUA 4TGLA 3LXUX 4RZHA 5CA1F 1K27A 3NKFA 3L7DA 4JQOA 1X8XA 3A9SA 3CNOA 3SHWA 4EUEA 5B7QA 5MFPA 2OXCA 4E1VA 3MB8A 4FX2A 1CJVC 4OSPA 4AMYA 3LY8A 1H5UA 3K9HA 4PCUA 1RAEA 4R8LA 4XARA 4F3YA 1YR8A 4EL0A 3VH4A 1FYWA 3CBQA 2BGJA 1O4VA 3DR5A 2P4EA 3MOGA 4ZDWA 2A67A 4M2LA 1W9MA 4HDRA 4AKTA 2BP7A 3DNPA 4FSHA 2OT3B 4BVAA 2BH9A 3HRHA 1LS1A 1N6PA 2FLVA 3O90A 4L8WB 1UDWA 4V0QA 2BLLA 3MTJA 2QOEA 4FYJA 1VIAA 3FMPB 4D4KA 2I80A 3C8HA 1TFRA 1XCJA 2PH5A 2YIVX 3TW4A 4DJFC 2DH6A 1M0SA 3TK1A 3IQHX 1SPXA 1NR5A 4MMXB 4HDRB 3A4NA 2O8VA 4X8LA 9ATCA 2BHTA 1KXJA 4HQKA 3B2NA 1ZL0A 3ZFOA 1ND6A 3NM5A 5H83A 3NNDA 4ZREA 1AU9A 4R9SA 4ETWA 5CLGA 2I4OA 2IPOA 1C30B 2FP3A 3RNLA 2NU9A 1UBFA 5EKUA 5JAUA 4DJEC 3HKDB 4U3JA 4GXTA 1IEXA 2I78A 4BNGA 1W88B 4LMBA 4TYNA 2RGCA 3MLBA 4OBBA 3GP3A 4YLGA 1A5AB 3G2LA 4TTAA 3GJ8A 4W6ZA 3VO2A 4CTMA 3CVWA 2H65A 3MUEA 5A4MS 3M34A 4BX3A 1FJ2A 1W2GA 1O8CA 1PR2A 2B8EA 2WKRA 3NR2A 3OE5A 4ACAA 4TMFA 1YV9A 2O8CA 2QYTA 4RKYA 1UDBA 5E8JA 2JZOA 2DEUA 1K5PA 5AVUA 3NDRA 3DHEA 2B2NA 3AWIA 7AT1A 4MB0A 1JDTA 2Y6UA 2JGIA 3KYCB 2ZSDA 3VU1A 4M53A 2O4UX 3ADPA 4WVLA 1ELOA 3OZAA 1ZKMA 4CMIB 1YIOA 3WQQA 3MINB 1SQSA 5C51B 1A9XB 1ZD3A 3L1UA 2FGJA 1G21A 2LVBA 2BBSA 1QPGA 3FTNA 2JAQA 5E3IA 1ORHA 3JQDA 2G8NA 3G2IA 4NCIA 2HLNA 3BTOA 5A4DA 4DOMA 2ZULA 3CH5A 4IZ6A 5FBZA 2EP7A 4QBGB 4LYHA 1DARA 3AGQA 4M0KA 3OQ1A 3BBPA 3VDQA 1TLLA 3NYQA 4XE5A 4CMEC 1XX6A 1KHHA 4M8IA 2ZEJA 1WQ1R 5EYPB 4YC7A 3C39A 1SUBA 2ETVA 4OX9B 4YQZA 2IQIA 3NBFA 1XRMA 4W1RA 3BA6A 3T3PB 1VLHA 1BGVA 1DKQA 2G5GX 3RRFA 3SHVA 2OG2A 3ORFA 3SLKA 3AM1A 2AK3A 3OKPA 1RWXA 1SXJB 2REOA 2DC1A 5HF8A 3AC0A 4JP8A 2HIAA 3RFVA 3OE1A 4REQA 5CGZA 2J87A 5KTNA 4PG5A 4ZOLA 1M1NA 4HEA6 1GNLA 1WMDA 4QWMA 1USKA 3CE9A 1UANA 3LECA 1X7ZB 1T6BY 3Q9SA 4PR0A 2PLAA 4UEQA 4WESA 1QIFA 3E0QA 4OJKA 4ZOEA 3W7VA 4F4FA 4J8PA 4LJSA 4ND1A 2YVQA 2VJBA 2HF8A 3N87A 3IESA 3V1MA 5A6SB 4TTQA 2P2YA 5AP9A 4AY2A 3PQFA 4GBED 1T4MA 2P2DA 5HTKA 5I7WA 2J8ZA 3H5LA 3HN7A 3WYFA 1JYSA 1B41A 3M6LA 5E6UB 4WLOA 1UIMA 2FCRA 3S2UA 1E4YA 3P0FA 1BS9A 1I24A 2ODAA 2ZWMA 4GMGA 1A04A 5AI0A 4R01A 5DLDA 4BFUA 1Y4ZA 1Z39A 4JUFA 2VSFA 5JLAA 5AW4A 4MNTA 3ILSA 4EZBA 1ZGBA 4YRKA 3IAS1 1NBEA 1M1YE 2OMEA 3LVBA 3TLBA 1WL8A 3S70A 3LWBA 5ICGA 3IP1A 1NY6A 1YDWA 2PUTA 2JI4A 2WM2A 1V7QA 3CZAA 1HDYA 3GIWA 3ZWPA 4DVJA 3VMFA 4KAJA 1CZLA 3R4CA 4EHBA 4ZVNA 3EZFA 1XA4A 4O0MA 1OJ7A 3I9KA 3QOFA 4O25A 1MP0A 3BA1A 4KNWA 2JFVA 4B6GA 1X39A 4X85A 3L01A 4DY6A 3FB1A 3G59A 4XDHA 3FDFA 3H17A 2WWRA 1TM7E 1ESMA 2ZYDA 2AHRA 3A6DA 1C3LA 3H42B 1B6GA 5LLTA 5D85A 5INTA 2GBFA 1ZMBA 3H0CA 3TQSA 3OO1A 1P3JA 4WADA 5A03A 5CBKA 4ZK6A 4C4OA 1JAZA 2HZ7A 1D6MA 1WZIA 1E62A 2RHLA 3VNRA 7ADHA 4AECA 3E53A 3L3BA 4RMHA 1JVSA 2P6UA 3CGGA 5EKDA 2W4MA 1SXJC 3H5WA 3I2FA 2ZR9A 4G5GA 3EWIA 3V8RA 4BEBA 3TTSA 2O9JA 4S1OA 4K9OA 4ZJUA 1E1QD 4CGZA 5EVJA 1DT3A 3TFOA 1G66A 2FR8C 3CLUC 3R7BA 1NF3A 1VYHA 1ZM2A 1C4XA 3LC1O 4MV1A 5SV2A 2CHUA 1FDIA 4RVNA 3SFTA 3RWOA 3TI7A 2MR6A 4L5JA 4YRTA 3V6MA 3WZLA 2XZOA 4L74A 3L7KA 1H85A 4RYLA 1K7YA 5DU2A 1N7HA 2GX6A 4NYJR 1VJ1A 2PGAA 2Q3BA 5AM3A 4R1MA 2MINA 3FHTA 3G0CA 1LVHA 3GL9A 1E69A 4ZALA 1KIFA 3KYDA 3GNTA 1JE1A 1RCTE 2FN3A 1KO8A 3AV3A 4IDHA 4PQYA 4H59A 4QQNA 4DQUA 3HKCB 4XAQA 1AQUA 4F84A 4E08A 1MKYA 2ZE8A 1UPCA 3D0KA 5HMLA 1G291 5FF9A 2NVUB 3WGQA 3GGPA 3DE3X 4MV0A 5KC8A 2Q27A 1Q1QA 4MRMA 1AQYA 5EJ7A 3SIXA 3NNNA 1HC7A 2JCBA 4TOIA 5T64A 2VJOA 1NQOA 1N8TA 1RCUA 1YJQA 4F98A 2Q3HA 3A1DA 1ZCJA 3IP8A 4I4TF 3R6DA 3RAGA 3HCWA 5GONF 2B3DA 3WKAA 3U44B 5FLKA 2XV1A 3DLBA 1SOUA 5EIAA 1XLUA 3AMVA 1G6OA 3CX3A 1PW5A 4EFNA 4Z9FA 2PS1A 1C9DB 3ZYZA 2ZPTX 1Y1RA 1NBOA 3PYXA 3QVXA 5DYYA 5HQJA 5M7EA 2C95A 4OQEA 2J7PD 3BRCA 3CN9A 2FZVA 3TLYA 2YWCA 3D5TA 3H3FA 4MYTA 2FPPB 2GZ3A 2R6CA 2V5VA 1RYBA 1F0NA 3H4IA 2NUTA 3QQ5A 4BE9A 3FXAA 4F92B 3T1YB 1XNRB 4EG3A 5HKLA 1QGDA 3AFGA 1F3OA 3NT2A 4RSGA 2JFHA 2Y2UA 1OBVA 4DAOA 5HUQA 4BUCA 2XOEA 2QZSA 2X5KO 5AMXA 2RHGB 1JTFA 4CLOB 2D2FA 1XAJA 1PKEA 2QNBA 4NZMA 3IXLA 1Z5PA 4RLHA 4KPFC 1Q0RA 3HEAA 4K9SA 2PTGA 1JQ5A 3LCMA 4KWCA 3IQDB 3C4JA 3WDMA 1X1AA 1YZKA 4X7BA 1MB9A 4DSUA 1NW3A 3BIWA 1F6BA 3JD0A 521PA 2H00A 3DNFA 1QV7A 3GYGA 3RSLA 1L0BA 5CCXA 3K4HA 1KJ8A 4RD3A 4B47A 2DP4E 4OYYA 3LPNA 3PGKA 4TSKA 4XSHA 4C4TA 2W8ZA 1XVIA 3EZNA 1H4QA 1DIHA 1XL1A 3A6GA 1S2OA 1MH9A 1YQWA 4FONA 1P6UA 3BRWA 3BWDD 4UZEA 3VU9B 4CRWB 1KQNA 2D62A 1H05A 1LBHA 3LUKA 5HKKA 4WECA 4LJ8A 3CFYA 3X2EA 3SYLA 3KQUA 1CQIB 2ZSKA 3PICA 4GWLA 4MV4A 2WB2A 1QU3A 4UHEA 3V3TA 4F56A 1X15A 4YRJA 2V0GA 1J8FA 3L8MA 3AVQA 4HBZA 2G08A 2Q6OA 2X8WA 1DWOA 1LXCA 4M0FA 4U2BA 3B3QA 4XGNA 2VH1A 2DPHA 3OCVA 1SIBE 1K86A 3OPVA 2TSYB 3BZBA 3A7DA 1NV9A 1QU2A 4JJ6A 1SAYA 2YQZA 3OLYA 3JQBC 4M21A 1OYWA 5DLPA 1KP3A 1J23A 2MYTA 2IGBA 1UJ2A 3M3PA 3KSMA 1AQJA 2WYUA 4TZTA 3MD9A 2XYHA 3VO8A 3M6WA 3NH9A 4OI1A 1O0SA 3GRYA 2DPYA 1J07A 3FNBA 5C18A 3HZHA 5IT0A 3KV1A 1OXKB 2QRGA 3LBAA 2QUBA 1WXXA 2VYFA 4IFBA 5LA6F 3VPXA 4MZXA 2J09A 2V74B 1NASA 2VJPA 4BGVA 4CEHB 1TM5E 4KXYA 1JDBB 3DTVA 3P9QA 4J49A 4MQUA 4E3ZA 4J7AA 1JMKC 1XZMA 2P6MA 4PYLA 3AOEC 5K0NA 3NOVA 1Y6RA 3U1VA 4Q4AB 5B5SA 1XZPA 5JTUA 4E03A 3Q0TA 5EIOA 3MTEA 4AZ0B 1AT1A 3L06A 5L3VA 2XGJA 3TTVA 4TXHA 3MNFA 3E3LA 3URKA 1WDKA 3SCZA 5KNBD 3FCCA 1AKUA 1MJNA 4OV6B 2CUTA 1NSTA 3CLSC 4ND8B 2G72A 3J7TA 3LYHA 4B9AA 3NHMA 4F5WA 5K4AA 5IXSA 5AKLA 2L69A 2JC3A 4H7IA 5DMHA 4Z4CA 1UJ5A 3BWEA 2ODPA 1X8LA 3SQXA 2FP4A 1LJUA 1T8SA 2AOTA 2QRNA 4I46A 4WA7A 2DHQA 4AICA 2DWPA 1L5SA 2JCGA 2OFOA 5ENDA 3U26A 5LD2C 4QBFA 2UZ1A 3JS5A 1JKJB 3K1AA 3PFHA 5GONB 5I9IA 1FJGB 2YN4A 4ZHQA 1KXZA 2KHZA 3PJRA 1C9YA 2VHJA 3MCUA 4JENA 4Q1DA 4R9VA 4Y0AA 4XLLA 3UJ7A 2ZQZA 1Q12A 3USZA 3O3NB 2JHFA 1O0BA 2QTHA 3AZOA 4MKFA 4BNTA 3IA2A 4NBKA 4DARA 3U7GA 1USGA 4OX9Y 4TWJA 4P58A 4E7PA 3UGJA 3TBKA 4IP0A 3F8WA 3MOSA 4GP6A 4A03A 1D6JA 2F1KA 1B6TA 1P5FA 3CRQA 1N6HA 2IF0A 3JQFA 1D07A 4FYYA 1N9GA 5TB5A 4N7BA 1LPMA 1J99A 1JHYA 3WYAA 3TQIA 4HKTA 3ZWQA 3GLTA 2ZUVA 1VHQA 4CMCA 1L9XA 3OD5A 4NDZA 2WWTA 4NFSA 5G1PA 3ELUA 4E1BA 3W5VA 3AJDA 4O4HA 1NI5A 1TZJA 3LKBA 1KZ1A 2GCOA 3MSCA 3MJFA 3QPDA 4LG1A 1OAOC 4ND8A 1JLLB 3V2UA 4DMCA 1NVMB 2FRXA 2BGNA 4FN4A 3ZGNA 1RRCA 2XDAA 1MNQA 421PA 4OTZA 1E9AA 1XZBA 4LUCA 1Q1EA 3AO0B 4ENUA 1KPGA 3KM0A 4XYBA 5TRTA 1MPXA 1SURA 2QX9A 4EGFA 5A3RA 3U3MA 2O23A 5AVRA 2ZUSA 3X1WA 1JNXX 1YUBA 2WPDD 4D74A 3VX4A 2C77A 2H31A 4MPRA 3H1FA 5ELMA 4EY4A 3AOGA 1D7OA 1K8YB 3MC1A 4J1QA 5J5VA 1D6SA 4PLCA 3KVNA 1GZHB 3D4OA 5BN4A 1VDMA 5JDCC 3UV6A 2JANA 1K08A 5LXTA 3O1LA 1NLZA 1J24A 1SC3A 2VPWA 4X20B 3M2PA 5DK6A 4J0DA 4BX2A 3TG2A 1FP2A 3UC5A 1B4DA 4Z7NB 5H3LA 3GQVA 4FT4A 2OM2A 2B83A 3QH4A 4DMHA 1JJBA 4QYIB 4PICA 2ZRDA 3I4CA 1ZP6A 2NZUG 4G5YA 2I55A 1B3BA 1RZ3A 3S3TA 1HL3A 1OXMA 2ACVA 3UJ9A 1KQGA 1YULA 2JA1A 4ND5A 5GY7A 2IS2A 3VHXA 5K01A 3Q2OA 3L8YA 5IZCC 2IBMA 3DZGA 3QEKA 4LOKA 1A8UA 3C6QA 3V2IA 3KEQA 3Q3HA 1KZ4A 5HG0A 1Z4LA 1GDTA 2IHNA 3HO1A 1OLSB 4LYYA 3AHDA 3MAGA 1WZCA 1F5SA 1WHTA 3I2IA 1PK7A 4ER6A 3FAZA 4LY3A 1Y7HA 5CJPA 3CISA 1ZGGA 2IJGX 1JLSA 2Y1FA 1T0IA 1XDSA 1UOPA 3QXCA 2A0KA 1E1KA 4TMZA 1L4HA 2CVOA 1XCMA 3HBNA 4MRNA 1S3IA 3M4JA 4RF3A 2V98A 2VO1A 4YR7A 1VYVA 2V6GA 1JA9A 4WSOA 1NONA 2BR5A 1AG9A 1DRUA 4Z5XA 2WJGA 4OHRA 1ISRA 1ESNA 3OBIA 1YB1A 3SZMA 1VMAA 1YDEA 2OO5A 3L0IB 1QG0A 5H3HA 3VTKA 3ZHBA 4DHEA 3GFOA 3FPLA 3JYQA 2VCEA 4K03A 5EIHA 3R7WB 1W52X 2CXTA 1CR4A 3RABA 3BD7A 4KDRA 1CVRA 2VQSA 3B1VA 1EK2A 4G1BA 4RDHA 5J58A 5JVDA 4LK2A 5ALNA 5I4BA 4ROTA 4FEYA 4OXQA 5B53A 2A9FA 5DHPA 2QTFA 3MTQA 2Q1WA 5C7YA 4ZDIA 3C5EA 3QJYA 1LLCA 5E7IA 5MGNA 2EQBA 2ZYGA 4O2AF 4RM2A 1ZUNA 3H4TA 4LW8A 2FI1A 2AN3A 3DCNA 1LEHA 4LJAA 4YV2A 4ZVPA 3INYA 1OBFO 1Z5NA 2EFDB 5F12A 1XI2A 3L8CA 3WK6A 1CIVA 4GDFA 1EXVA 2DBQA 4UUQA 1WXIA 2GNAA 3CKYA 3ENWA 1W4CA 3NBQA 2DFPA 3PZRA 4JKOA 4B3DA 1IE3A 1WCXA 5LA6A 1IVSA 3UAXA 3G0HA 1UZLA 3U7IA 4OXNA 1ARZA 1MO3A 1XNHA 3VUFA 1SBTA 4FHCA 4HADA 1LDYA 1G16A 4TTSA 5AOBA 4C4XA 3U44A 4XCVA 1W5TA 2WJZB 3FOBA 1N32B 1MA0A 1ZNZA 3P2OA 3P0HA 4I0WB 2A94A 3FFXA 4L4UA 2FUKA 4TTRA 5TT0A 3K2QA 4FSXA 4MARA 5ALQA 5ITSA 1KDRA 3E48A 1QPBA 1V9SA 2WKQA 2IY8A 3HU3A 3ITEA 3P9PA 4QARA 5EIBC 3VR6D 4RHFA 5DCLA 3QVKA 5EFZA 2ES4A 1N2HA 1RJWA 1T2DA 2Z2KA 4FKMA 4KGXA 3UGQA 3WI7A 4RCVA 2PLRA 2QM7A 4K8RB 4N01A 1VZ2A 1JHRA 3P32A 3R77A 2N42A 2PJUA 1NVEA 2Y1GA 4RPGA 4V0OA 3ZWOA 4ZZ3A 1XB2A 4ESEA 4FFPA 3PCTA 1PSDA 4KQEA 2C5LA 2XWQA 3UYLA 5KMGB 1YZVA 2Q49A 1BGWA 1THTA 2GEDA 1O5IA 3OTIA 4INJA 5KC9A 4Y7CA 5H1YA 3OU7A 5KB3A 3E9YA 3UOGA 4YMGA 1RAFA 5JECA 1FSFA 3GDGA 3TLEA 5CA0A 4GLFA 1A1SA 3D6TB 1FDVA 3GRZA 3BX1A 1NQTA 2BHNA 5LB4A 1Y6GA 4L07A 4OU4A 1EAYA 2Z2ZA 4FYVA 1QHYA 3FBTA 4RV4A 5KYUB 3WDLA 1YFKA 1UCFA 3BIJA 3W06A 1O4WA 4W8HA 5IDVA 3C3MA 3NI2A 1US8B 2Z56A 4F93B 1TQDA 1WMSA 1TUEA 1YBHA 3DO5A 1CERA 4ER3A 3KZKA 4XRGA 1I6WA 3OAAD 2XYPA 3TMKA 1VHWA 3E8MA 1QRAA 3GBSA 4JMPA 3VOBA 4D0GA 4NOLA 3SHTA 1NUQA 4JLMA 3E5NA 4UBOA 5AI5A 4YX9A 1IMJA 1E1QA 1ECLA 1WUYA 3FYTA 5ALLA 3HUEA 3HXQA 3T3OA 2P78A 1I3KA 2IH4A 3DH0A 1LC0A 1PYGA 1SQ6A 1Z29A 2HF2A 2ZIXB 3DSRA 4KQMA 3UHFA 4ASUA 4DCCA 3QELB 1IHPA 1VRCA 4K3VA 2Q3FA 3IVAA 4KGDA 3TN7A 1JXOA 3LU1A 2QIPA 2OQIA 4ZAZA 2DMRA 1Q2UA 2JLYA 1JB1A 1L8AA 2KS6A 2W5UA 1ZIOA 4C6RA 1CNFA 5K0JA 4EARA 2PUFA 1YXMA 2XZPA 1JU9A 4MWDA 3TEFA 1KSGA 2MSWA 5H4GA 2QIOA 1R6UA 2YRWA 3MJVA 1NJ8A 1EFCA 2A1TR 3EOAI 2FNAA 4HRXA 4QO8A 3HVKA 2A3NA 3R3ZA 3TVDA 5E7JA 3ZFPA 1WOYA 1ZL2A 3UK7A 3IP7A 3O31A 4EYEA 2VTBB 3R1IA 4NK5A 5LFAA 2FCAA 1AQNA 3RVPA 2GLTA 2HCBA 3QTBA 4URHA 2P65A 1R9NA 3L8EA 2WAXA 4J16A 3FDIA 3RB8A 1H6CA 1Q50A 4HAIA 4KE7A 4RU1A 1B8VA 4N7RA 1G8PA 4YPFA 4HI0E 1PFKA 4C06A 1BZYA 1RQRA 3K9LA 1CEEA 4G41A 5EJEA 1Q6ZA 1QZTA 2PKQO 4QOJA 3RAEC 2W83A 4B09A 1E3SA 3FCXA 4V1CB 5JBNA 2R48A 1QCDA 4S12A 5HKBA 1CUDA 5E7MA 3L4BA 4I3GA 2Q3JA 2WVGA 3ZTWA 4FFVA 4J6FA 3KJGA 2EARA 1C29B 3OQBA 1IXRC 4Z9XA 1V1MB 4LHWA 1XU7A 2O8BB 1IM8A 3CCCA 1Z6ZA 4WK6A 1Q77A 1W85B 4RKQA 5AIBA 3KVYA 1SC9A 4WZZA 2ZUWA 2OQRA 1FTQA 3JZMA 3MTAA 1S1CA 3QVWA 3CNHA 4B45A 4UUOA 3ICVA 4AX8A 1H2RS 1L5RA 4UMEA 3EXFA 4EEXA 3GRPA 1U7PA 3O8QA 4ZV7A 1P6QA 3WRYA 2ZYRA 1ECJA 1OYYA 2PU5A 3ZJYA 1ZCBA 2YICA 2O52A 1KGSA 3INNA 1XROA 1ZFNA 3K8ZA 4RVCA 4RFVA 5KJEA 5KVCA 4QGAA 2Q7XA 4YYZA 3H7IA 1L5FA 2WD7B 6REQB 3CH4B 1LNQA 3Q5GA 1VHLA 3LWZA 2BUAA 3OLWA 2YYZA 3PPWA 4TVKA 3WQRA 3ZE6A 3KV3O 2IIQA 5C0OE 5SY9A 1QRTA 3NIWA 4U5QA 2AOUA 4W6QA 1YRLA 1FU4A 2YZ7A 2XB6A 4HATA 1GFWA 1U2DC 3PXEA 3L41A 4M8KA 5DBIA 3PGVA 5HRCA 1ISSA 2VYQA 5DMXA 1NJFA 5FAKA 2NXEA 2IE8A 2LPMA 3TW8A 2BSQA 3TL3A 2KBEA 1SIOA 4Z7JA 1FRQA 3TG8A 5CFMA 1SCJA 3A6EA 1USIA 5CFOA 1CF2O 5TQJA 4BFXA 1E2BA 5EIEA 5JTTA 4QA9A 1QUEA 1Z9BA 4YJ3F 2OV6A 4E30A 5GZ1A 1UXHA 4FHDA 1B42A 1H65A 4LVUA 1L5ZA 2G7ZA 3H9BA 4YASA 5IKMA 4ZA2A 1GKLA 1TJ3A 4LZOA 4MYDA 5U4XA 1N4AA 4DZZA 3T4PA 4LPKA 1JHXA 4P6VF 4R8SA 4DLTA 3FKSD 1KAHA 3ETEA 2PMBA 1U0LA 3I2HA 5KSPA 4PNEA 4UTPA 4JK3A 2PUCA 1ZRNA 3EIUA 4NNJA 1NR7A 4GKBA 2J3JA 3I05A 4NZOA 1DKUA 1JEAA 4PAWA 3VR2D 4F71A 3LGSA 4C7BA 2YMPA 1KETA 1Y5RA 3D6FA 5JFOA 1ZBDA 1QMGA 1T2EA 2QL9A 2XCSB 1M6VB 2YJGA 4GRAA 5B58C 5L3QB 2HU5A 3IQWA 3VR4D 3IC5A 4LJYA 1YMQA 4UZSA 2IOYA 2FFQA 4YB8A 4DL9A 1PJ3A 4EWLA 1BDJA 5BV7A 5BOVA 3SKXA 2RKBA 3D8TA 1VG8A 2F43B 3ITKA 3LS2A 2P0EA 4EW6A 4MRSA 2Y0EA 4Y2YA 3QU5A 3N2IA 1P0MA 1YR7A 1NC1A 2Z43A 2B25A 4IIJB 3ZU2A 5KU1A 1T26A 4Y9TA 2DBRA 2FJPA 4WN9A 3DGFC 2H2HA 5GIOE 2PZEA 4FM9A 3HE3A 1QKIA 1E0JA 3G9TA 4RNCA 5CUQA 1ML4A 2WVHA 3C3KA 5IP5A 1U4NA 4XFJA 4NU6A 4Y6QA 2VVTA 4KVFA 2JFXA 1GV1A 3ID6C 3WL4A 4B5LA 4KHPB 1WO8A 4TTJA 1J00A 1UP6A 1C1XA 2GEUA 2GYWA 4L6AA 3VTAA 4F4DA 5EJ6A 3GLGB 1W36B 2YJ3A 3ZJVA 3FVVA 4DEYA 3HKDA 4U3JB 3WKDA 1RXSA 2B35A 3A0UA 4BLWA 4K0KB 3UKDA 4WKCA 1HDZA 2IC5A 1BRMA 1T8PA 3KT3A 4ZT4A 2BR4A 5AHXA 3BERA 4IGIA 2IK8A 1KYZA 5LA6B 3JATB 3E81A 5IT9A 1KFCB 4N5DA 5EPUA 1T2UA 3BREA 2VF2A 3QX8A 1RU3A 4ZI5A 1YVPA 5GOZA 4BJ5A 3ZE7A 3TNLA 2YBEA 3R6GA 4RA6B 4X90A 4ZAGA 1XQYA 4DLWA 5MDHA 1FU8A 4MUEA 3HQ4O 2FEKA 2GN4A 4DRYA 2OSVA 5C32A 4B2PA 3TTXA 1WEKA 2X0EA 3JQ7A 3M1AA 3L4KA 3OKCA 5HPYB 4B6SA 3UAGA 1MNAA 3GAFA 3GARA 3FVRA 5HKOA 4CN9A 1C7FA 3THOA 4W5RA 1NBAA 2E4XA 3MFQA 1NQAO 4RWEA 4JUDX 2Y3IA 5CVUA 1HI9A 3OWOA 1Z2AA 1HYHA 2HMTA 1DB3A 1X7HA 2WFLB 4KE9A 3SYKA 3QGMA 4ENTA 3PFIA 4UNRA 3Q3JB 4KQ1A 2IODA 3WC4A 1D03A 3ANSA 4BU1A 1PCXA 3PXUA 3PQ8A 4DDHA 2HDHA 4JFAA 2PN1A 4ALIA 1F38A 3KFVA 4FE3A 1FU7A 4RHUA 1DKNA 2OHXA 2HHHB 1P1FA 3LBNA 5CDYA 4U02A 2NYAA 1THZA 1VHDA 3M3HA 4L2IB 4L9AA 1K3FA 2VXYA 2BBWA 1X7XB 1TIBA 1ZKDA 2O7QA 5TQVA 5JT1A 3KOOA 1BHQ1 2D00A 5KI6A 4YDHB 2Y67A 2IZ7A 4NMMA 2REQA 2QJWA 1QIHA 1VBFA 1YJBA 3L40A 4HSGA 4UM9B 5AXAA 4UXHA 2EGUA 1L7NA 2JLAA 2ZB3A 4ZARA 2XADA 3I9V6 2XTJA 2O2ZA 3TFQA 1D5CA 5JPCA 3DJFA 1IPHA 3D02A 4EKYA 1ZJ5A 4Q7EA 4D0SA 1GYRA 2CCKA 2JW5A 2COUA 2I5PO 3EGWA 4XX1A 5B58T 3F7TA 4NOKA 4RL6A 1Z26A 4O3FA 5FD8A 1EFDN 1Q1ZA 3IDAA 2NVBA 2X9GA 2ZKIA 3E70C 1GL9B 1EH5A 2FZEA 1ST3A 2H8GA 4YRSA 4KDCA 1N77A 4EA9A 5FQOA 3OZCA 4M36A 3WGUA 4E5DA 1AV7A 2VA9A 4CI0B 2Q6KA 5KYXB 4WBXC 4LYAA 1LC3A 1EM8A 3BXOA 3VFDA 2BOVA 3WRXC 2PRIA 2XMDA 5JR3A 1Q0QA 4NJOA 1ZD9A 2IXAA 4YIKA 1EWTA 5ESWA 1I7QB 1BXRA 2NYUA 1GCGA 3ZHCA 3ZZ0A 1PZXA 1VCNA 2VDLB 3MXOA 5LNK1 3HKCA 4FBLA 1X13A 3IT2A 4IZOA 2WW8A 1L6IA 4FZ5A 5IT4A 4HGPA 4Y1RB 1RAGA 2GAJA 2YY6A 2HMWA 4XWAA 4D8VA 2WQZA 2ONZA 3K16A 1TM2A 2OQ2A 1A71A 1TKCA 2BIFA 2DQSA 3H9JA 5M2QA 4UPEA 1Q7RA 4BVFA 4N03A 3GJSA 1CJUC 2G1UA 2XLCA 2QA5A 1PBNA 1UBTS 5J23A 2OWDA 5DM4A 5KSOA 1QF6A 1PZFA 3BORA 4AMZA 1TO1E 1DRKA 3RT9A 2SKDA 2WTBA 4HEJA 1QVAA 1YL7A 2GEJA 3I58A 1T2NA 2I65A 2ODEA 3N7UA 5FBRB 1KI9A 2V7UA 4JIGA 1NXOA 3E9QA 3PGLA 1H66A 5DXJA 4FDTA 1RP1A 1LPAB 4MQ6A 3PS9A 4PG7A 3OCWA 2ZI9A 2DQ4A 4LQLA 1SUSA 3GEEA 4YAWA 3EGCA 1U7HA 2YHIB 3GDOA 3PQ2A 4LXIA 5HDQA 5K3OA 4LEIA 4JLDA 2VK2A 4ABYA 5JAOA 3CF6R 1JPUA 3HY6A 3TAHA 3ZCUA 3GEHA 4DIMA 1RM3A 2Q5CA 3AGPA 4EX6A 3BGDA 1R88A 2QG9A 3UK6A 4I55B 4NFYA 4ZMRA 1G6KA 1PWXA 3CHYA 2R44A 3PE6A 4M9QA 1F7VA 2J33A 3VNVA 1WUJS 1NG1A 3WLEA 4O4IF 1EZ4A 3NUGA 2Q5OA 3QOWA 5DHFA 1FLVA 1VXRA 5EPEA 2BISA 1W30A 1WP4A 2BFPA 1YFLA 3OF5A 3AW9A 3K09A 3KPVA 1GY8A 1JHPA 2Q2WA 2QLJA 3WK9A 5JZBA 5HCUA 1T4GA 1Z16A 2V4MA 3K92A 4RPCA 4RJJA 4HNUA 1VPEA 4U6QA 2O8FA 2FOXA 4WOCA 1F2TA 3GA5A 3NVDA 4DJDC 1IJKA 1P9RA 1M34A 1QZUA 1V16B 3AUYA 5AOAA 3TZKA 3ZGOA 4KFUA 1YB7A 2WD7A 4L6CA 3ZCTA 1CDOA 3CQ9A 4HPWA 3PNVA 4BQFA 3BMXA 2O3UA 1T6NA 1Y4UA 1S0UA 3OZRA 1QVZA 3TNYA 1DINA 1DX9A 1DLIA 5AKHA 3SOPA 4BFZA 2X3UA 3Q9UA 5HM6A 3B6ZA 1SBYA 1YFZA 1K8ZB 3NHUA 4PHTA 1SK8A 1QHSA 2GAIA 1VJCA 2CFIA 1SC6A 1CCWA 3LW7A 4XDYA 5EPOA 2ZVJA 3LUHA 5IX8A 1XTTA 1U3CA 3WGTA 3PU6A 3J81k 5G3YA 5LDDC 1E5DA 4LDAA 5K6RA 3EK2A 3MTDA 3PWKA 2QZPA 4YONB 4B6JA 4UBNA 3ZWKA 2FPWA 3TBHA 1X7WA 2DPMA 3K31A 3THYB 2FW9A 1VJ0A 2D5CA 3SJCA 4DQKA 4DXDA 2JH8A 2V65A 4U9IS 3TVTA 4QDTA 4BKQA 4BVKA 3TLGA 3RROA 1L8XA 4LV5B 5FUBA 2NM0A 3UCFA 1YE3A 4JJ8A 2ZI4A 5EUQB 2V7XA 1E32A 2WT9A 1ISIA 2AA3A 1NPYA 4Y2PA 5PGMA 2IHKA 1P1JA 3E84A 3B51X 4PO8A 3ZK9A 4IUCS 5JE8A 3DE6X 2PL3A 2FU5C 1A3CA 4A27A 2VF4X 1WS6A 2P75A 4OB8A 4FEGA 2H17A 5AUNB 4BC0A 4FGLA 1ZDMA 1LI5A 1FYEA 3GPDG 1JEEA 1V39A 4QODA 1XA0A 3UKJA 4CGYA 8ABPA 1A8PA 5FT9A 2AT1A 4IDAA 2P35A 4ZPJA 4W5QA 2X1HA 2B8NA 1WPGA 1QCZA 1O0CA 2IITA 1Z15A 2OBLA 1DUVG 2WNIA 3HG7A 5A4AA 5I7EA 4GI7A 4O59O 4XWWA 3GRKA 3HLYA 4DLRA 2Q50A 2VSYA 2ZI5A 3VOSA 5A2QA 1G3RA 3R0IA 4EK9A 3RYCB 1MRZA 4EG1A 1VG0B 2IY9A 4L2IA 1V41E 4MKHA 1NJSA 5CNKA 1MOZA 1D0SA 2FQYA 4N5MA 2AEJA 2HA0A 2IHBA 4L27A 2DX7A 4B17A 4X71A 4XJXA 4ZTUB 1AD2A 3DDWA 2YUTA 2Q5FA 3FPGA 3TD6A 1F1BA 2RAUA 4ARAA 4S05A 5IDYA 1KU6A 4X1YA 1ZW1A 2AOVA 2FSHA 1JIXA 3H99A 1Z37A 3PFKA 4GPD1 4QDJA 4BX8A 4PZPA 1TJNA 4HPXB 1HV8A 2V4UA 4MCJA 1E3MA 4EHHA 1FW6A 2D5BA 2R7NA 5EHIA 3R7AA 3H7AA 3ZV4A 4X44A 2B8JA 3BFKA 2VP0A 1O94C 2CD7A 4OQLA 3JW8A 1R15A 3N2KA 4WXHA 1JFRA 3TLJA 1JA1A 1FFCA 3VDXA 4KXFB 2QI9F 4MPPA 4RAQA 4JEUA 1B14A 4ZAYA 4QBIA 2HCJB 2MYNA 3TKYA 1R6TA 4V03A 4ZD6A 4KQIA 1NJ2A 1U9JA 3RVMA 4EA6A 5ALRA 3JQQA 1KKMA 4KWEA 1R7RA 1B1AA 5TX7A 3RSGA 4H7FA 3VZPA 3T7KA 2A1TS 4LDRA 4J0HA 1QH1A 4QAJA 1CE8B 4BMVA 1K5DA 2C2OA 4PLVA 4WGFA 5I7UA 3EGEA 1WQ3A 2EBWA 1M66A 2P9YA 1YQUA 2B21A 1SCUA 2G88A 4H4EA 1UF9A 4NOMA 2YHBA 4BMDA 1CU1A 2WLSA 4WT7A 3NANA 5DB4A 3PJDA 3QNWA 5HIMA 5CEJA 3FR8A 5CVVA 3DLHA 3CZMA 4HGZA 2IYNA 2XMBA 3HDHA 2QL7A 2FMIA 1ABEA 4HXFB 5MHTA 1GU7A 5CIYA 3I04A 3E82A 4QDKA 3P2KA 1V96A 1ODJA 2YN2A 3IP3A 3OZWA 1LBSA 1PR4A 3L07A 3VU3A 3BXGA 4LBWA 4YJFB 3RV4A 5IUJC 1GOTA 1U94A 4AJJA 4P5PA 3ZXUB 2JFZA 3FCEA 2BLNA 4U2EA 4LE1A 1YWGO 1ML3A 1P2FA 3A4LA 3PNMA 4UC0A 4MUKA 1ZR2A 4I6JA 2BMJA 5DM2A 2E9SA 5HF5A 1UJMA 3T12A 1WIWA 5K09A 1SU4A 5ALJA 1SU6A 3ABOB 3JQ7B 2M6RA 3WP1B 1E61A 1PV1A 1JFLA 4IO1A 1YK0A 3MWDB 4CM7A 3I73A 1MVNA 3KTAA 5J2UB 2HTEA 4JCOA 4F7DA 4C04A 2IRWA 1NNEA 1SHLA 4H0NA 4AWBA 5AJVB 4MQLA 5I48A 4P53A 5C1BA 2C7OA 2H4FA 4XGQA 3S5JA 2PV7A 2A4KA 5L3QA 4E5PA 2WTNA 1E3QA 2QMEA 4QTTB 3RS8A 3EXIB 3ZKWA 1AXEA 3MRVA 5A71A 4A8HA 3KQNA 2PD3A 3E22A 4AJLA 5BV2P 1KRXA 5EAIA 4UMDA 4B6EA 5JVDF 1QFZA 4N40A 1ZITA 3GCGA 1RVV1 5JU6A 2P2GA 4W5HA 2EHDA 1AK1A 1RAHA 4B8WA 5DWQA 2PX8A 3NWEA 3OIDA 3DLTA 1VL8A 4UAJA 3KUCA 4UM7A 1DC3A 1SCAA 1Z17A 3F90A 3D1JA 4D3SA 4EX7A 1CQXA 2YL2A 1K5GA 4PRLA 2RI6A 1OX6A 5DBEX