4YV2A

Crystal structure of trypanosoma cruzi spermidine synthase in complex with 2-phenyl-1,2-thiazol-3(2h)-one
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
290
structure length
278
Chain Sequence
ELISGGWFREENDQWPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the novel inhibition mechanism of Trypanosoma cruzi spermidine synthase
pubmed doi rcsb
source organism Trypanosoma cruzi (strain cl brener)
molecule tags Transferase
molecule keywords Spermidine synthase, putative
total genus 90
structure length 278
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 4yv2A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4yv2A02
3OE4A 5KYGA 2UYCA 1L1EA 3B5IA 4BLUA 2PXCA 5K01A 3AY0A 2ZBPA 3FUTA 2G8NA 3KQMA 4QVGA 2ORED 4XUEA 3BGDA 5CVEA 2IBSA 2PLWA 1X19A 3KPYA 5K0BA 3OZTA 4KW7A 4ER7A 1YUBA 3DXXA 3ORHA 3TM4A 1R00A 1Y8CA 1EIZA 3FTCA 4PYQA 3TLJA 5LSAA 1ZQ9A 2BR4A 1I4WA 4C06A 3DMGA 4MHTA 9MHTA 5JUWA 2UYOA 2G70A 2OZVA 3EEYA 1QAMA 3IHTA 1R8XA 1NW6A 2GS9A 4X41A 3O7WA 3UJ6A 1D2HA 4B17A 4E2ZA 2Z6UA 1SVUA 4E32A 1EJ6A 3PX3A 4M38A 4R6XA 5LQNA 4MIKA 3G2OA 2PSSA 3EGVA 3HCCA 1SQFA 1WXWA 4ER5A 5IH3A 1YB2A 3GU3A 3EGIA 1XVAA 5LQCA 3IV6A 2KW5A 4PONA 3HTXA 4E31A 4Z2YA 4GUAA 4NECA 3Q87B 4LECA 5E8RA 2IH2A 1T43A 1R74A 2K4MA 2IBTA 1G6Q1 1D2CA 4IWNA 2ZVJA 3HVJA 4RTNA 1EJ0A 3LPMA 4G56A 5B1SA 4R6WA 1U2ZA 2EG5A 5DTRA 1X1AA 3HA3A 1X1CA 2PWYA 4Y2HA 3U81A 4RTLA 2XYQA 4QVKA 5K0JA 3GCZA 5EGSA 1KHHA 4RYLA 1ZKDA 2O07A 2H1RA 3TPZA 3GRYA 3CBGA 4RWZA 2I9KA 5E1DA 4KIGA 5EEGA 4RTKA 5CUQA 3UA4A 3CC8A 4QPNA 3T7RA 1YFLA 4DKJA 2B2CA 2ZBQA 3LDGA 4F86A 5G02A 3AJDA 2IDKA 3A25A 4M37A 4CWAA 3UJCA 5KQRA 1FP2A 4AZVA 4PCLA 3G8BA 2FYTA 1AF7A 5CVDA 3CVOA 2VDVE 4QTUB 2FHPA 3FPGA 1INLA 2HTEA 4PYOA 2ESRA 5U4XA 3FUWA 2P7IA 3QOXA 2C7QA 2VS1A 3KPUA 3JWJA 1AQJA 5DX1A 1RJGA 3O31A 3CGGA 2XBMA 3KQYA 3M70A 4QQKA 4E33A 4HTFB 5CVUA 8MHTA 2CMHA 1XDUA 2OO3A 2OKCA 2VP3A 3RODA 4PYJA 5GM2A 3LBYA 2F8LA 3NVMB 2I7CA 2ZIEA 5DRYA 5EMMA 3OPNA 3TOSA 5GINE 4EMSA 1H1DA 5EC8A 3LKZA 1XTPA 1O9GA 3TMAA 5K0FA 3PFHA 2WA2A 4MQ4A 2Z6AA 2Y1WA 3NW9A 4DA4A 5EG5A 3ELWA 2GAFA 3CCFA 3EVEA 3NJRA 3ELYA 3THRA 3RW9A 3FYDA 3DP7A 3UZUA 2YUIA 5CD1A 3G88A 3DR5A 3FTDA 4GOND 1OR8A 2FK8A 5E9WA 2IPXA 2OB2A 3OCJA 2NXEA 5CIYA 5K0NA 1N7IA 4UOEA 5C0OE 1KPGA 3KQOA 4GF5A 2AOVA 3P2EA 2CMGA 3DOUA 4KDRA 4WVLA 1QANA 4GC9A 1G55A 2GH1A 3R6TA 2P7HA 2O0LA 1RI3A 3HVIA 1UFKA 5ICEA 5DM1A 1NBHA 3KQSA 3PVCA 1KXZA 4RVHA 2YXEA 1B42A 3BGIA 2PBFA 3FPJA 2IFTA 1L3CA 1JG2A 3C6MA 3GGDA 2OBFA 1V39A 2AOUB 2ZIGA 3I64A 3P9CA 4DZRA 2GLUA 1N2XA 3ME5A 3PS9A 1Q0TA 1SG9A 1TPYA 1F3LA 4R05A 4EKIA 5FTWA 2R6ZA 3GJYA 2ADMA 3KR9A 5FWAA 4PYMA 3L8DA 3SX0A 3R0QA 3LCCA 3EPPA 3MCZA 3B7PA 4FSXA 3TKYA 5KQSA 2QRVA 3LDFA 5ICCA 4C4AA 2PKWA 2A14A 2UYQA 2PV0A 3D2LA 2YXDA 3HNRA 3I58A 5EMKA 4OQEA 4YMHA 3ER9A 2VZ9A 1NKVA 3LDUA 3PTAA 1NW5A 3BZBA 2BM8A 2PGXA 2NYUA 5GM1A 2O06A 3FRHA 5HILA 5GP1A 4HGZA 2Z6QA 3NWEA 2AZTA 3LBFA 5LR6A 2QYOA 3FPHA 1JG3A 3HCBA 3QOWA 5DX0A 3UJ9A 2AN3A 3FPEA 4C03A 5CVJA 1EG2A 3K0BA 3JWIA 3BUSA 2H11A 5HIIA 1YF3A 5FA8A 3A7DA 4YUVA 3LCVB 4RVDA 10MHA 4CKBA 4P7GA 3A27A 1FPQA 2B78A 5FADA 3ER8A 2V74B 3FPFA 4GC5A 4GEKA 3HA7A 5P8WA 3WSTA 4FR0A 3KQTA 3OFJA 4V0RA 2FRXA 3IEIA 2ZCJA 3BXOA 5DPMA 3PX2A 3HP7A 3THSA 3R24A 3E7PA 1HNNA 1X1BA 3SR4A 3GXOA 2G1PA 1HMYA 1KP9A 1NW3A 1YZHA 2ZTHA 3ELUA 1XDZA 3FTEA 3HCAA 3EVFA 4KIFA 4GOLD 2ERCA 5HEKA 4YUXA 4DMGA 3EVAA 1XJ5A 3FZGA 1IY9A 4O29A 3A4TA 3EVZA 1L9KA 5K05A 3DLIA 3KR0A 2ZLBA 4GBED 2C7PA 4HC4A 3HCDA 1I9GA 1M0EA 2CWWA 5K8VA 1M6EX 1F38A 4YV1A 2AVNA 1G8AA 3MERA 3BGVA 5JR3A 3LL7A 1YFJA 1AV6A 3P71T 3JWHA 4HGYA 1VL5A 3G2QA 3LSTA 1XCLA 4P7KA 4C07A 4RTSA 5E1MA 2H00A 4YUYA 1ZGAA 3SSOA 1RI4A 5DM4A 3A7EA 4EKGA 3GIWA 2ZSUA 4FT4A 3HVKA 1JQDA 5F2OA 3LHDA 1AQIA 4KRGA 3KHKA 1MHTA 4ZTBA 3CJTA 1KR5A 3DXZA 4BY9E 4YV0A 2ZWAA 3C3PA 4QDJA 5EIWA 5K09A 3NVKI 3KPJA 2QM3A 2C7OA 1D2GA 5D1NA 3CJRA 4E2WA 3V97A 1O9HA 3SVZA 2YQZA 1G8SA 3DMFA 3PB3A 3UJDA 1DUSA 2P1DA 2WA1A 2AN5A 3DH0A 4PYIA 2EX4A 5FQOA 2B25A 4QDKA 5ICGA 1DCTA 1BKYA 4L7VA 4X61A 5K0GA 4U7TB 2I6GA 2AN4A 2BR3A 2P8JA 2ZFUA 2ZW9A 4RTRA 4MTLA 4RVGA 3RIEA 4ER6A 5LQKA 1G38A 1P1CA 5DTMA 2PY6A 2JG3A 5MHTA 2YX1A 1JSZA 3BWMA 3M4XA 3OZSA 3MQ2A 4E30A 3DLCA 4PIMA 4LG1A 2QY6A 2P3QA 1BHJA 1G60A 2I62A 5E9QA 5EHGA 4PIPA 4ER3A 2WK1A 2E5WA 3FUUA 3B3FA 3KQWA 4HSGA 4HTFA 5HIMA 5E1BA 1MJFA 2FPOA 2NXCA 5FWDA 2N47A 1WG8A 4DF3A 4YUWA 4BP3A 4R8SA 2ZZNA 4FZVA 5T67A 2AOXA 4RX1A 5T6BA 2GB4A 2AOWA 3I5UA 2XVAA 2PJDA 1WXXA 4OA5A 4U7PB 5KVAA 1NBIA 1O54A 1TW2A 2YXLA 3K6RA 1PRYA 5K0LA 5HOQA 4K6MA 1JTEA 3LX6A 3KPVA 5CVVA 3VC2A 2IP2A 2QRVB 3FUXA 4KWCA 3VC1A 3EMDA 5DXAA 3E05A 4OQDA 3NWBA 5GIPE 1IXKA 1VP9A 1P39A 2PT6A 2UYHA 5EHIA 4LWPA 3B89A 5FHRA 1Z3CA 3FYCA 3I53A 4RSRA 4EK9A 3AXTA 3BWBA 2AS0A 3ID6C 2JHCA 3OE5A 3TR6A 3NDJA 3LCUA 3BWCA 5BXYA 3EEOA 3HVHA 1R6AA 3OU7A 2V7EA 5HIKA 1VE3A 3C0KA 3EGEA 3MCTA 3HCEA 4FS8A 2PVCA 1VIDA 5LQAA 5K0EA 3UBTA 3FUVA 5T64A 4RTPA 2R3SA 3HM2A 3G5LA 3M6WA 4ISCA 4XUDA 3P8ZA 3C6KA 2G71A 3T0IA 1FP1D 1R18A 2ZZKA 5EOVA 3OU6A 3PLAE 1UWVA 4IKPA 4IV0A 5HZMA 1Q0SA 3TRKA 2ZULA 1BOOA 3UJBA 4AUKA 3TM5A 2IIPA 3UFBA 3UA3A 1KPHA 3AXSA 2HNKA 5EMJA 3FTFA 3H2BA 4C05A 2YTZA 2O05A 3B3JA 2O57A 3SMQA 1L3IA 3S68A 3VSEA 4P7JA 3NMUF 2JH8A 4P7FA 3BKWA 2EFJA 4AZSA 4M7RA 3UJ8A 4FT2A 2UZ4A 2OYRA 2ONZA 2BR5A 3KR2A 4R8RA 1NT2A 1JR4A 1JTFA 1VQ1A 1WZNA 3GRRA 1N7JA 1R8YA 5DM0A 5E9JA 5ERGB 5DLYA 2P40A 1YZ3A 2ZBRA 3G2MA 1UIRA 4XUCA 4F84A 5LQUA 2B9EA 5DWQA 1WS6A 3FRIA 5FULA 2OXTA 1ZHFA 5D1HA 3ANXA 3EVCA 2OY0A 4ATNA 3JWGA 3SXJA 5LQRA 4M36A 3O4FA 5ICFA 3A26A 2PXXA 2Y1XA 5KS2A 4X60A 1KIAA 3PT9A 1TW3A 1P91A 3KPWA 5HIJA 2IGTA 4HG2A 5FHQA 2YR0A 4RV9A 4Y30A 3KU1A 3SM3A 3TKAA 2B3TA 2JH9A 3LECA 4RTOA 4XCXA 1DL5A 4DQ0A 5EIFA 4A6DA 2NP7A 4BLVA 2Q41A 3E23A 3M6XA 2XVMA 2OPBA 3GRVA 4DM3A 3BT7A 2IH4A 3KQQA 5LQJA 1KPIA 1RJDA 4PGHA 3KQVA 4AZTA 2OB1A 5DT2A 4DCGA 2C7RA 3IYLW 2XYRA 3P9KA 4PCAA 1XDSA 3G7UA 2QE6A 3GO4A 3HEMA 3KKZA 1ZG3A 3CKKA 5F2NA 4RTJA 4PYKA 4YV2A 1NV8A 2IDJA 3MHTA 4EVIA 3G89A 1NE2A 4QPPA 3X0DA 5C9ZA 5GIOE 5F2KA 2PX8A 3BWYA 3GWZA 3Q7EA 3HCFA 4DCMA 5E2BA 2P3OA 2ONYA 2PX2A 5EEHA 3TFWA 2IH5A 5EZSA 3P9NA 1QAOA 3NTVA 3DULA 2HMYB 1JG1A 3GDHA 5EMLA 1KYZA 3EMBA 1ORIA 3BKXA 1NW8A 1JQ3A 2NXNA 4IV8A 4MWZA 5EZQA 2EJUA 3P2IA 2BZGA 4QTTB 5E2AA 2FK7A 2P3LA 2LD4A 1SKMA 3PFGA 3I9FA 2DULA 2HV9A 3C3YA 2AOTB 3UJ7A 3TQSA 2ZWVA 5BW4A 2AOTA 1I1NA 1XCJA 2JHAA 2PWPA 2ZIFA 3G5TA 3OZRA 3HA5A 4X1OA 2GA9A 5FA5A 5CCXA 1IM8A 4GOOD 5DSTA 4LWOA 3OFKA 3G8AA 2YVLA 5BP7A 1JQEA 3MGGA 2AOUA 4FP9A 4CTKA 4CKCA 1XXLA 1L3BA 4X63A 4ER0A 1P1BA 5EKXA 3QV2A 4PWYA 4OBWA 2NNWB 1WY7A 1PJZA 3P9IA 3MTEA 1ORHA 5DRTA 4EQZA 4JXJA 1M6YA 5GOZA 1QAQA 3MTIA 2FCAA 2DPMA 4V0QA 1RJFA 3R9XB 7MHTA 3SSMA 5EPEA 3P2KA 2VDUE 2NXJA 2HWKA 4YUZA 1ZGJA 3SSNA 4CXMA 2BM9A 3MAGA 4CTJA 1KYWA 5BW5A 1X1DA 4PNEA 3EVGA 3MB5A 4BLWA 1RI5A 4F85A 2EJTA 3DMHA 3P97A 5DM2A 2HR1A 4CKEA 1SQGA 1FJXA 3OU2A 4C08A 2JJQA 4POOA 3M6UA 5EKUA 5M5BA 3SGLA 3UWPA 3EVDA 3ERCA 3LGAA 4OBXA 4HH4A 5FUBA 3G2PA 5H02A 2BH2A 3KR1A 2VDWA 2CKDA 4PYLA 3NDIA 3LKDA 3CJQA 3GRUA 4GQBA 2NP6A 2P35A 3ELDA 4AZWA 3GNLA 4GOMD 5E8JA 2PXAA 1RI1A 1NW7A 5HFJA 3V8VA 4PYNA 4KVZA 4A6EA 3T7TA 5CM2Z 5K03A 4OX9Y 4E70A 3F4KA 2AVDA 5K0CA 4KDCA 3KQPA 5C1IA 2P41A 1EQAA 4QQNA 4RVFA 4E2XA 4WXHA 5FCDA 1EAMA 4FSDA 5DX8A 2PT9A 1SUIA 2JHPA 4RTQA 5EVJA 5GWXA 2PX4A 5IKMA 2CL5A 1NV9A 1SUSA 5DTQA 5E1OA 3UJAA 4H0NA 2PX5A 3E8SA 4E2YA 2ZZMA 3R3HA 4FGZA 2GPYA 1VP3A 5DSXA 5CCBA 1VLMA 1QYRA 1RI2A 3DUWA 3EVBA 4RTMA 1JG4A 2AR0A 5DXJA 5FQNA 4YMGA 3B3GA 2XYVA 4HRAA 3DXYA 4C04A 1BC5A 1VBFA 3M33A 3T7SA 3M6VA 4BP1A 5EQJB 1JSXA 1VPTA 2G72A 3VYWA 4P58A 4AX8A 3DTNA 4OA8A 1QZZA 3AWIA 4PINA 3REOA 1RJEA 1FBNA 4PGGA 3GRZA
chains in the Genus database with same CATH superfamily
4N5MA 5EFOA 4YMLA 1C30B 2PNJA 2CNBA 2XVXA 1G3UA 3RVQA 2QT0A 3RS8A 3KC2A 3AEKB 3OZTA 4L72A 1GNRA 1H66A 4LEIA 3QA3E 3ETJA 4INZA 4KQIA 4L0MA 4M9XA 2ZRLA 5BUCA 1IEXA 2Q1SA 2RAPA 4PYQA 3UOAB 4D81A 3U6KA 1XROA 4D41A 3A9UA 1XLWA 3FW1A 3O8NA 5C32A 1W44A 4ZODA 1EK5A 4AMBA 1I4DD 4QYMA 2Q1XA 1GFZA 1JDPA 1ZICA 1H0RA 3I2IA 3FSGD 1JI0A 5T8KA 3WLIA 4F6CA 1SVUA 3DR3A 3FRJA 3IJEB 5T4HA 4B3RB 1HOTA 2EQ5A 1KDYA 4TKVA 2B34A 1N6RA 4MIKA 1FQKA 4TVKA 2XKAA 1BGXT 1GU7A 3IA2A 4NCXA 5G0WA 1KIFA 5AW4A 1B16A 4NL4H 2QZSA 1XVAA 1Y33E 2CLMB 3QUCA 4M60A 4FI3F 2XA2A 4EY8A 1D2RA 2GN6A 5C1PA 5BVHA 1N2JA 2F7SA 4W82A 5KVCA 1HQCA 1NHGA 1ZOLA 3M9WA 3F9IA 3PENA 4MEAA 4UEQA 2Q4OA 1PT9A 3BL5A 1XVTA 1T43A 2J0EA 2PX6A 1ZU4A 3KJEA 4PXYA 4LGYA 5ALQA 4ZVOA 1QRTA 1IATA 4PQEA 4ZCIA 1T3TA 1Z0DA 2IGBA 4RQAA 4XFKA 4EAQA 1IUKA 2BV3A 2XYQA 1GNLA 4A8JA 3MF4A 4DQKA 5EUCA 1AMOA 2OC9A 5IF3A 1GUBA 2QTGA 2HPAA 3GRYA 1E4EA 4B76A 5EGNA 5JHGB 2I6UA 4EUHA 2WD8A 4DOMA 1EYZA 3DLBA 1W2HA 1C1DA 3WWZA 2AFIB 3KXPA 4YWHA 1B23P 3Q3EA 2V3WA 4B74A 2XRMA 1LU9A 3NNSA 1C4XA 1U8UA 3CY6A 3TD2A 4FVTA 4Z9AA 3UKOA 4CIWA 1H6DA 1SZJG 3RRYA 1UANA 3VYTB 3WMFA 1S0UA 1DC7A 2FSVC 2O2XA 2C7QA 5JS2A 2DBYA 2QPLA 2V6MA 1RJGA 3IUNA 1UDAA 4S3MA 1CP3A 3I9MA 4PRZA 3O8QA 3WKAA 3A6KA 2HIAA 5SZJA 2J9XB 4L4RA 1WLSA 1M6NA 3HQ4O 1WBJB 8MHTA 5LLTA 1YVEI 1ZVMA 2Y68A 4J4TA 3HBAA 1W76A 3VKWA 4ZI7A 2AMFA 1QGZA 4PVCA 2QU8A 4C30A 4EPYA 1WQ4A 5JEDA 2M32A 1IFXA 5IC4A 5ESXA 3E7WA 2AH5A 3ITKA 1VCMA 1OH7A 3Q3VA 4HS4A 4BLRA 2BCGY 3O74A 1RLOA 3DKRA 4JC8A 5FO1A 4B3JA 3N5KA 3S28A 1MXFA 1JHMA 4G1CA 4YMUA 3UZUA 3BWXA 1CEYA 3EH2A 2YZMA 3JYLA 4TT8A 2FPPA 1KZ9A 1TCBA 3IPAA 1VYTA 3R09A 5A05A 3RCBA 1SN7A 2FK8A 3MTBA 1K8ZB 4ENUA 2P2NA 5F77A 4QYIB 3WFIA 2OCIA 3BE4A 3H8JA 4XJVA 3B8EA 3KQOA 3M1AA 4O2LA 4KDRA 1MX5A 3MUFA 3RYHA 4J4BA 1JA1A 4CLDA 1RXWA 3CBQA 3HVIA 3IKLA 2X3UA 4E51A 1GL6A 1EXMA 1N2HA 1TYDE 2Q1UA 3PVCA 4ZK6A 4GQAA 4KQMA 1B42A 2YC2C 1ZM2A 3QUTA 4JU8A 5LDHA 1EG7A 2JKYA 3ZKAA 3TTUA 3GFBA 5KSZA 1YS1X 4ZYYA 1ECPA 2PWAA 2YZNA 3RS7A 1P61B 2W2LD 4CR6A 1RFGE 3I64A 3OE7A 4UE2A 3UCEA 1A2KC 5JBQA 3EAFA 5LP6A 1T9KA 2MU1A 5EIBC 1P77A 3QY0A 3GBSA 3TX2A 1J21A 1NQXA 1W1UA 4G2NA 5K6RA 3E1SA 1Z07A 4YMHA 3NIWA 1QLWA 2EOAA 1H1LB 3C7TA 4YJ3F 3SYNA 1VKJA 1LQ2A 1BXRB 5IBRA 1VFNA 2O06A 5GP1A 1P3Y1 2HTFA 2VBIA 3GPDG 4HB2A 5L8VA 4C5BA 1ICIA 3RHSA 2QBYB 3FPHA 3NONA 4A0RA 1YGYA 1JU9A 3QOWA 1XTQA 3E1KA 2L69A 5H3CA 3IMKA 3FPEA 3QEOA 3UJ9A 4C4TA 1KA9H 5TIIA 1I4TD 1U0HC 4B4KA 3H0EA 4ZQCB 4JT2A 4M4SA 2X0KA 3N3AC 2D5AA 2OCPA 1KQNA 4CG3A 1CS0B 3BCHA 3LT1A 4UUOA 2ONKA 4JJFA 5E38A 3ZHRA 4DLZA 5EYPB 2P9FA 2YICA 1N3IA 1S96A 2LE0A 3CUWA 4XQGA 4PCVA 1J25A 2W9XA 2ZCJA 3ZX5A 3MWEA 1SUBA 3DVQX 5IJ0A 4K7JA 2WJZB 2CUTA 1NNLA 3INRA 3I76A 4RE6A 3DBVO 3GXOA 4B31A 1L5YA 3NM5A 4J0KA 3DDWA 5DB4A 3HUEA 3KZXA 4KIFA 5AOAA 1CZHA 4W5WA 3RLFA 4IHQA 3UFXA 3GEBA 3EVAA 2IBMA 1UM8A 5H9VA 4O29A 2RHOA 4F2PA 3U7GA 3TZLA 4WCVA 1YQUA 2NT3A 4MX8A 1SKUA 1IM5A 3E9RA 2XZDA 4QTZA 1Z74A 4B7UA 1LLUA 1AKTA 4LNHA 5JMTA 3N6XA 2FUEA 1JU4A 2XIQA 2GJSA 2DUMA 3M5WA 3FKSD 1E2FA 1PBNA 3CNEA 5BY2A 4WJLA 3IP3A 4O4LB 3B5JA 4LJ8A 3E9ZA 5C8XA 1USVA 3AHCA 1ZD5A 3ZK9A 5KWJA 4YUYA 2QMEA 1UOPA 2ZTLA 4ZOLF 2ZUWA 4A2QA 1UZLA 1CRZA 5AMXA 4X92A 3UOGA 1Z0SA 3OQIA 1Q5PA 3C3BA 4S2EA 2QRQA 3CH5A 2QP9X 3DEFA 2OCDA 1IBKB 4ZTBA 3CJTA 3C1UA 1G9TA 3C3PA 1KIMA 1SCUB 3RK4A 4OK5A 1DIAA 4JMPA 4C89A 1FP6A 1TIKA 2MCFA 3VYUB 3KNZA 4W1SA 3WHKA 1A4UA 2EFEB 3GOQA 4C7KA 4TMTA 2XGOA 3GK3A 5L7WA 5C80A 3D43A 4O2BB 3VZCA 3OJLA 3K92A 5C37A 2KLBA 3OH8A 1QE3A 4X61A 2JK1A 4HDRB 3ROXA 4GI1A 2Q2NA 3DEIA 3BA6A 4FJ1A 2WJGA 2DYKA 3T5GA 1FCJA 2PD6A 3CRZA 4JLOA 3G6WA 3BWMA 3NPAA 1YKSA 2CCKA 3IAM1 4N49A 1XQYA 3C4JA 3B1WA 1HG0A 4B6OA 1KI3A 3Q0IA 3FUUA 4WBXC 1Z4QA 5L7TA 1GQQA 3MJFA 4B85A 2P0EA 3R9KA 4EQ6B 2X2FA 4U2EA 3DF7A 1AKRA 1V3QE 1OFTA 3GXBA 4FZVA 1CW2B 3TBFA 4RX1A 3N0RA 5TMBA 2GB4A 3TVYA 4OOEA 4D46A 2PJDA 4DIOA 4R3NA 2FMIA 2BBWA 4Q1AA 5FDFA 2R1ZA 5C8VA 2Q9UA 2X8WA 1A9ZA 4GKVA 1GZ5A 1G6HA 4FEYA 2JPDA 3C7KA 4LOHA 1BRTA 1A8HA 1T8RA 4FOLA 4PBRA 4J76A 4ZEVA 1E1NA 5JAOA 4TUYA 1OGYA 4LBVA 2BFFA 1P39A 2VO1A 2K87A 4CV0A 1E89A 1DWOA 1U0EA 3OLXA 3ADCA 1Z3CA 4EG7A 4TYNA 1E5XA 1PR0A 2VP4A 3AXTA 3RFFA 3ZNNA 2CE7A 3BRWD 1CERA 2XNHA 1YB4A 3BILA 2WT8A 3N2NA 1EIWA 1U0LA 4LXHA 1GZDA 2B1IA 2ZGVA 3FMPB 5E6RB 1DTWB 2WP8J 4DE5A 2Y1DA 4BFZA 4DLTA 5CEJA 1OXVA 1WUKS 1OCEA 3VFDA 5MN6A 1QHHA 1RRPA 1X2BA 5FO0A 3P8ZA 4DC0A 3IILA 2IV3A 3ZDCA 2Y71A 1AGRA 1LVHA 2VHJA 2Z4SA 2ZZKA 3I6QA 3I9JA 3L7KA 3QE0A 3SLGA 3UTDA 3PLAE 3UJBA 1Z7BA 5BV8A 3TIIA 3NGXA 1KMCA 2X9VA 3GMSA 3UA3A 1X14A 2WZQA 4HQ6A 1BXGB 3H4VA 1TO1E 1Z6ZA 1E59A 4GLBA 3AHFA 4O2BF 4BX3A 2OORA 2E5LB 2QORA 1ADBA 2VRWA 3TSYA 2VSNA 3EFBA 3EB9A 4Q3OA 3RPEA 5FB3A 4EEKA 4OV6B 3K9NA 1FMCA 1NJ8A 3OQ6A 3F6SA 5C7OO 4EPTA 3QSGA 4XLZA 2AK2A 3GAMA 5FEMA 1JYSA 3U3KA 3RSCA 1N8TA 4O25A 1KR2A 2QJOA 4Q3EA 2WJPA 4AUMA 2XMGA 3G2MA 3W3AD 4B44A 1B2RA 5JH7B 2B9EA 2Q5HA 1FSPA 1BNCA 1YV9A 1NXOA 1K8RA 4UAJA 1Q11A 1EESA 1QGAA 2PUVA 4RGBA 2Q0QA 4UZEA 2GHTA 4OHKA 3SX4A 2B6NA 2AUMA 4EFLA 1Z73A 5DE3A 4DLYA 1P91A 4IIJB 2OMEA 1U8XX 3BREA 4HG2A 3UCXA 3VKUA 2ZB8A 1K68A 5EQFA 3SAJA 4D9JA 4ZMBA 3OEEA 5TY0A 1E5QA 4OHCA 2RHWA 2AI1A 5FT9A 5FWXA 2DH6A 1CZUA 1OXXK 2OAP1 4Z51A 1OW3B 4DV3B 4W5JA 4FXPA 4X8HA 3TRHA 2ZUCA 1ZVJA 1Z39A 3AERA 3JVVA 5JMOA 4EY4A 4IRUB 2J9ZB 2BTEA 4CDGA 4ZI7F 4DCGA 1MV8A 4XGQA 3ZFRA 4IIFA 4ZQIA 3K31A 3ZFQA 1BAPA 1TFRA 3NP7A 4MB0A 3QVTA 2PLNA 3UV7A 1NW9B 4IF4A 1XALA 3PFFA 2R8PA 2QRHA 4EVIA 1JJFA 1Y6FA 5JSFA 3OCZA 1JEDA 1MCZA 4E1VA 3AOEC 3CZCA 2EERA 2PVSA 3H2ZA 3UPUA 1J4AA 3EISA 1YR3A 1B6TA 3CR7A 2MSLA 1PZHA 1YZLA 4MXDA 3VSBA 1QAOA 1U8AA 4M1OA 4Q93A 1IJBA 3AIIA 3QU9A 1NXXA 2IXFA 2PS9A 1Q50A 3VR6A 4R1MA 4OJMX 1GGNA 2X13A 3QYPA 1TM3E 5CAEA 1E9FA 3T1YB 4KX5A 1JPUA 1WPGA 3JCZA 4Z4QA 2CNWD 2H0AA 3TLYA 5CXUA 4MKFA 3I9FA 2WZBA 2MSWA 4B83A 5JI2E 1C50A 1K3UB 1P0QA 1PX2A 2R2AA 4I1PA 2FWAA 3LZ6A 4WK2B 1J9ZA 1AGNA 3IR6A 4E70A 1S3IA 1C7QA 3GGGA 2J67A 1R8QA 2GA9A 5IYZF 3SNKA 3VHXB 4DRXA 4M9UA 1U5BB 1HT3A 2CZGA 2JIZD 4GOOD 5CLQA 2J48A 3G8AA 3K8ZA 3RVOA 3C5VA 1CUWA 2Z3WA 1JEQA 1U1DA 2ZXFA 3RIHA 5B6IA 1OAKA 5KEIA 2JLUA 2H4XA 1ONBA 1SBHA 1L3BA 1MRSA 4Q05A 4XD7D 5FI3A 3S7TA 2AJBA 1VBKA 4XASA 5JU6A 3GRCA 4QASA 5HF9A 4PWYA 2R47A 2WY2D 1OGJA 3ZI0A 3HLTA 4BQPA 3LC2O 2NX2A 2AT1A 4IHJF 1AMNA 4HB0A 3P9IA 4EYKA 1KRHA 1UK8A 4C6SA 1OASA 4G25A 5AVSA 1ZAKA 1UKAA 1N7HA 1HEIA 1M7HA 1UDBA 1ND6A 3FNEA 3H65A 3MTIA 1WW8A 5FWYB 3SR3A 2JVIA 2D2VA 5KSPA 3P2KA 3T06B 1QH1B 3FF4A 4Q4LA 1UODA 1QTIA 4KU4A 3TR0A 2XT9A 1NQVA 2Y1FA 1QP0A 3SQMA 2B20A 1VKOA 1PJLA 3CWZA 1TUBB 2AL7A 3I92A 3NYIA 3V6LA 4CKEA 2DWOA 2O6HA 2YW9A 4C08A 1AVTA 1YRWA 2NYVA 1FFXB 2WG0A 4D5EA 2HK6A 2IOFK 3OEED 2WHXA 1C0PA 4LS3A 4PO9A 2C03A 5FF9A 4FC7A 1PFQA 4RKQA 4M6WA 2WWGA 1OPXA 3IB3A 4KIUA 1K4MA 2AKEA 2WJAA 5T4EA 2K7FA 5FPTA 1L4BA 2OLJA 1DDIA 1H8HD 3C6BA 1QC5A 1ZONA 2VDJA 1TQ6A 1NC1A 3S7ZA 1GTG1 4R83A 4YJGA 4BMCA 1TCAA 4L3VA 3QXJA 4IQ8A 2JGDA 4MSUA 1CBUA 1YDFA 1IVNA 1JHRA 1QHEA 4KWEA 4YAFA 2VWHA 3RS4A 4HWRA 5BN5B 3KQPA 1XMOB 5JJIA 1TJ4A 1CY7A 3BSWA 4ZVUA 4BTEA 3RC9A 2GM4A 4B4OA 1P4AA 3OWOA 2VPWA 4FD2A 4IRXA 2PMEA 3VU1A 3LNCA 1WBBA 5D3KA 4R9VA 4OJNA 5J47A 2PUEA 2DE0X 3LZCA 3OJXA 4Q48A 4UHDA 4AMUA 1JDTA 3W5CA 2W6JA 2V96A 3T5TA 3IRUA 3CUVA 2G25A 3SZUA 2QS9A 3DMRA 1NATA 2VHTA 1X80B 1IWPB 2OYSA 3AYZB 3ORSA 3FD8A 3I5MA 3S2IA 4UEOA 1SJ9A 5DSXA 1ICEA 3DOFA 4KUEA 1TAGA 5CCBA 4JXXA 4IIEA 5KX5A 3NMUF 3RUPA 4TTTS 1YZQA 2GA8A 5IJWA 1RPJA 3C14C 2VTVA 3QP9A 1OC2A 2IEYA 3JD4A 4R2JA 5EQJB 1N5MA 4W1RA 3TCNA 1J97A 1IOZA 5H0IA 3FFXA 2YVKA 5EJAA 3VR3A 4YXWA 3INNA 4B81A 1AK2A 1AN0A 3KTAA 3MQ4A 3ULKA 1LRLA 3E0XA 1WB9A 3JZDA 2QL6A 3CF4G 5A3RA 2YKGA 2H08A 2ODPA 4LTDA 5FR2A 1NBWB 2GRAA 3SHWA 4B3HA 2H4FA 4JV5B 2EFCB 2XECA 2ZBPA 1NY6A 4CF7A 1ZD3A 5IH7A 2J7PA 1K6IA 1NMZA 5JDIA 5COBA 1UC9A 4UBNA 5AI0A 2IYOA 2DR0A 1DAEA 3TLJA 2DCUA 5FFFA 3UAGA 3ZIAA 3L84A 1DX9A 4G85A 5AW9A 3OLVA 5CH5A 5CP8A 1JSRA 2F3UA 2IYQA 2MWMA 2BUBA 3W5AA 3O03A 2GT1A 1HZZA 3HMKA 4XFJA 4MHTA 1K5DA 3ECAA 4ISBA 2EZ8A 3WLAA 4CFYA 1R8XA 2FWBA 4CKWB 4F8YA 1D2HA 1DU4A 5I9NA 1G5RA 1V16A 1O7JA 4PPYA 1F2VA 1ADJA 2VAXA 3VR4D 5JAZA 3DE2X 2D1YA 1YBVA 2BW0A 3TCKA 1OBVA 1YQQA 1FX0A 1CUZA 2L42A 3HBJA 3CRNA 1JPJA 1DRUA 3BHMA 4ZCMA 3T1QA 5C8YF 3C74A 1SZPA 1W0KD 2PGDA 2CL0X 4GUAA 3FVRA 1BQEA 3WLFA 3E7DA 2PANA 2NU9B 2A67A 4C0SA 4HNQA 4LZAA 2GZ3A 2F67A 4EGAA 3B7GA 5FPPA 3HNPA 2ZVJA 3O0DA 2YUTA 4IWNA 4KIWA 3SEAA 3U5TA 1XRJA 4DY6A 5B36A 1PEAA 2BFDA 3TXAA 4JVSB 1XN1A 1JE0A 4EHFA 1DJMA 5E0OA 3ZGVA 2I2BA 4FX2A 2ODAA 4YONB 1ODLA 1H8HA 3PQ3A 5TMDA 2I9KA 1DELA 4R5MA 5EE9A 2EP7A 3ROMA 4A26A 4D0LB 4WOPA 3HYNA 1XI2A 3UAVA 1XA4A 3E3MA 4O33A 5CA1A 4WLNA 2YRXA 3EODA 1BOFA 4QU5A 4Y18A 4ZT6A 1GPAA 2GOYA 5JQGB 2J3MA 1GD1O 3K9FC 3OSUA 4GPAA 3BMOA 2ATEA 4FZJA 3PQ6A 1DKOA 1H3EA 4QTUB 5IZCC 3FPGA 4OGLA 3RS3A 2J3IA 2HJGA 3HXTA 4HMQA 1CE8A 3CW8X 4FDVA 4HZGA 1Q2XA 1KS9A 1XK7A 1TJNA 1XIVA 3OQ1A 3QJYA 1E2UA 1ZIYA 5C1BA 1LDYA 2JAOA 1XHFA 3AKEA 3OLYA 4UQOA 3GLIB 1S2MA 3HN2A 4NVRA 1DAHA 4HTFB 1L5RA 2YZ2A 2Z8YA 2CMHA 2OO3A 4CDMA 5TPZD 1CJBA 1RHKA 2G06A 3MUOA 4UHEA 4J9VA 5KINB 2JBWA 3TS1A 1DAMA 1PIWA 3WIBA 2WMYA 1QIGA 5CA0A 1HE2A 3I8SA 5TS3A 1NPDA 4E88A 3D8UA 3V34A 1J0EA 5FAKA 3TZQA 4LDNA 1L5MA 4N3GA 3NFRA 3PFHA 5EESA 3ZNOA 1VLQA 1HFJA 3P4UA 5IG2A 5IWCA 4DA4A 2HI0A 2JK0A 2HHHB 1A72A 1F2TB 4WZBA 1A9PA 3ZOKA 1NZDA 4DPMA 2I1VB 2FPUA 1OBCA 4PTLA 4R8VA 4B75A 2HSEA 4B40A 3FMGA 1W0CA 2BM0A 2ATCA 3KIPA 4GOND 1YJ8A 1QQ5A 1QH8A 1U5AA 2OFOA 3OZAA 2ODQA 4HAVA 3FMFA 1WXIA 1ZK1A 1NI4A 3P2EA 4ICIA 1UKBA 5CDHA 2ZWPA 1PGJA 3N76A 2ZRJA 1IXSB 1DDOA 4LRYA 4E5DA 3Q7SA 2WYIA 2EGUA 2A84A 4ETIA 2YXEA 1HURA 2XR1A 4MR9A 1WCV1 4AT1A 3BF7A 4JJIA 2XHZA 1UBOS 4P2BA 5LWQA 1UDWA 1L3CA 1VHLA 3HJUA 4D44A 1WPRA 5JSZB 1DKLA 1OOEA 5MFZA 3ZU6A 2X42A 4CEJA 3L1UA 3V1KA 2EU8A 2XMBA 3HPRA 2HCBA 3PNYA 4B3XA 4MV8A 1B4DA 2FCRA 1VE5A 2ADMA 5HNKA 3OY2A 1LI5A 3VVLA 4G9GA 3LDFA 1H1LA 2V7TA 2R00A 5T57A 2PV0A 2I54A 2OM2A 2XA1A 4ZYLA 2IWRA 2BFNA 3LDUA 2FDCA 2VBGA 1NTRA 4MZDA 1A4IA 4KAFA 1IYZA 4TV8B 3WDMA 5IX8A 2WIAA 4HO1X 4ENPA 5AVZA 5I5EA 3RUHA 4OHUA 4P3XA 1XT6A 5K8UA 2CJPA 5CVJA 3WIUA 3AJAA 1KU6A 1CS0A 2C92A 1PS9A 4YUVA 1W5EA 5FA8A 4F9FA 1R12A 2ZBVA 3DAPA 1EFPB 2PS0A 3T54A 2ZIAA 5KTPA 3FAKA 3NBZC 2O7RA 1LH0A 4K87A 4AD8A 4I9NA 3L9XA 2ECKA 2JIBA 2NIPA 4WK4B 3FNHA 1JWBB 1FLNA 2FH5B 5E2IA 2GAJA 1XELA 4WH0A 3CZ5A 4MLZA 3WO0A 1VG1A 2G1PA 2XLCA 4PSCA 4Q9DA 4RJTA 1L7VC 1KI1A 1NR1A 3H7IA 3FVTA 2E4ZA 2QOEA 3EVFA 3D4OA 2OQVA 1PFUA 1J9EA 4YUXA 2EFYA 2WVAA 4L5CA 3O8LA 1T4BA 5BRNA 1ZPDA 5K0ZA 2AFRA 3EVZA 3LGXA 1WQ1R 2D13A 3LVBA 5K05A 3GJ6A 4OYYA 2ZLBA 5EWLB 4C7BA 1O2DA 2XTAA 4Z4HA 4HWSA 1TC1A 2Q9AA 3Q8KA 4ZAXA 5K8VA 2I3BA 3AESA 3K1YA 5KYTA 3U3RA 3G7NA 4BO6A 2CK3A 1KXJA 4G1EB 4RA6A 5AVKA 1TECE 5ALFA 3JZMA 4HGQA 1XEWX 3IBCA 3AFGA 4PSAA 2QUHA 4FLEA 5C5DA 5MN5A 2LRHA 2VHYA 2Y1GA 3AUYA 4ZCRA 3PUZA 2J87A 2QAJA 2WINI 4IMPA 2E55A 2Q1WA 4ZV7A 2GF9A 3STWA 2C8VA 1UJ2A 3N0WA 3SDSA 4ZPXA 5B3JC 1UCFA 2NO5A 2GR9A 4Z99A 5AOVA 3BA1A 4V0OA 2XF8A 4X62B 2FQQA 4U0JA 1OXMA 4V38A 3PRJA 5EIWA 4JL6A 4DLSA 5HIAA 3T9FA 3SBOA 2C0CA 1AU9A 1DKQA 2ERXA 3EGXB 4HVAA 2WTNA 3WADA 1YULA 3G2KA 1XVIA 5IJXA 3UMJA 4ZOQI 2AN5A 2DM6A 3FYHA 1HQDA 2B1GA 2X8AA 5FQOA 2HA5A 3MS7A 1VOTA 2O8EB 4LZJA 4MVJH 3S8YA 3RADC 2I66A 1H8ED 4EJ0A 3N7UA 2ZW9A 4FR5A 5CPBA 4IDFA 1A98A 1SKYB 1ZUNB 2QG4A 4AWBA 1QPBA 1T1EA 1LJUA 1Z22A 3C85A 4I81A 1LX6A 3S2EA 3M4XA 1SB9A 3EEIA 4EI7A 3MQ2A 4ON9A 5EWJA 3HUDA 3F8SA 2HN9A 3SKYA 5A2GA 1O9BA 1GYPA 2PG3A 1TIPA 3AO0B 4QELA 1NF3A 1OKKA 1C8BA 3ZJUA 4FNMA 1ZI6A 2N47A 3K2IA 3SJ7A 1RU3A 4N3AA 1RQ2A 1TZCA 3H9BA 4IMJB 5AXBA 2ZKIA 3KTOA 1C1YA 3DDOA 2PMFA 3QH4A 3ZW8A 4HBGA 1A8PA 4NDNE 3R5TA 4CEJB 2D6FA 3UUEA 1O54A 2XKJE 1NM5C 5KYNA 3FWZA 2X5KO 1MO5A 1JMKC 2FOLA 4TUYF 1TYCA 4ALMA 5ALVA 3LOQA 1T1SA 3FUXA 4MW5A 2FN3A 2AYXA 1HDGO 4BN5A 5JC1A 4NQZA 1JQKA 3Q3JB 1K6XA 4PPFA 1P3JA 2DF8A 1GEEA 4V2UA 3TBHA 5K3BA 3EVNA 4DLUA 3GPIA 3DMTC 4TV8A 3ZUPA 4QZVA 1SD2A 1S2DA 4FMDF 4XX1A 3LUBA 3ON5A 5DK4A 1R4NA 4IUBS 2JHCA 2RKWA 4M1MA 3L7IA 2RHHA 2PBRA 1P4SA 4BNGA 2DT5A 5K0SA 3N6VA 4MQ6A 1CT9A 1RJWA 3STXA 2VDQB 2W37A 2XE7A 4LMRA 5F7JA 1FYEA 3BB3A 4B80A 4F4JA 2H57A 1G20A 4QPDA 1FY2A 1PGPA 5DGDA 4ZREA 3M6WA 1T5BA 4N54A 4RXMA 3SFVA 3C6KA 4MRMB 5ADWA 2UUAB 2HJWA 2OCLA 2ZRBA 4DQXA 1KK0A 3LY7A 3QFCA 5K4GA 1FTGA 5HZMA 3WWOA 3EFEA 1WB4A 3F5MA 3M8KA 1TUGA 2IIPA 1DCKA 2VNAA 1SHLA 3R6LA 4ETMA 2B4QA 3NHBA 4C05A 3B3JA 2EEZA 4C2TA 1DARA 1VXRA 1W581 2RJNA 4P7JA 3S5UA 4TSKA 1T2AA 4HGPA 4XKJA 4KR6A 3K5WA 3I0NA 4D3SA 4ZCQA 1YS4A 2JAUA 3WMEA 4ZFNA 4OSEA 3WXMA 3U13A 1U9CA 2YFHA 3KR2A 3VJKA 4JUAA 4DY4A 4CCAA 1Q83A 2X5JO 5DOVA 4FK8A 5FOUA 4D9IA 4F3YA 3GV0A 3BIXA 1NBAA 3VZPA 8ABPA 2Y8EA 1ESMA 2VL7A 4OQXA 3SQDA 2J0UA 3L6RA 3L5KA 2GKOA 5B1EA 4TPKA 1F8FA 2GHQA 1YI1A 1P1JA 2Q1TA 5EYPA 1XTVA 4ACBA 4JWKA 1FRNA 1T4GA 1PS8A 2A5FA 3TLAA 2PXXA 4CDRA 3KK0A 1DWPA 2G36A 1Z6QA 2EW8A 3GEEA 2IGTA 1BX0A 4ND6A 5JXIA 1E3TA 1HETA 4KN9S 4KXXA 1MO2A 4N7RA 2WUDA 1PGNA 4RVOA 4BO5A 4H9KA 1K0FA 3IS3A 2JH9A 5DISB 5BT9A 5BT8A 1PFWA 1SMKA 1JPVA 4Y2QA 4DQ0A 3HH8A 4BLVA 1XWIA 1WHTB 3GRVA 4DM3A 3C3KA 4UHFA 4V1CB 1VJTA 5B4TA 1U6JA 4FFMA 4CN8A 2COUA 4MR7A 5ALYA 3UPTA 1HO3A 4HP8A 4Q4HA 4WNYA 3V8PA 4LJAA 3BFPA 1PSDA 4QFMA 1BX1A 4M9CA 3TB4A 3ZV4A 3OD5A 4JLVA 2FPGA 2VTKA 5FYQA 4DSOA 1U3UA 5C81A 3HGMA 1L6IA 1XMXA 3OX2A 5CLGA 3VZBA 5TQ2A 5AHOA 5KNDH 1R9GA 2O19A 1SXGA 1RXUA 5E2BA 2XMCA 3VR5H 4BMXA 1J49A 1SUAA 3OPYA 5F7OA 3VNUA 3ZJ4A 3TLXA 3WNZA 3RI3A 2QX7A 3WOVA 1E6WA 2ZRNA 1V11A 1K5PA 4L5IA 1TVCA 3RJ9A 3R7FA 3AI1A 3PCXA 1ACLA 1TXGA 4TWZA 1CVIA 3P2IA 1H69A 2VHZA 1NBMD 3PFGA 3FN4A 1YVRA 2MR6A 3TQSA 3LU1A 2CHEA 3FPBA 2CYBA 2DY1A 3B85A 4NZOA 1WCXA 2ZIFA 1U8FO 2NU6A 1N1MA 4MB6A 4NK5A 4NE7A 3PHGA 3OHSX 1A77A 1QCCA 2O14A 4QO8A 3OC0A 4R9SA 3CCBA 3OFKA 4X91A 2Z57A 2R97A 1J8DA 2AOUA 4N7BA 1FUKA 1OC4A 5GV8A 1DAGA 3NBQA 1P2DA 3KLBA 1H6BA 3GYGA 5E3IA 4ZU6X 4B1FA 4GLJA 1E7SA 2A88A 1WIWA 1Y7HA 1ZM4A 5JMWA 3CEPB 4KQHA 3VDQA 4WBNA 2H1OA 5F9HA 2WYWA 1JZQA 1GFSA 3I05A 3JYQA 4PO8A 2D5CA 5LIPA 4I8IA 8ADHA 4JXJA 2EAUA 4N48A 4EB0A 2VSOA 3MYRA 1JDBB 3VR2A 5EPEA 2Q5IA 2Q2VA 4G63A 1Z5OA 5ALXA 3OJEA 2HWKA 2DSTA 1PR2A 3CZPA 4KJXA 5HCIA 4CIVA 4CXMA 3AF2A 1KMHB 1V6SA 3KYJB 1X9HA 2PDAA 1WTCA 5ALZA 4P4LA 1ZY2A 3P7MA 3ZXIA 5DM70 3DBHA 2IOFA 4QUBA 1VA5A 3JXEA 4R1NA 1S2NA 1MB2A 2EJTA 4F92B 4CKEB 5DM2A 3FFTA 1Y9AA 2CJXA 3ESBA 4XARA 5JZBA 1QO0D 2CLIB 4IEEA 5IULC 4YV7A 1I9CA 4CLHA 1DI0A 2BFOA 4ZHQA 4XTCS 4I4TA 4TTPA 1DQRA 2RH4A 1TLTA 5IC6A 4PU0A 3LUKA 3ZZ1A 4ND1A 3NDIA 5ILQA 1J6UA 2IUUA 1Y9ZA 4X8MA 1JEYA 4GQBA 4I9FA 3RJZA 1C9NA 4N18A 3IDAA 2R1TA 3MHPA 4RDXA 1ZK4A 2HQ1A 4OHMA 3HJRA 1OIWA 3VSAA 2JIRA 3K72B 2KHZA 3FBGA 4BRSA 7GPBA 1ZGGA 3ILHA 2I1LA 2R86A 3S29A 4ARCA 4WKCA 1Z0IA 5K6TA 2C20A 4MKRA 3TQCA 5GVSA 4MVXA 1IQUA 1J5EB 4AX4A 1HLPA 3IULA 1CZOA 2GBIA 2R6FA 2E9SA 3VYSB 1RRGA 5FXMA 3I30X 5TARA 1E8NA 1RYYA 5TDHA 1QVRA 1ZNXA 2HY7A 3MEQA 4AC9A 4WXHA 4FSDA 1QGUA 4I50F 1TLLA 2IZ5A 4PM4A 3RU7A 4GX0A 2C94A 1VLVA 4TLCA 5I47A 3QE9Y 2ZDGA 1PWXA 4XSGA 3QX7A 1GQYA 4HH3C 4F72A 3E8SA 3HI4A 3LQ1A 5B57C 1YZKA 1P72A 3EVBA 2I7VA 4Y2VA 2GM3A 2EW1A 1XNHA 3NHFA 1DEOA 1A7KA 4H0CA 1RMQA 5COAA 3OZGA 4IIJA 4I66A 2GM9A 4DR1B 3VNAA 4JLKA 1ADFA 3VZRA 3I37X 4EYQA 5IVPA 1A9QA 1DAKA 3NG1A 4YEDA 5TT0A 2G72A 3MRVA 2JKZA 2BFFB 4GP9A 4X64B 1GCIA 1TB4A 1M5UA 1YAHA 2EX0A 2G5PA 2HDHA 2POCA 3AWIA 1E2KA 4XSHA 5HCUA 5FWXB 2PGAA 1WXEA 1NKSA 2I0FA 1P7CA 5I4CA 2NPIA 4D96A 3BX1A 2PXCA 4C0KA 2POQX 5BMVF 3AERB 3E3AA 5I9LA 1TVMA 4HGNA 2QMUA 1DGQA 2A30A 2PLWA 2V6GA 4FOTA 2AMJA 4YI5A 3ABRB 3OIVA 3M6FA 3WNCA 2B8NA 2Z1NA 1OSNA 2EBUA 3FTCA 1EIZA 1V8FA 2BGRA 3AR5A 3DW3X 3MWLA 3V9AA 3ZYZA 2J46A 2VZ8A 3QTLA 5LSAA 3ETLA 4TZTA 2CN1A 2DFNA 2OENG 4E4TA 1GU0A 4JBIA 1UEXC 4M88A 4CU2A 4FMCF 3K1JA 5KYKA 1NW6A 2F3QA 1E1QA 2OGWA 2Y6UA 3A2MA 4YMIA 4A03A 4C3UA 2YYYA 3PNQA 1QVAA 1ZS9A 1FBTA 1H42A 2XI4A 4PR3A 2AXPA 3G2OA 3WQSB 1XPRA 3G9ZA 3QLUA 3EGIA 1JGTA 1NXSA 2VJDA 1YA4A 1MOQA 2M1ZA 2OBBA 3PNOA 4E31A 1SIUA 3WZMA 4X0EA 1NAHA 3PJEA 1E6UA 1MT0A 3ANLA 4Z7OB 2QNBA 4HLUC 4U6NA 3CUEF 1ZIDA 5E8RA 1AO3A 1AJEA 1PQPA 1R74A 1VPWA 5JOQA 1F8YA 3MJCA 5ELXA 2JLXA 3UB4A 4JI7B 1N6LA 1S4MA 4ESEA 2OUKA 4BC1A 4RA9B 3S55A 2NSYA 1KJQA 3LX8A 4QM7A 2A5YB 2VCEA 1XJ0A 2O07A 3THWB 2QGNA 3VTFA 3C6QA 1RSZA 4MROA 1W1IA 2JB9A 2PIDA 3AU8A 5A0VA 4W8GA 2NZJA 1UOQA 1FLAA 4AY5A 1OT5A 4D8UA 3NBFA 3USES 2BFEB 3PICA 3VR1A 1MXHA 1BE6A 3GLHA 4BASA 1LBSA 4YT8A 2VDVE 4W8OA 4JT4A 1MNAA 2JFGA 2QVYX 4QWMA 1EXNA 3ROZA 4B5KA 2QUKA 4JXKA 3IOMA 4LSGA 3PEYA 1WD5A 4HVTA 2O5EA 5JNWA 1LDEA 2WP0A 3GG2A 1H2AS 5BQPA 4R4JA 5AKXA 1LK7A 2Z98A 4KPEC 4C0XA 4OX9B 1CETA 2HNBA 4MGHA 2WPDD 5A4JA 4XH9B 4YREA 1IN5A 5KNDD 1NC3A 5HHTA 3ZVNA 4W5TA 1E9VA 2I7CA 2IYFA 1L5SA 3DL7A 2FX3A 2RGUA 5JZ9A 1FFYA 3LKZA 1FUIA 3EHDA 3F46A 3NJ4A 1JEOA 2FZ5A 1Z38A 2FW1A 4PLYA 3RAJA 3T15A 1XKTA 1IEQA 3MQFA 3UWMA 4BJ3A 4YRKA 2Z6AA 4XOUA 2X0RA 2C2HA 1GLVA 4GL4A 4HUJA 3ZH9B 4DCNA 3DWGA 2YNMA 4BTLA 3FYDA 1AGPA 1JDNA 1U2TA 4ZANA 1SKQA 2Z2JA 1N2GA 4ZYXA 4MB2A 3LG2A 3IRVA 5CTAA 4GNKA 2PEZA 3H5OA 4ND8B 1RYDA 5JZSA 2C3MA 2Z56A 1Z34A 1YIDA 3DP9A 1C0LA 2BD0A 4M1EA 4W8HA 5TVKA 5KYXB 5K20A 1F48A 3HE3A 1UP4A 1H5UA 1CUDA 1YTLA 2GAOA 2QL7A 2JL1A 1QDUA 2X2EA 5JALA 4MVYA 1FTWA 3EIWA 4XRRA 1L8QA 1P81A 1TM1E 5CX4A 5BN5A 3B6JA 3UMBA 1OV4A 5LB2A 3T4UA 4LOIA 1Q6YA 3L8CA 4ZYTA 1QTRA 1NNI1 4TMYA 2J3HA 5BWNA 3BICA 1DEKA 4R2HA 3HKEB 5E4FA 3L8HA 5CBPA 3G2JA 3TH5A 1ABEA 5LDGA 5AVRA 5L40A 2D8MA 3JPYA 5ICMA 1TCUA 5U1PA 4LMPA 5FWAA 1Q0PA 4FR2A 1N9GB 2BYTA 3R0QA 4IVPA 2DAPA 1JFTA 2W71A 5JSUA 4WPGA 1W34A 3TJRA 3UUGA 1K86A 2V3VA 4Q3LA 3QU4A 2WPNA 1GTZA 5ICCA 5JCOC 4OUDA 4RLQA 3VU8A 4XW2A 2HLPA 2WHPB 4NU8X 3V7UA 2DFKB 2NTVA 4FYMA 4H7DA 1PN3A 4I08A 2ZEJA 1CRWG 1T3ZA 4P98A 1ISJA 4DSUA 2GRUA 3RFXA 2O50A 3HCBA 4Q9HA 3ET5A 3IMCA 4DYVA 4FE3A 1NPTO 1JN0A 3QX9A 4JITA 5KTMA 3K0BA 2HX1A 3A1VA 2PIAA 2P67A 3PTLA 4MVJF 1F17A 4P7GA 3G1UA 5SV2A 4CKBA 5DN6D 2WQ7A 4LYFA 3FPFA 2AK3A 1XVVA 1YVDA 3LO8A 5LVAA 4G07A 1GDDA 4XVQA 1M66A 3TOXA 2IYSA 3IEIA 4XQEA 1LJLA 1NR7A 4BZZA 3N5CA 4HSEA 4XCVA 4G1UC 3F5QA 1IOLA 1DRJA 2H29A 5TX7A 1R3UA 2B1JA 2WM9B 3S1AB 3NIDB 2IE0A 1YQEA 4ZD6A 3MM4A 2XRZA 3GFFA 4DIEA 5CBKA 4CCYA 5JV5A 3PL1A 1GGFA 2QRNA 3A4TA 4WADA 5JWOA 4KPYA 1QRRA 4ZI2A 1IZ7A 4AUEA 5K8IA 4QGGA 3NTQA 4LJRA 1B43A 1GGVA 2ILVA 3CHYA 3MUNA 3U4AA 5AM1A 3OZUA 1O6BA 2GD1O 2VP6A 2X3FA 5B1HA 2IV2X 4BJ1A 3VOBA 4UTNA 1BDIA 1MAWA 3OUZA 3G2QA 4GZMA 4U2DA 1J8VA 1RC8A 2C4NA 1D0SA 5KAMA 3SSOA 1E0JA 1VI6A 3WV4A 3CVWA 1ZJWA 5CT8A 3LHDA 3SCZA 4X84A 3UM9A 4F56A 2XZOA 2X9NA 2ZWAA 4QUEA 3MWYW 1XZQA 4JB8A 2FLWA 4IEIA 4KMRA 5HSGA 2C7BA 4ZU3A 3L40A 4XPIA 3BJRA 3RSHA 1LBHA 2YYZA 4WASA 5DYGA 2RFLA 4TV8F 1W7AA 2AR7A 5BYJA 3NXKA 1OILA 1SEPA 2LBPA 3WGUA 3R0ZA 1Y7TA 2I8LA 2ZVDA 3DOEA 3GLHE 4IVNA 1SGWA 3T7JA 3W90A 4NBVA 4ZAYA 1LW6E 1JXQA 1MLDA 3LBIA 3KB2A 4MTLA 5A71A 5LA6B 3AUFA 4R54A 4ER6A 1U8YA 3D6JA 4ZIRA 4XWAA 1NHWA 3UT0A 2VK2A 5IAOA 5IM5A 3QMPA 3IJPA 1W88B 4LE2A 4BNTA 3QNWA 2P2YA 5TNXA 4LE1A 4PANA 2ZI7A 3I45A 1U8EA 1Y8RA 4XX0B 3TRDA 2DQKA 2W70A 3OLCX 4U7HA 1F5NA 5KNCD 2NV2B 1IY2A 2FUNB 4AWXA 3UK7A 4EECA 2FF7A 1BO6A 2O2IA 3LUPA 5ER6A 2RGXA 2ZAMA 3ILVA 4U7PB 2P2CA 2CY0A 4GUDA 2OO5A 1XLUA 3KSZO 4FDLA 4OTZA 4MVJD 4WZBE 3O4HA 4H6VA 4K6MA 1JTEA 2JCGA 3IE2A 4MAFA 1NVFA 4MDHA 5KVVA 3OJCA 4TKMA 4KWCA 4DR5B 1GZ6A 3F71A 2IS4A 2MHCA 3G0BA 3RV3A 3ETHA 3R4CA 1IXKA 4NE9A 1VP9A 4Z0HO 2B4TO 4X44A 3QLTA 1QR2A 3A1SA 1JKIA 4PW0A 2BP7A 3SOZA 3GZTB 3V8BA 4XIJA 4RSRA 3FCYA 1WY5A 5D5PA 5LIRA 1DWUA 5TEWA 2RIPA 2H9YA 3NDJA 1AZTA 4RZQA 5BXYA 1SCDA 1TQ4A 5EY5B 3R7WB 4F4FA 3JRNA 2HHAA 1MVNA 3HCEA 2IYYA 2PVCA 4NYJR 4DLKA 2GZMA 4TL7A 3DOJA 5EP2A 1RQ7A 3WGOA 4TT3D 1HDRA 4UPDA 4MTCA 1QHIA 4RF4A 1XEAA 4Y1GA 1IUNA 2AJLI 4MRPA 4NSNA 3ROTA 1N6IA 4YPVA 2HAEA 1W4BA 3ZDEA 5J2TF 3OAAD 3LYAA 1AS3A 3O84A 4YMTA 3EF0A 3M0EA 1DV1A 1T4DA 4PHGA 3GLFB 3LQQA 2YTZA 3TINA 3KT3A 1BW9A 1PI3A 1CFZA 2OPHA 1W48A 2H1LA 4F04A 2PRYA 3UNXA 4XB6B 4JR0A 1LZKA 1M2HA 1LNQA 1SUWA 4EMTA 2DQZA 3DDUA 4M7RA 2OHXA 3ZFTA 5IFLA 4Z4CA 3T7DA 5TF4A 2FPIB 3WZ2A 3OHPA 2X3YA 2ZRFA 4IJ6A 4BJHB 2G9QA 2H92A 3MTJA 3NB0A 3M34A 4GIBA 3G0HA 4IF6A 2IV7A 3KQLA 4GOXA 4JFRA 4K9PA 5DLYA 5GY7A 1ADGA 3NIFB 4AP5A 1PZEA 5ED0A 1QS0B 3NANA 1GQRA 2RG7A 1JLSA 2QQ0A 4RCZA 5THXA 3OP1A 2FSGA 1D8AA 3V1LA 1A71A 1J22A 4HDQB 1ENPA 3FRIA 4AN4A 5IP5A 5CA0B 3WLPA 1AUPA 2VZLA 3OOHA 3JWGA 1A3CA 2X1LA 4FCWA 4K9OA 4ZYWA 1Y7LA 3W05A 2IOYA 3LPNA 3L1IA 4B5LA 4BGUA 5BN3B 4LNUA 4YR9A 1HT2E 4I2NA 4RNCA 3VR4A 1GUFA 3RTEA 5CHYA 1SXJC 1W73A 1C0IA 1XXHA 2QHXA 2YIVX 1I14A 1QH0A 3D0OA 4Q7LA 3RVMA 2CLFB 5SYAA 4QBGB 3S44A 4C7MA 5IVIA 1RRVA 3ZWYA 1DNPA 1JT2A 2DCMA 4ZGGA 2REBA 5LQJA 4NEGA 4OBBA 1ZINA 3HS3A 4ZIRB 2CVFA 1G66A 2TYSB 3KQVA 1DHRA 5JAMA 3GT3A 5LWHA 2ZSBA 3K9GA 3ROEA 1IZ8A 1Q15A 3MS2A 2VFAA 4NCAA 1Y8QA 3N8HA 1SA0B 2QVZX 4URFA 4JQOA 5KBYA 4QU0A 5BSUA 4HFRA 3REGA 1KU0A 4YXFA 1N4AA 2I80A 4QGBA 5HPYB 2C8LA 2ONYA 2ZRAA 1QG6A 4OJKA 4PLHA 4UCXA 2QA5A 1WX1A 3JARB 5KI6A 3P9NA 1NQTA 1U98A 2R65A 4GI2A 5I7AA 2Z04A 1FNDA 4GYYA 2WFZA 1J0XO 3NU1A 3KUCA 4UFNA 2JLRA 1JQBA 3B6IA 3MNFA 2G7ZA 2X7XA 4F1KA 4I5IA 2HXGA 2DFDA 4I3GA 4QTTB 3SYTA 4MW0A 1LC0A 4CG0A 2G6BA 1WL8A 4YMWA 5KYWA 1F51E 1VL1A 2IHKA 3WRYC 4ZOLA 3QKIA 1N2EA 1R9JA 4DSAA 3LUJA 4C21A 3ENNA 4HS9A 4OY3A 2XRFA 4TYYA 3E53A 4N0MA 2ZVQX 4WKNA 4H4DA 3TGPA 1XZNA 2BGGA 4X65B 2FB9A 4ESVA 1G19A 2W6ID 5BSTA 3STVA 3HDQA 3ZWXA 2AXQA 5CEEA 1Z75A 3HA2A 3RSQA 1RCUA 3HP1A 1UP6A 1XXLA 4BVLA 1YHYA 1BDMA 4HJXA 1I4OA 1NN5A 2VI5A 3K4PA 1QLJA 2GVDC 2HWWA 4OB8A 3DM5A 3FAZA 5I6DA 1ZH6A 4OIMA 4S0XA 4GDFA 3RS9A 4H1VA 1J99A 3SKVA 4GI7A 5KHOC 4G1MB 4K28A 1H05A 3F7NA 2CKMA 2VH2A 2XUFA 4KWTA 3AFNA 2FCAA 1WD7A 1VI5A 4O1MA 3HXMA 3GUVA 4PHTA 2QP4A 2IXEA 3KP1A 1QF9A 3EIFA 4GPTA 2WF8A 4AB1A 5L3SA 3IR7A 2XE4A 4RD6A 3QVLA 3WHPA 1ZGJA 3MLBA 3MB8A 4H9GA 4IUYA 2Y1EA 3EVGA 1QFXA 4JI1B 1O03A 3DE4X 3H1BA 2CBZA 5BYKA 3AF1A 2VN8A 3YASA 1U7TA 3CPJB 3JQ9C 4RE5A 4M1YA 4UUAA 2HR1A 3FVWA 3RARA 5L4LA 2PZEA 3GZNB 3OU2A 3AHIA 1GOTA 4R51A 4WJKB 2HLDD 1PKEA 4GSYA 3C3XA 1FNSA 1E69A 1UMDB 1IMJA 1ODSA 3UH1A 4J49A 4ZI5A 2J3KA 3O21A 1A95A 1Z4OA 2XD4A 1KYYA 1G3IA 3FJ1A 3VDXA 1FSFA 1RM0A 4NBWA 5FBVB 3K0FA 2Z4TA 4ZAFA 2PS3A 2REXB 2XOKD 4IH1A 4OFBA 3V8EA 3GT4A 3DF9A 1MPXA 2G1JA 3HL4A 5DTEA 1TEHA 1QIJA 1RI1A 2JJMA 3NCTA 4CHTA 2A9KA 4ZVTA 3R3SA 3SJBA 3D5QA 5AT1A 3DZIA 2UYGA 4W1QA 3RK1A 2C97A 2X58A 4JUBA 4Z7JA 3IQGX 1E2LA 4X1KB 4C20A 3C8HA 3DFFA 4QQNA 1G5TA 4DR3B 3IVCA 1C4OA 2EW2A 2WIDA 5K3OA 1R16A 4E3WA 5AP9A 5EVJA 4HB4A 3KBBA 5E95A 2WOOA 2AMLA 4IGKA 4BVBA 2OCGA 4D82A 3TTWA 1KEEA 1DC4A 4WZAE 4L16A 4TRMA 5AKKA 2W0MA 1RNLA 2ZJZA 1GNPA 1RM4A 1YZUA 2Q7XA 2YRFA 3E81A 2AR0A 4UCWA 4MLDA 3TLBA 1T0JB 1WE2A 2RARA 2C84A 2RG1A 3H2JA 5ICEA 2LWIA 1BXRA 3KOZA 1EM8A 1NMSA 1HDEA 1CXZA 3ANNA 4OQMA 1HSZA 1Y82A 2AG6A 1B8VA 1KEVA 2Z4RA 4FNGA 1WCIA 2QN3A 2JLBA 3Q72A 4MUYA 3RREA 4DUZB 4BNMA 2I99A 5IDYA 2GFIA 4CEIB 3EFHA 2OBXA 1CULC 1E4VA 1ZGCA 3CEHA 3QQPA 4FFVA 1PL6A 1FJGB 4GP7A 4IWYA 5KJEA 1PZXA 1O95A 2FZEA 2WNSA 4AJNA 2VYQA 2O1WA 2PFSA 4XDZA 2JZOA 2PLRA 1YI8A 3IKMB 5K2OA 1QE0A 2JFPA 2FSIA 3VH4A 2ZE7A 3ZGLA 5JRDS 5MDHA 5ILOA 2I4NA 1JILA 2XZPA 4OAPA 3A9SA 3MJ4A 3QKRB 4ND2A 3UUWA 1I2DA 1G21A 3AHDA 3THWA 4PSUA 2AUTA 1E2BA 1NNSA 2IEIA 2V7UA 2WMDA 2RK6A 5F5NA 5TQ2B 1YJ5A 3UMGA 3D8SA 3PE4A 1CZRA 2EL7A 1GUAA 1SVKA 3FGPA 3O7WA 3K6SB 1R1DA 3CONA 2ZSKA 1K5HA 1NVXQ 5IKPA 5J1SB 1XCMA 1WXWA 4AF6A 2CUZA 3D4BA 4U63A 2Y76A 2O0MA 2VA8A 5I4IA 3OURA 4B3CA 2M98A 1NTOA 3GFVA 1GZSA 4XWOA 3MN1A 1Z4IA 2Z08A 1JB9A 2HLDA 4LECA 4UAVA 3V7YA 1I2MA 2G08A 4L22A 1U9ZA 3HZZA 3TDNA 4NFLA 5CW1A 1WXFA 4AK9A 3VDNB 3AVTA 4OHRA 2PZFA 1USWA 2CDCA 1UDCA 2CSXA 1IC6A 3QFFA 3ZFNA 2ZYIA 1NF8A 4G5QA 3GQBA 1DKRA 4EY7A 1WV0A 2O2EA 4Q3DA 1ODFA 4Q34A 1JXOA 5CFLA 1R9MA 4EHLA 3U7EB 1GR0A 4QPNA 3T7RA 4DKJA 3C6ZA 1M1YA 5CITA 2DJ5A 4N1AA 1UC8A 3ND9A 3AJDA 1BVRA 3M1IA 5LU9A 3D5EA 4PGAA 4DB4A 1KQPA 2PM8A 2Y2VA 4JYMA 2RONA 2FP3A 1X7WA 5CVDA 4UEWA 1UBGA 4NBNA 2ZYSA 1ESNA 1Z15A 1HNXB 3NKFA 4LJ6A 1PT7A 1Z9BA 2ESRA 3KUXA 5I5GA 3NHSA 3RIXA 3BSYA 3C8MA 3EGWA 3O9VA 5EJ2A 2O2YA 3AEYA 3SZ3A 5CB4F 4YYZA 1J8MF 1CEEA 1E3WB 1TMYA 1W85A 4YIKA 5J23A 5GV7A 1UWLA 4C2AA 3ZE2B 3Q2OA 3GLQA 2X19A 3IV7A 2BTQA 2VP3A 2WAYA 3WGQA 1JH8A 2ANBA 2F8LA 5DBEX 2PMBA 5CLHA 5H83A 4IG9A 2WG1A 1AURA 1FFBA 1UOEA 3MMSA 2JIZA 4R98A 1GPJA 1M2EA 2F2TA 1EHYA 2C9DA 3D3QA 4I4TB 3UANA 3KSBC 3SEQA 2BZ0A 5HK9A 2YWRA 1YL7A 2AKYA 2QROA 3MMXA 5FPSA 4FFNA 1OWMA 1E2HA 1X94A 3DCJA 2OV1A 3K0AA 3KHUA 4KPUB 4L5BA 4PS1A 3V33A 3EG9A 3VTZA 4H3VA 2IPXA 4NMWA 2NXEA 5K0NA 2VYCA 1XPJA 4GF5A 4D9CA 4HVLA 2CMGA 3EZ2A 1SCIA 2UV8A 1G55A 2HPVA 3A0RB 3JATB 2IKQA 2BT4A 2ZE5A 3DZFA 4H4EA 3FPAA 4Z54A 3S2GA 1WDTA 3VAYA 1FYXA 2QGFA 2O0HA 4K6CA 4QSHA 4R7GA 3SDBA 3T7IA 5KMGB 5L95A 1GG2A 4LDQA 3FPJA 4L3WA 4PRKA 2FGKA 3DUFB 4URUR 4UKDA 1K8QA 1Q1NA 1QGUB 3PJDA 5ITWA 2XB2A 5INTA 4KV7A 2GLUA 4RZIA 1MC8A 4DLAA 4E5NA 1VPEA 5HMMA 1CJCA 1SG9A 4RSMA 1N9GA 2RI1A 3Q6IA 4LQDA 1Q17A 1Q1AA 3KR9A 5E7QA 1LFAA 3L8DA 4RTMA 3SHFA 2BHSA 2IYWA 4OGGA 4Z9XA 2EBWA 6YASA 4JENA 2O2SA 4FFBA 4C4AA 1MEJA 2JRCA 3D2LA 4M83A 5HBRA 3ROPA 3ZHQA 4W6ZA 5KHLB 4ASUA 3D4IA 2WC1A 3KKOA 1W5FA 4M8NE 1YTUA 3ZH2A 3SNHA 3QF7A 2JHFA 4XEHA 2GZDA 2W7TA 3I04A 1LKZA 1N6OA 3H11A 2CNKA 2FNAA 2IUTA 3I72A 5HRUA 1EFTA 1U3CA 3IXQA 4MS4B 1IHYA 4PLTA 3GP8A 1LWNA 1QCDA 3F7TA 2CL6X 2B99A 4MAAA 4P5PA 1BCSA 3EIHA 1EZ4A 1Z56C 2AKAB 3QJ5A 4Q00A 4QDZA 5JVDA 5JCZA 1FS6A 4V0RA 3KM0A 4L73A 3H97A 5ARBA 2OLEA 3HZHA 1YU9A 1Y9JA 2I4IA 4BMYA 5HUHA 1YZHA 4O4HA 1CLEA 1GQ2A 1E0AA 3IJ5A 2ZQYA 4X97A 3TWOA 2YHUA 4GOLD 5F33A 4E5YA 4UULA 3ICQB 2Q49A 2JG3A 4UTZA 4EVRA 1IY9A 2AF4C 3PBKA 4UDYX 3V7NA 4Q15A 4FYWA 2MSDB 4AO6A 1SQSA 2AYZA 2P4HX 4MWOA 3B1XA 2NO0A 1OLSA 2WUGA 4XEUA 4M0MA 5H4GA 1M6EX 3GL9A 3N0VA 4YCAA 3MERA 3SFZA 3KEQA 1IY1A 4MV5A 5TQVA 2ZT7A 2YN2A 1QSGA 4V0NA 4WZ6A 3U19A 2W6OA 3LSTA 4EELA 4BVKA 1QQBA 1XRQA 3PUXA 1ODTC 4QC2A 1NG9A 4DR4B 3SXPA 1C7JA 1ACMA 1BG6A 2VJOA 3W5HA 5FI0B 1FLVA 4R40A 5L4NA 3ZDDA 1IXYA 4YJHB 2EFDB 1J06A 4EHKA 5JYBA 1NONA 4BY9E 1SXHA 3BXFA 3D0RA 2FRVA 4WEQA 3IP9A 1K2WA 3T52A 1I7NA 2P9ZA 4J75A 3HKCB 2C00A 1XRSB 4IYJA 4PLVA 5CXXA 1G17A 4J0CA 4UVHA 1V25A 3K0AB 4I4NA 4AF8A 5BMVB 1ZQ1A 3L1KA 4TTQA 1DJPA 4G84A 1AKMA 4QDTA 4HAOA 4RVNA 1X7HA 5F2EA 4S35A 1QIFA 2E1PA 2BL4A 5KNBA 1VIYA 3FETA 2GFHA 4UMDA 3MJEA 5K8JB 1KK2A 4GMKA 5DTMA 1SAYA 3JATA 4H6WA 5TGTA 2EDCA 1MO3A 3AEXA 3OA2A 1BHJA 3HUNA 1A04A 1GEGA 2P6MA 2WIBA 5E9QA 4AZ0A 4UAUA 2XV1A 1MJFA 1VL8A 1VMIA 3DV0B 3GDOA 5M7EA 1C9EA 3LPLA 3PUKA 5FTJA 5CPFA 3GLFE 1U04A 3UF0A 1L5ZA 4ZT2A 5T67A 4Q4DA 2IHBA 3T1TA 2UZ0A 1YZTA 3EGDB 2NPOA 2V7XA 4K9MA 3ZQ6A 3WISA 3ETEA 4FGKA 3CLHA 3E9MA 4HL6A 1PJRA 3AG5A 3PE3A 4MICA 2QRGA 4G0WA 2IYAA 1BFUA 5JTUA 2PSEA 4EMBA 4BQIA 5JLJA 4MCAA 4YRRA 1VSBA 2I3ZA 4NCIA 4OPMA 3RAEC 5JNVA 1MVOA 4DSZA 3OIUA 4RV4A 4K6OA 1II0A 1DXOA 2I22A 3U0VA 2CDNA 2F1HA 4EGSA 2WHYA 3EIQA 2QQGA 3V8RA 2ZIXB 4RTPA 2FR8A 2Q5LA 4H59A 2OV6A 3HM2A 2QD3A 3FR7A 2YWJA 1JLMA 1T0UA 1QHHB 1J23A 5HFNA 3A04A 3Q3IA 5IAJA 4DA8A 2NZVG 1REQA 3WP1B 1PVVA 3KUUA 3VPSA 3IQDB 3D1JA 1KSJA 4I6EA 1FU8A 4BNWA 1LS1A 3UFBA 3GG9A 3UVEA 3D3JA 3QITA 1H65A 1OVGA 1RR6A 2O05A 4CR7A 4E94A 3TGLA 4EYGA 2DFLA 1SXIA 5FUWA 1FP4B 2GO1A 3VISA 3JQFA 3GMIA 2G83A 3FY4A 4P34A 4E4RA 1XL1A 1Z7YA 5I51A 1BJKA 3AZQA 1QIHA 2CYCA 1RYEA 1N8NA 4Y2SA 2XEXA 2P6NA 2WNHA 1N5LA 1L1QA 2D1QA 3A9CA 5MFPA 1AUOA 1M67A 1VPLA 1V43A 1CYDA 1XQ6A 4YMVA 3ILSA 2H1WA 1QO9A 1N7JA 2J07A 2RHLA 3PL5A 1UT8A 1L4GA 3IO5A 3K30A 4Y67A 3IPRA 3UTCA 3WQQA 4F4DA 4BKOA 1PJAA 1LSOA 3H19A 3S2SA 1TNDA 2P6UA 5CGZA 5EJMA 1PQWA 5D1HA 2C83A 3RYCB 1V9SA 1GA6A 1I5OA 2A1IA 4P92A 3R4VA 3W6NA 4QT0A 1BQ4A 1PYDA 1DLJA 2ZUUA 5LZ8A 5KS2A 5G0TA 3EDYA 2HF8A 3WX0A 1XXHB 3JQFC 4BV2A 4DC9A 1N2BA 4G24A 4GLFA 4RV9A 4UTXA 1DTEA 1QFZA 4TMZA 1T0IA 2NUTA 4NCBA 3M89A 1VA4A 4KFUA 4RZHA 3D9QX 3S3TA 4W5OA 2VF2A 1DJLA 1RADA 1FNCA 1J07A 3MG9A 5B6PA 5C46F 3GCXA 4R1UA 4RPGA 3VR5D 1VYHA 3WYBA 1R66A 1Z2PX 2BFBA 2V9ZA 3OZFA 3ROFA 3RT9A 2UAGA 3AQIA 3D7NA 2IQIA 3QFTA 3ASUA 5L9AA 2FX5A 3ENKA 4PGHA 4IG4A 3GWGA 4YQFA 5A5GA 4Z49A 4XB1A 3IYLW 4P84A 4B82A 2WICA 3DHNA 4Q4AB 5DHPA 2A0UA 2F3RA 4B6SA 4EPXA 4J43A 1YBMA 2GSWA 3OJWA 4PZZA 4XFDA 4E11A 4IY1A 1M73E 4BRZA 3T94A 2ZUDA 1KP2A 3RU9A 5IASA 3GJ8A 3WGIA 2Q27A 2VWQA 2PX2A 1Q7GA 5JO9A 5IU6A 2UUBB 4TM8A 1R7RA 2PX0A 1GDTA 3IDZA 2QMQA 2X6TA 1RW4A 1PV2A 4NOLA 4PC7A 4YPFA 3TLZA 4IZIA 2C57A 1XX6A 3E4DA 3EMBA 1ORIA 4C1NA 1C80A 4LHYA 1JQ3A 1OXSC 2JAHA 3PNMA 4AMGA 2C4KA 5AM3A 5HZKA 1MDBA 2YCLA 3RTGA 5GVRA 2TMDA 4WKPA 3C16C 2YNMC 3UAWA 1VMDA 4RDCA 1ZJZA 5DEIA 2QSYA 3WLKX 3OZRA 5BUSA 2JHAA 2NN3C 2WMNB 2XB4A 3TFQA 3GUZA 4F3KA 1Z29A 1N3BA 4R9NA 3SX2A 1L5NA 5HQTA 1UKCA 1ODJA 4LWOA 1GPUA 1OTXA 4ZEOA 2XKKA 3W78A 3F2VA 1JQEA 4QHTA 5CXQA 2Y0CA 1KTVA 1FXSA 5A02A 2UVPB 3CEAA 1CDOA 3B6ZA 4I1VA 5EJGA 5B58C 4XPZA 3NVAA 3ZCTA 1GFWA 4ENWA 1V3VA 3IC5A 4BYMA 3RAPR 3R3UA 1JMYA 1U7OA 5DT9A 4RUKA 3F3SA 4IDOA 1PJZA 3NUQA 4DPLA 3KJHA 1OZ0A 4AUNA 4D8XA 1GTVA 3GQVA 1CUAA 3W5SA 1J8YF 1G0NA 3GH1A 1IEWA 2ZAOA 4DMHA 1TTTA 4DYHA 3R9XB 1CHNA 2WLTA 1E2DA 4OU4A 2OWEA 4MW7A 4WAUA 3VDMA 3BGOS 4YK7A 1BMFD 1I4EB 2FRDA 5F78A 4YRTA 5IF9A 3QBEA 4JOCA 4EW1A 4UU8A 2MR5A 1ORTA 1XAJA 3U3MA 1TJYA 4B4UA 3WNBA 2RMKA 4NBSA 5K51A 2I78A 2ON6A 4BLWA 4MIYA 3T7AA 4F85A 4RF5A 2V59A 3SF8A 2VSQA 3CRQA 4UUNA 1VSTA 1A7JA 3EUWA 4FHGA 4NU6A 1TDJA 4ARZB 1W94A 4F8EA 3GEGA 2GTIA 4TTVA 2XYPA 3D31A 3HR4A 1NBME 2AFHA 1FFXA 1U2GC 4QOIA 4CLEA 4QBFA 2R85A 3JQQA 5ESRA 5FUBA 1DVRA 2C2XA 3A14A 1UPCA 2CKDA 1AGXA 3R5FA 4PZDA 1E3MA 4HVCA 5A04A 2JATA 3LPCA 1ZN7A 2FN4A 2QZ9A 1HFKA 2IXGA 1G3RA 3GFRA 2ROQA 1EDEA 4NAHA 5J43A 4JNCA 1HXHA 1KYTA 2AJDA 3ZVRA 4F5ZA 4EHDA 3MMZA 1DADA 2OD7A 3QM1A 4IM7A 4MK4A 4A6EA 4MRSA 3IL2A 1EEHA 1UFVA 2FN8A 4YJGB 1ZSYA 5JS1A 2OYCA 4TL6A 4P0PB 3K35A 5K0CA 4CMIB 1V8BA 1IQRA 2VQ6A 4IDNA 3OF5A 1KBZA 3VUEA 3MMPA 1OGIA 3D0KA 5BYBA 4LDPA 5K6AA 1N1GA 4P33A 3GNTA 4RTQA 4LJ5A 2CJWB 5EERA 1NMYA 5DTQA 2R7LA 1BCRB 5D87A 1MC4A 3GVCA 4H0NA 4MUAA 4TRNA 4RCYA 1PW7A 4B7ZA 1KH2A 3DAFA 5IT4A 5F23A 1YS6A 3R1IA 2ZSDA 2PGOA 3IT1A 3SBDA 5H4HA 1HZZC 1WF3A 3FGNA 5K45A 3DXYA 2HCFA 2XSZA 4M54A 4HEA6 1BC5A 4B2YA 4LJKA 2XJ9A 4GRAA 5G1OA 3GEPA 3BD7A 3ADKA 1HY3A 3VYWA 3UGQA 2P4QA 3CZ4A 2C2ZA 3HJCA 3RFUA 3EPHA 1Q1BA 4EG8A 4JB2A 3LP5A 1LW7A 4YRDA 1UJNA 1SVOA 2R7NA 1G8FA 2WFAA 3FCCA 4IIDA 1XTTA 4BEWA 5JW6A 1TQHA 4OHOA 4LSWA 1CUYA 1M0SA 1YO6A 4R2WA 4G5SA 4QXMA 2HC9A 3R3ZA 4KW7A 1AH2A 1SBIA 3ICCA 2GK7A 4N8EA 5BNWA 4J0GA 3ZHBA 1KEUA 2PGIA 2EJBA 2VAMA 2WBLC 1RQGA 1ZQ9A 2R4TA 3KZNA 4OP3A 3KQNA 1RRMA 3SF0A 1B8OA 1I1QB 1UMKA 1XZ8A 1X92A 3Q40A 3T0GA 4YR7A 2UYOA 2REOA 1FFHA 1NN3A 2VJBA 1OY1A 4NZYA 3TQOA 2Q4TA 1DDGA 2GXUA 1QBGA 3A3PA 4PSKA 5DDIP 5G0UA 5T4BA 2F9FA 4CLRA 4R6XA 9ATCA 1I94B 1STOA 3F6YA 1ZLXA 4D79A 3QQ5A 2NYAA 1MD9A 2V0NA 2CB0A 2FP4A 2OHGA 1TKAA 5C34B 4J0IA 3Q7QA 3SYRA 5LQCA 4PONA 3T0FA 1NM5A 2XDQA 1JALA 3U31A 1IZZA 4G26A 3HN6A 3GCGA 4LOKA 1IM2A 1NT4A 1F60A 5E6UA 3ZGXA 3DDZX 4B7XA 1WHSA 4HYQA 3R3VA 4HDNA 3GLTA 3D6UA 1YZGA 3H5AA 5CT4A 4DXAA 2H2IA 4M22A 5HBGA 4JYCA 4N3NA 3HA3A 3QGMA 2BGIA 4IXDA 1WXHA 4JEUA 4P08A 3TXXA 5L3ZA 4B79A 4CM8B 1DQNA 3GQBB 5BSHA 5KIAA 1NJ6A 5JD3A 4LFBB 2RBEA 1CY2A 2A57A 1K7XB 2PZ8A 3DB2A 1A9RA 3CBGA 5IN4A 5KTOA 1KAEA 1V4BA 5DHUA 1A69A 5A03A 5KOYA 3E8MA 2ZBQA 1MH9A 2FMKA 3DO5A 3QU5A 4UJ3A 3ABZA 2IXBA 3SC6A 1SR8A 3K6JA 1O08A 1EFDN 3REFA 5BMVA 4TSFA 4ENTA 5C2JB 1JG7A 1QKIA 1SVIA 3DFMA 4KR0A 1RP1A 3GNQA 3TI7A 2OHVA 1Y6JA 2OEPA 2O8BB 1ZNQO 3VV2A 3IIEA 2X1HA 4BNUA 3LBNA 2CNLA 3BEDA 3NRCA 4L4ZA 3PQFA 2JI9A 1G5IA 5GGXA 3H13A 4JP1A 3CRRA 4NCJA 3TECE 3CGGA 3D7RA 4P3NA 4QOJA 1A8QA 4TQAA 3SZLA 5D01A 1BH6A 4NYJQ 3KKLA 3F49S 1F06A 1GG9A 3E7XA 4L8VA 3RSGA 4GI5A 4YHBA 4IPTA 5A3JA 4LMBA 5JCJD 4DJDC 1B2LA 1GG8A 1OX4B 2OO5C 2CV0A 2V6BA 3TMAA 4TS4A 4JLJA 1V4NA 4A0GA 1V41E 2ETXA 4EUFA 5JFOA 3T5AA 1KEZA 3FGOA 2QLNA 1TAUA 4W63A 3C8UA 3O4VA 4PFSA 4Q9AA 5EG5A 4DLBA 1T9CA 3DFUA 2SHKA 3EG9B 2CFCA 3G88A 1KO5A 3GEDA 4I4LA 1EXDA 1PYOA 1WXDA 2ZI4A 2OB2A 3HBFA 3PUVA 2PFKA 4KPGA 2P65A 4YJFB 5AKEA 3MJDA 3FHTA 2B5VA 4S2UA 1TF2A 2AOVA 3VDRA 4WVLA 3HXPA 2XXAA 5JMPA 3SC2B 2G4LA 4V1CA 1ZMRA 1XQ1A 2GPJA 1PNOA 1PJTA 3FNRA 3PR2B 3QEMA 4TV9F 4ZU1X 2JLWA 4XYLA 2VCHA 1R0CA 5M29A 2QE7A 1T2NA 3O2SB 3N6RA 1GGMA 2PL9A 3NHRA 3BG5A 5JNUA 1HDXA 2YDXA 3G13A 1PJSA 2YS6A 3QPUA 1XP5A 3FWKA 3P9CA 3UATA 4PZCA 2P4SA 3A2LA 3DPSA 2H3EA 3H16A 4DKXA 1SCNE 1JAYA 2V4MA 4H6XA 1OLUA 1YCDA 4KMMA 4RGYA 4WRRA 5F7ZA 5K8LA 1T4CB 3EQ2A 3AM4A 2NV6A 1IUPA 1C9DB 3KOMA 1RTKA 5IAEA 4DVGA 4MEBA 1SVLA 5BV1A 5BYAA 3WS7A 2HF9A 1PV4A 2ZB2A 2GPBA 1FEZA 1PF7E 4KCGA 1RCFA 4ZOAA