2FP3A

Crystal structure of the drosophila initiator caspase dronc
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
293
structure length
254
Chain Sequence
ALTPYVGVVDGPEVKKSKKIHGGDSAILGTYKMQSRFNRGVLLMVNIMDYPDQNRRRIGAEKDSKSLIHLFQELNFTIFPYGNVNQDQFFKLLTMVTSSSYVQNTECFVMVLMTHGNSVEGKEKVEFRDGSVVDMQKIKDHFQTAKCPYLVNKPKVLMFPFASTNVPSLADTLVCYANTPGYVTHRDLDTGSWYIQKFCQVMADHAHDTDLEDILKKTSEAVGNKRTKKGSMQTGAYDNLGFNKKLYFNPGFFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase Nc
publication title Structure and activation mechanism of the Drosophila initiator caspase dronc
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolysis/apoptosis
total genus 76
structure length 254
sequence length 293
ec nomenclature ec 3.4.22.-:
pdb deposition date 2006-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fp3A01
3QNWA 5IC4A 3EDRA 4QUDA 2H54A 5LU8A 2QL5A 5IBCA 2CDRA 2H5IA 2XZDA 1PAUA 4PRYA 2XYPA 4D3XA 2QLBA 4JR0A 3SIPA 3IBCA 2H48A 5JFTA 5IABA 5K20A 4PRZA 4PS1A 3GJRA 4NOLA 1QX3A 4NBKA 1F9EA 3DEJA 4FGUA 1GQFA 3SIRA 2P2CA 5IBPA 1RHMA 4JQYA 1I4OA 3IBFA 4FEAA 2WDPA 4QU8A 1I51A 1JXQA 4ZVPA 3EDQA 2CNKA 4NOJA 3DEIA 4ZVTA 3RJMA 4EHAA 1RWXA 1RWOA 4N7MA 2C1EA 1I3OA 4DCPA 4N6GA 3R7SA 3GJTA 1CVRA 3H13A 1PYOA 5LUAA 3D6HA 4QU0A 1RE1A 1SHLA 3KJNA 1NMEA 4PS0A 4HQRA 2CNOA 3P4UA 3GJSA 1QDUA 4N6NA 5IAGA 4EHLA 3V4LA 4EHKA 4JB8A 2XYGA 5IAKA 2HBQA 5IC6A 2J30A 2XYHA 4QTYA 4EHDA 3R6LA 2J32A 4JR2A 4NOMA 3D6FA 1SHJA 2Y0BA 5IAJA 1RHQA 2CJYA 3OD5A 5I9TA 1RHJA 1F1JA 4QUAA 4ZVQA 1QTNA 4EHFA 2HBYA 1NMQA 4JJ7A 3KJQA 3R6GA 2QL9A 1K88A 1K86A 3D6MA 3UOAB 2QL7A 3K7EA 4ZVOA 4HQ0A 2DKOA 2HBRA 2C2OA 4HVAA 1RHKA 3V6MA 2AR9A 3BIJA 5IANA 3R5JA 1SC3A 4QUIA 5IARA 3H11A 3NS7A 4NBNA 2H5JA 1RHRA 4QUGA 4ZVSA 3R5KA 1RWWA 2FQQA 5H0IA 1RWVA 1M72A 4FDLA 1BMQA 1CP3A 1NMSA 4IEFB 4QU5A 3S70A 3PD0A 2H4WA 3PCXA 4JQZA 4N6OA 3R7NA 4IYRA 1KMCA 2NN3C 4I1PA 4D3YA 4AWAA 4QUEA 1IBCA 2C2MA 4AWBA 2FUNB 4QTXA 3KJFA 4JJ8A 3UO8B 3NR2A 2Y1LA 4NBLA 5IBRA 4EHNA 1RWMA 4ZVRA 1SC1A 2HBZA 4QUJA 4DCOA 1GFWA 1SC4A 4DCJA 4M9RA 4FXOA 3PD1A 2C2ZA 2CNLA 1RWKA 4LSZA 5IASA 4ZVUA 1RHUA 3V6LA 3DEKA 2XZTA 3ITNA 4JJEA 2FP3A 2QLFA 5LUBA 4I1RA 5IAEA 3V55A 3V4OA 4N7JA 4QU9A 5LU9A 3S8EA 3NKFA 4NOKA 1RWNA 2C2KA 4QULA 4AW9A 4N5DA 2QLJA 4JR1A 3H1PA 4EHHA 2CNNA 1I4EB 2CJXA 2H4YA 1RWPA 3R7BA 3H0EA 4QUHA 3H11B 4EJFA 1ICEA 2H51A 2K7ZA 3GJQA 2J33A 3V3KA 3E4CA 3P45A 4D3ZA 5I9BA 3DEHA 1NW9B 2H65A 4QUBA 2J31A
chains in the Genus database with same CATH superfamily
1T3TA 3AY6A 4MUAA 2FSGA 5KQLA 3DUFA 1SUBA 2QOEA 2FMKA 1FFGA 2H4FA 2L69A 2ZWMA 1V1RA 3HYNA 4L5BA 4L8LA 5BRNA 4JASB 2WICA 4Q02A 3DMRA 4PX5A 7REQA 3I5XA 3T35A 4BAGA 2UYYA 1GY8A 3AHJA 1XTUA 2VOEA 1R4AA 1FSFA 1V8PA 2PAFA 3KM0A 1KBQA 4XZ3A 2HSZA 4ALJA 1COWD 1EQUA 4IHAA 4B40A 5AW1A 3W05A 2XMSA 1H6BA 1NX6A 3AY0A 1YQ9A 4UHKA 5ED0A 3JVEA 4RCZA 1S1CA 4GZ5A 1PFUA 2OBBA 4EG3A 1QG2A 2QXTA 4OP3A 5E8RA 4TGLA 3AF2A 1JFSA 1YKFA 4YAOA 3UMGA 5AKYA 1R6XA 4HUQA 3PNPA 3ZD9A 2O0HA 1SU7A 1XZLA 2ZBFA 3URMA 3I5AA 3MF4A 4E5KA 4AO8A 3KTDA 3THSA 3GXBA 1WULS 4RVNA 3GJSA 4TQAA 3W7AA 4B8ZA 1WABA 2XJ9A 3EWNA 1U8YA 3V4FA 4BMOB 1YE8A 4QELA 1YZLA 5BR7A 3M34A 4WMLA 1VECA 1Z88A 1DXOA 3RSLA 1P7VA 4AUMA 4R6XA 2AOUB 3ER6A 3K0FB 4UBOA 5FI0B 1T2EA 1VL8A 1PR0A 3HADA 3OOYA 3AHDA 2PXCA 4EHFA 2ZAYA 1TQ6A 5GVRA 2RH8A 2GCPA 3EC1A 3GHYA 4ZV9A 2D2IA 3DDNA 1IK6A 2F1HA 2QD3A 2RJOA 1CY0A 2WFAA 3QNMA 3I6QA 4H0CA 4LK2A 2GPWA 4M0CA 1JEOA 3M1YA 3DZ8A 2RSLA 5JD5A 3Q3IA 4LNUA 3LUBA 1FJGB 4LRUA 3NDIA 1GTVA 1GQRA 3KPWA 4XSHA 4I1OA 2BM9A 5F51A 2EVWX 1B4DA 4HLQB 4Q7EA 4RVOA 1VGRA 1Y7PA 2BKUA 4FR0A 3E8SA 2I3BA 3UMCA 4GGPA 5DLQC 3ACCA 2VS1A 4M53A 3UPUA 1QWOA 1FY2A 1E5DA 2C9OA 4H7DA 4JP8A 1Z73A 4QXRA 5IN4A 4J1TA 3ESZA 4ZGBA 1C1XB 4XR4A 2X0EA 3ZZMA 3TUJC 3NPAA 4F1JA 5LZ9A 1KORA 4N8DA 1BDHA 2DFNA 3TO5A 4PC7A 1AB5A 3WWEA 1NW8A 1CETA 2I4OA 3HPQA 1SG0A 3C97A 4WESA 4E1BA 1EXNA 1L7EA 2WJYA 1FDWA 2YFKA 5ALEA 2OZVA 3OU6A 4Q7QA 1Z34A 3L6UA 4B80A 4DCOA 4KK4A 5IKPA 2DZDA 1ZGBA 1N9KA 3SEAA 2PTGA 2WSIA 4EPVA 5BN1A 1N0VC 2L0XA 2ZJ0A 3PQDA 2RGCA 5E6SB 3B5JA 1BCSB 5ER9A 5JSQA 2G07A 5K0JA 4KTVE 4EECA 2FEWB 5I4IA 2QPTA 1VSBA 1N33B 2HB6A 2Q1YA 3G0GA 3TTYA 2Q4BA 1JIKA 3LW8A 4LI3X 1FU8A 2CLOB 4HTFA 4DMKA 1ULAA 2HRCA 3DOUA 3AEUA 3JZMA 1APBA 3NKFA 3UCEA 2XUFA 3H19A 2E18A 3VOBA 2YXDA 1DB3A 1N2CE 1I4EB 4Q3LA 2O8CA 1TQ4A 1E0SA 4TXLA 2HPAA 1QYXA 4BEVA 1R8XA 3TTSA 2V3WA 4PIVA 3ESQA 1M2HA 5ICCA 2B99A 3EGWA 5H59A 2GZ1A 4QUBA 3IP7A 4COKA 1PL8A 1M8FA 2O8VA 1NIPA 5L3QB 1H9CA 2Q5CA 3L0BA 2H54A 2JA1A 4CM8B 2QF7A 4DQVA 5H83A 5K8UA 1F3LA 4U4AA 4XWYA 2PKQO 1Z06A 3N59A 3NHWA 4E5SA 3CUUA 1N5IA 2Z4SA 3OEHD 3K0CA 3M1AA 1H0HA 2D1YA 2HGSA 2V7WA 3VPAA 3PIDA 2BL4A 4UJ3A 2IV3A 4B79A 1C7QA 4Z4CA 4CKWA 4CMJA 4QBGB 1H1DA 3G1TA 5EERA 1OGYA 1IH8A 1W0JA 1WW8A 3MEQA 5AYVA 3VV3A 4Q39A 3DMGA 3V4PB 3ZY4A 1OSNA 4OQYA 5BW6B 1RU3A 4NFSA 3LYHA 2Z8XA 4MUKA 5CA1F 5CHYA 1ISSA 2ZSDA 2HYIC 4AN0A 3FYHA 2XD4A 4N6GA 1OPRA 3F3YA 3HZHA 1UWLA 1EWVA 2PL3A 3OVMA 1I33A 5AM1A 5ITSA 2BY4A 5F7OA 4YT5A 1C0IA 1KIMA 2XMRA 1JVSA 1OE0A 1XCOA 2RJ3A 4WRRA 3MTGA 1EU1A 5I3CA 1LBEA 1U2PA 2YMPA 2CNOA 5I4KA 1P0FA 4TYYA 1QG0A 4PONA 4R1NA 2J7PD 3CRNA 3PXEA 2X0DA 4NU0A 4BMNA 3QRWA 5AUNB 3NTXA 2FLVA 3OZAA 1G6Q1 3SYNA 3AMVA 1OIXA 2HCTA 4MS1B 1KZ1A 2Z9DA 1JR3E 3EPRA 3DCIA 1Q0QA 1DJPA 2YXPX 1K3FA 2J5KA 3E2PA 2BUBA 1JS1X 4FE4A 1JKIA 4H1VA 1TQHA 3O4FA 3S7TA 4BNJA 3SVLA 4LRWA 4TTTS 2QL7A 3FLAA 4KQWA 2B7CA 3P71T 4MTLA 1Z08A 5E9QA 1JDTA 2A92A 2VQ3A 4KW7A 1SCQA 4V0OA 4RY0A 4QUIA 1FB5A 1O3YA 4DTIA 2QT1A 3GVCA 1GFSA 1KI8A 2WKSA 1DU4A 2FZEA 3WJAA 4OJKA 1S6YA 3U4MA 1L8LA 4MWZA 4M7RA 3X0DA 3MLEA 1EX1A 4HNHA 3HKDA 1G64A 5CNKA 3TINA 2IF0A 1T2FA 4KQKA 5EXEA 1IPEA 2PXHA 3VNAA 3E5RA 4NNPA 4QJBA 5F35A 2ZXUA 3GLGE 2XXAB 4RHTA 1MQSA 4Y2HA 2BAGA 2F9LA 2M32A 1OXBB 1PFVA 1ZAKA 1T10A 3CZPA 3VSDA 5KNCH 2XDQB 3HKEA 2QGZA 3NGMA 4KR2A 5SY9A 2WF5A 4KV7A 4DEXA 2WSSD 3HYCA 5D2CA 1RQGA 1W1IA 3JQ9C 4ZANA 2A8YA 3O47A 4HDRA 2AJLI 2O0KA 3EIHA 4DABA 1BW9A 4QWWA 5TR9A 1X1EA 3EQ8A 3BMCA 3W5BA 4FI3F 1KYXA 1F17A 4BWFB 1FUEA 1UDWA 5FD8A 3CLSD 2PLNA 2NXNA 4OK6A 4GUAA 3KJEA 1ZUD1 3FFAA 3OUUA 3E7XA 2G71A 2D06A 4BU1A 3NCHA 1YVPA 9GPBA 2GCOB 1W52X 4QU9A 5LU9A 2XUKA 5AVOA 2QTWB 2ZRFA 2I4NA 4F3CA 1DUIA 1WTCA 1YRAA 2E5WA 2JANA 3BQ9A 3HDQA 4MCJA 2DT8A 4ZP1A 5IRCD 3R7BA 3AL3A 1BHO1 3CPJB 2A4MA 5CIWA 4QL3A 4F6RB 4G1CA 1SQGA 2F43B 2IFTA 3T3NA 2I03A 4HDKA 4MICA 4QDTA 1QQTA 3AR9A 1K6MA 4K3UA 3SNKA 4PYMA 5CAEB 4ADSG 1QJCA 2QPAA 2D1TA 3OM9A 4CDRA 2IOFK 3QE3A 4AT1A 3HXQA 1IAQA 1TKCA 2H5IA 4IIDA 3ZQ6A 4QOSA 1MVLA 1AS2A 5LZ5A 3SJUA 4RL6A 3TVDA 3V7NA 1UOPA 3DAFA 1ABFA 2NUBA 3SG0A 4F4UA 1EK0A 3E22B 4ZJYA 2PVCA 4IXWA 3H3FA 3KKEA 5DHPA 3MUFA 1KO4A 2ADOA 3HYTA 3NHBA 2DPLA 1WZ2A 3M4XA 4F3YA 4MQ6A 4J0EA 1CR6A 5LQJA 4OYHA 4M88A 4Q9JA 4D8UA 5GZ6A 2VAMA 3ZOZA 4ERXA 1M75A 3EJWA 2AMFA 4ND4A 3GI1A 1DAMA 1YSCA 2PX5A 2E82A 3NUQA 4CTMA 1WQ1R 2BCEA 1NBMD 2O2SA 3QMVA 3TQTA 5EIXA 2ZUBA 2PVSA 3N05A 4NE9A 3TOVA 1LSJA 2RH9B 3OE1A 3DS8A 4J3JA 1P5RA 4RFVA 1E4EB 2G04A 1MAHA 3LUGA 4JYPA 4WDQA 1I3NA 3AR2A 2DPGA 3IEMA 2V3VA 4ZRDA 3ETLA 2I1VB 3VPGA 3BD9A 4GO1A 4KODA 2GYYA 2I0FA 1KSGA 3P97A 4YI3A 1HEUA 4ER7A 2OBYA 1LDMA 4YCCA 3Q3CA 4R5MA 1OOEA 3TF5A 5EWJA 3VR4A 2DHQA 3DMNA 3WRXA 4QEKA 3LYAA 3ZYZA 5B12A 4C9BA 1V11B 2QVGA 1GQOA 2QX6A 1M8PA 4IDNA 3ZCRA 1LC0A 4FFWA 3CTMA 5KOHB 1ZCJA 2QU7A 4U7TB 5FA5A 1G17A 1QS0A 2X14A 1RWVA 2AN5A 3CJTA 3MINA 3P52A 4I66A 1RVV1 1FBNA 1ZL2A 3HG7A 2I33A 2BHNA 3G2IA 4RULA 1DQZA 3TSYA 3PUYA 2NSLA 3BMNA 1TMOA 3MJSA 4XGQA 4ZU6X 1AHPA 3LY9A 1BZYA 4LTNA 3NORA 4U8GA 5A03A 2XB6A 2LP4Y 3QMMA 4NQZA 2A30A 2ZROA 1C7EA 2YUIA 5HILA 1SQ0A 2POQX 4GHWA 1A76A 4LISA 4PC3A 1D2CA 3AV3A 4KXNA 3X1YA 2Q8QA 4RH3A 4MIKA 1FQOA 4ONEA 1F9AA 4F56A 4AKGA 1SCAA 1WF3A 3U4AA 2QVCA 4PN7A 1SUAA 1X42A 4HFRA 2RGYA 3EARA 4XUCA 1H4TA 1XLTA 2BEJA 1QGZA 3CH5A 5DX0A 5BN5B 4LFAB 5IASA 3R5TA 4FILA 5K0FA 1G98A 4B9EA 4L78A 3D2BA 5EINA 4LQDA 4IOLA 1VL6A 1P1KA 2VUSA 4KWTA 1BD4A 3BRWA 1IDN1 3LTEA 1IXRC 1EA7A 4GYYA 1YHZA 1GAEO 2GMWA 1F7VA 2V03A 1LPPA 2G76A 3FOZA 1ML3A 1ZN8A 2ATVA 5DNYB 3DMFA 4P3KA 3RJ9A 4MUHA 5EP1A 4UNQA 1HLPA 4MKXA 4U0JA 5AJTA 4CUJA 3L6BA 4BV9A 1SCJA 1V4NA 4WPGA 1JZTA 3ZDCA 4L08A 3RVQA 4BP1A 4BX2A 1O89A 3INTA 4FSXA 2GSDA 4GU5A 2XY4A 4PR3A 1H69A 1PU2A 1IZ8A 2X9GA 4M1QA 4UFOA 4TOIA 3TLYA 1YZNA 1PNRA 1GLGA 2IYTA 1YA6A 4P3NA 4D42A 2EOAA 4RPHA 3ZDFA 1VL0A 1ADCA 1A7AA 3OT1A 1TK9A 3R7DA 1SHUX 1YASA 1U2ZA 1A04A 3VZSA 3NIGB 1HK7A 1C4WA 3QVXA 1IQUA 1XNHA 2EBFX 4ZEMA 3I1JA 2C2XA 1QB8A 4JXXA 4FMBB 2GI4A 1JLLB 1R18A 4QD3A 4ALLA 4DCPA 1GDTA 1AKUA 2C7VA 4E2FA 4Q1BA 2B4KA 1WE2A 2JFXA 5F52A 5I7RA 5BYJA 4ND8B 4PNZA 3M82A 2YIDA 3O4GA 2HWUA 4E31A 4DBLE 4GZ6A 1RLUA 2J7KA 1OF1A 1XZAA 1XYVA 2V55B 3MTIA 5F33A 4D4IA 1JKJA 1Y8RA 2CHFA 2CFIA 4UFNA 3KKQA 3M6XA 1QF9A 3LXRA 4JI4B 2CSXA 2D5BA 4BWGA 3CEMA 3GEPA 4NDAA 3RF6A 2JD1A 4TS9A 3T54A 1W93A 2JW5A 4W5JA 2JFVA 2RC5A 5CEJA 1YDHA 2QQGA 2C7RA 1Q84A 1Z4JA 3TL6A 2O2XA 1KEVA 2C59A 1DCFA 3GFTA 3KZNA 4BYGA 5CEFA 1W2WB 2YV4A 2TSYB 4RJ2A 2NUPB 4Q9DA 5JW6A 1DKQA 4DV3B 4I3FA 2Z2JA 4RMJA 2J9YB 3OG9A 4YAWA 4ZHQF 3NHPA 1YFJA 1O0CA 1Y3HA 4JFRA 2CHUA 2JBWA 4GAEA 4YQEA 4F06A 2F8LA 5JH7B 2ERCA 5DOVA 4ZVKA 4P4UA 1XAGA 3RK0A 5DIZA 4QT0A 4PPFA 4DQLA 3BMQB 1VFNA 4N8SA 4O8ZA 5C51B 2VATA 2N3ZA 3DDOA 2V98A 2CLDX 1QHIA 3H9GA 5CG2A 1UINA 1R12A 3RGGA 2B2NA 3FYUB 3E8XA 1FDRA 3LPMA 4LMPA 4DM3A 1HQDA 4BJHB 2K5UA 1JDBB 3EMKA 3GLIA 1HDEA 4PYNA 2V7GA 2G80A 1MQ8B 1Q3KA 1YBMA 4L57A 3L8YA 1BQ3A 3T4EA 1VI2A 4EJSA 1KOGA 2EX0A 3RYIA 3RTCA 4JI0B 3QG5A 1EJ2A 5KYGA 1HY3A 1BWRA 1P9WA 1U0RA 4IINA 2VUUA 1H65A 1YR6A 3G7NA 4AZTA 2O6HA 3OP4A 4LRQA 5JZ9A 1QYWA 1TK2A 3JD2A 3MQ4A 2EZ4A 3A58B 3BREA 5ALWA 2DLCX 4E32A 4C78A 1RS0A 3B9RA 3QELB 1Z6PA 4Q4JA 5TGDA 3D1LA 1VBKA 1CF4A 4FZ5A 1F0NA 1LTHR 4INAA 2I54A 1GRRA 1H2FA 2ZIGA 3DBLB 2Y0CA 2Z1NA 3H4TA 3QFTA 4PQRA 2W6PA 4CLRB 4LVCA 2PX8A 5CFMA 1MIOA 1H1TA 2Q0HA 2C2KA 3P9XA 4A1OA 3OIDA 2QG6A 3AWDA 4QJ3A 3PWSA 4IMJB 4LYDA 1G8MA 1GITA 1V5GA 3DV0B 2QM8A 1DQYA 2FSSA 3JAWA 2DBVO 1OU0A 3LHIA 4FN4A 3RYHB 4H1WA 4ZMRA 3KAJA 1Y9AA 2B69A 2H51A 2ZJ1A 5DRYA 3PR3A 3TR6A 5BSKA 5JH7F 1K3TA 2XD9A 2PGOA 2GK3A 4MRMA 1XMSA 1CEEA 5B58C 4WBXC 1UKBA 5EIEA 1AKRA 3FRIA 1U11A 2DHRA 1M34E 2BSAA 3F2VA 1NR7A 1WDKA 4G01B 4D3XA 3GDGA 2D2VA 5AM0A 5F1KA 3I01A 3RWOA 4GXQA 1G9SA 4ZYYA 1HLFA 2ZT8A 5DGHA 2RK6A 5JYCA 4DSNA 1H2AS 1L5MA 2JHPA 4K5QA 3KB8A 4EJ6A 4NYIQ 3OE4A 1FFAA 1N1EA 1ZICA 3RSZA 3ZQ4A 4R3UC 2R96A 2VSFA 2GNAA 3NBKA 4NOJA 2YOGA 5EUBA 1Q91A 4N7MA 3TR0A 3NO4A 1A98A 3PR2B 3PNSA 4YRFA 1P3JA 1Y7LA 3GARA 3IUNA 4U7HA 1MZVA 2PQ6A 4UPDA 4BMYA 4CKCA 3K31A 4CCYB 5FI3A 1D5WA 1P2SA 1UK9A 1NWCA 3LL7A 1XZGA 2C96A 4YUWA 1DJQA 5LQMA 4LF5B 3D4OA 4HGZA 5JC8A 4CM4A 1KBZA 2IPMA 1FDSA 2HXGA 1D8AA 3GD7A 4JQOA 1ZH2A 2Q9AA 4TV8A 4B2PA 3FCAA 2FEOA 4HBZA 4JIMA 5K7SA 1JFVA 3LNCA 1QIIA 3P0HA 4YGYA 1J90A 5THQA 3QYAA 5JYDA 2FFHA 4EQZA 3O9ZA 1A8HA 1NUAA 3AM5A 4OYLA 4RMGA 2X9NA 1KNXA 2N0SA 3HKBB 1NVXQ 2W90A 1CR4A 3EGDA 1HNNA 4A10A 2J48A 3ZEAA 1PCXA 3PHHA 4MVXA 3AERA 3IIKA 1RQLA 2CBXA 3KZKA 2DWOA 2HDOA 4QVKA 3M7IA 2R65A 3LO8A 2W93A 1IMJA 4NBTA 4HX5A 3MRTA 4IDEA 3AR3A 2CVQA 1KH1A 8ADHA 3DH0A 5EP4A 4K8OA 4RY2A 4ZQFA 3SMQA 3K5HA 4MR9A 4K6FA 1E9BA 4JCCA 2XWJI 2X2OA 1ZINA 1QQ7A 3KQKA 3G5TA 1VYTA 4K1LA 2CNDA 4M38A 1SWWA 4DT1A 3ZIDA 3CZRA 4WFKA 1NVGA 1L7PA 2QS9A 3V4VB 3R7AA 1QGAA 5HQTA 5D3MA 1M76A 1LBQA 3KWJA 4RADA 5KNCD 3RRZA 3P2MA 2YZNA 3QNUA 2OECA 2ET6A 3Q10A 1PEYA 1EUQA 1I5RA 3OP1A 5SICE 4JK3A 4EKYA 4KSBA 4NYMR 3K1ZA 1WZIA 1KFEB 2ZYRA 4D4MA 3KUKA 3AEZA 2Y1XA 3UA4A 3OJEA 3GRRA 1T1JA 1SU8A 1G9TA 1Z5VA 1AXGA 1KR5A 1R0YA 1SQFA 3O73A 4M1YA 3ZE7A 3VSAA 1H66A 1TD1A 4WK4B 4GD3Q 5EJFA 1TUIA 2G88A 3QVKA 3R4CA 3EYAA 1C29B 1D2HA 4FYWA 4BIMA 3LC7O 2Q5LA 4L74A 4LXHA 5K0NA 1M7GA 4TYPA 4DPLA 5JBIA 4NABA 2YWFA 1N2HA 4WXPA 4HWPA 4AAYA 2Y4NA 2IXEA 3KXLA 2I3GA 4ZAVA 5A4JA 4RHEA 1P4GA 1A9QA 1X74A 1SVLA 2Z1MA 2XNDD 4UHCA 1K27A 3TSAA 2BHLA 2HA5A 5F5XA 4HGPA 4LAFA 3T5TA 4E46A 1AO0A 2BCJQ 1MHTA 3NANA 4R1OA 1XTVA 3G7SA 1X92A 4OQXA 4EI7A 4BYMA 1VMAA 3C45A 3OIWA 5ENDA 2NUAA 1PZXA 2Q6OA 4BP3A 4KR6A 3PGA1 4KGDA 4UC0A 5LDHA 3QVOA 1DWUA 4ZEOA 3OCYA 4EHBA 3QVLA 1ODFA 4XH9B 4F9EA 3EBPA 4H3HB 3K70B 5F9HA 2A5JA 2QUAA 5EE9A 2VYCA 1RJ9A 3ACBA 3PRKE 2CVFA 2ZRAA 2BFAA 2DT5A 3ME5A 4FONA 4JJAA 3TRHA 5J2UA 4WA8A 3RHTA 3LC1O 1C9YA 5FWYA 5K1ZA 5CIYA 1N6HA 1VE1A 1GRCA 4HDMA 1GUBA 3FSRA 2LCQA 1S8AA 1EZ4A 1CLEA 3ICPA 1SZCA 3DZCA 4NZ9A 4PHGA 4ATNA 4C89A 5HQ3B 4N5LA 3TIVA 5CJJA 4TVOA 3A4IA 3K6RA 3LY7A 1Z2NX 3AP1A 4TT3A 1JXMA 2YDYA 2ZUDA 2DY1A 3EXHB 4OXNA 3CRVA 1DDGA 3JQ7B 4HF7A 1DG9A 1DX6A 4OUDB 1QZUA 3Q8KA 3ZDAA 1XV5A 4S05A 2QDKA 3F4BA 4X3OA 1Y8CA 1DRWA 4A8TA 1NC1A 3NAMA 2IODA 3QVGA 2AQ8A 1CUFA 3GPBA 4PXAA 4WBNF 1NNEA 3I9KA 3Q72A 1EM8B 4LC0A 1E58A 4NU6A 3ZNQA 4PGMA 1KH3A 1PFWA 1QNLA 5E7MA 4E1AA 4KRXA 1J2EA 1NG9A 2CLSA 1M1ZA 3KD3A 4MDFA 4OK3A 4W4TA 1Z75A 3UJ8A 2PQ2A 5K3BA 2EJWA 1U0HC 3R6DA 4K05A 3T3PB 3RR2A 3BH0A 2PXXA 1QTRA 3O4JA 3JQ8A 3S2YA 4AUKA 4D92A 1XZPA 4UHHA 5FLYA 2GEUA 3LPLA 3P2KA 4ZOLB 5JDCC 1HDRA 2CJWB 4JQZA 1QRRA 5CBKA 2NTYC 2P4EA 5D3QA 3R7FA 2JD0A 1C3JA 3AJDA 3FVTA 3A28A 3ZWDA 1NSYA 3OLXA 2PLWA 4EF5A 5A4KA 1CIPA 2UVQA 3NT2A 3EXIB 2PU5A 3NKLA 4NFHA 1ZU5A 4FPXA 1IXYA 5E3IA 2ILTA 4WACA 4KO4S 1K8YB 3P9IA 3G2JA 1B8UA 2XF2A 421PA 1CKEA 1Z0FA 4OBXA 2H1IA 5BQXA 3R0VA 1EFLA 4RTKA 2P9CA 4WXHA 1VC2A 3P26A 1PFGA 3H8SA 4A6XA 5K0TA 5EXDA 4TPKA 1TU4A 2AMLA 2XQFA 1KF0A 1NTRA 3PC2A 3NU1A 3RJZA 2UZ0A 1G8SA 4CTKA 2QJTA 4HWRA 1I4TD 3EXEB 1X87A 3ONDA 3N70A 3AT1A 3D3JA 3VO9A 1H0RA 4A0FA 5I45A 2VP6A 1EJ6A 4ILKA 1DAHA 5CLFA 2NP7A 4YONB 1J33A 4QDUA 1TO1E 2OXCA 1RM3A 3A36A 2FVXA 3A4MA 2MINA 3GFFA 3V32A 4RLSA 1E8MA 1OW3B 4Y9RA 5P21A 1W581 4N48A 3R76A 1GSOA 1P6XA 5EMJA 4A1FA 5IT0A 1U4OA 1DCMA 3DCYA 2W8ZA 4CBVA 4ZOLF 4L02A 4JP2A 4G97A 5ITZB 2NU9B 3EVNA 3RASA 2AXPA 4ETWA 3F73A 3GLHA 4QOHA 1NXPA 1R3UA 4R8KA 5IH3A 3O8CA 3A6GA 1QIHA 3NHAA 3PTZA 3ROQA 3FTEA 2QV7A 2QQ0A 3F46A 5KTNA 2ZTSA 1VZ3A 4LRTB 3G0IA 3S2SA 3CVWA 3UOAB 1ILEA 2VPWA 2W6IA 1A9ZA 1H6AA 1GU0A 1IPFA 2YZKA 3I4FA 4JEHA 2ZIFA 5EOVA 3V1NA 4BTEA 3DR3A 3F9CA 1I51A 4H6WA 1EWRA 1KRXA 1XEFA 2B8EA 3CZCA 4DDUA 1O94C 3KXKA 4XEHA 5T41A 2IKQA 4RVCA 4BE7B 2XW6A 4IYJA 2VDLB 4NMWA 4GKJB 1NVFA 4HEJA 1U5CA 1SUIA 2PD4A 1AKNA 2Y71A 3O93A 1JG4A 3KZMA 1MKYA 2MHCA 3COVA 5BR1A 2DCUA 1CUJA 2SHKA 3JQAD 4EHKA 3VR6D 1EGVB 2RD2A 2ANCA 3FNFA 1KWKA 3I61A 3RBXA 3GJ5A 2QZ4A 1LBSA 2E5FA 2BFMA 2GAIA 1MJFA 2PMWB 1ONBA 2J32A 3W7BA 4ESHA 4EPXA 4XX0A 1RHQA 1TMGE 1Z13A 3H5VA 1MBZA 1Q3HA 3HEMA 3JAKB 4FU0A 4O4HA 3H2SA 2ZB2A 3HJGA 2PFGA 1T3SA 2LRHA 1IQRA 4CQLA 1FJ2A 1RYFA 2DG2A 3AEKA 3GJ7A 1OT3A 1ZIPA 3PNMA 5T4BA 3V8RA 2E55A 2HJHA 1RBZA 3E3AA 3OZBA 1NXVA 4ETIA 2C2OA 4MR7A 1V0JA 2AR0A 2EFJA 1T2VA 1YB2A 1WZCA 1RHRA 1M8KA 4B3GA 1Z6QA 5EL0A 2DTXA 2XZOA 2H0AA 4YRKA 5K0GA 1DWPA 5BN4B 2OPBA 4QU5A 1CS0B 5ALPA 4UM7A 2QR5A 1N0IA 3TOZA 4IV5A 1A9RA 1RJWA 3F2IA 3VHXB 3VH4A 1VFPA 4IFEA 1AMUA 3KDSE 3ZK7A 3ZHXA 3EW7A 5E4YA 4MEBA 2OCBA 4FK8A 3RV3A 1AF4A 5AI4A 1IAVA 3PUVA 1KO8A 3K0BA 4HYQA 4MLDA 3OFNA 3LQYA 4NYJR 1UBMS 1AUPA 4MH0R 3FKSD 4DZTA 3TPFA 1OBOA 3N0RA 4OQNA 2IU4A 4KNYA 2X86A 1G6OA 4RVHA 2D1QA 3OQ1A 1IM2A 1FF9A 1Z5WA 1RQRA 4HWSA 5DHRA 2QTGA 2XCOA 5DN6A 2E85A 2FXVA 2Q5EA 3B6IA 1KAEA 3FVWA 4HT3B 3QKRA 1JJIA 3V1UA 2YV3A 2ZCUA 1T8TA 5KWJA 1PGOA 2YWCA 1CZKA 2RGBA 3THYB 1XTTA 3OZGA 1L4GA 1ETUA 4BNGA 4CIVA 3P7MA 1K8QA 3BK7A 3KR9A 4FFOA 5FOSA 3D6TB 2X5JO 3VBEA 1A95A 4WNAB 4K1XA 4H4EA 4MVJG 2WJHA 5C31A 2WZBA 4Z3DA 3VSEA 1MW8X 3ANMA 4ZOQI 4WKCA 3F71A 3JQGB 1GM5A 4C0JA 2H08A 1CFJA 1KKUA 1KAHA 3T99A 1KXJA 1G3QA 1NMYA 3Q7QA 4QUHA 2IUUA 4F9GA 2FMUA 1PBTA 4AJEA 4KZKA 1CE8B 4XPIA 2UZ4A 1M54A 2WJWA 5J4YA 2ODNA 1NI4A 3ORYA 2W9XA 3QEMB 4O3FA 5TMPA 1WS6A 1SC9A 4OX9Y 1ZJ5A 1V9LA 1ES9A 2O4CA 2HKIA 3B6KA 2YWRA 3DAYA 3CRMA 5ALZA 4US2R 1QFXA 1CP2A 2GZMA 2RGGA 5ELMA 3OZFA 1U5BA 2ZVPX 3GWZA 1PWXA 1XYYA 3IQDB 3D4NA 1YOVB 1G55A 3IAHA 3FWNA 1UBGA 1U2GA 4UVIA 4AUEA 3DHEA 1JE1A 3TQFA 3DBHA 2Y1KA 3TECE 2CMGA 4NKRA 4CG1A 2OPHA 2BEUB 2BFFA 3PLRA 3PPIA 4NG5A 3EEQA 2BGTA 2QN9A 4DIKA 1MF7A 3OO1A 3GMTA 2O5EA 1UBLS 4UUMA 1PWZA 4DUGD 1QBGA 3P96A 1P7YA 4B4KA 2A9KA 4UAVA 1X13A 4UTPA 2GJ9A 1DEOA 2C20A 1YB1A 1W5SA 2FEKA 3M6VA 1T5TA 4ISBA 5CLIA 5EE5B 5FYQA 5HTKA 1KJQA 2FWPA 1CJVC 4A2QA 4E12A 1F8UA 3ZVKA 2OGSA 1PJ2A 2IZOA 3CISA 3EZFA 4P98A 1L5GB 1PL6A 4F8EA 2ERYA 3IYLW 1LNZA 4R84A 1W29A 2OAEA 4J16C 2VHCA 5H5JA 3IV7A 4QTYA 4GL2A 2ASEA 4N9WA 4WL0A 1A5AB 1KE2A 4XFDA 4QXPA 1VLQA 3SOZA 1QV6A 2NXEA 2BGJA 2ZBUA 1HE2A 2NV6A 2WZCA 4YJ3F 1ZMXA 4NSNA 1JJVA 1QGYA 2Y9PB 3D8HA 3PP8A 3QXSA 4DS3A 2VJCA 1Y9JA 2JJ2D 2C88A 1DPGA 1L0BA 5HSGA 3FH0A 1YR7A 2OHGA 1FYEA 5TPZD 3UAXA 5IG2A 2O19A 2QUJA 1LD3A 2WSBA 4KGVA 5B1IA 5JCPA 1FFSA 1E7MA 1NE7A 1Z5ZA 2I7XA 2OO5A 2TMKA 2WNIA 3NHFA 5FTJA 3BIJA 4LGVA 3ZWKA 2J0EA 2X0IA 1NXQA 2FEMA 5HF6A 1BAPA 1WXWA 3TZQA 5KYYB 1RAEA 5I8WA 2JASA 3ADBA 1H4SA 4P7FA 3GT4A 1WMAA 1PR4A 4WBSA 1CC1S 2CLEB 3JV7A 4GMDA 2IYXA 2VF5X 5BSUA 3DTVB 2V59A 5BOSA 4IFBA 3NBZC 3JQEA 3H17A 4PGGA 4CM3A 2W8BB 2AOTA 3COWA 3NW9A 4Z0PA 3ZW7A 2VHJA 2CK3D 3PU6A 4XM1A 1TUEA 1C3OB 2NQ8A 1IY0A 2X41A 5DHFA 3WP1B 2FUNB 1VIYA 3EFBA 2CHVA 2J87A 7MDHA 3GT3A 1JQAA 1ECFA 4I4TA 1Q7BA 4YXWA 3ZY2A 3LNTA 2G5PA 3I9LA 1GGFA 1KAQA 5L40A 3B9QA 3NTVA 4H2DA 4JITA 4EABA 4HH3C 4KXLA 4Y2VA 1IIRA 3SYLA 3L82B 1VKHA 2E21A 4K9NA 1MX9A 5FTWA 4KYVA 3VKFA 4B8YA 4AZ3A 1A9XA 2QAGC 1KZHA 2FOLA 4L9RA 3AUAA 5BOVA 4PBTA 3U48A 4G0QA 5KYNA 4UM5A 1JPNA 3CUWA 3EAQA 3VNUA 4DWVA 2YKGA 2P4UA 1GR0A 4KX3A 2ZANA 4MKRA 4L0QA 2PUDA 3JYLA 2QG4A 1JAXA 4HR7A 5AXAA 1NR1A 2ZR7A 5GM2A 4EHHA 4WXYB 5JBQA 2WUWE 4FYYA 3WKAA 5ERGB 1T1IA 3ZNOA 1EJ0A 3NUGA 3QHAA 4EB3A 3ZE1B 3KPUA 3WAKA 4WAUA 4AF8A 5D3KA 3DKIA 2Y1WA 1OXKB 1C4KA 2H1FA 5JMTA 3QH4A 3K0KA 1U7TA 5H4GA 4L4RA 3CE9A 3F6CA 3SQDA 1I4LD 3TB6A 3CR8A 1PRYA 4X6XA 3W8RA 4C6HA 3WK9A 5KOJB 4EG7A 4QYXA 3KBOA 5BYBA 1JEDA 5AJYA 3B9PA 3UA3A 4CT5A 4EP1A 1XYGA 5EXXA 1YBFA 3EFOB 2ODEA 4QJIA 4US0R 1DWQA 1R8SA 4BBJA 2G9RA 3G0OA 2O7RA 3MPOA 4ZI7A 4MKGA 3THWA 3VAAA 3GP3A 3MB5A 1LJ8A 1KY4A 4BNTA 3BERA 3C6ZA 1U3UA 3OD1A 3FN4A 3CVYA 3HJHA 1DQRA 1DC5A 3NFRA 3N2GB 1MB4A 2KQUA 1E2BA 2BFOA 5CU7A 3C5HA 4BV2A 1JHDA 4R41A 4MS3B 5FEMA 2DPHA 3SCZA 3V2UA 3ZKWA 5J4VA 2GD0A 1QYRA 1LB1B 3HKCB 5E2BA 2I99A 4ARBA 4AY5A 1XTRA 1N7GA 1DSSG 3A70A 4TVKA 4XOUA 3NBXX 5J63A 5JLJA 3U3XA 4ECEA 1NVTA 1UK8A 1GCOA 5AVSA 1HO3A 3LDHA 2OHFA 5D00A 3UICA 1Q12A 2GBFA 4FFDA 9ATCA 1CB0A 3QMWA 4CV3A 2JLVA 3TB4A 1EWTA 3L49A 2WU0A 4DTCA 1YVEI 3QKSB 1UIMA 2ZS7A 2Z2XA 2ZIXB 1YV9A 3D2LA 2KX7A 1XTKA 1PJSA 2HAEA 5DI3B 2NW6A 2BJVA 5KMGA 1OHHD 3V9AA 1CT9A 3K2IA 3VO2A 4ZMBA 1BN6A 2H5LA 4ZT2A 3PG5A 1DIGA 3FZEA 5BR8B 2GCEA 3N8IA 3LFUA 3G6KA 1GA6A 1QG6A 4F2GA 1F6BA 2WIKA 3ETHA 3HVHA 3MWDB 4RGVA 2QD1A 1L1QA 4EFKA 4JYZA 2HFKA 4Z49A 4UCWA 4JKIA 4Q4AB 2GPJA 1WHTA 1JKMA 2Q5IA 4KQJA 3ZS9A 1IN6A 1VE9A 4QPCA 3C7KA 4QRDA 1S2NA 3O9MA 4WK0B 4R7GA 4WNYA 5JARA 5T8KC 5LDGA 4P53A 3VZQA 1KTVA 2W2KA 3DZIA 2AG5A 2VHVA 1II8B 2Z5FA 4QUEA 3PNYA 4FT2A 3RJTA 2Q3CA 3IKJA 1M83A 3OE7A 10MHA 4W1QA 1SPXA 4HI0E 2QE7D 5C8VA 2QI9C 4BNKA 5AW8A 1EINA 1G1MA 3DTYA 3ZCTA 5TNXA 1NF9A 4MVJI 1MA3A 1ODTC 1M2VA 3BMXA 4O4JF 2V5AA 4TMYA 2C4HA 2J4DA 2A5GA 4Y67A 3R5XA 2Z2KA 3W8EA 2QPLA 3EPHA 4IZIA 1JHMA 1J00A 2ECKA 4M1MA 3G2QA 4KBYA 1CR0A 4CEHB 3DVLA 2HD4A 2BP7A 2EZ8A 5HHTA 4G4SO 3VHQA 2JLUA 3J80A 5B3JA 3AI3A 4YUVA 2R4UA 3O0DA 4CV2A 2PLRA 3OWOA 1DXQA 1V37A 5AVUA 4ZJZA 3K9QO 5JPIA 4P0PB 1N6NA 2NTVA 3N0TA 1WNFA 1UMDA 3VVBA 4GI3A 3KQNA 4F4CA 4G0XA 2HSGA 3H3JA 5CLHA 2PXAA 4QBKA 4F93B 2BEVB 4FSDA 2OV4A 2FRVA 3HDYA 4TLCA 4HPWA 3RAFC 3WG9A 4EMBA 3FPLA 2C9MA 5KJ6A 3I6YA 2WWXA 4TWJA 2KWIA 5JNTA 1UZUA 1CR1A 1NQXA 2PSSA 1UJ2A 4IGEA 4FMDB 1D1SA 4A5SA 3U0BA 4GR5A 2WUFA 3WBBA 4IIXA 3WWCA 3EZ9A 1EUCB 2W83A 4G37A 2FFBA 3KOYA 2MU1A 4O5AA 1L4NA 1PVOA 3I32A 4KHZA 5CDSA 3U44A 2HIGA 1FMTA 2JFPA 4RK7A 4F5EA 1B23P 5DF1A 5CXXA 4GPBA 1AKTA 5HM6A 3QW4B 4KLRA 3BT7A 2HU8A 2QRVB 2ZYDA 3E9YA 1N2CA 3RSSA 4EY7A 5C4IA 1WIWA 1ZRSA 3ZV7A 5GOTA 2XE7A 3ONFA 3ELBA 4IUBS 3DHVA 4I08A 5DNVA 4QO8A 4RF4A 3ANTA 2JFGA 2ZSBA 1IPHA 2GLUA 3ANXA 1MRZA 5I51A 1T8PA 1EVLA 1L7VC 3DZDA 1MR3F 4XWWA 1SCBA 3RG2A 1QO0D 4PG5A 4CDNA 2WKWA 5AW7A 1SUFA 2WYHA 4WCDA 2XDWA 1NYRA 4OEHA 3GEBA 5JVDB 1BJKA 4KREA 5JADA 1D03A 2BMDA 1HZZA 2OHOA 3K8OE 3CKYA 4NATA 1B6SA 1SXJE 3KUUA 2C3UA 5LXTA 2Y93A 4V24A 5ENZA 2VIIA 1V5IA 1E7WA 4IZHA 2GPNA 3D7SA 3GLKA 3WK7A 3MWJA 5D6NA 3SZ3A 2Q3LA 4W9RA 1CTQA 2CLLB 4WZAB 4B2YA 5A4FS 2JLQA 2QRNA 4QQFA 2HBYA 1T9ZA 3R0IA 1B1AA 2BN4A 4AN4A 2GLTA 2IP4A 1WM1A 3D6MA 3FFBA 3UGTA 1F3OA 3U3MA 1KS9A 2AN9A 2IHJA 4FMDF 2NO1A 2W71A 3DO8A 1JR3D 2Q27A 5EZYA 1EVQA 1EXMA 3V8NA 3WWOA 3UC5A 3RLFA 1V6SA 4BZXA 4KPUA 4QAJA 5FCDA 1Z4LA 2WWGA 2X0RA 2ZJ3A 1U8TA 3SFTA 5HS6A 1R66A 1TQDA 3WK6A 3TOCA 2A5LA 5B1SA 3VZDA 3FUXA 4F2WA 2CFOA 4XIYA 2B98A 2R1UA 2B7LA 4BV8A 1QAMA 4PSVA 4C4RA 2F8SA 1NQVA 2C8KA 2EX4A 3OX4A 4C21A 3DAHA 4M0FA 4B48A 4LWPA 5IMSA 1GKUB 3K0AB 5TEWA 1V16B 1NY5A 4CKEB 2VP9A 1E1CA 3DHNA 5CBPA 5F1YA 4WEOA 1ID8A 2PPLA 3VPBA 1HXHA 2OXEA 4ZJPA 1UC9A 2JIMA 3AFHA 2PSJA 3D8TA 3DL7A 3MWEB 1E1RD 1KKMA 1RXUA 1H3FA 4UNSA 5FPYA 1DTWB 3WYGA 5JVDF 5MHTA 2YZMA 3ROZA 3RO7A 5JAQA 4CEJB 4LVUA 3ES9A 4LRYA 2P7HA 4R01A 1Z62A 1N2SA 4OPMA 4DA9A 1ZD2P 1Q50A 1NKSA 3PX2A 4J1QA 2JJ8A 5TMBA 2RBEA 1M67A 3KU1A 2PUWA 4G36A 3IEVA 1YOBA 4Z3OA 2EZTA 4QDOA 5AH0A 1LA2A 3MUNA 2N42A 3GLGA 3OURA 4CFSA 5KSYA 4PLHA 3DWEX 4PTZA 2ZRMA 5KYUA 2V7UA 4QGFA 3CW8X 3U17A 4XM2A 1YS6A 3T3GA 1EEHA 3SF0A 1GCAA 3OTHA 1GZUA 1AUOA 2HSEA 1V8BA 3TLGA 2IVZA 3LBHA 4FNMA 3S2IA 3X2FA 1JLHA 2ZBGA 2WAAA 3JD0A 1ICEA 1RQPA 1WU8A 3BTVA 3LOQA 1XAHA 3RFFA 3B8HA 1ZMRA 1HYHA 3PCTA 4RJJA 3B53X 3LZCA 3PQ3A 2VHWA 2WT9A 5TC4A 4QUDA 1TJNA 1MTZA 1JIVA 4X93A 3V8QA 2OUKA 3FZYA 4I1SA 2GZDA 4P2BA 1XVAA 1Z47A 2RGAA 5CLGA 3SEZA 5JANA 1BDIA 5KTPA 3ND8A 2GO1A 1QOQB 3OI7A 1F9EA 1GUYA 1W35A 3GGCA 3PC8C 4NOLA 4CM7A 4DSTA 4EYQA 2Z6UA 1EFPA 3B5EA 5C3MA 3I2JA 3ZXYA 5G0TA 5FV7A 2VT3A 3Q5DA 1MABA 3IT2A 4UZSA 1ADGA 2PRIA 3FHLA 1ONOA 4S1TA 1UZLA 2J67A 2C8VA 3DEIA 3GGGA 2DC1A 4FN5A 1XVLA 3GGOA 3K32A 4OA5A 4WOPA 1C1YA 1RXEA 4J0KA 3ZUPA 1ZXLA 2B83A 2ORED 5HK8A 3OTIA 4DLVA 4QUKA 5KX5B 4L8VA 3KT3A 1ULSA 1EP2B 4OSOA 4ZQIA 1YS4A 3W3AH 4A92A 4P93A 3Q6IA 3CVJA 4ENTA 1M2EA 5JJKA 2B8NA 2Q07A 1B8PA 4BX9A 3R3SA 5FPHA 2I6XA 4D2IA 1Z63A 2WKRA 3AVTA 1KI6B 2W2LD 3FNRA 1W73A 4L72A 5LCXA 4A8JC 3CV3A 4YQFA 2Q28A 3PBKA 2GPBA 1DKPA 1IUKA 1KPGA 2A1UB 1V1MB 2CVPA 3D6NB 4XYLA 4BFZA 4GQIA 2MSCB 2DXIA 3BCRA 2A0WA 3MJHA 3A1SA 4MVJM 2IE8A 3HUDA 5JXIA 5GIPE 3RSCA 3WHKA 2ECPA 1C9JA 1Q11A 1RHKA 2AR9A 3ZHQA 2AFIA 2GGSA 3ZCQA 9MHTA 2IKSA 4YRQA 1PEDA 2RAUA 3T9DA 1HV8A 3L0YA 3STYA 1LQUA 3I8SA 4NBSA 1BMQA 5AVWA 4GPEA 2IYEA 2XWSA 5K0BA 1KVQA 3AF3A 3DM5A 6NULA 1XRRA 4DXHA 5C80A 1MO5A 3MT8A 3PC4A 3L7NA 1VG1A 1SR8A 4CV0A 3C4JA 4XIJA 5JZSA 3QLEA 1NQTA 4L8FA 4QGAA 2H4XA 3JZDA 3C1OA 4Z7NB 1FSGA 1X9GA 3FDZB 4RGBA 2OC4A 1ZOIA 1QHXA 1EFRD 2AC7A 1LI7A 3MTJA 3W77A 3RK4A 5KX5F 3RFUA 4K0KB 4ON9A 3LBNA 4LOHA 1UDCA 3KKLA 3L2OB 2C0QA 4L2IB 5CB0A 5D8DA 1QSGA 1LDNA 1UPUA 3DDUA 3TZ6A 3NOOA 1CW2B 1Y6QA 2YHIB 1YT5A 1U04A 1PX0A 4Y30A 3U62A 3S28A 3V7UA 4QEZA 1MDFA 1WKBA 3E2MA 1PTJA 4RMHA 4DUPA 4YR9A 1G8HA 4OU5A 1UPTA 1U90A 1CZOA 2ZW9A 3KYJB 3NYQA 4XVRA 1P7CA 5TVKA 3RYTC 3KQPA 5LUBA 3QTTA 3WNVA 2G9VA 2WHPB 4D57A 3IEPA 4IS2A 3HVIA 4M9QA 3TIGA 4DLSA 5ILOA 2GBLA 4BQPA 4E30A 3GRCA 3SEFA 4NEGA 2D0IA 2AOUA 3C7CB 3OUZA 5FFNA 3K0FA 4GLJA 4KK3A 2LW7A 2ZI6A 5FQNA 4C7MA 2WAMA 3GLUA 4CCSA 1D4OA 3E35A 2F3UA 2Q5HA 1MU0A 4J0JA 3JWIA 1YCGA 4KN5A 4DA6A 2UVDA 1YRYE 1XDWA 4DM4A 5K8JB 1MXFA 2ZI4A 1L5YA 1YXMA 5E1BA 3OTOB 4KWEA 1C7ZA 3IMCA 3ZWXA 1PGNA 2OVBA 1HYQA 3SLKA 2CCKA 2ZPUA 2YFYA 4OYRA 2VTDA 1DAGA 4R8RA 3TD2A 1RWBA 2UDPA 1FTSA 4ZDJA 1ZZEA 3IURA 4OHVA 1EWQA 1RHMA 3ZEIA 5I8PA 2XTNA 5K8CA 2V6GA 1C1XA 1KOFA 2XGGA 4QHTA 2XCTB 2WWTA 3LLSA 4OL0A 3GCGA 2D2EA 4EHAA 3JQFC 3COJA 4U9HS 3WO0A 5DM60 4K9QA 5A05A 1O9HA 1PYOA 1RLJA 4I5EA 4K9SA 4Y9TA 1K7FB 3H5TA 1E1YA 1V9SA 3IP9A 3TPCA 1CQIB 2FFRA 2VDWB 1A2BA 1RQNA 1A88A 5CA1A 1KHTA 2BZ1A 3EOAI 3I2IA 5E6SA 1RKVA 3ZH2A 4W5QA 1BCSA 1PN3A 2VCHA 4HK4A 3I83A 4JBWA 4JODA 4X45A 3BORA 2PSHA 3V97A 4GBJA 5G3ZA 4IJMA 4HC4A 4HAWA 3K9GA 4M1WA 1XDGA 5JTUA 1GNVA 2O7NA 3M5CA 2V7PA 3L4EA 3RYFB 3HZOA 4NYIR 2F55A 2Z6QA 1ZIOA 1J2JA 1W87A 4LYYA 5F12A 3HVKA 3WGQA 2R5FA 1PG0A 4U2CA 3L79A 1BMFD 2JPDA 1WCWA 3GFBA 4NL4H 4F5ZA 3T3DA 1DAIA 4FGJA 3DL4A 1CUBA 2AT1A 3KVNA 3PC6A 4KJXA 4M21A 5CK5A 5AICA 4A0HA 2WBLC 1FJXA 4EO4A 4G89A 5L3QA 5ES3A 3LPCA 3LCJA 3QLVA 1NJ6A 2P8SA 3GROA 4CM8A 2F48A 2NVOA 2DPXA 4MAAA 2V7QA 4FZRA 1OUMA 1DINA 4ZICA 2UUBB 4HEA1 3EGXB 3P1JA 3QVMA 3AHEA 1BVUA 3TIXB 1FNCA 5AESA 2VTKA 1YJQA 2QGNA 1L7DA 3EQ9A 3DE5X 3EF1A 5DNDA 4M6WB 4IL5A 4I14A 5T6BA 2GEVA 2LXNA 3WQQA 3ZGVA 1O8CA 4UEQA 2OHVA 1VDZA 5AVXA 3NC0C 2VLIA 5GZ1A 2ADFA 2B9EA 3G9XA 3A9CA 1TAGA 1Z4QA 4RSMA 4JQSA 2BV3A 1XDBA 2JIRA 1LDGA 3DDWA 4EUHA 2E4VA 3SJCA 4BVEA 3LECA 4N0EA 5IYZB 3FHJA 3VYWA 1CG6A 4JC4A 1E1LA 5A9RA 2FR8C 1IOVA 1FDOA 2ATCA 2GN8A 1XDZA 3EGVA 4X41A 2P79A 5EJ6A 4B7ZA 1HOTA 2W00A 2ZSHA 2LE0A 4KE9A 5JAPA 3V4OA 2ORYA 3CUYA 2DE0X 1X14A 3BAFA 2SCUA 3A05A 1JUDA 1NN0A 3DAOA 2DU8A 3BULA 1JNYA 4C07A 2G06A 3RABA 3E5HA 3W6NA 2VNAA 2PUHA 3VNBA 2WUDA 1YL6A 2O8NA 4MV9A 4JVLA 4MS1A 4EJFA 2RHDA 3GFQA 1XCMA 3IKVA 4C4AA 4CLOB 1MNQA 5JYBA 2XQIA 1EDDA 2XIJA 2W4QA 3RVBA 1KMIY 4C22A 3A1UA 5IZCA 3KT8A 1TVKB 1TW3A 2R48A 2EGGA 4X7PA 3BKWA 4ZKEA 1X9IA 1GO2A 2AXEA 3KKZA 3FUCA 5JJBA 4HL6A 3GUVA 3ZU2A 1OI4A 1S9HA 4I8DA 2YWDA 2Q8NA 1JEYA 2ISSD 3GVIA 5DM4A 5JG7A 3SZGA 3TW6A 2WUEA 4RQUA 4BZQA 4YRMA 2ZRGA 1Y1QA 1WUKS 5HPYB 1K7CA 4UUNA 1T4GA 4ZZ3A 4FGUA 2OBFA 3QVUA 1IRIA 2RIRA 2MYNA 3B78A 3U1VA 3QTBA 3HYRA 3SX2A 4D6YA 1RRKA 1O97C 4IQGA 2CLIB 4NP6A 4PLVA 2JGNA 5E8JA 1C7IA 4EZEA 2XXAA 4QJ4A 4XIIA 4UVDA 2PJZA 2C1EA 2X0NA 5J2TB 1FFCA 2XDQA 4ZC8A 4D0SA 2TS1A 4K6OA 3V4ZA 3V8BA 2ZT5A 1B6RA 2QX4A 1YC5A 4PZDA 5IYZF 4N5IX 2I4MA 3FVRA 4BKOA 5LA6B 1I7DA 1Y37A 1SBCA 2R5WA 4V1CA 1B26A 1K9SA 3VYVA 5IAGA 1I3KA 1Z4MA 4G8BA 4TXJA 2FSHA 1K8RA 3SQNA 4V0SA 1EP3B 4PXSA 4PC2A 4MW9A 4XRRA 2FHSA 3AKCA 3FRHA 4L9AA 4AXXA 5ALQA 1Z22A 3OCXA 5G53C 3U81A 5LFAA 4HUJA 1B6TA 1OFUX 1SHJA 3NM5A 3P9SA 4HZUB 4HXYA 3U7QB 4Y2XA 4EF4A 2AJTA 2PSEA 4GZLA 3QEOA 3AIKA 1E89A 2XZLA 5BXQC 2HMSA 1UWVA 2GCOA 4HXGA 4YV7A 3UGQA 1PGQA 1L7MA 1JNXX 1LJLA 3CONA 3KQOA 3KXPA 1WPQA 4UUPA 3N8GA 1XN4A 4EG6A 5BXYA 1CFZA 1DC7A 4JC0A 1NMXA 5TQVA 1Q2XA 4ZFNA 4RNCA 4F6RA 1JZSA 3DMHA 4ZVSA 1UADA 2F43A 4OJQA 4L5IA 3QI7A 2JGKA 3ZH9B 2BC9A 5CAEA 4J94A 5LSAA 3WLOA 4B76A 2ZRPA 2P9TA 1ZL0A 4WI1A 3P2YA 1TNDA 1R0RE 2PMDA 2A58A 4LXXA 1HEIA 2EARA 3ORRA 4J7CA 4RF2A 4DLBA 1KAMA 1SQSA 2C42A 4DNOA 1YONA 4FYXA 2WMNB 1W5TA 5J2TF 1OX6A 3H5NA 3E22A 2GYVA 4LKRA 2HTFA 2OFWA 1MXHA 1VJ1A 3K05A 4JEMA 2GPTA 4ZVRA 5FOWA 5LA6F 3RM3A 5U9CA 1RP7A 2BDTA 3Q88A 4MV7A 3VU3A 3U09A 3F5QA 5ERXA 3GWGA 1M33A 3GZ4A 4C0SA 4RC9A 3PF9A 4YXFA 2VK4A 4BPRA 3O2QB 1YB5A 4JUFA 4DZZA 2PSFA 1MAUA 2JGRA 4FC7A 1P6UA 4LQ4A 3WMGA 1D2GA 1PGPA 2WWWA 3DC7A 5EIFA 3HUUA 5CLJA 3SHQA 1E62A 3CLKA 2AD5A 3EEFA 2WJPA 3AWIA 4IW3B 4DIEA 4F6CA 1G18A 3TI9A 1RI5A 1E4EA 4WY2A 2GYWA 3CF0A 3L4BA 3M6IA 1SB9A 1NQAO 4W9NA 2NVUA 2JKZA 1F5NA 2WILA 2H1HA 4JLPA 2QR2A 3T3EA 4X0EA 3DDCA 1TJPB 1UBOS 2NVBA 5G0UA 1VI5A 4JH0A 3AFMA 3LPNA 1Z5UA 4HRAA 3NRJA 2QORA 1KSFX 2ID7A 4QPDA 1KDZA 3VTAA 2R3SA 4C4ZA 4K26A 2WIAA 4IWNA 2X23A 2X42A 4OQPA 1V11A 4WLVA 4YACA 5EA2A 5TMEA 4KN9S 4WKGA 1G20B 2HRQA 2LIPA 2ZE5A 2ZS8A 3A2NA 3KP1A 5DTQA 1JIQA 1XQXA 3ESCA 5CFLA 2PGLA 5IABA 1XKQA 1PW7A 3PIRA 4XCQA 2JZCA 3LGAA 4BFYA 5BV7A 2JIOA 1R8YA 2J45A 1NV8A 2X8BA 3KTAA 2FUG1 4DCGA 2XECA 2ZR0A 1Z15A 5FF9A 2NAPA 4HNQA 3ZCUA 1CJUC 1UOQA 1VE6A 1YL7A 4F4HA 2QAJA 2XMBA 3EDQA 3I34X 3RVMA 5KVVA 1TUBB 1DEKA 5K01A 1LSSA 4WZ6A 4RM2A 2VSXA 5T6MA 6LDHA 4LF6B 4NCBA 3KBBA 4XFJA 2B5OA 4JXZA 5DRTA 4BNDB 1T8UA 1FIUA 2GN9A 2HLPA 3EIEA 3FWKA 4QNRA 1SN7A 1C4XA 3JRWA 1OYYA 1H2WA 1NMEA 3O8DA 3PA6A 2GJ8A 4O08A 4DJJA 4G1EB 4OGGA 3WGMA 4Y18A 3CCFA 1KMNA 1T91A 5F78A 4RTNA 3GQVA 2XEDA 5HCUA 3ZD8A 5BN5A 4NFLA 5ABPA 1OBCA 4ZC1A 5AT1A 1BS9A 4MWBA 3AXSA 1ODJA 3H18A 3LLMA 2ZWVA 1FPMA 2HV9A 1F1JA 3FGZA 5DWVA 3UJCA 3FW1A 5K0ZA 1PJTA 2FV8A 2ZSKA 2R7AA 4JFAA 2MCFA 2QY6A 1D8TA 5BYKA 3BEDA 1BA2A 5DJ5A 2FI1A 1R3DA 2X8JA 3UWSA 3UXYA 4UCXA 5SYMA 2GTHA 3Q8WA 2VQEB 5IKXA 4IHJB 5HBGA 1AN9A 3R20A 4XVQA 1NW7A 3BGVA 2ZTLA 4FD2A 3TW8B 4QFCA 2W6JD 2P2NA 3CLUC 3HRHA 2Q6LA 3OT4A 1A77A 4Q16A 1T5SA 1G0OA 1O9BA 3LT5A 3B52X 3P4XA 1KP2A 2M6SA 1W85B 3ESBA 4ZQGA 5EI5A 3VPCA 4EW6A 4ZHQA 4RA6B 5KPDA 4XVCA 1JV2B 1BX0A 4A82A 1UL1X 2H1RA 1GP2A 3DWIA 5ICMA 2HSWA 5HFAA 1YRWA 3DT6A 3P2JA 3KWMA 5K2MA 1JEQA 2I4TA 1L5VA 3B1KA 1A1SA 4B46A 2Z8ZA 1JQJC 1G2QA 2QVYX 5FL7A 1RXVA 2HHHB 2RKBA 3P9QA 4MUBA 4OATA 2HBZA 4XLTA 4EO9A 2I3DA 2VJBA 4YRPA 3S2FA 4BB0A 2B1RA 1YUNA 1JLLA 3A0UA 3PD1A 3OMLA 3FTCA 2D62A 4K87A 4O2LA 3ERCA 2X7HA 1XU9A 1YGYA 2RG1A 2F8TA 1XP5A 3ANYB 3O3CA 5DU2A 2DHEA 2OFPA 4XLLA 5KNBA 4FVTA 3PGLA 5T4EA 3I9MA 3IPXA 2V45A 2C95A 2VAWA 4NAUA 2GUGA 2R2AA 3D3QA 3UV3A 4YAIA 4K9MA 3ENQA 1N92A 2Z4RA 1JR6A 2IDKA 4IHJF 1CYDA 1SWVA 1UEIA 2F64A 1DEAA 2JD2A 2AN3A 2PNJA 2J4CA 1RBMA 2HQOA 2CXHA 3DKPA 3UAVA 2FRDA 1NA5A 3TL2A 2NUPA 3SSNA 2WFLB 2ZK7A 2J5RA 4IDFA 3W5AA 1QV9A 2X19A 2H2GA 4GVXA 5COAA 2FFAA 3PXGA 4WZBB 2D00A 2I6QA 3LUFA 3OZUA 1ZEJA 4I6JA 5JH7A 2UUOA 6REQB 4QG3A 2YXEA 4JB0A 1PQYA 3VR1A 1ZONA 1NW3A 4M4SA 4L7QA 4G81A 4PHCA 4JLMA 5GTDA 2SICE 1T8SA 4EFLA 2Q41A 4LK3A 2VDRB 2O2ZA 4N4AA 1ZJJA 4C14A 1XBTA 3EA0A 3AF6A 1EESA 5ALLA 3FYUA 3UMJA 2O7VA 4UOZA 4Z3KA 3IB3A 1LLFA 1FU4A 4AC9A 4LOLA 3RFCA 2GH1A 4FBGA 5HRAA 2PJRA 3BGDA 5DBHX 3DEFA 2FPPB 3N1UA 4Q9LA 3TYXA 3PUJA 4BLVA 4YCBA 2GNOA 1UCFA 3T7TA 4TZ0A 2JIQA 4MI1A 5LB4A 1Q1EA 1AQJA 3NHZA 1HLGA 4FGZA 3WRYA 4F7DA 3COZA 1ZN2A 1U4SA 2OENG 4G1UC 2F3QA 2VHZA 4QECA 3W6OA 3DFZA 1JYFA 1DV1A 3QELA 4BNYA 4ZZ0A 4RACA 3EG9B 3L3BA 1UP6A 1FRQA 2O0MA 2FPRA 2RKWA 4TYWA 2GLXA 4AG6A 3RUDA 5IC5A 2ZUFA 3DBLA 3VHRA 1FTYA 4BC0A 3NEYA 1AUVA 2OXRA 1PFKA 3UXHA 2EJBA 3F5FA 4EW2A 1E7RA 2IHTA 2P5UA 2F7SA 5AKLA 2HFJA 2X13A 2Y1EA 3DV0A 5DTIA 1E1DA 1Q3TA 5CJ2A 3RYHA 2I4IA 3ESDA 4RLFA 2FZVA 3FPJA 3ILSA 4G1FA 4X85A 2VDJA 2WLSA 5G1PA 5JCJA 5LM3A 5TE9A 4MVJF 1G7RA 3GH3A 5BRJA 2HQRA 1I1OA 1DE0A 2CLCX 4Z9FA 4EO7A 5AOVA 5A6VA 2XB8A 1CS4C 3GAFA 1ZOSA 3SMVA 1P60A 2WIBA 5C8YF 1M7HA 3QOYA 4LF8B 3A32A 3IH5A 4TMFA 4ZGGA 2HCRA 1L1FA 3K9HA 4EGJA 4GXTA 3EF0A 4XD7D 3GF4A 2DAPA 1G9XA 1PDWA 3FLEA 2X5OA 3E4DA 4AJJA 4CQMB 4GS5A 3ZNNA 3VR4H 4MZDA 1Y4DE 4R2LA 1GG9A 5EYPB 2WSYB 5DFAA 5HF5A 5B4UA 3GPLA 1I1HA 3PGXA 3CF2A 3IOMA 4U2FA 4FFLA 4LZNA 3ADDA 3O92A 1ONPA 4KU4A 3IEUA 3H65A 2C3YA 1H8ED 1RCFA 1AO3A 4L0MA 3C8DA 1EH5A 5JROA 3P5BA 1TEZA 1TAHA 1O95D 4WIAA 4TM7A 1C2TA 1PHPA 3PNOA 3L4KA 3T15A 1WNTA 1ZK2A 2H9AA 4NIMA 3I5UA 2KE5A 5H1YA 3LBIA 5EMMA 1SGWA 5U4QA 2VDVE 1XXHB 2ZB3A 5ADHA 4I81A 5K3FB 2DR2A 1QV7A 1TIKA 2FMTA 1O96B 1GPNA 1MV8A 4NICA 5JO0A 1XA3A 1FMLA 1XMPA 2ZZNA 3IIIA 2OCXA 2VQ6A 4ZOEA 3EX7C 4NARA 3WBJA 1J2RA 1U9JA 4N41A 2QN7A 4RKQA 2FR1A 4W7HA 1P4RA 3GBSA 3HKBA 2X1LA 1ONNA 5E9WA 4JL5A 2IRWA 4MJ7A 4WQMA 5LYYA 1ZGGA 4P08A 3M83A 3RARA 1HEYA 1KH2A 1PG2A 1RI2A 1P5HA 2OC9A 1TB4A 2VDMB 3B6ZA 5D01A 5E6UB 3TFWA 1QFMA 1A0OA 2QBYB 3HM9A 1VGQA 2QG9A 1UDRA 2WABA 1SVIA 2QAGB 3KTFA 4D9NA 2C5SA 1HPLA 4B6OA 1W4CA 5IEJA 3SQXA 1K1EA 2WWYA 1YMUA 4HFNA 3I42A 3HN2A 3DMPA 3P8ZA 4PTYA 3WSVA 2JCBA 2C77A 3UQZA 3OM0A 1WLYA 4FLMA 3H13A 3T1YB 2CFRA 2DUMA 1W34A 4D9EA 1AV6A 1YZUA 4H7KA 3V33A 1UPBA 2HA2A 3FOAA 1JMYA 1SVNA 4IXNA 4ZYTA 5EQFA 2WTXA 3B9BA 1JFRA 4L0CA 5DVZA 3UG7A 3ZX4A 2YMQA 5CM8B 2W2OA 2ZE6A 2CEAA 4W1SA 5CW2A 2NSDA 4IDGA 3FNIA 4Z7QB 2ZSAA 2QRPA 3PFKA 2XAAA 5IKMA 2ZI7A 4ARZB 4E2WA 5DLEA 3QEJA 2AF3C 4BASA 3FPCA 1DT5A 3LUKA 4I1UA 1TMKA 2QRGA 1WY5A 1K88A 2H00A 3LAWA 5BSGA 3R0JA 4RIEA 1MQAA 1GRNA 3Q1LA 3IHWA 4H16A 4LHWA 5F1OA 4IKPA 4WBNA 4F3TA 4KDEA 1OB2A 2OOSA 1O4VA 2R62A 1KAOA 1LBIA 3NVMB 2EJCA 3R41A 1OKKD 2RHMA 4ZODA 3VVCA 3T61A 4KJZA 3WFJA 4Y1RB 4FIZA 4ER0A 1G5RA 2WA1A 3KWLA 1CU1A 4FE3A 4ZARA 1EM6A 1S3GA 1D2NA 1XR3A 4HHEA 5DH9A 1OASA 2CXNA 4MI3A 4X1YB 2EXXA 4HSGA 3TQOA 3I3OA 4D3YA 3NAZA 2G83A 3UJDA 4KDCA 5DP2A 2Q45A 4XJSA 1KMMA 3QXXA 3U31A 3C3MA 1IBLB 4MRRA 2O3RA 3JD3A 4RDXA 1W6UA 3HY3A 4ZCIA 4FFSA 5HZGA 1W2HA 4HAZA 3T38A 1AS0A 1XMOB 4GYKA 1RYHA 4ICIA 4LPSA 1CZNA 3GZTB 5BRAA 3BB3A 5BSFA 2O05A 4DDHA 2O5RA 2WU4A 1PT7A 3MMZA 4F3KA 1IOZA 3QTLA 4OD0A 4UM9D 2PRSA 2I2CA 2YFQA 3O4IA 1T3ZA 4FOSA 3SJ7A 5HQ3A 3AY3A 4Z86A 3RSHA 1P7ZA 4BUCA 1GRVA 5TJHA 1H6CA 1Z2CA 1EXVA 3E9MA 5LBUA 3EXHA 1R1DA 1L7NA 3JQ7A 1M2WA 2WV9A 2Y0DA 2JIPA 4OUDA 4PCLA 1IJEA 1YRLA 4DY6A 2V6MA 3BXGA 5IW8A 1IHUA 4FQ7A 4A6PA 5JT1A 4YDHB 2XVAA 1AK1A 4KB5A 4ZV4A 4CI0B 3RQIA 1QIGA 1DZIA 3GJQA 5K8IA 4PLCA 2V0CA 1EM8A 4LOJA 4DRZA 3DEHA 2J0QA 1LFAA 3X2SA 3AK4A 3NATA 2CBZA 4DNPA 4OFWA 5T5QA 1XELA 5LLDA 3H5OA 1OXXK 3ENKA 2Q99A 5DBFA 4CM6A 3G59A 2XYPA 3NCTA 2VF2A 1F51E 1MN6A 3QPWA 4JR0A 1L5KA 4GYWA 3BKXA 2O2HA 4JYBA 1BJRE 3E9EA 4GPAA 4OGWA 1FBTA 4HD8A 4QYWA 3LCCA 4KE6A 4ZOLA 3W6PA 1CY8A 2CJWA 2R2GA 3AVYA 2YWGA 1XCPA 1GTG1 2JHAA 3U1TA 3KEFA 4RSGA 5DSTA 2H4JA 4DL9A 2HLDD 4CV1A 1MW9X 1WY7A 3IVCA 2IZ7A 3ZWYA 3BCUA 1ZJYA 2JLBA 2Y9MB 3FWHA 2Q62A 4UBKA 3EXIA 3JD1A 1THTA 3B3QA 4FHFA 5A9SB 2Q3MA 2DEUA 1KZ9A 1P0PA 1SKQA 2OCDA 3S2GA 1I7PA 1JILA 1HWYA 1IUPA 2BFCB 3BXOA 3E53A 3EPPA 1JH8A 2AV6A 3GMIA 2HA6A 4HB0A 1GGMA 4P2GA 5HXAA 1KVRA 4LBWA 1TLFA 1USKA 4GSKA 4GXRA 1TCCA 3AJEA 4IDHA 1L4KA 4FYKA 4KGXA 3QJ5A 2X1MA 3V4LA 3A06A 3AOEC 3BH6A 3C8HA 3IP5A 4LJLA 3F0TA 1NM5A 4L3WA 4PTLA 4D3FA 3JQBC 1QRTA 1FQKA 1VE7A 1X39A 3DE1X 3NWJA 3QX7A 2SNIE 3FOBA 3EXEA 1GFIA 1Y1RA 4KR0A 3O90A 1R16A 1T6ZA 1X1DA 5CLQA 3G2HA 3D8NA 4MVJE 1D4FA 3A25A 4ASUD 3IDZA 4E5VA 3R9WA 2C5GA 1KI3A 5BY2A 4HUTA 3FNGA 3NWPA 4IXDA 1Y7HA 3AF4A 4MW7A 4AY2A 5B6PA 3I52A 2QI9F 4GOOD 2VHEA 2XAUA 3IAUA 3STWA 1J5XA 2DGDA 5EKTA 3SZUA 2HRBA 1O2DA 2FWAA 4Z7JA 3LKVA 1VI6A 4CLXA 2BE7A 2ORVA 1VDMA 1NT4A 3MUEA 1KWGA 4EX7A 4BWVA 1A27A 2QTRA 4GBMA 2NU9A 5ITZA 2Z5LA 1AHNA 4UD6A 1VLLA 2WSLA 4LZLA 1NULA 4RNDB 5TDHA 2MSNA 3UWPA 5CFQA 3AL0C 3DPSA 3OSUA 4MLCA 4BGDA 1P1RA 1QG4A 3WS7A 3LOPA 3LHFA 4HNSA 4R3NA 1O7JA 4EYSA 4AJ4A 1WVMA 3G88A 1QJ4A 1HSZA 3EAFA 1P1HA 1ZNYA 2I2WA 2VTEA 4LF7B 3W5DA 2JIBA 3PC3A 4ZQCB 1U7PA 1NZJA 1C80A 3UJ3X 1GNQA 1K7YA 1Q0UA 3OZCA 4MRSA 4IIVA 1I2ZA 4KLCA 1JI3A 4LHEA 1U3DA 5B3LA 5IM5A 2OL4A 4HP8A 3JTMA 4Z4HA 1GV0A 2ACVA 2QYSA 3E9DA 4JJEA 4XB6B 3MBKA 1KDTA 3Q5EA 1QDLB 3QBTA 2WIGA 4TWIA 4DG8A 3A3KA 5K9ZA 3I2HA 2WOOA 3CSSA 1E79A 121PA 1UDAA 2AS0A 2QLTA 4MVCA 4YCMA 1QHSA 2FPKA 1E3QA 1P29A 2ZYTX 2FE4A 2FSUA 3DNFA 5J47A 3T4UA 3CX7A 3IR5A 1UMKA 3RPEA 3AL2A 1T6NA 1WQ3A 4IH9A 4L0DA 4EH1A 3IAXA 2IA5A 3KNZA 5H9VA 1M6EX 3ZE9A 3DGFC 1AS3A 1GU7A 5T4HA 1IMOA 2JCVA 4BVAA 3RIHA 4AMVA 2HA4A 3RSGA 3K6SB 2I2BA 1CV2A 2HJ9A 3W5SA 1R2QA 1J1ZA 1F12A 3OY7A 4DWWA 5C7LO 2O8BB 4R2HA 3K4PA 4HZIA 4NEHB 1FE8A 1B8NA 1LQ2A 1CS0A 2ICAA 1SVUA 2Z09A 3MCTA 4KZPA 3HN6A 3L6RA 4Y2TA 1JTFA 3VHXA 3QUAA 3T06B 1M0WA 1I0IA 1W47A 3DAPA 4WH0A 4YP5A 4UHFA 1AGXA 4JIGA 2J8ZA 2GAAA 4UOEA 2J9ZB 1NXTA 3QP9A 3S8MA 2XDAA 3SI7A 3D6VA 4FHGA 1E59A 3F67A 2W5UA 2GF0A 3UJ9A 2ZS9A 1OAOC 2VHQA 1N8KA 3NVAA 4Y7CA 3HBJA 1XVTA 4PU0A 4AZ0B 5FUQA 1T0UA 1IJFA 1KQOA 4RFLA 4AO7A 1ZSVA 3L7AA 2Y3IA 4ARIA 1G7CA 2YR0A 3FCEA 2ZIZA 3IV9A 3ZU6A 4JB8A 2ZJ6A 1DDIA 1BDBA 3L8CA 4IJ5A 4NG4A 5FPSA 4AQDA 1QE0A 4OHFA 3U49A 5H3LA 1RJFA 2NU8B 1GSHA 3ISVA 1PK9A 3FM9A 3KSUA 4U5XA 3THYA 2GUWA 4B3BA 1HDGO 2Y1DA 1C9KA 3QYPA 3UF0A 2D74A 2YASA 1RE0A 1TZJA 3EB9A 5C5CA 2O07A 5M29A 5MFZA 1SXJD 3C3EA 1Q57A 2H18A 2I80A 3T9FA 4MQLA 4WNAA 5D1NA 4RWZA 3F97A 4NV0A 3GL9A 3JQGA 5AM3A 1QKKA 2O20A 2BZSA 2SKCA 2QMZA 1F0YA 1GL6A 1SNYA 3HN7A 4WWHA 5IARA 2X40A 4YJ3A 3SIWA 2W11A 4KVZA 1CE8A 3CVOA 4DIMA 5HW0A 3U4HA 5DX1A 4RSRA 3QEMA 3PD0A 4E0BA 5KYKA 4WKOA 2G7ZA 4UQPA 4K6CA 5AMXA 3NH6A 1E7SA 2JZOA 3EAGA 3PV0A 4ZAYA 1HX7A 2RH5A 4KRGA 3FSJX 3C1UA 3AF1A 3UFXB 3WLAA 4RBNA 1F7UA 1PT9A 3CMMA 4TMZA 4DLWA 4UE3S 2QZPA 1YOVA 1P1IA 3E9QA 1QLWA 4R9UC 4EG5A 2IHVA 1ZNWA 3EUAA 2PUGA 3M89A 4A8JB 2VK2A 1O6FA 4UBJA 2MIIA 1I9CA 2VC2B 1V6AA 8GPBA 3CT6A 4B0PA 1ENPA 2BEUA 1IN8A 2GBCA 2GS9A 1IZ0A 1XL0A 3GJZA 3D5QA 4O33A 3NVDA 1NDQA 4KQXA 4M8NE 4BFTA 4LFCB 1UPAA 2IEBA 2BUAA 3FB4A 1DELA 4MWTA 3L1IA 3RSFA 1QP4A 2G72A 4KQEA 4QXQA 1P2FA 2FQYA 4C0BA 2NPIA 1GDHA 4ITVA 1TA9A 4JLDA 5A1TA 3NIWA 2EKLA 3ASYA 3I6MA 4N76A 2C97A 4QLAA 1QAOA 2R751 3K1AB 3CR7A 4MR8B 1NURA 3LL4A 4ND5A 1GTZA 1I01A 3TLAA 2NO9A 2R6FA 3TKYA 4DHEA 4PN3A 4MQ5A 4LTDA 4D3SA 3O21A 5H4HA 2OCYC 5L6LB 2XB2A 1N5LA 2BJHA 4YVFA 1J06A 1USWA 2A9FA 4LGMA 4Q7KA 1V3QE 1X7XA 4HSEA 5DYTA 5H3HA 5JTTA 3F49S 1OIWA 1L8OA 4IWYA 2B1JA 1NBAA 2IBTA 1ZD8A 1A5SB 4QVGA 4PVCA 2UUAB 3I1YA 1EFTA 3NT4A 3B36A 3E1SA 4OJNA 2NZJA 4CQJA 1D0IA 1E96A 1J2UA 1GUZA 1YGPA 2ENUA 5HIJA 2WQ7A 1T0BA 1TO6A 5EMLA 3TBFA 5KYYA 4C05A 5FAXA 2B8WA 3CEPB 2WDZA 4HNGA 4U7WA 3TLBA 4A03A 4JL8A 2J6IA 1DBPA 1Y81A 3O3MB 2ZM6B 1GQYA 4F2HA 2OD9A 1GXSB 3DTVA 4N7RA 3C5EA 4TS4A 4WCFC 3VX4A 6GPBA 2OV3A 1PO7A 1L9XA 2W8BA 1DBWA 3BRSA 2WMOB 1UJ6A 1C3OA 2VWQA 1EB8A 2XE4A 2XNHA 3H9QA 1KEKA 5PGMA 1MB2A 1V35A 3PUZA 3PQ2A 4F4DA 4G85A 5C35A 1N5JA 1ZU4A 1RTKA 2W6QA 5FFMA 3JRXA 3VR3D 1LVHA 1XJ5A 2HMAA 3T3MB 1XIVA 1MZPA 2AIRA 3CW9A 4OI1A 4DLPA 4JLKA 2L17A 3IL2A 2P35A 5TF4A 4EY8A 2D1RA 4R7ZA 5C34B 4PG7A 2CUTA 5EAIA 3STHA 4D7AA 4XQ9A 3GAAA 2WAYA 3A6FA 3OZTA 1HG0A 1KDPA 2P6OA 3DZFA 1XQ1A 1L8XA 1U3CA 4MWDA 5HMMA 2P41A 4BVKA 1ZGCA 2WKQA 1P2DA 4CPDA 1IM8A 4JENA 5IJXA 2W70A 3Q7RA 5I5GA 4DBZA 3R7LA 4CIAA 2YFHA 3DDZX 3DD1A 3K7EA 1V95A 2NG1A 2ZTHA 3IXQA 2JFHA 4XCVA 4A4DA 2C61A 2OUIA 1EVJA 3HA2A 3WP0A 2FSIA 3GRKA 3BYZA 1AHIA 4M76B 5G1NA 4KI0A 4ED9A 1QIKA 3BWBA 1E18A 1M72A 5LN1A 3I6ZA 4DLAA 1C0LA 4CF7A 2XTJA 4MVYA 3JQDA 1UMCB 4UNIA 4LSGA 1D3AA 1FP4B 2PKCA 2Y76A 1T24A 3NGLA 4N5NA 3V46A 5KOJA 5F9FA 3FBGA 2H8GA 3G5LA 3K0HA 3M3HA 2OHIA 5DNCA 2OZPA 2AN4A 1S4QA 3HWSA 4DYDA 3EFOA 5B1DA 1RZRD 1K2WA 2VRCA 5SZKB 1R50A 1CRWG 5FA8A 2C03A 1XQ6A 3BFXA 4MUIA 4XJXA 5CT5A 1DAOA 3FIJA 1P0QA 1Y1TA 3GDOA 4IVRA 3L7JA 4MRPA 2F9MA 3MD9A 5DGIA 3RC7A 5AKJA 3NALA 4NE7A 3N2YA 1M74A 1S8NA 3N2GA 3P5SA 2ZTMA 2YV1A 5D3ZA 3MS4A 3DDHA 4FW8A 4D4HA 5JALA 5P8WA 4BWYA 1QRUA 3RGWS 4BCCA 5I7EA 3ZJTA 4MS3A 3LF1A 2CD9A 3HKCA 4NHEA 1WCYA 2YNMD 1RKXA 3QUTA 2XEXA 4QYMA 4TTIA 3TEJA 3V42A 3AR5A 3DEKA 2HGZA 3M81A 1Q7GA 2WVHA 4RVUA 2CXOA 1SB8A 5F5LA 3S1LA 2IU6A 1MEOA 2KPOA 3FSGD 3PUHA 3PXCX 4HGNA 1QH9A 4O4JA 3D0QA 5COBA 3QEAZ 1UBCA 2ZJ2A 1NOIA 2D4HA 2DTDA 2ODTX 2WK1A 3DMYA 5E3JA 1EE2A 2NO5A 4I4CA 5DM2A 1LF0A 3W5HA 4DC1A 3VR0A 5A3QA 3P4YA 3UT5A 1ZYUA 2Q7DA 3LX4A 3J81k 1UBRS 3QKSA 2QTLA 2ZIXA 1VLHA 2OZLB 3A9VA 1TAUA 3I8XA 4XQGA 4J0GA 4JLWA 4PC6A 1J20A 2FZ5A 4KPGA 1TPZA 4RIHA 2CVHA 1Y1PA 3BCHA 3HCPA 3U40A 3HJFA 3F90A 221PA 3WZ2A 4KMOA 3MK31 2HJWA 2JAUA 3MWDA 3SIPA 1JIXA 3MVEA 4JD5A 2FZGA 3BXZA 1ECGA 5CVJA 1WX1A 2V4MA 4HNUA 3AJ8A 4Q4AA 2C99A 3TXAA 1THGA 4AJNA 1P1CA 2QVZX 1U63A 4MV4A 2ODAA 3SYRA 4Z4QA 3BJRA 4WVFA 4O6VA 4WSOA 2LTAA 3M33A 4R0MA 5CA0B 3H6GA 2FG6C 2P9GA 3CJQA 1J0CA 1SCNE 5PNTA 3L46A 4HEA6 2FEPA 1J7JA 1II8A 3STTA 4M9UA 2IZZA 1N36B 2A94A 2DHDA 2OYSA 4D6XA 1L7XA 3ISJA 3AJRA 3PHCA 4IJWA 4II2A 4YMHA 1R4MB 4IGFA 3A6HA 3HI4A 1ZUWA 5LBIA 4C6TB 1GPUA 2CBGA 2M6KA 3GEEA 4E08A 3LDFA 4XIGS 3N6VA 1HG1A 1BGXT 4F5DA 3B38A 1PNTA 4FJ1A 1V4VA 1Z25A 2P0EA 1LLDA 1OVMA 1M6VB 2J30A 3N39C 3CX6A 4C5BA 4CEHA 3L9XA 3TCXB 4LHSA 1ABEA 3QX9A 4NOMA 3IQZA 3SXUA 1OR8A 2D2XA 2Y77A 3C6KA 1BEUB 2IYNA 2O54A 1RPNA 2EP8A 2JI4A 1X1QA 2ATEA 3VNSA 5F77A 2OGTA 4DIUA 1K86A 5IFKA 1A8QA 4MPPA 5FTMA 1P9RA 4G4IA 1VGVA 2OILA 3D6JA 4UUOA 2GEFA 4FYIA 3HO6A 2BEVA 4QM7A 4L22A 4ITRC 1KRHA 3MUOA 2PS1A 5A5DA 1RSZA 1LW6E 1RWWA 4NESA 4R1UA 2JLXA 1NMSA 2CKMA 3NEPX 4M0DA 1MJGM 5L7TA 3I1FA 2I8LA 1RAFA 1T4CB 2LCFA 3LI2A 4KMSA 4G23A 4CM9D 1AJEA 2ZP1A 3IO3A 5MN5A 1ZLYA 3AV0B 3CE6A 4DXAA 4RKRA 4WA7A 1NNLA 5CA0F 3JQ9A 2ONYA 2VXOA 1EUCA 4HNRA 3DPUA 2D5LA 1D7OA 2PKYX 2VSOA 3QLUC 4R2IA 4XI9A 3TX6A 4EKDA 3C70A 4X24A 3LTNC 1KJIA 2C2MA 1C5KA 2NT3A 3PT5A 2PU7A 2G67A 4JJ8A 2KSQA 1Q1NA 3JCZA 3MS2A 1N7JA 2CEKA 2VEOA 1NVVQ 1NRXA 3PSAA 4OHZA 5LWHA 3RYCB 4MRVA 2QRVA 2OGUA 3JWEA 4I5FA 4XGNA 4Y2GA 2G82A 5IP5A 2OBXA 1MO4A 4G9BA 2VJKA 1YBVA 3JS5A 1WZNA 2X15A 5KSWB 3AF5A 1YUMA 2AC4A 4OKIA 2IE0A 3CINA 1X1TA 4HLDA 1SBHA 4IV8A 4K9KA 3LS2A 3NP9A 4V0QA 1TZMA 1PV1A 2A9RA 2O3JA 4NPHA 5KTKA 4GOLD 3VPSA 4PCAA 4M0MA 3KQYA 2QLFA 5JVDA 1XPRA 1A1VA 2HK6A 3PEEA 1DMSA 3IHLA 1CEQA 3NP7A 4AMZA 5IAEA 5LQUA 3ZZ1A 3ORFA 4ZXFA 2BIFA 2VRBA 2P30A 2OV1A 2IELA 3ZWOA 2H7YA 1LDYA 3AUTA 2MYUA 1UBUS 4JROA 5L4LA 1XZDA 4RZUA 5JAIA 1NRIA 3G0CA 4Q4CA 4WZAA 1J09A 4HQLA 2UZAA 4BKMA 1RAAA 4B6RA 1BVHA 3NHLA 4L3VA 2DLDA 3L5OA 4E5YA 1GYRA 3JVVA