2FP3A

Crystal structure of the drosophila initiator caspase dronc
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
293
structure length
254
Chain Sequence
ALTPYVGVVDGPEVKKSKKIHGGDSAILGTYKMQSRFNRGVLLMVNIMDYPDQNRRRIGAEKDSKSLIHLFQELNFTIFPYGNVNQDQFFKLLTMVTSSSYVQNTECFVMVLMTHGNSVEGKEKVEFRDGSVVDMQKIKDHFQTAKCPYLVNKPKVLMFPFASTNVPSLADTLVCYANTPGYVTHRDLDTGSWYIQKFCQVMADHAHDTDLEDILKKTSEAVGNKRTKKGSMQTGAYDNLGFNKKLYFNPGFFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and activation mechanism of the Drosophila initiator caspase dronc
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolysis/apoptosis
molecule keywords Caspase Nc
total genus 76
structure length 254
sequence length 293
ec nomenclature ec 3.4.22.-:
pdb deposition date 2006-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fp3A01
1M72A 2H51A 3NS7A 3PD1A 3E4CA 4JQYA 5IAKA 2C2ZA 4QUGA 2H48A 2H5JA 3K7EA 4N7MA 5IBPA 3S70A 2H5IA 2CJXA 1NW9B 4I1PA 4AWBA 2H4YA 4FGUA 4JR0A 5IAGA 4PRZA 1F1JA 4QU5A 4FDLA 5I9TA 4EHFA 2XYHA 3KJFA 4I1RA 3GJRA 5K20A 1RWWA 4N6NA 5IC6A 4EJFA 5IABA 4QUEA 3GJSA 3R6GA 1RHMA 1NMSA 4EHAA 3ITNA 3D6HA 4JJEA 4LSZA 4NOJA 1SHJA 2K7ZA 4JJ8A 3NR2A 1NMEA 5LU9A 1I4EB 1GFWA 4ZVUA 4EHNA 2CNNA 2J33A 4JR2A 1RHJA 5IAEA 4DCOA 3SIRA 3IBCA 3H13A 2CJYA 2HBRA 4EHKA 1QTNA 4QUAA 2XYPA 4N5DA 5IASA 1BMQA 5IANA 4QU9A 3EDRA 5IC4A 1RHQA 4QTYA 2DKOA 3R7NA 3R5KA 2QLFA 4JR1A 4D3XA 5LUAA 1RWNA 3PD0A 4ZVQA 3R7SA 3D6FA 4AW9A 3DEKA 3IBFA 1QDUA 4PRYA 3SIPA 5IBCA 2XZDA 5LUBA 3UO8B 2Y1LA 2CNOA 4N6GA 3V3KA 4FXOA 3DEHA 3NKFA 3GJTA 2H65A 3QNWA 4ZVRA 4ZVTA 3V4OA 2HBQA 1RWOA 3H11A 5IAJA 3V6LA 4NOLA 1PAUA 1I3OA 4NOKA 3BIJA 1F9EA 2Y0BA 5IARA 4QTXA 3H11B 5H0IA 1SC1A 4QUDA 5JFTA 4PS1A 4DCPA 2P2CA 4NBNA 4HQRA 2C2OA 3V55A 3KJQA 3R7BA 1RHRA 2FUNB 2H54A 2CDRA 3UOAB 4EHDA 1RHKA 1PYOA 1SC3A 4D3YA 4AWAA 1NMQA 4N7JA 1I51A 4NOMA 1RWPA 2QL5A 3D6MA 3R6LA 4HQ0A 4IEFB 4QUJA 1RWXA 5I9BA 3S8EA 2CNLA 5LU8A 1K88A 1JXQA 3KJNA 2AR9A 2HBYA 2J30A 3P4UA 4FEAA 4QU0A 2QL9A 3P45A 1RHUA 4HVAA 4N6OA 4NBLA 4NBKA 1I4OA 2QLJA 3DEJA 2FP3A 3EDQA 3OD5A 4EHLA 3H0EA 4IYRA 4ZVOA 3R5JA 2FQQA 2NN3C 2C1EA 4M9RA 4ZVSA 1GQFA 1QX3A 5IBRA 1RWMA 3RJMA 4ZVPA 1IBCA 3V4LA 1RWVA 2H4WA 2XYGA 2C2KA 4EHHA 1ICEA 4QUHA 3GJQA 2WDPA 3H1PA 2J32A 4QUBA 4JQZA 1CP3A 1RWKA 2J31A 4QUIA 4D3ZA 4QULA 1CVRA 1RE1A 2QLBA 2CNKA 3PCXA 4JB8A 4JJ7A 4PS0A 2XZTA 1SHLA 4QU8A 4DCJA 1KMCA 3V6MA 2HBZA 1SC4A 2QL7A 2C2MA 3DEIA 1K86A
chains in the Genus database with same CATH superfamily
4LCBA 1M0SA 3R09A 1Z3CA 2HXSA 3C48A 4G3XA 4WLFA 1G3IA 1JEEA 1OZ0A 3WY9A 2A8YA 3KJXA 4LWOA 2A9VA 1JEAA 3ONWA 2IBSA 1R6BX 5HBGA 1Y82A 1MO4A 3I61A 2N47A 4C4RA 1IAQA 1RI1A 1WMBA 1VRVA 1TMKA 2OHOA 2NO7A 2SECE 3BTSA 3DL0A 4Z3DA 3P0JA 1XXHB 1WETA 2DR3A 4JI7B 3FWNA 4A0GA 4JK3A 4UEKA 2XDQB 3RYFB 4ZK6A 4RMJA 4JITA 2QUZA 4LHWA 3TQHA 2O2ZA 4PYNA 1J90A 3WNVA 3H2JA 3WZLA 4YUWA 1LEHA 3FOFC 5K3CA 2IEGA 3HADA 4OIMA 3BA1A 4XWWA 4WLVA 3Q8MA 2PX0A 1EK2A 4PN3A 1QZTA 1ZM7A 5EYPB 3MRTA 4XFDA 2EKQA 2MR5A 1E4EA 3MLBA 2OYCA 1WD5A 821PA 5G1PA 2DBRA 4HH1A 4XRRA 2GD2A 1EVYA 3NHUA 5EXTA 1YZGA 3N5CA 2PZGA 2EJWA 3LUGA 3MZ0A 3DJFA 1RQPA 2CNWD 4Q34A 1GL3A 2IXAA 2R5FA 4O1HA 4PZZA 4RA6A 3C4VA 1YI0A 5D1HA 2Q6OA 4LFBB 5FUBA 4V0ME 2YV5A 3LT4A 1HZZA 1NZJA 1X13A 2IYRA 1H85A 1E89A 1MQAA 1W1UA 5BMVF 3HU2A 3O2SB 1PG0A 3ANTA 2QZJA 3FWYA 1DDGA 1WOMA 4PCLA 1G6OA 2IHNA 3K5HA 3FBWA 3MPUA 4UCWA 3GGOA 2ZRDA 5K8CA 3BWVA 5BW5A 4C01A 4PC7A 2YTZA 3GC6A 1PS0A 1VCNA 3RBVA 3ROKA 1SG6A 3E81A 3K71B 1G5PA 3NOXA 4JJGA 4ITUA 3WQSB 3FUCA 3UQZA 1XPOA 3ELUA 3FMIA 4KQWA 3GUVA 1QMGA 5HRCA 4YQYA 5K6RA 1Y3BE 4BRZA 2B4QA 4MWGA 3HP7A 1V95A 2HJWA 4E5UA 4GD3Q 2YWHA 1NLUA 1Q91A 1E98A 1R37A 1Y1LA 2XOEA 2NOAA 1OXUA 4OB6A 1C0IA 2ACWA 5COBA 5GJWC 1WVMA 4FYVA 5AVTA 1A4XA 3EEIA 1YS2X 1Y6JA 2YVUA 3MCAA 1C9EA 3UMFA 4EMSA 4YR9A 1DB3A 2RGEA 2ZYAA 4JC5A 3ZIAD 4Q7QA 3NU1A 3ZTTA 1JAIA 4HLQB 2F62A 5A3SA 2QQEA 1COZA 3OEED 3HZRA 2G88A 2LKCA 4ZXFA 3H8WA 2AOTA 3GEGA 2AR7A 5KSWB 3T7RA 1VCIA 2C42A 1CR1A 4PIMA 2SICE 4JC0A 2ZTUA 2BEVA 2W8BB 2O23A 3FFXA 4LSWA 3RVQA 4BEWA 1A1VA 3CWZA 3AF4A 3EC1A 4NCKA 4UZEA 1TPYA 4C7KA 3IHTA 1A4RA 1BH2A 1U0NA 1UDBA 1E18A 2QAGC 3NEPX 3QLUC 1UADA 4LNUB 4MS1B 1MGPA 5CB4F 2CZQA 2GARA 3CB2A 4GM4A 4JJ7A 3SNHA 1IE3A 2FJUA 2W2LD 1VE1A 3EVCA 3FBTA 2PFKA 1X94A 3LWZA 5CA1B 4MGZR 1OIWA 2RHRA 2Z8YM 3DD1A 3QI7A 2FSVA 3F8SA 2LCQA 4KQJA 4YV7A 3JD0A 1DBWA 4QRHA 8ATCA 1XP8A 2QE7D 3SZRA 1SXJB 4EVQA 4C0LA 2P2NA 1IN1A 4B35A 2YHSA 2W83A 3S70A 3K4HA 5JRDS 3HA7A 2GZAA 5DEOA 1MO2A 3PPXA 3ZHTA 2G28A 2OPHA 4XX1A 5EJFA 3TBHA 3NIBA 5FTJA 1WU8A 3ORYA 3Q7IA 5IC6A 1DLIA 1QWSA 3VPDA 3JCZA 1GZHB 2JI6A 2ZAYA 3L4BA 1EQ2A 1V1RA 3ETLA 1Z22A 1XYVA 3IEPA 2WLTA 1Y3IA 1A2OA 2UYQA 3D7KA 2E1PA 3OFVA 4RD1A 4DIBA 2AR0A 4B7AA 4OU4A 4QBKA 4YEDA 3PPVA 2OY0A 3KJIA 5CVCA 4PF1A 1VYTA 4DSNA 5BV8A 2I4NA 2PNJA 2BM0A 3KUCA 3TLBA 2B9EA 3V4PB 4S1PA 1TLFA 4B2PA 5LYJF 4B5KA 1G63A 1OZHA 3T4XA 3T95A 4PHGA 3PEUA 3MB5A 2EZTA 4F4CA 3VSEA 2XTZA 2FXVA 2O6HA 1L7AA 1QONA 2DXIA 1MJFA 1JR3A 4FFOA 1E5TA 3P2KA 3RH0A 1MOQA 1SBNE 1TMGE 1UMKA 4Z1MD 3JAKA 1P4HA 5IJ9A 1W1IA 5MHTA 1PRYA 2DZDA 3D8BA 1XVTA 3T12A 1HXHA 3LFTA 1W35A 3CX6A 1SD2A 1MNQA 1MENA 2GFQA 3DEHA 1EK5A 1IHYA 4QLBA 2VP2A 2FPKA 4BEVA 4CKEB 4EL5A 1JU4A 1IC6A 2XDQA 1KAHA 1HYBA 1E7YA 3MINB 3TEFA 3U3KA 1BE6A 2GCGA 2IP4A 2PX3A 5BQOA 5DRTA 1KOLA 1OVMA 1CY0A 4JZYA 3KZNA 4ND8B 1F4VA 4G0NA 5C31A 1BVYF 1ZVMA 3O38A 2A9FA 5TY0A 1N4AA 4KRFA 1CUCA 2ZYVX 2ZTMA 4RDIA 3DZBA 4K8RB 5FTKA 2XI4A 2OCGA 3QEJA 3VDNB 1MDFA 4PONA 4KAJA 2A9OA 2RHGB 4R8MA 3NT2A 5FJIA 1CUDA 4RWEA 3TZEA 3ZWOA 8LDHA 5K0ZA 5THXA 1D2AA 1EFKA 3BMOB 3AIOA 3NWJA 4M9SA 3DXYA 5A5DA 3ET5A 1AIPA 2R44A 3QVVA 2QG6A 3M6IA 1PG5A 4LQDA 4TSFD 4FYKA 4LWQA 1HE4A 4LUCA 4BFXA 2DM6A 3PFFA 2BI4A 3RBZA 3JR7A 4PSVA 5LYJA 2C5EA 1XQXA 1Y81A 3FRIA 4A2PA 3I83A 3V7UA 2VL7A 2SCUA 2ZRGA 4Y2TA 2ZRMA 1O8BA 2FLVA 2IXGA 3OD5A 1M2VB 1QR6A 1U1FA 3SQLA 1I94B 1XKTA 1DPFA 4Q4AA 4E5PA 4EELA 2E4YA 2ZT7A 2VP4A 4FINA 3LQ1A 4F72A 5TXGA 3KJHA 2QVXX 3IAM6 1WCIB 3F2VA 3KKLA 3CNNA 3SHVA 3H2HA 1GL6A 5AM2A 9LDTA 5SYNA 4OAQA 1P91A 4BVEA 2OECA 1DZ3A 1TF5A 2HDNB 1RI2A 1K3TA 2EEZA 1L7NA 3L84A 4HRVA 3ZDQA 2QOEA 5JSQA 4D9JA 3PNPA 1II0A 4IH4A 4JYBA 2BKXA 3KPVA 1ZBQA 2WIAA 4U1RA 1S3SA 5BR1A 5DYIA 2CXTA 2G6TA 4KDEA 1Z5VA 1XZEA 1A71A 3IUMA 2JVKA 3IERA 4L7QA 5TPWB 4DM4A 1AZSC 1VKJA 5HXAA 4R1NA 1Y3FE 4N7MA 1H3NA 2H7VA 3EGDB 5G3ZA 5J2TF 1DC6A 2IYYA 1N6NA 3TRIA 3IGFA 4BFCA 5JNTA 1OZFA 1P1IA 1ENYA 4QZVA 2V6JA 1KVUA 5HFJA 1NRXA 2FPMA 3EIEA 5T6BA 4CKBB 3F9RA 4Y18A 1FBTA 2F00A 4QUEA 4ZDIA 1EAMA 3FVVA 2VF4X 2RB5A 3ZLJA 1E5QA 3KHTA 3ONDA 2VCYA 3DZCA 1BFKA 3KU1A 4JWKA 4WA7A 2C4WA 3LP5A 2JLXA 1JHPA 1G1AA 2Q2WA 3R9WA 3EYAA 4OP1A 1C81A 5DULA 5LZ5A 5F7OA 4M1KA 1T91A 3L04A 3I4CA 1L5GB 4JYPA 4TWAA 1KC1A 2NXEA 2PKWA 4OHKA 4IQ4A 5ETJA 5EPOA 1VCMA 1JBKA 5TE9A 1XP5A 3OCJA 3DBVO 4P7JA 3IJEB 4IMIB 4BNVA 3ZZTA 4B6QA 2R5NA 1MIOA 4FOOA 3TNFA 4X0EA 2OO5A 3A8TA 4HYYA 1KJYA 4JIMA 3TM4A 3HUDA 2DWUA 1GQSA 3E3NA 3K6SB 1I4DD 1WB4A 4ND2A 5DTQA 1FX0B 1MR3F 2C7GA 2P6OA 3OIGA 4MW9A 5J1SB 2FKAA 5CLJA 3HXPA 5JATA 1JN0A 3HNOA 4AMGA 5BPHA 4FGLA 1RKBA 1RWOA 4W5HA 1SN7A 4LRYA 1Y3DE 4GOLD 3UXHA 1EWTA 2JGDA 2KB0A 3D31A 3RC3A 1N3BA 1GVHA 5CB4B 3WQRA 3ZWAA 4R1TA 2J3JA 2AW3A 4YDSA 4GPEA 1H66A 5FFNA 2RHJA 3WMGA 1AY0A 2EU8A 4GFDA 5CIWA 5B7QA 5HUQA 2VZ8A 1SQ6A 3N5KA 3KALA 1QQ6A 4H6VA 1K7FB 3DZ8A 1S96A 1NFFA 3E5NA 3FSJX 3QX8A 1U9YA 1IH8A 4LYDA 4RULA 1EDEA 1ULHA 2H8KA 2XCIA 4LJ7A 4ZAVA 1XJ5A 3N0VA 1H8HD 4BU0A 4PN7A 1XZDA 2VSOA 3I6ZA 1RBZA 2GH1A 1N2IA 3BERA 1H9AA 1QS0B 5EHQA 5DHFA 2FMKA 4I1VA 3QOWA 1PK9A 2O5VA 1TM5E 1RABA 2E4WA 3G1TA 1NI4B 4TLLB 4YMIA 3WRVA 5TEWA 1E6MA 3KR9A 1SKYE 2JGAA 4E15A 4EHLA 3LNCA 4L6AA 2VFAA 2FQYA 4FU0A 4MPJA 4PU0A 4CT5A 2AXPA 4YQZA 2Q5FA 3AUJB 1J0DA 3NBYC 1FUYB 2ZSEA 2J45A 3M6XA 3LBIA 5B55A 2DFVA 2XUQA 3HN2A 3ILSA 4C0BA 2HHCA 5DWDA 1WIWA 2P2GA 3U4QA 2WQ7A 1J9GA 3M70A 3AR3A 3AONB 7ABPA 1GKYA 4YAWA 4HLDA 3FCEA 1JQ3A 3OLZA 4JFRA 4XDYA 1HV8A 1DO0A 3KCQA 4QPNA 4Q16A 4BAUA 1NKSA 3H3JA 5F98A 3BH7A 3O6VA 4X54A 2FQXA 3BTVA 5CW2A 4R2LA 3PHJA 3ZJUA 3IVCA 3B48A 1QBGA 2F7SA 3PV0A 1FSFA 2R87A 4FZJA 4K88A 5HZMA 5ICEA 1WPQA 1FFAA 5IM4A 2IZOA 2P8JA 1WUTA 3G2LA 4AQDA 1E69A 3K7EA 2ZP1A 3AVOA 4HOYA 4EW2A 4F2WA 4KREA 3TTXA 4UAGA 2H4YA 4JI3B 3U62A 1UXGA 2GZHA 3TBFA 4XR4A 4BMVA 4NU8X 3X1XA 3OF2A 4X66B 2OM2A 2Q3HA 2HCTA 4EB0A 1DFHA 3JSAA 1QF9A 3HEAA 2R25B 5EY5B 4POOA 5LMNB 4XVRA 3ZBPA 3RSHA 4X3PA 4FN5A 2FWPA 1S89A 4NZPA 1H4SA 1CUJA 2Y27A 4LXHA 3UGQA 3LO5A 2ZSAA 1KI9A 2CNNA 1YCFA 4ZVUA 1FUEA 1ORVA 2XUGA 4BVBA 2XZOA 1SO8A 3HJAA 3I34X 4CM3A 1MD9A 2V6GA 4TT8A 2GPJA 1DEOA 4BWFB 2IQ5A 1PUIA 4OXQA 2HHLA 3KOYA 2HV8A 1QUFA 2JLWA 4NCJA 4QTUB 2K6GA 1IXRC 3HJGA 3T3MB 3VZPA 2EDAA 5JZMA 4JR1A 4D6XA 1XEFA 3ORQA 4TRRA 3HY6A 5ISMA 1VB3A 2IQIA 3JRWA 1OAKA 4RGBA 5HGJA 3R7SA 3SC6A 4I5IA 4NDZA 4LVNA 4C1NA 5L4LA 1QVVA 4W9RA 3OSZA 2XY4A 1ADBA 3PEEA 4OGWA 3RE1A 1M8GA 5F3WB 3SYLA 3LNTA 1HNWB 3QXGA 4ZKEA 3SJZA 3OT5A 3IP3A 1B8OA 3WK5A 4M9UA 2VBCA 2YRFA 1J97A 3HKDA 3Q5DA 3RDPA 2VCHA 4EKIA 1IRIA 2PYZA 3K15A 4BCCA 3IQHX 1U6JA 2IITA 3TPZA 4FYWA 3NUZA 1C3EA 5EP4A 3UGTA 4AS2A 3DXFA 4MW0A 4EGQA 1XXHE 2GZ2A 1YFKA 4NENB 1DEHA 2Q6VA 1EJ6A 3K70C 2C84A 2VSXA 5M7EA 1N2CA 2IK8A 3QY0A 3DF9A 3PRJA 1X92A 1VG0B 2BLLA 2DFKB 3PC8C 4XIJA 5JLAA 2BGLA 3VVMA 5EQFA 4MW5A 2BKLA 5EL0A 2XB6A 2E4XA 1LTKA 1TPZA 3I52A 3EK2A 3FNIA 5D6OA 3V1MA 2O19A 4KX5A 4FEAA 1WDKA 1GR1A 2HDHA 2PQ2A 4UD2A 3R76A 3RVBA 3G6KA 1XRJA 2DUWA 3WSTA 4EG5A 3MOGA 1E9RA 1XDWA 2D1RA 4MVJG 6GPBA 1ZCZA 1GGVA 1YASA 5JS1A 4S1TA 4QFMA 2IY9A 4LCJA 3MRSA 5G0WA 2C00A 2EW8A 3D0QA 4ABTA 4KK3A 4L02A 1LW6E 1GPLA 3AL2A 4HXEB 3BXHA 5E9JA 3TPFA 1E4EB 4P58A 2H8GA 4NYIQ 3LC0A 2YMMA 2Q3EA 3U4MA 4OXXA 2AE1A 1FXUA 3HCEA 4C4OA 2ZOSA 3EVGA 3AETB 4O4LB 2OMKA 1OA1A 1OWOA 2VQSA 4Y6QA 1Z6ZA 3JXEA 1OVGA 1CE8A 1I6MA 2XDYA 1R12A 2ZKIA 4RZIA 4YK7A 4I55F 4MVWA 1UFRA 4Q1CA 3QYPA 1N8NA 3WWDA 2VF7A 5TQ0B 3IULA 1SHZA 4O2AF 3RIYA 1FQOA 1HDEA 4PLGA 3J80A 2NPFA 3SFTA 5KCZA 2OQ2A 3H83A 4JXKA 5K6AA 1J99A 1K08A 4AP5A 3B3JA 4CMHA 3OMWA 4DXDA 1ECLA 3W6PA 4DIEA 2DKNA 4HDNA 3F7NA 1YBFA 4GHWA 1IHOA 1Z82A 4G1FA 4RPJA 1T8RA 4G0MA 4P31A 4AN0A 2BY4A 2HADA 4GBMA 4NP6A 3ND7A 3KU4A 2D4AA 2BOVA 1KGSA 2X41A 4QXPA 4JHXA 4AO7A 5T4FA 3WNBA 3QXXA 4ZZ3A 4U2CA 1RHMA 2M6SA 1Y33E 4PQRA 1KEZA 1M67A 3V8BA 1O94D 5A5VA 4N48A 3NYRA 5JROA 3PITA 5DTRA 2BTQA 3BIWA 1BE0A 3IEKA 3LVFO 1ULBA 1LLCA 1RJWA 1HEUA 1XQ9A 2EX0A 2LDBA 3G8BA 5HIKA 4RTKA 2OUKA 4L8LA 5HIIA 2VP5A 3COYA 2YYYA 5WRFA 3BULA 5TF4A 3ZGXA 3CX7A 5FF9A 4ZEOA 3TLZA 4DMKA 1SQ5A 3BSYA 1ZP6A 2VDMB 4MRMB 3USES 5L9AA 5KI6A 5D6NA 5AJYA 3CX4A 1T6XA 4NX2A 5GZ6A 1IY9A 2VAWA 4EYEA 4EMBA 1PEDA 2FY8A 1JIKA 4C30A 3F8TA 3JQAB 4GH5A 1IM2A 4BKPA 3RAPR 4RTSA 1PJ4A 2XUIA 5AJWA 1NMYA 3AP1A 4FP9A 1OOEA 4JLBA 4N8DA 3DLAA 1CZUA 1UKBA 1F48A 4MQ4A 2QPLA 3SZOA 4BX3A 4OX9Y 1JFSA 5HKAA 1V1JA 2DH6A 1ZX1A 1N1DA 3W6ZA 1U5BA 4FFBA 1ZM9A 2DC1A 3WHPA 1UWVA 3IEXA 3FSGA 1T2DA 5ILQA 2ZRJA 4H0NA 1W52X 4WXPA 3FD8A 2G09A 3L7IA 3ABOB 4GRAA 5AIAA 2IZ6A 3ZI0A 2GASA 3FDFA 3X1ZA 1HQYE 4LOKA 3DMTA 4RYDA 2QVGA 1EM6A 1NULA 2H54A 1X1QA 2ZTVA 3VPFA 4FYIA 5B2FA 4EHNA 3FSRA 1B0ZA 1CQXA 1HTBA 3FUUA 4HQ0A 3V8EA 5CDFE 1ABBA 4HEHA 3PRHA 1M1UA 4OJMX 5CB6A 2XRYA 4TOIA 1ODFA 3ZDDA 4F5DA 4PG6A 3P45A 3VJMA 2XVAA 1EUCB 3UWMA 4F6RB 1Z36A 1KQGA 2ZYUX 4HVAA 4OGFA 4EM6A 1IJEA 2OD2A 1ZI6A 3FZEA 1OBHA 4G24A 3M5WA 4XVQA 2AH5A 2JIOA 4RA9B 4FUTA 4NK4A 4OHPA 1SIBE 2X0NA 3HPRA 2JCGA 3H5WA 4H31A 4AKGA 5HOEA 5E7IA 4H17A 2WZQA 4Q3CA 4CM5A 2VDRB 4EQZA 1PIWA 2X1VA 3CF2A 4NR0A 4Q1FA 2DFLA 4F1JA 2PRKA 3SFZA 3NHMA 4L08A 4NY1A 3RJMA 4G0VA 3H9UA 1BOFA 2ZYRA 1G3QA 3V4LA 4EW6A 4DQUA 5HOQA 1GYRA 1OUMA 4P5PA 4ZCMA 3KO8A 2J9FB 3HKCB 2IPMA 3JRNA 3H1PA 4TV9A 4XGQA 4CL0A 1ONPA 2BMWA 4DA6A 1EXDA 3VAZA 5HDBB 4D8XA 1YS1X 5HKOA 1YRLA 5IX8A 3FYUB 2ID7A 5TDHA 3JD3A 2E82A 1P2UA 1NIJA 3VU9B 4BNGA 2ENWA 4XARA 1E3JA 1K86A 4W5QA 1EX6A 2Q07A 4ND1A 4XI9A 1ZMRA 2JLVA 4MAMA 4QHYA 1ZA2A 1NRIA 1NXOA 2H48A 3OE5A 1PNRA 2QZ9A 1IFXA 4NZ9A 2VKQA 4ISBA 4UHDA 3STVA 1ZJ6A 4ZYZA 1AKRA 1F1JA 2ST1A 3NC1C 3OCZA 2PY6A 5FWXB 1DUIA 1SUBA 3BB4A 1AS2A 3DAGA 4WEOA 2GHTA 2H7YA 5K20A 4MVJA 1QV7A 4RQTA 2XKKA 5JI3E 4YVFA 4A6DA 1VBFA 4L0DA 4W1SA 4K9RA 1YZHA 1OQAA 4FDUA 4BUZA 5CAEA 1RAHA 1TUBA 1KI4A 3PE4A 2B61A 3BRWD 4O63O 4UTVA 5KJCA 2OBYA 3T5PA 2WQZA 2ZRNA 3O3NB 1CUAA 4GX1A 4OSPA 3KAKA 2YJZA 5DT2A 3V4ZA 1Q92A 3S99A 1UM9A 4KPFC 1FEZA 4JVLA 4OUDA 3RC7A 4D8VA 2CD7A 4OHCA 5K0FA 2WBLC 3NV9A 2F4VB 3DEZA 3W4JA 2Q27A 3HZHA 1SXIA 2W6PA 1ISHA 1BMQA 1SBZA 2WZCA 3RTDA 2JGLA 2OVBA 4AJPA 4CG3A 5M34A 1GTMA 4TTAA 1ZSYA 3JARB 1BCRB 4QVIA 3RT9A 4CI9A 1H2WA 3P9ZA 1EGQA 5K09A 3A6ZA 4FK8A 3VKFA 2ZM6B 4HG2A 4IXMA 3KKMA 2AF4C 5DI3B 4QJBA 3UKOA 4TTSA 3BKXA 2OBLA 5AK4A 1TUGA 3EVTA 4XPZA 4L85A 2PH5A 5ECGC 4HWTA 2PT9A 3UTDA 1Z2AA 4P83A 2HQBA 1DWUA 3NHWA 1F60A 1WMEA 1CFJA 1XMVA 3UMRA 3AF2A 4Y3UA 4HL6A 4F5EA 5I7OA 1GILA 5HZGA 1SHTX 1VZ2A 5E3HA 2JLZA 1JIQA 2HB6A 4BZPA 1EINA 1X7DA 3I6MA 4I50B 4JLPA 1J23A 2Q5LA 2XGOA 4UUOA 2V0GA 2WUGA 4NULA 3K20A 2E89A 2VUHB 3NB0A 4KWTA 3GXBA 4AWAA 4MVJP 3LLSA 2P41A 2Y4NA 4OI4A 4MI1A 1UZUA 2VDWA 1T4MA 3SYKA 1GXSB 2BHRA 4G0ZA 4KMOA 2RIPA 2PLNA 2UYHA 2ZYGA 4NMXB 3TKAA 3HJTA 5DCLA 1G8MA 4ETIA 3W7BA 1WHSB 3R6WA 4M60A 5ABPA 3AUTA 2FP3A 3N70A 4HI0E 4X64B 1PR6A 2J0EA 4JL6A 4RV4A 9ATCA 4BLWA 2W48A 1IK6A 1VYHA 1IY0A 1JH8A 5FBWB 1NNSA 3K0AA 2X76A 3CCCA 1MCZA 1YB1A 2VHQA 1TB4A 3FUXA 1E2HA 3KKPA 3LPAA 4TKLA 4YS6A 3PUHA 1P6UA 4B8WA 3QH4A 4DWWA 1CF4A 1SKAA 5ES4B 4F0JA 1GZ3A 1DXOA 2JI4A 1YAHA 3QHPA 4DUPA 1RYBA 1LPOA 3OTIA 4B4OA 4MYDA 1R3DA 1XCGB 4BO9A 2X5KO 1P81A 3PJDA 5C80A 5K3DA 5THKA 2YN2A 1QPGA 1C80A 3LHIA 3N28A 4PFSA 4E5SA 5HGXA 4D4LA 3CZMA 3H7AA 3IKJA 4JKIA 3RQIA 4ZPJA 4FDMA 3NTVA 2PWBA 4HUJA 4DL9A 2NSDA 5G40A 5HUHA 2VHYA 2ISSD 2AS0A 4PLCA 3EHDA 2F6RA 3AH8A 1N2GA 3GOHA 3QLJA 4MUNA 4UPVA 4ZVKA 2OP0A 2ZB4A 5AW0A 4DV0B 2B7BA 3AJ9A 4I5EA 3U5TA 4NZZA 1LF5A 2BZ1A 3CLKA 2Q8PA 3EW9A 2DP4E 1A4IA 1EK0A 4YP1A 4FGUA 2C96A 1EVQA 2ONKA 3IC5A 1AB6A 1RQXA 2AZMA 5FNVF 3U7GA 4OVKA 2Q6KA 3ZDBA 3E82A 3I9V6 3Q40A 2B37A 3ULKA 1BHO1 2OXFA 4KV9A 4MEJA 4YAGA 4PQEA 3M1LA 2A94A 4KAXA 2WNIA 1NVEA 2PZFA 3ZDRA 3DKPA 3EODA 5C8DA 3GU3A 4CKWA 2EAUA 4IO0A 5A2GA 3TKYA 3PTLA 2ECQA 3NHZA 3KXLA 2G4VA 2DBVO 2TECE 3ON5A 3WB1A 3RSZA 3E7PA 3KETA 1N8TA 2GBPA 2RG7A 4JOCA 1YJAA 2EG5A 5ICSA 2AJTA 1EZ4A 1KEUA 1S2MA 2C3YA 4OA8A 1S2DA 4CKEA 3L7BA 4G5GA 3NFYA 2JGIA 2VDOB 3LQRA 2QX7A 1QOPB 4NYMQ 3ZDYB 4D42A 1XVAA 2IYPA 5K9ZA 2J7PA 4Y1RB 3ACBA 4HGPA 4AJJA 1P19A 4PG4A 4N6GA 3K8ZA 1C9MA 4FXOA 4I4NA 1E58A 4GSLA 4LWPA 1C7EA 4YRIA 4HPJB 5B30A 4JUIA 3OZFA 3H5TA 3K9CA 1I4LD 2QS9A 2FFRA 4OSEA 4KITB 4Y6SA 2QL6A 1PAUA 1W4CA 4NOLA 1JHRA 2Y1WA 4OHUA 4JLOA 4RK1A 4ZAGA 5HYVA 3BIJA 5JMWA 1SUDA 4QTXA 4QDZA 1P45A 4ZP1A 3R0ZA 2AHRA 1VMEA 3W5IA 5HNKA 5BWMA 3LOPA 1PQYA 1KKUA 2GB4A 4M0EA 1DIAA 2BMFA 2RJ3A 4BFSA 2WFAA 1K1EA 5IASA 1MKYA 2C83A 2HJVA 3H3FA 5C8YA 2H4XA 4C78A 5LU8A 2QKYA 1EG2A 3O4VA 4BVAA 3C5CA 1H9CA 2XODA 2IDMA 4LJ4A 4TMWA 1CNMA 5L3SB 5AJHA 1BMFA 3ANYB 1KI3A 1U31A 2ZIGA 4PE5B 2YC4C 3U2QA 2RGAA 4MQEA 4DMCA 2N9UA 3T5GA 1FJGB 2QM7A 4FHCA 1D1PA 4J16C 5LLSA 3I23A 2W2MA 5KHLB 4D81A 2MJLA 4GR9A 1MIHA 5AKYA 3OJLA 4ZI7F 5IJWA 1G64A 2HSJA 4O4HF 2WSSD 2GN9A 3W5CA 1VHWA 1JJIA 5KKAA 1ORTA 5HJ5A 3V4FA 4YCLA 1FSSA 3GLFB 4DV7B 2G8LA 1JPNA 3E2MA 3NJRA 1QB8A 5T6MA 4E7OA 3FB1A 4RTJA 3FPJA 3TH5A 2Z09A 3EBLA 3LRTA 2C94A 2NO9A 1HT1E 3I9LA 3H1TA 3PDIB 4G1MB 4JC8A 1NGSA 4X24A 3WJ7A 3D59A 1N57A 4RH0A 1QGZA 1ODJA 2OB1A 1XQWA 2PTHA 1M8KA 3C39A 3LXUX 4QVKA 4IP0A 3GVXA 4BP9A 2XBMA 3U4GA 3O4GA 3B36A 4IJQA 4BO1A 4NXMB 1KWKA 3LRXA 1JSRA 2G0AA 2X3FA 3JQ8A 3VR2A 4CHTA 5U1PA 3PTAA 1Z5ZA 2XMDA 2G9ZA 3D81A 4BNMA 1MB0A 4UVEA 3GRAA 1N3IA 4EYKA 4OXNA 3E5HA 3CV3A 4FSXA 1KH3A 3S8YA 4IVPA 4LI3X 2VJYA 4RJKA 5IMSA 1QBKC 3IVMA 2ZJYA 2E49A 3WLMA 4AMVA 3NXSA 1ZYUA 1QC5B 4EW1A 2M98A 3LZ6A 3A3PA 3RR2A 5CFPA 1C7QA 1MXFA 4KWIA 4AUEA 2BMEA 4TTPA 2VYFA 4GZLA 3D4PA 3T1TA 3COZA 3R40A 4TV8A 3ZE6A 1KY2A 1CJTC 1TZ2A 4EHAA 4IILA 1UJNA 1BU8A 3N2GA 3R74A 2V7EA 4QG7A 3VBCA 3VA7A 3CH4B 4GECA 2XB4A 1EXVA 1GFWA 5AW7A 1I2AA 2HLDA 2O0HA 5ERGB 3RK0A 3VISA 2M1XA 3QEOA 2GEVA 2QRLA 3NGXA 3ZV7A 4DEXA 2ZM5A 1JL3A 3CC8A 2BFMA 2DLNA 3R0JA 2HFKA 4YCBA 4YC7A 3VZCA 1OTHA 3QJ5A 1TQ2A 2W70A 3BTOA 4BLOA 1J00A 4P7BA 1AZTA 1C8KA 3VYSB 3RNOA 4BB0A 1OHHD 5LQNA 1NJ8A 4OH7A 4B83A 2EFHB 1RE0A 2WYVA 3DO8A 2B8WA 2I6UA 2C5FA 4CM4B 4J0FA 1JFTA 2WHPA 2Q29A 1NJSA 2GPBA 3DFUA 2JIQA 3L7YA 2V7WA 4G56A 3B9PA 5IBCA 5KWEA 3OM8A 2CDAA 2J3LA 1V41E 4Q4AB 1K4MA 1NPTO 3CINA 3STXA 3ZDEA 4J1TA 3KSUA 1KZGB 3WK7A 3PIRA 1YOVA 3HU3A 1N77A 2A9RA 3KVRA 3I5XA 4C4PA 2YC2C 4L3VA 3DFZA 2WILA 4ME6A 4B7CA 5B1YA 1FYEA 5HILA 5J2UF 4M6WB 5J4VA 4IR7A 4AJLA 3R3HA 2P2CA 5LFAA 2DUJA 3L1UA 3OA0A 4GLJA 1GA4A 1UUFA 2NO4A 3RJTA 2NXJA 1JMVA 3PC6A 4BN0A 3PEYA 2O8CA 2WM3A 4FYPA 4TVSA 1RM5A 2DH5A 5C7LO 2J9ZB 2JFQA 4NJEB 4JVMA 3HGMA 3U17A 1SC6A 4S04A 2XKAA 4A27A 2HPHA 1Z2NX 2HZ7A 3LECA 4OP2A 5I8ZA 5J58A 3O0DA 4FNMA 4ZK2A 4LX0A 2OKCA 2X22A 1RHUA 5DTIA 5DHRA 3PUXA 3EGXA 3OH8A 5TQ0A 4K0RA 1GQOA 1LBIA 2FSPA 3AHCA 1U2ZA 3DC7A 1SRRA 3SQWA 3ZNNA 3U6KA 5F2NA 2VEDA 2BM1A 4KE7A 3ZDCA 1O7JA 1N2JA 1AS3A 2ZTSA 2D2XA 4WTOA 2WTUA 4TTTS 3LSYA 1XTJA 1Z9BA 1QG6A 3PTZA 4Y0AA 5DWQA 1J2YA 1YULA 4RVOA 3CVOA 3RVRA 2W6NA 3EULA 4EENA 4DV5B 4G9BA 4HB4A 4MB2A 3FOEC 3ND6A 1XNGA 2P9EA 5EJ2A 2FMHA 2P3LA 4GKKB 2AN3A 2R2AA 3WIDA 3BD7A 3ZJ4A 2PSEA 2JLAA 5GIOE 3AY0A 1FX0A 5DYWA 2CMKA 2JAHA 1HFEL 2ZPTX 4HYTA 1MEJA 5FI5A 3D3NA 1SCQA 4L4UA 3M6UA 3L2OB 5DTMA 3SLKA 2AGVA 4PYQA 1K4YA 221PA 4RTOA 5CIQA 3L02A 4JJFA 2HHHB 1TZKA 1P3Y1 4DC9A 1IB0A 1ZC3A 3OOJA 2C59A 2CXXA 1JIXA 1U80A 4IPTA 3S81A 2C5HA 3MJCA 4H6WA 4MUJA 2DT8A 1ADYA 1FRZA 1WMSA 4E30A 4BKOA 1WUKS 1OBVA 2CVPA 4BHTA 4RTMA 1ISIA 2ONYA 2YMQA 1XI2A 1NATA 3QE3A 3LWNA 4R1UA 1RYFA 1YU9A 4F4DA 4L72A 4COKA 1VP9A 4B3CA 4YV0A 1I3NA 1RAFA 2GAJA 2Z5VA 1B3RA 8AT1A 2BGTA 3D6HA 1WM1A 2RAUA 3IR5A 2Z2JA 1TIKA 3PYLA 5FKJA 4N1AA 5IDWA 3DBHB 4IRMA 4LGYA 1GVNB 3THRA 4F2HA 2WWRA 2AFHA 3LQYA 1GA6A 2AV6A 4JWTA 3VOSA 4BVKA 4G1VA 3SIRA 1X1AA 4Z8YA 5FFMA 2FWMX 1JWLA 4COOA 1KAOA 1ZH0A 4QL3A 2ATCA 3B6IA 4Y6OA 3BHNA 3ROEA 4D56A 4OHMA 3NETA 4HLNA 4YRTA 5HR5A 2FN4A 1IEWA 1N9ZA 3Q9SA 4EFDA 2WV7A 3QU2A 2E0IA 1P4RA 3BYZA 4KO4S 5JCZA 2OGZA 3WGKA 1K7EB 2V45A 4UVGA 5CEEA 2E4ZA 5JZBA 2C3MA 2O0KA 2KYRA 5B36A 1RCFA 2YHAA 5BUCA 2VNAA 5L4NA 2IW1A 1X1EA 1UFVA 2ZDGA 4DPMA 4MUHA 4JLJA 3W34A 4EJFA 1CUFA 4TMYA 4MRAA 2O8BA 2A9PA 1TKRA 1UOOA 5B64A 2DBYA 4KDCA 2WTMA 4K81B 3NH9A 4U9IS 3GZNA 2FX5A 1GNSA 1YFZA 2ZIFA 1XYGA 2XUHA 3BMOA 4F11A 3RAGA 3VDMA 5NLLA 1N4DA 2WYHA 5H02A 4Q7EA 5JHGB 5GONF 3HBLA 3QOXA 4WAUA 4QDUA 3PFCA 1YBMA 4D97A 3I39X 5I7UA 1CRQA 4WFKA 3NEAA 5H9VA 2VSFA 2RSLA 2SCUB 4MRRA 1GRVA 3VXKA 3O8OA 1XQ6A 3GARA 5TT1A 4AT1A 4C4AA 4RACA 2X4IA 1FMCA 4JX9A 3ANNA 1Q0SA 3REGA 1OYWA 2ZAOA 4K6KA 2FK8A 4AN4A 4CQMA 4DMUB 1HA3A 2G9QA 4EAAA 1IUNA 4TV9F 3ECCA 1IAVA 1ST2A 3GJYA 1V0JA 3S5JA 3IP1A 1TNDA 1U7WA 1XMPA 3TLCA 5TGDA 2YIDA 3O03A 1IZ0A 4RLQA 4QDJA 4YJ3B 1FP4B 4YRDA 4CM4A 3UBTA 1H8HA 1G21E 3GVPA 4N0DA 4TPKA 5TS2A 3SSAA 4Q1BA 5CU7A 3SJBA 4G67A 3SR3A 3B7WA 3LIIA 4CT0A 1AUXA 1J7JA 1DPGA 1H4TA 3LUHA 3EMDA 4DG9A 5IXJA 4AY5A 2OPBA 4MSUA 5FLYA 4GKBA 1JKJA 1XMSA 4MUEA 4PSDA 4QWWA 4UBOA 3EG9B 1PTKA 1E9BA 3LT2A 3WGOA 4AD8A 1G8AA 4B71A 4RHEA 1U8CB 4TLAA 1ZG3A 4AULA 3VO1A 5I6DA 3D8SA 3ML1A 5KTYA 3ZXYA 2WWXA 3A9CA 2V5AA 4PS0A 5BN4B 3LK6A 2XUPA 3IPRA 4FFWA 3W5SA 2IYFA 5IBQA 5ALTA 2IV2X 1K06A 2O9JA 2Z3ZA 4QVGA 3SQNA 5DISB 3UMYA 4J07A 4MMXB 2O7SA 1TM3E 2FR8A 4B85A 1H69A 2QTFA 2ZAIA 1FPQA 3HWRA 3CONA 3H5RA 4H2DA 5CT9A 5D3MB 3WYCA 1P4AA 1O9BA 3ZQ4A 3IVXA 1QHYA 2Z6VA 2H1IA 3OT1A 1EFVB 3N74A 3L0IB 1GTJ1 5F35A 3NNDA 1C8BA 4M8SA 5A03A 1TTQB 4BTEA 5CNMA 3F5DA 3OQIB 3DDHA 3GOQA 2PFSA 3ZH2A 4W82A 5JNSA 2ZJAA 4LSZA 4JIGA 5GPBA 5AJVB 3ED1A 4NMWA 3ZQ6A 1KFJB 3AOEC 3SC3A 5B6IA 3HM2A 2D06A 2FZCA 1OFUA 1V26A 4TV9B 2AXEA 3VDQA 3VKVA 1ZL0A 1E3DA 3FETA 3ZHRA 3AGQA 3JQGB 5DHAA 4OHBA 1GPH1 1ZCAA 3H8VA 3HBFA 4PANA 2Y77A 5HSGA 4HXGA 1R66A 1W4RA 2M1ZA 2ZUVA 4AQYB 1KPGA 2UZ1A 4WY8A 1IOWA 1CQZA 2YRXA 3AHHA 1CRLA 3L6OO 4QFCA 4R9SA 3RUEA 2FEAA 3Q7TA 4MX8A 3T52A 4ZI3A 3G0HA 1G66A 4GM0A 4XVHA 5A2QA 1W46A 4JZKA 1WVGA 1JQKA 4G89A 4QNRA 3N2KA 1PGJA 4EUNA 2PIDA 2UXDB 2XZDA 1U0SY 2HRDA 3OLVA 4UM5A 3RKSA 3ZWBA 2WM2A 4E88A 2H65A 3ENVA 3MNFA 4L8YA 4QLAA 2XCSB 1WA5A 4U3JB 3HVKA 1L1FA 4DUZB 4WSOA 3ZHSA 1XRSB 4KN9S 3EPRA 1CY4A 4Q4HB 4CIWA 4IIYA 5JUWA 2OHHA 1KHHA 4WCFA 3NCTA 1D9ZA 3DO5A 3B89A 3OPQA 3BS4A 5B3LA 1G38A 1XT6A 3DCJA 1GARA 1NMQA 2CJPA 3G2IA 3DTYA 4M7RA 4X90A 4GNRA 1LCIA 5TMBA 5MGNA 4TTVA 3IA7A 2XPCA 1ZC4A 2QRNA 2B6HA 1J5EB 3H19A 3HXLA 3W2EA 3W6OA 4RL6A 1BE8A 3A9TA 2GK3A 2IX3A 3VSDA 3L07A 2PZ8A 1M8JA 2R65A 3QMVA 3RT1A 3TXXA 4C43A 1Y0BA 3V8NA 5HF6A 2O05A 2Q6LA 4RNCA 1QNLA 2RB4A 5BRNA 1LSSA 1K97A 2P5YA 4KO2S 4KRYA 4DCMA 1VSBA 1SZCA 1T43A 1XA3A 1XZIA 3HR4A 4M9ZA 2WM8A 1M1YA 3VHXA 2PCJA 2RDMA 4BFYA 5IDYA 3CNEA 2EKPA 1O57A 1Q1EA 2ALJA 2D0PB 5A9SA 4YBRA 1F8UA 1H4VB 1GPYA 4JY7A 5DLQC 4JQZA 1FBNA 4QOEA 1I7NA 4HLUA 4Z2AA 2RD2A 3PI7A 3ABIA 3EZ6A 3JRXA 4J91A 3VR6H 4FEGA 1UT8A 5K3FA 1LJ8A 1HRDA 4I6JA 2F8TA 4O2BA 1QRAA 3CNBA 3OKAA 2FEXA 3R5XA 2G3YA 2ONCA 2GXSA 1CETA 3AT1A 4XJSA 1VE3A 4GE3A 2J0SA 1C2YA 1NC1A 1KO4A 3S2GA 2WE7A 3QLEA 3OTQA 4M36A 2CSXA 4HGYA 2V5VA 2JAWA 1Z63A 2H11A 1QGYA 4M49A 3H8JA 3ORSA 1RPAA 4N0EA 2UZIR 4QU5A 2VWHA 4J4BA 5D3KA 5I3CA 4KFTA 3C8DA 4F71A 4XSHA 1IATA 1GPUA 1RXUA 1O6CA 2MIIA 4QASA 1DKQA 3KRTA 4JXJA 3JQFC 2JLQA 1JAXA 1KZ7B 1SQGA 1YDMA 5TF0A 3WVNA 5KYKA 3I9OA 1U5CA 2PR2A 4RE6A 3B1WA 3QM1A 2QYOA 1SXJC 5TQ2A 3VPCA 3Q0IA 1QX4A 3D7MA 3N7TA 1ML4A 2Z9BA 1N78A 1Y9DA 4O0LA 3BFPA 3KZMA 4KODA 4NENA 4F7WA 1HG1A 5FO1A 5E1MA 1KZHA 1HG0A 3EAGA 1PZGA 1JDNA 3QXHA 4BTLA 4DCVA 3JYNA 3G2KA 4B7XA 4BJ3A 2C5LA 3TAUA 5L3VA 4XYEA 1K3FA 5AOBA 1GCAA 2H06A 2J0QA 1CRWG 3HKDB 4TSKA 2HSDA 3N6XA 2YVAA 2ZANA 5E6SB 3NG1A 1W96A 1DQSA 4ZJYA 2QUKA 1RWNA 1VJDA 2VHEA 3G5AA 1H0HA 3LHDA 4G0PA 1AKTA 5EZ6B 1JW9B 4DTCA 2OG1A 3LC1O 5BSWA 5LWHA 1BEUB 5E8RA 2Q3MA 4DADA 2CNOA 4DSUA 5EIWA 1EZ1A 2QDKA 1H05A 1TO6A 3TQSA 4YONB 3B6ZA 3H11A 4DRXB 2J9YB 2RGRA 1DT3A 2HU5A 4TLBA 2GN6A 1T0UA 2LCIA 1ACLA 1EM8B 1JDZA 1VMAA 1R88A 3OQ1A 4G0OA 4GI7A 4Y8VA 1LD3A 1ZITA 1J2RA 4NJMA 1KZYC 3FGZA 1P7VA 4XUEA 1JHDA 1AURA 1DAPA 1MJNA 2I7TA 4EJSC 3OX1A 4ZU1X 3SDZA 1JXOA 1BHSA 5I47A 5EEGA 1YB7A 2PH1A 1MG0A 3SS7X 1DBQA 1E0JA 1RJ9A 4ZOLA 4DG5A 3HFJA 4TM8A 3VDXA 1JT9A 1W93A 3DKVA 3EEBA 4AJ2A 2REXB 1P1HA 4F84A 1TLTA 4XYBA 2W37A 3QEMB 2JFZA 4RPHA 2EZ8A 4IXNA 1CEXA 5BXQC 3QBTA 4FX5A 4PPGA 2NG1A 4WZBE 1CEEA 3KWFA 3KR2A 2NM0A 4LCEA 1KDYA 4AY6A 4ROTA 3WYEA 4DMGA 2X14A 3GRKA 1NJ2A 4Z86A 2OV3A 2XADA 3TL6A 1LRLA 4A0FA 1Z3IX 4AWXA 3GDFA 3JWHA 4OK5A 4TM7A 4LDJA 4XRGA 1AQUA 5BQXA 5ALFA 2CXOA 5I4CA 5JAQA 1V37A 1NW7A 1LNSA 4WKCA 2P90A 4WNYA 3UN1A 3V2GA 3IMFA 2ZIVB 4EYGA 2BBOA 2WWYA 2C3UA 5C1IA 5FRDA 1O95D 4XH9B 5LKRA 3SYMA 4Y2SA 4MKRA 3A1NA 3CY6A 1U0GA 1Q1BA 1UKVY 3L7JA 4FT2A 4G8DA 2JHCA 1Z17A 1YZVA 3LUJA 1KDOA 1RWKA 4M9CA 4QGHA 4YI3A 2I4RA 1TU3A 4CMCA 3PCXA 4MWTA 5JIBA 1T8TA 4DIUA 4WXRA 3V4RA 3K9BA 1TAUA 2ON6A 2R96A 2ORYA 1DV2A 2Q7OE 2BM9A 4MR7B 4FR0A 3ZUPA 3IUJA 4HP8A 5DNWA 1OWLA 4CLRA 1FW6A 1N3YA 4UHJA 3DDCA 3OY2A 5F4ZA 1W9HA 3S29A 1XCJA 1X0VA 3WL5A 2ERCA 2DJ5A 2ZE6A 3WLTA 4V0NA 3TJMA 2HPVA 4P98A 1ECCA 2HA3A 2XAAA 4Q6WA 4MVCA 2BV3A 4JT2A 2NTVA 1GV0A 2GKOA 2PVPA 3LCMA 3HKBB 4FE7A 5CX4A 4EY5A 4K6MA 5KSZA 4C2TA 3DGEC 1APBA 3DE4X 4W63A 1GDHA 4LQCA 1II8B 3UWSA 1QHXA 3FKJA 1ZW6A 1WZUA 2R97A 1A7JA 1U0BB 3AKEA 2LR0A 1JYEA 3NBUA 1KRWA 3MPOA 1BZYA 1RZUA 2NWQA 2Z2YA 1UK9A 4QAJA 3UB3A 1DCTA 1R15A 3TDMA 1QHHA 2QG4A 2XNDD 4XGNA 4BLTA 3W5DA 3L06A 4MHSA 1MQSA 1UMDA 1MQ9A 2DUNA 2I71A 4KWHA 4EW3A 3IBCA 4Q39A 2FF7A 2G0NA 3QTBA 1K8XB 1Y34E 2CK3D 1KEEB 2RGUA 4DRZA 3II6X 1W6UA 4P9NA 4O4IB 3LXMA 3FGOA 2PS3A 4ZQBA 4B2IA 1OYYA 9LDBA 3HVUA 2AZXA 4CRWB 2BAGA 2OORC 4I9FA 3VC7A 1A8HA 1CR6A 1P72A 2G8NA 2VJMA 2ZRHA 1OLXA 2W22A 3HFSA 3LCRA 2K5UA 3PQDA 4LGVA 2EL9A 5HM6A 5KINB 5KNCA 1ZSVA 4RHTA 1RRCA 1A76A 1IZYA 1BVRA 1KI6A 2HWXA 2X7JA 4ETWA 5DM2A 5LZ8A 2C8VA 1R6XA 3JWPA 3IUNA 4I8XA 4RPKA 1P17A 2GD6A 4DG8A 1GEEA 3FTDA 4OJKA 5KNCH 3SSNA 1T29A 1G0NA 1WP4A 2WT8A 3B1KA 3FTCA 1FNDA 1QDLB 4IDFA 1YQGA 4IHJB 4LY3A 3UK2A 4EF5A 1E1RD 3P9RA 1KAEA 5KDLA 2FSHA 2H1HA 1K5GA 4XYGA 4RA9A 5KYWB 1WOYA 3M6VA 4WHMA 4MVJE 5GADl 4FKZA 2WTAA 3SYRA 1OI2A 4M76B 3BFVA 3R3WA 3JQ7A 1NBME 2XUOA 4GOJA 3NWPA 3CSDA 4Z4EA 4URHA 3MHPA 4D5GA 2XWQA 2KQUA 3QA3E 1L4HA 3BA6A 5BUQA 4C14A 3P9NA 5JAPA 2G63A 3DOUA 3LLVA 3CJQA 1I0IA 3R0XA 3GW8A 2OT3B 1CYEA 1XRNA 2JK1A 1YT5A 4KUEA 5DTEA 5J47A 2UV8A 1S7GA 4RVGA 4P3YA 3V1LA 1T2AA 1ZVVA 4GEKA 4HRAA 1EGMB 4KO1S 4N0PA 1T15A 2VRNA 3K8OE 3KXDA 3STHA 4RUKA 4N5HX 4RM3A 1KE2A 2I29A 2OSBA 1OFTA 1G9SA 1ICEA 3C3DA 3ODGA 3LS2A 1O87A 5LOVA 1Y4AE 1EJ2A 3DMNA 2P77A 2PT5A 3K8QA 4MCJA 4U0JA 4I1IA 2PO5A 1KE1A 4D3ZA 4HNVA 5T4BA 1RJFA 1FS4A 1YZYA 4AL4A 4BMPB 1V6CA 5DDIP 4ZYTA 3V7WA 3ND5A 2OLJA 4D0RA 1KFKB 1RZVA 1Z62A 4WWHA 3CUTA 1UWKA 4MR9A 5ED0A 4C89A 5CIYA 1A3CA 2AC7A 3IHWA 4WK4B 5CM8B 5JDCC 2WFLA 1Q83A 3QF4A 4CEHA 3DBRA 5C5DA 2A86A 2G04A 3GNTA 1I7LA 3DMFA 3IHLA 2CVZA 3EXG2 1BHQ1 1LI4A 3B78A 4XVCA 4D4IA 4G09A 3HI4A 1Y7PA 4NATA 1OT3A 2YVQA 5AVXA 3L93A 4OF4A 5TB5A 2IBMA 4U2DA 3ZU2A 4WNCA 4JKOA 5BQFA 1ZUHA 1IVSA 1IBMB 4YCSA 3LTNC 1AU9A 4ALMA 4ZYVA 3FPFA 3GNLA 5JVDB 4MQBA 3YASA 1UKEA 1E2KA 4S0XA 3BZWA 3D1LA 4Q0MA 4YHBA 4OY3A 2V03A 4NCNA 3TRDA 1TW3A 4Q9DA 3EDCA 1CX9B 3LY9A 2PEYA 2W71A 4KKXB 1C9JA 5F77A 4JI2B 4GC9A 4HDRB 1QXSA 1Q12A 1SKUA 4BMYA 3PNKA 1K0UA 3ZX4A 2HR1A 4DA8A 4OHXA 1DC3A 3UB4A 4NEHB 3IKTA 1FNCA 1GP2A 2J3EA 3IPCA 4H7EA 1R8SA 3HJCA 2W2QA 4O2AA 2VR1A 4X7RA 2WJ3A 1IUKA 3M0EA 4MJ7A 3CLRD 2HWWA 2XEDA 4MW2A 2I2FA 3HFRA 5JFGA 3ZVKA 4RJIA 5GQSA 3JAKB 2J9RA 3T5MA 3TLGA 1RIIA 2VDQB 1B73A 2VHZA 1U94A 4AY4A 3F96A 5ECWA 1L7MA 1VHJA 4A23A 1BGVA 4HO1X 3WE7A 2J09A 3M9WA 5TS3A 2OXIA 2XQVA 2XMPA 3MJVA 4IZ6A 4UUBA 5FUQA 2C2BA 2R7NA 4GWKA 1I7QB 2V4UA 4Q4JB 1M8PA 1WNFA 3OOSA 2BMJA 4IDCA 4M55A 1VPEA 3LBNA 4Z3OA 3QVKA 3L40A 1XPRA 4L07A 3FVQA 2R6R1 4LYJA 1MFZA 1IN5A 2V3WA 4RGYA 1S8NA 1X7XA 3OLQA 3NUQA 3WIUA 2ODEA 2QL5A 1P5JA 1OX4A 1X38A 1XTUA 1B43A 2X0KA 1TOAA 4I3FA 5EXDA 4L9AA 2IU3A 1D9XA 1DP4A 2JD2A 2OHJA 2RGDA 2RIRA 5J5VA 1OXMA 3T9FA 1Z7WA 1RQGA 2HA4A 3F4BA 2C95A 3JD2A 4PSKA 4JVNA 4HR7A 1HE8B 4A5SA 4BXOB 2BR4A 4WNAA 2GXAA 2EJTA 2WRZA 4Q21A 4ZVOA 1OKKD 4FS8A 3HB9A 4Q4DA 1ZRHA 2QZ4A 4EPWA 2JAPA 2DYKA 1JBEA 3QWAA 3UH1A 3DVAA 1Q1QA 1S1CA 2G5CA 2GERA 3AM5A 4I36A 3VNVA 1EGVB 1ZWLA 4KWCA 5CFZA 1Q19A 2GM9A 2VLBA 4WI1A 4X71A 2W4QA 3ZEIA 1DTEA 1PD1A 1VLJA 1R0XA 3JQDA 4ZD6A 1MXHA 5KWIA 4OQPA 1C7IA 1V6AA 1GG9A 1ZZEA 3K9NA 3UANA 1P0CA 2ZI4A 5GM1A 1R5BA 1Y5RA 4A8PA 1L2TA 1L4MA 2WWFA 3TW6A 2ZRQA 3FJOA 3BC1A 1GCOA 2PM8A 3RFXA 1H6BA 2WHYA 1DDOA 3ID6C 3W8FA 1Z08A 3OT4A 1XD2A 4F8YA 1QRSA 1HY3A 3IEMA 1X1SA 3QITA 4QYMA 4FB5A 3CNQS 3D9QX 3QKRA 4UULA 4EJSB 1JBQA 3GCZA 4LVUA 3GQBA 2A4MA 3AKDA 3LWDA 3QW2A 3H5IA 1OLUB 2OLEA 2F1IA 4RZ2A 1IPHA 3DZJA 3GBPA 5DASA 1G8SA 4YAFA 3W7AA 4CFYA 2A0YA 1PK7A 1BMTA 1H65A 1U5BB 1UAGA 2QM8A 4FFBB 1XDZA 5H82A 2ODNA 5F5XA 3T4UA 3GP8A 2XQKA 1U2DC 3M4YA 4DILA 1P1RA 1Q5PA 4TMVA 3H8SA 1KY3A 1ZIXA 5DO9A 1RW4A 3ZHOA 3ZS8A 3VMFA 2GK7A 2XGMA 1RVV1 3FFBA 2V55B 1I2BA 4QEDA 5FULA 3LP8A 3UV7A 1NI3A 4P7FA 5CP8A 2Q1SA 3SEAA 4BC1A 5A7FA 5IU6A 3HZOA 4HNGA 1YVPA 5IT0A 2QLFA 2QTNA 3QYAA 1OTYA 5EZYA 3AESB 3VVBA 1N6IA 4MKGA 3IE0A 4EGCB 4L22A 2PQ6A 4Q9IA 4C6TA 4JUFA 3L01A 4B6SA 1JECA 3HDTA 2P4EA 2I54A 5IUJC 1NLMA 3WLAA 3IVAA 4RKQA 2ATXA 4W8HA 3WLIA 5E1OA 2HGZA 1RLJA 1A0OA 1GGMA 2Q4BA 3EVEA 2BKAA 2JHGA 3EZNA 4IDOA 4MV0A 1I1QB 2XE6A 2H18A 4ZO8A 2V3VA 2V7TA 2Y3IA 3ICPA 4ESEA 4EJ2A 5ALYA 5K2OA 1JH9A 4DC1A 4EA8A 2MYUA 2D7CA 3CEJA 3N3AC 5I9IA 4X1KA 3Q7RA 4LMRA 1RXCA 4MV9A 4RADA 2B78A 1SZPA 2NU9A 2PO7A 2RGBA 4RTLA 2X1MA 5EJ9A 5H0IA 2ECFA 3LPMA 3GUYA 4J7AA 5JD4A 4QQFA 3RVPA 4M83A 2OCXA 3U5ZB 5KC8A 3W9YA 3AWIA 7ADHA 2FUCA 2KWIA 1GTZA 1UDAA 1YIAA 3R75A 4HGRA 5IPFA 2ZWMA 3GEBA 4IGAA 1WF6A 1QCYA 1X0XA 1BE1A 3GRYA 3WLLA 3WWOA 4YT2A 3SK0A 2PMFA 5FR1A 2B1JA 1Y4UA 4L8WB 4PYMA 4QNNA 1E9DA 4Y2QA 3T4PA 1RRMA 4YCCA 4YUXA 2PUEA 2RHHA 4ZV9A 4DKJA 5IDVA 2VVTA 2AW5A 2C77A 3EMVA 3FOWA 5IUNC 3HO6A 2AG6A 3EGWA 2JZCA 1R4MA 3I8OA 1UPAA 3HYCA 2NN3C 4QQNA 4KVFA 3LKZA 5CNJA 1OGIA 1EUDA 3CLSC 3RRNA 2OLKA 3LK7A 4D3FA 1GQYA 4C0QC 4LZPA 8GPBA 4RELA 4ALKA 1XWIA 1K7XB 2GI4A 2NV0A 4C04A 3PC3A 3GR6A 2ADOA 2JNWA 2JAQA 3OOHA 5JBNA 2A4KA 3LHKA 1JEJA 4DCCA 1B23P 4X5OA 1GNTA 2AQ8A 2YXNA 5C4MA 4JLWA 1BIFA 1E0KA 1JQAA 4RTNA 4I55B 2X58A 4NLLA 1A5TA 1KAGA 1YBVA 3RRBA 3T7CA 1GZVA 4NYJR 3ZU5A 5LMCA 4MUBA 5HZHA 1DRJA 2ZBUA 4OOEA 2P91A 3AVQA 4WY2A 3U48A 4Z4CA 4PYIA 1UC9A 2A0KA 1IZ7A 1E96A 1W75A 1E3LA 1H2FA 3C6BA 4U8GA 3ESDA 2AJCA 4WOPA 1BG6A 4XDGA 4L0CA 1BS2A 4ZAWA 4X3CA 4CFZA 4B80A 1XF1A 4WK6A 3KDAA 3VTKA 3LV8A 4BQPA 5CEJA 3MD9A 4L8GA 2VDUE 2H7CA 3ZIUA 1Z6XA 3OX4A 3H86A 2C9CA 1FYXA 2ACKA 4UZSA 3ZYCA 4QOFA 3A2MA 1NBOA 1HNNA 2RGGA 1RC8A 5FTMA 3FF4A 2B1RA 2HU2A 5KX5F 1BQEA 4B0OA 2G77B 3LA8A 2AMFA 5B6JA 3L8DA 4CF7A 1I01A 2X1HA 5JWRA 1IBLB 2WWHA 3PVZA 3FHTA 4UQPA 3PVSA 2QRGA 4DV4B 4BZWA 1IYZA 4QU9A 2KBEA 1AKNA 1I3CA 1Z0AA 2HC9A 2OVFA 4P34A 4UARA 2C3OA 1Z6QA 3I9MA 4M9QA 1IWBB 1PNQA 1OPXA 3COSA 3U81A 4BNZA 4IDPA 4Z99A 4RXMA 2XITA 1WZEA 3CO0S 3ZE2B 2H7XA 1MRZA 4GF5A 5I7RA 4B47A 3Q5EA 2BDUA 3ZK9A 3FCYA 4HN4B 4BLSA 1U3VA 2VF5X 1SU8A 3DMHA 2XVYA 1QV9A 4GPBA 3LOUA 5DV9A 3F47A 1L4BA 4RPCA 4DR7B 5BPFA 1EEHA 2JJYA 1IZ8A 3K4PA 2C8LA 1R4MB 3FDZB 3Q0TA 4R05A 3QKSA 1QTIA 1H3EA 3CEMA 1DE0A 1BKSB 4KQ2A 5TGZA 3OM0A 4REMA 3RU9A 3EGXB 1YDHA 5H9WA 1RAIA 5K8VA 2O8EA 4PHCA 3IDSA 1NDQA 2DRIA 4DLPA 1PQ4A 3KXIA 4K40A 3KYCB 5T3UA 3U4QB 3RVNA 1CV2A 3F90A 1RRGA 5CD9A 2NAFA 2WT4A 2YHUA 1OILA 3PEVA 3PL5A 1SBHA 4LOHA 4A92A 4C6RA 4Z4GA 4BNKA 4R3WA 3OPYI 4B73A 1I30A 3EC7A 1Y6GA 2HA5A 4E5KA 2HK6A 3FCUB 1XB2A 3TXAA 3ZVMA 2V1UA 3ODPA 3OPXA 3DMYA 1Q95A 1TT7A 2IHUA 1YU6A 2WNSA 3HXMA 1OC2A 1QHSA 2O07A 2OORA 4K9KA 5H70A 1I2ZA 2LTAA 4AZWA 4RY2A 1ABEA 5I8PA 3C6XA 3WIEA 4BVJA 1JR2A 4KUHA 3H1BA 4C6HA 3Q1LA 2I6QA 5IEJA 1AUPA 4G1UC 1JFLA 1HL3A 3DT8A 4N03A 4Q1VA 3ZBQA 3G7SA 5DNEA 2EDCA 5DCWA 3IL2A 3D8TA 1QHHB 4HDCA 1X2BA 2PZKA 3IA2A 4JI8B 4KKVA 1VBNA 2P67A 2WD9A 4DCJA 4A10A 2CHVA 2A35A 2WAOA 1SVOA 1L4FA 3HRHA 3EZ9A 4XEHA 4Y2JA 1IG3A 2P27A 1UCFA 3QNUA 4C07A 1GPBA 1OZAA 2F43A 1VJRA 1XCBA 2XH8A 1CIJA 3Q6MA 5EE0A 3N8HA 4QUGA 3CEPB 1UIRA 4KE9A 4D74A 4DGQA 1XQ1A 3ILXA 3AIIA 3CF4G 5CHEA 1ZNQO 5KMGA 3CKYA 3AG5A 2BZ0A 1SXJE 4FDLA 1H2HA 2PU5A 4Y2UA 3IELA 1MX3A 4RS3A 1VFPA 3MYYA 4ZO9A 1Z28A 1CDDA 3I1JA 3IP6A 1RWWA 1ZIDA 3DOOA 3VSBA 3MAGA 3ZVRA 3AM1A 3K73O 1M0WA 5EXEA 2J85A 3F5SA 1I2DA 2B7LA 5DM60 1KERA 2C2YA 3A27A 3ZDFA 2V1XA 3WSVA 3DZIA 5DEIA 2R11A 5JH7F 3HN6A 4MRSA 1OAOA 3A4LA 4TN5A 2O3QA 2WUEA 5EKXA 2V7QD 4MV5A 3TJRA 4U7PB 2V4MA 2HIHA 3QVGB 1SURA 1NW4A 2I6SA 2JFUA 2VUIB 2WC1A 3QVXA 3Q3JB 5EKUA 5AWFC 3RSOA 1X8KA 4CM6A 4EB6B 5M29A 4XIIA 1HE2A 1HQKA 2AMLA 1QF7A 3IT3A 5JBIA 1KDPA 1E77A 4ZVVA 4DRXA 4RX1A 3F98A 1E9VA 3QX7A 4TUYA 1SB9A 1ZH6A 3NT4A 1P2SA 1UC5B 2YQ4A 4U7JA 5FR2A 4EVRA 1NTOA 5I51A 1FUKA 4F4UA 1JVNA 4C5AA 4TS1A 3DWFA 1U1CA 4YRRA 3TINA 2BGMA 3G2OA 4D1YA 3QSYA 2H29A 4R6XA 1BWSA 3K0KA 3V48A 1GFSA 4GL2A 4QFBA 4RZXA 1DQYA 3G1UA 2HZBA 5CK4A 1RRVA 2VHCA 3G0IA 1AQYA 1CZOA 1R10A 2CVOA 3C4JA 3TSAA 1MO6A 5KTOA 1IOVA 2D2IA 2WF9A 1O95A 5DGCA 1KI2A 4EQ6B 3IBYA 1UK8A 3UMBA 3RS0A 1T5BA 4TWZA 3NM5A 1PR1A 2HF9A 5HE8A 2D2VA 2PKRA 4KMSA 1SR8A 1TJPB 1R0LA 1J6UA 4R1SA 4XWKA 1T9DA 1WQ3A 3CEHA 3DXXA 1C4XA 4UHCA 2ZBPA 3ORRA 5JJLA 1O58A 1KRXA 3MGCA 2V6FA 3RPEA 1AUQA 4NG4A 3GNSA 5EPUA 4DR5B 2QSZA 1SQSA 1BXRB 3D3JA 3FVTA 3R5HA 1RXSA 4P4NA 4KQXA 3I1FA 1WCV1 3KEQA 1FMJA 2OHVA 1GTSA 3KVNA 4EG8A 3QLVC 3LQQA 1H5UA 3VR0A 4AU1A 2WIBA 1DAMA 2NSYA 3EUFA 4JBXA 4MYHA 1I2CA 3RFTA 1QQBA 3BMQB 3HV0A 3K8YA 3D6TB 4RBNA 4XWAA 3AUUA 3OQIA 4IGIA 3VJLA 4EHHA 2YFYA 4M7WA 5TMPA 2Q0QA 4Y1GA 1ADJA 2YASA 2X13A 3EDYA 4KWEA 1KS2A 3K30A 4Q9KA 5DSZA 2SKCA 5TQ2B 2XB8A 1RPJA 4QUIA 1GL7A 1DTWB 2FSGA 3ABRB 1KK2A 3U7EB 3LHFA 2XNDA 1YRQA 3OT1B 3BWEA 4M1MA 5JZOA 1BRMA 1UBCA 2PYDA 3IX7A 2G80A 5CNKA 4QUKA 3NIWA 1IXZA 1L7VC 4YFYA 3GLGA 3F7OA 5DWVA 1HT0A 4KGZA 5FOSA 1S4QA 1SD5A 3I64A 3COPA 1J8YF 3UHPA 4ERNA 1NBEA 2CWDA 5AOVA 3WBBA 4INPA 4QECA 5DW3A 1NFRA 4MZDA 1YZKA 3ER9A 2Q3FA 2AEJA 1QB7A 1DEKA 1R27A 4OJTA 4HV4A 3FROA 4F3TA 3KL4A 4KYIB 2VJKA 4IIJA 4UM7A 2UU9B 4A6PA 1JX6A 1DARA 3AF3A 4DANA 5CFMA 4MQLA 1H1TA 4LF7B 5EZ5A 3IE1A 1CZHA 1GNRA 1BXZA 1W73A 2QORA 1JTFA 4GZ5A 4CMIA 1KBZA 2C2GA 3DOEA 3OY7A 4HN9A 3D3QA 4Y2VA 1LVHA 3B6KA 5KSPA 3VI4B 1G18A 4FDAA 3ST7A 6NULA 3LUBA 3BMNA 2V7PA 4DRYA 2OCDA 4BO5A 4DNOA 4QYIB 2HV9A 2HQOA 3JQ9A 4IRUB 4OUDB 4DJ5X 2YW9A 2JZNA 5EHIA 2FDXA 3KQVA 1TYAE 2Z57A 4QC2A 2WMOB 1GQ2A 3WK4A 4CCSA 3A7EA 5JYEA 4PZ9A 2QTVA 2ZDQA 4IXTA 5DYGA 4BP8A 3CTMA 3H6GA 5BUZA 3BJRA 4FSHA 3RKUA 4NQZA 2H5EA 1UBEA 2F9MA 4RF3A 2UVDA 1IN6A 1I13A 1R6TA 4F04A 5JO9A 2WKWA 3SIPA 4LE2A 3I30X 1FZTA 3RS4A 2IUSA 3U80A 4PTLA 4DBZA 1VZ3A 1P2GA 1JPVA 2DY1A 3KYIB 1WUHS 1L5WA 5D51S 3AM4A 5EXXA 2AOVA 1JR3E 3RAEC 4MO2A 5AKXA 2WTBA 3BL5A 2FZVA 1Y6RA 2OENG 3NUGA 3O93A 2EXXA 3O3CA 4G4GA 4G36A 1FDUA 3MILA 4WN9B 1PR3A 1DQRA 1JQDA 4HADA 4XWGA 4YH1A 4CXMA 2UYCA 2CK3A 1Y8ZA 4HNAB 2JKZA 1NXXA 1IM8A 5L7YA 1XVUA 1W4LA 4PWYA 3C70A 4C7MA 4LHVA 3WYGA 4CDMA 1UL1X 1PVOA 4M1YA 3SG0A 1OBCA 3ND9A 1F2UB 1KRHA 2JA1A 4XJTA 4EJSA 4HQOA 1Z7EA 4LPSA 3E7DA 3BGSA 3PCRB 3AHDA 4V0SA 1WQ4A 3NGLA 2ZYSA 3P5SA 4EJ6A 1RQ2A 2Z1MA 4FLFA 1NURA 5E2BA 5G0SA 2W00A 2QQ5A 1F38A 3M4XA 3GRUA 2BCEA 2HCRA 1KJQA 3OZAA 4LDQA 3S1AB 3ITKA 2VAPA 3O4JA 2UXCB 3WK9A 3D2AA 3O8LA 1CQJA 3U0BA 1LB1B 3I01A 5IXYA 3UG6A 1V5FA 5BWLA 2CV1A 3PQ7A 2DCUA 3AR5A 5LQRA 3C16C 4BNUA 4UDNA 4IUCS 2J3MA 2I5PO 4R83A 4Y9TA 4QT4A 3TMAA 2R751 3ZX5A 5J59A 4CR6A 4E08A 5K0CA 1P1FA 1JIUA 2HD4A 1YBAA 1JDUA 1JDBB 1PZFA 2MSEB 3W79A 4BQOA 4E1BA 3E2PA 2B0JA 3QVTA 4HFMA 3UJ3X 4YRSA 3ZDAA 2CLHB 3EVFA 1WDLA 5DGIA 3TE6A 5FA8A 4PAGA 5FI0B 3ZE7A 2BM8A 2ZK7A 2HFJA 4R81A 2O2YA 2QTZA 2YWEA 3E35A 1YE8A 3C3WA 4LTDA 1HTWA 2ZQZA 2AYYA 3OOYA 1M74A 3QVSA 4UTOA 3UW3A 3ZBUA 1QVZA 2ZE5A 1G8KA 4INJA 4B32A 4B9AA 4BFLA 5BT8A 4BLQA 1DNPA 5C8YF 5K8LA 2LDXA 1E1NA 4KUGA 1GPDG 5F5NA 5JMOA 1G2QA 1BCSA 1T4DA 1EK1A 2EV9A 3VR5H 2P0YA 3DM9B 3VU8A 1LBEA 2AVDA 2CDNA 2H1CA 2N3ZA 1NVKA 4X1IB 4WZ6A 4RVHA 1BQ4A 4ZWNA 3OEEA 2IUTA 4ARZA 1YZTA 3FJYA 4MEBA 1EA5A 2HQRA 2C7RA 2Y6VA 3ESZA 4D02A 4B2YA 3GZJA 1TF2A 5TARA 3NHAA 3SYTA 4PFQA 3H1EA 2GPYA 2R4TA 5FBKA 3K5PA 3QELB 3O8OB 4L74A 3T3DA 3IUPA 3IYLW 1XZMA 1C1HA 2PK3A 3WQHA 1TA4A 4CV3A 3PGA1 2BKEA 2Z0MA 1ESCA 3KVOA 2AMVA 2H00A 3MGGA 2A5YB 2G06A 2NYVA 3K2IA 1OY1A 4GG1A 4UZFA 4KQHA 4KHPB 3PNSA 4X1YB 5LD2C 3E53A 3IOCA 4BN5A 1GJRA 3A58B 1UODA 2FPOA 4OGKA 3WK8A 1EBUA 5EOVA 4AECA 4MVJF 2DF8A 2FKNA 5KOHA 3KV3O 1RKVA 3C3KA 3HY4A 3BUSA 2IYQA 4EUHA 1OJLA 1I1OA 1OWMA 1PQPA 4MKZA 3M7IA 2ODQA 1SELA 3L4EA 1N9GB 1MZVA 2HYDA 3HCBA 4MIEA 3DCNA 3HJNA 3QVJA 3H87A 1TZCA 1X1BA 3LUFA 1XZJA 1MG5A 2AKYA 1XMXA 5FBLB 3LKVA 2AEEA 4OIFA 4H7DA 4Q15A 4H60A 1UQUA 1ZL2A 3EB9A 4PAQA 4LMBA 1LQ2A 5IDXA 3P97A 3UEOA 3IPAA 2WA1A 4WZAB 4UNIA 4TYYA 1ZH2A 2VRCA 4A1FA 3FWHA 1H6AA 1QO0A 2PJZA 3KJQA 3L0ZA 3TLJA 3WKEA 4RVCA 2NTNA 4E11A 2DHRA 5JQGA 4XX0A 3LP6A 2GCPA 2HMSA 4BGVA 1RWXA 3FKQA 4EITA 3S8EA 3GLUA 5HCIA 1G6KA 1YZNA 1UK7A 4HDKB 2J30A 4LDZA 2AZ4A 1P29A 2CXQA 2O5RA 4M0DA 3AEKB 3CKLA 2QF7A 1XU7A 4AZSA 4WJLA 2VNSA 2BGRA 5AKKA 3I1YA 1SGWA 4R7GA 1HC7A 3I2JA 1BNCA 2XXJA 3KZ1E 3P2OA 3G0BA 4DDTA 3SDBA 1HI9A 2JFWA 4DNQA 1EWKA 4X85A 1P2DA 2B3TA 2GCOB 3VKWA 4I4IA 5HS6A 4CMGA 4RIFA 1HDIA 1CKEA 3MSCA 2OD7A 3U13A 3SBOA 2ZYTX 3Q10A 4YTEA 2NZYA 3ZVNA 2CJWA 1WKVA 3PFHA 5EWJA 1WHTB 1YONA 3IIJA 4UAJA 1O96A 1B3BA 1Q7BA 3QKRB 1KDVA 3A04A 3QPAA 2H6EA 4Y0VA 4DIFA 4KDFA 5I4KA 3BK7A 3F49S 3LXRA 4G0QA 3TLAA 1Z5WA 1YZQA 4OM7A 4YPVA 1M2WA 4JUBA 5BSVA 2ZVQX 3BDAA 5JO0A 4X7PA 3GLSA 3TTWA 2IP2A 2NXCA 2Q0XA 2O3RA 3I0MA 1TYBE 3LX4A 3M33A 4PXSA 4R2XA 4J9VA 4WIAA 3UT0A 3ZGZA 4TKVA 2C88A 2BFCB 2FDRA 2V0CA 3AUXA 3PQ4A 1VRCA 3UH0A 3UCXA 1A04A 4BNTA 2GBIA 4IIXA 4M1SA 1YV9A 4V0RA 4B4KA 5LP1A 2GPTA 4FFNA 2B5VA 4UCXA 4A8JA 4RKRA 2QM0A 2I3GA 1BFUA 5D3ZA 1T9GS 4NG5A 4XWOA 5K3AA 3INYA 4DCUA 4XDHA 3M3DA 4MWDA 1KYIA 4W4TA 5DI3A 2FR0A 2REQA 5BN1A 2OOKA 3I53A 4M53A 4AROA 1ACMA 4FE4A 1PVDA 2AOWA 1UJ5A 1QK3A 2C4HA 4K28A 4D9EA 3IQXA 1NPYA 3U44B 1VGVA 2FMXA 1L5LA 4KCGA 3LCUA 1ATIA 1JJVA 3AEZA 4U2KA 1E2MA 1V43A 1R3UA 4R68A 4WNIA 3TCXB 4P53A 3MXOA 5BR4A 2X8JA 1QP0A 4EKGA 3WG9A 1KIMA 3VAYA 5JZSA 2JA2A 4GQBA 4PZAA 3UAXA 1H5NA 1DCMA 3D1JA 1DRVA 1E7MA 4L5AA 5C8YB 3UFXA 5ALQA 4BN4A 5ENVA 4BO8A 2R6GA 2XVMA 3MM4A 4CL8A 1E62A 1NQ5A 2MMGA 5AT1A 2GEDA 3B51X 5B1DA 2CT8A 1KZ9A 1KTIA 1HWYA 2RI1A 2YFHA 5KNBA 2X2FA 2AG5A 4PYKA 4XASA 3G8AA 3DE2X 2D1SA 1M2HA 3QW4B 4KXFB 5BNWA 2BJVA 4PLYA 4ARZB 1NF3A 1X7ZB 1XD8A 5JAMA 1U11A 2QNIA 2XWPA 1Z2EA 2YN4A 3R8XA 3RYCA 1GPWB 4OLHA 4B31A 3C74A 3NALA 1C3XA 3CIOA 3NC4A 1UM8A 4BNDA 4CQJA 2VA9A 1GZ7A 4GC5A 1CK4A 1HPLA 3JZAA 3Q2IA 1A8UA 4H59A 4LY6A 4M1QA 3R7BA 4KR3A 3BGIA 2NIPA 5IM4F 2FUG1 4G5YA 2PGNA 1DRWA 4QJ3A 2GF0A 4CLHA 4OG2A 4AY3A 2FOXA 4GR5A 3BXEA 4BAZA 1YB5A 3ELWA 1Z6YA 2WU0A 3IAS1 1XDUA 3HFGA 1QH1A 3PQ6A 2BI7A 3ACCA 1OLSA 3MGKA 3UM9A 1X7YB 1RQLA 2Z2KA 2RBEA 3WC4A 5K4HA 3SOZA 3OUZA 1NVGA 2I8AA 2CLMB 4JYCA 2FDCA 4F56A 2YJ4A 4RWZA 5I7HA 5JS7A 4E6EA 5I5EA 4ALNA 1FDIA 1XZQA 2FN9A 2MYPA 2R1VA 3C6ZA 3JD1A 2O8NA 2OFXA 1E32A 2NV6A 2B1GA 3IT0A 4CM8A 3FB4A 2A78A 4JLAA 2P65A 2GF2A 3NHFA 2CLFB 2X8JB 1HK7A 8ADHA 4QUBA 1U9CA 4QPJC 4FHDA 4JT9A 5BV1A 3O83A 2AI1A 2QNRA 4PX3A 3WS7A 1FFGA 2WICA 4W8GA 3ZGLA 5C8XA 1AN9A 4U5XA 4RKFA 3FE2A 2COKA 3WYAA 4C4ZA 2P4SA 3UJCA 3HC7A 5FOXA 3QU7A 4N54A 3QU9A 4YIHA 1EFAA 1ZNZA 1DJLA 2RK4A 3UAVA 1TEVA 3F97A 2Q8QA 1NLFA 2VA8A 4X91A 3GGJA 3T1VA 4QICA 4RKWA 3MWJA 3JQGA 4FS3A 1OH7A 1F0NA 1A7AA 2MINB 1SUWA 2HJSA 1V7QA 3VR5D 1FFCA 4Q37A 4UM9B 2QN7A 2QNBA 3L9WA 1GRQA 4UFNA 2CFIA 4F4IA 3QKUA 3WIOA 5B4TA 1MOSA 2ID8A 4G1EB 3DLBA 2BD0A 3KTDA 3IQGX 1HSZA 4YMWA 4TYQA 4JBLA 3WO1A 3LXXA 3ITDA 1PR2A 2ONJA 2GXUA 3B38A 1GUBA 1IWPB 1E2UA 2GLUA 2NVOA 3BIXA 3RFUA 1MZPA 1P9LA 4ZHQF 8OHMA 2Z8YA 3EGCA 3ZBTA 3NOQA 2WJ6A 3K1AB 1NFQA 5I01A 5JI2E 2D1YA 3T1OA 4BS9A 1O94C 4MYUA 1DG9A 4N5MA 1Q77A 1E3QA 5THQA 4HMQA 3WRXA 1S8FA 4EATA 4F9GA 4U9HS 5IN4A 2GYVA 1THZA 2AOUA 2I1LA 1Y6QA 4L95C 4B6RA 2AL7A 4D80A 4D3XA 2OUIA 4FDVA 5LKAA 5H59A 3LT0A 1LS1A 3IDOA 5F1YA 4J16A 1CZRA 5HF5A 4MGIR 1HL7A 3KWLA 3QPWA 3LBFA 1G7RA 2GHIA 1RXEA 2QA5A 2R8OA 2P9BA 2K4MA 1VPVA 4URUR 3OZXA 2FEPA 2QQ0A 2X9VA 3H2BA 2JC3A 4HMOA 3CLHA 4L2IB 4MGKR 1GD1O 3SR4A 4UHBA 4ZQGA 4UQLA 1YB2A 2VRBA 1QOZA 5DHPA 3UK1A 1Z25A 4E7PA 5BXYA 4I6GA 3EBPA 4LSMA 1EVKA 1P8JA 2CLEB 1WD7A 2VOJA 3STYA 5C7YA 2C4TA 4IMRA 3QKTA 1WVIA 1QUEA 3REOA 1DBSA 2VPZA 4EHDA 1MABA 4PLWA 2IXTA 4BQIA 4U7DA 4FMCF 3HDYA 1O5IA 5LP6C 5AYVA 4OQXA 1THTA 3C3EA 4DJDC 4CQNA 4BTVA 5BMOA 4HB3A 3CZ9A 4BV8A 3AJRA 3I62A 2PL3A 2UKDA 4P6VF 1E60A 4Q5IA 2GRAA 3P4UA 3WAJA 1BDIA 4MA4A 3PFKA 4K7JA 3KSMA 4QHSA 2HLDD 3GDHA 3KQSA 4WKPA 1O9GA 4FMBB 3RSGA 2W7TA 2AFIA 1XE3A 1NN0A 1LPSA 4NBLA 4NBKA 4AX8A 3GUCA 4MV3A 2QLJA 3TB4A 1H2XA 5IKEA 2VF8A 3ILYA 2F8LA 4Z49A 1ENPA 3A1DA 1WXIA 3NTQA 1XVVA 4RQBA 4ZVMA 4A15A 4XXHA 3LLUA 1MFPA 4ZYLA 2EP8A 3MT9A 3VQTA 3AETA 4O4LA 3VU1A 3NBAA 1H2ZA 5ES3A 4CUJA 3X1KA 4B79A 2VK1A 1KOJA 1I36A 2HK9A 1T5DX 4WXHA 5ARCA 5LD2B 3DE0X 3ZNPA 1PR5A 1ZAYA 3EFBA 2RGNA 4ZCTA 3A6GA 2OK7A 1HKUA 5IXSA 5C52B 4A8HA 4CLOA 2ZI6A 3SE7A 2ZIXB 1ZM4A 3OEHD 5LQDA 3NX4A 3F6BX 4PQYA 5HKBA 3R7FA 4QLOA 1Z0DA 4NMLA 1M2GA 4BP3A 3SHWA 2AX4A 4LA4A 1JHMA 3JATB 4RLSA 2IS4A 5ILGA 4NYMR 3TLYA 2ZPAA 4LYEA 1PDVA 1JHQA 1Q7CA 2CL5A 1T3GA 3RG8A 1YQDA 4AUNA 4RF5A 1T1SA 3DQPA 5AKJA 3EA4A 1RRPA 1I4WA 1DUSA 4R4JA 1Y1RA 3O95A 4CZ2A 4DDHA 2ZJ1A 1CNFA 1QFJA 4N40A 5CH5A 3TQCA 1TTHA 3PKIA 1GAQA 1V7PC 2NZVG 2ET6A 1POWA 2RK3A 1LC0A 3OICA 4K6HA 5IAGA 4E2WA 2RI6A 5EN4A 3WHIA 1GCGA 4CMEA 4GIBA 1EXWA 4R31A 2GAFA 3NBZC 3VO2A 2R6AA 2WUDA 4K46A 3MTGA 5F21A 3ZOKA 3DYIA 3DNMA 1NUSA 1O4VA 4E2FA 3CW8X 1CVLA 4FGSA 1M7HA 3K4QA 1JSZA 4KPGA 3FAKA 1HDCA 2RBKA 4XOIA 4RY0A 5HJ7A 2EJUA 1U4SA 4MPDA 1AK2A 2DQ4A 2WTNA 3EIUA 1QG0A 4BE9A 4CMKA 2FCAA 4ECAA 3UGJA 3VHRA 2A9KA 4FHEA 5EMLA 4E14A 1UXOA 2HU8A 3L9XA 1N2HA 1GTVA 2QW8A 4UNRA 1SCNE 2X6TA 2B6NA 2NW6A 4B33A 1CULC 3R2JA 4XWYA 5IM5A 3IRUA 4DMFA 4IWXA 1BDHA 1NKVA 1G8PA 4FI3C 4IKOA 4OP3A 4EPVA 4B6OA 2H1RA 4RYLA 3T0IA 3KZOA 4FOTA 4LE0A 5CVDA 1KQNA 1YR9A 5CGZA 3OA2A 1XKLA 1D09A 3IO3A 4A6EA 2I2XB 4AB1A 2CCKA 2W6CX 3BD9A 3S2SA 1MJ5A 3O47A 3Q11A 4QGSA 5ADHA 4A36A 4D26A 2EHDA 2IE0A 4OTZA 4YA6A 1OH8A 3ZCSA 4MARA 3E9RA 4P81A 1AZWA 3DL7A 4UTPA 4GNKA 1D6MA