2FP3A

Crystal structure of the drosophila initiator caspase dronc
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
293
structure length
254
Chain Sequence
ALTPYVGVVDGPEVKKSKKIHGGDSAILGTYKMQSRFNRGVLLMVNIMDYPDQNRRRIGAEKDSKSLIHLFQELNFTIFPYGNVNQDQFFKLLTMVTSSSYVQNTECFVMVLMTHGNSVEGKEKVEFRDGSVVDMQKIKDHFQTAKCPYLVNKPKVLMFPFASTNVPSLADTLVCYANTPGYVTHRDLDTGSWYIQKFCQVMADHAHDTDLEDILKKTSEAVGNKRTKKGSMQTGAYDNLGFNKKLYFNPGFFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and activation mechanism of the Drosophila initiator caspase dronc
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolysis/apoptosis
molecule keywords Caspase Nc
total genus 76
structure length 254
sequence length 293
ec nomenclature ec 3.4.22.-:
pdb deposition date 2006-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fp3A01
3SIPA 2XYPA 3V6MA 5IABA 1I4OA 2QL7A 3SIRA 4HVAA 5LUBA 3R5JA 2P2CA 2HBQA 3S70A 4N6GA 4NOKA 2J32A 2QL5A 4D3XA 4IEFB 3K7EA 4PRZA 2J33A 1SC1A 4QU8A 4QU9A 1RWOA 4JB8A 3UOAB 2H4WA 3PD1A 2FP3A 3H1PA 1CVRA 3EDQA 4JJ8A 1F9EA 4ZVPA 5H0IA 4EHNA 1K88A 2XYGA 3NS7A 2QLFA 1SC3A 3GJRA 1PYOA 2DKOA 1SHJA 2XYHA 1RWMA 2WDPA 1RWXA 3GJTA 3PD0A 4ZVOA 3R5KA 1CP3A 4PS0A 2C2ZA 2CJYA 3DEJA 4PS1A 1F1JA 4ZVRA 3GJQA 4PRYA 1M72A 4N6OA 2CNKA 1RHKA 2H5IA 1NMQA 2H4YA 4ZVSA 1NMEA 2FQQA 2J30A 4NOLA 5I9BA 2CNNA 5IAEA 4N7MA 4QUHA 4HQ0A 1GQFA 3V55A 2H5JA 2J31A 2FUNB 2H54A 4N5DA 2K7ZA 3H11A 1NMSA 2CDRA 3R7BA 1RHJA 2XZDA 5IBRA 3RJMA 4JR2A 5IC6A 5IASA 2Y1LA 4AWBA 4N7JA 4NBNA 4JR1A 5IBCA 3KJNA 4EHDA 1GFWA 3BIJA 1RHMA 4QUIA 3R7SA 3V3KA 4D3ZA 4DCJA 3H11B 3DEKA 4QULA 3R7NA 5LU8A 3H0EA 4QUDA 2H51A 3R6GA 3NKFA 3DEIA 4ZVTA 1NW9B 1SC4A 2NN3C 4LSZA 4EJFA 3IBFA 2CNOA 4FDLA 2C2OA 4JQZA 3H13A 2XZTA 2C2KA 3D6HA 3ITNA 2CNLA 1RWKA 4AWAA 2QLJA 1RWPA 3IBCA 2HBRA 3EDRA 4NBLA 1ICEA 1RHUA 4NBKA 1RHQA 1RWNA 4HQRA 1I3OA 3QNWA 5IARA 5IAKA 1I51A 1RE1A 3D6MA 4JJEA 4QUGA 3P4UA 3S8EA 3GJSA 4FGUA 1KMCA 5IAJA 5IANA 5LU9A 1QTNA 3P45A 3DEHA 3KJQA 2AR9A 4JR0A 1I4EB 5K20A 4ZVUA 4I1PA 4IYRA 4M9RA 1SHLA 5IAGA 3V4OA 1QX3A 4DCPA 4EHLA 3NR2A 5LUAA 2HBZA 2CJXA 4QU5A 4EHHA 4EHFA 2HBYA 2H65A 5IBPA 1IBCA 1RHRA 5I9TA 3OD5A 3D6FA 4QTXA 1RWVA 4QUJA 4QUAA 4I1RA 2QL9A 4EHKA 5JFTA 3PCXA 4DCOA 1QDUA 2H48A 5IC4A 4FEAA 4NOMA 3V6LA 1RWWA 4JJ7A 3UO8B 3KJFA 4D3YA 1K86A 1PAUA 4QU0A 2QLBA 4QUEA 4FXOA 4QTYA 3R6LA 2Y0BA 2C1EA 4AW9A 1JXQA 4N6NA 3E4CA 4JQYA 4NOJA 4ZVQA 2C2MA 4EHAA 3V4LA 1BMQA 4QUBA
chains in the Genus database with same CATH superfamily
2VPPA 4NBVA 4J2HA 1K2WA 3GEIA 5F2KA 4QXAA 2ISQA 4OHVA 4ZHQB 2CLHB 3JQAD 3K3PA 4NV1A 5FUBA 1VPWA 1ZZGA 1E1QD 3IQXA 2NU8B 4RD1A 2CE7A 2HPAA 1YB7A 3CF4A 3OURA 4FUTA 1ECFA 2F43B 1T5TA 2RC5A 5SZKB 4JI3B 2CLSA 2YFKA 3SR0A 2QG4A 5L4SA 1LBTA 2PM8A 5JS7A 3AUYA 3FM9A 1A7AA 5E7MA 4EKDA 1NATA 4FMCB 5JPCA 2PEYA 5L3VA 4X6LA 4MK4A 1X7GA 1XELA 3Q0TA 2QHXA 1NPDA 4EPTA 1S8FA 1SHJA 3BF7A 1IEVA 4INAA 1NXVA 4MQLA 1RM5A 5G0TA 4P2BA 1SUSA 5IBQA 2ZT5A 4ZXFA 1P1RA 5JNTA 2V58A 1TFRA 4AURA 3GGSA 4DXHA 2WVAA 3GMDA 4QREA 1L5LA 2PUVA 4YFYA 4MXDA 2PUWA 1FLDA 3V8BA 2VCHA 1PR4A 1YR7A 2HA5A 1BTOA 4G0PA 1ANKA 1EQUA 2B2NA 4XARA 4P53A 4XW2A 3SHVA 2DFKB 3H97A 4CEJB 1NJFA 3AEZA 3KSMA 4HRVA 4RIIA 4HPWA 1NMSA 3ORSA 3HKDA 3WKCA 4IIHA 2AF4C 3AEKB 3DWIA 3WY9A 1A5BB 1REQB 1NN5A 1OAKA 1VBFA 3I2HA 5E8RA 2NSDA 1ENZA 4CG3A 1SKAA 5A0FA 5MN5A 3Q8LA 5ABPA 3ZDDA 3NT5A 2MINB 3Q1KA 3HYTA 1XRRA 4HS9A 3AUXA 3OC0A 2YFHA 2G6BA 1UCFA 3GV0A 2VHWA 2FU5C 3ECSA 4GXQA 3DWFA 2EJUA 3B53X 3FHTA 4BRSA 3CH5A 2P4SA 1WXGA 3DZ8A 3NYRA 2WWGA 3F47A 4A36A 1OASA 3C1UA 3F9IA 4BZQA 4A3SA 1GN8A 4FEEA 4XQCA 1TRHA 1TYBE 4UM5A 1R0RE 2GJ4A 4QARA 2PFSA 1O9HA 1ZK4A 2XWPA 4LSGA 4EJ2A 3VNUA 3HK2A 2QN6A 3OLVA 4AJ1A 4BASA 2X1HA 1JV2B 2F4NA 1S01A 5TPZA 5CDUA 2DFDA 3QFCA 1HSZA 4QUGA 3EGIA 3EOZA 4TLEA 3A25A 1E1CB 1AX9A 4HATA 1KMCA 4MLPA 2BELA 4HUQA 4DBVO 4U63A 3SJZA 1VCNA 5AVSA 4YI5A 2WUWE 3U6KA 3EVFA 4U7JA 3V4OA 2VEOA 3IALA 4ER5A 4J2TA 3E3MA 3TLAA 1CJVC 4CDGA 1M67A 1TDJA 1XU7A 2FXIA 2G9QA 4ZYUA 3PICA 4RELA 2I2FA 4R3NA 4OI2A 3BWMA 4MVWA 3C3BA 2WV7A 3EZLA 1DARA 4L5JA 4TUYF 3F9RA 3LI2A 2Q3MA 1U31A 2YY7A 3KM0A 4L3WA 2X13A 5CB4A 4ABTA 2C97A 2ZIAA 4AYXA 3U7RA 1E2PA 3CE6A 4Y3UA 3MUEA 4Z4IA 4HNAB 3WZLA 2YYZA 4D9FA 2CXNA 3DL0A 3FJ1A 2HCJB 1I1QB 4EKNB 4F2GA 4F2WA 1PJ8A 8MHTA 2JI8A 3KWMA 1KKMA 3D64A 4FR0A 1QXSA 2JD2A 4LHYA 1XVLA 2UZAA 5KYNA 3EXEB 1WXQA 4CKWB 4U8HA 2D8AA 3D54D 1FP6A 5H80A 1TUGA 3HRHA 1NV9A 4RVHA 1OAOC 4NV0A 4Q19A 3VNSA 1FP2A 1WDLA 5KZMB 4ZVKA 1ZUNA 4L0MA 5J59A 1HF3A 2O2ZA 2J59A 2QRGA 5AMXA 2HMYB 4L6CA 1J9EA 1EJ2A 4JCOA 3F2VA 3UJCA 4D8WA 3CMMA 1CY0A 2V9ZA 4Q82A 4LMBA 1M8GA 3TSAA 2FPGA 4AZ3B 1QORA 1T6ZA 3D02A 3LW8A 1Q5PA 3JZDA 4HX5A 4YMTA 5CB4B 2FG7C 2HCBA 3NOVA 2JFGA 3DMHA 4HFJA 2HMWA 4FHGA 3VXKA 4AZSA 5AVTA 3RTDA 2YNMA 3DEJA 1GSOA 2GPWA 1MOQA 1N32B 2P79A 4NBUA 2JGIA 3LYLA 3WQRA 1A3CA 1KGSA 5A9TA 3RS5A 1N6NA 4YP6A 4P7FA 1PWHA 1VHLA 2Y6VA 4S3MA 1NNI1 4LF7B 3C6YA 3L93A 4MUIA 3V55A 4QXQA 3WNCA 4BO0A 1QGOA 4PO1A 2GR9A 4ZEXA 3OCCA 2ATXA 4PU0A 3ZKAA 1V4NA 1D6NA 5FFNA 4V0KA 4BQOA 2G77B 2L2QA 4L4XA 1QG6A 2B5OA 3RUEA 4XB2A 3RHZA 2WM3A 4ITRC 4EGQA 5F33A 1BH6A 1JLLB 2EIHA 2WAOA 4RE6A 2ZJ7A 2J08A 5DRYA 4ZVMA 4JI1B 4ZHSA 3UMYA 3GA5A 2DYKA 2LDXA 5A7HA 3VNAA 1KQOA 2WMNB 3ROKA 3IVGA 4AJJA 4KPUA 1ZO8A 1YS4A 2AYZA 1RKXA 2WSIA 1D4OA 5BVGB 3DXFA 1H4VB 4LKOA 5EC8A 1KVQA 3WRYA 4YCJA 4CLDA 1J24A 4JXKA 3VC7A 4CIYA 4AF8A 1GRCA 4QBKA 3WKAA 5H68A 2NTNA 1M6EX 3Q5EA 4A1FA 7YASA 3L6UA 1SBCA 3B9RA 3BWCA 1ZM2A 3D0RA 2I2DA 3QUTA 4YAEA 4MZDA 3HA7A 1Y3FE 2GPBA 3CKYA 5KYTA 2P5TB 1N2IA 3GLHA 2CMGA 5EVCA 1PBTA 4ILKA 2RKOA 4AAYA 3MGCA 1WF3A 2HV9A 2RK6A 3D9QX 5E4TA 3GZ4A 4XGRA 2XCLA 1GWNA 3GNQA 4G0XA 2HHHB 4WGGA 1VJTA 3RLIA 4Y0VA 3P9RA 3FTFA 5EGNA 3SXJA 4IINA 1UF9A 4IQ8A 3O1JC 3VM6A 1TCVA 4TUYA 1YJBA 3OE4A 4F84A 4MUBA 4QDJA 3DDSA 5C5EA 3KWLA 5AI9A 1SHTX 3UB4A 3NDBB 2Z6AA 4RHEA 3MJDA 2VWGA 3Q0EA 1DQPA 2OL4A 3DAFA 2FR8A 4KK4A 4NFHA 4OOFA 1V96A 4RPCA 4YA6A 1LPBB 3V4FA 3L43A 1LPSA 4WUVA 4TKUB 1I7NA 2Q3LA 4QFMA 4U8GA 4WLVA 3SM9A 2DHRA 3DBHA 1AS3A 3PI6A 3Q4GA 2DOKA 3MNFA 4ND8B 4PONA 4EFMA 5A04A 5HJ5A 4H18A 2AMLA 4GOLD 1Y6QA 4X0EA 1DINA 3RNOA 3MWYW 4A2WA 2JAPA 1NOJA 1GLVA 1MRSA 1XMOB 2B8TA 3WLJA 4PZUA 2H11A 3AR3A 1YBVA 3E48A 3WMXA 5JVDF 3PHIA 2XB2A 2OMEA 4X6UA 1SIOA 1A8HA 2Q1YA 5KKNB 4GHWA 3SF0A 1A5SB 3LUBA 4FONA 1IVSA 1YTUA 1SBNE 1ZI6A 2FTKE 4BKQA 3H1BA 4L72A 5BURA 5CURA 4QM6A 3GBPA 3PD1A 3KLPX 2QTCA 1PVDA 1XR3A 1GYPA 3CE9A 3HB5X 5A3VA 1NASA 2E5WA 1PYOA 3GJRA 1YU6A 3KUKA 4JC4A 2Z95A 2ADFA 3D7SA 3WQQA 1WS6A 2GA9A 4WESB 2FOLA 2IL1A 2MR5A 4DA0A 3LO5A 2VP6A 1WWKA 4KYIB 1E0SA 1FDSA 2HU2A 4RVFA 4C22A 4YMHA 2W6ID 2QTZA 2OD9A 1RYMA 1JJIA 4IDHA 1W49A 4K03A 2FMXA 1JI0A 3NWBA 1R37A 1UK9A 3PQ8A 4LDNA 4KR0A 4WD3A 3THSA 2ZYTX 3ZVLA 4LOLA 2BMVA 2WF5A 1BN6A 4PLVA 2IRWA 5T67A 4FIZA 2VTBA 3DTTA 5AKIA 3W5DA 3HFGA 2HTFA 1R6UA 1WM1A 5JAPA 1V5EA 1RI2A 2C9YA 5C32A 1GU0A 2RMKA 3GJYA 1TL7C 4HN2A 2WD7A 2KE5A 4H31A 2J0UB 3G59A 2O3QA 1PNRA 3ESAA 1UMBA 2XEDA 3D0KA 3KE9A 4P3OA 1PSZA 3NDPA 3GEBA 4OXXA 3VHLB 5AWFC 3FZQA 3H13A 2XZTA 1Q6YA 3AUSA 3AQ4A 1E6CA 1SO8A 5B1YA 1QCYA 1SUPA 1DJLA 2JF0A 4F21A 2PX6A 3RSSA 3Q1LA 1PGPA 2BI8A 1GEGA 3IBCA 2IHTA 1T26A 2HBRA 3IP8A 2HOQA 3MS4A 3X2FA 4D8YA 4ZTZB 2GZ1A 3OJFA 2XMQA 1VE5A 1Y33E 1D0IA 4NBLA 5AW1A 1KFBB 2ZSUA 2HB6A 1FSZA 3I9KA 2WP8J 1AJEA 3HEBA 4YLEA 4OXYA 3ZQ4A 4YRIA 3C43A 1NYRA 2F3QA 1EE9A 4IQGA 4RL4A 2H29A 1GUYA 5IWAB 2Z2KA 2E0IA 4NFYA 5KNDH 2OILA 4PANA 1CNEA 3QJ5A 5ERGB 1F2TB 4HDAA 5K51A 5DP2A 1O58A 2OK7A 3SKYA 5ALWA 4EARA 3A37A 2GN0A 1D2EA 5KQSA 3WIUA 1CR6A 5J5CA 4AG3A 4PX5A 5MGNA 5LBTA 4BLSA 5DNDA 1EM8B 3O8CA 3HYNA 4HNHA 3OKFA 7GPBA 2Y1OA 4OXRA 1DIGA 4QTUB 3KOYA 3QKRB 2PXHA 1E4YA 1RJ9A 1XL0A 1VMIA 4DCOA 1UWLA 1QQ5A 2KM1A 1JG1A 4Y6OA 1TVMA 3ZWQA 1T6XA 1FS4A 4DE5A 2FF5A 1J2TA 4OSEA 3WVNA 1DC6A 1HURA 1IZ8A 3V7YA 5AW6A 4FGKA 3IO3A 2QLBA 4FI3C 5HRUA 4YREA 1PE0A 2R4UA 3O74A 3O82A 4JYCA 1THMA 4KCGA 1VRCA 1JG4A 2G83A 3RVRA 5LYJB 2NM0A 3HCPA 1MAVA 3A3PA 1UODA 3HPQA 2FWBA 4I5EA 4IGFA 2BGJA 3GYBA 3VVCA 5CDFE 5L7WA 4Q1VA 1KMNA 3RWMB 3K5WA 3Q7QA 8ATCA 1ESEA 2AGVA 3WV5A 1DRJA 3PQ4A 2IHZA 1L7BA 4FLMA 2RHDA 1M33A 2WE7A 3ETDA 1NN0A 1COWD 3MRTA 4EYEA 1KDOA 2BOVA 3N1UA 3PCTA 1T0BA 3ZIAA 4NCHA 3OQHA 5DSTA 1E0DA 2HA7A 4GQBA 5LOVA 2JIDA 4Q21A 5EIHA 1OY1A 1VI6A 2XJ4A 1Q22A 2AOVA 4IDDA 2EU8A 3G0IA 3IT0A 1XD2B 3JASB 3QVMA 4HH4A 1HDOA 1L4BA 3AEQB 3HV0A 1P9LA 3CPEA 5DFAA 4B73A 5EMMA 3ZV6A 4G4SP 4J9VA 4WFIA 5H1YA 1Z8HA 2ZT7A 1GGNA 1F60A 3BGIA 4H1UA 3RVPA 4OVKA 1R88A 4DT1B 3NGMA 4Z2AA 2CNNA 1N9GA 1UPCA 3QOFA 3AVWA 4H4CA 3HZOA 2W0MA 1ILEA 3DAGA 1Y1KE 3M2TA 1MJGM 3PITA 3Q87B 4DVJA 1T5HX 4OGWA 4CM8A 2EAUA 3FGPA 1OAOA 1S2NA 2EX0A 3CW9A 3B60A 1KJWA 1BH2A 4D0SA 3ME5A 2CJPA 4JXJA 1E99A 4A91A 5DW3A 1ORWA 4YUWA 1YQTA 3IODA 2W6ZA 3FUCA 4HGNA 1JQAA 1WRBA 1LBSA 2DSNA 3B2NA 4LC1A 4XFJA 3O0DA 1HDGO 2ZYDA 1SB8A 2XZPA 1J7KA 1ECPA 1I1OA 3L0CA 3OM0A 4FDLA 4X1OA 4ZARA 2E5LB 4C0HA 1CUYA 3BE4A 2JEOA 4CU2A 1WL8A 3AHFA 1FEZA 2IYNA 2WLSA 3EFOA 4ZCQA 2DEUA 2D62A 3VR4H 2IS4A 1QU3A 1NUSA 4CCWA 1LNSA 3N53A 3VPGA 1JHQA 1QLJA 4HYTA 4Z0HO 5ADUS 4X62B 1ZJ6A 3BZWA 3OJXA 5AJTA 3ZWYA 1BX3A 3T34A 2VJBA 4EH1A 3KEMA 1YMQA 2IVZA 3CINA 1JLMA 1XFDA 1Q0PA 1MJHA 5EP1A 1MKYA 3M5WA 1FDIA 5IU6A 1K4YA 2PNJA 4MCHA 1PF7E 3PPXA 3RS7A 1Q92A 4KNWA 2JFBA 4OJQA 1DI0A 3BJZA 3FJYA 4ZOLF 5EOVA 3G89A 4O2AB 4DARA 4RK6A 1K5PA 1WTCA 2MR6A 5KNBA 3EIEA 3H5WA 2W2TA 3L7OA 2EATA 4QSMA 1CUSA 3ROMA 1NW3A 1SC6A 1ZUHA 4KAXA 4E5SA 2Q0HA 1ADGA 3SE0A 1S89A 4D0GA 1Q0ZA 2AXPA 5HX7A 1TC2A 4B4KA 3EXIB 3FYDA 5BPFA 1QPZA 4V1CI 2C0QA 1L7MA 1VP9A 5I3ZA 1SXPA 1DJQA 1QDUA 1X42A 4DWVA 2R3SA 2W2LD 4BYMA 1SQSA 2HA0A 4AF7A 2B3TA 1NAIA 3UO8B 3LVFO 4A23A 4C05A 3DH0A 1K27A 3REGA 4ZI7F 1ZHOA 1Y3IA 2RGUA 1DG1G 3JTEA 3M1IA 3OPYB 3R6LA 4F1KA 4N6NA 2VDKB 2WOOA 4YWJA 3QG1A 1L1QA 4I6JA 3UY4A 4JP1A 5KAMA 1ZGAA 3OHMA 3QFRA 1N77A 4BVHA 3GJ6A 3HUFA 3NJ4A 5BWBA 3HKEA 4P83A 1GT6A 1CEXA 1NMXA 2ZGVA 1Q0UA 4E3ZA 2C1XA 4JJGA 4EPYA 1GL9B 2UXDB 5JZBA 5HIKA 4G26A 1CRQA 5G41A 3QMMA 3OX4A 3HCOA 3PDCA 1P4GA 3C14C 5KBYA 3WBBA 2J3HA 4B3FX 3GLGE 3B7GA 4E94A 2JFPA 2WJJA 5GINE 5AKLA 2NU8A 1CUDA 1LTHR 2PKQO 1OV6A 1K5GA 3ROQA 1CQJB 4QQRA 3QVUA 1PO7A 1QIGA 3A6FA 1YRWA 3GJTA 3SHTA 3WHLA 5ICCA 4AMYA 2WWIA 2Z2JA 5GVRA 3X2SA 3DFKA 2FSHA 1U5BB 3N76A 4R2JA 4CHGA 2JA2A 1P4JA 1ZJJA 3RT7A 5AFSA 1GKIA 1WQ1R 2Q7XA 1RXUA 5DYWA 4CEJA 3GEDA 3N5KA 1EFRA 2J3LA 2QM3A 3QU7A 5EKUA 4D56A 5ALVA 5K8UA 3AEKA 1IBLB 2FMHA 4X5OA 1W35A 2ORWA 2OHHA 4IV8A 1HTTA 2VYNA 3OU6A 1G3MA 2ZLBA 2FEAA 1FSSA 4J75A 3HKEB 4C0BA 4AYTA 1YUBA 4QL3A 3SU8A 2NP6A 2W6IA 1II8B 2WIAA 1M1NB 4H1TA 3E7PA 4OG2A 1JT9A 3OQ6A 4COKA 5JY6A 2JFVA 2HDOA 2J07A 3F7NA 4FQ8A 2FPKA 3BCHA 5EZSA 3RUPA 3DZGA 3QKSA 4ZZIA 5FTLA 2I6FA 1CJBA 2OZKA 1KEEA 4BPBA 4ZCLA 1KOGA 2PKCA 2X14A 1DHRA 5KYUB 4QVGA 2O7QA 1V8ZA 3KT8A 1FUKA 1LJUA 5JVDB 1PJ2A 3GO4A 1YQDA 2Q8QA 4ANFA 4RK4A 5JH7F 1NTRA 4NG5A 3WBFA 4ESEA 1JQKA 3VX3A 1OLUA 1G8KA 1WHSA 4M9CA 1ZU4A 3VVLA 4WZBB 4FDMA 2ZRHA 2AG0A 2AOTB 1TU4A 1TZKA 2AYYA 4GYKA 4JODA 5LYJF 1GQOA 5E0OA 1ADFA 2A1TS 2PK3A 2AFHA 4KH1A 3WNQA 3S1LA 4FOSA 1VE7A 5L3RA 4TYWA 1P33A 1U0TA 4J1QA 2QD1A 4FBGA 3RVBA 3KUUA 2GRAA 3TQHA 2GM3A 3MINB 1F0NA 2H16A 4KAAA 2VIIA 3R5FA 2LRHA 3DBRB 3KWJA 5IAJA 2MHCA 2C31A 4BMZA 1MFPA 3P19A 3G5TA 1CHDA 3FI9A 1RP1A 4MKFA 4WFQA 1IY1A 3L4SO 4NYMQ 4FYVA 5D5PA 3HU1A 3ZU2A 1YVRA 3AGQA 4Y2PA 1RLOA 1W4LA 2Q41A 3CC8A 3DAOA 1N4AA 2WAMA 1C0PA 5JFGA 2ZROA 3F49S 4PXSA 4HQOA 4LV5B 5BW5A 4LZAA 1AS2A 3CEMA 1OFTA 3NJ8A 5DP1A 4ZKDA 3GA7A 1NXWA 1XTIA 1ZM7A 4U2FA 3R3JA 2AVDA 3RS8A 4K81B 3QHAA 2GZSA 4US2R 1FVXA 1IHXA 1Z4LA 3WJ1A 4RF4A 4AMZA 2V54A 4NYIR 3PGXA 1TOAA 5TX7A 2J3EA 4FHCA 4BGVA 1TECE 4TLLB 4D5GA 5CLQA 1NR7A 5FR2A 2PWAA 4BVFA 5KSOA 3VPDA 1A1VA 3NT4A 2EP8A 1N25A 4X94A 4OQLA 2ZIUB 1ORRA 1P61B 3B6KA 4G0NA 1U3CA 3NIBA 1KYYA 1UBKS 2WHXA 3OJCA 4XQGA 3TXAA 3D7NA 4XIGS 1RR6A 1GGHA 1SUCA 2QVLA 2XVMA 4HXFB 5B1DA 4U2BA 4B33A 2R7AA 4O4JF 1NW7A 5DK4A 2IA5A 4DLNA 3TWOA 1JJAA 1V3UA 1JJFA 2W6PA 3FGOA 3IYLW 4MWDA 4FCCA 3ITEA 5G0WA 2G72A 1I13A 2H9AA 3LLMA 4GEGA 1CUVA 4RLFA 3RREA 4BRWA 2DKOA 4NCBA 1DBQA 1T6NA 1PHRA 2AX3A 1Y8AA 3FIUA 3GIDA 4AJEA 1M2KA 3JYLA 4FB5A 3WLSA 3BK1A 4OHKA 1NG1A 3SLKA 3LE8A 1TAUA 2GFIA 1U8TA 1XK6A 2D74A 4Q3NA 1AN0A 4YJ3F 1UIMA 3FDIA 1H9AA 2OQVA 1WUIS 3A2NA 2H4YA 3O8OA 4INPA 4P7KA 5F73A 4V3CA 2RIPA 1KTIA 4E6PA 1EBBA 3G2MA 5L45A 2N9UA 2RFLA 1U7OA 4LHSA 2H17A 3K0CA 5JASA 1E2DA 2QZ4A 1I6KA 2G08A 1SD1A 5SYNA 2Q21A 1G21E 3WMGA 3ICWA 4OKNA 5B1SA 2FMUA 2GARA 4WY8A 3CCFA 5EHZA 4JV5B 1KXJA 1RP7A 4KPUB 3IHLA 4BEWA 4MQUA 4L6AA 2QI9F 3OC6A 4FKMA 1QB8A 4ER0A 2PV0A 2GN9A 3ZLVA 3IPAA 1OXBB 2VF2A 3C7TA 3ZIAD 4Z7JA 5CK5A 1NF8A 4IWYA 1E2HA 4GX0A 1U2ZA 1L4NA 1UBSB 3ESCA 2B9EA 3MTBA 2R1TA 3IVMA 2FGKA 1UOPA 4IFEA 2G0AA 4EY3A 4IUDS 4Q7QA 4F3YA 4MO2A 3CUEF 3NVDA 3OOJA 5ERXA 1L4FA 2AZDA 3ZBTA 4NYJQ 1Q2UA 4GKAA 4IBOA 1PWEA 4OSOA 4UFNA 5G0UA 4P36A 3D7KA 5GM2A 1ICEA 4OHCA 1ISIA 1OPRA 4D9NA 4DNPA 3ZDRA 5C35A 1PTKA 3NOQA 1Z3IX 4FGLA 4C7KA 1M7BA 1V11A 5IM4A 1I51A 3W06A 3Q7PA 1Z6ZA 3A8TA 2Z58A 1KC3A 4YRBA 1TQ2A 1UMCB 2C03A 5IXSA 1G8JA 3EYWA 3FMIA 3H2JA 3O9VA 3ONVA 3I01A 4RDCA 3VOBA 2R7MA 1RC0A 1RQPA 4IDBA 3T3OA 3EJ6A 3D2CA 3GLHB 5ES4B 2J0VA 2FK8A 5GJCA 4F46A 1YC5A 1DHTA 1JVSA 3SIWA 3ZCXA 3KQKA 3OF2A 1OU4A 1GO2A 4JGGA 3NX4A 3HN7A 1E2IA 3BS4A 4X00A 1WXFA 4J0CA 2GUGA 4YNBA 2ZBFA 5FA8A 1ZRNA 3OZIA 3IPXA 4G1EB 5DCWA 3MEQA 1I6WA 1VHDA 3OESA 3ZS8A 3RIXA 4C01A 1KHTA 1YZKA 3WFZA 3G17A 3QW4B 1HTBA 3BBLA 4GP7A 1TM7E 2C57A 1XVUA 2X8LA 1RPAA 1S9DA 3PE6A 1A8SA 5JJCA 4N54A 3KZNA 2JHCA 3K16A 4UU7A 2QAGC 4QNMA 1KDYA 3UNXA 3FTNA 1H0HA 1PJRA 3CNOA 5IJ9B 1O96B 1RKBA 1A0OA 2GDJA 2VJPA 5CFPA 1O3YA 5KQGA 1Y7IA 1ST2A 5B7PA 3CSSA 4LC0A 5DYIA 1JT2A 1WHTB 5CFNA 3FPEA 3M6VA 3WI7A 1KDTA 1Y42X 2IOQA 1WUKS 4L08A 3FN4A 4OFWA 1UBCA 1K5HA 5ADHA 2NMVA 3AI2A 3P9KA 3L7BA 2C58A 2PMFA 2PY6A 3AR9A 4Q4DA 5E7JA 4QU9A 2W42A 3HJFA 3JALA 3EVDA 4MCAA 4XCQA 4HVCA 4KQ9A 4KFCA 3V1MA 1DFIA 4LRSB 2VDUE 2O5CA 1JP7A 3QEAZ 3FUXA 3ETLA 2F59A 2PWPA 1H6DA 3DVLA 3HJCA 3L5OA 3UWKA 4RQUA 4R8MA 1UZLA 1J8YF 4WNAA 4NRDA 1XYGA 3JQFC 2YW9A 4BBZA 2XTAA 3AFIA 4Y0AA 5I5EA 1W5AA 4C7JA 2E49A 2L19A 3O8LA 4AJ9A 4AXXA 4OX9B 4D81A 2C88A 4DEYA 3HWX1 4CKWA 2AC2A 3ASUA 5LR6A 1NT4A 2O7VA 5DHPA 1M9NA 5JZSA 3TW4A 2NZJA 2G6TA 2IYXA 1BGWA 3D59A 5KWSA 2IXFA 3F6PA 3EARA 2YCBA 3RSLA 3X1JA 4BWVA 4EUSA 4RDXA 4AQ7A 3HY4A 3IOMA 2MIIA 3PKJA 2R8YA 1OJ7A 2YZNA 2ZAOA 3RJTA 4MINA 5AVWA 4PTYA 3DVRX 1KYXA 2CC2A 3GJ4A 3HO8A 5KYVA 3REQB 3RK1A 5CB4F 1UKYA 1Y8QB 2MMCA 2X9QA 3I76A 4DRXB 1X1SA 2ZT8A 1MB2A 5F7XA 2NTJA 2WUGA 1NTOA 4IXWA 5BWNA 1XF1A 3FW1A 2CVHA 3IUJA 3NIFB 2GXUA 4BNHA 4ZYYA 1T1SA 4UEKA 3JR7A 4UKDA 5CVVA 3SGLA 4TV9B 4BNKA 1DKOA 2QQFA 2QZPA 1VA5A 2QQ0A 3LWNA 1UMKA 3GH3A 3WLTA 4A6DA 4IUBS 1HQYE 1U7ZA 1XDDA 1DAIA 4FFOA 3PTZA 3T4PA 4DIKA 1M6YA 1YC2A 1J0BA 3C3MA 2O8FA 1IM8A 2G07A 1BWPA 3C15C 4I6GA 5EI5A 4B87A 2ZCJA 4XPIA 5EJAA 1RZVA 2C07A 2RHGB 4PRLA 4TTPA 1SQ6A 4UDXX 4RC9A 5GONF 5BRAA 1WB5A 4R5MA 2BSAA 4E3WA 3CGGA 1N6LA 3ZLTA 1NBHA 4ID9A 4WDQA 1FXUA 2AC4A 3ISVA 3DEZA 1GA4A 2WA1A 2R6R1 2X0JA 4YCDA 4EB0A 3U7HB 1MO3A 2WJZB 3HUUA 4JSRA 3DAPA 4XEUA 4PCUA 1Q74A 2I1LA 3VBEA 1B6GA 3MD0A 3PIIA 1YFJA 2PDAA 2EZ8A 4EHFA 1GUZA 2YXBA 4GGMX 3V8MA 3SS7X 1ZUD1 1KSHA 2GF2A 1MZVA 1UZUA 4KXLA 5B7GA 3IRVA 3GLFA 3KLOA 1ZR2A 1CYEA 1L3IA 2PT5A 1Q6ZA 4HB0A 2OP0A 4FIDA 4YFVA 4JT9A 3JPYA 2X6RA 3AERB 3GDFA 1Z5NA 2HA4A 1N78A 1A9PA 1UM9B 3HDJA 3S4YA 2VDLB 4QXRA 4FEAA 2MSWA 2O1SA 1XQVA 1CJCA 1Q3KA 1M54A 2CJFA 4E4TA 3OJWA 5IH7A 4YPOA 1H9CA 1ECGA 4BFYA 4HWRA 3EX7C 2WF7A 3KR2A 5CNKA 2AN4A 2PH1A 2WVHA 1ZCZA 2IZ5A 2NO0A 2REQA 4RF3A 1ICIA 4HAUA 3W5IA 2BONA 2XUKA 1GTSA 1KNXA 2EG5A 1QQBA 3HU3A 4BNXA 4LDAA 1N2CE 1WA5A 3V2IA 4US0R 1O4VA 2WF9A 3U4IA 5T64A 3EWNA 2O57A 4GWLA 5EZQA 5DI3B 2HL6A 3ZDZB 1VOTA 1G63A 1DKUA 1KYZA 1JEEA 1PR6A 1TTQB 2W8BA 3OIYA 1GPDG 4G1FA 3RFVA 2Q28A 5HKAA 1SGWA 4NBWA 1L5ZA 1SCBA 3JRWA 5EUQB 2PIDA 3MHTA 2WD9A 3AVPA 4Q9DA 3TS1A 3WGKA 3PD0A 3WIEA 1JHZA 4GKVA 4OB7A 2F8TA 3REOA 5HWSA 3VZPA 2A4MA 4B47A 1KZYC 2C2ZA 2XVXA 4B4WA 9MHTA 1BEUB 2Q6IA 3FPCA 2JW5A 5JJBA 1AUQA 3VGPA 3A3YA 2JFYA 1POXA 3PFBA 2OZLA 2VF5X 2WIFA 3BA1A 4PQEA 3U80A 4AG6A 4D41A 4YMVA 5A05A 3KL4A 3GLKA 2WSBA 1AM4D 1P19A 3BWVA 3KV3O 3L7IA 3QNMA 4V38A 3I73A 3M34A 4KMOA 4I66A 4QWMA 3LX6A 3TRKA 1K7YA 2D1SA 4IXTA 4X93A 4JUCA 1VECA 2G9NA 4JBNA 5KNDD 1XVTA 2YQ5A 3KQYA 3PXUA 4DSTA 2IUYA 4V2UA 3TLYA 2JLRA 4N7JA 4N5IX 2HJHA 2Y4NA 5FORA 3VPAA 1UAYA 1NOKA 1UKVY 3L9WA 2P4QA 3LF2A 3MHPA 5E6UA 3MLAA 2P90A 4HDNA 2CLKB 5EJ9A 3SBDA 4YDQA 2PGAA 3H9GA 3TEFA 5BUCA 4LJ7A 1UKEA 1PQWA 2I91A 3J81k 1QR2A 2DQKA 4I46A 3SN6A 3HO6A 1KI7A 3KG2A 3EPHA 4R41A 2HMVA 2FAXA 4H60A 1G8PA 1UOQA 2B82A 1KEWA 1T3LA 3MQFA 3PKIA 5AKHA 1J07A 3ZVNA 5F7OA 2QLJA 3MOSA 4GO1A 2HXYA 4UNIA 1AZWA 2J9FB 3HXLA 5FO0A 1M7HA 5L4NA 3NHAA 2CB0A 1NAHA 2Z3WA 3EFOB 5C3UA 2L0XA 2W22A 3DDWA 4JFAA 1DRVA 2J46A 4C4ZA 1G17A 1GY8A 2XVYA 4CIDA 5LZ4A 4MUMA 3K9CA 5L6LB 2NYAA 2RGAA 3IE2A 1TVKB 4MQFA 3GK3A 4FYJA 1I32A 4NCNA 1PLJA 4P4UA 3ZWVA 1B8NA 1BVYF 4CL0A 4BNLA 3ZTYA 1MQAA 1R4NA 4KNVA 2B78A 2X0KA 2QAIA 4GQAA 4ROSA 2O8NA 3LYAA 2PHZA 4TQUS 1FTWA 1UZAA 3NR2A 4JZKA 4PAWA 5HCIA 2B8JA 5TXGA 3L7DA 1YZVA 3B2QA 3DHEA 2H5LA 3H3JA 4TPKA 3CJQA 5DB4A 1DSSG 3TUJC 3VPBA 4BZXA 4TL6A 3SZRA 4KDEA 2DB3A 3UGQA 5DJ5A 5FDFA 3FWNA 4HPJB 3PEUA 4X20B 2QL9A 3GJ8A 1MXFA 1RI5A 1F0YA 1R6VA 4YJ2F 2CMFA 4DADA 4NDAA 3K8OE 1GNPA 2H48A 4JI5B 5CLFA 1TJPB 2D1TA 3TZHA 1P0FA 3W1WA 1KKUA 3CYFA 1SVWA 2YC4C 3I92A 2FRVA 3VSCA 4QATA 4B8YA 3QXGA 3CO5A 4ZN6A 3CO0S 4CEHA 3BCUA 4Q03A 4YJDA 2WMDA 3P20A 1T0IA 5BN5A 3SC3A 1W8DA 4GYWA 1JBKA 2FQXA 1ZM4A 2X3YA 1Q84A 3PXCX 4V39A 2YICA 3BMQA 4CYMA 1R0YA 3FVWA 4IGKA 1Y8ZA 5GY7A 2FZGA 4E5MA 5LPNA 3K7EA 3AONB 2C00A 5ITWA 1SVMA 3IUBA 3ED1A 1Y0BA 3AIMA 3RSCA 1OROA 4KZKA 4AZ0B 4Z5XA 2CK3D 2YY5A 4OQXA 1EAMA 1LDGA 3KZVA 1DMRA 1Q7RA 3PHJA 3M0EA 5DHTA 1QRSA 1YAHA 4BX3A 2FPIA 3ADDA 3TBKA 2QRLA 5IXYA 3UGJA 2FSSA 5JNUA 2XSZA 5KNCH 3C3DA 2PX0A 4LXGA 3WB9A 1DADA 4KEAA 1AKMA 4QFBA 1DELA 2IIVA 3QIVA 4P4NA 4BU1A 5JQGB 4G0MA 3LUHA 3MXTA 1ZLYA 4TWZA 5KOJA 1GA6A 1M72A 2O3JA 5BNFA 4KRYA 4MQEB 3NRJA 2PUFA 3CT4A 3I0MA 4P7GA 2X0DA 3RVJA 1VKOA 4BQFA 1ZK2A 4LV6A 1LBEA 1AQJA 1QP0A 3RB8A 2FPOA 3UK6A 3U5TA 3PEFA 3HI6A 1GG9A 3F7OA 4DV0B 2QWXA 1Z5OA 3T0GA 2GA8A 3T95A 2BP7A 2BTOA 2V5UA 3ABSB 2XLCA 3CKMA 2H4JA 4J1NA 4UTVA 1E8MA 1S8AA 4I4IA 2ZI7A 2FEXA 3H11B 3MPUA 5JMOA 4G5QA 1DLJA 1HKUA 1JECA 1U8UA 2DQYA 3DAHA 3F6CA 2WPDD 4QULA 4YBZA 3RAJA 3SFZA 3WLFA 3QU2A 1PN3A 5IK2D 1MAAA 4N3GA 4D4LA 1ZAYA 4R2LA 1FDUA 4N3BA 5DBFA 4BO3A 2JLSA 2C2OA 1TZMA 4TV8B 4L5BA 1CNFA 3AEQA 1G3RA 4X6YA 4FHZA 3GLTA 5DHAA 1AXRA 3S8MA 5KU1A 3K9HA 1CJKC 2R11A 4BE9A 2SCUB 3ONEA 1PBNA 3GLHE 2CV2A 3K9FC 1QHYA 3A27A 1MG0A 4W1RA 3DBLA 4DC0A 2PU7A 3DE3X 2AJ8A 3Q0IA 3C5HA 2O8EA 4HVLA 1SD2A 3TL3A 3U3ZA 3JZIA 3BDAA 5U1PA 2H1WA 2W58A 3KQVA 3TZCA 2IQ5A 3LA6A 4TTAA 2O48X 2PRJA 2XGSA 4K28A 4PZCA 3UCEA 2Z3ZA 1U5AA 1YR6A 1NW4A 2P4UA 4BNUA 1H66A 4CKZA 1HT3A 2XMRA 1CZNA 5I3CA 1QIJA 2HCFA 5K99A 2C4WA 3BZUA 3BSYA 3H5OA 3LT1A 4R83A 1CLEA 5A0VA 4YJ2A 1FFXA 1X70A 4FEYA 4I1YA 4PTLA 5DDIP 3BFJA 2NTYC 3EQ7A 3PUWA 1KORA 3SFTA 5JSZB 2VSNA 5M2QA 4HN9A 2KJQA 3IIMA 4A6XA 3HVRA 1WDKA 1AQUA 1BWSA 1ZVKA 1U7HA 2OV6A 2FW8A 3BB1A 4WLNA 3K96A 2FNAA 2A5YB 3GB9A 1DT5A 3L2OB 3WGIA 2H3EA 2K4MA 2HF8A 1F38A 3KDPA 1D4ZA 3FETA 1X1RA 3BZBA 3AH8A 2CZQA 3PNOA 3SSMA 3O4GA 2GJKA 3VOTA 3VSEA 5HPYB 1V25A 3DE7X 3HWSA 4EHAA 1TCCA 2EFCB 2QTTA 2WKPA 3KHTA 4QXOA 1S5PA 5CK4A 1Y48E 2GXQA 5CX1B 3FMVA 5CA1B 5FPSA 1XTKA 4AN0A 5IAAA 3HL0A 4HGOA 1RI1A 2J32A 4ZQGA 1YDFA 4QASA 2ZVJA 4YCSA 2GCGA 4IZ6A 1TEHA 1YCFA 1ID1A 3H9CA 1QH9A 3MOIA 3KAKA 3NAMA 3OTIA 1B2RA 4W8OA 1JA1A 4GSYA 1ZMRA 1IRIA 4QGAA 4PW0A 4QHSA 1N5OX 3K31A 2X6QA 2AB0A 3EFHA 2JAHA 1NN3A 3M5DA 2HPVA 3CLHA 1HDEA 3EEOA 5CPBA 3UMFA 4WKBA 1NLYA 1RWXA 3G1WA 6LDHA 4HKTA 5ALUA 3VR4A 3LDHA 1QAQA 2WNSA 1GLGA 3DPSA 1MP0A 4QE3A 4LRWA 4A8JA 3N0XA 3WAKA 1ZONA 3U7QB 2Q1XA 4CMEA 3HKDB 5D6NA 3SNKA 1DIHA 1O7JA 4NMWA 3GN2A 2EWVA 1JIJA 5FWAA 4RTSA 1YNOA 1I5EA 1U0HC 3GY0A 4DB2A 1OBVA 1OBOA 2B92A 1RYYA 4V2IA 4CU5A 3IEXA 2CV1A 2VZEA 3PCRB 5ESRA 5DYNA 2QL6A 1PJTA 4YXWD 4QU0A 2PR7A 3OE1A 3SBOA 1APBA 4QUKA 1FX0A 1P3DA 2QB5A 1TO2E 2VDOB 3GGJA 3PFIA 4BTLA 4Y2UA 4D3ZA 1Z2AA 2QGZA 4AJOA 2IDZA 1NBEA 4W7SA 1RNLA 4NYJR 3SC2A 2OUKA 3T5GA 4D96A 1YDMA 2VK8A 4G9BA 2PMCA 2JAQA 4GSLA 3NHWA 2HMAA 2ZT6A 3ZJTA 1H2YA 5F78A 3WGLA 4ZJYA 4JEMA 2CNOA 5BP7A 2K7FA 1IJKA 4C7MA 3UWMA 1C7QA 1UBRS 3DMTC 2V97A 3HJTA 3KVOA 3Q8KA 4I5DA 3GPCA 4BNWA 1HQDA 5BWMA 6ADHA 3SHFA 2NSYA 3BXGA 2O3UA 1OTYA 2QRNA 3EVZA 4TWAA 3T4EA 1LEHA 1S4MA 4URVR 5CT5A 2NXCA 1JFTA 1WMFA 3ZEIA 2XADA 3NOXA 3PGJA 4J0FA 1RHQA 2PS3A 3RODA 2CN1A 2OAQ1 3Q7EA 1F3OA 3CN9A 5ANRB 3IVXA 3OQNA 1KI8A 1P1FA 3JSXA 1OT3A 4OQEA 4RPKA 1PTJC 1BE1A 3FB4A 1I3NA 2PPVA 2O2CA 2VOEA 3IVRA 4K40A 4KB5A 3FPHA 2IU0A 4D2IA 4ZK2A 3HUDA 1OLOA 5EJ5A 5AHXA 1E5QA 1QTNA 2AHRA 4QDKA 2B35A 4BLVA 2X9NA 4IFTA 3WJAA 3ED5A 4OLHA 1NHGA 5FH9A 4DIBA 4D7AA 4ZI7B 4Z4HA 1OWOA 1CZLA 4HR7A 2O1XA 5JAIA 2Z2ZA 3QQ5A 2FG6C 3CF6R 3Q41A 2QQGA 4GX2A 3ZUPA 1RWVA 4P80A 5INTA 1E3MA 1B1CA 4Q66C 5EZ5A 2P5UA 1UMDA 4LBZA 4Y2JA 1P81A 1Y9DA 5FUYA 3BXEA 1P7WA 3KVYA 3FYCA 4BMCA 4LIPD 3RF6A 4N03A 1G42A 1NFRA 1UWCA 3E61A 4ZMBA 4B0PA 1JHRA 4HDKA 1XX6A 3PVCA 1JALA 4P0TA 1YRAA 1OI7A 1MQ8B 2F17A 4OKSA 4RGVA 3A36A 5FBLB 3U3KA 3LBYA 1WNFA 4BN4A 2ZR9A 4C04A 4LTMA 2UUAB 1KZ1A 4PYKA 4KIWA 2B0JA 5F9HA 1PZFA 4GSKA 1JXAA 1U2SA 3SYTA 1K08A 5LDDC 3KELA 1GQRA 3DW3X 5K3BA 1Y5RA 3FZGA 5K3SA 5HUHA 1CRPA 5BYKA 1KEVA 3LSYA 1S7CA 4RETA 1CULC 2ZIZA 3F90A 2WHEA 4I9FA 3WLLA 2XBMA 2BKLA 4CLXA 1K92A 2GX6A 1UEIA 3A1SA 3DT9A 5CMLA 5BN4A 1ORIA 2AI2A 1VYTA 4YCAA 5CNJA 1G9SA 3WK9A 4XASA 4RKEA 3PLNA 1BU8A 4PQFA 3NZEA 4OLBA 3ZWAA 2F1RA 2OORA 1HYHA 4BZZA 3HTXA 1GTMA 4NTZA 3PWZA 1N7HA 1ZI8A 2X5XA 5FUXA 4UD6A 3THOA 3G7NA 5GM1A 3SSAA 4RYDA 4YACA 3P71T 4RZHA 4EKEA 1POWA 1PUIA 1C4XA 3G1TA 4RH3A 1CZRA 1F6BA 2FR0A 3MGKA 4CT0A 4F56A 8GPBA 1XMIA 1X9GA 4DJDC 1A69A 2IPAB 3SQNA 4EUHA 2PG3A 1U04A 2Q9UA 2RAFA 5AJHA 3LRPA 2V7TA 2E4VA 2X19A 3L01A 4P4LA 1SOAA 1E7MA 3D0OA 4IF6A 1OX5A 4AWBA 4TYQA 2XB6A 2P91A 3ISJA 3RWBA 1XVIA 3OQPA 2C4VA 2AXQA 2GH1A 3FHLA 5LNK6 3ELYA 4R1TA 4ZQCB 1Z75A 4LF4B 1SQGA 4QPZA 2A33A 4TVSA 3HB1A 3P0RA 3P9XA 1TADA 3WLMA 1EP1B 3AY6A 3A6LA 1KRXA 3FLEA 4YC7A 1NVGA 1TTHA 4UMEA 2H2HA 3RVOA 1SN7A 5A3RA 1SA0A 3CH4B 2VUHB 1JTVA 3L6OO 2YFQA 3N2EA 1EFCA 4Z2YA 3DMNA 4L9SA 2PX8A 2VAPA 4CR6A 1Y6FA 4K46A 4BP1A 4NDNE 3R5SA 2H2WA 4JELA 5C3MA 4X54A 3MAJA 4M1EA 4O4JA 4HBGA 1CEEA 1ECLA 2PX4A 3RVMA 3V8NA 3J81A 1R6TA 4NDZA 1WZ2A 1ONBA 1YONA 1DC7A 4F7WA 3DOJA 3BWXA 5JOQA 5GIPE 3TJRA 4EJMA 3IAHA 2WG1A 1O6FA 4DCGA 5IVKA 2RDMA 5IZCA 2GTPA 3CNEA 4DZRA 2I2BA 2VJDA 1VRVA 4RGQA 3BDIA 3NWPA 1EFVA 3LX4A 4LECA 1Y6GA 5ESDA 3KYCB 3D8TA 4Q3CA 1W36B 1ML4A 3DF7A 3GAAA 3P5SA 3T7JA 3VUFA 2YYSA 2OVFA 4NEQA 4I1PA 5DBIA 1LD3A 2TS1A 3JQ8B 4ND6A 1DU4A 4NCXA 4TXHA 3G1UA 2VG8A 3NHJA 2A9OA 4JOQA 4DPMA 3OZSA 2ZFUA 3MLEA 4GVPA 2VT6A 1RBYA 1PJCA 5DHFA 1U98A 1DO8A 1ABFA 4Y9RA 5AKGA 2FCAA 4B7AA 1FC0A 3HSYA 3RC7A 2X3FA 3K72B 2VUUA 4LEIA 3K0SA 4CHTA 3DPIA 1E6EA 4MV7A 2Q5QA 4L8GA 3UJHA 3PQ5A 4BV2A 5JZOA 1F0PA 4DV1B 4BFVA 3LPLA 3PJGA 4IIDA 3V4RA 4GDMA 4YDHB 2C5SA 1QF6A 4DYDA 3OEHA 4W5NA 2X3UA 2PE5A 1SHKA 2NO4A 2RI1A 5GGXA 1IMJA 3KOUA 3I6MA 3U19A 2K2QB 1M1ZA 3KYCA 3G7SA 2CD9A 1G98A 2GQ0A 1EGHA 2TMGA 4ZDWA 1K66A 1SCKA 4DDHA 4BECA 4ZU3A 1PTJA 1T25A 2BKVA 4TLBA 1NQOA 2AIRA 2IIQA 1OIWA 1UBTS 1RWOA 4RACA 1ISPA 2CF5A 3GJ3A 2D59A 2QEQA 2OHOA 2BFOA 1AO3A 5E2AA 3R76A 3TOXA 4ZYXA 3GT7A 1CJUC 1ABBA 4GZ5A 1P75A 4P4SB 1V4VA 3CM0A 3NETA 3W79A 4LFAB 1IB6A 4YAFA 4F12A 2IHNA 4PTZA 1J1IA 2RAPA 2M9MA 4E5KA 2QN2A 5JS8A 4WHMA 1BS9A 4B2LA 3NH9A 2EYUA 5K45A 2XCUA 1EFUA 2ZOSA 3ZHVA 5AESA 1E1MA 1JDJA 3PUYA 4ZVSA 3I05A 2J4FA 2O0JA 3ZCTA 1Q19A 4GZ3A 1YB5A 1WCWA 3VZRA 2DLNA 3BE8A 4A16A 3FMFA 4EVQA 4M46A 1SCUA 4BKMA 3L05A 4QA9A 5J3JA 2H00A 1E5LA 4M60A 5IYZB 3KAPA 3E9RA 4WNYA 4LTDA 4Z9XA 1C7IA 5HS6A 4ZCMA 4S1TA 4OD0A 2W2VA 3BX1A 3EFBA 1CDOA 2ZDQA 2VP2A 4WA7A 1NXSA 2OORC 3OCVA 1OFUA 4RMNA 1S1CA 1C4WA 4N0PA 4QYMA 1ZAKA 4IUCS 5AOAA 1UK7A 1G2QA 1GG8A 3CLRD 3KPJA 4I36A 4MS4A 3ROEA 5C8ZA 2BYTA 3KT0A 9LDTA 4YDRA 5KJ1A 2P27A 3DL7A 1AH2A 1WG8A 2NSHA 2OPHA 5FNZA 3QXCA 3T7KA 5FPYA 4KFUA 1GN9A 2C3PA 3VYTB 3P0IA 1ISMA 1BHO1 2QX8A 3DQQA 2A9RA 2H9YA 1M6VB 1RC8A 1CDEA 3JVVA 5ED0A 5EE9A 1D0VA 2D3TA 4KZPA 2IKSA 5EPUA 4C3UA 3JX9A 2IYYA 2VA9A 2Y2VA 3GL9A 2D5BA 4HNAA 1KR2A 4CKEA 2OSBA 1XLWA 2YCLA 2ERYA 4D9MA 2LKCA 4LF8B 3FR7A 2JJ8A 3RSZA 2P9BA 1A88A 5C37A 4L0DA 4YQEA 2GCEA 3L4BA 3FUUA 3L4BC 4IS2A 4DC9A 4F8EA 2UYYA 1FBTA 1UDRA 1JQBA 4KQMA 4X84A 3NASA 1KDZA 2AR9A 3AZQA 1E94E 5FOWA 4DRXA 3RK0A 5ICSA 1UXOA 2HSZA 1MAWA 1R12A 2BKEA 2DH5A 4XVUA 1YACA 3WB1A 3E2PA 4OA5A 1R00A 1LPNA 2ATEA 2V5AA 4ZQFA 1IM5A 2WG0A 3V4PB 1N3LA 5ECWA 5C7IO 2AOUB 3PL1A 2Z4RA 1U3DA 1QVAA 4H0CA 5AT1A 1OLSA 2ZJ5A 1GR1A 1HEIA 3UXHA 5LQNA 3SC4A 1JPNA 2ZW9A 1VPVA 5I4BA 1FSPA 4OQQA 2BT4A 3IDZA 4TMYA 2GT1A 2R66A 4L51A 2Z6UA 1AHHA 4HAZA 1WCXA 3CTPA 2NZVG 3WC4A 1NVDA 1D2HA 4DF3A 5CA1F 3D3QA 4A2QA 2R1UA 3PC4A 2NU7A 1S2OA 4K9DA 2ZS7A 4I8IA 1MC4A 4D0LB 2V55B 2ZBEA 3RS2A 1KOLA 2B7CA 1U0LA 3U16A 3MTJA 4UOEA 4P58A 1H6AA 5DN9A 4D8XA 3DMTA 5F7JA 1H8ED 4DA8A 3LIPA 2ZAGA 3EWIA 3IR6A 4RORA 1JHVA 1L4YA 1M2HA 2XNKA 3JQ6A 4HZUB 4JAVC 5COAA 3JQAA 4BHTA 3TCKA 4D4HA 3AIKA 3KSRA 4DLTA 4EPRA 5BV2P 1JQ3A 3F67A 3F78A 3IEVA 4RZ2A 3UTDA 2OFOA 1EB8A 1J9ZA 1ISGA 1XWIA 4DT1A 6YASA 2G4VA 1H2XA 3MCUA 2HW8A 2JJQA 1GCAA 3BA6A 3FX2A 1C7ZA 1CU1A 2WSSA 4RVOA 1P7CA 2IPXA 4ZD6A 3TTWA 4F3TA 3C8ZA 5AJWA 1Q2XA 1M2WA 3IOCA 3M6LA 3QV1A 4CM8B 2JJYA 1FFSA 3TSYA 4C6HA 4L3OA 3H5VA 2REQB 5KOJB 2C92A 2ZJ4A 3OOYA 1WBDA 1KY3A 1ZD2P 5K01A 2NU7B 2O1WA 3E0XA 3WJ2A 2MSDB 2P1RA 3CLSC 2OCYC 1H4TA 2ONJA 3RQIA 3QTLA 2C1ZA 4E33A 1BMFA 4CM9A 5KTRA 3JAMA 2QTFA 3KQLA 2Y0EA 2NVOA 1E20A 4AECA 1DEHA 4B5KA 2X0EA 4C1NA 1QO0A 2NTEA 1JSXA 3PDIB 4BUZA 1E4OA 2Y1WA 1OXUA 4PR3A 5I9LA 4H7KA 1Z8DA 5ITSA 5LZ5A 4CLHA 1I01A 3AUTA 1H2WA 1QDLB 1RWBA 2AX4A 3CX4A 3Q9SA 4TV8F 4EA6A 4UNQA 2GNPA 4ZCTA 2PMWB 5BR4A 4MI6A 5B6JA 2Q2OA 3TNFA 2AJDA 1DZIA 3VC3A 1E4EB 1IY8A 2JAXA 2TMYA 1C30A 3E9DA 4IF4A 4GW3A 1G19A 2HLNA 5LYYA 3GFGA 1QRUA 5AVXA 3E5HA 1KVUA 1KFEB 3NPAA 5DLEA 3PRJA 3ZZUA 1PT9A 3CCCA 4UMFA 5IVDA 1BSVA 1ULAA 3LS2A 3ORRA 5AVZA 1T24A 1V5FA 3GLRA 4PBTA 3Q40A 3DOCA 4K9RA 4A26A 2RB5A 4L8VA 2BR4A 1D5CA 3C1TA 4QYTA 3PDIA 1USIA 4HEA1 4K6MA 2V1XA 3TR0A 1ST3A 1GZ6A 1XLVA 3ZVRA 1G41A 2DF8A 3CISA 3OEEA 1O95C 2VJMA 2G82A 3Q6IA 1ZGGA 2GJ8A 1MJFA 3UUFA 2R6GA 4IJQA 2BMAA 1SUEA 2ST1A 1MO6A 1J8MF 2QUBA 5D87A 1W4RA 3Q6NA 4IIEA 2ZULA 3VDQA 3AF0A 3WGGA 3H5NA 5C7YA 2PLRA 5LN1A 2WK1A 1EP2B 4EYKA 4PN7A 4CM4B 1DTWB 2F1JA 5TMPA 1FFXB 1PL0A 2H6EA 3W8FA 4A5OA 3OPYA 1GG5A 2AZ4A 4HUJA 5EA2A 1H42A 2CSXA 4HRAA 2R62A 4GMGA 1AKEA 5CX1A 5CA1A 4KX3A 2ZB2A 4J1TC 1TYEB 1G4AE 1K86A 2B7BA 4G1VA 3NWOA 3ZHCA 2FFBA 4IHQA 2XB8A 3OZAA 4KXYA 2FPUA 4EPXA 3EHEA 3E8MA 3LP8A 2Q5LA 1C5KA 4EG5A 4KN8A 2CDBA 5IC5A 4BGDA 2N75A 1KI6B 2ADMA 1CDZA 1BE0A 4KU4A 1E2NA 3ZZNA 3KQHA 1FJ2A 1T5BA 4ILEA 1QS0B 3ET4A 1KO4A 1YA4A 2Z5VA 3IAM6 3OIFA 4KXQA 5B4TA 1IN7A 1PSWA 4ZAGA 1HBJA 5JWOA 1Y37A 1LWOA 1BXRB 1L5HA 2WWXA 4PZ9A 5KSWB 3I6QA 2GHQA 3H4VA 1ECJA 1GUBA 3BH7A 4HTAA 4HG2A 3ZBQA 3ZCVA 4EJ0A 3ETGA 3O38A 4HWGA 3SEZA 3VKGA 3D6JA 3RV3A 2CCJA 5CVJA 1S1MA 1T15A 1PV2A 1UBEA 2YV4A 3GCXA 2K2WA 1Y7TA 4MRRA 4UULA 4UU1A 1Q1NA 4QOJA 1R2QA 3FNFA 4BB6A 2DBRA 1N6KA 1YHYA 3ZTWA 2X4LA 2R6JA 1KBQA 3LY8A 2YNMD 3EXHB 5JS2A 4O1IA 5DSXA 2FSUA 3H2GA 1LGYA 4X91A 4DOMA 4MVJD 1N5DA 2NADA 2GPAA 1EM6A 3K9NA 1C8LA 3TQIA 4B4VA 1FQJA 1X15A 2PT9A 1GNLA 1H0SA 3OZBA 3PE4A 2WA2A 5DLYA 5DOZA 4RPHA 1PQPA 1W96A 1PD1A 2X4IA 3GNTA 4EGFA 3PC6A 2WSMA 1XEWY 1GEEA 2IF0A 3EVCA 3M6XA 3A1EA 2PUJA 4TVBA 2I7XA 1U6KA 1C4KA 1ESCA 2MSNA 2XE7A 4L5CA 2REXB 5CGQB 2PBFA 4YGXB 1RSZA 5F52A 5ADWA 1SVSA 1UC4B 2NWQA 1IMOA 3CBGA 3OU7A 3W5VA 3IIKA 1OBCA 1CP2A 4OP1A 1CRZA 4DA7A 1L7RA 1IU9A 1C8VB 4JQZA 4BB9A 1V3VA 4DM7A 4ENQA 3RE1A 4ZYZA 2R65A 1HDIA 4LDPA 4RHCA 4AWAA 2ILVA 4UVHA 4PYIA 1XZQA 4LZWA 4NR0A 3I62A 1P39A 5IDQA 2I3ZA 4IM7A 3RYFB 4M0DA 3JQBA 5A4DA 1FNBA 2YRWA 5FIUA 1P45A 1WXDA 3KYIB 4M9XA 4E5UA 4X45A 4FE3A 3P97A 2IHUA 5ALHA 5ADVA 3S40A 2F4VB 4YT8A 3T7CA 1ZD5A 1JMYA 3PHLA 1R6XA 2WJ3A 5EWMA 3X3HA 2HIHA 1YIOA 3UXMA 2C5AA 3I04M 4DCVA 2AE2A 3NHPA 1BKSB 2DJIA 4B2PA 2ENWA 2ZE8A 5K2OA 2AR7A 4L16A 2JLQA 2Q5OA 5C18A 5IJZA 1GKUB 5C4GB 2FP4B 5JEEA 3PEVA 4Q7KA 4Y2VA 1B42A 1SU8A 4QPJC 1PG5A 5AI5A 5ARCA 2QTWB 2I1VB 1RTKA 1I4WA 3AYXB 3HY3A 5AI6A 2QJTA 1NI4A 4MVCA 4CDMA 2ZVPX 2UVPA 4IDGA 2GS9A 4MGEA 5BW8A 3AFGA 5BUZA 2J9RA 2W2KB 2PO5A 4QLOA 4JOCA 3T3GA 1IZ7A 1K6JA 2RB4A 4PG7A 4W5QA 3C3EA 3HCAA 1L1EA 3W2HA 3FZNA 4JCCA 1Z4JA 4RXMA 5KYYB 3L5KA 2Q9CA 2P9QA 2YWEA 3O26A 3OWOA 4YJKA 3TLMA 1Z5ZA 3HNRA 2WTEA 2BHSA 2YWDA 2DAPA 4Q7JB 4TTVA 2A67A 1EGAA 1TO1E 2BFWA 1M74A 4OHXA 1LS1A 1VL6A 5ICGA 1TMKA 1UR5A 1S0UA 1E3TA 5SY4A 3UOGA 5I9IA 2JLZA 5LUBA 3ZDCA 4JC0A 4X85A 5HF6A 1M66A 4FK8A 4QOHA 1G21B 3H2ZA 4WY2A 1G5RA 3FRHA 3TRFA 3UJBA 2LGJA 4G8BA 5M29A 1PQYA 2ONYA 2P6RA 3VJKA 3G9ZA 2VAMA 1Z16A 2LBPA 5AVOA 3BJMA 1OXXK 1X77A 2ZIEA 1PZMA 2RHBA 4MWEA 3TI9A 3A1DA 4UBNA 1PFQA 1P1IA 5JSZA 1K4KA 4KPYA 2JFUA 2YMLA 4LX0A 4B0OA 5ELXA 1BXZA 1F2DA 4H4EA 5BNWA 2ZTHA 2Y1FA 3CNNA 1MOPA 3FCSB 3ZOZA 3GJQA 1K4MA 3CX8A 3NEAA 1YJQA 2R6ZA 3BMNB 5DM4A 1ZD8A 3ESBA 1VSVA 6ABPA 4CDRA 3NAGA 4H27A 1JF8A 3HR8A 1RQRA 3V9PA 2J31A 5K4HA 2YHIA 5IKXA 4DBLE 4L5AA 4I4LA 1E79D 3H4IA 4DILA 2KBFA 3B6ZA 2KSQA 1S2MA 4I1VA 4NBNA 4G25A 1J1ZA 3ENWA 4TTTS 3I3SR 5CVUA 4MAFA 5HQ3A 2RGNC 1FVFA 1NBWB 4YX9A 1FYFA 5HBRA 1I3KA 2JD0A 3LFTA 4GU5A 4OU5A 4WKGA 3TZBA 1FRQA 5TB5A 3PUZA 3VSDA 1XTTA 2FPGB 1PG2A 2J5KA 4AJ2A 2V6JA 1XD8A 2R8OA 2N3ZA 1NHWA 4ZGWA 1WBBA 3MRSA 1LDNA 4UTPA 4TT3D 3PR3A 4IZHA 2WSSD 4C5CA 4O02B 4OBWA 5CB8A 2WT4A 5JFOA 4UPDA 1IFXA 4PLPA 3QLEA 2QUKA 5HDQA 3T1OA 2D5CA 5A9RA 2HXGA 2D4AA 4GBGA 3BSSA 1CXZA 1KMIY 2GKSA 1VMKA 3ESDA 1SA0B 3I39X 2A0KA 3UJ8A 3MYYA 1VBNA 1XU4A 3NUGA 4FU0A 3AI1A 3UW1A 4BKRA 2ASVA 4NCIA 1G5PA 5JNSA 2VLIA 4CM5A 2PWBA 1HUQA 3F6EX 5DNYB 5TGDA 1XEXA 2ZCVA 4KBYA 1K8QA 2I2WA 4ZCPA 4DJEC 1QIKA 4W5TA 3OZDA 1J20A 5ECGC 4DBLC 4EO7A 2I67A 4TXMA 3K71B 1GGFA 1H23A 1YQ9A 4JN6B 4YT2A 4IIFA 1V95A 3R40A 2CYBA 1G59A 3C74A 1Z45A 4EBBA 2VBCA 1ATZA 2H2AA 3C7AA 3F5QA 1V48A 3LDUA 3HNOA 1KE1A 1DZ3A 5IBPA 1VL8A 3UMVA 4FCVA 3I2GA 3EE6A 1TVCA 2OBXA 2Q2VA 1JSZA 2Q29A 1ECBA 4TN1A 3LNCA 2UUOA 4NBTA 2I3DA 3KOMA 3T1HB 1GPLA 1D1PA 5CEEA 5IVHA 3UPUA 2C4KA 2XAAA 1YQUA 2HA2A 2OO7A 1QKJA 3QELB 1H2FA 2EYQA 2R00C 3COYA 1NMYA 4M99A 1EU1A 3CH6A 5GZ3A 3V8QA 2HUPA 1YXMA 2XNSA 4E51A 3H42B 1ONSA 4OI0A 4L9RA 2FN3A 3PQ3A 4G2TA 3AHGA 4BCCA 3SD7A 4FFMA 1SRQA 2XW6A 2AMYA 3KBBA 2B8NA 1S4QA 2QQ5A 4KQFA 1L5KA 3V32A 1PS8A 4LHVA 4XD7D 2W83A 2IKQA 1WVMA 1NMZA 4XVQA 3K1AB 2RSLA 3RANA 4KR2A 5HVNA 2JH3A 4C4XA 2PRYA 3OOSA 2DX7A 3GR6A 5JXGA 2HPHA 1A5ZA 1QYCA 3EK2A 3OOWA 1GZSA 3IT2A 4MROA 1JRLA 3M7IA 4HO1X 2WHRA 1U90A 3N2NA 3MCAA 3FTQA 4K9MA 2IIBA 2QRKA 3KKKA 3OF3A 1LLFA 3PT5A 2O8BA 2VP4A 4DMFA 1E2EA 3BB3A 1HX7A 2CJYA 4PS1A 4CF3A 2A4KA 4NK5A 4Y2SA 1IULA 1HZZA 3CVXA 4ID3A 3BTSA 5IHPA 3KKOA 3K5IA 4U39A 1IN4A 2V7QD 1F7UA 1YQQA 2CVZA 2PCLA 4F5YA 4EY4A 4UTXA 2YVKA 3AM3A 4UOZA 4CKCA 3WGOA 1VRWA 3F5FA 4Y6PA 3QA9A 1IK4A 1DC8A 1TX4B 5H9VA 1WY7A 5K8CA 1TNDA 1FSFA 4L22A 2AA3A 4Z54A 5LQJA 1USUA 1HE5A 3C97A 1RHMA 3I4FA 1FVOA 5EIWA 3OZXA 3HWWA 2CE2X 4J49A 3ILHA 1QWOA 2ILTA 2YV3A 4MUGA 3ML1A 3SDZA 3I6YA 5DT9A 2CFOA 2J9GA 1EVZA 3KQPA 5HCUA 4PAQA 1VBMA 5HE9A 2ZSIA 2BC9A 3O4RA 2G5CA 4GXRA 1NZJA 5TLSA 1QHFA 4RLSA 1P7VA 2JASA 2TMDA 1M5UA 5HQJA 3KJZA 3PQEA 3QENA 4N39A 3FOCA 4IW3B 1JGTA 2LW7A 4A0HA 4PIVA 1CY4A 3WKEA 2G3YA 5AJYA 4I9UA 1AGRA 2LV8A 3LUPA 1VB5A 4UNRA 4C2TA 1KH1A 1R1DA 1JQEA 2H4ZA 3QNWA 3OOEA 3R0QA 1NSFA 3MMZA 3W7BA 3SX0A 2CFIA 5FFMA 7MHTA 2OGZA 2I6TA 1RQGA 1WCIB 2J6CA 2F6RA 3DVQX 3S7ZA 2D7JA 3IVCA 5H5JA 1ZEJA 3TSZA 1B15A 2I0FA 1QYWA 2QE6A 1Q1BA 1C1DB 1PJSA 1UJ5A 1EUZA 2YQ4A 2ZP1A 3H04A 3QFHA 2C3YA 3VH2A 5K6TA 3NW9A 3N07A 1WR8A 4LMPA 2JLYA 3N5CA 4BIMA 2ID7A 4MAMA 3FCUB 5AW5A 4EB8A 3TTYA 3O5AA 4HS4A 1EDEA 4LJ6A 5L7YA 3NP9A 3FTCA 4ARSA 4MWZA 3CVJA 3SPXA 1G8YA 3M3PA 2Q9AA 4TRRA 2J41A 3N9IA 5C8VA 4N0QA 2R87A 4QTZA 1ZMXA 1N2XA 2V59A 3HMKA 3HDQA 3M5PA 2VKTA 2JJ2D 4O4JB 2GTIA 3IEIA 4K6OA 2ID8A 4JMLA 1G5HA 3AG5A 4ETNA 2XKBA 3DPUA 2OYRA 4DUPA 5CYGA 3MVEA 4U6SA 5M3BA 1XHEA 3VMFA 4MQMA 1XAGA 2I55A 5IXJA 3KVVA 1KF0A 4MVYA 2QJFA 2AWNA 2BGRA 3AF4A 4OHFA 1WXEA 5H3LA 4CUZA 5KHOC 5KHAA 4PEVA 3OBBA 4ARVA 3EUFA 3L82B 1VIMA 1OAAA 1WMDA 4AWXA 4B3XA 4XZ3A 3RTGA 2XUZA 4ZVPA 3AP3A 2MSLA 2XKJE 2Q3FA 1B3RA 2Q3CA 5KSZA 1GTVA 1HORA 1KP9A 2YVQA 4RU1A 3A28A 3L8ZA 1OVGA 1DBPA 4TSKA 4UBLA 4YALA 4H08A 1B43A 5I7HA 1PL7A 1V1RB 4GMHA 1FTYA 1DO0A 2RHHA 4GBJA 3IERA 4HWKA 1USVA 1M0EA 2J5QA 4ZVVA 5DGDA 2ZRAA 3QMPA 3V7FA 1QX4A 4OQYA 4JEHA 4PLWA 4N8DA 3CZ9A 3RYCA 1NR1A 2RG1A 3QVOA 4TZTA 3SBXA 3ST7A 4BJ3A 2GZMA 1MJ5A 1NXTA 3I9JA 2LP4Y 3TQCA 3W6ZA 1J21A 1ORHA 1P72A 1J2JA 1GSAA 1JQJC 3ZE1B 3A9VA 4EPWA 2QSYA 3BE6A 3GZJA 2PZ8A 5ES3A 1OZFA 3H0CA 1Q20A 1RM4A 2HADA 3C8HA 3CIOA 3SXUB 2IXDA 3EG9B 4MWGA 4OGLA 4QYXA 4Y6RA 4RHUA 1BDBA 4M53A 1H2RS 1QK3A 2NZ2A 5H3HA 2M6LA 2D2XA 2IEZA 2AHOA 3QIAA 4LGCA 5JYDA 3FR8A 1TC1A 4M0EA 3CPJB 3O9MA 3C6MA 3LKBA 5BWOA 2FMFA 2VJQA 1XD2A 4HLNA 1A7JA 1UJCA 3OSZA 2YDXA 4DLVA 1NP7A 2ZTMA 4MH0R 2K87A 2ACVA 3C4VA 2IP1A 3JAKA 4NU5A 3KVRA 1A82A 3VR3A 4FX2A 1GGKA 1PDVA 1U81A 2XOKD 3H1AA 4WWHA 4YJFB 4GBMA 4Y6QA 4MLCA 5F12A 2HA3A 2VHTA 3KZXA 1FDRA 1SU7A 4CZ2A 4Y2QA 1E1KA 3DOUA 1QV7A 1U6JA 2H7CA 4ENUA 4JVMA 4O2BA 2OOSA 4U6QA 3QFSA 3G8CA 3HM2A 4URYR 5F2OA 1JA9A 3N0TA 3CHYA 3W5UA 4C6SA 2I3GA 3U2QA 1MV8A 1ZMBA 2ZRFA 3D4LA 1G8HA 5TV2A 1GPUA 1CFZA 3D6UA 2GEJA 1ZWKA 3I5MA 4X20A 3LPAA 4MW5A 4C2AA 1TZJA 1Q11A 1YOBA 2GD2A 2H4XA 2BEVA 1F8FA 1IDN1 1AKTA 4ENVA 2NAFA 1YHNA 1KYIA 3Q2OA 2AW5A 4URHA 4GRDA 4R69A 5JFTA 2QVXX 5GZ1A 1YR8A 2ZR8A 2KX7A 1E7SA 2PZEA 5JXHA 4G4JA 4C4SA 1C50A 1W6RA 2AMJA 2WJ4A 2ZJZA 2IWHA 3GPDG 4EFLA 1KMMA 1KJJA 3L8GA 4BZWA 3BN3A 1OWMA 4CKXA 3HYRA 3WRXC 2JS7A 2YHBA 4RS4A 4KPGA 1GZ5A 3WO1A 1M2OB 4EQ6A 4POOA 2LTAA 2GILA 4NAVA 1MOSA 2JAOA 2HC9A 2QS9A 2JI4A 3DF9A 3M2PA 4ZCSA 4AZ0A 4ICIA 4HP8A 3CZMA 1BQEA 1FNCA 2GK4A 1ZMTA 2XTZA 3B5JA 3HN2A 4FNGA 4LJ5A 1CJMA 5EEGA 2R0QC 1M6NA 4A73A 4CFSA 2B4RO 5G40A 3M1LA 1J33A 1RXVA 3FYHA 2B6NA 2AOUA 2E3JA 4DUZB 1XNRB 2QTMA 3FOAA 3OUUA 2Q4TA 1NU8A 2KYRA 4RF5A 3U0BA 3PT9A 5JSQA 2NG1A 3PRHA 4MQEA 4X7PA 1R8XA 5AW2A 1NY5A 4ONEA 1FFHA 3HSSA 4Q3DA 3KLMX 3RUDA 3UANA 1E1LA 3P7MA 3LK7A 2QUZA 4E2YA 1D8AA 2OCIA 2BFFB 3T9DA 1XCJA 4DLLA 2BDEA 1HL7A 1BN7A 2BGTA 3JQCA 3LHDA 4MR8A 3EUAA 7ABPA 3RRBA 3ZU5A 5L95A 1WW2A 3SJBA 1AUPA 1OI3A 2IZOA 4J90A 5BSVA 1ZSVA 2O2IA 4HAIA 1QGUB 3E70C 4XR4A 5KTYA 1EJ6A 5DULA 3E23A 1G6KA 2B94A 3GDWA 3JWGA 3MUOA 3HKBA 2NUTB 4J76A 4LYEA 4OXKA 1M2JA 5EXTA 4EMBA 1NOIA 4RCVA 3NYIA 1T1JA 4GL2A 2VXOA 1VI5A 1O0BA 1RJDA 1E7RA 3LZ6A 3AR8A 3QKUA 1ZINA 3PUXA 5EYPA 4F6RB 5I7VA 1E3JA 3BHJA 1N2CB 2YBEA 4K6FA 3RVKA 1CUWA 1UBOS 2EQBA 3FH0A 5K3DA 2Z2XA 1FTSA 4EEXA 1FNSA 3SYRA 3IBFA 4HDRA 4CM6A 2RARA 1G18A 1DUVG 2SCUA 3IQFA 3MFYA 2P1ZA 3EDYA 4DYVA 5A2QA 3UT5B 1BRTA 3GVXA 5L3ZA 4MWBA 1J7JA 1JA0A 4IDQA 1BU5A 4BLPA 2A1IA 2EBFX 4CV1A 2OYCA 3UWDA 2J9XB 3IO5A 1FXWF 4HDMB 4IL5A 4O2BF 4D5EA 4MR7B 1IXZA 1XKLA 4FT2A 4I1IA 4I8DA 4YH1A 3ENZA 3U3OA 1YVEI 2VJKA 4E11A 2E4ZA 4W7IA 1S3GA 1MU0A 3HKBB 2NUTA 1XMPA 3DOHA 4TKVB 5EY5B 2PSJA 4BNFA 5ALLA 4PC2A 4WX2B 1IOZA 2PJZA 3PHCA 2Y9PB 4PLFA 3Q85A 2G9RA 1AGNA 4C4TA 2ETVA 4QHTA 3EODA 8ADHA 3V80A 3DM5A 5GIOE 3OLYA 5EYPB 3GFVA 2HO5A 3QPCA 2RGWA 4E1BA 4DV6B 3AFOA 4LHZA 4YQYA 1PZXA 4LJYA 3TX6A 4J4HA 3MWKA 3WDMA 1F2TA 1U5CA 4RKQA 5I5GA 4J29A 2QV7A 4PZLA 2E37A 4BMYA 1JSLA 1M8JA 3CA8A 1TM2A 1SUWA 4EUFA 1VGQA 1E7YA 5KNBD 1QIMA 4K1XA 1H3NA 1EM8A 1XZIA 3BRWA 2W93A 1CUXA 1JX6A 3ZQ6A 1RADA 5FV7A 1BW9B 4BGIA 4NFSA 4HF7A 4YUYA 3QE9Y 3K4PA 1N33B 5AR1A 2WWHA 2GFHA 2VYFA 3VVMA 4RSRA 5A9SA 3R09A 1O1YA 1F8GA 2IV3A 1I24A 3EIOA 3IT1A 3HJNA 4XSHA 4MUFA 5ELLA 5EP4A 2QT1A 1YQGA 4FDVA 1DKLA 1DWUA 4KWCA 1V4BA 4MZXA 2JJ2A 3IHTA 1JS1X 1RFLA 2I1QA 3UV3A 1KDRA 4P0QB 1GTZA 4GPD1 3WTBA 4UOQA 4U5XA 5JALA 3VRHA 1YS6A 2O4UX 2JHFA 5EJEA 3ADKA 3BHIA 4JVNA 1SKBA 2DTDA 1LFAA 3L1HA 4YRQA 1SNYA 1VJ5A 3E5NA 3HVIA 4CW7A 3FVTA 4UAJA 2FHSA 1T1IA 4MV0A 4WXRA 3TQRA 5FWNA 5DOVA 3QX7A 3ZKWB 1LBQA 2QDXA 2W11A 2J0QA 1SZDA 4JDPA 5HRCA 3WSVA 1G8SA 1HK7A 5FTMA 5I7OA 5JT1A 4M6WB 4O8ZA 4MOWA 2G06A 5F3DA 4DRYA 1W4ZA 1HH4A 4A8HA 1IQPA 4C08A 2UU9B 3LQFA 2XCSB 2WF6A 3TLEA 2IYUA 2GN8A 5CHEA 4GXTA 5JTUA 4F4JA 3RAFC 1DJPA 3HG7A 4Q4LA 2OYSA 3M83A 1Z37A 4PYQA 5HKOA 4FYIA 2RGNA 3EEQA 1KS9A 1YK0A 3HJGA 2R96A 2ZQYA 2ZJOA 5JDCC 2QRMA 3U09A 1L8QA 2PSEA 2P35A 4CV3A 5GP1A 1ZJWA 1G38A 5FADA 2BTQA 4IIJA 3M81A 4NZNA 3PWSA 1E3EA 2WHPA 3KQWA 1D2AA 3BAFA 4JP8A 4X1KA 5LLTA 2O8CB 1W4AA 1TK9A 1QGAA 1P7PA 1EGVB 4DMMA 1FXWA 2HCTA 3AM5A 3VR6H 1J09A 3D5QA 4BKOA 3P1JA 2J3KA 5KO2A 5LA6A 4OF4A 3IOYA 5JEDA 1VG8A 4DQUA 3QJYA 5JC1A 2QTNA 1D1TA 4IOKA 1LK7A 1V9SA 3P0HA 2HRRA 5KX5A 1I7QB 1MHPA 3D31A 4B31A 3R5HA 1F20A 3OPQA 5E95A 4HQRA 3GA0A 4YRLA 4ZPXA 4YV0A 4O5AA 5FQOA 4DWJA 1XZGA 3E9MA 5AYVA 2NU9B 3DE5X 4ZZ1A 3G49A 4M1QA 4UHHA 3CPHA 4D6XA 1YE3A 1QV9A 3KFXA 4GX1A 1FU8A 3F7TA 4QPDA 2Q5JA 2WTNA 3ABQB 3FLAA 5IW8A 3RTAA 5SZHB 1D04A 2HMTA 5ALDA 4AY3A 3SM3A 3WIBA 1V6AA 3JYNA 3Q3EA 1EDBA 2AJBA 4XX1A 3OCWA 4RQTA 3D7LA 3E1GA 2HNKA 3GUHA 4NYMR 5IT4A 1Z6PA 2APJA 2H07A 1NKSA 3T1TA 3G68A 2XH8A 1BOOA 1THZA 4HZIA 3ZDFA 1P4HA 2ODWA 3TRDA 4B2IA 4LJ8A 1QTIA 2R5NA 1A72A 1X74A 3STHA 2BMFA 3NM5A 1NDUA 2FR8C 3OJLA 2WE8A 4HTFA 2YVLA 4FFRA 4IHKA 1VIVA 2GETA 2P2NA 4LRXA 2CB9A 3WHPA 3E9YA 3RIYA 4QJ5A 2KWIA 1I4DD 1O0SA 2Y0BA 1RXYA 3OPYI 5AKXA 3SNHA 1ETUA 3LPCA 4Q1CA 2LE0A 3R6DA 4BDSA 2V98A 2VDJA 5REQB 2PSFA 3ZX5A 2ZTUA 2QMZA 2FMTA 1NX9A 1RM3A 1KMHB 5E9QA 2G67A 1C0LA 1SZJG 1IVYA 1C7RA 1RE0A 2AS0A 2BIFA 3KKEA 3BJIC 5HKBA 3S81A 2PGNA 1Z63A 1G2IA 2DUUA 2YJ4A 4BB5A 2AFHE 5KREA 3JWJA 4BJHB 1L7DA 1RMYA 2VQDA 3MJVA 2ZZMA 3PPIA 4DR6B 5DF1A 4GMXA 3ER8A 4FJ1A 1Z5GA 1UEXC 1CZHA 3R41A 2Q6VA 4U2EA 1M1YE 4E0BA 4UE3S 5BSWA 521PA 3K9GA 5GTDA 1H65A 4FB4A 3VU1A 3W7AA 2SICE 2B9VA 3NV9A 4L8FA 4F4UA 2QF7A 5IDXA 2Z6QA 3ZNQA 1BA3A 4DVGA 3E9CA 1N8NA 3CNBA 3HL4A 4RIGA 5AXAA 3ZWBA 1NT2A 1MG5A 2IE0A 1H22A 2O54A 1NMEA 3RVLA 3RJZA 3W9BA 3T7SA 1HE1C 1E32A 3C6KA 3RYIA 3H9UA 3UA4A 3KZOA 3STUA 2CVOA 1MDBA 2QMYA 1CZKA 3SQMA 3K30A 4OFZA 3A10A 4PLHA 4OEHA 1MORA 1QYXA 2PA3A 2QPOA 4YIKA 3U7EB 5CCEA 5JZ9A 4X66B 2ZJ2A 3KR0A 3JD0A 1Y4AE 4Z4EA 1PHPA 2AKEA 2OBNA 3NO4A 2UYOA 3AL0C 1RYNA 2IYTA 4BN5A 4R1PA 1IZ9A 2EFHB 3DZKA 5CLLA 3WX0A 2IEIA 3IBTA 4C21A 4DNQA 3AF1A 4EG0A 2ZPAA 2PN1A 1IN1A 5LA6F 4JH0A 1DEXA 5LP6C 5A3QA 4U7WA 5D00A 3ASZA 3RU2A 1K6IA 1XRQA 4DC1A 3CEPB 3KDAA 4F4DA 1IL0A 4RCZA 1GTL1 4MS1A 4C7BA 4DSZA 1FFGA 1TRKA 1B4DA 3F5SA 1KJ9A 1KS2A 4GP9A 4E2FA 2AFRA 3K2EA 4KDCA 1JVBA 1LW6E 1NW5A 1G1MA 2XGOA 1MVNA 5JVDA 3MYRA 1ZN9A 1GZVA 3ICVA 1XZKA 4B74A 1G5IA 3B13B 1HMYA 1OH8A 1WZEA 3HHEA 5E38A 2X58A 1Q1GA 1ZHHA 1X7WA 3IP7A 1F6DA 1OQAA 2CT8A 1N0HA 1H4QA 2QY9A 3AR7A 1DV1A 4GE0A 2PZBA 1EUCB 3C45A 5EMNA 2JK0A 4Y6GB 4ALJA 4DQLA 3F4LA 1XL1A 3R6TA 4AM8A 1U0EA 3QWBA 1QUFA 5EWJA 2MYNA 3MTGA 3NM6B 3RF7A 3PFHA 3L8CA 3TIVA 1J9GA 3OQBA 4FKBA 3RK4A 5JROA 4GDFA 1TAHA 4OFXA 1G6HA 1JFLA 3HUEA 4QD3A 1X0VA 1S3SA 1GZUA 2QN1A 4NCKA 4B6SA 3A4IA 2VHEA 2ZRBA 1EYZA 3LLUA 1O5IA 3R3XA 2X6TA 4Q7MB 5CLGA 5SZIA 3QPVA 1Y9AA 4DM3A 1Z5PA 4P08A 4BLTA 3G0GA 5FKJA 5TMEA 4ZDIA 1EWRA 5DH9A 2G4LA 3NTVA 4OA8A 2OHVA 2AOWA 1X1EA 1K7EB 2B7LA 2ZI9A 3LBNA 3WICA 4TZ0A 1SQ0A 4ASUD 1LDMA 1THTA 4KX5A 3CVYA 2IXGA 1KI2A 3TNYA 3OG9A 4CLOB 1YS7A 1O95A 3H1GA 2F43A 1V8DA 2J7KA 4ABYA 5IABA 1V8PA 1U2RA 5LXTA 5ETJA 3G5LA 2XXJA 3RGGA 1N5RA 4A15A 4E1AA 4HQNA 3RC1A 2YZMA 4ALNA 1II8A 1UFQA 1NVKA 2NZUG 2W2QA 1IZZA 2JVIA 4RTLA 4DR4B 2ZM5A 2JCSA 2O2EA 4WIAA 1R8SA 3QLJA 3LQRA 1VSUA 4LSWA 4B3SB 1NJ5A 1C9JA 4KKXB 4XJTA 3RS3A 4D46A 2P30A 1YT5A 1T5IA 3PGMA 4L0CA 3RDPA 3PTLA 1O5TA 3S2GA 3X1DA 5K0CA 3GCWA 2RCYA 5CVDA 3UV6A 3QITA 4R1UA 3PNPA 4G1CA 2D4HA 3FFTA 3HGTA 4W99A 3WNDA 2UUCB 3RFXA 3D8BA 1E3WA 3B5EA 3W9SA 4RJIA 5K6AC 3AU8A 2QE7A 1GL6A 3H3FA 4JLDA 2XSZD 1AGXA 4BVBA 4DXAA 1Z0SA 1C14A 2JK1A 1KK3A 1XDGA 4HQ0A 4JLJA 4JQCA 4OLFA 4PR0A 2WIJA 4R1SA 1X8JA 4QDTA 1GDTA 2QRUA 3O8OB 4XIJA 7AT1A 3TNLA 1AGYA 2JKZA 3HV2A 1QFMA 3K5PA 3VR5A 4ZREA 1M2VB 2GHRA 2JBAA 2TECE 1YL6A 1TI7A 2DP4E 4PSVA 4CIXA 1L4MA 1AQNA 3CF0A 1H3EA 5HM8A 5K0SA 3BQMB 4G86A 1E3DA 2FI1A 4BE4A 4OHPA 1YF3A 2BGMA 1UQTA 2CYAA 3CRW1 1HKHA 3SE7A 1FDTA 2DPYA 2RGYA 3HBMA 4L02A 1T43A 5CDYA 2GI4A 1V16B 4TS1A 4DA9A 4PZAA 1W30A 5FLXA 1FJHA 1HE2A