2DP4E

Crystal structure of the complex formed between proteinase k and a human lactoferrin fragment at 2.9 a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
279
structure length
279
Chain Sequence
b'AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Crystal structure of the complex formed between proteinase K and a human lactoferrin fragment at 2.9 A resolution
rcsb
molecule tags Hydrolase
total genus 88
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2006-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2dp4E00
1NDUA 2Z2ZA 1Y3BE 4AKTA 2ID4A 1P7WA 1DUIA 3VV3A 2ZWOA 4CFYA 5CW1A 3DE7X 3CO0S 3GCXA 1TM4E 2Z2XA 3LPDA 1XF1A 1ZVJA 1GA4A 1WMDA 5FAXA 1SCAA 1GNSA 3DYBA 2IXTA 3H42B 4DJ5X 1Y34E 1Y4AE 3DE5X 1AH2A 2WUWE 1AQNA 2PRKA 2PMWB 3DVRX 3WQBA 3OSZA 3DW1X 2ST1A 2PWAA 2W2PA 4K8RB 3I34X 2Z57A 3AFGA 1R6VA 1WMFA 5SICE 3EIFA 4JP8A 2B6NA 3DE0X 1KE2A 2G4VA 1SIUA 4ZOQI 4DZTA 1SCJA 2IY9A 2PQ2A 1C9MA 1Y3FE 1SUPA 1VSBA 1JEAA 5JXIA 2DQKA 2XTJA 1EA7A 3TI9A 1AU9A 1SH7A 2ZRQA 3Q40A 3QTLA 3WIVA 1WVMA 5AMXA 3GT3A 1PJ8A 2SICE 2W2NA 1SN7A 4NE7A 1BJRE 3VSBA 4RYDA 1GT91 1C9NA 1NDQA 1KDVA 1TM5E 2ZWPA 5FFNA 4BWGA 3D43A 1KE1A 3TECE 1SCNE 4HVLA 1SBCA 1SIBE 3D9QX 3DE3X 1S02A 4WOBA 4H6WA 3HJRA 1GTG1 1SVNA 2XRMA 2Z56A 3DE1X 1Y48E 2HPZA 2Z58A 3QMPA 1ST3A 1ST2A 3AJ9A 5JMOA 4KG7A 1GA6A 3BPSA 4DWWA 2DP4E 1Y3DE 3BX1A 3DE6X 2SNIE 1YU6A 4HX2A 5B1DA 3P5BA 3UNXA 1TM3E 1ZVKA 2W2MA 1R0RE 2Z30A 5ARBA 2PYZA 1UBNA 1CNMA 1R64A 2E1PA 4NMXB 3BGOS 2HD4A 4FONA 3F7MA 1TECE 3PTLA 3LXUX 1WSDA 2GKOA 1YJCA 1GNVA 4OV6B 4C3VA 3SQOA 5ARCA 1AF4A 3F7OA 3LPAA 3F49S 4LVOA 1C3LA 3CNQS 2QTWB 1SELA 1SUAA 3I37X 3LPCA 3WIUA 4CG0A 5JXHA 4Z2AA 2DUJA 2W2OA 1LW6E 3PRKE 5K7SA 1C9JA 1HT3A 5AVJA 2Z2YA 1T1GA 4M1ZA 5AQEA 3DE4X 4NE9A 1SCBA 2WV7A 1AVTA 1GTL1 1Q5PA 1TM1E 1SBHA 1AK9A 1PEKE 1OT5A 3I30X 1GA1A 4CFZA 1P7VA 1SUEA 1AV7A 4KB5A 3VV2A 1OYOA 4YN3A 1KDYA 2SECE 4OMDA 3AJ8A 1GCIA 3EDYA 2P4EA 1P8JA 1SPBS 4H6XA 3DWEX 5ARDA 4OMCA 1V6CA 4B5LA 1Y3CE 1A2QA 3SICE 3VYVA 3DW3X 2PWBA 1EGQA 1SBTA 3DVQX 1GTJ1 4MZDA 4KPGA 3L1KA 3DDZX 2ID8A 1YJAA 4J94A 3TI7A 1Y1KE 4GI3A 3Q5GA 1SBNE 1TO1E 1THMA 4H6VA 5JXGA 1SUCA 1Y33E 1BH6A 1SUDA 3ZXXA 2WUVA 1IC6A 3DVSX 2WWTA 1SIOA 3DE2X 3VTAA 5JXJA 1TO2E 1OYVA 5FBZA 1SCDA 1Y4DE 1PTKA 3VHQA 1NLUA 4AKSA 2TECE 3A3PA 1T1EA 2X8JB 5I9SA 1CSEE 4C3UA 1YJBA 3GCWA 1WMEA 1Y9ZA 1BFUA 3A3NA 3ZXYA 3GT4A 1BE8A 1DBIA 4ZARA 2X8JA 5AVKA 1MPTA 1IAVA 3QFHA 1BFKA 3T41A 1TK2A 2PKCA 3WHIA 2W2QA 1S2NA 3EE6A 1BE6A 3I2YX 1MEEA 4WOCA 1T1IA 1SUBA 1V5IA 4LVNA 2SBTA 3A3OA 1SBIA 1S01A 1KDZA 2V8BA 4I0WB 1TM7E 1PFGA 5B1EA 1TMGE
chains in the Genus database with same CATH superfamily
3DOIA 4PLPA 3RFXA 5EQTA 4ZI7B 2V7WA 2HWWA 2ZAOA 3SSAA 1M7GA 9LDBA 1A8QA 2XQJA 1J2YA 3A6GA 3PHGA 1N6RA 3KTAB 1LI4A 2HQ1A 3HCBA 2JZNA 4OXRA 3QLVA 4Y6PA 1V16A 3NEPX 4PZ0A 3LW8A 5HIMA 1U63A 4RPLA 3UATA 521PA 2GSDA 2ZAGA 1JX6A 3F6BX 3CO0S 3U4IA 4OU4A 2L19A 4LPSA 3JQFC 4XUEA 5HZHA 4C04A 1DT3A 3ZDRA 5EWMB 4EVRA 5IK2D 3FAZA 1Z5GA 2BONA 2GZ3A 4TTTS 1XKQA 3E9RA 4XX1A 4BGDA 3S81A 2WJZB 5KVVA 2AK2A 2YMQA 3RBAA 5A02A 1GARA 3NH9A 4WFIA 2PV0A 1R4AA 5KJ6A 4JT8A 2E4AA 1ECGA 1J2EA 4M88A 4YRFA 2EEPA 2F9LA 3EY4A 2LRHA 2L42A 1R5OA 3FMGA 1U2DA 2JLRA 2B21A 1UBJS 2ZJ8A 1E79A 1C3EA 4ND8B 3F74A 3DMTC 4EFDA 3IQHX 3DXXA 5ESRA 4BO9A 2PU5A 1O96B 2OY0A 3KP1A 1KMIY 1UWKA 3KVRA 4Q3NA 1OB5A 4N7RA 4Z4GA 4O6VA 5TXGA 4OFXA 3I6QA 3KAJA 4NJEB 3ILYA 4MQ5A 3L8HA 3SBDA 4GFDA 3DMPA 3RIHA 1NYQA 3B1YA 1HV8A 1YV9A 2II6A 2AFIA 3AQIA 4TWIA 2VYCA 5IT5A 2B0JA 2V0NA 2WY2D 2AOUA 3TOSA 3C5CA 1JG7A 5SZHB 4I1YA 4DMKA 4D5EA 5KNCA 1RPTA 1L5SA 3V2GA 2ZIWB 1YB1A 3L1IA 3WWZA 5I8WA 2NU6B 1X6VA 2M9MA 3WI7A 1DUVG 2IYWA 4OHFA 1YS7A 1LJ8A 2Q5QA 1S96A 3MJHA 2M2IA 3CVWA 3DVLA 1HZZA 1F38A 2F90A 2A9RA 3BMQB 1LRKA 4YMHA 1CZRA 5KQPA 4Z9XA 1JIJA 2CE7A 1JR2A 1EGAA 3OZUA 5I4IA 4CG1A 4KPEC 3EIFA 4JP8A 4C7OA 4BNUA 3VPHA 2IA5A 4PX2A 4XYLA 3DG9A 3EXAA 3DBVO 4ZIRA 3AG5A 2CL5A 3INGA 5J23A 2H8KA 3LFHA 1QO0D 3TW8A 1LBSA 4D6YA 2ATXA 3JQEA 1UM8A 2EJBA 4QGFA 1IAQA 2BUCA 2Z2IA 4IXDA 2Q3HA 5K6TA 1PR9A 2Q1SA 2X6QA 5AOVA 2D13A 4MGHA 2PZEA 2C4HA 2X77A 1RI3A 4I14A 2I4NA 4MUJA 4BWFB 4DLBA 3O3NB 2ZBRA 4HNRA 2GMWA 3UKJA 3TAUA 1MXHA 1ESEA 4KDRA 2A94A 1CR4A 2X5NA 2H92A 4BNFA 3FOEC 3U44A 4AWBA 2PL1A 3N2GA 4FYWA 3LT0A 4BNNA 1TKRA 2VH5R 2ENWA 2I54A 3BHIA 3HCOA 4LZZA 1BTOA 5ICFA 2ZWAA 3PLAE 4BIIA 4MUAA 4X1IB 5ELMA 4XCQA 1B0ZA 1C8BA 2H7XA 1X1CA 2J6BA 2XYQA 1NN5A 2XQGA 4XAQA 1I1HA 3GT3A 4K9OA 3G9QA 1P1BA 3DB2A 4PBSA 3T1TA 4CKEA 3OEWA 3QEAZ 4R8VA 1G8YA 2I22A 1DXHA 4KSBA 1D5WA 3BJMA 5ECYA 1PLLA 3VHLB 3KQHA 3WA7A 1KZGB 2WTUA 1IBSA 3AEQB 3MM4A 1H0SA 3IUNA 1F6DA 3H86A 4KMMA 4WLNA 4AJNA 4ETIA 2FV8A 3HN6A 1XD9A 2M1XA 2PXAA 1OWLA 3LUKA 3TL6A 2EKQA 2CUNA 4XOIA 2NO6A 4K1XA 4P93A 4KSYA 2QPOA 4XVQA 2TMDA 2IYLD 5TSDA 5K9ZA 4G0UA 1VKRA 3BF7A 2ZTUA 4WMLA 1J0DA 3K0SA 2C84A 4EG7A 4D9BA 2WR8A 3LBNA 4CMHA 1M83A 3N2LA 3CRVA 2OD9A 1V9CA 5ECGC 3OIWA 1F3LA 3VR4D 3PI6A 2WAYA 3OBIA 4HVLA 5C7IO 3GLFB 5PGMA 4M22A 4BAUA 2FVYA 1SIBE 1FP1D 1PIWA 3IRVA 1DIRA 3AZPA 3I32A 4KH0A 4E32A 1H65A 2FXIA 3DFMA 1ODLA 3STUA 2EYUA 5IKEA 3P4YA 5EP1A 4CL8A 1KK3A 5TMPA 2GN6A 4Z0PA 4TUYA 3WX0A 2ZRGA 5GIPE 3THWB 1Z16A 2QTGA 1T3SA 1YDHA 3ZE8A 1Q19A 1JF8A 1I13A 2XBMA 1T9AA 1MH1A 1BAPA 2WW8A 3AJRA 4HKTA 1QIIA 2DH5A 3QVSA 4G9GA 2OV8A 5FQNA 1L7QA 3RAGA 5KMGB 1OI3A 4ZZ1A 4GZ3A 4JYZA 3THYA 2AMLA 4F5EA 1OXSC 3ZDAA 3FBTA 2VRCA 2IZZA 3HCWA 3EVBA 1HYQA 2JD1A 3FE2A 3HHEA 8GPBA 3PGA1 2ZROA 2P6UA 4TYPA 2P9EA 3BHJA 3MRVA 4MGYR 3VR5D 2BSXA 3PEFA 1FDTA 3ENZA 1IXRC 1VLVA 2IEIA 4LHZA 3MJ4A 3RFTA 3UG7A 2P2GA 2BI4A 5F5NA 2J33A 1JMYA 5K8UA 2G0AA 5DIFA 3IB3A 2WABA 4B09A 2B1QA 3EEBA 2YYZA 3ET5A 4B3JA 4A8JC 1U8UA 1LDGA 3TDMA 1SA0B 1E8NA 3NEJA 4LX8A 4AIRA 4C5CA 4BBPA 1JUDA 1VQ1A 1D6JA 5KTTA 1V5EA 4FOOA 1YZQA 1FLAA 1AQYA 2HFJA 3DBIA 1C8KA 3KPYA 3L8GA 4EPRA 3F8WA 3GG2A 2CXSA 2VXCA 2PV7A 2J3EA 3JWPA 5LQNA 2XRZA 5REQB 3B9PA 3PLRA 1E2KA 1WNFA 4LZLA 3BL5A 4LYYA 3VPDA 1RADA 2X2PA 4RWEA 1I9GA 3HCPA 3KKOA 4I4CA 3E5MA 4D43A 3VVMA 2V7PA 2P4QA 5F9MA 5HM8A 4FFRA 2WSMA 3B8EA 4MDFA 1WUKS 3U9TA 1XNGA 3O1HB 1ZXBA 2XCTB 4R01A 2WJ3A 4AY6A 1QTIA 3IVRA 4FONA 2Q49A 3IUBA 2R6DA 3KAKA 1XRRA 2WAOA 4UDYX 3NV7A 4CL3A 5ILOA 2C3OA 1YC2A 2HRRA 3RSSA 4EQ6B 5B2EA 5JNVA 1ORWA 1Y1LA 2XF8A 4EF5A 1KU0A 2PL3A 4QSMA 3G8BA 3AK4A 1C1DB 4L27A 4RTNA 4JXZA 2BFOA 2DHRA 2NO1A 1OKKD 1OU0A 1P81A 3AHIA 4R84A 3NC0C 4ZYLA 3QZUA 4UATA 5LL6P 4TVOA 2P2CA 3MWJA 3L3BA 4I55B 5JLAA 3VJKA 1G16A 5BW5A 5K0GA 3U61B 3BAZA 3JZDA 4BRUA 5CDHA 1G17A 1PYDA 5K3OA 1XWIA 3OCWA 5EE3A 5FR1A 1XTUA 4ZEMA 1W36C 2I2WA 4JB8A 2C5HA 1KPHA 4JQOA 1PFYA 1A50B 4N5MA 4P0QB 5FOVA 2C88A 1JJFA 3FDFA 2PK3A 1LBIA 2ANBA 2QYSA 2UXBB 5JY6A 1TYEB 3DMDA 2RHWA 5DMXA 1JGTA 1KDRA 2QD5A 4WNIA 4RY0A 3BF8A 1QPGA 4PSCA 5I9BA 1JN0A 1XTQA 4B76A 1HDZA 4KPYA 1SVIA 5ALKA 5HBRA 3ZW7A 1EWVA 3IOEA 1D1PA 1EWYA 3BIFA 3DZCA 2ECPA 3TIXB 2HIGA 1J99A 2WP0A 3IDSA 3EWNA 4RU1A 1LNQA 4UMVA 2C2XA 1X7YA 1Z8NA 4KO2S 1KDOA 2AUNA 4QGSA 1F4VA 3K5PA 3PZRA 4J0CA 3TFOA 3E3OA 4OQ4A 1EEXB 3FDZA 5TVKA 5MN6A 2QW8A 4WI1A 4NCBA 4E4RA 1W2WB 3AR9A 4OSOA 4KRYA 3R9XB 3OQIB 3UXYA 4OXKA 5ADUS 3VHXB 2CVQA 3WL8A 1IWBB 3R5TA 5HRAA 5LU9A 3VC1A 3QP9A 1QR2A 2PMBA 2BEUB 4ACAA 1SKUA 4F2WA 6Q21A 4FMPA 2FRXA 1DO0A 4ZEXA 2QR2A 4FFSA 5F35A 3UY4A 1VGVA 4EYSA 4YO8A 3ME5A 4RMHA 3VR0A 1YKFA 3EGXB 5KSWB 4FT2A 5EI5A 2IYQA 1UKEA 3FNHA 2YH2A 3PFFA 1CUXA 1SVMA 2O52A 3LXXA 4EMBA 4BMCA 4BHTA 2G76A 3LCMA 4MLCA 5K51A 4N7MA 4EGSA 3JWIA 3CW8X 4HFMA 3MWDB 1VIDA 3DZGA 3NHYA 1DC7A 3O4HA 4JLOA 2QI9C 4TSFD 3RAPR 5H8WA 1ZOPA 1DBVO 4M8NE 5DYYA 3ZVLA 1KXJA 4C0SA 3FR7A 4I5FA 4CR7A 3KETA 3HKBB 1T0HB 5CB4B 2CBXA 3V9AA 1VJ1A 4LQCA 5HQTA 3I5UA 4I8DA 1P4SA 1A2QA 2R8OA 2GHIA 5DM0A 2BELA 3ADPA 1AB6A 2O23A 3KJHA 1JHRA 3VPCA 4ODIA 2XE6A 3Q3VA 3UMVA 2PWBA 3LDAA 3O1LA 5CFQA 3K70C 2KPOA 4N0DA 4DQUA 4PWZA 5HUJA 3L49A 2JK0A 2XNCA 1P45A 1FF9A 1U9IC 3WWPA 4N3AA 3VRHA 4G0WA 2QJOA 3L7DA 2FPKA 3BSYA 2CWDA 4TS4A 4MV4A 1H3EA 2YX1A 2NYAA 3TLGB 4DDKA 4ETNA 4W7HA 3UUFA 4GMFA 3DAPA 4LFBB 1GG2A 1TUBA 1XB2A 3UGQA 5JNLA 2GF2A 1GXSA 3IQXA 4PQFA 1NMXA 3VC2A 3TLAA 1J8MF 1NW5A 2WWVD 3P9NA 4AX8A 4E5VA 1PR4A 2C82A 1B3RA 1W1IA 1QNFA 3E4DA 1N7GA 2GTHA 2JA1A 1KDTA 4MVJH 1LZKA 2J07A 1I01A 4F6RB 1ZR4A 3EMVA 2CDAA 2X1VA 1OLUB 2H1LA 3RF6A 1JKIA 3D4BA 4GE0A 2B37A 3WQQA 3JQ8A 2G71A 5JXGA 3OHMA 1R00A 4RGVA 1N5RA 4A3SA 3TE6A 3IQFA 4IXTA 5FADA 2WUVA 2PT7A 1EX1A 2AUMA 1JSZA 5JZVA 4H7JA 1IZYA 3EOZA 3NHZA 4OGLA 5K4HA 1NMYA 2BUBA 1CIJA 3DXFA 1QHXA 3PX2A 4NZPA 4UVGA 4ARZA 5I7FA 1R3UA 1WKVA 3ZJ5A 3HGMA 1GGEA 4OJQA 5DNAA 3W7VA 4PGHA 1WETA 1AE1A 1GADO 1WE2A 1JJAA 1EBUA 2HN9A 2VDQB 3B70A 5CLIA 3U4QB 4FEYA 4YBZA 2QRNA 3G2KA 3IP6A 5EN4A 4Y2JA 3BGSA 5U4QA 1A8HA 4NXMB 2HQBA 2NAFA 3DNPA 5JSFA 2D8AA 2H1IA 3DBHB 3VTZA 2P9HA 2PR2A 1GG8A 4HAXA 1VSVA 4PQYA 1T4DA 1RPJA 1ZGAA 1Y6JA 1JT2A 1NQXA 3A2MA 3RQSA 1Z8DA 3QG5A 3T0GA 2H9YA 2WILA 3GYGA 4WY8A 3OTHA 3QX8A 4YJHA 3TX2A 2E37A 1VZ3A 4UUAA 3LA6A 2PQ0A 3WGQA 1GY8A 3R0QA 4A8PA 2GJ9A 3T5GA 4A4DA 1CSEE 3TCNA 1PTJC 4G0ZA 4MZXA 3BFXA 4EAAA 3O7WA 4Q1EA 3I0MA 4W99A 2FMUA 1WMEA 1XJWA 4EHAA 2YFHA 3VU0A 3SF8A 3NBYC 4CJXA 1LBEA 1HMPA 1JDNA 3EQ8A 4RIGA 3BUSA 2FSPA 3F97A 2BSQA 1PDOA 3O03A 5KYVA 1KYVA 1YS6A 4AQYB 1UOQA 3LC1O 5E4FA 3G2PA 4FFWA 2OWEA 1UXOA 3WK4A 1F0KA 1ZJ6A 3NI2A 4LN1A 3V80A 4I4TB 1XP8A 1IZ0A 1PJZA 3WJ7A 1P1FA 2EP5A 2ZOSA 4KN5A 1PJRA 4G1VA 3UO8B 2NG1A 2QM7A 2NTJA 3G2QA 1ZMBA 2GETA 4J7CA 1BFKA 1QGUB 2A84A 5DBEX 4GMDA 2A0FA 4WJKB 1RM3A 2V6MA 4Z99A 4YUZA 5DYIA 2W6JD 5AKJA 3K9CA 2FJPA 5EPEA 3ISVA 2Z8YA 4EF4A 4RF2A 1JVNA 3WICA 2JFOA 4UTOA 4UM8B 4ZQEA 1RXWA 2P5SA 2PH3A 3LSYA 4ZYVA 1C3OA 1OUMA 1NR5A 1KJNA 1VE1A 2ZJ6A 3A31A 3KE8A 3RIYA 3WLMA 4A0SA 2DFKB 3FLEA 3IT2A 2CFRA 5A6VA 5KOHA 3KR0A 4Q1DA 4DJTA 1V16B 2V6BA 1GDHA 1UXGA 1RI5A 1ZH6A 1B76A 3PYLA 4KC0A 1S2LA 1W2GA 2QR3A 4WCDA 4BN4A 3OWHA 2J45A 1W4BA 2V8BA 1T9KA 2YMLA 4FDUA 4KGZA 5D00A 1QAMA 4PEVA 1Q0RA 1NUAA 1XJ5A 2NV0A 3ENQA 4GWGA 1QDLB 1W6UA 2CMHA 3E05A 1WXGA 4OVKA 1R8QA 4OKIA 4AS3A 3DZHA 1ZJJA 4ED9A 1FVOA 2GCIA 2J5KA 1USVA 3KD3A 1HDIA 2FFJA 5IMBA 5MN4A 1WCYA 3A1UA 3HI4A 3HU3A 4WVFA 2BFDB 1BS1A 3TAHA 4NATA 3ZE1B 4H08A 3QXSA 1FNDA 5IEJA 4ME6A 1AKYA 3VV3A 4RKYA 1R5BA 3H11A 1IUNA 4HSGA 3VSDA 1H2HA 4NFSA 3L6CA 4IEFB 4HRYA 4S3MA 2Z95A 3T0IA 3WIBA 2Z2XA 2WZCA 1RCFA 3FFXA 3BD8A 5HJ7A 4RLSA 5AXAA 4ONEA 5K2MA 4Z8YA 4D9GA 1YOBA 4R9UC 4KPFC 5HCIA 2C7BA 1XX6A 2AFIB 2UVDA 2YZGA 2C61A 2XA2A 4ZREA 1SCAA 3NHUA 3KSRA 3MYYA 3OA2A 1E1NA 5JO9A 4E3ZA 5KNDD 1ULZA 1NBMA 3ZY4A 4MRNA 3ETGA 4G84A 1Y8RB 1ZCJA 5CX4A 5ALDA 3WLKX 1EBBA 2AR7A 5K05A 1PGJA 2I87A 4CV3A 5KQSA 2KBEA 3TE7A 3W2TA 4F3TA 1LD3A 4NENA 3VPAA 4DPKA 2H1VA 5LQAA 3NBQA 5WRFA 1DJPA 1SVLA 3MOIA 4R71A 5HG0A 4EFKA 3IERA 5EEHA 1JLLA 1XPOA 1TAHA 2REQB 2WMYA 3C6QA 2Z8YM 3BXEA 4IVNA 3DW1X 3AERA 5DM60 4C7OB 3IOMA 3NVAA 4F3CA 1AXEA 2ZUDA 5FFFA 4ZIRB 1L4LA 3TW8B 1CZHA 3IVMA 1KI7A 4PIPA 3G0DA 1D2GA 4F5ZA 5AIAA 3SQNA 3GELA 2IYTA 3MWYW 4ZAWA 1Z0AA 2JLQA 5CTAA 5KCZA 3P32A 5D2CA 2R84A 3L40A 2B2NA 2GD0A 4PANA 5EJ7A 5LU8A 1QPBA 1X70A 1BXGA 1J7KA 3L01A 2CNKA 4LXTA 2XZOA 2D2EA 3N8HA 4HZGA 3U44B 4ER3A 4MMZB 1HFKA 2HH9A 1BKSB 2I65A 3BWBA 1H8EA 3OHPA 4DPMA 4XGRA 4CEIB 1YI1A 1HYEA 4TZKA 5JAZA 5FUYA 2R8RA 4CKCB 3EN0A 8ADHA 2GFQA 1KGDA 2G9ZA 4NX2A 1P60A 4DY4A 4EP1A 5K09A 2PQ2A 5AKEA 5A4AA 2W43A 1KMNA 3C41J 1WXHA 2IQ5A 4I46A 3EPJA 1C2TA 2DETA 3AEXA 3HO1A 4V1CB 1II8A 2FGJA 2XTJA 2JF0A 1DS6A 2IHVA 1B16A 3ASYA 1IMJA 3MA0A 3PGJA 3S7ZA 4IDEA 3UB3A 5BMVF 4MHSA 4ZT6A 3L4BA 2XMBA 2HZ7A 2BFFB 2EBFX 3T12A 3HU5A 1AF7A 2O2DA 3RS2A 3K4HA 2QSJA 1OB2A 2B3TA 3E1KA 4X90A 4CG3A 3BMCB 4PE5B 4JVMA 3GAAA 3K9NA 2VH2A 2VI5A 4AMYA 1TZKA 2GLXA 1G5TA 3O75A 3SK0A 2P9JA 2CL6X 2GZAA 1G9SA 2PJDA 3UB4A 3HKEA 2JL1A 1QYVA 3DQPA 3HNPA 5HW0A 3FMVA 2OZLB 5CLLA 2ZCJA 4GBJA 4M8LA 4R2MA 2V55B 1YA4A 4FOTA 1KJZA 4M4SA 3W4KA 3RU2A 5CDGA 3H2KA 5H4GA 1T3LA 1Q7BA 1IY2A 2O9JA 1P17A 3E35A 4GQIA 2QE7D 3MHPA 4TXJA 2ZBVA 2GK3A 2YUTA 1BCSA 1T8RA 3A1SA 3AHFA 3Q0TA 2FX2A 3G02A 4V02A 3QKSA 4P31A 3W79A 3LRXA 4BUJA 2I8LA 5CH8A 3W2HA 3AKDA 4ZAXA 1SG6A 3VISA 3N87A 2ZYHA 4WK0B 4DMGA 4IS3A 4AKGA 2OAP1 4RY8A 5AJYA 3CH4B 4TUYB 1CR2A 2WOOA 3LGSA 3OZFA 1M8JA 3E9YA 2WF8A 4GECA 1KE1A 2VPXA 4HS9A 1ZK2A 5C8YF 1SY7A 5I7OA 3EIWA 1TJ5A 1FFDA 3NBMA 1UJMA 3QU4A 4YJ3F 2EP7A 3WWEA 3V34A 2YXBA 4L51A 3R40A 3ASVA 5JW6A 1EUYA 3O4VA 4E21A 3A70A 5B4TA 3THYB 4LYHA 2GM3A 3AG6A 2YDYA 1X7HA 3VR3A 1U0SY 2MSDB 2PRJA 2GPSA 5FTNA 3T4XA 3ZHCA 4OFZA 5AJVB 4OCZA 3OJ0A 3HYNA 1D4AA 3VO2A 2R0QC 1E8DA 4EK9A 2JEZA 4H6WA 3TZLA 1ZMOA 1JSXA 1QH0A 3LKZA 4G1EB 3A9WA 4BLSA 2HXYA 1A7AA 5LSAA 1MAWA 1NW4A 1LFDB 1VKOA 1ZINA 2REXB 4MYTA 1IONA 5EIAA 4FYPA 5IKMA 2G1PA 1RKBA 4KR6A 5KWJA 1EUZA 1P4HA 3AWIA 4RMNA 3N0XA 3PKIA 1GGNA 1OXUA 3S1LA 2PL5A 5C81A 4YONB 4TL6A 4JJGA 2C1ZA 4D5GA 1M2NA 2QRLA 2WFMA 4GZLA 5KBYA 4WPGA 1E1YA 1RYDA 4AN1A 4A15A 3VNRA 4FDMA 1S9DA 4OHVA 4AMUA 2LCFA 3AUYA 5BQXA 3C3PA 4DDHA 2AFHA 4TSKA 3ZVMA 1GA6A 4Q3LA 4HO1X 5I5EA 3V8EA 3WGUA 3BPSA 5CITA 4QICA 3M6IA 2POQX 2IY8A 2YC4C 2O8NA 3SDZA 4KO8A 3NJ4A 1FYVA 4OHZA 3SYMA 5KAMA 1BU8A 2Q6IA 2VYVA 3IDAA 1D9XA 1VDZA 3EZFA 1NRJB 3L7NA 2WIAA 1NN0A 3REGA 4BEVA 1OGJA 3C3YA 3LOQA 4B2LA 4IHQA 1YASA 1YMVA 1KO8A 3OJWA 4LEIA 2G9RA 3WGLA 2GPWA 2TMKA 2CN1A 3WKBA 4RX1A 5CFPA 4ZZIA 1OXKB 2H2DA 2XR1A 1BGWA 1E3DA 3H5WA 2WAAA 1E77A 1XK7A 2GK6A 4H35A 3K0BA 4KXYA 5EWJB 3R4VA 4EI8A 4WBNF 1O6GA 1RRVA 4FCCA 2ZJ7A 3FKJA 4GOOD 5BNTA 1HRDA 5T3UA 4JMPA 2GWRA 1OZ0A 1UBEA 1UZAA 3NWPA 2AC7A 1KEEB 1ECPA 2TMGA 5DLPA 2FDRA 2OCYC 4L5CA 1B8UA 3PWZA 2OL4A 1EHYA 2DT8A 4PAWA 4JJZA 2ZB3A 4JLSA 4RKRA 2IYRA 1EFPB 1WOYA 2IH2A 2I4MA 1LUAA 2Q0XA 4ZO7A 2O48X 2EHDA 1RLJA 4TKVB 2W2KB 4UM5A 5FXMA 4CM5A 3X2FA 2XYVA 2GJSA 2ZQ5A 4KO4S 4YJ2B 2E5LB 2EFHB 3FPCA 3JQ7A 2Q2OA 3KJQA 3OAAA 4OV6B 1L4HA 1E63A 4LZNA 4ZU1X 3KK0A 1UT5A 1N2OA 4G5YA 4YLEA 4BLTA 5EUQB 4NV1A 3C5HA 5LMZA 3VKFA 4EAQA 1USIA 2ZB7A 3LBFA 3BA1A 5ALOA 2AF3C 4RVFA 4WERA 3Q9UA 4GPZA 5L6LB 5K01A 3TCXB 4C06A 3LX5A 3B38A 5EPOA 3L43A 2K2WA 3Q88A 5B1SA 2RMKA 5LA6F 1MBZA 3MGCA 2JGJA 1GYQA 1R12A 3EXHA 4NNOA 3W5CA 4CEHA 2W2OA 3F3MA 4H1HA 4ESHA 1E5DA 4I6GA 2J4DA 2OCBA 3PF8A 5EVCA 2WM2A 2G09A 3PFIA 4N65A 4Z0NA 4A6PA 1XZLA 3O3CA 1OAOA 4NPAA 5HIIA 1C9JA 1JB1A 2OLEA 1IIRA 4AULA 2OHOA 4KOEC 4B9EA 2VQ3A 2AV6A 2Q1XA 4FFPA 1A04A 2BEVA 3Q9LA 4RVGA 4P8RA 4H7IA 1YBVA 4A8HA 3DE4X 5TQ2A 2ZBUA 2OCAA 4G65A 3R7SA 1XJQA 1AK2A 5L3QA 1B0PA 1GNRA 4WY2A 1PBNA 2P2ZA 3N5KA 5LP6C 4A2QA 3P4UA 3FSRA 1CP2A 5J40A 5L3SB 3O31A 1NU8A 3CZQA 1N2CA 2B1RA 1GTL1 1ULSA 1LWOA 1UKVY 2DQYA 4OGKA 4RM3A 2G1KA 1OWNA 3NRJA 3KLBA 3DTVA 1EB8A 4LDRA 1ZLYA 3QHPA 3G6WA 1ADGA 3SZOA 3I30X 2AJLI 3MLEA 4MYSA 2GAOA 5AO9A 3T7KA 3O83A 3SNHA 5I7HA 2O7VA 2PMEA 5DTEA 4CV1A 4DREA 3HB1A 1ZCZA 4J0HA 3ISJA 3E3AA 1SPXA 4GM4A 4XB6B 3BWCA 1Z5VA 4D4HA 1KWKA 3HR4A 1HE3A 1NGSA 2EFGA 3GA7A 2BRUA 4YN3A 5HJEA 1UP7A 1URPA 3A25A 2TMYA 4RELA 2WWGA 1QIMA 4HOYA 2QAJA 3K15A 5KQRA 4XVHA 2WLSA 1U4OA 2HC9A 3C3XA 4FHZA 4O2LA 4K0KB 3V4LA 2CF6A 2A1IA 4KR2A 1G64A 4NRDA 4D9MA 1MAAA 3W3AD 4OX9B 4MVJM 4OMCA 4CKYA 1QHYA 1YVDA 4MI6A 4ARBA 1V35A 3SC6A 3PX7A 2I99A 1TUBB 1W4CA 2VBCA 2RIRA 1RQPA 2C2KA 2OFWA 2QYHA 1GXSB 1S7CA 4CV0A 2P5TB 2QRVB 1R8XA 1TLLA 1M73E 3R2JA 3AP2A 1I3KA 2FSUA 3BSSA 4XQCA 4CMIA 5JD5A 1R6DA 1CF2O 3KKNA 3V2IA 4EJSC 4UBIA 2IPAB 1UDBA 3QXXA 1AQLA 2OXCA 4L7VA 1Y5IA 4FQ8A 2XCUA 2Y05A 2HI0A 3F8TA 4U6QA 3SR0A 1Z06A 5KQLA 1ZGJA 3ADOA 3H4TA 4HDCA 3AKCA 3ENKA 4QOJA 3IVXA 4Y9TA 4JI5B 4FXPA 2AZMA 4MHOA 4RL4A 1P44A 3LQFA 1LX6A 3SMQA 4A0QA 4Q4DA 3ZWCA 3G2IA 3K4PA 5AM2A 5JLJA 1W94A 3GEPA 4EM6A 2BJHA 4RSMA 1P0MA 2ID8A 4DXHA 1BGXT 4DCSA 4BFYA 5BUZA 3I58A 5FWAA 3LWDA 3JZFA 3LH5A 1WKBA 1N32B 4RESA 2CVPA 2DPXA 4OM8A 1JKJA 3D1LA 1XMQB 4GMHA 4DA9A 2O6HA 3L6RA 4GEGA 2FWMX 3ESDA 2ZI3A 3J7TA 3IAAA 3V4ZA 3EX7C 2F67A 2ZJFA 2X1LA 2YWJA 1QZTA 2UVPA 5E6SA 3LBYA 4FTWA 4DLZA 3HN7A 4YJHB 1JFFB 1I10A 1Z68A 1BDBA 2CNLA 2QRQA 1K0UA 2VZEA 1Y0BA 5KO2A 1H0KA 3UJ7A 1H2YA 1N5KA 4KSCA 4MW9A 3P9SA 4JNKA 4U9UA 3WAGA 2NNWB 2ODNA 4DCPA 4P3OA 4PN3A 5F7XA 2QX7A 4X63A 5FBZA 2NSJA 2AYYA 3KAQA 3VPBA 5GVSA 1CRPA 1L9XA 1ORVA 3CZ9A 4P35A 4E94A 3D6VA 3QF7A 4YAGA 2CXXA 4XIIA 6NULA 2TECE 4EKGA 3BA6A 5SZIA 1CZUA 3VJMA 4X20B 2VJNA 4JJ6A 3MNFA 3BC1A 2CDNA 3I5MA 4GBED 3FA2A 3NBAA 2DB3A 3GCGA 3L7AA 5CVUA 4ZC1A 5BQOA 1OHHA 1U0RA 3KD2A 5IH3A 2QZJA 3G8YA 4HH0A 1OT3A 2GILA 1KO4A 4JLJA 2HA3A 4V3CA 2D7DA 3A0RB 3H6HA 2ZYSA 4QXPA 4NMWA 2HXSA 5U1PA 2QX8A 1J2TA 3SKVA 2XVAA 4CM8B 3TZEA 4JC5A 3HDGA 4U5XA 2L69A 2ZSJA 5DCLA 5FL7A 3TEFA 4QYWA 1V8FA 1WABA 1IRIA 2J6CA 4ENQA 1C3OB 1XXHE 2JIQA 4M37A 4OQXA 3OEYA 4WKNA 1SC6A 5L40A 3UA4A 1DBIA 4ZARA 3VGPA 1FMJA 2VG8A 1VYVA 1MO5A 2J85A 3F67A 4EY6A 4ASUA 5BOSA 5JAIA 3MRXA 1ISPA 5MFPA 1P61B 1XO1A 1QK4A 3QVLA 3UJ3X 3P0EA 4O4HA 1UFOA 2Y2VA 3R77A 5C8DA 3WYBA 2ZCUA 4B48A 3UC5A 1E2DA 4RW0A 3GRPA 3OKPA 3PITA 3NNDA 4KXUA 5A5EA 1NI4A 3H0CA 5E3IA 3I09A 2R8BA 3I2YX 2B36A 1RPNA 1DKOA 4UEKA 1ONBA 1OX4B 2GM9A 1LVGA 3CJRA 3SD7A 5B57C 2GXAA 2J3JA 2GSWA 1DAGA 2G08A 4JEIA 1XROA 1CEQA 3E9DA 2P1ZA 3H11B 1QYDA 4ZOLA 5BOVA 3ZDZB 1U94A 3A3OA 5K0TA 1SBIA 2R00C 1F5NA 3HDHA 3QVGB 5IC5A 2R6ZA 5JV5A 2X0DA 3H17A 4PZAA 4ROSA 2GXSA 4DEYA 4Y6GB 2O6LA 3I4CA 3PPIA 1OCEA 1GKKA 4YLYA 4E15A 4A5SA 2CXTA 4KVFA 2NIPA 4C1NA 4FSHA 3LZDA 4IYJA 1V3UA 2E21A 2JRCA 3TPZA 3NP9A 3A04A 1UUFA 4AJKA 3K3PA 2GXUA 2WKSA 2QU8A 2E4YA 2KS6A 1BH2A 4BQFA 3KJEA 4RMGA 2XVXA 4EARA 3MJCA 2Q5OA 3C43A 3O74A 1U28C 3LWBA 1OGYA 2J3IA 1GPUA 1PFQA 1IXYA 1W85A 3MGGA 3W1WA 4PSKA 1YT5A 3DC2A 2G67A 4C78A 1NR1A 4BV9A 4ER5A 1XEAA 4BCBA 1WU8A 1Y5LA 1SVSA 3F7NA 5E38A 4NENB 1I14A 1PYGA 4DG8A 1MAVA 4KR0A 2PT6A 3JSXA 4RD3A 1IY8A 4DC1A 3ZI0A 2QTZA 2FJUA 1YJ8A 1DBQA 2KWIA 3DDUA 3ZHYA 4HX9A 4Z51A 1O89A 3H9GA 3OCZA 1JZQA 3KL4A 1THGA 1G6Q1 5LR6A 1MD9A 3AERB 3GGJA 5F7ZA 5CIYA 3T15A 2WDPA 2ODWA 4PLWA 4DVJA 5JNWA 1Z63A 4R1NA 3VR2D 4O29A 4B7UA 1E9RA 4DJ5X 3OTIA 1NBWB 2P4HX 1A82A 3HMKA 4J9UE 1V26A 1Y34E 4RPJA 1M8KA 2ZE6A 2PWPA 3MK31 3ZHXA 1CQZA 4RVUA 3LO5A 3SJBA 3NDRA 1DRVA 4MAMA 2HRCA 3KZVA 3U39A 3TEJA 2O7SA 3RK4A 2GDZA 3TZKA 1E7WA 3NRBA 3ZK7A 3MTEA 2A3NA 4CIYA 2V6GA 1YR1A 1FQWA 1AO0A 2L0XA 4QUJA 4KR7A 3CTMA 3GLGB 1V6AA 2F1IA 3ANYB 1HLFA 5KOYA 1EJ2A 2IDMA 3F3YA 1Y4SA 3AO0B 2X6TA 3FPBA 3JWEA 3OFNA 4K6HA 3T1VA 4Q00A 4ROTA 5EKDA 1R2QA 5EE0A 4D3FA 1NW7A 1TA4A 1JI0A 1UJNA 3ILXA 5CPFA 3ZWAA 1Q11A 3ZKAA 2P1DA 2WQZA 4HV4A 1IUPA 2MR6A 4HLUC 2Q9CA 2QRGA 2WPNA 2BV3A 2O2EA 2XUGA 4TLLB 1ZKDA 1YB6A 2J41A 1U3TA 1T2NA 4HRVA 4ZP1A 3M5WA 4PGMA 1KAEA 1LDMA 1NRXA 3IEVA 3DMYA 3EAQA 1MX5A 2VHZA 4GOXA 4MRMA 2DFNA 4MR7A 1B7GO 1FUYB 1N5DA 3QBJA 5H7XA 1QU3A 3WIDA 2B4RO 3VU8A 2H63A 1CHDA 4PLVA 4KL8S 5A9SB 4RIHA 4U63A 4DR4B 1CUHA 1X8JA 3PUHA 4NBLA 3E22B 1H2BA 5B58C 1FFYA 1U2ZA 3HKEB 5JXIA 1YZYA 1N8NA 2R1VB 3FGZA 5EFZA 1CETA 3U3JA 4BJ1A 4E6EA 4TRNA 1PHPA 2VZ9A 5G1PA 4BWVA 3TAXA 5KOJA 1BE1A 3FSGD 1U0JA 3IOCA 3PCRB 2A35A 4XUDA 4F9FA 3QTLA 1DQNA 2WVHA 4KXVA 1HMYA 1U98A 3PT9A 4EABA 1BCSB 1ZJ5A 1QJ4A 5F9HA 1EK2A 3Q72A 3QKSB 3ZX4A 5LDDC 4ZT7A 5B53A 5JH7F 2QUBA 4WNAB 2YBEA 2Q4EA 2QZ4A 1M0SA 1U2SA 3EC7A 4IWNA 5C1BA 5TT1A 3SLRA 3V4SA 4RDXA 1SZPA 4B6SA 3OQBA 4GOKA 3NX4A 1B0UA 5KX5F 3PE3A 4BP8A 1RWKA 1F5SA 1TTQB 2C9MA 1E1QD 4K86A 4BNMA 4QQ8A 2BI7A 4OXYA 5HR5A 5ER6A 1ZVMA 1L4GA 1ZM9A 4AFNA 1J00A 1GVNB 4Z4CA 2QY9A 1NC3A 2PLRA 1DOHA 1YBFA 1T0BA 1TEZA 4N12A 2NXWA 3AHGA 5DNCA 3TLYA 4R5MA 2FOXA 4DMLA 2B4TO 3BM5A 2BM1A 4CMBA 4P7FA 4DMHA 4X1KA 2AHOA 3LUDA 1M72A 4BQSA 1FMLA 1M1NB 1BMDA 1G5FA 1SC1A 3NATA 5FYQA 4BWGA 1NFQA 4J0KA 4BVAA 3OM8A 2VUTA 1AUPA 4OJMX 1PR0A 2IIPA 2J3QA 3A6LA 5BYJA 4ZTUB 2X0RA 1JWLA 3BJEA 1S3FA 1LPNA 1J6UA 1XP5A 2BHSA 2H17A 3H5RA 2WSSD 4L8YA 4MMXB 4R6WA 5F4ZA 4ZXPA 4RHUA 1L4YA 2HRQA 1ONOA 1NVVR 2AG5A 2QRKA 3DJYA 3R5FA 4OFWA 3E3LA 4EA6A 4X41A 4BU1A 2D0DA 2ZR8A 3AZOA 1VA4A 4TQ9A 1TA0A 2GD1O 3PSAA 4WEQA 3U6KA 2IDJA 3OJCA 3H16A 4QWMA 1JHMA 2QLFA 1UC5B 3EOAI 1UC4B 3FJYA 3PUXA 5BP7A 3ZEIA 3ZTWA 2ZR0A 1GT6A 4TS1A 1U7XA 1U8AA 2IZOA 3DZKA 1C30B 1RC0A 2SKCA 4LYDA 3T35A 3WGVA 3PC3A 3ZCUA 3FFTA 3AEYA 3SU8A 2DQ4A 2IP1A 3HNOA 3W06A 2VCEA 1SKYE 5A4MS 4CKZA 2ACKA 4MINA 4LJSA 4XZ3A 2HNKA 3G5LA 5FOWA 1ISMA 1LW7A 2PFGA 5IDVA 1E4VA 5FX2A 3HUDA 1UCFA 3GUZA 2F1KA 2FPRA 4II7A 4RPKA 3UK6A 2ZRMA 5M04A 1GZDA 1TK9A 4MICA 4ZZ3A 2X13A 3GXBA 3PTZA 2CV0A 1C1HA 1XLUA 2DCUA 3QKRB 1YS9A 2FZGA 1I2ZA 1Y8QA 2N9UA 3DP9A 3L9XA 1E6LA 3UPDA 4MQ6A 4KK3A 4XDHA 3CRZA 5FWXA 5BSMA 5AUPB 4XGKA 3NHBA 4PS0A 3COZA 3E3MA 4IDFA 5KJFA 3URKA 5J1SB 5E95A 1R15A 2WTEA 2NPFA 4FX2A 4BGUA 4RQUA 1X7XB 1DAFA 3CO5A 1T5BA 3U7QB 2UYHA 3MT8A 1D8AA 4JFAA 1WDKA 4PYRA 3P5BA 1EP3B 1FXWF 3KFLA 5A2GA 2QVGA 1IN7A 3CT6A 3OLXA 2NUAB 4BLVA 4X3CA 2IHTA 1V4BA 1QORA 2RH9B 3DO8A 3GCDA 4BP1A 4EL5A 4JLVA 5H83A 2ZCVA 4E2WA 2OB1A 2ICAA 2IYNA 3BQMB 2Q28A 4M0EA 1R6AA 4P82A 2FSFA 3JQ7B 3NT2A 3VNAA 1XEXB 2Z4RA 5HFAA 1F8YA 5K8VA 1G59A 1DBWA 4N8SA 3PC7A 4CM1A 4MI3A 4UEWA 4UMEA 4F4HA 1G41A 1J8QA 2G88A 2MYTA 5P8WA 3LRPA 3K35A 2ONYA 3E9CA 4C08A 3F7MA 4OU5A 5MGBA 1RRFA 3IS3A 3JS5A 1WO8A 4C4SA 2I7DA 3FCEA 1WTCA 1UMCA 1NYRA 3LXUX 1EVKA 1A7KA 1ESDA 4CF5A 3EPLA 3KUUA 5J4YA 1GTSA 4DSNA 1CY4A 1CQJA 2EW2A 2WB2A 3QWFA 1Z7BA 2A5LA 1E0DA 3K0CC 3F7OA 4ZOEA 4HH4A 4JBYA 2H3HA 2JCYA 1C3LA 2K87A 1BA2A 1NNLA 2AXQA 2VC2B 2XNHA 3EIUA 3JX9A 4IBOA 2ZJYA 1GP2A 1HOXA 3QJGA 4OYHA 4IICA 1RQGA 3W1VA 3CUVA 5FUMA 2YY5A 3QQ5A 4B7AA 4HAWA 4GNKA 1IUKA 1OV6A 4R2LA 5IC6A 2I3AA 4HGNA 1FX1A 4BVBA 3G2LA 4GR4A 4MP6A 1BC5A 1DKMA 5GZ1A 3W04A 3ECCA 2G40A 5DNVA 3TTTA 3BIWA 3FI9A 4GQBA 1ISJA 1DP4A 4PXAA 4Y2XA 2E55A 3DTVB 4KWHA 2D0PB 1WCWA 3KZMA 3OA0A 3TD2A 2WIDA 3DC7A 3NTVA 3RWMB 1Z35A 3CLSD 4C7MA 4P7JA 4E0BA 3IOBA 4MPPA 1F06A 4FILA 1POXA 4YXWA 3C97A 2A1UA 3B89A 2H85A 3LUJA 4FYJA 4J1QA 4L22A 3S29A 2ESRA 3JRNA 5BT8A 1MC1A 3GAMA 2RH5A 2JFYA 4FXOA 2WVGA 1TF2A 3HRIA 5CFZA 4BQPA 2EX0A 3NOVA 4XM0A 4EELA 2AEFA 1D2CA 2RKBA 4K9DA 5E6RA 3HCEA 3LY5A 3LQ4A 2HBZA 4WL0A 2IUTA 4DIDA 3DM5A 4D9NA 2NADA 3QEOA 2P90A 4C7VA 5KUTA 4PYOA 4IDCA 4L7QA 2EWVA 1QRDA 3LT1A 4Z6KA 3R0VA 4H59A 5JMPA 4ETWA 1Q7GA 4LDQA 2XGGA 3D6UA 2GYVA 2Q6KA 1SUEA 3KWMA 3GN2A 1QIKA 3A6KA 5FF9A 4O02B 1EFRD 2ZI7A 2P69A 3BWXA 1L4UA 5I7AA 1B14A 3ESXA 1YAHA 3U2QA 4BO6A 3ZJYA 2R4TA 2VPWA 1K6EA 4CMIB 1E4YA 4B3GA 2XB8A 1LBTA 4R1QA 4DYVA 3GJXC 1C1YA 4D2IA 4HLQB 2JAOA 2PNFA 5DI3A 3T99A 4GHWA 4P84A 4J6FA 4D0NA 1A76A 2PUAA 1SPBS 2ANCA 1FUIA 3VPGA 1CY8A 3FWZA 4CT0A 5A9RA 4HQOA 5ITZA 4X3PA 2WJIA 4FLEA 2QTVB 3K8YA 1ZHHA 4ZHQA 4PICA 2R60A 2QN8A 4WHMA 1IOVA 1CY6A 5FB3A 3WL7A 3CX7A 1Y1TA 4DZZA 1MOSA 2IKSA 3E9QA 3QBDA 4HVAA 3VYVA 1ZO8A 4B71A 4B3IA 5HCUA 3JWGA 3X2EA 5BSGA 2B30A 2JHFA 1FU7A 1PT9A 2CJWB 4NYIQ 2OCKA 3M6LA 5ALSA 5FYDA 1A9RA 1K92A 2A0KA 2WNHA 3F46A 4U00A 5I7EA 3MWEB 1R66A 1D2MA 1RJWA 1QHSA 2C7VA 2VHJA 1BOOA 1K88A 1JKJB 1TTHA 2YHUA 2YN4A 3SM9A 1N9GA 1DWQA 1T1RA 3HUFA 3TBHA 4ZVOA 3R6GA 5EUMA 3B1JA 2E48A 1NJSA 1YTUA 3P9QA 1Y5MA 1XDUA 2D1TA 1OI7A 2WJAA 2GA8A 2UVPB 1XOIA 2PGDA 1MB9A 4MAAA 4YP9A 2W98A 4YNBA 1HNZB 1HEYA 3TD9A 4D44A 2PLAA 3VXKA 3IHLA 2J6HA 4IXMA 1HNXB 1ESNA 1SHZA 4RFLA 1YJAA 3FFBA 1ZUIA 4NG4A 4DLPA 2VL7A 3NPMA 4E5KA 4RCYA 3BB1A 1LK5A 1U3GA 2D4HA 3I1JA 1N2EA 5AW3A 2V7QD 1FTSA 4JC8A 4BYGA 5GOTA 1TLTA 2HO4A 2MYNA 2ZYVX 4UHJA 4UBOA 5EMLA 4B6FA 1QRTA 1A8PA 1JEQA 1ZVQA 5JNTA 1CQXA 4YRBA 5DHAA 1JL3A 2R8XA 4JBLA 4UBMA 1DEAA 4QL3A 1IN4A 4FZRA 4RH3A 1NSFA 1KEUA 1K4YA 1REQA 2FSSA 3IQZA 4MWTA 4QBHA 2G4CA 5KTRA 2P40A 1K9VF 1SIOA 4BB0A 1TVEA 3VH3A 1DIBA 4EY4A 2DEUA 3PC6A 1ZR2A 3IUQA 1V8PA 3KB6A 5BQ5A 5P21A 3UJAA 5KC8A 1VBKA 1CDZA 1WR8A 1G7CA 1R0WA 2FWIA 1GAWA 1OE0A 3LKVA 5ILGA 2B4KA 5TNXA 3SX0A 4KQWA 1Z5UA 1O9BA 2FQ1A 4E51A 1WZNA 6AT1A 3KL2A 4YV0A 1MO3A 4J1TA 4U5QA 4XRRA 3KPVA 4DKJA 1PYOA 3V6LA 2AEMA 1QTQA 4OYYA 1VL5A 4BXOA 4MUNA 3KUDA 1WL8A 2V7UA 5T4FA 1IUOA 1QIFA 1NZDA 3GHYA 4Q4HB 3WXMA 5IFLA 1GNLA 1E9FA 4LJLA 4YYZA 5A3QA 1NR7A 2DFPA 4OF4A 5E1OA 4Z4FA 4TWBA 4TTPA 4C3UA 4L2IA 5EZYA 4O4HB 1RQ2A 3F4LA 2GN2A 3M70A 4XIFA 1FSGA 3L8DA 4ZCQA 3UHPA 3OT5A 2TS1A 4YAOA 4LY0A 5HS4A 1QMPA 4PO8A 4TZTA 3HZHA 4AZ3A 2XNJA 3E81A 3TVTA 1NI4B 1ZN9A 3EF3A 4PW0A 1DO8A 4PCAA 5SZJA 5HILA 1K2WA 1ORTA 1XYGA 1ZUNA 2OV6A 4PLYA 1E2EA 3E82A 3M3HA 4GDFA 1RFGE 5HFNA 4OB8A 1T4CA 4F97A 4LTDA 3PYMA 4G8CA 2H6EA 4MUYA 1U2RA 3P0HA 4RF4A 2GN1A 4W9RA 1SKQA 4ZOLB 4AQ7A 4IYRA 5CNMA 1DC8A 3K8OE 4BMNA 4MS1A 2VF7A 1MPTA 3E5NA 5EZ6B 1NRWA 4D9CA 2ZU0C 4ZYWA 5BWMA 3ZV3A 5EJ2A 3GC6A 3OICA 3PIRA 1JFRA 3G1TA 4ER0A 2WINI 5B37A 3SCZA 5IAGA 3MPUA 3A2LA 3VC3A 3QBTA 3OF2A 5CAEB 3S2IA 3BB4A 1C7ZA 1J0XO 1GPDG 2EX4A 1C9DB 2JH9A 3H9CA 5CBPB 2WQ7A 5MHTA 3FSJX 2YVAA 4Q34A 4BMYA 1OXVA 1SD1A 3HSKA 1NNSA 3ENNA 1T6YA 1VBFA 2J48A 4KXQA 3DKRA 4JITA 3WGOA 1BDJA 1UMBA 2AFVA 3KQLA 1SHLA 3NHRA 1NAHA 1Q7RA 3LQQA 3OUTA 4NAUA 4JA0A 5GONB 3UMCA 2NO5A 3H8VA 1QCCA 1W85B 4OQMA 1X13A 2FHSA 3AR3A 1KDZA 3VR6A 2EBHX 1QFSA 4L8VA 1QJCA 2HSGA 3KOXA 4J2TA 4V0NA 2NVWA 2XEXA 5DYTA 1D6MA 3ZK8A 2ISSD 3ABRB 4CF7A 2QD3A 3WLJA 1TMKA 2ERXA 2UYOA 2D06A 3HKCB 5H59A 1AX9A 1E3IA 1HO3A 3ZD9A 1XCOA 4LHXA 3TLKA 4ECAA 1GAXA 3K96A 3RABA 5LIPA 4A0GA 1XG5A 3AM4A 1P7WA 4Z0HO 1M6VB 1S9HA 2HV8A 4HWGA 1SB9A 1G7SA 4TV8F 3OM9A 5ABPA 3HR8A 1PJ2A 3U6BA 1E94E 3N8IA 1RRCA 2D3WA 4DV2B 3OZAA 4U7HA 1KZ1A 3WP1B 1TK3A 1ZI9A 2NVBA 3HVJA 3R3ZA 4LA4A 3P7MA 5DGTA 1Q1GA 3T95A 1DXOA 4J49A 1EQ2A 2PY6A 4GX1A 4R3NA 4XIYA 1LFAA 1P33A 1YQDA 2GCPA 2IHKA 1KVTA 3ADKA 1XNRB 4XDGA 4XSHA 1Q3TA 5CT8A 3QWAA 4YAJA 1UBMS 2QZPA 4BV8A 3FPKA 1EXDA 4R2HA 2M6KA 2BDUA 2POCA 1LRJA 1Z6QA 3K9HA 2Q45A 4NS4A 3KELA 5JHGB 2J5XA 3GLHB 1I3OA 4H3SA 3SE7A 3WKEA 1P91A 1RRPA 4KACA 4Z3OA 5E9AA 1QU2A 1GRNA 4JVNA 3UK7A 4CQMA 2OZVA 2YVQA 4NK4A 5DBGA 2XI4A 1E7YA 2QW0X 4R68A 3RGWS 1H9BA 3TG2A 1QH1B 3VDMA 2V4MA 4BRWA 1D6NA 3CNOA 3ELDA 4IV8A 3T52A 1K7EB 4C5AA 3CVUA 3MRSA 3HA5A 3NT5A 2Z9DA 1RWOA 1ZP6A 4TT3D 2XT0A 3TSYA 2PKWA 1Z2OX 1Q50A 1XDDA 2H4HA 4MRMB 3OM0A 4ZQGA 1RQXA 3ZLVA 1ODKA 3KQMA 1TC2A 2JPDA 5BN5A 1RXCA 3H1FA 3VYWA 3CEJA 3FPHA 1DIOB 3L6DA 2HIMA 2P2LA 5EQJB 1M1YB 1X7ZB 3HLTA 4URFA 2C7OA 5C0OE 4UZSA 3LY8A 4ISBA 4ZVSA 4CVNA 5BXYA 4HLNA 3O92A 4JLKA 3DL7A 3ODPA 4MJLA 4WCFC 3GFTA 3SEAA 1AGXA 2V1UA 4YRDA 4FW9A 1JH8A 1CLUA 4GQAA 3V1MA 4PZDA 1SBZA 1KMMA 2ETXA 3F1KA 4TQAA 2LWIA 2A67A 5EHXA 3W7AA 2Q7OE 3HO6A 2WB4A 3HTXA 3A9VA 1G5PA 3D3JA 4X8OA 5FLEX 5I9TA 3ZOKA 2R6GA 4ZQHA 3KJZA 3C3WA 1X9HA 3EQ6A 2W48A 3MTGA 3T5TA 3W78A 4IHJB 1NDHA 4HGRA 2G4VA 4BLPA 1XAIA 3A32A 1GTVA 1DI0A 3DYVA 4MGEA 4MQUA 1T5DX 4OQLA 3OUUA 3MQFA 4MYHA 2BFBA 2GM5A 5LXTF 2GRJA 4NI5A 2OHGA 5LQKA 3PDHA 2BR5A 3PQ6A 1TJNA 1LPSA 4R2IA 5CK4A 4QE3A 2R25B 2QTFA 2V7BA 3PQ3A 2DQKA 4OXNA 4PVCA 5AM1A 3EEOA 1FNCA 2G70A 3ZWWA 3PGLA 1SD5A 3K71B 3B3FA 1NE7A 3E1SA 3IPAA 3JQ6A 3Q85A 4PZCA 4D81A 1NOKA 1L8OA 4DA7A 1EUQA 2XVYA 1V43A 1FVHA 1D1TA 1Q1NA 2BGNA 1Y9AA 5C53B 3BQ9A 1BVHA 4E7PA 2WHPA 1SWWA 5B36A 1A9TA 2GVZC 3I01A 5G53C 4PG5A 3JAKA 3FYUC 3DEFA 2QIOA 4WZ6A 4X1KB 4YH1A 3HJTA 3LYHA 3L7MA 4TX1A 1JBKA 4QPDA 1I4TD 4HEA6 3PFHA 1GZ5A 1UPXA 2G3YA 4MUBA 2GX6A 1YRYE 2C4TA 3G2OA 3NBFA 5L45A 5IAAA 1PJ8A 1ZOSA 2ZI4A 1KOLA 2W2NA 3QE2A 4C4YA 2LBPA 3GVCA 3TRHA 2PANA 1CUZA 1X8XA 2EWMA 2XDWA 3UCEA 2ZSBA 3CXUA 5ESWA 5FUQA 1KC3A 1GL7A 1BN6A 1PNQA 4LF7B 1I0LA 1U2QA 5HRCA 2PD6A 2BLLA 3SMVA 3VAZA 1PSDA 1XTJA 3OQNA 4CMEC 2H4JA 4EKEA 5JU6A 4P58A 3V4FA 4PBRA 4NYJR 4A8JA 3JZMA 2JZCA 1KO7A 4MB2A 4DXAA 2BFEB 3GJ3A 3QH4A 1GPAA 4YJGB 3DDNA 3EWIA 3HFSA 2PSJA 5AHXA 1WXFA 1T26A 7ABPA 1AT1A 2QR5A 1E2MA 1N2SA 1P80A 5T8KC 5K0ZA 3FTQA 2DY1A 2PPVA 2WG0A 4JI3B 4UHFA 3KSAC 3FVVA 1TLFA 1PFUA 3FNQA 2G1UA 4GL4A 1YMUA 5BUQA 1AD2A 2X76A 2MSLA 4A73A 3ADCA 4PX5A 3OOYA 1BEZA 1C0LA 1MC5A 2FEXA 3KSZO 5IT9A 2V9PA 5JC8A 5E2IA 4N01A 3K2BA 4E2YA 3U5ZB 1Y8QB 2WJGA 4PSUA 1AKMA 1EX9A 4D8XA 3CBQA 2G7MC 4EO4A 4YQEA 2WWRA 3PYXA 1GTG1 4DCGA 4EBFA 1V25A 4S2EA 1O95A 2EW1A 3C87A 1PX2A 1SHUX 4X93A 1Z2EA 1JNXX 5ICSA 4QXAA 2R1UA 3PNKA 1M34A 1PHRA 4E70A 1J06A 4ZALA 5AUOB 3FJ1A 1Z7EA 4ZEOA 3KUCA 5JJ5A 4LJ4A 3H3XA 2PLWA 2QY6A 2BHLA 3I01M 3T94A 3VPSA 1GDTA 4GKKB 4DLXA 1C9KA 2WBLC 1HQYE 2RGDA 4FFOA 4JD5A 3STHA 2O5EA 3L8EA 1QBGA 1U8TA 1Z26A 2FN7A 4FBGA 4WOJA 5LQRA 3AOEC 1UDRA 2X5KO 3GA0A 3EXG1 1S2GA 3G2NA 1DADA 4IS2A 4RQBA 1N5LA 1PG0A 3F2VA 4M0KA 4MCHA 1NIJA 1OC4A 3P0FA 5GTDA 2H2IA 5A5DA 1YU6A 4ND3A 2F2TA 3CB4A 4F56A 3ES9A 3OLQA 1JIKA 1VHTA 3PHBE 3UNXA 3OQJA 4DMRA 1YHZA 1MVLA 4XPIB 5A1TA 3H2HA 3DDOA 3EAGA 2ZZKA 1UMCB 2PH7A 4LDPA 5JNRA 1SCIA 3PXGA 3NALA 3GJSA 4L08A 1DBSA 4R4JA 1AB5A 3LL7A 1GQQA 1U81A 3QUCA 4GOJA 2ZRDA 1VA5A 4FEAA 3O38A 1M1ZA 1Y7IA 2XW6A 4C30A 2HGZA 3DP7A 1Z37A 2FPWA 3IPXA 5ECDA 5JWRA 5EKUA 2X58A 3SHFA 4X95A 3UV7A 3OT4A 4RENA 4J0EA 3DBOB 2G72A 5BSVA 1F51E 4ENRA 1ITZA 3OZ7A 2WT4A 2DC1A 4EQZA 3INYA 3GGDA 1JA1A 1F8XA 1K0FA 1L1RA 1TECE 2BEWA 3QHAA 3RIEA 4D8YA 1ZOLA 3DBRA 1BS2A 3QFRA 4CNQA 1PEDA 2G5PA 3VR4H 3I8OA 3GWZA 1I94B 2YWGA 4B33A 4TL8A 3I42A 1MZVA 1VCIA 4L76A 5E3JA 1XMIA 4OK6A 5HIJA 2PS3A 1WVIA 4X6XA 5I4BA 5AVWA 1QVZA 1XR3A 2UUCB 3WK7A 2ODQA 5KU1A 2UUBB 1KRXA 2AW5A 1MP0A 5D1NA 5AOCA 3CKYA 1DFIA 4RTJA 1L7XA 1KIMA 1WZEA 1XKLA 3IP5A 4DEXA 2NTYC 2A1UB 3FN4A 3FNFA 3QVWA 4BO8A 1CEYA 1PD1A 1RDFA 4IVQA 4J16C 4NCHA 3RODA 4DIFA 3LPCA 4FMCB 1K5DA 2HSWA 1IHUA 1MV5A 2Q5CA 3HZRA 3BSWA 3DZFA 4L74A 4W63A 3WL5A 4CG0A 2PBFA 2PSDA 4EPWA 1TGVA 3BHNA 4ZOBA 5CA0B 2E7ZA 5HCNA 4B32A 3M1AA 4LVCA 4UHHA 4ZRNA 4ZV4A 1L4KA 1H6BA 2WMNB 1WP9A 3SKYA 1MU0A 5K7SA 1Y8AA 4GKJB 4UQPA 2WUEA 4UE3S 3AR7A 3G5UA 5DNWA 2C4WA 4CIAA 2FMFA 3EFBA 1A27A 3JARA 3NEYA 2CCGA 3PNPA 3AXTA 4B6PA 1IATA 1F14A 4OKSA 3T3EA 3B3GA 4AP6A 2ADMA 3BKXA 5FPKA 4OUDB 3UAGA 3MTAA 1E2IA 1P1HA 3FRHA 1U9IA 2C5GA 4HQ6A 5HQ3A 4HVTA 3UMFA 4FU0A 4CMJA 4F21A 5C31A 1RKVA 2ZRNA 2QMHA 4FOSA 3W7BA 2VDVE 3LMKA 4JOBA 1HEIA 3QVXA 1C80A 2C59A 1MB4A 2QIPA 3EIEA 1HGXA 3V4OA 1K86A 5EQDA 1UXIA 1TW2A 1QGDA 2YCBA 3ZDEA 1GAJA 1XZMA 5HJ5A 1Q2UA 3AVOA 5ED4A 1YHYA 1BMQA 1WWKA 3AOGA 5THQA 4PX9A 3CLSC 4EPTA 3ZUGA 4F06A 5AK4A 4BX2A 1MF7A 2AN3A 1CJVC 1N0HA 3QK7A 1UWCA 3OU2A 4CKWA 2DWPA 2ONJA 1I4DD 3DPSA 4KAAA 2QT1A 2VJYA 2WK1A 2XHEA 1Z62A 1Z5PA 2FPXA 2G9QA 1JZTA 1KMHB 1KRHA 3EXEA 1HY3A 2GEJA 2PM8A 3O9VA 1UWVA 4XWGA 5CLHA 5JIBA 1HTWA 1ZM3A 2HDHA 4HNSA 2HZBA 2GFIA 2XA9A 3IKJA 1JIXA 5J2UA 1DKQA 1DHRA 4I66A 2C83A 1KY5A 1MORA 4MKGA 3B5IA 1NBEA 2H4FA 3RKRA 4RJTA 1N9GB 2PUGA 2VSQA 2OECA 1SZDA 4FGSA 1Y1PA 4RK6A 1JHXA 2ORVA 3ZKWB 1HSZA 1Y3AA 2Y0CA 3V8QA 2B2CA 4DRZA 4PC1A 2GBCA 4GSLA 3WBFA 1YWGO 5FNZA 4RTMA 2A92A 4C6SA 2HCFA 3E7XA 1NVKA 3G2JA 2O7QA 4RHEA 2CL0X 1ZUHA 1V0JA 2FCRA 2CUKA 2QTBA 5JS6A 4BCCA 2NSDA 4G2NA 4M9UA 3I04A 1CQIA 5E7MA 4RETA 3TN7A 4G1MB 3FVQA 5BW4A 3DLBA 3Q3IA 2BFMA 4OA8A 3PB3A 2ZDGA 5EIHA 4ZDKA 1MFZA 4MZDA 1DLIA 4C7KA 1WHTA 2GUWA 1JEQB 4IILA 5ALQA 3FROA 2EKDA 4HYQA 2EX1A 5D3QA 2R86A 1PTJA 4NH4A 3TPFA 4RANA 5A4KA 2EXXA 1R0CA 1REQB 3LUGA 4I4TF 5JRZA 1RCTE 2AWNA 4IZIA 5KYWA 1RRMA 3DDZX 3KCQA 3R6WA 3CKMA 4OSEA 3DEJA 4HLDA 4ZAYA 4ZVRA 5GM2A 1A4IA 3TI7A 5AK0A 2OESA 1PK7A 1QRAA 2VP9A 3IO5A 4FYVA 1I1QB 4OHKA 3TQQA 2V96A 2XMPA 1XSEA 5FTJA 3C1OA 1KO5A 2YQZA 1S5PA 3Q5GA 2EWWA 4TXLA 4TXHA 5CW2A 5IYZF 2RHJA 1GQSA 1SUCA 4BWYA 1BH6A 4EB8A 1SUSA 1Z2NX 1UK8A 2HOQA 4F91B 1L5NA 2FN9A 3FCXA 3E6AA 3N53A 4O2AB 5IAEA 2FMKA 4MGKR 3ZHZA 1QSGA 4BXOB 2CLMB 3BG5A 1NZJA 2P9QA 3IJEB 4JL5A 2BMWA 1U4SA 1Y6QA 4NU0A 1D0SA 1DWOA 1M0WA 4Q6BA 1KWGA 2YYSA 2CV1A 3QW2A 1TAQA 4BNKA 1ENPA 3FKSD 3DFZA 3ID6C 1KEZA 4L2IB 2R85A 5EZYB 1IK4A 1SUWA 3QKTA 1SCDA 4GX0A 2YQ5A 4U8GA 2CJYA 4GU5A 4UMFA 5TS2A 2JI9A 2A57A 3P52A 3RS7A 4MRRA 3CN9A 2Q4TA 4AZ3B 1LBHA 5HMLA 3RU7A 1XUOA 1E2FA 2NV2B 1A4UA 1ZUNB 4GLOA 5MF6A 1BDMA 3ZZMA 4CUKA 3DEAA 2HQOA 3UWKA 4G5XA 1T4CB 1N75A 2IU6A 4ZDWA 1I8TA 1ECCA 3EJ6A 2F3QA 1M3SA 4HNQA 4C5BA 2NUPA 5J4KA 3JD2A 3HWWA 4L6IA 2NPIA 4MS1B 1SHKA 1NQOA 1QVVA 2HHLA 3C1UA 5AJWA 4JN6B 2F43A 5KTMA 4DE5A 4BEWA 2P4SA 4LOKA 1U9JA 1RJEA 1USWA 4QA9A 4CU2A 5HOEA 2RK3A 3A1CA 3I04M 5I01A 5AOAA 3PHHA 3UICA 2AQIA 2JA2A 1WHSA 1V71A 4OQDA 1HE2A 2VF8A 2RE8A 1DFGA 2C5BA 2YZ7A 3IJRA 3DTNA 1OW3B 3TNFA 1UMBB 1ZG3A 5JECA 2ZYWX 3KJGA 3ZQUA 1NXPA 2A78A 4RV4A 3LTEA 3RYIA 2VQDA 3CUWA 2OE2A 3EC2A 4O3FA 4CIWA 3KKLA 1COWA 3CLHA 5HEKA 3H5NA 4N47A 5CURA 3UMBA 5LMCA 4V24A 1A4XA 2R8YA 4L4UA 4R81A 5HKLA 4DCVA 4AYWA 4Z1MD 4OBBA 1HRKA 2VNAA 4U2DA 4JI2B 1F1BA 5CFLA 1YA6A 1DIHA 1HETA 1E1LA 4JI1B 4Q3AA 2VAVA 4BKRA 1U7PA 3ZU5A 1IDN1 1CC1S 1RVV1 4LJ5A 1TDJA 3A9TA 1M2FA 3CVOA 3ZDBA 4FW8A 1JR3E 5LJLA 5B4VA 4DBLC 4HWSA 4Q19A 1PJLA 2YJ4A 4DIKA 4E33A 4G56A 3O8QB 3T3NA 2QZSA 1IOLA 3GJ4A 4F85A 1O94D 3NM4A 2CGEA 1JNYA 1CW2B 5IK2A 5KDDA 4QOGA 5LDHA 4UEJA 3S2SA 4LXIA 5CYGA 5KINB 1WB6A 5ALJA 4EO7A 1E6MA 2X2EA 4INOA 1TMOA 4HXEB 4OHXA 4WBSA 4OK3A 3O84A 4BDSA 4DR3B 4XVCA 4Q7JB 1XCMA 2HWYA 2ZYAA 2VP6A 3M7IA 4DV3B 3NUQA 2ZSDA 2R6FA 4IMIB 1HX7A 1QAOA 1Y3BE 4PYNA 1E2UA 5DJ5A 2GD2A 5ALIA 4RPHA 5ALLA 5K3BA 5JY1A 2W5UA 2XYPA 2OCPA 3AF2A 1QOZA 1UIMA 2FWBA 3DDHA 4O08A 4PG4A 3VH2A 2FN3A 3INNA 2NQTA 1KYZA 3PDJA 4OJNA 4QPNA 4L9AA 3SVZA 5HF9A 5FUBA 4NABA 2FZEA 1XZJA 3JYLA 5F2KA 1HT0A 1HT2E 3HACA 4R1UA 3PHJA 1L7EA 4DM7A 3PRYA 4DKXA 1OPRA 3D8BA 4P4TA 3C3MA 5FHQA 1JU9A 3D7NA 3V8PA 3BD9A 1RYEA 1XZCA 1ZN2A 3L84A 3P26A 3PL5A 3LPDA 3MS7A 4QNRA 1WQ1R 4KRFA 5AVYA 2OBMA 3AIKA 3VNBA 1JP7A 4EB6A 3HDTA 1CUVA 2BZ1A 2XE4A 4RDIA 3T5BA 1IBCA 3IAS1 1U0TA 4CWAA 3HUEA 1GYRA 5BN5B 1FYWA 2FOIA 1TYDE 3H42B 5K2OA 2OGUA 5EEGA 1T9GS 2C4VA 3C6ZA 3FZQA 4KTTE 1B74A 3FNBA 3ZU2A 3GZNB 2JIZA 1SVWA 2ZUSA 4U39A 1LDBA 1C7IA 2QW1A 3BL8A 2A5JA 2JNWA 3G82C 1JG4A 2EKZA 1I51A 1X39A 4IF4A 4Y30A 3W9BA 1Q7TA 2E4ZA 1LS1A 3F6CA 4D8WA 4MQBA 5DM70 3B7PA 3RVKA 4RVSA 4Q37A 3SBEA 4WLVA 3UV3A 5DK6A 3OPYA 1IJKA 1I24A 1NMSA 2OWDA 2XMRA 1ZNYA 1NSTA 3K1TA 4P32A 4I3HA 3K2QA 1G9XA 4W1RA 2W2PA 3SIRA 4YALA 1GOTA 1QGED 3TZHA 3NVMB 2HV9A 2C78A 3VO1A 5A71A 1KSJA 2NYVA 2X2FA 1LWNA 2AZ4A 2XUZA 3B20A 4JMLA 3Q87B 4TUYF 5FPHA 1K4KA 3FBGA 5AI9A 3UB2A 4EW2A 2OVFA 4TT8A 1X2BA 3AB8A 1G5RA 3QNUA 4MXDA 3SOPA 4B2IA 4DDVA 1SBYA 2WWWA 2YWDA 4TMVA 1DJQA 2I4IA 1M2OA 4FWTA 3EUEA 1D2HA 1Z0ZA 2F00A 5J3JA 3VGJA 4RY2A 4X60A 1QF7A 4UM9B 4ZYTA 3WAKA 1SIUA 2QUZA 3FHTA 3JVIA 2D2VA 1KO1A 4DXDA 1KQOA 5ALHA 3UANA 3NKLA 1SC4A 4B6RA 2CLIB 5L7WA 1RR6A 2OD7A 1CS0A 4K7JA 5IFKA 2ZTMA 2YJTD 1CLEA 3H2ZA 2R7MA 1XNQB 3V4VB 2X0KA 3HJAA 3GLFE 4J8PA 1L5GB 2NW6A 4PLFA 3BTUA 4LTNA 3HLYA 4M7PA 5AI5A 4RYLA 1UDCA 4NAVA 4C07A 3F5QA 2ZJ3A 3GQBB 4M7WA 3EMKA 3OLYA 3CRRA 3CZMA 2R5NA 3I0NA 3MOGA 2WTAA 3T3IA 1XJCA 4NCIA 2WYVA 4X91A 4NEGA 4N49A 3ONWA 2XRYA 4H1UA 5ELXA 5HIAA 2G5GX 5J5CA 4K87A 1JDVA 3DMGA 1T34A 2W00A 3NAMA 3PDIA 4LW8A 2MINA 6LDHA 3Q8LA 2YN0A 2VVTA 4WA8A 5CA1F 1O08A 5KNDH 5LQCA 4TLDA 1WMAA 5A4IS 1OA1A 3KB8A 3Q6IA 4F38A 2C5AA 3FDJA 4LNUA 3DOEA 3VR4A 3KLNA 4AN4A 5JTTA 1YQ9A 2V03A 3OFSA 1WA5A 3GFQA 3DTTA 5T57A 1B42A 1J07A 4X3OA 1BJRE 3OE4A 4KNVA 4MUIA 3TJRA 4B80A 1GT91 1BE0A 3KDPA 4B3DA 2XITA 4YR9A 1W88B 4QG3A 5CD9A 3NWBA 4US2R 2ZWPA 4GRDA 4MSUA 1I2CA 1SZJG 1XL1A 4GMXA 2NUTA 3W6OA 3KEOA 2P9YA 2ZJ5A 4YTEA 4JT4A 5LP1A 2ET6A 3HPRA 5AK6A 5JAMA 4XFKA 1PQPA 2ZBFA 4J3JA 4Q4CA 2V7EA 4WJLA 3R3WA 4PVDA 2JFPA 2W70A 4I6EA 2ORYA 3AETB 3DO5A 2YJ3A 4YJDA 4B3FX 3U09A 1KQFA 2WM8A 3JYHA 5E3HA 1TIKA 4IIJA 4ITUA 1T3HA 1MEOA 3JRWA 4CL2A 2I3ZA 2IZ6A 1WP4A 2GPJA 3IMCA 4IDPA 1K08A 1M34B 2P3QA 3RLIA 2IX3A 1EK1A 3HP1A 5BR7A 1XU4A 3AHDA 4YCCA 2NZYA 3HRHA 4KQ2A 4FT4A 4X8MA 1VLMA 2R6AA 3R5JA 4HQLA 4X45A 1YIDA 2VDNB 2O54A 1PR5A 2JK1A 2H1WA 3WGNA 1VL8A 1Z0SA 4OYLA 5T67A 4ENVA 1CIPA 1W36B 1ZUWA 1PNTA 1M75A 5HSGA 2QUKA 1E1DA 3E2MA 1XQWA 4CG2A 1SO8A 2NT3A 3SE0A 1PSWA 3IKMB 3QYJA 4P3XA 5BSRA 1PG5A 4R16A 1G3QA 1M6HA 1AMUA 1A2OA 4O4LA 4Z9FA 4LZPA 1T36B 1VYHA 4H0CA 3KVOA 3TIIA 1FTGA 3FVWA 3QYFA 4XA8A 4UPEA 1E98A 2ZTHA 2KMLA 2NGRA 1J7JA 1UADA 1Z0JA 3N1UA 1L0BA 3MB8A 4LBYA 1TF7A 5DULA 1BJKA 1R0ZA 5G0VA 4QU0A 4C7XA 1VMEA 3DOOA 1ACLA 4WV3A 4IV5A 1U3FA 1Y3DE 1G3MA 2YY7A 1L6RA 4KOAA 1DWPA 4DYHA 4AJPA 1ABEA 1FFCA 4FK8A 5BSFA 2SNIE 4REMA 5G0TA 3DZJA 4HDSB 4GBGA 1X77A 2C2WA 3ROEA 1T4GA 2NTEA 2FZVA 4K2HA 4ZPXA 4EHIA 4H7EA 4KQGA 2IU3A 4PSAA 1AKUA 4Y2UA 2RONA 4QM7A 3AVTA 4JH0A 4Q16A 4CFSA 2BEWB 7REQA 1OKKA 2QJWA 3PDWA 1EDEA 2JGEA 3KLPX 1T29A 2X8WA 2H1HA 1KH2A 4EY3A 1TJ4A 4DQ0A 2OFOA 1BX1A 2V5AA 2OBNA 4KYVA 5FBRB 5JSHA 3SYTA 4DUPA 4Q3EA 3OQMA 3W5IA 1EVLA 1Q2XA 2XAAA 3QY9A 1JHYA 3CRQA 1AKTA 4QFCA 3TZCA 2W0SA 4EHNA 5LP6A 4M8KA 3DONA 1K8YB 2VSYA 4YHBA 3OHSX 5HK8A 4BKOA 3NC1C 1NUQA 4NHEA 4ITVA 1EK6A 1UINA 4PO3X 3SEQA 1AUQA 4EATA 3LKBA 5M5BA 3M9XA 1NLMA 4ICIA 1XTVA 1N3BA 1XTSA 3RRXA 3C8UA 2GAJA 4I5DA 1AHHA 1OLOA 2YS6A 4LGVA 1WW2A 1VYUA 5FNVB 1ZEMA 3GZ4A 1FSSA 2UYYA 2O8VA 3EAFA 5D3MB 4LF6B 5AWFC 1XRSB 3AEZA 3PC8A 2ERYA 2ZS8A 5LYJA 3KSMA 4B4UA 5DN6D 2BY4A 2O0HA 3NR2A 1BXRB 1I5EA 3AINA 3K1ZA 4HXYA 4HJXA 3UPUA 5AVRA 4B6QA 1DZ3A 3F3KA 5BW6B 4C2UA 3JARB 3I1IA 3DJFA 4H9GA 5FUWA 1JEOA 2NLOA 4AM8A 1U8YA 1XLVA 2INGX 2HMAA 2QTWB 1SELA 2HTFA 3LLMA 4G0QA 4YI3A 4RGYA 4HNAB 3TZQA 3K70B 4JBIA 3MELA 4MS4B 5HQ3B 2I5PO 5JQGF 2A0XA 2DUJA 2CMKA 2XUQA 4P4UA 1PGNA 3AC0A 4KQCA 3S5UA 5AIBA 3OEEA 4WVLA 1J8VA 2W11A 2ZT8A 2MHCA 2ISCA 3G3EA 5ELLA 2I3BA 3TJMA 2C5SA 2ZUUA 3U9LA 1FFXB 1L5ZA 5AD1A 1L7OA 5JEDA 2O2YA 2Z2YA 5IRCD 2YWHA 2AVNA 3I6MA 4JB3A 4ZA2A 4DQKA 4UTRA 5HKKD 4B9AA 2Y0DA 2YR0A 4K1LA 3HFRA 3W9SA 1W52X 4EJSA 3ESYA 3FPFA 3ELUA 1V1RA 1L8AA 2C31A 1R6UA 1NC1A 2PKXA 1J0EA 3TTUA 3D5EA 4XE5A 4TSFA 3EXEB 3LXRA 3UXEA 5K0CA 1PVVA 4BRSA 1L7BA 2OSVA 1GGJA 3UUGA 4CDMA 1NW8A 1XZAA 4YCMA 5BWBA 2M32A 1NLFA 1XA3A 1TM1E 3GVIA 4IGIA 3WMRA 4DR5B 1O6CA 2GJKA 2Y4OA 2CW5A 2DOKA 3L41A 3ESCA 4FHEA 3ONVA 4IIVA 1E18A 4P4NA 4PS1A 3UH0A 4E22A 3MBOA 4CLOA 4E1BA 1DKRA 3KQUA 2BP7A 4NNPA 1M5TA 1ENOA 3EG9A 3IBGA 1Z4KA 4IDBA 3AGPA 3GDOA 3SIWA 4WADA 3SHVA 4W5OA 1U8EA 4D0LB 2MT9A 5TMEA 2A9QA 1UZNA 4D99A 4Z7OB 5INTA 5KKCA 2O8EB 1FCJA 2YZKA 4Z9BA 1QFYA 2HHCA 4OMDA 5K3FB 2W2VA 3USZA 5K8JB 1W34A 2PT9A 2PVPA 2Z6VA 4LC9A 5GPBA 5HXAA 4Z4IA 3ADBA 1UIRA 2EBWA 3Q7PA 2CLOB 3EDYA 4HTAA 1CQIB 1KJ9A 2YBDA 3W90A 2VJKA 1J0BA 2H4ZA 3DUWA 2DR3A 3P94A 1K9SA 1Y5RA 5I51A 4MUKA 2I9KA 2UXDB 4I50B 1M76A 2OCLA 3B85A 4XYGA 4YRCA 1V6CA 1WHTB 3UCXA 1HBJA 1E3TA 1MB2A 3WGJA 5FOTA 3A58B 1VLHA 1FUUA 1WAMA 1ISSA 2VBGA 1PJSA 3B5EA 4OM7A 2HL6A 2HSEA 2FEKA 4O0MA 3I9LA 3RF7A 4CZ2A 4A0RA 3KR1A 4Y2TA 1X1DA 4KFRA 5LQUA 4A10A 2O2IA 2F3TA 2B5OA 4IRXA 2QJRA 2B7LA 3IRUA 4MNTA 4L78A 3I64A 4K9KA 1GUFA 4FB4A 3HDQA 4YY3B 4ZT3A 3QW4B 1CJCA 1KI9A 4NARA 4Z2YA 4KQ9A 4CXMA 1AY0A 1N6HA 1DU4A 1R6BX 2PKYX 1X8KA 1Q1QA 3HCNA 4BE9A 2ODEA 1JMVA 1YDGA 5I7UA 3KVVA 3DM9B 5CD1A 5HVNA 4AXXA 2IBTA 2YUIA 1Y7HA 3DNMA 3SR4A 1J0AA 1R3DA 2O2XA 3BMNA 4RXUA 2F4VB 1SKBA 5DHUA 5FFMA 4YRGA 4HEQA 2J9FA 4MQFA 1Z88A 1BHJA 4HZUB 2P35A 1NTRA 3FLAA 3Q0EA 3RU3A 2JKVA 1VPEA 2OO7A 2BZSA 2OTCA 2PQ6A 3WB9A 1TO1E 4JGIA 3AUTA 4PRLA 2FKAA 4F4UA 5EYPB 3CURA 1TYZA 2Y4NA 4IAOA 4ZYYA 5IJ9A 1RAEA 3KYDB 5KYTA 4WESB 3E5RA 1P6QA 2QP9X 4PRYA 3RARA 3N3AC 4JOQA 2WVJA 1IPHA 3VTAA 4IOKA 4JLNA 2J3LA 4QARA 4DDUA 1V39A 4QJIA 4C0LA 4LJ7A 1J20A 4ALKA 1C4OA 1YZ3A 2H5LA 5A03A 3SC2A 2XWBF 1Z17A 2F43B 3DR5A 2YW9A 1LLQA 4LISA 4J0JA 1W87A 2GB4A 4MIEA 3H0KA 4RVNA 3WYNA 4AKSA 2OR3A 2VSOA 3LF1A 4LY3A 4Q12A 1NMEA 1O0SA 2QN7A 4BLOA 4BFUA 4MITA 3ZN2A 1BYIA 1G38A 2Q5FA 3S7TA 5GV8A 1DG9A 2R00A 3ZDQA 3CGGA 2C3YA 2RI6A 3VUEA 3O4FA 5IDWA 1C7JA 2JGFA 4F4JA 3RWBA 1T1EA 2Y1XA 4XDYA 4U7PB 3C3JA 3W3AH 3RYIB 4TTIA 2FSIA 2OCXA 4H16A 1PJCA 2WYWA 5I9SA 1V47A 1Y81A 2Q4OA 2VDKB 1GSAA 2WHRA 3PFNA 5F2NA 1S1MA 2W6JA 1G4UR 5UKDA 3D4LA 3NMUF 4QUAA 1OH8A 3KNZA 4E5YA 4ALMA 1GG5A 1HF3A 2TYSB 3IV7A 2VPPA 4JEUA 3SC3A 2QVBA 3IUMA 3AB7A 3OO1A 1RHQA 3OWXA 4O59O 2B8WA 3ZXYA 1KJJA 1U28A 4QDJA 3T38A 1X1RA 1LPPA 4ZAVA 3I92A 1E1KA 1QVRA 1FA9A 1EZ1A 5LB2A 3IUEA 3B52X 4X92A 5JTUA 3QFFA 1KTVA 5JO0A 4HAZA 3AF6A 4QO7A 3EFOB 1O9HA 3KLOA 1K75A 1RKQA 2FKNA 3R1IA 4I36A 2AFIE 4UBLA 4OP2A 3HJNA 4MO2A 4M1KA 3TLEA 1U1IA 2NSYA 3QNMA 4KO1S 4F8JA 2HLDA 1VKZA 1W29A 3AIIA 3W5UA 2PLNA 3HGTA 3PHCA 3OOEA 3PR2B 1M66A 1MJNA 4G1CA 2R47A 1P6XA 1EFTA 2Y76A 1TUGA 1NAIA 4X0EA 1X0VA 4F6LA 4TTSA 3IP9A 4YRSA 4C05A 4ZI2A 3A14A 1PJAA 2O2JA 2W4QA 1EXVA 1GUBA 5HFJA 1R9JA 1G5QA 4YECA 1D09A 5A05A 2ZVQX 3CMCO 1PR6A 4QG7A 3ZIUA 1CUGA 4V0OA 4J07A 4I0WB 2GEBA 5FBHA 4RQTA 4DQLA 1T10A 4RCVA 2F55A 5IVIA 3ZUPA 4GVLA 5DT9A 4F11A 3TSOA 3ND9A 1K5GA 2DUWA 1BJTA 3BEDA 5IHPA 4XUCA 5KNDA 3LPMA 4JYMA 5EGNA 5TE9A 4C9BA 1Z4LA 3M9LA 4CTOA 2QRMA 4NBRA 2QQ5A 4EB6B 5DTJA 3DCNA 3ZV7A 4EKIA 3U4HA 3EDOA 2H0RA 1ID1A 1TD9A 2VF2A 1ZS9A 2FEMA 1M54A 4KMRA 3AVQA 1XU9A 2E3JA 1CF9A 3SXJA 1LTQA 1X7WB 1O94C 3VYSB 1ZW1A 5JPDA 4FB5A 2GDJA 1OYWA 3FHLA 3OZTA 2J4CA 1X7DA 4NBSA 5E6UB 1XMX