2DP4E

Crystal structure of the complex formed between proteinase k and a human lactoferrin fragment at 2.9 a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Proteinase K
publication title Crystal structure of the complex formed between proteinase K and a human lactoferrin fragment at 2.9 A resolution
rcsb
total genus 88
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2006-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2dp4E00
3BGOS 4AKSA 2B6NA 1GCIA 5FFNA 1Y48E 1R6VA 1UBNA 5FAXA 5AMXA 1VSBA 1GNVA 1S2NA 1Y3CE 3L1KA 3ZXYA 3UNXA 1HT3A 2QTWB 2Z2XA 1TM4E 4WOCA 1R64A 3VV2A 1TO1E 1THMA 1KE1A 1GA6A 2TECE 2WV7A 1V6CA 3DYBA 4Z2AA 3VTAA 1LW6E 4RYDA 1TM3E 4DZTA 1TECE 5CW1A 1BJRE 1SCDA 1Y4AE 1S01A 3HJRA 3SQOA 1WSDA 3TI9A 1AK9A 3WQBA 3SICE 4LVOA 3TI7A 1JEAA 4I0WB 2W2NA 5AVJA 3A3PA 2SECE 1OYOA 1SIOA 5JXIA 4CFYA 1WVMA 4NE7A 1SUPA 3I34X 3QFHA 4B5LA 2PRKA 3F7OA 2DP4E 1SCAA 3DE6X 2E1PA 3GCWA 5AQEA 1SPBS 1SCJA 2ST1A 1WMEA 2PYZA 1GTL1 3BX1A 5SICE 4C3VA 1IC6A 4ZOQI 3QTLA 1YU6A 1P7WA 2G4VA 2IY9A 5JMOA 3ZXXA 1YJBA 3EE6A 2Z2ZA 2HD4A 3Q5GA 1NDQA 3VHQA 3CNQS 4JP8A 3DW1X 1Y3FE 2GKOA 1T1IA 5JXJA 1TK2A 4K8RB 4CG0A 1SUEA 1SCNE 5ARDA 3LPCA 2IXTA 3P5BA 1R0RE 2V8BA 3DE4X 5ARCA 2PWAA 3I2YX 2XTJA 4H6XA 2Z2YA 4OV6B 3DE7X 3DVQX 4HX2A 1SIBE 1EA7A 1Y34E 2X8JB 2PQ2A 3VSBA 4YN3A 2ID4A 3A3OA 1AV7A 3DDZX 3I37X 1PTKA 2W2QA 3PRKE 1Y4DE 4FONA 4CFZA 2SNIE 3DE5X 1AQNA 1V5IA 1PFGA 4NE9A 4OMCA 1Y9ZA 4HVLA 1C3LA 2W2MA 3DVRX 5B1EA 3WIVA 4LVNA 1TM5E 2WUWE 1P7VA 3AFGA 4C3UA 1AVTA 1KDVA 1SBHA 1WMFA 1SBCA 1YJCA 3DW3X 2Z56A 1SBIA 5ARBA 1NLUA 1TO2E 3T41A 1Y3BE 3PTLA 4BWGA 3D43A 1GA4A 5FBZA 3DE1X 5I9SA 1TM7E 1TMGE 1BE8A 1SBNE 3GT4A 2PWBA 3D9QX 1KE2A 4KG7A 2WUVA 3DVSX 5B1DA 3AJ9A 5AVKA 3CO0S 1SUDA 1TM1E 2Z57A 4AKTA 1BE6A 3EIFA 3GCXA 1SH7A 1BH6A 2DUJA 3DE2X 1CSEE 1OYVA 1ST3A 1T1GA 1KDYA 1SN7A 4MZDA 1IAVA 5JXGA 1WMDA 3OSZA 1SCBA 1MPTA 3H42B 4H6VA 2ZWPA 1EGQA 1OT5A 3F7MA 1SBTA 4KB5A 1XF1A 3VV3A 3GT3A 1C9NA 1S02A 1Y33E 1Y3DE 3LPDA 1GNSA 2Z58A 2HPZA 2ZRQA 3VYVA 2X8JA 1KDZA 2WWTA 2PKCA 1AU9A 3LPAA 1SVNA 1DUIA 3DE0X 4ZARA 1GT91 5JXHA 1AH2A 1Y1KE 1SELA 2SBTA 1DBIA 2W2PA 3QMPA 1ST2A 1A2QA 1NDUA 3Q40A 3WIUA 3BPSA 1T1EA 3F49S 2Z30A 4DJ5X 2ZWOA 1GA1A 1GTJ1 2W2OA 4WOBA 4DWWA 3WHIA 1Q5PA 4OMDA 2P4EA 4J94A 4GI3A 1ZVJA 1C9JA 1ZVKA 3TECE 1AF4A 1SUBA 2ID8A 1BFUA 2DQKA 1SUAA 3DE3X 1YJAA 4H6WA 1SIUA 3LXUX 3A3NA 1P8JA 4NMXB 1BFKA 1GTG1 5K7SA 1MEEA 1C9MA 4KPGA 1PEKE 2XRMA 3I30X 2SICE 1PJ8A 2PMWB 3AJ8A 3EDYA 3DWEX 4M1ZA 1SUCA 1CNMA
chains in the Genus database with same CATH superfamily
1KI3A 1FDRA 5HZHA 4Q7LA 1DAHA 2I78A 5AVZA 3ETLA 1ZRSA 5AVXA 4DCUA 4CM7A 3T7SA 2WWIA 4PC1A 1Y48E 4FVTA 4FR0A 4F3TA 2XUJA 1L5WA 1W35A 3KJQA 1W19A 3ZWQA 4A27A 3IE1A 3MT8A 4ZQIA 3D6MA 5IT0A 3MM4A 4B7UA 3OE5A 4JB0A 4MS4A 3SBEA 1P4JA 2ACVA 3OFSA 3WWYA 2AZMA 3D7SA 3TMKA 4BP9A 4YECA 3E5RA 5E2IA 4EMSA 1RLIA 4V38A 1CUAA 1V5WA 2V6JA 3DLPX 3H99A 2D2EA 3VAAA 4D8YA 1MIOB 2QRVA 2GBFA 2V4UA 3ESQA 3OM8A 3PT9A 4OHFA 3UOAB 3ZLJA 5AQ1A 2I4TA 2ASEA 4TMWA 5TR9A 2AHOA 3UNXA 4I1SA 3BMXA 1C1XA 4KLRA 1ZIOA 2RAPA 2FX2A 2NO4A 4FILA 4TXJA 5F2KA 2QN3A 4WLEA 4WSOA 5ER9A 3TSZA 4EKEA 4UBNA 4FE4A 1T2NA 1WZ2A 1MC4A 1KTVA 3PF9A 4LGMA 1GA6A 2XKBA 3CXRA 3NTVA 1L4GA 1QHIA 4YAKA 1UKBA 1AY0A 3PGA1 2P6RA 4L4UA 1VMIA 4LJKA 1K5GA 4ARVA 3O8RA 4W5HA 2ZRCA 1W59A 2VJQA 4RKYA 1HETA 4LRXA 4P35A 1T0BA 3ZI7A 1KI1A 2QRMA 3MGGA 4POAA 5KYGA 2EKPA 4DV5B 2VIIA 1Y4AE 3ECAA 2C4TA 3MWFA 5EJEA 4B3HA 1Z73A 3TNFA 5IJAA 4UAGA 2M9MA 4MKXA 4C6RA 4EITA 1N8SA 4WJKB 4XQ9A 1RHMA 4C0SA 1AMNA 3AF1A 2FCRA 1VIAA 2FSUA 3OJXA 3HO1A 3IHWA 4L7QA 1ZCAA 2G63A 1U7TA 4HRXA 3TZKA 1IUPA 4HYQA 5HMLA 3G89A 2IEGA 1QV9A 2P3SA 3OQPA 4MYCA 4B2LA 1GDHA 3B60A 4V0QA 3ABOB 3VH4A 4TSKA 2A5JA 5ALYA 1ZK4A 5BWLA 5CHYA 2MHCA 4O8ZA 4N3NA 3MMSA 4ZEOA 2VF8A 2ZAOA 3GGOA 3TSOA 1YU9A 1CETA 2IHVA 2Q1YA 2BTQB 1DE0A 3C5CA 3O1IC 3R3YA 1KDOA 3RRZA 1IPFA 1E1DA 1YDFA 3EGCA 3PNBA 4DCGA 1E3WB 2TSYB 3JD1A 4H7IA 1ADBA 1M1NB 1UADA 2RHCA 5IVIA 4YLYA 2R2AA 3MT9A 2DKFA 4LG1A 3V3TA 1G5FA 3QNUA 4NENB 1KSJA 2Z04A 4QJ3A 1Y6GA 2ZB7A 4XKJA 2B98A 2NN3C 4I4CA 2Q6VA 1G8YA 2I2BA 3O8QA 1RSZA 4B6SA 4F8YA 2IZ7A 2PR2A 5KKAA 4EG4A 4FHEA 2VF2A 2GAFA 2BKVA 1RQ2A 1GTRA 2A7XA 5B1SA 3ZTTA 3GFBA 2NVWA 4ME6A 2NO9A 3AF6A 5K4GA 2GARA 3RC3A 4Z9BA 4MW6A 2IH2A 5CX4A 3CEPB 1LBTA 4LQCA 4OAPA 4LJAA 3SDZA 2CVQA 2QLNA 3D7NA 3G9TA 1ONOA 1CUXA 4MGYR 4MHOA 1V8ZA 1RYYA 4MW7A 1E3JA 1X8JA 2JZOA 1YMQA 1N57A 2HQBA 5DXJA 5DYNA 4WHMA 2JBWA 1I1QB 3AM1A 5FUMA 5L4NA 1QRSA 1RC1A 3JAWA 5JFOA 2IZ6A 3I5YA 3R3UA 3KTFA 2E48A 1WMEA 5JS2A 2XNCA 4HS9A 1J7KA 4O4IA 2QORA 1PD0A 1QCDA 1WKCA 4KEAA 2Y0CA 1LWNA 3D3NA 3I8OA 4L57A 5SICE 5JANA 3F4KA 1NQAO 1AG9A 1AKNA 4UBLA 3UZUA 2VHTA 4DCOA 2JLRA 2D5AA 4Z4GA 1DIHA 2PN1A 2CLEB 3GD5A 3W04A 4OGFA 2O54A 5GONF 1JBKA 4ZD6A 3HTXA 4JXXA 2KBFA 1RXCA 4KU4A 3LUKA 3K9BA 1E2EA 3WLFA 4D6XA 2EZ8A 1K97A 3R3WA 4Z9FA 2J3HA 2JCSA 2HA4A 3E8XA 4AY5A 4PTLA 1NXXA 1IFXA 3SF0A 4D6YA 5JMOA 1WPGA 3A06A 1CE8B 4QUBA 3QW4B 2B69A 5HFNA 4XB6B 1Q2UA 1WTCA 2J4FA 2OGZA 2Q0XA 3N6VA 1EP9A 1U5AA 2JJ1D 4X7MA 3Q5GA 5DWVA 3OOSA 1U0EA 4J9VA 4RL6A 4EX6A 1SU4A 2F3QA 4O25A 1KXZA 1O57A 3A28A 4EYOA 3DDSA 2CLSA 5KREA 1ZC4A 3VHQA 4EO7A 2J48A 1SUSA 1P3Y1 2BSAA 2JH3A 4BAGA 1TAUA 1RPAA 1Z3CA 2QMYA 2JJ1A 3OZIA 2XRYA 2W6NA 3MTDA 5KAMA 3H4IA 2D62A 2IELA 4DNPA 5J47A 2RKOA 4QOJA 1GG8A 1WPRA 4G3XA 1BMDA 3QSYA 4M9XA 3UPDA 3BF8A 2B7CA 3L0SA 2RBEA 4XX1A 2G8NA 3QVMA 4OHPA 2ZU6A 2XOKD 4IXTA 5HIIA 1FSGA 3T0GA 2DGDA 1K6IA 2PUBA 2PWAA 2GN2A 1EFLA 2FWJA 1HDXA 3I09A 3RSCA 3UUWA 2I33A 1R88A 4DIDA 3E84A 3PXGA 1BN7A 1QIMA 3ZR4B 1I4LD 1SM4A 1EFVA 1ZD5A 4ZEXA 5FUWA 1HTBA 2XOKA 2YQ4A 4PSUA 1RI4A 4CM4B 1Z5PA 3LX4A 3DFIA 4HB2A 1YR9A 3OBBA 1A9SA 1EWYA 2W2KB 4HAVA 1SIBE 4LI3X 3VPDA 1B73A 2VATA 3ILSA 3L06A 2E37A 2RCYA 5GAJA 3ZHBA 4N6NA 1QHHB 3AFHA 3CC8A 4PR0A 1FZTA 4R7TA 4C7VA 2D2VA 5AW2A 3RKSA 4FM9A 4LRWA 1SK8A 1U65A 2O6LA 1HBJA 4DQ0A 2XTZA 5JZMA 5DHFA 3V32A 1XTSA 5GM1A 2Z98A 1R8XA 4WX2B 3A3OA 3F4BA 5JPIA 1WEKA 4WA7A 2VHXA 2CDAA 5I7HA 3G9UA 4UVHA 1X8XA 4BP1A 4C4AA 1M0TA 2GO7A 1QO7A 3A9WA 2H8GA 4L4XA 4ZJUA 4Y9TA 5KKNB 1PIWA 4NK4A 2CL6X 1DKQA 4EUEA 1MB3A 4F2PA 2QW0X 1TUBA 3UFBA 3GBSA 1G6KA 3PLAE 3ETCA 2HTEA 1XMSA 2SNIE 2YMQA 4I9UA 4XLLA 2O4UX 3L7IA 4MYSA 5CM8B 3DE5X 2FWAA 5DFAA 1PR6A 1TVKA 3U56A 1N6LA 1KZYC 2Q6KA 4YCBA 3S2FA 4ZGBA 4MLCA 3QBEA 2QWXA 2BZGA 2OBFA 3JVEA 5CDUA 3N2GA 4DLYA 2ZGVA 2BFBB 1U6IA 2FSSA 5KU1A 2FXVA 4Q7JB 1LGYA 4E15A 4DMGA 3TIGA 5C80A 2FCAA 2J9XB 2ZTSA 3TYXA 1T6NA 2ZUEA 3LYHA 1DMSA 3WY9A 4G86A 4QTTB 2A0FA 1CVIA 3HA5A 3OY2A 3GLRA 2QAGC 1E6LA 4IIUA 5D86A 2QRLA 1QUFA 4FI3C 2ZRIA 4ALMA 3DL2A 1QE3A 3JQFC 3E3MA 1ZS9A 3BM5A 1NX9A 4I9HA 3C16C 2HSZA 3QU2A 5IC4A 3W5AA 1E7WA 2V0CA 2ZG6A 4FHCA 5IJWA 4A0SA 2PZJA 3DOUA 4J1TC 3QEBZ 2MDTA 2H31A 3ZKAA 3KSUA 1NV9A 1ZCZA 2PL9A 4MGEA 2JI6A 2J08A 2Z1NA 2BI7A 4G24A 4Q6BA 4CPDA 3PFCA 4OFWA 1HNNA 1Y37A 3ZHTA 2G7MC 3SHQA 1GZUA 2ZWVA 1UEIA 1C30A 4J1SA 2JFZA 2EP8A 4CMIA 1L4FA 1XVUA 2FJUA 5TLSA 1JDUA 2IYAA 1D9XA 3H1EA 2A1UA 4I9GA 3LTEA 4M98A 1XTKA 4F06A 5KMGA 2V6IA 3RAGA 3I4FA 4CM1A 2W6CX 2VCHA 4ND4A 2MYTA 2YICA 4QBGB 4YDHB 3RRXA 2ISCA 3OQHA 5T3YA 2IP2A 3B9RA 2WJPA 3TR0A 2H0QA 2C5LA 3VTFA 1FTNA 3CVWA 1JLRA 1RQRA 2A9QA 4KQIA 5ELLA 1CUWA 3KZKA 3ZQJA 2JCYA 3W06A 3UYKA 4P84A 2QTMA 3CZMA 5K99A 4OXKA 2PL3A 2QAJA 2B6HA 3AETA 4NICA 1IYZA 3Q10A 4O6VA 2DX7A 3PR3A 1E1RD 2OG2A 4I9FA 1ICIA 4XFDA 1Z2AA 3EIFA 1I51A 3ASVA 1MENA 3LWZA 5B57C 2NO5A 1EESA 1SG6A 2I1VB 3U3OA 4ZAWA 3CRMA 2OBBA 5TXGA 4C0WA 2XGMA 2FEKA 3BMQB 1SQFA 3LCCA 1W73A 4TTSA 5ICGA 1Q7RA 1E1RA 2DHDA 2ZTVA 1OVMA 4MWGA 1DXOA 2VNAA 2PX8A 3BJMA 3EN0A 3KL2A 3ONEA 2CKDA 4W8HA 4EUFA 1E3EA 5KJ6A 1E4EA 2W2LD 1JNYA 4BXOB 3S0JA 3D81A 4D9BA 2W6PA 3DYIA 4QHTA 1K4YA 3REFA 3R9XB 2DUMA 2WQ6A 4N6OA 4BU1A 5TMPA 3WHKA 4BBAA 1L6IA 4CV1A 2FMKA 3L05A 2GEJA 2NW6A 3OIYA 2W2LA 4MGIR 4ND8A 1GQOA 1ZK3A 2V1XA 2WF9A 5SZJA 1SVIA 3LL4A 3A3KA 5GGYA 1LPMA 3WLRA 2PS3A 5LUAA 3SOPA 2GPNA 3WS7A 2QM7A 3ZE2B 4DZRA 3FKQA 3I9V1 1PV1A 1P44A 1Y5RA 3C98A 1L5YA 3CLRD 3L7JA 4YK7A 4B45A 1E1NA 2QGZA 2YFQA 1JAZA 4ZHSA 4RTJA 1G5PA 1W5FA 4CCSA 2UZAA 1DQZA 1W6UA 4X95A 5KQLA 3UH1A 1CBUA 4L27A 1FYVA 1NUUA 4BNIA 1OIXA 2V96A 2XAUA 5IXYA 2HJGA 1JJFA 2QF7A 4JQOA 1D2AA 4IHQA 4L15A 4QOIA 3NASA 4C03A 2VEOA 5I7SA 2N3ZA 5EUQB 4F92B 1Y8RA 2OFXA 1NPYA 3BB4A 1L7MA 3K5PA 3Q87B 2PS0A 3IHLA 5EGSA 2DSTA 1Y6JA 1ATZA 4L02A 1BROA 4PHFA 2AT1A 5KYXA 3ICQB 1KF0A 4PZ9A 4B0OA 3HWSA 5KS2A 1K92A 1JDJA 2Y9PB 4FFMA 3ESCA 1EK6A 4OQNA 1NGSA 2HHCA 3DE0X 3E8MA 1ORHA 4TKUB 1TXGA 1VGQA 2YVQA 3IOCA 3ZN2A 3EX7C 1NJGA 4O2AB 1JHUA 1ZINA 2FOXA 2PYIA 2FFBA 4GVLA 5EE3A 4B3FX 1F6BA 3FZYA 3PQ7A 4JGBA 1I13A 4LHVA 4DJDC 1Q0ZA 1Y1KE 4NRDA 3DKIA 3L7MA 4BPRA 3UT5B 5DK6A 3QUAA 3L79A 1AXEA 5B4UA 2HBYA 4KUGA 1HKHA 2G9RA 1XAIA 3L4EA 4A2QA 2JK1A 4OQXA 2XJ9A 4Y2HA 3VGPA 5BQ5A 2R8EA 4UOZA 4YRFA 4KX5A 4ZMBA 4M8KA 2M2IA 3L8MA 1MOZA 2OV6A 4Q93A 4M0EA 4D9IA 3NW9A 1K0UA 4GZ5A 3QXGA 4PYJA 5DI3B 2OMKA 4GXTA 3VHXB 2CW5A 2ID9A 1ZGZA 1N4DA 1ACJA 2QYTA 3GEDA 1QOQB 3GJTA 5T6MA 4D9CA 3EVBA 3KJNA 1J00A 4DCVA 4O63O 3UBMA 4TYNA 3U3DA 1L4KA 4WVFA 2XYVA 4BN5A 4GI5A 3KVOA 4PWZA 2XXAA 3HCDA 1YQUA 4CKCB 3NO4A 1W46A 4LDQA 2VQ6A 2W4QA 3I9FA 4OI4A 1RLTA 3BSFA 3QEMB 4EX7A 3VNSA 2IYUA 2VK8A 3QIAA 4S1TA 4FFLA 5B53A 3GVXA 4U39A 1M8KA 4E70A 3U7FB 4WJZA 3BB3A 3I2HA 2VAXA 3G8CA 1E6CA 2ZWOA 1N2BA 3QVGA 3HV2A 2OV1A 1XJQA 4UE2A 2CEKA 1U9IA 4LISA 3IAS6 2XRZA 4ABYA 4DWWA 1U9JA 3TJRA 1JLSA 3IPRA 3TNYA 4YV0A 2AZXA 1DGQA 2IV7A 4ZO7A 3A6LA 1KSFX 3IAM6 3BZUA 5JD6A 1EINA 5LLDA 1A77A 1DDOA 1SQ5A 3BWDD 4JEHA 4MR9B 1Z8NA 4WXEA 5EYPB 2H85A 2UV8A 5E8JA 1UQUA 3UGKA 1N78A 1RRVA 5IDWA 1OZAA 9GPBA 1FFYA 1QWOA 2RI6A 1EZ4A 4NDNE 4B3IA 3RG2A 5FI5A 4UPEA 3UATA 7ADHA 3IB6A 4P0TA 1I9CA 3EZ2A 1WB5A 2E0IA 5FJIA 1OZ0A 1SO8A 4U63A 4WUVA 1G2OA 5H3HA 3QXJA 3WQHA 3R5XA 5JYBA 2GBLA 5KSWB 1RR6A 5KTPA 3IEXA 2Q5JA 4HRYA 2IPXA 3UJ9A 4OMFG 1RAAA 4OXNA 1M8PA 1PQ4A 1VKRA 4U2DA 4L85A 3W8EA 2DHRA 5JISA 1Y98A 5JVDF 1Z68A 1Y6ZA 1GFIA 2XDWA 5E2BA 3TL2A 4QDZA 3C1UA 5K7SA 3W3AD 2FRDA 1KERA 2G5GX 1C9MA 3DBVO 5AM3A 4AY2A 3Q7EA 1O03A 4DXHA 4JIGA 4HQOA 2X19A 3MTGA 3AEXA 1LDMA 4OI2A 4GX1A 4FMBB 2R8RA 4KXNA 2F8MA 5CCDA 3RREA 3S2IA 3SQLA 2BP7B 1TTHA 3BVPA 1PJSA 2D0PB 2F9MA 3BGOS 3W3AA 4J7XA 1Y6FA 1IN5A 1TC1A 3MJRA 4HYTA 1OI4A 1XDSA 1PGJA 1NLMA 2XWQA 3RIYA 3SBDA 2WPDD 7AT1A 5ESDA 3RNLA 4MH0R 1OLXB 1R6VA 2ZJ4A 4MRRA 1K9VF 3CN7A 5FAXA 5GOZA 2VQFB 1HE1C 3UMJA 2Q46A 4DNQA 3ZY5A 2P0YA 4DM4A 4ESVA 4OO3A 3UWOA 2ZSAA 4L9RA 4HF7A 2CGEA 2B8JA 2VK1A 3WG9A 3LY5A 4I6GA 1HNZB 3SLKA 1EG7A 1RLOA 1UPAA 2NXWA 3S68A 4E4YA 1FTGA 2NUPA 4M9UA 4HL6A 1N7HA 3AX6A 2PRZA 2ZJZA 4MGKR 1ZITA 1W4AA 2YUTA 3W5SA 1FE8A 3K15A 2DM6A 1UBMS 2ORWA 1CLUA 1V7ZA 4LNUB 1VBMA 1HG0A 3EFBA 1SUFA 3ENNA 3KNZA 5HF5A 2GQ0A 5PNTA 3KX2A 4NMWA 4B34A 3H2JA 1SMKA 1SUWA 4NS1A 4Y9RA 5CA1A 1USIA 2ECKA 3ESRA 3SYRA 3WKDA 3JQ6A 5A5FA 2QVLA 1U1FA 3P4XA 2DBZA 3IUYA 3VZSA 3NUQA 4YPFA 3Q72A 2UXBB 1C0PA 3S99A 3OFVA 5KYWB 2QD1A 3Q0EA 3UBTA 2HQ1A 2PVCA 5ILOA 3IKMB 2VWGA 4DV0B 1OLOA 4H3SA 4UNNA 1RZUA 4PGAA 3K31A 4KCGA 3FMFA 2PSFA 1YFLA 3AEKB 5BN4A 1PV4A 5REQA 3L0PA 3CINA 1C7IA 3D1LA 3HSKA 1RBZA 3IMKA 1YUMA 1U2DA 1G8JA 5CW1A 1BJRE 1B43A 4WBNF 3SX2A 1S01A 1P74A 2OP1A 2W70A 1HEIA 1LLUA 1P5JA 1AUOA 2GCNA 3NALA 1VYUA 5IAEA 1W87A 2IU0A 4IIBA 3VZCA 1Y0BA 4XJSA 3K5IA 3MB8A 1OR8A 1P2VA 2QP9X 1KP2A 3ONFA 2EKZA 3ZW7A 4JGIA 1KMHA 3RF7A 3SU8A 1QE5A 1S89A 1UR5A 2DTDA 2DH6A 2HQOA 1XL1A 3R6GA 4OHVA 4RH3A 2EBWA 3T0IA 4OATA 1D6SA 3VPFA 2BFEA 3IFSA 2XOXA 3OCXA 3VNQA 1GPJA 1CF2O 1L4HA 2DFTA 2HJHA 3DG9A 1CFZA 1KNQA 2R97A 3I9JA 3ENVA 4Q4JB 3G3EA 3KYBA 4UXHA 5LLTA 4MS3B 2CD7A 1X80B 3IQGX 5CMLA 1HNWB 4EF4A 2D1YA 1M6YA 4I2NA 1BMFA 4RXUA 5JSKA 3AL0C 1USKA 3BIXA 4CNBA 1UJ2A 4IJVA 4DSOA 3ICCA 5CEEA 3KWLA 3OCWA 3GJYA 1WXWA 1Z8HA 1M2HA 3OZDA 4LDPA 5DYIA 4HNTA 2WTEA 1NVVQ 4D9KA 1PWXA 4YQEA 2C57A 1QVZA 1E1CA 4LSGA 3ROFA 5EE5B 3RROA 3WFIA 4DT1B 5DBGA 2QGNA 3A4YA 5ABPA 2YASA 1JKIA 2Y1DA 4HZUA 4UAUA 4R2MA 2VOEA 4Q21A 3TFWA 4J0IA 2V7UA 4GOLD 1U5BB 4IJUA 3RVDA 2GWRA 1ZK0A 1P5HA 3NG1A 3RVOA 4UHFA 1U2GA 2QXYA 1GFWA 3LOPA 4KFTA 2OYCA 2IYFA 3VTZA 2ZJ0A 4B5KA 3GG2A 3MUEA 2V97A 5ALTA 1C4OA 1UXIA 3OZCA 3TM5A 5C5EA 2A1IA 4NPAA 2C94A 1DMRA 5A6VA 5K4HA 2AF3C 2OILA 3UXHA 5JDIA 2CB0A 3GLHE 4MUAA 1E5LA 1FVXA 2IYTA 3GOQA 4KMOA 1Z5NA 4P34A 4OIMA 1SCJA 2V4MA 5F9MA 1N5JA 2WDPA 1F60A 3CCBA 1YKFA 4DG5A 1QH1B 2QL7A 2Y2VA 4UTNA 2JAXA 2PKQP 4CT4B 1NP7A 4CDMA 4EYKA 4OX9B 1JE1A 2OD9A 5JJKA 1UFRA 2AFVA 2O8CB 3PFGA 5FPQA 3ZE6A 4CZ2A 5TT1A 1P9LA 2CLLB 3S5JA 3CE9A 1Z6AA 3RC9A 1HFWA 1JEOA 1HYHA 3LBYA 4BJ6A 1CIPA 4F12A 2A9PA 2JS7A 1GAEO 5LBIA 4JP5A 1NSFA 3A3YA 1HL7A 4MYRA 3A2MA 3EVCA 3VVCA 3FKSD 4OP1A 5BO5A 1XZNA 1YJBA 5BW5A 1PZHA 4JLVA 4D99A 7GPBA 2GN6A 3QQ5A 1UBOS 5IT9A 3M9LA 1X87A 3I61A 1YCFA 4PZPA 1AB6A 1OX4A 5JUWA 3FKSA 1USGA 2IW1A 4I50F 1EDZA 5FR2A 2GI4A 2HPAA 1VE3A 1V11A 3NDIA 3DLBA 3L5KA 4R6XA 1M10A 1Z5UA 3P4YA 3BH0A 1FX1A 3DHEA 1TB4A 4G0XA 1F2UA 1FMLA 1V6SA 1Z2EA 2VFAA 4TYQA 2HOQA 1LPSA 4S0ZA 4CM5A 4OQDA 4AB1A 2V1UA 5JXJA 5BT9A 2VA8A 4BV3A 1OKKD 2H2WA 2O05A 1J8YF 3U4HA 1YB2A 3KKLA 1DADA 2JI7A 4RORA 3CVUA 3RADC 2JASA 1C2YA 4V3CA 2C58A 2E89A 3V4LA 5CITA 3ZK7A 2W6JD 1UCFA 5LR6A 2D4HA 2QTZA 4R8SA 5HTOA 2WWFA 4P80A 1W2HA 1XQVA 2PD6A 1L6RA 1BYUA 2YY6A 3C48A 2DLNA 2IFTA 3OM9A 4M88A 5NLLA 4WGGA 1YULA 3NBUA 3UJAA 5KX5F 1JR3A 1NNSA 5GZ6A 2FZKA 1MRZA 2I4OA 5ALQA 5EKSA 2CYCA 3U3RA 2MSNA 4UTOA 4NULA 4YRLA 2YKGA 1YR6A 1PL6A 1NWCA 2J9GA 3N2LA 3Q6MA 1P0PA 5DN6A 3PV0A 4A0HA 4EEXA 1LW7A 4QOFA 3BIOA 1Z75A 2C03A 1Y34E 4ALNA 4FKMA 4L4SA 4J91A 2EG9A 1XTRA 4U3JB 3RFFA 3WO0A 5K8VA 2XMCA 1KMMA 2ZJ6A 3FJOA 1OGJA 4XR4A 3V55A 4MKIA 3X2EA 3TCXB 1QP7A 2MR6A 5CYFA 4UCWA 4E5SA 3BGSA 3JWHA 1HDCA 3DDZX 3EMVA 4KIUA 1X7DA 2O2IA 3A1EA 3MWLA 1L7RA 4NCXA 1HI9A 5FI1B 1AKVA 2HLHA 2OHFA 2OUIA 3LRXA 4GGPA 2Q5QA 2O1SA 2C9MA 2GLXA 4PFKA 3UAZA 4QUGA 1QIJA 1L1RA 2QJWA 3I9KA 3K8QA 3HEBA 3R23A 4W8OA 5EG5A 3O31A 1JE0A 2F59A 2YJTD 3T7IA 4KIFA 1DCMA 1BQEA 3HZZA 4ZP1A 2QLBA 1NL3A 4A5SA 4M22A 4EJFA 2ZBVA 1RPTA 3HA2A 4Q9KA 3ROKA 3VR5H 4N1AA 5C8XA 4X3PA 1XAJA 1ZOOA 2M1ZA 5BSWA 3DV0A 5KYKA 1VPTA 4V0RA 5AVYA 1H69A 3ELDA 3O4JA 4HV4A 1PFGA 5HOQA 1AQNA 4GL2A 2A8YA 2JIPA 1H5QA 3DO5A 1GPLA 2Q4OA 2EWVA 4XD2A 1C3LA 2EFDB 4DDMA 1CUVA 3EQ9A 3JARA 1LDGA 1A95A 1MO6A 1SR8A 1YD7A 2OV4A 4R1SA 3K2QA 3EOBI 4ZO9A 3V8VA 3GPBA 4MDFA 2YZ2A 5CGZA 1UMCA 3N8GA 1SKBA 3GZNA 3ANTA 3QJ5A 5JPCA 2CLHB 3D59A 2CDBA 3MYRA 1GADO 2ATCA 4U00A 5E9WA 2IUTA 1BGXT 4G5XA 2FY8A 3QU9A 1K06A 4P4GA 2ZTMA 3C3DA 3NWOA 2R8XA 4AU1A 4LC9A 4ZGGA 1ZWLA 4I6EA 1R0BA 1RJEA 1V45E 3P7MA 4CL2A 1DG3A 1X3SA 4N12A 1ISMA 4OKSA 2AOUB 2Q7DA 4DLLA 3F8WA 4P6VF 2A9FA 5JDCA 3HEMA 4ZT2A 1XPJA 3OZXA 5ALSA 3T41A 2BI4A 4KO1S 1N9GB 1OY1A 3T5TA 2X42A 3RV3A 4IXNA 1M2OA 4FCCA 5CB4A 1LS6A 3H17A 2EQ5A 2ZJ2A 5EY5B 3U7QA 1TOAA 2ZRJA 3CLVA 3UXMA 3IPLA 1R0CA 3V33A 4MR8B 4JU9A 1OC2A 2AXNA 4MVJE 3UH0A 3FDZA 5DO9A 3WTCA 5A6SA 5IBQA 1AN0A 5DIZA 2GXAA 1X0VA 1TM7E 3OU2A 3K94A 2QX7A 3WLNA 1JSCA 1EM8B 2IYSA 4H1VA 2ZJ7A 4WUTA 1JDPA 1MQ9A 3ND6A 1MFZA 3NB0A 4DUGD 2YWXA 4X8MA 2ZRLA 3DZJA 3L0ZA 1T6ZA 2CJWA 1QZXA 4M83A 3H8WA 4C0XA 5JNLA 1XMXA 1SXJE 1E5VA 1WSAA 1XQ9A 4A23A 3L0BA 3GLQA 1CQXA 5MN5A 2PUAA 1SVWA 4UOEA 4FYHA 4WBNB 4LAFA 3E61A 1T2CA 2AIRA 4FGSA 1FFBA 1Q11A 4O2RA 3WMGA 4AMVA 3QKSB 4L78A 5KTTA 2Q6OA 4XX0A 5A4MS 1IEQA 3JU3A 2G7ZA 5TEWA 5KQSA 4G1FA 2P4QA 2ZAYA 3NXSA 5ILQA 3WO1A 1V5EA 4B8YA 4REOA 4YJGB 4YC7A 1BXRA 5JAUA 3V4ZA 3GRYA 4YCCA 4QJ4A 3RBZA 3ND8A 3RYHB 4C14A 1TM1E 4JZYA 4LDRA 3KQYA 1UBRS 3PNYA 121PA 1XA0A 2ALJA 4QPPA 1NXTA 3FIJA 5FBLB 1EI9A 1Z26A 4GW3A 4RD4A 2QYHA 2XT9A 1WWKA 3RVNA 2PUFA 3M6UA 3Q9SA 1JKJB 2QXTA 3BFVA 1UJ6A 3FGOA 3UB2A 1IB6A 3MYYA 2OCLA 1MB0A 3UAWA 3P9QA 1MMFB 2J3QA 5AJUA 1W8DA 3DEAA 1PT7A 1MXHA 3EA4A 1CZHA 1PFUA 5FHQA 1E62A 3PC2A 2OCDA 1GTSA 5KHOC 2BEWB 5HA5A 3JVVA 3TSAA 2A35A 4KXQA 2PX0A 4FZ3A 4TS3A 3TZLA 4QDJA 5KHLB 1ZR2A 1MIOA 2P6MA 1E2LA 3ZGZA 1U9IC 3C97A 1EVJA 1T2FA 3DMGA 3DPUA 3LZCA 1BEEA 1Z06A 2XUIA 3A2LA 3AR6A 1NXVA 2EZTA 3ZUPA 2QLLA 5JW6A 1YDHA 2JGLA 3C74A 4MS1A 2C3MA 3MTAA 5IKMA 3BHJA 1WPXA 4CHTA 4RM3A 5B6JA 1DLJA 2UZ1B 3DDWA 4QDUA 3X1MA 2J4DA 1C81A 3OKPA 4B84A 2I8AA 2Q0SA 3LUCA 1WQ3A 3MT7A 3P32A 3UUEA 3JCZA 3ABQB 5LXTB 3KT8A 3FYCA 5JCJD 2JJ2D 1FBNA 4K86A 1PK9A 2AOTB 2ES4A 1L7OA 5AM0A 5EJAA 5FTJA 2FRVA 3VOBA 1ZOLA 3QWBA 1ZICA 2GBLC 5D51S 5L3VA 2J5BA 3IV6A 2OAQ1 1RQPA 4DV7B 2RONA 1U2TA 3PNQA 1H3FA 1U81A 3DULA 2DE0X 3RIMA 5LM3A 5JCJA 4J4HA 3NYQA 3OHMA 2FG7C 5FADA 2X7JA 1PLJA 5DNVA 1CVLA 2B4TO 1QH9A 1YZGA 4M38A 1Q77A 4GVPA 2DERA 1L5HB 1UKVY 1J25A 1UP4A 2FRDC 3JQQA 3PF8A 3P2OA 3AV0B 1E1LA 2AJTA 2A30A 2PH5A 3C7DB 3QPBA 4E88A 3C3JA 2Y1GA 2O9JA 3G23A 2CFRA 1G3UA 3IIMA 3LK7A 4C7KA 2PXCA 1A2OA 3NIDB 5HOEA 2ZTLA 3FAKA 2XUZA 4FDLA 4JC4A 3D5EA 4QJIA 3HGQA 3B9PA 1F38A 2XXBA 4HNRA 1G8FA 2AK3A 2F17A 4ZPJA 1VTKA 1RP7A 1PQPA 4C4YA 4EB3A 1LX7A 3ZK9A 3GUUA 2CXUA 1MHPA 5H9VA 1TCBA 2QY6A 1H8ED 3IQXA 3M4NA 4HGZA 1PUXA 3OETA 4YUVA 5IT4A 2JLXA 1LDYA 3A2KA 3M6VA 2A5LA 4D43A 1SOAA 5JCOA 1GZ3A 3C5EA 2PBFA 3PD7A 1M1NA 3F2IA 1OBCA 2RBKA 2VP0A 3MCUA 2HDOA 1H8EA 3EPHA 1GY8A 1O6ZA 1U7UA 4OSOA 3JQ8B 4E51A 5BR4A 1K9SA 5BXYA 5KNBD 3LJKA 3IUPA 4JHLA 2O2GA 3WLLA 1AS3A 2WI8A 1GKLA 1T9ZA 2FU5C 1PWYE 4HO1X 4RJKA 2NU8B 1D0VA 1GSAA 4C0AC 4G41A 3I6YA 4GT1A 3I12A 1O5OA 1XOIA 2ERXA 2WPNA 4JFRA 5WRFA 5IEBA 3U4AA 1Q20A 1VSQA 1XI2A 2EBUA 1N1MA 2GH1A 4YMIA 1FK8A 3V8QA 3IALA 3WZMA 1AS2A 1BO6A 4GI2A 3QF7A 5DI9A 4EHLA 2XMZA 4ZI7B 4TUYA 3VJMA 5LZ4A 2CYBA 3GLGB 2HQRA 2I7VA 4GI3A 4LZAA 1ZVJA 1H3EA 3KR1A 1I24A 4NAHA 3GX1A 2HUPA 3JQDA 1TJNA 3G1TA 2N1BA 2HA0A 3DZGA 3I52A 3Q9NA 4K6KA 1KAGA 1U2DC 2R8PA 5CT5A 4A8JB 1Z39A 3NLLA 3Q7QA 1S5PA 4PZUA 2XDAA 4XIIA 3TSCA 4RH1A 5CNJA 5AKJA 2VPZA 1TKAA 3T3HA 4CMKA 4I4TF 4MCAA 5FOVA 5B7QA 4BP8A 5BSHA 3OCZA 5KQPA 3WGTA 2XQKA 3PL1A 4QQ8A 3WSTA 4AY6A 3FNIA 1KY4A 3O8OB 4EI2A 1Z07A 2QBYB 2O5CA 4GP6A 4H3HB 4KSCA 5G0SA 1YMVA 3LXUX 3STYA 3QKRB 4ZVVA 2QTLA 3VU8A 5FPPA 1OAOC 3ZVRA 1XZDA 2GN0A 3T95A 2PBZA 1HTWA 2P2LA 3MA0A 1L7XA 2FPWA 4HNSA 3ORSA 4BJHB 3D4NA 1PEKE 3CNHA 2NO1A 4J8PA 4O4HB 1ABFA 4QRDA 4D81A 1JJAA 2CYAA 4PG8A 4GD3Q 1CU1A 3UXEA 1KO8A 4Z99A 4IIXA 5B2FA 4HEQA 4MSUA 2P4UA 3EIXA 3EF0A 3HL4A 1J0BA 3OFJA 4JXKA 1YCDA 1GG5A 1ADCA 3PUKA 5LZ9A 4BJ1A 4XTCS 5LYYA 3H5VA 4KXLA 1DDIA 2QSZA 3ZCQA 2Q9AA 5FFNA 5LQJA 2XA1A 4WBXC 4B9AA 2DPXA 3EXEB 3ISTA 4GSLA 2C7GA 1F8UA 1HMYA 2GCEA 1Q1QA 4KBGA 2HWWA 4E4TA 3WL3A 2IIQA 1JDSA 2OPBA 1Q19A 3A37A 3DOFA 3LVQE 5BSUA 3L9XA 4G0QA 1G6HA 4YDRA 3MHPA 2KLBA 5AXAA 4F4FA 5BUZA 5J4YA 1R5NA 1QZTA 3AESB 4TQAA 3LX5A 2KS6A 3G02A 3PXCX 4FW8A 4UHDA 1ZJJA 3TB4A 2BM0A 4XWTA 3CVOA 3RVJA 1ECFA 2VDWA 2LVBA 1U2GC 4IIYA 4DREA 5CVTA 1WDTA 3E6AA 1XCMA 3PKIA 2Y6UA 4DSNA 5BMVB 5JO0A 5B7PA 2PH3A 4FK8A 1Y8QA 4ZYWA 1HSOA 2PJRA 2W2KA 4C6TA 4PNEA 5LNK1 5JDIC 1NJ8A 1THTA 1A8HA 2ACWA 4JL6A 3W3ZB 3DNFA 4G0NA 3TCKA 4C04A 4PC7A 2Q6IA 1E5XA 4HDAA 4KQFA 3TLYA 3CPHA 3EVNA 2JIZD 3VX4A 2ID7A 3GRKA 3KS9A 3UN1A 3ZWWA 4DBZA 2QQFA 4DVJA 1JIIA 2OP0A 4B75A 3N2YA 1O4VA 4LZPA 1WX1A 1EX1A 1JIUA 1I9GA 1NKTA 1TM3E 2JIZA 2V6MA 1D8TA 3BD7A 3EUFA 4FD2A 4HD8A 5CNKA 3W34A 3E9CA 4TLAA 4HNVA 2YWDA 4J1QA 4R1QA 3UHFA 1N36B 1W5BA 3MPOA 3ZVMA 4R1LA 1QZ3A 3SQOA 3GU3A 3ZNOA 1N1EA 1TVCA 2XMPA 4QXAA 1QB8A 4RJ2A 4C20A 4E07A 5A4DA 5JD4A 3JYPA 4JHXA 1GNLA 1QKKA 3E81A 1XZIA 8GPBA 3IEIA 4X93A 5DNWA 2F6RA 3PGMA 5ENVA 4UM9B 1J8DA 2BFBA 4ZA2A 2JKYA 2GASA 4HMOA 1Q1ZA 3BMNB 1KDRA 3KYIB 3PIRA 4G0ZA 3CT6A 3HGTA 3B5JA 5BSMA 4ZJYA 3H1AA 2O57A 4IH1A 4LY6A 2NTJA 1K7YA 1UP6A 1WOYA 4KSYA 4IDDA 2HRDA 4LYGA 1H42A 4DG9A 3EWAA 4F4UA 1D4AA 4EW3A 1WVMA 2VZLA 4I8XA 5B1IA 4R9VA 2HO5A 4NHOA 5ELXA 3DLHA 1VRCA 3I34X 5JNRA 4P4NA 5EFOA 2BCEA 5IU6A 3ZD9A 1E0DA 5AUNB 2ZZMA 3FUXA 3ICEA 1AKEA 4ILEA 5DM60 5J43A 2QLJA 5CUQA 1V3TA 2BCGY 1LS1A 4WECA 2J0SA 4KRYA 1P45A 4XDGA 3B2QA 4YRQA 3ZE1B 2RC5A 3KE9A 4X62B 1CJSA 1DEAA 3AERA 4FYWA 3PYXA 4UOQA 3QXXA 1JP7A 4NJOA 4JK3A 4RQAA 5CCBA 5JXWA 4CT0A 5CEJA 2H1WA 1EEXB 5DIFA 4B43A 2P5UA 2H3HA 3UK1A 3TMAA 4EA8A 4R1OA 1OXMA 2DXIA 1ABEA 1QXSA 1L1QA 3ANXA 5KZMB 4FX5A 4EMTA 4ITVA 7MHTA 2HK7A 2VHCA 1X1SA 5EJIA 3EGXB 1U0LA 3GIDA 4KXFB 4A1FA 4DLTA 5DX8A 1NLZA 2FZEA 1TC2A 1NM5A 1NU8A 2XYQA 1KI4A 2W2XA 1A3CA 5FPTA 1S1MA 4PPYA 5EKDA 1XZAA 3QV1A 1KEWA 1YSCA 4TL9A 4P3OA 4PYIA 4QG3A 3ABSB 4FBMA 5F78A 4XDHA 1PW5A 1LK5A 3OQOA 4W5QA 3UCEA 3ZU4A 4BO6A 3AKZA 3I5MA 3ZE8A 3RRMA 1HFKA 2GZ3A 4ETMA 3FUCA 4YRDA 3MJDA 2IDJA 3QG1A 4TXHA 4I5DA 4PCVA 3ZJVA 1SHTX 2I6TA 4XFJA 3STUA 2C5EA 1KJ8A 5D6OA 4TTVA 3T94A 1DCFA 1YR1A 5HCUA 3VJKA 1X8KA 3JRXA 1JMKC 3HADA 1IBCA 2ETXA 2QSUA 5FF9A 2C1XA 4NCHA 3BMQA 4D3XA 3RABA 3G8YA 4QGFA 2C95A 3T5DA 1VKHA 1XPUA 4JJIA 3H04A 3M5WA 4H08A 2BOVA 2GZHA 4NFLA 5IK2A 1BVRA 2H7YA 4BXOA 3SLRA 4B6EA 4EW1A 3R9XA 3NIFB 1TFUA 4YCNA 3CX6A 3D7MA 2PFSA 2O2YA 2FUG1 5JDCC 2HWXA 1IWPB 2IYNA 2VUSA 1DUVG 1CZRA 1QFZA 3OEHD 1PZMA 4Q00A 5TF0A 2OCXA 2P7HA 3ZD6A 3Q7RA 4NYMQ 1ZD4A 3WLJA 2B83A 2VA9A 2O0HA 1KP9A 1NZFA 1O77A 1SKYE 1YHNA 3TGLA 1R0RE 4PHTA 4JIMA 3H97A 4WINA 2ORIA 3MK31 3OVMA 4ISCA 1XUOA 2RHLA 1II0A 4HAYA 3G8AA 3B89A 2BMJA 3CG0A 3W77A 2AEJA 1WXFA 3ZE9A 3VR1A 5CT6A 1GARA 1EK0A 4INOA 1UPBA 1W4LA 3N75A 3HWRA 3AOGA 4FNOA 3TZQA 1XHEA 5FHRA 5EN4A 5KOJB 2ERCA 2ILTA 5I8WA 2AWOA 2B4QA 2QM0A 2EIXA 4GPTA 4GG1A 3PSHA 4GGOA 1MC1A 2RHHA 1YRYE 2YZKA 5IULC 2FZLA 3I23A 3R2JA 1NR7A 5CHEA 4TKUA 5EIOA 2DYKA 4M7PA 1R74A 1YK1A 4N9WA 4NOMA 4AROA 1RKXA 4O2AA 4WKPA 1H6DA 1PQYA 3IEMA 1NBMA 2DUNA 2IGTA 5EKTA 1G3MA 1PSDA 1U3VA 1FF9A 1DTEA 2GJSA 3UT5A 1VMDA 3FWPA 1X86B 3ENKA 1YIDA 3DTTA 1ZGCA 5DKFA 1ZH2A 1GXSB 2P3QA 3HP1A 2W2QA 2QP3A 2ZOSA 3FI0A 4FFRA 1W0JD 5FNVB 3VKUA 3VYRB 5EA2A 4C22A 4F86A 3G5MA 5HUJA 1UZUA 1YB1A 2EP7A 3SC4A 3IP7A 1QO0A 1TU0A 1ZNXA 4F9TA 4J7AA 4PXAA 1VMEA 2SKCA 4FONA 1P4SA 1K63A 4RFLA 5DI3A 4X3CA 2QMQA 1LDEA 1FUKA 1W0JA 5JH7F 2NT3A 1VI5A 3DMNA 3E5NA 2ZYTX 2ON6A 4PYQA 4W9NA 1ISIA 2VXYA 1XB2A 1S7CA 2VBIA 3A04A 1E8DA 4KQ1A 4RL4A 1RXUA 2XVYA 2W2MA 3OH8A 4CKCA 1QIFA 1G2IA 3WIVA 1WE2A 5DT2A 5G53C 1G0OA 3M6IA 3TD6A 2MYPA 4YMUA 2C9ZA 4G26A 3S8MA 3K2BA 2DJ5A 3ESZA 1NULA 4XWKA 3KG2A 5KVAA 4V02A 1GRCA 1I2ZA 2DTEA 1CUEA 1CUHA 1IU9A 1CX9B 2I6XA 2N75A 2OZLB 2P77A 3BWEA 2X2EA 2Z3VA 3H5TA 2O8DB 4LHXA 1UBLS 3EAFA 1BDHA 3IIJA 4PG6A 3HN7A 4HXEB 1U3DA 1NXSA 1Z2OX 3WLSA 3PTLA 1HC7A 2NO7A 1CEXA 1KYYA 2RI0A 3NAQA 1PJ3A 4ZAXA 1MC5A 2R7KA 5G1NA 5ITVA 3PTAA 2GMWA 1BIFA 3U80A 1GA4A 1DRJA 5JD5A 2DLDA 1O5TA 1SQ0A 2AN4A 4X9XA 1EJ0A 3DE1X 2JW5A 4NBRA 4OP2A 4UNQA 4DLXA 5ADUS 1RWMA 4A36A 3X1JA 4YRMA 1Q57A 4QVGA 3B52X 1SBNE 3D5QA 4DLBA 2GM5A 3T3MB 4DPKA 5L45A 1BXZA 1X2EA 4TWAA 1QRDA 3FY4A 2HKIA 1K6JA 2Z3WA 4BLVA 4IM7A 2R00A 3DBOB 5DX1A 1ZD2P 4U6QA 2SKEA 5AESA 4I7EA 3IMCA 3P2MA 4MQLA 1RVV1 1RYDA 2GPBA 2CLOB 3D4PA 3LPMA 4YJFB 4CW7A 2H18A 1GAXA 2PTGA 3TAUA 1II9A 1XHFA 4BZWA 4D8TA 4O3FA 4TRMA 4TT3A 5EMLA 2NYVA 3G6KA 4F0JA 4MRMB 5ALEA 1MP0A 1W1UA 4IOLA 4RVDA 2OQRA 4IFIA 4COKA 3CZCA 2CFSA 1JR4A 3FWYA 5K8JB 1XPOA 2WMNB 5JCOC 3BORA 1W47A 3HXLA 2DETA 4OK3A 1OLXA 1G21A 2NSJA 2B0JA 1OW3B 2BE9A 2R47A 4QNNA 3T9AA 4YIHA 2Q3MA 3RBAA 1UFKA 1E1YA 4HQFA 4J0GA 3ZWNA 4ASUD 4NOLA 4D3FA 1DINA 4DMHA 1RZ3A 3LWNA 1CLEA 1ZEJA 4DQDA 2F8LA 1XQWA 4O0LA 4LYDA 2IXFA 4BN4A 3RTBA 2HFKA 2GHIA 3BE4A 3IEPA 4JCOA 4MW9A 4F46A 2C96A 2FSPA 3PQFA 3RS2A 3TK1A 3CNEA 4ZEMA 1KK1A 2OVBA 2G0TA 3GH3A 2F43A 2FFRA 3H05A 3QG5A 4FCVA 2O3TA 5IMBA 1RABA 2B2NA 3B9QA 2WAOA 1SCBA 1PT6A 4LNUA 2B9VA 1RDFA 1V7CA 5BYJA 1XLWA 1YNSA 1V1MB 2IHTA 2VNIA 3G1WA 1QFXA 5EP4A 3SIPA 1Z0KA 2XOEA 4LX8A 3GJRA 3T1NA 1U8EA 3L1UA 1ZGGA 4ZODA 4U7PB 1I5RA 2I54A 3CCFA 2ACKA 3HGMA 3MRSA 3ZOKA 1EVYA 1ZL2A 4D42A 2PFKA 3DONA 1S02A 3N0XA 4L50A 1MW8X 2R85A 4GX5A 3ND5A 5KYWA 2QRJA 4X00A 1MC8A 1SC6A 2YX1A 4DSUA 4EO4A 2HDHA 5GZ3A 1GNSA 1PQWA 1ZI8A 3LVBA 3W4IA 1GZ5A 1DNPA 4Q16A 3T3DA 3A1VA 3KQPA 2J3EA 1VHJA 2A5GA 3PENA 2ARKA 1XZCA 4GNRA 1QU2A 1A69A 3SJ7A 5JY1A 4EHJA 5AK5A 1F0PA 1Y8AA 4RTKA 2FN7A 4DMFA 5EJ7A 2ADFA 2X0EA 4D8UA 5ITSA 4DF3A 3BZWA 3CNBA 4YFVA 4OHKA 1UANA 2GLUA 2V7BA 1MEJA 5KU7A 1XFDA 3G5LA 3ZTYA 3AY0A 2J07A 3P9RA 4IW3B 2X0JA 5CFQA 3OZRA 1DAGA 4ZRNA 2QX8A 2J5XA 3NC4A 1SELA 2BLLA 1E9FA 2OPHA 2FPRA 3QUQA 4KMSA 3O8CA 4PLFA 4AJLA 3RTGA 4DJAA 2IYVA 2UKDA 4NC9A 1CQZA 2PQ6A 4Q4JA 2J67A 3OSUA 3VC3A 1FP7A 4MS3A 3RFCA 1X80A 2QU8A 3MMPA 4E30A 2HSEA 4EPXA 3NX4A 3ZG6A 4HBGA 1ZRNA 2GZAA 4RLHA 1THZA 4F11A 1F5SA 1NDUA 1XTTA 3GR6A 3KJIA 4CMHA 3A9TA 3IDOA 5LP1A 2BONA 4RK6A 1UK7A 4HS4A 4PLGA 3Q40A 1RQNA 5JAQA 2ZRPA 3N2ZB 4DT1A 1WETA 4HQNA 1YQTA 3HDHA 1QZZA 4UHKA 5ANRB 4LBVA 1UBJS 5IAOA 3NYWA 1KJQA 1YS7A 5K0JA 1J8VA 1U5BA 2ECPA 4PZEA 2QD2A 3D3EA 3PQ8A 2FETA 3N87A 3ZH2A 4BFSA 5KI6A 1GTJ1 4G8DA 2R87A 1YT5A 2CL7X 3FN4A 2VYFA 3S2ZA 1O54A 2B0CA 2PIDA 5BSFA 4ZANA 3RTEA 3RVLA 4OMDA 2NZUG 3E7DA 4IDFA 4PG7A 4LI0A 5T5QA 2JLBA 1EFKA 5HUHA 1GQYA 3E3LA 4FEYA 3A4LA 1U7WA 2H59A 1JW9B 1AF4A 2CHGA 3KLMX 4CEIB 1E2NA 2CNWD 4FJ0A 4CN8A 4HC4A 4AQDA 1N9KA 4DLPA 1X1TA 3RQSA 3THXB 4QTYA 3IO3A 5G4KA 5F98A 3DOEA 1K6MA 4ESEA 4C1NA 3ZHCA 2O8CA 2QMOA 2N9UA 5HJ7A 3KELA 4PCAA 1GUZA 1JVNA 1T6XA 2GBGA 1U1IA 2REOA 2XPCA 3AM4A 2X15A 3H0EA 3FETA 3H2SA 3PJEA 3RG8A 3T9BA 4EDHA 3VNUA 1JZQA 1WSBA 4NMXB 4E5NA 1DC5A 1R37A 3P9CA 2OB2A 2EFYA 3SIXA 4ZZ3A 3ZBQA 2HW8A 2P6UA 4QFCA 4ESOA 2XXJA 5A02A 4ZI2A 1W1WA 3AWDA 1PJ8A 3O8LA 5E6SB 1JF8A 3WLMA 2OBXA 4Z7OB 3VZBA 3RUEA 2OFPA 3KT6A 2R5WA 3BCUA 1JT2A 3K72B 4I55F 5DOVA 1LRKA 1L5GB 2WHEA 1R8YA 4AKSA 5B2ZA 5AOAA 3I3OA 4XIJA 2X0IA 3W0LB 2PWPA 1R0LA 2Y66A 3NRJA 4PRYA 3TN7A 2HA2A 4JENA 2BTEA 4EP1A 2RH8A 2BFOA 1DAOA 4JROA 4L3WA 4B48A 4KR2A 4HNAB 3QE9Y 2PD3A 2FUCA 4GS5A 5EJFA 3H6GA 1DU4A 2X13A 5FI0B 2WU4A 3GELA 4MW2A 3DL4A 4MI9A 4G5GA 4GP7A 1JAXA 2AXQA 3CH4B 4HYYA 3JY6A 4HN4B 3EH2A 4KH0A 3VSEA 1PJZA 3UWSA 2G09A 3M4XA 1B2LA 1ECPA 2VH5R 4REMA 4PS0A 5EZQA 1JJIA 5IHXA 1ZRMA 1UPTA 5A62A 3IIKA 1DHTA 1R6UA 2GR9A 2QTGA 2EFEB 3TL3A 1VRVA 5FWYB 2C5BA 5DLEA 1D9ZA 2EU8A 4TVKA 1Z7GA 3LC1O 4Y2VA 4K05A 4MB2A 4AYTA 4YRAA 2LRHA 1E3SA 1XVVA 2WICA 5A3VA 4HRAA 4F5DA 1IRXA 1RCFA 2A9RA 1NM5C 4QGBA 3O82A 9MHTA 1OI3A 4CM6A 3BUSA 2ZE8A 5JJ5A 3QYAA 2ZSUA 1XNRB 3E0XA 3EZ6A 3NCTA 4PIPA 4ZHQF 3UKDA 2BE7A 3THYB 5JVDA 3K4QA 3A4MA 1PX0A 1X9GA 3I01A 1EUZA 5AYVA 1HKUA 5H5JA 3R9IA 3RVRA 3VI4B 4GLJA 4ENVA 4FQ5A 4UTPA 3BGVA 3ZWPA 2VJMB 3C6MA 3PGVA 5F9FA 4EB6B 1VPLA 4KX3A 5AKXA 5IYZF 1YQWA 3UWMA 2IYLD 3PNSA 5HF6A 1J20A 1FFHA 1C2TA 1I36A 4HWOA 1QVRA 1MAAA 3FBWA 5EJ2A 4EZIA 5JJCA 3FHJA 2CKMA 3LE8A 4RMNA 3HJRA 1W96A 2WF5A 4HDMB 3T7TA 4KE9A 3D2LA 4PX2A 1QHYA 2RK3A 3LQQA 3UB3A 2HIHA 3R0QA 4HCJA 5IM4A 1DC8A 3HCCA 4M2LA 5HGXA 4PV7A 2O2ZA 3CF0A 5IAAA 2Q5OA 4B09A 1KI8A 3MQ4A 2R6CA 3JW8A 3VJLA 3I1YA 2X6TA 1XLTA 4IDEA 4NZPA 4U02A 3GN2A 4LDNA 4DA4A 4JJAA 4X7BA 4QU9A 4NYMR 2WAMA 4MUEA 2H5EA 1H5UA 1T1SA 3AIMA 3FNFA 3HCPA 4E11A 4US2R 1PNQA 3O1JC 1EAYA 5CK4A 5LQDA 3GC6A 2ZI6A 3SQDA 4JI6B 1XZ8A 2AOWA 3RKRA 3GEEA 2HM7A 5JZSA 1O95D 1AHIA 1NI5A 1XE3A 2IBMA 2VPXA 2DMRA 6PFKA 1C3XA 2AOUA 2WJIA 2XQGA 2I4MA 1VCNA 1G5RA 2FOLA 2HCBA 1J24A 3FX2A 1N9GA 1MX9A 4BCDA 3OEEA 4QLBA 4ZK2A 1SVKA 2XD9A 4DDHA 4GQBA 5L6LB 1EQUA 1L4LA 3A1DA 4YCLA 3JALB 3K9CA 4GWKA 1DBSA 3H8VA 4FFSA 4MVCA 5JOQA 2GM4A 4KOEC 2X77A 5C53B 4MVYA 1EM8A 2VKTA 4I5IA 3IKJA 1ZGJA 4RIFA 2J30A 1GUBA 1LDBA 1K8ZB 1IN7A 1XTPA 2RG1A 4EUKA 4M7RA 4OY3A 2HXGA 4R98A 3MBIA 4TVBA 4DIOA 1ULBA 1WOMA 1U8AA 2WSIA 3D0RA 5FCDA 3VDQA 4JL8A 2X9GA 3EZGA 3OM0A 4XLZA 3PLRA 5DNUA 4Y6PA 1IOLA 4WBNA 1SPBS 2PZMA 3FZQA 3NOQA 3QX8A 5ER6A 3ZWOA 2ZB2A 3GUCA 1M7HA 2C2YA 3D8SA 2XKKA 2HREA 3OY7A 3S81A 1XWFA 1WRBA 4YJGA 2A84A 3JQEA 1OWNA 2CL5A 5CLIA 3WKBA 3AIKA 4X71A 4PHCA 2WF7A 3DEZA 3RYHA 3ZDDA 3EQ2A 1WM1A 5B30A 4E33A 2AQHA 1TW3A 1ZKDA 3PI6A 4EA9A 5HS4A 1ADJA 4KKXB 3HJFA 1TUEA 1A0OA 1T4BA 4NQRA 4W9NC 3KYCA 5CD1A 4UE3S 3DVLA 3SZMA 4BRSA 1JKJA 5J2UB 4CIVA 1DCKA 1Y3IA 2IY8A 4ZQFA 4AWXA 1M8JA 3VR5D 1DT5A 4O59O 2IZ1A 4DEVA 2JKVA 1L5NA 2JIMA 1Y5MA 3DOJA 3QTBA 1MORA 1XALA 2HD4A 5A4KA 1CP3A 1I4WA 2BEWA 2QVZX 4FMPA 4BUZA 1CYDA 5AKEA 2BM8A 2H5IA 1EK2A 3EGDB 2OBMA 4KDEA 3D4OA 4QOEA 4Q3OA 3W1WA 5LD2B 3CWZA 3VR5A 3U6BA 4HN9A 2AK2A 3KPVA 2VYQA 2NYUA 1GZ7A 1F5NA 2P6NA 1Y3FE 3AHGA 1FDWA 3K2EA 3M0EA 3Q0TA 3WR5A 3V7FA 1R66A 1SHZA 4EJSB 1FA9A 2VBGA 1R6AA 1T1IA 4TV8F 3ZOZA 4Q3NA 2VDUE 4B7CA 1MHTA 4UTRA 4K8RB 1MOSA 4W4TA 5H7XA 1RHQA 2A94A 4MVJF 1PFYA 5BV2P 4OQ4A 1MO4A 2UZ1A 4XH9B 4QSHA 5LDDC 5HRUA 4MV1A 4WDRA 1NVMB 3LQKA 2GRUA 4HGOA 1BDBA 1L7EA 3DE4X 1XZLA 3LHKA 4N5DA 5HE9A 4JQSA 3TG8A 1JH9A 4AZ0B 1J56A 2AOTA 3GUVA 5ILGA 1BKSB 2FLKA 1XP8A 3FE2A 2PWYA 2WE8A 1GV1A 2BH2A 3WMWA 5DYTA 4EBBA 4JYBA 5BURA 2FA9A 4GI1A 2ZRGA 4Q9IA 1C0LA 3EZ9A 1ZHFA 2UZ4A 1GFSA 4IF4A 2RGWA 2R00C 3J80A 1UZMA 4FEGA 4MO9A 4PPFA 2G80A 5GWXA 5EINA 1SZPA 3LH5A 1KK2A 3EF3A 5CM2Z 4CIYA 1E7SA 5AW7A 5FORA 4RA6B 1XU4A 2NTNA 3QKTA 1RVDA 5JJIA 2AEMA 2KMLA 2G82A 2V6BA 4RIHA 1WW2A 4LF7B 2VZ8A 4QU0A 4YNBA 1KH2A 1X1QA 1OC4A 4YASA 1DL5A 3LGSA 2ANBA 2DY1A 1EX7A 2IDMA 5KOIA 1XELA 1YQQA 1TJYA 1G8AA 1UK8A 1YZ3A 3H1BA 1D2GA 4JJKA 4QAQA 2PA3A 2C0CA 4G09A 2AOVA 2E9SA 2AG8A 1AGNA 3X43A 3CB4A 1CY1A 5J9FA 2OA0A 4D4GA 1KORA 1G42A 4O08A 4C29A 2BFMA 3B85A 4ZDJA 4M1QA 4G0WA 5CIQA 1T9GS 621PA 3NZEA 3BULA 3NCHA 4TTRA 2FW1A 2LV8A 3W5CA 1UINA 1HDIA 4HEA1 5AW4A 5AVOA 3ZXIA 1D2MA 3L4KA 2KE5A 3OX1A 4UXIA 3K6JA 3EXIB 4F9GA 5BSGA 2FE4A 2CMHA 2FQYA 3K32A 4TL8A 2BY4A 4CDRA 4DR7B 4ZDKA 1N33B 5JAIA 4KO2S 3PNKA 1KY2A 2QMUA 1GDDA 2QSJA 2Z5LA 4IJWA 5JS1A 1FNBA 2CHQA 2O7VA 2ZE7A 3TOXA 3M81A 3JQ8A 4PICA 3AL2A 1PEAA 1EWVA 1Z4JA 4OXRA 4OLHA 1A04A 1YE3A 5FTMA 4LVNA 4W5TA 4CEJA 2P2ZA 1NW3A 2QDXA 5JTTA 4D26A 3M3HA 2BKXA 1LKZA 2IPAB 4YHHB 1FYWA 2DR0A 2NU8A 1M1XB 1P7CA 1NBHA 5K0GA 1XRLA 3DFFA 1WMFA 3KSDO 5KX5A 4FIDA 4TLEA 3ROGA 1YJCA 1XP5A 3FNBA 3T1HB 3L0DA 4DDWA 1K4KA 3R0ZA 4MQBA 1K7XB 2HAEA 2OTCA 4Q9JA 1SBIA 1Y82A 3NT4A 3L7CA 5C31A 4MDYA 4DPLA 3JZMA 3GLGA 3AXTA 2QIOA 3KUCA 4FS3A 4BNGA 2RDMA 2Q5CA 2W93A 4FIZA 4HVTA 1AB5A 2XJ4A 3QVJA 2H1RA 1YACA 1X92A 4WCVA 1XZPA 3KBBA 3TTSA 3WIEA 3C87A 3D43A 4D0NA 5JAZA 4YJ2F 1BMTA 1B1AA 1SOMA 2FJ0A 4KHPB 2VRBA 3DB2A 4BQSA 1YOVB 4CR7A 2MJLA 2EZUA 5IN5A 3EXFB 1RHRA 3L6UA 4JXZA 2GPYA 3GJ4A 4G01B 3O8OA 1ZMOA 1K98A 3K0HA 3L8YA 1YB7A 1P6UA 3B36A 4IDAA 4LBWA 5U1PA 4B6FA 5DTMA 2NMVA 3OQIB 4PCUA 2VK2A 3TEJA 1FFGA 3FGNA 3A05A 2QYOA 3EC2A 3N7AA 4MKRA 2Q5EA 5DGTA 5TJHA 4A9AA 3KQWA 4LE1A 1EUDA 1XEFA 4I6JA 3FYUB 2QTRA 4Q9NA 5D84A 1LLCA 1OASA 4V0ME 4RZSA 1N2GA 3LC2O 1CJCA 1WP4A 5H0IA 1PU2A 4DIBA 3NAMA 4FWTA 3M3PA 4RZUA 5BR8B 1SUDA 4ESHA 2QLMA 1R0SA 3E82A 5EIEA 3TD9A 4RULA 4OI0A 4MVJH 5LJIA 4UDOA 4ZO6A 1KU0A 3EXEA 4UZFA 2OV2A 2J0UB 1WW8A 3V97A 2EKBA 2Q9UA 1LDNA 3GIWA 5IC6A 3TOCA 1N92A 1T8PA 3NBZC 4IS2A 4YY3B 4IDQA 5JIBA 3DE2X 2IBSA 4L4RA 4G6ZA 1CUSA 3ZHUA 5AVTA 3F6CA 1ISRA 1QC5B 4WMLA 4Y6GB 4BVFA 2ZXUA 4H1TA 2C4VA 4B2YA 4F4IA 4O4LB 1PJAA 3LLCA 5I9TA 4F2DA 5BV1A 3NHPA 3AFNA 5E8RA 5LPNA 1U2RA 2QE7D 3G7NA 4KQJA 4XB2A 5EC8A 1A1SA 5F7ZA 4Z4HA 2PT6A 1VG0B 5BMVA 4F3YA 4GRIA 1G4UR 2GNPA 4X54A 1BJKA 4BQPA 4ZYVA 4CEHA 4P7GA 4TRJA 1RJGA 3RM3A 3V8BA 4YRTA 5K8CA 4JSTA 3ASUA 1R4NB 1YO6A 4R0VA 5D7BA 2HU2A 4PGHA 5CTJA 2FZGA 6NULA 1NVDA 1SCQA 1M6EX 2BBWA 3E22B 3RU2A 4IAOA 2ZI4A 1C41A 3K09A 3LOQA 3OT1B 1FVOA 3A32A 1N1GA 1Z47A 2RKBA 4OQYA 1Y3DE 2HWKA 3L1HA 3LQ4A 4X97A 3ELWA 3OX2A 1Z12A 5K4AA 2Z9CA 4Q4HA 1H4TA 2JCGA 4F9FA 2XNDA 4U2GA 3UV7A 2CXNA 2WK1A 1CQJB 2L69A 1GZDA 4WESB 4J3FA 3GDHA 4MV4A 4C5BA 3GA7A 3IDQA 1GCGA 2ZJ8A 4XSHA 3QPDA 4B3XA 1QRAA 3EIEA 1EJ6A 1QNLA 3DHWC 3I2KA 1Z0SA 1JALA 4UM9D 3BXEA 2GSDA 5TY0A 4EDFA 4K26A 1PS8A 1YWGO 2I80A 1BTOA 2YJ6A 3B38A 4R6WA 3F9IA 3B8HA 1UF9A 2I1QA 2J0EA 3WYEA 4QLOA 4UBOA 4F4JA 3CGWA 4GLFA 1SG0A 2CEAA 5K0SA 3A6PC 3X2SA 4O8CA 4BLUA 1NW6A 3H11B 4A7PA 1PF7E 1PFWA 3EUWA 2J3KA 4XM1A 5CFPA 1BXKA 3BMNA 1RC0A 3EB9A 5IBCA 1GO2A 3LHSA 4NG4A 1XZBA 4O5AA 4EJ2A 1W2GA 1QH8B 3IV7A 3DL0A 4KYIB 4RAOA 1L7PA 2AJCA 5DYYA 3RH0A 1JHPA 4PZCA 4L5YA 4RHUA 1DX6A 2PXAA 4N65A 5E3IA 4WNCA 4BMNA 6ABPA 2ZU0C 3FWHA 3QMPA 2FDXA 1YR7A 2JFUA 2VJAA 2RGCA 4R9RA 2E2WA 4RE5A 3X1DA 4LTNA 5BN3B 1WCIB 3W2TA 1ECBA 1A2QA 1NURA 3K7EA 3ZDXB 4ZFNA 5ICFA 3H1GA 4TV8B 5FO0A 4EAQA 2FWBA 1IY0A 3KXKA 1W85B 3L41A 1H3NA 4EO9A 1PJRA 4CLHA 3OIUA 4S1VA 4GLOA 3C7CB 3BJIC 1NW7A 1FU4A 1KIMA 5LMCA 4X8HA 2Q3JA 4OREX 4DJ5X 2ZIWB 2IUEA 2ZUDA 3GRAA 4GGMX 3U4MA 3Q2IA 4M9RA 4Z7QB 1WXQA 4P7BA 4YJHA 4LJ4A 1MZPA 3FVQA 3T34A 3P2YA 4ARIA 3AINA 2NVUA 2G8LA 4RGBA 4W1PA 1ZESA 5LMZA 2BEVB 4B3SB 3BD8A 3ZCSA 2VXOA 5JYDA 2EV9A 4AMBA 1D1PA 5FBQB 4CIBA 3LKZA 1T6YA 3STWA 1MJGM 2XSZD 1PG0A 1SVSA 2GPSA 2VDPB 3JQRA 5DSZA 2PANA 2P9ZA 4LHEA 4QGGA 5D2CA 3N5CA 1T36B 5EVJA 3SP1A 1VYTA 3R0JA 1CY8A 2CUTA 4WOPA 4E2XA 1B3BA 1BW9B 1UOPA 3H1PA 1N5RA 5MFZA 3LIPA 4BX3A 2XSZA 2OXRA 2ZSBA 3PX2A 4UM5A 1Y7PA 3MEQA 5CAEB 5DBFA 1I6KA 2WHRA 4RY0A 4DCNA 2QZJA 2AE1A 3DGFC 3SEZA 9LDTA 4BATA 2VPPA 1G7TA 1JVSA 1NW9B 1YJAA 1B00A 3JWEA 1OV4A 1S2DA 3H3JA 4UPVA 3HCRA 3A3NA 1QONA 3Q7SA 3H9JA 5HQJA 1EQAA 1GTMA 5BQPA 3NQ41 3FVRA 2X41A 1YMUA 4M76B 5HZKA 2W48A 2XR1A 3GJZA 3E9DA 1XLTC 4NFYA 4E6PA 1P1IA 2FFAA 2W00A 1GNQA 2SICE 3CZ4A 5DT9A 1M6HA 5ESRA 5F5XA 1ZVVA 4TVSA 2Q49A 2XZPA 3PDIB 3DLCA 4BB5A 5I7OA 1HXHA 3I1IA 4EFMA 1RXVA 3QE4A 1R8SA 2O0MA 4RD2A 1P1HA 1IHDA 3ZGYA 4HATA 1G66A 4CV0A 3MBKA 1Y9AA 4KTVE 3TINA 4Y0NA 5FBWB 4BNJA 4FWBA 2VHZA 1UBNA 4NMMA 1M2NA 3W78A 4GXRA 4WL0A 4YRJA 3WV4A 4IFBA 2C07A 1XTBA 2C3YA 4F97A 3THWB 1SCUA 5HJEA 3P71T 4F6LA 3QEAZ 2YV4A 4ZDWA 4QRHA 5FO1A 5FL3A 1P31A 5LFAA 1QV6A 4GHWA 2GCPA 2XI4A 1AK1A 1RMYA 1ZN8A 4HNQA 4LKOA 2PKXA 3R5HA 4RVCA 1XZJA 4QQNA 1R4MB 1VGRA 4OPMA 1HUQA 4US0R 4BYGA 1FY2A 3DTVB 2PUGA 4ZREA 2HJVA 1FCJA 1LPPA 2VP3A 4JQZA 1XJ0A 4CTOA 1NMXA 1VE6A 3MF4A 5KOJA 1R64A 5IW8A 4JV5B 3LCJA 4YP6A 4N5MA 5EEHA 3VV2A 3ZNNA 4UXJA 3P20A 2VHQA 2P0AA 4QVIA 1XDZA 3P2JA 2K4MA 3CVXA 3KZVA 5CVCA 4Z0TA 1YB6A 1YQGA 2BMEA 4HDCA 3T5AA 4NTZA 4LGVA 2Z2JA 5G40A 3SJBA 4PLZA 1HTTA 3HVHA 5CBPB 2D3WA 3LKDA 4CF5A 2WEKA 3C41J 4M7WA 2DFDA 3R5FA 3P0EA 3WNBA 2Q9CA 1COZA 4L3OA 4BNDB 3ANNA 1S2MA 1U98A 1ZU5A 2OZVA 1OH5A 1YVPA 2DPLA 3V1KA 3OD5A 1WB6A 1HO3A 1FNCA 1GXSA 3R7NA 4F3KA 4QE3A 1N0VC 1JQAA 4S0XA 2WJJA 2AN9A 4R9SA 5SZKB 2PNJA 1MFPA 1AGRA 2NAPA 4ZAYA 2IXGA 1RPNA 1B16A 2BGNA 2QN6A 2Z43A 3JWJA 3TLXA 2NYRA 5C1BA 1AF7A 5BPHA 4MA5A 1YZFA 3WLOA 1UK9A 4YXWD 3FLMA 3PFNA 3UTDA 4RU1A 4C43A 3UC5A 4UEKA 5A3SA 5B4TA 2PBLA 2REXB 1OFUX 1YL6A 5EZ6B 3HVJA 3ZDBA 1IHXA 4XE5A 1H2BA 1Q14A 1T9CA 2WIFA 1M33A 2Z08A 3PGXA 5C4GB 2VS1A 3OOYA 1DOAA 1YJ5A 3CLTD 4N8SA 3GG9A 3IP9A 4HP8A 4R83A 1QQ5A 1NW4A 2A9VA 1B6SA 4JAVC 4Y2YA 3QWIA 4PO9A 4CR8A 4AN0A 1MV8A 2GK7A 5LL6P 1IQRA 3OPYI 2WYIA 1GTVA 1PDVA 2OZLA 3M4ZA 5D3MB 2MIIA 3K9WA 4NOKA 5FBKA 3HVKA 5A2GA 3IERA 4E03A 1J5EB 2O8DA 8ATCA 3HUFA 1W34A 3USCS 5E2AA 3QUCA 3LV8A 4LOAA 2EX4A 4J75A 3S1AB 3SM9A 3PLNA 2F67A 5L3SB 1U0HC 3KYJB 2YXPX 1Q84A 1M34B 3NP9A 4GZMA 5DTRA 3MRXA 3GLIB 3DJFA 4ARZB 3GAZA 2GCIA 1KEPA 1E9CA 1DRWA 3WRXA 3C6QA 5KHAA 2G1UA 3DGEC 3ITDA 1E9RA 1VG9B 4KQXA 4U9HS 4RTSA 1WDWB 4V39A 1EDOA 2A67A 4JJFA 3VPBA 3CX7A 1W36D 1PR3A 2YJZA 2IXAA 3NEPX 1HE8B 3OJLA 1CHDA 1JLHA 5C1DA 2XTMA 4RTQA 1JIJA 4DL9A 1ATIA 4V0KA 4UMFA 5ALIA 1XAGA 1KR5A 5HIJA 3ZTWA 1VHLA 3ZZTA 2C84A 1O1YA 2J9RA 4PLVA 1ZQ1A 4ZYTA 3CUKA 4RTLA 1PKXA 2W6OA 2CXXA 2WIDA 1NQOA 4Q39A 4IWYA 2JFQA 3FCXA 1UT6A 2C4UA 2HRZA 3KKOA 4V24A 3L6BA 3SZUA 4CUKA 5BRAA 4UDXX 1SWVA 5I7FA 3LAWA 5TS2A 1EVQA 4MRMA 1Z5OA 4UNRA 2I2WA 1Z2DA 1Z5GA 4MUXA 1JIXA 4L5AA 5AK6A 4G2NA 4HB3A 4ZCTA 3U19A 3UAVA 2XWPA 1BU5A 4PTYA 5DGXA 4KH1A 3WTBA 4Q3LA 2Y0PA 2PEYA 4FBGA 5FULA 3DMYA 3V5NA 2QX4A 1RIIA 1GNRA 2R6DA 4N49A 3O9ZA 3VR4H 1WB4A 2WD9A 2NP6A 1E92A 1NVGA 2PS1A 4JR1A 2O8VA 3MUNA 4AJJA 4OP3A 5T64A 1B3RA 1GPYA 3RRFA 2DSNA 3N7TA 4LYFA 1NDQA 3NHKA 4HAOA 3KT0A 4QELA 1PWZA 4P2BA 4XA8A 2Z8YM 4WXPA 3HB7A 4BO5A 1YA8A 4FX2A 3AVPA 2UZ3A 5BNWA 4Y2UA 1G20B 2I2FA 2P9QA 2V7EA 1I80A 4V1CI 4OJYA 1U3WA 2G5PA 2IUSA 1V1MA 5KC8A 3DDNA 2G1JA 5ALJA 4CG0A 3OLWA 1SUEA 3LVFO 4AS3A 3T9FA 5TPWA 1YGYA 4DUYB 2IUUA 2V7GA 1FNDA 2G4LA 2Q3EA 4R9UC 4BE7B 5K8UA 2Q07A 4RV5A 1A7JA 1NIJA 5HQ3B 4BIMA 3D2BA 1FTYA 4CT5A 1YASA 2W9XA 4ND5A 4QO7A 1QGED 4RDIA 1JA1A 1LCIA 4HLCA 3RJZA 1MGPA 1JPNA 4EY6A 3JXEA 4EZBA 3I28A 4AMZA 3Q9UA 2B4AA 1OMOA 2FPLA 1ZSNA 4IR7A 3VPXA 1PK7A 1BX3A 3B20A 1CY7A 3TIFA 2H48A 3OHPA 1PVVA 4AFNA 4DIEA 4Z8YA 1CUZA 1NMEA 2HXYA 2BYTA 1II8B 2AR0A 1T2AA 2GFIA 3AP2A 3ILHA 2EAUA 1BOFA 1DO2A 4MCIA 4N03A 4BKQA 3CRRA 2KBEA 4IKEA 1YZVA 5F52A 3W8RA 2ZRKA 4UTXA 5JRDS 1EGMB 1WPQA 2IU4A 2ODTX 1TMOA 2RHDA 1OU0A 3PFKA 4MW0A 4B4VA 1SK9A 2WD7B 4LXTA 4LYAA 4D4JA 5LZ7A 4X66B 3TR6A 1ODCA 4AO6A 4TTQA 3OZUA 3PRKE 1E66A 3GRPA 4TKZA 1I2AA 1RYBA 1C3EA 4DDVA 4G0OA 4K0RA 3T54A 5TRTA 1CUGA 1W36B 2ATIA 2ZQZA 1KPHA 1LSSA 3KHTA 3KKEA 4MINA 3JVDA 4RENA 3JQBA 3S7TA 3PSAA 3DJYA 1Z0DA 3B1JA 1VL6A 4OMCA 4Q82A 2YN0A 1NSTA 1Y7IA 1GGJA 3W5VA 4B8ZA 4HVLA 4IX9A 2A0KA 2O50A 1BS9A 3EC1A 3ITKA 4GBED 3TEFA 3WNCA 3VJRA 3QPCA 2PDAA 2WJGA 2Q6TA 3DNPA 3K6SB 1JG4A 3FNQA 3PZRA 1X74A 1JS1X 1QGOA 4RD6A 3SG0A 5HVNA 5CT4A 4E7OA 4UD6A 3QYJA 3LSTA 3MXOA 4I3HA 1WO8A 4I5FA 3ZWVA 5ICEA 3NBQA 4H2DA 1V26A 1PHPA 3B3GA 1Z35A 1SBCA 1ZN2A 3K09C 4R2JA 1PZGA 4KNVA 3EUAA 2YFYA 1RRFA 4I4NA 3OCYA 3OFND 1EWRA 4B7ZA 1KEZA 3O3MB 1OH6A 1VI6A 3CUSA 2GEBA 2ZBQA 3L8ZA 2AUTA 1CUFA 1WU8A 5B5SA 1HGXA 2Y6VA 1ZIXA 1J22A 1OPRA 3FCAA 3UXYA 3ZHXA 1MW9X 2QR2A 3OFNA 2DFVA 4LJLA 3PEFA 1RXIA 1HQYE 2UUOA 1DXHA 3FGPA 4E32A 2QMZA 3THXA 2R1VB 4G0PA 2VTDA 3GDOA 4K9RA 3CLHA 4WGFA 1HOXA 3SZRA 5MF6A 2VDLB 1DEKA 1C9YA 1CDDA 3IRVA 3EMKA 3L77A 2G9UA 4OBWA 1IN6A 5BWOA 3D9QX 3TKAA 5SY6A 2HF8A 2QZ9A 5C81A 3PXDA 4B7AA 1S2LA 3EQ8A 3T12A 4AUKA 3NAGA 1Z6YA 2R1ZA 3R7WA 4XLTA 4C6HA 3J81k 1N6IA 5BORA 1ND5A 3U4IA 1QAQA 2WUVA 1D6MA 3NM4A 4ZZ0A 5KWSA 5E6SA 3E4DA 5IMSA 5F77A 4QYXA 1OB5A 4LOIA 3JD2A 2NTYC 4JVNA 4Y2RA 3M1AA 1LLDA 2EF0A 3DMTA 4H7JA 4QUIA 3LL7A 4WE3A 3TMYA 4PC3A 5TVGA 3VBEA 3QX7A 5I3ZA 2QTBA 4C4PA 1QTRA 1P9RA 4TM7A 1B26A 4AKTA 2YZGA 2BGLA 2F48A 3D4LA 3R44A 4IUYA 4II3A 4EEZA 1Q3HA 4CKEB 4ACAA 2XBMA 1T29A 2SCUA 2EBHX 2G9VA 3VOAA 1N3YA 3M83A 1BGVA 3MCVA 4N01A 3H3FA 4QUKA 4HMPA 1BNCA 1ST3A 3OPXA 3K3PA 2JK0A 3ZCPA 3LPLA 2IUFA 3UK6A 2GZSA 1MN6A 3PPYA 4OA5A 3AFOA 2H2FA 1H2YA 2JGDB 1HYBA 4C6SA 4A15A 2VJPA 2L18A 4HGQA 4B2PA 3KZMA 5IFKA 3V1TC 5EWMB 3LOUA 4HDRA 3ISVA 1A9YA 2V7TA 3MS2A 4GE3A 1E94E 1YE8A 2MCFA 1PHRA 1UDXA 4GC9A 2W42A 2DHQA 4Z0NA 2J6IA 5FPHA 4EYQA 2PX5A 4ENTA 2KW5A 5GVRA 2W8BB 3G0DA 2C5FA 3TAXA 3D8RA 1JVBA 3C3CA 1K08A 3CKKA 5DTJA 5B2EA 4KZPA 4EKIA 4JN6B 1OFIA 4M0FA 2ZSKA 1ML3A 1SY7A 4RHEA 1PVOA 4LMAA 3LY7A 3TRKA 4KKVA 4BKUA 4ER5A 1U2QA 2HHAA 2I9KA 1JXMA 3IAHA 4LWZA 2HWUA 5GIOE 2GRJA 3W7VA 3WMRA 4C7XA 2VYVD 1NU6A 4EB6A 1B0ZA 1JX6A 2QSYA 1J39A 1IXSB 2CDNA 4HKTA 2AI1A 2RHOA 5DHQA 2HSDA 1I4DD 3CXUA 3D6AA 3ZJUA 1TT7A 5AXCA 2Y05A 3X1KA 5DASA 8ABPA 4HDMA 1C1HA 3HG7A 2VYVA 1YRWA 2ZZKA 4YHBA 421PA 2D7CA 1JPVA 2YYSA 4LIPD 3THSA 3L6EA 5EJGA 2G6TA 2ZT8A 3BERA 2O8EB 1AHHA 1C3OB 5J2TB 4OEHA 2I62A 1XEXB 4ZOAA 3TE7A 4K6OA 5HKKD 1HRKA 2I8CA 4OHYA 2OD7A 5EIWA 4GYJA 3NJ8A 3EH1A 1OHHA 2O2DA 1W88B 2FLVA 4LS3A 1ITZA 1KJZA 4M8NE 3SBXA 4OHBA 5JCXA 2FTKE 1CEYA 1CJKC 3LP8A 1VG1A 1R1DA 3KD3A 4GBGA 1DQYA 1SRRA 2OHXA 2Q9BA 4GC5A 1UPFA 4O4IF 5I9BA 1TQ2A 4RVFA 4TS4A 2FB9A 1CHNA 3OKFA 1XSEA 3VX3A 1T8RA 5DM1A 4ATNA 1VLJA 3WNZA 2A2ZA 1ZMXA 3HBJA 1R15A 1AURA 3EG9A 4UNSA 4CDGA 2YIMA 3IVAA 1KL7A 1M8GA 2FXIA 2QRKA 2VBCA 3KB6A 4HGPA 4HDKB 2HFJA 5GY7A 3DBLB 3FTNA 3KRTA 3AR8A 3JQ7B 4NS4A 5EQFA 2B7BA 5J40A 1E0KA 5AVWA 2H57A 1WW3A 3IT1A 1ISHA 1FP4B 1RBMA 3FYDA 3VDRA 1QRUA 1TZ2A 2GXUA 1O87A 1Y7LA 1I1NA 3EFHA 1ULHA 2BFFB 3DFMA 2ET6A 3LD9A 3NNSA 3JZIA 3JALA 3WK4A 2AG1A 1D3AA 2HRQA 5GM2A 1STOA 1YF3A 2FQXA 3CX4A 1K89A 5LKRA 1SU6A 1EK5A 3A9CA 4X64B 4H35A 2NXEA 5HKBA 3S29A 4BNHA 3NHBA 2X4IA 3LHDA 2AE2A 3ADBA 1ZD1A 1UODA 4P4TA 4YWJA 3MWEA 1GU1A 2Q2VA 4R68A 2B8NA 1OWPA 2AMJA 2GEVA 3MJTA 4GECA 4M0KA 4Z1MD 3T5GA 1YHYA 3A9RA 3RHSA 3AF4A 2GWHA 5T57A 1GAQA 1H8HD 3RSOA 3UAGA 3DC2A 2QUZA 2A9JA 1O96B 2ROQA 4D1YA 4Q18A 3H9UA 3WXBA 4G4SP 3WOHA 1A8UA 1FTWA 2QUBA 3AL3A 3M7IA 4N3AA 4Z1MA 3GMDA 4CMBA 3C6XA 3NTUA 3DE3X 1UMDB 1H8HA 2DQ4A 2VPTA 4U7TB 1XX6A 1RLMA 2QTFA 2JFHA 2ZKIA 3AUTA 4OHWA 3WGNA 1G55A 4P31A 5BUQA 4YIKA 3BXFA 3ETDA 1X1EA 4QKQA 3QFFA 4YAEA 1BFKA 3UHJA 1VKOA 2JAWA 3WK9A 1CRZA 4D45A 4Q03A 2XRMA 4ND2A 5LWHA 3IQEA 5IF3A 1YR3A 1OJLA 4XSVA 2PS9A 1KI2A 2A33A 2QPOA 3FHTA 3T3PB 2Q2WA 3EGDA 2GKGA 1NC3A 2P65A 2WG2A 4LZOA 3AJAA 3P9P