2DP4E

Crystal structure of the complex formed between proteinase k and a human lactoferrin fragment at 2.9 a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the complex formed between proteinase K and a human lactoferrin fragment at 2.9 A resolution
rcsb
molecule tags Hydrolase
molecule keywords Proteinase K
total genus 88
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2006-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2dp4E00
1V6CA 3AFGA 1YJBA 4FONA 1R6VA 1Y48E 4DWWA 1GA4A 1Y34E 1GNVA 3DE0X 4AKSA 1KE2A 2WUVA 2HD4A 3DE2X 1SUDA 1BFUA 1WSDA 3LPCA 4KG7A 1GT91 4OMCA 5AQEA 3WHIA 3F7OA 3HJRA 5AVKA 4C3VA 5SICE 3A3PA 2ID4A 5K7SA 3Q5GA 1GA6A 1T1EA 2TECE 3DE4X 1S2NA 3BX1A 3H42B 3WIUA 2Z58A 2DQKA 3A3OA 4ZOQI 5JMOA 3BGOS 5ARCA 1PJ8A 1SBTA 1T1GA 1SCDA 3EE6A 1MEEA 1SH7A 3TI7A 1SELA 2Z57A 1R0RE 5B1DA 3WIVA 3VTAA 5AMXA 4LVNA 4ZARA 1SVNA 2Z2XA 4YN3A 1A2QA 3D9QX 3DE6X 2WUWE 2PMWB 4HX2A 5CW1A 4NMXB 1EA7A 1P7WA 1SIOA 1BFKA 1MPTA 2Z2ZA 4NE9A 1NDUA 5JXIA 1SIUA 3DE7X 4KPGA 4BWGA 3CO0S 4JP8A 2X8JB 5ARBA 1NDQA 1TK2A 1VSBA 3VSBA 1SUBA 1HT3A 3DW1X 3DDZX 3EIFA 2V8BA 2X8JA 1CNMA 1EGQA 3D43A 3GCXA 1KDYA 3VHQA 4AKTA 3OSZA 1Y3BE 2ZRQA 3QTLA 4CFYA 1C9JA 1WMEA 4CG0A 3DE5X 1KDZA 1OT5A 3EDYA 2PYZA 1TMGE 1SBIA 1ZVJA 1S02A 2HPZA 1P7VA 1Q5PA 3PRKE 3QFHA 5I9SA 4B5LA 5FBZA 1SBHA 1AVTA 1AV7A 1V5IA 1Y3DE 1GTJ1 1BJRE 1XF1A 1IC6A 2Z56A 4K8RB 1KDVA 3GT3A 3LPAA 2XRMA 4NE7A 3VYVA 2ID8A 4M1ZA 1Y1KE 1SCBA 1AU9A 4Z2AA 1BE6A 1WMDA 2DP4E 3I34X 1WMFA 2PQ2A 3Q40A 3UNXA 1TO2E 4GI3A 4C3UA 5JXJA 3TI9A 2SICE 1GA1A 1OYVA 1SCAA 1DBIA 3AJ8A 3LPDA 4CFZA 2IY9A 3GCWA 3I2YX 3T41A 2IXTA 5FFNA 1P8JA 5FAXA 1PFGA 1BH6A 1GNSA 4H6WA 4J94A 3VV3A 2SNIE 2WV7A 1BE8A 1WVMA 1YJAA 3AJ9A 1DUIA 1Y33E 4H6VA 5JXHA 1ST2A 1AF4A 2E1PA 3L1KA 3LXUX 1IAVA 2SBTA 1SPBS 2B6NA 3P5BA 1SCJA 1TM3E 1C9MA 1TO1E 1AQNA 1C3LA 1Y4DE 1TM5E 2WWTA 3F7MA 1TM7E 3DWEX 2XTJA 2Z30A 3PTLA 4WOBA 3SICE 4WOCA 2W2OA 3DE1X 4KB5A 1SUCA 1LW6E 1S01A 1SCNE 2G4VA 1TM4E 1ST3A 1SUEA 2QTWB 4OMDA 3ZXYA 5JXGA 2ST1A 1YU6A 2W2QA 3F49S 1PEKE 1TM1E 4I0WB 5ARDA 4OV6B 2PWBA 2PWAA 1GTG1 1SUPA 3CNQS 1GCIA 1NLUA 2W2MA 1SBNE 1THMA 2Z2YA 4RYDA 3VV2A 3ZXXA 1SUAA 1CSEE 2PKCA 1Y9ZA 3A3NA 1SIBE 1Y3CE 1ZVKA 2W2PA 2P4EA 1JEAA 3DW3X 3DYBA 2DUJA 2SECE 2ZWPA 1UBNA 3I37X 3I30X 1AK9A 1GTL1 1OYOA 1R64A 1C9NA 1SN7A 3DVSX 3GT4A 4MZDA 1KE1A 3BPSA 3QMPA 1T1IA 1Y3FE 3DVQX 2ZWOA 3TECE 4DZTA 1TECE 5AVJA 3WQBA 4HVLA 4LVOA 1PTKA 4DJ5X 2W2NA 5B1EA 1YJCA 1Y4AE 3DE3X 1AH2A 3DVRX 1SBCA 2GKOA 4H6XA 3SQOA 2PRKA
chains in the Genus database with same CATH superfamily
2JD1A 2ZXEA 3ESAA 4CM1A 1AF7A 3BTOA 3A14A 4J0FA 3CX3A 4L3WA 2AD1A 4QGFA 4X65B 3TR5A 4EG5A 2EQAA 3G0OA 3ROEA 2LWIA 4RM3A 2CE7A 3OKPA 4KQKA 1BYUA 1V71A 4JSTA 4KBYA 3B38A 2FWNA 4B6SA 1KYVA 4WHMA 5AW5A 2ZVPX 3WRXA 3WZMA 1BD4A 2DQ4A 2HA4A 5EMLA 1EE2A 4F2GA 3F8WA 1IUNA 1VE6A 4IEIA 5CNMA 2UUAB 3CG4A 2GN4A 5JY6A 7MHTA 1XPUA 4GRAA 1YS6A 4UD6A 1N6KA 4E33A 1KKLA 1HQCA 2ERYA 1U1GA 3H13A 1CJTC 1AC5A 2R1ZA 4LHXA 1DWPA 5DP2A 1QQTA 5CTAA 4G0ZA 3DQPA 3QU9A 1DAIA 3EZ6A 5EKDA 3CW9A 4M87A 2EZ9A 2YYZA 3D3QA 1VYTA 1IHPA 4AF7A 3QFRA 2O9JA 3C3XA 3EODA 3TO5A 3GCXA 3RYTC 1NF9A 4D9HA 4GBMA 5JMWA 3AU8A 3HNOA 4CV3A 4NH0A 4E88A 4G4JA 4WJLA 4YP1A 1NUSA 4TKUA 5LYYA 1T8WA 3ABSB 3CISA 2GXQA 2MSWA 2VT7A 2J67A 3OFND 2Y27A 2Q8PA 4TT3A 1KTVA 1IHUA 3HLYA 4O6VA 3T4UA 4CG1A 3TUZC 2RAPA 2OOKA 1GAQA 1LQ2A 1PZFA 2DG2A 3DXFA 3OOJA 3K30A 1PL6A 4N5IX 4E1BA 1NLMA 1M5UA 2AYXA 1UPFA 3H2BA 4QU9A 1T8YA 3WGJA 3PXXA 3QTBA 4A2WA 2P9BA 1E7WA 3GRVA 3IE2A 2A5DA 1BQ3A 1HEYA 2X22A 4QEZA 3KAKA 5BYJA 2CMFA 2FRDC 2HC9A 3P97A 2DY0A 4J9VA 4J4HA 3AJ8A 4JN6B 421PA 4BVKA 1A82A 2PAAA 3NAQA 5DXJA 5FHQA 1PHPA 2IS1A 3OCJA 5I9TA 4PZEA 4WCFB 1SCKA 2C5HA 2VKTA 5KB3A 3QP9A 1C8KA 1T2AA 4OHUA 5E6UA 2ZE8A 3K8OE 2YWDA 1HNXB 4C87A 4RFSA 2J59A 2B8WA 3LIPA 1E9EA 4EO9A 5A5GA 4JUDX 1G8AA 1NC3A 3CE9A 3T9CA 1ZAKA 3AHHA 3AR7A 2PYIA 2W2LA 4R8VA 1FBNA 3BA6A 1JVBA 3COYA 2QP9X 4OY3A 2R8YA 1YUNA 2JHGA 1AOXA 1DC8A 3EQ7A 4G23A 1M2OA 1C4OA 1XZPA 1ZCFA 2QS9A 4YP0A 2CLDX 4ZC1A 3RSFA 3AESB 4MW9A 2HADA 1D4FA 5HF6A 3LVRE 5LUAA 3ORQA 1D2HA 2EG9A 4TV8A 3QLVA 3Q7IA 4HY3A 4RXUA 3SK0A 3ZVRA 1FXUA 1X8KA 1XTSA 4EX7A 4WNAB 6CHYA 1FMLA 1T9BA 2UVPB 3QF4A 3SJCA 3SC6A 5DM1A 3GZNB 3PUYA 4YMGA 1JKMA 5LXTF 2NNWB 4NV3A 4FQ7A 1JBQA 1V4NA 3GQBB 1G7SA 4UBIA 2FXIA 1E9AA 1R6AA 1XTVA 3F90A 1X1BA 3Q85A 3ZW8A 4DDHA 3O03A 3CYFA 2EYUA 3A1SA 121PA 2CJWA 4YACA 3B3AA 2XUQA 2XLBA 3HL4A 4PAMA 5CT4A 3SYNA 3T3PB 1LBEA 2H29A 3LQFA 5DKFA 5EXSA 3LF2A 2X2OA 1B4DA 4GKVA 4HEJA 4CVNA 1DV1A 3KPWA 4FOLA 4YRPA 3PYXA 4MI6A 1U7PA 2G9VA 2OFOA 1JECA 5ALDA 5LLSA 5KOHA 3MC1A 1D4OA 2A3NA 4WDRA 3CKMA 2P2ZA 3QYFA 3U1VA 3R9IA 2H0QA 2KPOA 2PXXA 5B53A 3WL7A 4PIVA 4EB8A 4DVGA 5GJBA 5BW5A 4MVJP 5KHLB 4E5YA 2O1WA 4UU7A 1RHQA 1ODJA 4FUTA 4MUGA 1DC7A 1SCDA 2VRWA 2I1WA 1MIHA 1L5RA 2NU6B 1T9KA 3PVSA 4EI8A 4PHGA 1P7PA 4G0WA 4HEA6 3RF6A 4CR8A 1L4UA 2OENG 3KO8A 3M81A 3MJDA 1Z83A 2R1TA 2Q4TA 3QENA 4MARA 4V0SA 4DLZA 5A02A 1TKBA 1ESMA 4XWGA 4DREA 3OSUA 4OHWA 1B8OA 3HEMA 3M6VA 4HFRA 4QOGA 2PMFA 4ENSA 1HPLA 4IDEA 4YT4A 2CBZA 2PUGA 4JP8A 3BEDA 1RXSA 1SEVA 1IFXA 1D2MA 1GPYA 3BE6A 3Q0IA 4GMFA 3HVIA 5EVJA 1CFZA 2ET6A 5LQRA 5M7EA 1BW9B 1DCKA 2CFIA 1MVNA 3D2LA 2QUZA 4U7FA 2XT6A 4LKOA 1NPDA 4NBVA 3AFNA 1NXOA 1T8TA 4JY7A 2QIOA 5J2TF 4E2FA 3SZLA 1NSTA 3K9FC 1RIIA 2CDNA 1F06A 3LC0A 5LSAA 4MQEB 1E1DA 2NV2B 4GBJA 4JLWA 2P1ZA 3EBLA 1YI0A 1I1QB 4H0CA 2PRYA 1QM5A 1PRYA 4L72A 2A35A 2W9XA 3OD5A 1GUAA 2OHOA 1Y1KE 2CHGA 3ST7A 5CRIA 1KAEA 2XNDD 1FFSA 3GPCA 3UWOA 4HB3A 2XZDA 1B0AA 3GZJA 3KFLA 1BHSA 5E2IA 4JKYA 1GAWA 3ZZ0A 5LP6C 2J7PD 3H4VA 4UU8A 4XGNA 3G68A 2Q3MA 1XFAA 4POAA 2HYDA 5DO9A 5H70A 1VI5A 4A36A 5J59A 1OT3A 1WVMA 2EBFX 2ZT5A 3VR1A 2OY0A 2HIHA 1VMEA 3AR3A 3QNUA 4PN3A 2Z83A 3AUYA 4DR6B 2X4DA 4IIUA 1VLHA 4BFCA 3FW1A 3VC7A 1WQ3A 1RYMA 1LJUA 1PGJA 3TUJC 3M70A 1V4BA 3VBEA 3CUKA 4N9WA 2FSVC 1PWEA 1TLTA 5EZYA 1DX9A 5MDHA 5HQ3B 4JCCA 1ZX1A 2HMUA 1QPGA 2FEOA 2PL5A 3HV0A 4KLAA 4C08A 3HBMA 3Q12A 4XB6B 4F3CA 3Q8MA 5I7HA 1XEXB 3BF7A 4NBRA 1X1CA 1IY1A 1DKUA 2GCPA 2VAPA 4LKRA 3ZH2A 3DBIA 5EHGA 3W5DA 3VU9A 3ETDA 4ZAYA 3QFFA 5JFGA 2OBFA 4KAAA 4WLFA 2Z2YA 4XYEA 3SMQA 1CSEE 3BB4A 3HDVA 2QZJA 3QPUA 4W9RA 2BCJQ 1P0IA 3GAZA 4Y9RA 3RTDA 1XZ8A 1XZBA 1SHUX 4M0UA 5T4HA 4E51A 3WQQA 5J4HA 5JAZA 2WIGA 1WMSA 4MRVA 4RH0A 4Y0AA 2O2HA 4C29A 4DLKA 3AIOA 1MKYA 3STHA 4MNTA 3VGPA 4HVLA 4E3WA 4LJRA 5FEMA 1RACA 1NI5A 3SJZA 1E6LA 4NCJA 2QYTA 2XA1A 4MV7A 2WJ4A 1JE0A 4CIVA 1Q1ZA 3GLQA 2QAGC 2ZBDA 4MV5A 3W3AH 2C03A 3JQBC 2WINI 1FQWA 3BSFA 4Q9NA 1SKYB 3TN7A 2V4MA 3R8XA 4E5DA 5H7XA 3GF4A 1YKSA 3MWGA 4C6TA 2FQWA 1GLNA 1LJ8A 3BK2A 1NAHA 3FWZA 3MUEA 4GLLA 1EFTA 4FT2A 5AVKA 5JVDB 4US1R 5JOQA 2F90A 1GA6A 3OZFA 3LUHA 4RLHA 3D3WA 4FZ3A 3RAJA 1OLSA 4Z6KA 1N2HA 1IMJA 1TQ4A 2HI0A 4M2LA 1U9YA 4EHHA 4ZKDA 4FYHA 5LYJB 1L7DA 1YHZA 3BF8A 3SE0A 3ZTYA 2BPOA 3GD5A 3HCAA 2JGJA 1XMVA 4LYGA 2DWOA 2I78A 3UQZA 5ECDA 4XD7A 3W8NA 2PS1A 1YOBA 4CM4B 4NMXB 2EQ5A 1PI3A 3AM5A 3WMEA 3ZHTA 3NHMA 5KNDD 4BWGA 3NH6A 1U8ZA 1W0JA 4NOLA 5HEKA 5EWLB 4U7TB 4LA4A 4I46A 4TWJA 3TBFA 3X1ZA 4LE2A 1TM2A 1J56A 4CKYA 4UTOA 4TKVB 1LDYA 2G83A 2YY5A 1O03A 5K03A 2BGLA 2Q4DA 4D6XA 1EBBA 1CZRA 3MW8A 4J8PA 1Z34A 4JBWA 4D99A 2ZK7A 3KWMA 3IEXA 1O3YA 2CF6A 3U7FB 3IB3A 4K0RA 4UTZA 4N01A 1AKQA 1NUUA 2X5OA 1SA0B 4MHOA 1V9CA 5TX7A 3QWFA 4IBOA 4Q7JB 3VYRB 4L8VA 2G5TA 4BWYA 3IT3A 4WZAA 1JHVA 2ZROA 2V65A 3O2QB 2IP4A 1YRBA 1L3BA 1H9BA 3CNLA 3AK4A 4MAAA 2I2DA 2KQUA 3WNQA 4XOUA 3NU1A 3TNFA 1NIJA 2HL6A 1W5AA 3ZLVA 5E9QA 5SV2A 1H6AA 3HKEA 1GV1A 2ZJ2A 1UK8A 4UE2A 2JL1A 4KL8S 1KJNA 4F9EA 3DYVA 5A2GA 3RAEC 4N0DA 5DGHA 1DEKA 2BCGY 3TH5A 4ER6A 3H11A 2WTNA 4G26A 3IOCA 1GEGA 4KZKA 3OLZA 3WLEA 2ZYDA 3LXMA 2BJVA 5LP6F 2QP3A 5JRDS 4MB2A 4NJOA 1XCPA 4TLLB 1QIIA 2DOKA 2QHXA 1A7AA 1EDZA 1LVHA 1P9RA 4L9WA 1G9XA 4KXWA 2GCEA 3HSSA 3CLTC 2NG1A 2AFHE 1SG9A 4AN4A 1IDOA 1OJLA 4QXPA 3WX0A 4RVNA 1ZNXA 3C4JA 1GILA 4DWVA 3C5VA 4O0MA 3D8TA 4L1KA 2B25A 2YWJA 2ZIFA 4CTOA 5FOTA 2OBYA 1YB1A 2F9LA 5F5NA 3RFXA 1ULHA 2C82A 2GBLC 1W2GA 2RK3A 3JQGB 4OI4A 5IN4A 5LLTA 3PQ6A 3Q6NA 4PLGA 3BPSA 4ND2A 1V8ZA 4UAUA 5LA6B 1VBFA 1LS1A 4I1PA 2REBA 4GECA 4LY3A 5DU2A 4AUEA 3MK31 2L0XA 2W2NA 4MCAA 3NOOA 3W5IA 5LOVB 1OGIA 3IALA 4B2PA 2WYUA 3B1WA 3DEKA 3IKMB 1HE3A 5DHFA 4AO7A 3EZFA 1GT6A 4CF3A 3SZGA 1PJ2A 2GM9A 2WJ6A 3LD9A 4ZAGA 4W8OA 3ETHA 3GRRA 3BD9A 4HI0E 4E5PA 2R1VA 5B30A 1IBKB 3CIFA 4MUFA 4LRQA 1XMQB 2OGUA 2R0QC 2IBMA 3IP5A 2H65A 3H9QA 1FP4B 4IMRA 5CT6A 4X1IA 5CA1F 3PDHA 1A5TA 4BPBA 1WZUA 2O8FA 2OV4A 4WKGA 4EJSC 1JQ3A 3KPUA 4QG7A 4EY4A 1NURA 1EBFA 2LD4A 3REGA 2MWMA 4P7BA 2LW7A 5ERYA 4C0BA 3K20A 4E2XA 2FMUA 3FJYA 3PUVA 3DDSA 4GU5A 3EBPA 1PHRA 3CONA 3IOYA 5I8ZA 5TQ0B 4PG7A 3K4PA 4RELA 3S40A 3WO0A 1KU6A 4X71A 4GZLA 4Q34A 1GZHB 2J5QA 3UUFA 4BCDA 4W7SA 1QIKA 2E4AA 3NP9A 2WIBA 2C5FA 1FNCA 2XA2A 3WJAA 1QP4A 4HX2A 2X23A 3REQA 5ILOA 3IODA 4BQIA 5IM4F 2QQ5A 5HF8A 2BMJA 3DVAB 2UVDA 4KPGA 4D8UA 3GFRA 3PFNA 1YC5A 4KI7A 2Q8NA 2BF4A 4M1SA 5BNZA 4AMYA 3OM9A 2D1TA 1FX0A 2WTXA 3D43A 3DDZX 5L4SA 5TLSA 3HZRA 3EF1A 1TKCA 2GILA 1HDIA 2PKXA 3GA0A 3L92A 4G5YA 3RB8A 4CGYA 3P9ZA 4A10A 4YVFA 2ZBVA 2D5IA 1Y8ZA 1HV8A 1VCHA 4OF4A 2Q1SA 3D5TA 3MT7A 3OA0A 3IR6A 3PFIA 3QX8A 4ZDJA 3IDQA 3OZTA 5FWNA 1L8AA 4OYYA 4LYJA 3MYYA 4BP1A 3LLVA 2WWXA 4CKEB 1BOFA 4BN0A 2CBXA 4WSOA 4DRYA 4JYAB 5IDWA 3QMMA 2WM2A 5JNWA 4IJ6A 2JD0A 2WM3A 2Y05A 5FOVA 2PHZA 3CC8A 1HGXA 3ON5A 5B1IA 4QIHA 5DSXA 4CMHA 4EY8A 3H5VA 3EGCA 1GNSA 3IPLA 3NONA 4INJA 5EP1A 5A03A 4RTNA 2OECA 1NVBA 1RBYA 3HCDA 2XXAA 1Y33E 5FA5A 1MDFA 3PL1A 5GOTA 4KBFA 1Y3AA 2Q6IA 4PYJA 4Z86A 5TQ2B 2FN3A 1XRMA 5EUMA 1VPEA 4YCMA 2O20A 4YT5A 2KW5A 3RVBA 4QM6A 2C9YA 4JJAA 2W48A 4QRHA 4ND6A 4U3JB 2PT6A 2GM3A 2W2VA 1RPTA 4CI0B 3E8XA 2JIZA 4E4RA 1QH1B 2Y8EA 3LE8A 5L40A 1A0OA 1N1GA 3QPVA 4HL6A 3ZR4B 4O25A 2GN8A 1DFHA 2XMDA 1QIEA 4RSHA 3ONDA 3OMXA 3ISTA 3V4VB 2CJFA 1CRPA 3L40A 3LYUA 3SHTA 2Q1XA 3TZ6A 2ZI7A 4EBFA 1ECFA 4ZT2A 5E2BA 2W2KB 3B6KA 1CF2O 4GMKA 4KBGA 4YRZA 3BJRA 1HZZC 3PEWA 3EWNA 3KDAA 2P27A 3RG2A 1SVMA 2HOQA 4DLXA 1DCMA 1GJRA 3HSYA 4W1RA 2BEUB 5AIBA 3D2CA 4B79A 3WTBA 3FYCA 1V41E 3BGVA 3EFOB 3SQOA 8GPBA 2RC6A 3IQEA 1WY7A 2E85A 2GT1A 2LNDA 1T0JB 3AUSA 5AM0A 4DPKA 5HRUA 3AERB 2HHLA 3GXBA 2AQHA 2JHAA 2X86A 4UAGA 2HA0A 2Q4EA 1A9QA 1YR2A 3VAAA 3HWRA 5LXTB 4DSNA 2VTEA 2PQ6A 5T7BA 1FJGB 5JMOA 2DQKA 4OGLA 1I1NA 4RGYA 3AUJB 3VPCA 2A30A 3P9CA 4G0PA 4AUKA 2NO1A 2ZFUA 2R4TA 3NFRA 3IAHA 4K6MA 3AVUA 3Q3VA 2DHQA 1NT2A 3EHEA 4NS4A 1CUGA 3IDAA 4WUVA 1P81A 5BMVF 3CN9A 4ZI7B 4HDOB 3BD7A 3T7SA 1KU0A 3HYCA 2Q0XA 1ZK0A 1AS3A 1XP8A 1VMDA 2OGSA 2VH1A 1QZXA 4K8OA 1R0KA 1G18A 4KLRA 4QRDA 1Q1NA 4NAUA 3W7VA 3LVFO 5HFNA 3CEPB 3U17A 3TZEA 3MLEA 4KLZA 4OHKA 3SQLA 5GTDA 4XYMA 4PSKA 3LSTA 3MGCA 3ZK8A 2HJRA 3P9XA 5D2CA 5B1HA 4DQ0A 4F6RA 1XPOA 1MVOA 4RMNA 2ZS8A 1Q5PA 1Z63A 2FWRA 3G7SA 5B36A 4MO2A 1IJFA 3MUOA 4AQ7A 3R7AA 2HBYA 1FFEA 4ZTZB 4Q12A 1PV2A 3MJ4A 2ZYHA 4M7WA 1DSSG 5BUQA 3IX7A 4XE5A 4BPRA 1A71A 5K3EA 4AJ4A 1R4NB 1S2GA 4ZOEA 1E3SA 2HU8A 1GSIA 3KLBA 2C4NA 4N47A 3VOTA 2D1RA 3LDAA 4YLYA 1KY3A 5IBCA 2FETA 1Q15A 4EEKA 1O9HA 5I3CA 3C24A 3O8NA 1Q83A 4Z49A 3H9GA 3L0YA 5GQSA 4IL5A 5LQMA 2YIVX 3Q10A 1FNDA 4DSUA 2VPTA 2DFNA 3H4TA 4JK3A 4O33A 5ES3A 3EX7C 3P0IA 2YHSA 1TKAA 1Z7EA 4DLYA 2Q07A 2ZB4A 2D7JA 2IDJA 2W42A 2FG5A 1FVOA 4RLQA 5C5CA 1SXJA 1EWTA 4KOEC 1GPBA 4YEDA 3STTA 4URFA 3NKLA 4BVAA 3UHFA 1Z88A 5AVVA 1CQZA 3KOUA 2WI8A 2WHPB 1E1NA 3AEXA 1KC3A 1SUEA 3L4KA 1M9NA 2ST1A 1Q95A 2BRUA 2FN9A 4D9GA 1CW2B 2YQZA 2EEPA 1E0SA 1I32A 1GNTA 3G5AA 1VGQA 4EJ0A 3SD7A 1P4HA 1WKVA 2WHQA 1YQ9A 3TDKA 4GRIA 2XECA 3HFGA 4YS6A 4UHHA 3L0PA 2R8PA 4ZDIA 3V1LA 1E3JA 4RQBA 4CLOB 4IJMA 4GPAA 2CHEA 2VHCA 1OI7A 3TIFA 4Q6WA 3B3FA 3JW8A 4KDEA 2E18A 4U7JA 2OKCA 3L0OA 1WV0A 2NU9B 4QO7A 2GKOA 4JJFA 4LGVA 2ZAMA 1CJVC 3VNSA 2AFRA 721PA 3RS9A 1O54A 3B1YA 4GM1A 1KMHB 1W34A 4HQKA 2R44A 3EVDA 3MVEA 2GFQA 1W94A 1RJ9B 1WOMA 3HMKA 1N2SA 2X8AA 5EJAA 3HJRA 4YPOA 3D1LA 3LBAA 1USIA 3FLBA 3QXSA 5DX0A 5U9CA 3S2IA 5CXQA 3WKDA 4Y2UA 3QVXA 1YFJA 2P91A 3P2JA 4QICA 4D0LB 2BKXA 3IQDB 3DL0A 3AJAA 5LU9A 1GYQA 1W9HA 3HSKA 1Q74A 5GIOE 3INRA 4OG2A 3HWSA 1GPMA 1P0QA 3N2NA 4HNAA 4R2JA 3RGWS 5ISMA 1XHFA 4RZSA 1JN0A 2ZPTX 4RV5A 3ZU4A 4TL8A 3IEUA 3KVVA 3O92A 4H4DA 1S8NA 5F4BA 1IWOA 1NNSA 2QV7A 3LFTA 3NTRA 1R0XA 1EFRD 2OV2A 1MAAA 3CSUA 1Q2UA 3O75A 3OFSA 4MUEA 4JB2A 1Y6FA 1GGKA 4LJ5A 4BNFA 2PT9A 4OHYA 2IZ7A 2LR0A 4MRMB 4PHTA 3RS4A 1MEOA 3FNFA 1PGOA 2WRZA 2WMYA 1GAXA 3ACBA 4Q1DA 4KHPB 2FPSA 1Y8CA 1YZKA 4IWYA 3ESRA 1LXCA 1UKCA 3OZVA 4HLNA 3ZNQA 5CA1A 2WU1A 1JKXA 3EB9A 4QYSA 8MHTA 2CLKB 1PUIA 2JCBA 4DQKA 3LUJA 5IKXA 3DKVA 1B43A 3V8NA 3U9LA 4KC0A 2GDJA 4DIEA 2V7VA 3OIGA 2OLKA 4NE7A 4X6XA 2WMNB 3EFOA 1GFZA 3MRTA 3QE9Y 2NQ8A 1RM4A 1YZLA 2PLWA 1ILEA 3OC0A 3ZZUA 5TGTA 1G6KA 1LNSA 3ZI7A 2A78A 4PG6A 3TLZA 2FQXA 2ZXUA 1XLTC 3GH3A 3I2JA 4HAOA 1AGRA 4JXZA 1COWA 2OEPA 3L8FA 4MP8A 4EKGA 1GFIA 4RF2A 1C14A 3FMGA 1GG9A 3HCEA 3MTDA 5K6AC 3UMRA 1ZSYA 1CZNA 1G5HA 4NCNA 1KZGB 1KARA 1MNAA 1RJDA 1VL2A 2RJ3A 4JJGA 4K6GA 4HHEA 1B76A 3E3NA 1G8HA 4MP6A 1KAHA 2W4QA 3RDPA 1Z2CA 4P8RA 2QVXX 4C21A 3OQBA 1H0SA 2G9UA 1CDZA 3AF4A 3P7MA 3W1WA 5K4GA 2PS0A 2BGKA 4M54A 3A05A 2JCYA 4KZPA 3WE7A 3OKCA 1BYIA 4KB5A 3WWEA 1SOVA 1UT5A 1OCEA 2QM3A 4BB9A 1NF2A 4LF7B 3JX9A 5KDDA 1UXIA 4CN8A 2GBIA 2KYRA 1JXQA 1SQFA 2PXCA 2XUDA 3I9FA 4FHDA 4ZREA 3ZGVA 1QJ4A 2ZUBA 3C6KA 3T4XA 1DC4A 3C16C 2BEJA 2NGRA 5TB5A 4ZVLA 3AW8A 3O83A 2AF4C 2M32A 3PNLA 3K8YA 2GK7A 3FI0A 3HABA 5TT0A 4I66A 1WAMA 2BBTA 2GLUA 4HGPA 1A9RA 4F5YA 5HKKD 1XFDA 2WV9A 2ORED 2X5JO 1SHZA 1ZUWA 4HQOA 5CNIA 5HZHA 2IY8A 1FNMA 2EP8A 4QASA 3A2NA 4JQCA 2G08A 1ILWA 1YJBA 3EXHC 2BFFB 3OTIA 1M6EX 1RYEA 1ZU5A 2TS1A 4D96A 3QEMA 2J5BA 4L4RA 3KB2A 3UWMA 1KE2A 3OKAA 4YJFA 5DHQA 1AKYA 3QHAA 4F1WA 1LBHA 3DPSA 3SEAA 2IW3A 1KR5A 3GVHA 1F4LA 1WCWA 3TJZA 2PGXA 3VOSA 4E6PA 1NW3A 4UBOA 3EZNA 5ARCA 1BDIA 4MVCA 2C5EA 3AHGA 1CX9B 1ZYUA 4GLFA 4KUHA 4LIPD 3K0AB 4Y6LA 2QB5A 3RWMB 3S1AB 1NQOA 3ZUGA 3ZWQA 2QMQA 2WR8A 4ZMRA 2ACEA 2JFWA 1QPZA 3N2LA 3ZGYA 3FDZB 3VHXA 1MO3A 1F2UA 1Y6RA 2AEEA 3PUWA 2AC7A 4DANA 4DSZA 4EPTA 2C97A 3SKVA 1CB7A 4RD2A 1BU5A 3ET5A 5CMLA 4BQRA 3CO0S 1K9SA 1BKYA 1J0XO 5H3HA 4LNHA 1OLXB 1WRBA 1XVTA 4B2IA 1LLFA 4R6XA 1HT3A 4C7JA 3I1YA 3EEIA 3RS5A 3VOAA 1RHRA 4EHIA 3DP9A 2LKCA 5CLHA 3GPLA 4CCYA 1TMGE 4DR1B 4N1AA 3R5TA 3AF1A 3V1KA 2XTNA 4EYEA 2A0KA 3EVZA 3GR6A 4NJEB 6NULA 5LQUA 2ARKA 4I4TA 3RNLA 5A4FS 1ZM7A 2IS2A 3FVRA 3N2GB 1SCBA 4MEJA 4C7MA 1JIIA 2XUHA 4UZEA 4WVFA 1Q6YA 4EMUA 4CV1A 5TQVA 3EN0A 4YO7A 1R5BA 2NAFA 4WW0A 2DBYA 3OJ0A 3OCXA 3MAAC 2IXAA 4FEGA 3MJFA 4KO1S 2ASVA 2WJZB 3CUWA 3HJTA 4M8NE 4Q1FA 2FQ1A 2VCYA 4HB0A 4AG5A 4A3SA 2CVPA 3MB8A 2WW8A 4JLUA 1B3RA 3DMYA 3HR7A 2GZDA 2NPIA 2V55B 4DYDA 4E0BA 3PA6A 1KFBB 4DM3A 4OXQA 3M9WA 1XRPA 3CHYA 2P6MA 3PTLA 5E38A 2JGFA 4E12A 2NSLA 5HE9A 3GJQA 2X0IA 1XU7A 3HP1A 3IOBA 3FIJA 3UH0A 1FSZA 2JIPA 5DBFA 1DJNA 3OUZA 4IEEA 2B1RA 4NS1A 2FLVA 1AS2A 1KQPA 1P5ZB 3H5WA 2B1JA 4CXMA 3ND5A 4PZCA 1JSLA 3D1JA 4WQMA 4BMZA 1XKXA 2QR5A 1JYFA 3MT9A 2JATA 5CA0A 1Z45A 1V5EA 2OL4A 3A0UA 4ND4A 4XZ3A 5KYUA 2AZDA 1SU8A 3PXCX 4R8MA 5JCZA 4LJ6A 2EZUA 5K0TA 1HKUA 3P9QA 4O3FA 1NBMA 2P4EA 2WDPA 4JR1A 4YJGB 4BNLA 4DKXA 4DV7B 3IO3A 4O2LA 4ZK2A 5CVCA 3U44B 3R40A 4IDOA 1XGKA 4UOZA 3CSSA 1V11A 4WFKA 5BW4A 5F12A 1OMOA 2R6CA 4IFTA 2UXCB 3AINA 4O4IB 4DV1B 4ASUD 1LRLA 4YCLA 1G66A 2CMHA 4EY5A 3C6MA 4R2HA 4EPXA 3TKYA 5AO9A 5KSWB 1Z3IX 2VUUA 1XAHA 2JAOA 2A1TR 2OG1A 3IP9A 4RHEA 2RB4A 3ZWAA 4CETA 1HZJA 3ZWDA 5T6MA 3MJSA 4B8WA 2VRBA 3AB7A 4WNIA 4PFQA 4ZCPA 2WT8A 3MXTA 4N8EA 2Q5LA 2XITA 4P31A 1J22A 4MVXA 3L6BA 2X1MA 3NWBA 3OQ6A 1U8TA 3QPWA 4GP7A 4HBZA 3ZNNA 4F60A 1MUUA 4HNUA 5M5BA 3I5XA 3BL6A 5FPKA 1QP0A 4AY2A 3K0KA 3M6FA 2ID9A 1XXHA 3K6SB 4GL2A 5CFMA 1O95C 3BA1A 1FL9A 3VR4D 1P5JA 1SHJA 3B1KA 2Y66A 2CYBA 2GO1A 5JSYA 2ERXA 3PKZA 4QFMA 1NLZA 4PZ0A 3LGAA 5KVSA 2D8MA 3ROFA 1EFHA 4NY1A 4DYHA 1WULS 3LDHA 3PQ3A 4CL0A 4YRSA 3IULA 5L3VA 4BLPA 2PT5A 2Y1CA 7REQA 4GOLD 1SCIA 3GMDA 4OJMX 1J70A 3W7AA 4J0HA 3IAXA 4X20B 5AKIA 4CMIA 4YMHA 3I0NA 2CHQA 3G2QA 3I6QA 1YF3A 1WETA 2XVXA 1DFGA 3CRW1 2PSDA 3QFHA 3DR5A 4CUZA 3A9WA 3OURA 2UUCB 1Y3DE 1QO0A 1HYBA 1N9GA 4HAXA 1KBZA 4O1HA 3VU1A 2F55A 1EQ2A 4ACBA 1Y9EA 2HR1A 3ANSA 4BU1A 4MKGA 1KOFA 4L4UA 1Z8NA 4XQGA 3RYCB 3KZMA 3TG2A 4R83A 1S2OA 4NMHA 3K1TA 1G4AE 3TI9A 3X1DA 5KMGB 3S4YA 2FZGA 1Q21A 3VC3A 1XQVA 1L1EA 1UP6A 2PR7A 3L0ZA 2HJ9A 2J5KA 4XRRA 4ZXPA 1SVIA 1RRGA 2BOVA 5IXYA 1Z18A 4R01A 4UARA 1F2TB 1M8PA 2WOJA 3D3WB 4DEYA 1VJ1A 5A4DA 4FFBB 1F9AA 2X4LA 5AJVB 2B6NA 3OBBA 5K3AA 1TM3E 4DUYB 2ZM5A 3U3JA 4JLVA 2L2QA 3G2JA 1T1RA 2BHNA 3E7XA 5DTQA 1U0SY 2YZMA 3HJAA 1JQEA 4G0QA 3ZOKA 4X92A 2OK8A 3ROPA 3D3KA 1NXSA 1JJAA 4WKNA 1P3Y1 3UV3A 5JNSA 2ZQYA 3CQ9A 3R41A 2G4VA 2QDXA 1WB5A 2I6TA 2PRIA 3KVNA 3MFQA 3JAKA 3UJ7A 1XL1A 3VQTA 4G1FA 2YIJA 3A10A 4O4HA 2OBLA 4IF4A 4KXMA 4H3KB 2PKQO 4IUBS 3E23A 2PUJA 3LCMA 4PO9A 4YRIA 5JANA 3WMFA 4DRXA 3KCQA 2G06A 1RCFA 3I9JA 4RK7A 1NJ2A 1O96A 1AUOA 3FCOA 3LVQE 5KCZA 5E0OA 1T1IA 3A1WA 5FOSA 5FQOA 1QFZA 2Y92A 1YC2A 2JJ1D 3DOEA 1SVOA 2OCBA 4KUEA 4Z9BA 3AL2A 3LZDA 4HRXA 4I4TB 1ZIDA 4NU8X 3F9RA 4G36A 2NZWA 3LY5A 1XI2A 1X86B 2G6TA 3NUZA 2QRHA 1Z17A 3CBQA 3PUJA 3IDZA 4IYJA 3UOAB 4OU4A 1YQQA 5JNRA 1FOEB 2WKSA 3H1GA 3N9IA 3KSDO 4DABA 1LLCA 4WBNB 2XCRB 1T3TA 2H48A 3VTFA 2FWAA 2DH6A 1RQGA 2PL1A 3ANTA 1TZCA 2QJWA 4GOJA 5D00A 3L0IB 3A0RB 1PP4A 3QOYA 3DB2A 1NY6A 2ZKIA 2L82A 5C52B 1MN6A 1WV1A 1FMTA 4DSAA 1XVIA 2BDUA 3MYRA 2FMTA 3SPXA 5BY2A 4IO0A 2QZ4A 3O9MA 3PGA1 4NYMQ 1NW6A 3G2NA 3CH7A 1R0CA 1GZDA 3M6AA 1IG0A 3OEED 4UNPA 3RC9A 2VBFA 4YPVA 5A7FA 4P3YA 1KYXA 1WCXA 8LDHA 1SQ6A 2QMUA 5GJCA 3X1KA 3DUWA 4MW6A 4RE5A 4F4HA 5L9AA 1JG4A 3FXAA 3AQIA 1I24A 4R9RA 1T34A 3I1FA 2DTDA 4DCVA 2V54A 3O82A 1LDBA 4BAUA 3W2TA 4YMTA 2JCXA 3K5HA 2CDBA 3AW9A 5ERGB 1X15A 3ROGA 1QDUA 3PPXA 2V3WA 4DKJA 3C74A 1Y8AA 3WK6A 1QVZA 4B74A 1E4EB 5FFFA 5L6MB 3ZU5A 3OZBA 4QLOA 3T3MB 3F7TA 4U2CA 1MV5A 4CIDA 2B1IA 4XWAA 1G9TA 1DXOA 2IBSA 2NSYA 4HS4A 1TMOA 5C9ZA 5JQGA 3UW3A 5KYYA 2XCSB 1XZMA 1E2DA 2PCJA 3B3QA 3P9NA 4HEA1 1TZMA 2OBNA 4LHVA 3VA7A 3FSRA 4UAJA 3HHPA 2XPCA 1VKHA 2FFAA 4KXFB 3T9AA 4DRZA 5KYXA 4WLVA 1PNOA 2MIIA 3QMVA 3U6BA 1T0PA 1Z7WA 4U2EA 2FK7A 3I6ZA 1WDTA 3RUDA 2FN8A 4A1OA 5TR9A 3L07A 4CFZA 1MB9A 4HLUC 3EQ9A 5GGYA 1E9DA 3TR6A 2ZWIA 2JNWA 3BMCA 4HDNB 1X7DA 2IRWA 3A36A 1KPHA 1Y5RA 3H6HA 3IXQA 3Q98A 3OPNA 2X0FA 1YE3A 2PXAA 1XRSB 1AXGA 1T4GA 1GGMA 1Z36A 3E1SA 4YJ2B 5BN4A 5JNTA 4JVNA 3DTVB 2QRQA 4QYWA 3U56A 1TFUA 3AUTA 1U02A 1KGDA 1RBZA 3EMDA 4MICA 2Z3ZA 3BQMB 4QPJC 4RVGA 2ZRCA 5FPPA 1J00A 3W90A 4RADA 4ALNA 4BKUA 3O8RA 3RBZA 2HXGA 1EUYA 4YDSA 4P3NA 3CZCA 4Y1GA 3JQ8A 4HAUA 3EUWA 4QREA 4RTMA 2UYHA 3K1ZA 4RHUA 4KVFA 3QEBZ 3VR6A 2DM6A 1TUIA 5FWXB 4AN0A 4YRMA 1G42A 1X8XA 2GCNA 4O2BF 3ZY4A 3BE4A 4M7RA 4DCCA 5DNYB 4LYFA 1SBYA 1QSGA 3KG2A 5AOBA 1A2KC 3LWZA 4O02B 3KZCA 3INGA 5B12A 2I8LA 3IL2A 4QYIB 2O48X 4RENA 4TGLA 3WGOA 2Y0DA 3ZE2B 4IIFA 5JFTA 3E58A 1F8XA 1GN8A 3V32A 3SSMA 2X7JA 3OOHA 3COZA 2JIZD 3W9UA 4GW3A 1ODLA 3E35A 2XT9A 1VE5A 2NVOA 1BEZA 2DT5A 2GETA 1PFVA 2FHPA 4OBXA 5ALQA 4HF7A 2H4YA 2OZLA 1YA4A 4LY0A 3MD9A 1V48A 1GU1A 1BHJA 2JHFA 3W7BA 3ABZA 2IOHA 4H15A 2OO3A 2R68A 3GJYA 1IBCA 4M8SA 4I8IA 5FUQA 4HH3C 1KXJA 1T8SA 3JQEA 3RASA 4EPWA 1X2EA 3CZ5A 3NP7A 3ZZ1A 3CLRC 4TLAA 5CVEA 2IHJA 1HYEA 4NCAA 1CUCA 3PL5A 4ER7A 3V4PB 2YX1A 3WHIA 3WRVA 4KR6A 3JQAA 5KIAA 1DBVO 2AJTA 1ADCA 4A23A 5KTMA 2HLPA 3IIIA 3DE4X 1SZCA 1LK7A 5AVXA 3EPHA 1YS1X 4QOJA 4CPDA 4Z2YA 4ZOQI 5KOIA 3NBKA 4I19A 1QCZA 2EKQA 2EKZA 1NFFA 1X38A 4NWIA 1NASA 4EENA 3JWPA 1NZFA 1RPNA 3PQ7A 2HU2A 2A9OA 2AOTA 3EXHA 4CQLA 3T5MA 5IG2A 3DEAA 3S68A 1AV6A 2V7TA 4TSRA 3GJ5A 1NMSA 3L9XA 2HSEA 3R3JA 4HWKA 2QYSA 1NVMB 1OXXK 4B34A 4FYVA 2DWPA 4PM4A 5AJUA 5LVAA 1L5FA 3TQFA 2H6EA 2W8ZA 4CTNA 1CUUA 3K0HA 4W63A 3R9XB 3DEJA 4YP5A 2H11A 1O9BA 4F06A 2AIRA 3QSYA 5NLLA 3M4JA 3UENA 3KJEA 1QVAA 2FCRA 4I4TF 2AZTA 4CV2A 5T41A 3X2FA 4LJ4A 5LFAA 4URHA 4HEQA 4R8LA 5TC4A 2OHGA 4E31A 5I7AA 4CV0A 2KSQA 4Y9DA 2PMEA 1M2GA 2H1RA 3LHKA 1V5IA 4PN7A 1OJ7A 4KEAA 1FFAA 3WIEA 3MA0A 3FYSA 5EGNA 1KO4A 4KFRA 2VSXA 4PZLA 1M2HA 4TKMA 2P4QA 4GWGA 1A97A 1E1CA 3H8SA 4JH0A 1M8GA 1Q0ZA 1KJYA 1ZN7A 1T3HA 1ZNWA 3A1CA 4CE6A 1ZEMA 2D06A 4OJQA 3GFBA 3I39X 3R7BA 5J47A 2GPWA 1CT9A 4WI1A 3WOVA 4ZI2A 2GN9A 1BWPA 3FR8A 5B6IA 5FL7D 1M1XB 2QVBA 3CNBA 1WDKA 1IDN1 4B4KA 4BJ1A 1F8UA 2JRLA 2YJNA 4CF4A 1IN7A 4OIFA 4MJLA 3A4YA 2IPMA 1KI4A 3M33A 4AYXA 4LI0A 4KPUA 5I4CA 3PFGA 3Q7PA 2E4YA 1X7ZA 3IE1A 3UAXA 2G9QA 4JUAA 1J2RA 1N5KA 3LYAA 4CU5A 3MJCA 4WLOA 4ZT6A 1QRUA 5L53A 4J16A 4Q4LA 1E59A 3PR3A 4J49A 5DW3A 4UXIA 2G40A 4BNJA 2GERA 3RU3A 2HQ1A 1TEXA 3AIKA 4FYWA 3NV7A 1OFVA 1QKIA 2WYHA 3VSAA 3AP2A 4JP2A 2YY7A 4NCHA 3UHPA 2IYAA 3IIJA 4GRDA 1CIJA 5JCJD 3GJ6A 4F38A 3U4HA 4Y6SA 3DXYA 1SUFA 3OP1A 4MHSA 1CUIA 1CHDA 3AKYA 1LZLA 1RFGE 4IIYA 2H2AA 4LQDA 1ANKA 3KWLA 3I9V6 2FVYA 2J7KA 3MGAA 4I8XA 3E7DA 1LDEA 4HTFB 3A1VA 5JU6A 3A6ZA 1ZIXA 2OZLB 2WU0A 1J06A 2XBUA 4G07A 5FFMA 1IBMB 1ODSA 3RI3A 4R2MA 1AKRA 1OA0A 3VDMA 4LCEA 3WNDA 1XDZA 4XDHA 1QCYA 2HNBA 1I4DD 1MC5A 4A26A 3ID6C 4BMOB 5AVZA 2AMLA 3PFKA 4QVIA 1LK5A 1GVHA 1N8SA 1YR9A 2ILTA 3WIBA 2C0QA 3Q3IA 1WP9A 4C1NA 2WVGA 1UIRA 3BBPA 1TYEB 3F6RA 1GRQA 4QVKA 5F4ZA 4QT0A 3I2GA 4OTZA 3FF4A 3RC1A 4RAOA 4OA8A 3CLUC 5BORA 5HRCA 1X3SA 2BJWA 3F4LA 3EGVA 3I1IA 3ZV7A 1E1KA 3AP3A 2PYDA 2OAGA 5AJXA 5DZSA 4RIHA 3CUUA 3M82A 4MVJH 1XJ0A 2XHEA 2XIQA 1MH1A 1QZ3A 2DFPA 3ZJYA 1B2RA 1U28C 1IN6A 3TI7A 1R4MB 3GP5A 3NJ4A 4ENWA 4RE6A 2VNHA 2BGIA 2ZRLA 4PAGA 3HH8A 3TIXB 3V8VA 4S1TA 4CM8B 3UJBA 3KAPA 3R3XA 4DEXA 1CZOA 5C8YF 4C3ZA 4MUAA 2GMWA 1HDRA 1IVSA 4AF8A 1F5SA 2FE4A 1JA9A 1TW2A 1KO7A 5ALMA 1GL3A 1VPTA 2J9YB 2W2KA 4MV3A 4YONB 4MCJA 3W5AA 5IAAA 4J07A 3PDWA 3FNBA 4BB6A 4MI3A 3PPYA 1QQBA 5ECYA 4GI5A 2NXWA 1UEXC 4UZFA 4JI1B 4KXQA 3UJAA 4BNXA 5FI1B 3I0ZA 2DBRA 2HA2A 1DEHA 2NTJA 3EOBI 2EBWA 2C04A 2BSXA 3ODPA 1HH4A 4AM8A 3MIZA 5CIQA 5LUBA 1VLMA 3UKJA 5EWJB 3E7PA 1KMQA 3KBOA 1JIVA 2C7PA 1NXTA 4MULA 3L8YA 2RJOA 4FDAA 5DDIP 4BX2A 1TA9A 3R5KA 3AHIA 1RI1A 5DYGA 3H5NA 2QMZA 4LNAA 1ISHA 3G3EA 4KPUB 1L7OA 1T0HB 4UDXX 2OXTA 1IWPB 5JBNA 1E2MA 3ABRB 5JAIA 2ZLBA 4BVFA 1I10A 4H3SA 2VSOA 4X3CA 1LSUA 4LBYA 3NHRA 1Q14A 1GCGA 3MBOA 3QKTA 3E7FA 4F86A 221PA 4EJSA 2GPBA 3AXSA 4HQRA 4N49A 3BWYA 1G7CA 3K73O 5EZYF 1F20A 2J3QA 1KEWA 2XOEA 3RTEA 1ISRA 3EY9A 3WKAA 5B3JC 3P26A 1K97A 3UUGA 2P9GA 1V9LA 3QTTA 1BGWA 1KETA 1RQLA 4B4UA 4J16C 1MX5A 4B48A 2PFSA 2ZZMA 3R24A 4QYMA 3L4EA 1DDIA 3FKJA 2ZYWX 3PA8A 5IW8A 2GM4A 2VI5A 2VP6A 1KZ6A 4XDGA 4BFUA 2RHDA 2YV2A 3KZ1E 4WZZA 1KFJB 2VWHA 1I7DA 1QHIA 3DB1A 3TZCA 3UHAA 4QUEA 3OZIA 1VIAA 4BTEA 1NKSA 4CCAA 4LXYA 4XM2A 5H59A 3G0CA 4FI3F 1UBSB 3KYDA 5DYYA 4JIMA 1ULAA 1SUAA 3HADA 5EZ6B 2C9BA 2KB0A 2O3RA 3V3KA 3N2KA 4V0ME 3FHLA 5EMNA 2QTAA 5JDCA 5LM3A 4PTYA 2ATVA 2HZ7A 4HMPA 4TV9F 1EAYA 1M66A 5DN9A 4ZHQA 4X1KB 3D4NA 2H31A 2ZPAA 1PDOA 1I5RA 3BHMA 4UE3S 2FWBA 1NULA 1XELA 2XY4A 4UCFA 3KD2A 1R9GA 1EUZA 5KOJB 4HUQA 4F93B 2C31A 3DO6A 4L5AA 4DRXB 3KK0A 4G9GA 4MDFA 5IN5A 1XWIA 1HRDA 1JMVA 3JQFA 2GZRA 5EXEA 1QP7A 4P3KA 1YFZA 5AXBA 5EA2A 5JXHA 2O8FB 1YVDA 3C5HA 1RLOA 4HJXA 1HZZA 1UKAA 2BR5A 4GEGA 4U8HA 3U4IA 4XVUA 1QF7A 2NUAB 4RU1A 4DFDA 5GGXA 2IH2A 1U3DA 1U7HA 3U4DA 3ECSA 2CLIB 1MR3F 3EBOA 2Y67A 4OREX 5LCXA 3CINA 4E22A 3RABA 3WYDA 4LK3A 3EE6A 2X1HA 1XD8A 2UUPA 3IPXA 2LCIA 4A5SA 4QUKA 4DTIA 1N33B 3SF0A 2JGKA 4XQEA 1P1IA 4LMPA 4I4LA 3IBYA 4RQTA 4Q9HA 2QVGA 1Q20A 1JMKC 4QT4A 4Z7NB 1DWOA 3HY6A 3ZWKA 3D3NA 4EA7A 4JYZA 1E2JA 2QSUA 2YRWA 1O89A 1OFGA 3MWDA 5FNVA 5C80A 4FTWA 3N6RA 2PIDA 3REOA 1IOVA 1HDEA 1OV6A 3ZKWA 1NQTA 4OI2A 2EX1A 1FTYA 1NUPA 3SG0A 2XYHA 2XWJI 3NRCA 1JWAB 2QN6A 1RRFA 1TADA 3H9CA 5KQLA 4LTNA 4OQZA 5HMLA 3M4ZA 2J08A 3QIAA 3UXHA 4NSNA 4RAQA 1G38A 1TW3A 2JAQA 2PT7A 3DLPX 5FADA 5AHWA 2FGKA 1JX6A 5TMPA 1M2WA 2PR2A 3J80A 2FJ0A 3AHJA 2B5WA 2CJXA 4G1EB 1OILA 4BLQA 4MKXA 3RYIB 4R41A 4DLAA 3SDSA 4B6FA 4K2AA 3TW8B 3TRFA 1HT0A 3VJMA 4CM3A 1MQ8B 2VTKA 1RXWA 1T2VA 4FW9A 4G37A 3KU1A 3C6YA 2XQIA 3OOSA 2E5WA 4IJUA 2PCLA 2W7TA 4NEGA 3D0KA 4HH4A 5BURA 4FE3A 3BMCB 4HDNA 1I6MA 3CR8A 4ZMSA 2Q7DA 1JWBB 1BCRB 3C7AA 1SKMA 2O8CA 5C46F 2CJYA 5EQJB 4HFJA 2ZJ3A 4F9FA 1EK6A 1NZDA 4I1OA 4D79A 2ZAIA 3W3AA 1ISPA 1TO1E 2IOFK 4L4ZA 1IY2A 1RWBA 4ND8B 4ZVNA 3UA3A 4RK1A 2FZWA 1CYEA 2QTVB 1YQUA 2F2TA 2PGJA 3A9TA 3GV0A 5D1NA 1FYEA 3RGGA 3C3KA 2R7KA 2BGGA 5AVQA 4FCWA 2EZ8A 2J07A 3ZHYA 3ZIUA 1V25A 4OHCA 1DB3A 1ZK1A 5ALTA 4BLOA 2OXFA 4I3FA 1GEEA 5AM3A 2FLWA 1SXHA 2HK7A 4TL6A 2XJ4A 4JEUA 2GPYA 3GPIA 4KGZA 4XCQA 4R2WA 1NDHA 4H17A 5EJ9A 5K0CA 2REQA 5AHXA 1AURA 1M34A 2F4VB 5I3ZA 4WZBA 1CWUA 4B3DA 1W0KD 3AC0A 2QRVB 2YRFA 3QSGA 4ZAXA 7REQB 4RHXA 4FNGA 4BS9A 1U3FA 4A8JC 1BN7A 4JELA 2Y71A 5G4LA 1SKAA 3GOHA 4WZAB 1ABFA 1VZ2A 3OICA 2CW5A 5ALUA 1UMBA 5KYWB 4OUKX 4X6YA 5CM9C 2QPTA 3N7TA 3T61A 4PVDA 3ZDFA 4HRAA 3CRVA 1K6IA 4DEVA 1O8CA 4RPHA 3RSHA 3O21A 4X63A 3ZLBA 1M2FA 4Y7CA 1OAKA 4CMCA 2GYVA 1AN9A 4XW2A 1U6IA 1E2NA 2I7CA 3T5GA 2Y6UA 5EIAA 1U1IA 3P0RA 1XOIA 1T36A 2RFLA 1T0UA 2V5VA 3DZGA 4JC0A 3EQZA 5EAIA 4EKYA 1NNEA 1BO6A 2ECOA 1XR3A 5J43A 2BELA 3GLGB 1F2DA 1TF2A 2BD0A 1QIGA 4J0GA 4GBED 4PQGA 4W82A 2QUJA 2HV8A 4AECA 4MMZB 3TLXA 4BUJA 1NKTA 5HF9A 4ZEOA 3ROTA 3D5QA 3OZUA 3E9MA 1KEVA 3DAFA 3RVQA 2I34A 2ONJA 2YZ7A 1IN4A 1TOAA 1I4TD 2PX5A 3MMXA 3H2GA 2VAWA 4RKEA 3RTAA 1LGYA 2K6GA 4UHCA 4ZP1A 5EKUA 2RH5A 1Z9BA 5BMOA 1RVV1 1D2NA 2WJYA 3EXG2 4NZNA 1QHXA 5SZIA 4EUKA 3N2YA 1YNSA 1BGXT 1C1DA 1OT5A 2PYZA 2XWSA 2H1LA 6REQB 1CUZA 3A37A 3PHCA 3ITEA 2ADFA 1VSTA 4BVJA 1NOKA 5KYUB 2EBHX 4K40A 5A06A 4DN6A 4LNUB 5JCXA 2P41A 4KRFA 3R5SA 3BC1A 2J3EA 4IMJB 3SBXA 2H2FA 4IQ4A 1NLFA 3OJOA 4QDOA 5J4VA 3VVLA 3HPRA 4TS1A 5LOVA 3SBEA 4LTDA 5K01A 2ZRIA 3E9YA 2PA3A 4CQMD 2ZAOA 1WPRA 1XDUA 3JAWB 3PSAA 3RSCA 1JHXA 2AX4A 2CLLB 4DBZA 1CP3A 4UVDA 2F43B 1YBHA 3CLHA 5DHAA 3W4IA 4LSGA 1FK8A 3WWPA 1FUIA 1I3MA 2AE2A 1SQ0A 1NLYA 1DUIA 1D6MA 1E9FA 3CCCA 4BN5A 2F3QA 2P2GA 4RCVA 2QN7A 5JS2A 3KPYA 4CKWB 3IA7A 1KNXA 4M0KA 2DU8A 4JI7B 1PK8A 3B7PA 3CXUA 1Y4DE 2A9RA 2VPPA 4BO7A 1KYTA 1SFRA 4CMEA 3D6FA 4E4YA 3WS7A 1IK6A 2HMSA 3E5HA 3QVUA 2FF5A 1L6RA 4C0AC 2HAEA 3G82C 3L5KA 3G8YA 3TCKA 3QUSA 2DPXA 1KH3A 2AXQA 2YW2A 3FFWA 2F59A 2A2ZA 4OBBA 3T3EA 3VFDA 1G5FA 2QRVA 4HMOA 2QF7A 5F78A 4XGIA 5TMBA 5ALNA 2P77A 3TSYA 3K09C 2V6MA 5TNXA 5K1ZA 1JB9A 3K2QA 1N8KA 4GSKA 3O3NB 5DM4A 1JHOA 2BYTA 3JQDA 3H99A 1WNTA 2ZJYA 3OT4A 2PKCA 3STXA 1Q0LA 2HUPA 2JBHA 4RC9A 5B58C 1ZJ4A 2C4UA 2X3YA 2FHSA 4DLUA 2J4DA 4U9HS 4LTMA 4KREA 4EDHA 4LMAA 5FRDA 2NACA 1A88A 2R6DA 4TVOA 4JP5A 3JR7A 4LF9B 1P0FA 2F7SA 4R2KA 3UOWA 1JFFA 4UJ5A 5JMTA 4OM7A 1H05A 1T6YA 1OKKA 3A9VA 3L41A 1FUYB 4GICA 4JDPA 1OH7A 2Q9UA 3FUUA 2CDRA 1DO0A 1PR9A 1RJGA 1Y1LA 4H31A 4DILA 4PICA 2HIMA 4RV4A 3HDHA 4HDCA 2O2CA 4IDAA 5E6SA 3NASA 3P2KA 3VJKA 4EOGA 4Z8XA 3OQNA 4LPKA 2PIAA 1TQHA 1MO6A 1XLTA 2BEKA 2FOLA 5AKJA 4N7JA 5AQEA 2H1HA 2Y93A 2HNKA 3IIMA 2NVBA 2A5YB 1L4GA 2UYYA 1PV1A 1PBTA 2X15A 2AHRA 2VAVA 3GGCA 4TMFA 4EW6A 5A0VA 4NBNA 3CZPA 1DXHA 4QDTA 1J20A 1PJ8A 2IQ5A 4LE0A 4LI3X 3IV7A 5AKYA 5HK9A 2OV8A 3CLUD 1QE3A 2SCUA 2XMGA 2WB2A 4ESHA 1FW6A 3AFIA 1JR2A 4YJFB 3ICEA 1XMIA 2P9CA 4KDFA 3FTEA 3TLKA 1C1YA 1V6AA 3VAYA 4WCDA 2Z08A 2ZRKA 1WO8A 3O4RA 3MMNA 5JPDA 2H5EA 3H7AA 1P7WA 3WZ2A 3QXHA 5F5XA 4ENUA 2J7PA 1KSFX 3FPCA 4J1TA 4G0MA 5FOQA 1DAEA 1NNLA 2IW1A 3AVTA 4IY1A 2ADOA 1B23P 3C6ZA 1SOAA 3IRUA 2A5LA 1WCIB 4G01B 4L8FA 5A9TA 3T1TA 1U1EA 4WJZA 3FOEC 1YK0A 1YA6A 3EQ8A 1PT6A 3IQGX 3KOXA 1WMEA 2O52A 4FILA 1QH8A 4ZQFA 4YRNA 4WZBB 3VKVA 1CDEA 3UWPA 1A8UA 2CZGA 2REQB 2ASEA 4AJPA 4RW0A 2X3UA 4TVBA 3K35A 1IZ8A 3MTQA 2PLNA 3MT8A 3P2MA 4R9UC 5BQPA 3TS1A 1RPJA 1VSVA 2PEYA 1VOTA 3NOXA 4OQQA 3SYTA 1KRXA 3GT3A 3M6UA 1CHNA 2ZUCA 3SS8A 1LCIA 3CT4A 4NBKA 4B6GA 1K7YA 1A1VA 1FU7A 1VB3A 4TMVA 4CW7A 4M1KA 4G1BA 3AKCA 4PRZA 3V1NA 1VGRA 3J81k 3KP1A 3LUKA 4IFIA 2LKDA 2LIPA 3KTOA 1SXJC 4TSFA 2H0AA 4XWOA 3QJYA 4S2UA 1D5WA 5DHSA 4ZA2A 2JBWA 2XD9A 5AT1A 1UZNA 5AXAA 4TTAA 2NUAA 2ZR8A 3SR4A 2V7EA 1TAGA 5CH3A 1Q2XA 1L7RA 3JRXA 3S28A 3KT0A 5L7TA 2VA9A 1C9MA 1AQNA 3DT8A 1GPUA 2EFEB 5DBGA 4MQLA 1H3EA 4JLOA 3RUCA 5T8KA 3JVVA 1X7YA 1XYGA 2WJWA 3COWA 3HJCA 3MINA 3NCHA 1KOLA 3VO9A 5B7GA 4Q01A 4RTOA 3JQPA 2AI2A 2PSFA 4JXJA 4P35A 3OX4A 4HMQA 4TS3A 1U63A 2O8DB 1X80A 5IYZF 2PKQP 4IKOA 4ZCRA 4W5OA 3MSCA 4QTTB 4LYHA 1T0BA 4QPNA 1P1RA 3B13B 1TAHA 3KD3A 4QBKA 5DNAA 3LGXA 1W8DA 3DMDA 3JQRA 3IR5A 3WHLA 4Q3CA 5TIIA 2GARA 3P4XA 5B64A 2WZQA 1Y9ZA 2C5GA 3F1LA 4D02A 3C6XA 3ZD6A 1MW8X 3VH4A 2EEZA 5CDYA 1EFCA 1Z5GA 2RBEA 1Y6QA 1VDZA 3FMIA 3AZPA 1IHYA 3BXPA 3ELWA 4ZHQB 5AVTA 2FMHA 2PS9A 4MJ7A 1PG5A 2OM2A 4YR9A 2O0MA 2VF8A 2A6PA 1YJCA 3B1ZA 3RKRA 2TSYB 3DNMA 1SU4A 2QRNA 2ORYA 5LMNB 4K87A 1AE1A 2XZPA 1J97A 4HX5A 4LRXA 1U4SA 2QGNA 5EE1A 3NIBA 1C9DB 3C3EA 3RK4A 4YCDA 2V7QA 4F2PA 3K92A 4PO1A 5HCNA 4EF4A 2VHYA 4BO5A 4AY6A 2P6PA 4OYHA 1SZDA 3MOSA 3KEGA 1XZEA 2EHJA 2B4RO 1ZRMA 3ZBQA 1VKZA 2TECE 3NOVA 5FI3A 5JDCC 1ZESA 4L08A 4MRNA 4W6ZA 2VUHB 2RD2A 1WF3A 2YJ5A 1PZHA 2YOFA 3ELDA 3PD7A 3PJDA 4DB2A 1Q17A 2Q50A 5C32A 4B4WA 3HKDA 4QFDA 3DAYA 1C7JA 3QU7A 4CEHA 4LWPA 5JG7A 4FLFA 2EV9A 3R5JA 1RRKA 3DFZA 2HEIA 2XGMA 1KI2A 4MRMA 821PA 4NAVA 3DMNA 3LM8A 4MQ6A 1YK1A 2NUTA 4FC6A 4GH5A 3CRRA 1RKQA 4IDFA 2IYOA 1X1DA 2QVZX 3HP4A 3RADC 2IYLD 4LF8B 4ETNA 5E9AA 1JIKA 1PYOA 2VIIA 3F3SA 1AK1A 1GRVA 3V2UA 5C3MA 1PR2A 4TTTS 5CD9A 3HU1A 4EKIA 1RLMA 4YWHA 5ITSA 1L7PA 4U7GA 3A26A 1DX4A 1GUZA 4TLCA 2YHBA 5I9SA 3ELYA 5FUBA 3ICPA 3MEQA 4WCFA 3DDHA 4BFYA 1W4AA 3BHIA 2FPUA 2W2XA 4UZSA 3UXYA 5GINE 3H18A 1SOUA 3W06A 2JK0A 3RS8A 5K6TA 3OEYA 3MRXA 1YJQA 2F3PA 4OLAA 1R0ZA 4NZZA 3FTPA 2AMVA 4U00A 1QFYA 4BAZA 3CLRD 2A9QA 3I4CA 5EEHA 2Q4OA 4U8GA 2I6FA 2HFKA 1UBHS 2B7CA 2QTZA 3AL3A 3DDOA 3EHDA 3OM8A 4YJ3F 5E3JA 4AXXA 3HTXA 4ZXFA 1BOOA 2RI6A 4D41A 2KS6A 1M0EA 3LNCA 3NANA 1UJMA 1EKXA 1FPMA 2XT0A 1Z68A 5LP6B 5GADl 1WL8A 1XZGA 1JJIA 2OV6A 2EQBA 2YN2A 3OFKA 3B70A 1YRQA 2QMHA 3M4XA 3WVNA 3ZV3A 4IMIB 4WOJA 1D7OA 3RRXA 4A0FA 3Q8WA 5ALEA 4M8IA 3ZDYB 1NW4A 3CPEA 3KLMX 4UVIA 2WTAA 1TIBA 2B20A 2FI1A 1XA0A 2G7MC 4IZHA 4XTRA 3CEHA 5LC1A 3ENVA 3L8HA 4R8KA 4N48A 2GS9A 3GU3A 3ZXIA 3NKFA 4FM9A 1S5PA 4I1VA 3SC4A 2CNDA 3DHNA 4R31A 4IQ0A 4DMCA 2BEWA 1PS9A 2QNRA 3DTTA 3QFCA 1JHPA 2RH9B 7GPBA 1U2EA 1W1WA 4A16A 2OFWA 5EE5B 4F6RB 3ZNPA 3E1GA 4M0DA 5KYXB 3BSYA 3OZRA 4C05A 2I99A 2B9VA 5CLGA 2FVXA 1VHQA 1QLWA 4RJKA 4WK4B 4FCCA 3C6BA 1K9VF 1E0JA 4L5JA 3H8VA 2WSMA 2XCOA 4G5GA 3WXBA 5KNBD 1H2HA 3C3WA 1ZCZA 2O2XA 3IVRA 3L82B 3NRBA 4LV6A 4ACAA 4F7WA 5FAKA 4RTKA 1ZMXA 4PO3X 4IHJA 3COVA 3RYFB 4Q21A 3AWIA 4FX5A 2HB6A 2JC3A 3VU0A 4CEJB 3RSGA 4BQPA 4MQUA 2BFMA 2X8WA 2IV3A 4IIJF 1SC4A 4Y6QA 3GAFA 5ITVA 3NT4A 4Y0NA 2J30A 2LCFA 3LQ2A 5D3KA 1G8FA 2AS0A 4P4NA 2D62A 4P93A 5HTKA 4D0SA 1M1YB 2PZFA 3C43A 3EZXA 3P0JA 1P2DA 1HMPA 1P6QA 3HGMA 4AY3A 4EQZA 1PF7E 2N1BA 5FWDA 4ZJUA 1NFQA 3G02A 4N5HX 5IXJA 3V7WA 3DBHA 5D7NA 4KQHA 3DLBA 3OZXA 5BUSA 2QXTA 4P7FA 1JE1A 3F4BA 3HR4A 1FVHA 1G0OA 4OQEA 2WM8A 1T26A 5G0UA 1DKMA 2C2GA 2H9AA 1VHJA 2Z5FA 3BRWA 4MLCA 4WECA 3WGGA 5LQAA 1XP5A 3U09A 1P2VA 10MHA 5AXCA 3NORA 4UOQA 4RA9A 4ZV4A 4P81A 4W5WA 4EI7A 2PWYA 3UCEA 2C29D 4PZUA 3UWKA 4KFTA 1R6XA 1E2IA 2V5UA 3GUHA 3SCZA 1L5VA 3ZHZA 3K5WA 3CVJA 5REQA 1NRIA 3E9RA 5AICA 1QAOA 5JQGF 2QJFA 3TCXB 1L4BA 2HSDA 3GGOA 4FYJA 4W1PA 3QTLA 1FX0B 5AI8A 1DIHA 4KGXA 1W5TA 3KVRA 4Q4HB 2FP4B 3E84A 2GAIA 3V8EA 4OQLA 2MYPA 4BVLA 1E6UA 4C4ZA 3NBFA 4OX9Y 5IBPA 1AV7A 4KIUA 1BJRE 5K3DA 2QUIA 4A8TA 1B8NA 4JJ4A 3LLUA 1N6OA 3WIOA 1FYDA 3E2IA 4GI2A 1CU1A 4TXLA 1VI2A 2NLOA 2QKYA 2WWWA 3PXGA 4YAWA 1XAGA 2FKAA 2PN1A 4RDXA 1LPBB 2B8EA 5I6DA 2QP4A 5JSZB 3PC2A 1TAQA 2VQSA 1AZLA 3TTYA 3WV5A 1RYZA 5JQGB 4NJMA 3QPAA 1XN1A 1IN1A 2H7CA 2QTTA 5DOZA 3LFUA 3REFA 3RS3A 3C85A 3ZY3A 5KUTA 1UJ5A 1DKRA 1QMPA 1A9OA 1FFWA 3MJEA 4MB0A 2RGAA 1G60A 2RAUA 1Q77A 2Q21A 2QUHA 4FZVA 2H54A 3UJDA 5D5HA 4NV0A 5EWMB 2IXBA 1AHNA 3WB2A 5KNDH 4NIMA 3RYHB 3HV2A 1A76A 3DA8A 3I5AA 3VJLA 4JNCA 3B8HA 4KPEC 1IB0A 2O7NA 4C0LA 3I9OA 3MAGA 1CZKA 5AVUA 4CEHB 1VJ5A 4G4GA 5H5JA 1SVKA 1WCIA 3I4LA 1RKUA 2PKRA 4QXOA 3U26A 2CF5A 4P0TA 4MRAA 1N2CE 2N9UA 4FDUA 5JATA 2HREA 1S7GA 1NVWQ 3LL7A 4JUFA 3SHWA 1M6NA 4KSBA 1I6LA 2XJ9A 4A2PA 4HVTA 2C7QA 1BFDA 3DBRB 1DLIA 3UG7A 3USES 3NIFB 3JQ9C 1U28A 1QHGA 4UE6A 4EFLA 3ZXXA 4B6RA 4ROTA 4DUPA 4RMJA 2FEKA 2WWRA 1JDSA 3QKSA 3B9QA 1V3VA 1YJXA 3MJVA 1MENA 2EW1A 5I9NA 2OP0A 5CCBA 3LC2O 4H3VA 1P2UA 4ZRDA 2F8MA 2JFBA 2JKZA 2QLFA 3ITDA 5AVWA 1S8FA 3IBFA 2OHFA 4UCWA 3A3YA 3DE3X 3RANA 3LTNC 3FCXA 3CLKA 2QIPA 4P22A 1FFXA 4D9FA 2OYRA 2ZIXB 5E95A 2QTCA 4NH4A 3O6VA 3V5NA 5JHGB 2IPAB 1WBDA 4YJDA 3TQRA 3THYB 3C98A 4EFMA 5JE8A 1ZNQO 4IAOA 3F7OA 4ZVTA 1REQA 3CRNA 3D8SA 5A2QA 2GSWA 1JI3A 3MIIA 4ED9A 2CCJA 5JWOA 1C2YA 4F2DA 4RLFA 3NT2A 2WIDA 4WFIA 5TQ0A 5ADVA 1M5RA 5HG0A 4GOMD 1BS1A 1HX7A 1OWMA 5D86A 5IJ9A 3SAJA 1Y1TA 1H6BA 4M0FA 3E2PA 2CFCA 1CUXA 2I66A 1TMYA 3OT1B 5E2AA 4V1CI 1XQ9A 4K9SA 4Y8VA 4FGWA 5LQSA 5SYNA 2FZLA 3RSLA 2VZ9A 3KUUA 3LYHA 3OO1A 1JEDA 3KUKA 1CFJA 2BGMA 1JBEA 1Z4IA 1USGA 2H17A 1JDBB 3NBAA 4ZEVA 3ANNA 5C1DA 4HRVA 2QI9C 3SS9X 2AXNA 3VU3A 3PGXA 2X4GA 5DTJA 1HY3A 2GSDA 3M4YA 4B6PA 4AI6A 2VCHA 2ODAA 1GGVA 2ZI4A 3I53A 4CFYA 1XG5A 5IABA 2WY2D 3TRKA 4JDUA 1BJTA 3ONVA 1GKYA 1RYFA 3L1VA 1XAJA 4G1UC 2C42A 1DOAA 1JEQA 1XQ1A 3ZCVA 1G8JA 3CLVA 1F1JA 4U6QA 3VZRA 1BE1A 3D6HA 3OX1A 1CF4A 3RYCA 3GD7A 1T5TA 3PXBA 1GFSA 5CU7A 2HJVA 3CLTD 3EISA 2GTIA 2MYUA 4LYEA 5A04A 4R54A 1DMRA 4HDAA 5JXJA 1ZIYA 2AWNA 2J9RA 4L4XA 4W7HA 3ORSA 2UYCA 3DMGA 4B7UA 1NC1A 3ZQ6A 1U8FO 1YZVA 2QR2A 1UWKA 2ZIEA 3KKKA 3GLHA 3IBCA 4E03A 5DOVA 4Y9SA 1DRVA 2CB0A 2IZ1A 2O6LA 2X2EA 3T4EA 2XE6A 2X0JA 2O50A 3BFKA 4GOKA 4E6EA 4G25A 1KHHA 3EIEA 5LJLA 3R0XA 1E2BA 1DTWA 3IV6A 1TZKA 1YGPA 4GI7A 1IQUA 2JD2A 1BDHA 4NMLA 2UZ4A 1QGUB 3H2KA 3LV8A 3S7ZA 2JASA 4X85A 5JS6A 3CF6R 3AVXA 2O19A 5TSDA 2BUCA 1UXHA 1UBMS 3UAWA 4EHBA 3L7MA 1Q57A 3HCWA 2JGEA 5LIPA 2QUAA 1DOHA 1WA5A 3SM3A 3SY8A 1WOYA 3Q8XB 2XXBA 1ZVKA 4OB7A 4CMIB 2CD7A 4EHKA 5A9SA 5K5EA 3CE6A 2UVQA 3F73A 2PX4A 1TYAE 1C3JA 3VVBA 5IKEA 3LX4A 5CG2A 3FPAA 3H2HA 5EHNA 5K3FB 3TXYA 1L7NA 1G5PA 4ZTUB 1EFRA 2Y1XA 3PPWA 3ZU3A 3I01A 1G2OA 2J0SA 2ZR0A 2R6ZA 3O4IA 4GSYA 5DHTA 3RYIA 1Q7GA 3KIPA 4D8XA 3HKEB 1GA4A 2VOJA 4NONA 1D8TA 2OD2A 4OYRA 3DE0X 2XCTB 1HNNA 1Z73A 1V35A 2JGMA 2O8EA 1HE4A 5A05A 2MOKA 1Z33A 1K89A 5L3RA 5KOJA 4LECA 3BJMA 1FUUA 4WXMA 4OP1A 1W19A 1CE8B 5IJ0B 621PA 3ENQA 5IM4A 4IKEA 2XGOA 3V4FA 1QONA 4Q4JA 2GO7A 1K6MA 1KO5A 4XLLA 4F71A 1C2TA 3KETA 2GJ9A 3P0EA 2YJ6A 5IUKC 4JI5B 4D74A 3DZHA 1E2GA 4PZYA 3B3JA 1CKEA 1A5AB 1LSJA 2V3VA 1VLJA 3O84A 4XLTA 3EZ7A 3Q6IA 4R51A 3MT0A 4Z4GA 1RIFA 4A2QA 3OWXA 1SIUA 3FYDA 2RHLA 1G3RA 2VN8A 2JJ1A 1Y8RA 2AG6A 5CVVA 4P9NA 4LRYA 4EKEA 2BMVA 2PRSA 4RD1A 3MPUA 4FC7A 1Y8RB 4H7KA 3DOIA 1OFUA 1MF7A 4YTEA 3V9PA 2PKEA 4Q4CA 2BTQA 3LC1O 3NM6B 3PEUA 4A6PA 3ESCA 1VQ1A 1FJ2A 1AKUA 3DCIA 1C3OB 2UVPA 3QF4B 1OREA 3FR7A 4BNVA 2VAXA 2AW5A 3BMNA 3D2AA 1ZUNA 3ZJ5A 2IT1A 1E1QA 1ZISA 1RP7A 3IAS1 4CKBA 1JFVA 3TOSA 2W6ZA 4ZV9A 1IWBB 2J9XB 3ZDDA 1BE6A 4JJIA 1KYZA 4TL9A 2B82A 3RTGA 2XVZA 4OAQA 4PU0A 1YL5A 2Y4OA 3RH0A 4N82A 5EWMA 2BZSA 1KK1A 1DDOA 2PDAA 1RRMA 4F5ZA 3BDVA 2G72A 5IRCD 3IAM6 1Z37A 4MVJA 2NUPB 1MO2A 2QPOA 3FAZA 3QX7A 4REQA 4BV9A 4C0WA 1PFGA 3D3JA 3TIIA 3MRVA 4GM0A 2VH2A 1WCV1 2F1OA 3FKQA 3KE9A 4FYXA 3S0JA 1WF6A 4G67A 3VZPA 3PC8C 1YFKA 5KKAA 3JYPA 1SKUA 2AV6A 1JJBA 3HJNA 4QOIA 1JFTA 3PQFA 2EU8A 2WYWA 3OWOA 1O58A 3UJ3X 4E13A 2HLNA 2V97A 1FS6A 1EWYA 4EO4A 4NCBA 2V74B 2WLTA 1NI4B 2O8CB 2RGXA 3STVA 2VBIA 1SWVA 4BO2A 2PLAA 3I61A 2A92A 4OMDA 3MWDB 1R6UA 2W2QA 1PEKE 1OVMA 1ODIA 4Q48A 4QDKA 1NMZA 5JEDA 1VJRA 5P8WA 4YUWA 1W4CA 3BIWA 5G3ZA 3RS7A 3WWOA 1JGTA 2OK7A 4UQOA 4UPEA 5D87A 4FMCB 2GYYA 3W5VA 3C1UA 3QOXA 4GWLA 4GKAA 2H2DA 3OPXA 3GUYA 3UMBA 3Q8LA 1PS8A 3AR8A 1Z06A 2E3JA 3F96A 3BCRA 2HSWA 3MCZA 5INTA 3ONNA 4S12A 3ZWNA 4YCNA 1N0UA 2O5RA 2VK2A 5JTUA 1V0JA 4L8YA 4DJ5X 2W4IA 4XFDA 5JZ9A 3A2MA 2ZJ7A 4FFDA 1Y7LA 4XOIA 5LJIA 1NXVA 1UR5A 3GIDA 3JQ7B 4J29A 1QHSA 1S8AA 4YDHB 3WYBA 4RFVA 3CPSA 4Z4QA 2C8KA 1TCVA 3O8QB 1K7EB 4HVAA 3VR0A 8OHMA 1XJCA 4BO1A 3JTMA 5K8IA 1XX6A 2YV5A 3U9TA 3ZHCA 4F84A 3DTYA 2VBCA 1XVUA 4G85A 3GJRA 1ZINA 1V2GA 4TT3D 3NNDA 1A5BB 4G4IA 4MV9A 4OEHA 3V7UA 4ON9A 1PSWA 4PS1A 2TMDA 1WUKS 4G0YA 4REMA 3FYHA 1WHTB 3WSTA 3QVMA 2YQ4A 4XIIA 3KQHA 1KJ9A 5DEOA 3LO8A 2AR0A 1XF9A 1JAYA 4NTZA 4NENA 2DLDA 5FUMA 4MW5A 3GRAA 4G1MB 1YNOA 3R6GA 4R2XA 5A6SA 1YRYE 2BW0A 2W6OA 3UTDA 2G8LA 3H84A 3BWMA 4IGKA 5TEVA 1BQ4A 4HWOA 3RRZA 4AO6A 3SKYA 3WGMA 3S44A 1WG8A 4R6WA 3B1VA 2X8JA 1XEAA 3GNSA 3HA3A 2CMDA 3JALA 3L8CA 3GPDG 4J7AA 4QUBA 3SDZA 2HGZA 2QUBA 1GQSA 4MQFB 5IF3A 1ZLYA 2NTVA 1EINA 4TUYB 3QE3A 5EVCA 5CYOA 4C2UA 4CDRA 4IZOA 3VR3A 4Z1MD 4Q4HA 2CXUA 4AJHA 1YBFA 1LA2A 3GZNA 1E2LA 3AYXB 1CPYA 4RZ3A 3VSEA 1FA9A 3DAPA 1Z5VA 4L4YA 4JU8A 4YJHB 2I6XA 1WKCA 1ONPA 3E9NA 3MWJA 4L75A 5HGJA 3TEFA 1UJNA 4ZYVA 3E5MA 4ZGGA 1J9EA 2HK8A 2ZIXA 2G1AA 2AMYA 4RA6A 2JHCA 1U4NA 1WMFA 3GEPA 1T8UA 2OUIA 4GM4A 1XQYA 3TM5A 5KOHB 1R9JA 3TD9A 1LC0A 3D0QA 1EESA 4LDRA 2F1RA 3LQ4A 3WLQA 4ENRA 1H2XA 3N8IA 2I2WA 4TUYF 2VDUE 1X1AA 2XZTA 4OKNA 1G4HA 4OM8A 1Y3IA 2PBFA 3NH9A 5F2EA 2QGFA 5F1OA 4XGRA 4DA9A 3H65A 3T5CA 4MUHA 1YASA 2R5WA 2P3OA 4HDSB 2FSIA 2OGZA 4K6KA 2HSZA 2VKQA 4MR8B 3R7WA 2QQFA 4GF5A 1GPJA 3TE7A 4QA9A 4LWOA 4NICA 1GL6A 4S35A 4D3XA 2CB9A 4ZT5A 1K4YA 2OM6A 4H4EA 1PWHA 1ZLXA 4BEBA 5EJ2A 1E1RA 3LHIA 4MW1A 4P5PA 1O95A 1YL7A 4KACA 4J2OA 4W5HA 4JI2B 1UAYA 5BVHA 3KEQA 5ARDA 2C9MA 4HWPA 1N0VC 2ID7A 4L27A 1UXKA 1QO7A 4B45A 3EXHB 1TD9A 4ZN6A 3AHCA 1BW9A 3ZLUA 3N7UA 2DR2A 5AVOA 1ORTA 3L9WA 2OKGA 3CZMA 2O8BA 2ZTUA 4GWKA 1U2GA 1PD0A 4J0CA 2A9FA 5BN3B 1UUFA 2QT9A 3SX2A 1N6LA 2VH5R 3ZWXA 2XA9A 4YAFA 4YI3A 3UIEA 1AMNA 3I45A 3KQPA 5H3CA 3ULKA 3MGGA 2HBZA 5HDQA 3ZWMA 1Z8HA 5JXWA 1NI3A 5JI3E 1HFKA 4DNFA 2MHCA 2FRXA 3TX6A 2IHYA 3DZJA 4QELA 2E4ZA 1A4UA 4KU4A 3BTSA 1TT5A 4MWCA 3GCGA 3EEYA 5EKXA 3VH1A 1TU0A 3TE6A 4F4JA 3DZ8A 4IHJB 1IQRA 1AXEA 4FE4A 3EDRA 4CLOA 3WGIA 1ZIOA 3HRIA 4XYGA 1KVUA 5HXAA 3A4VA 2I1QA 3GLIA 1S2NA 2G07A 1DHRA 3RVRA 4BRZA 4F21A 2CD9A 2JGDA 1L7XA 3VAZA 5HOEA 2ZBFA 1LS6A 1Y6JA 2IHVA 1OZHA 2V7XA 2QG6A 1DGQA 2GRAA 4CM8A 2JGDB 2EW8A 4P2GA 3VSDA 3IJPA 5AVRA 1C30B 5JNLA 1RJ9A 4Q16A 4BLTA 2C92A 1H6CA 2HRBA 4RZ2A 2DUMA 3N2EA 2X0DA 1OXUA 2CXNA 3PX7A 4KDRA 3PFHA 4E08A 3QOWA 1N6NA 2DE0X 3CX4A 4L16A 3DOFA 1LD3A 4D3YA 1DBPA 3KNZA 4U9IS 2WZBA 1K8YB 3K1JA 4YAUA 1V96A 1JG3A 2V96A 3IUJA 3UT0A 3KT8A 3U49A 4WNAA 1KMMA 4AKTA 5ALRA 3DWFA 3GX1A 4IOJA 3AJDA 4RA6B 3RUHA 4V02A 5FA6A 4KAJA 3N76A 4LZPA 4QJ4A 1QNFA 1L5LA 4XSGA 2I87A 3D8HA 1B6SA 1QK3A 1TZJA 3K94A 3NTXA 5EEGA 3RRMA 2CLHB 3AO0B 4B17A 1CR2A 4W8GA 5F1YA 3O1LA 5DK6A 5KTNA 3R0VA 2E21A 3LQKA 3ZKAA 1OFHA 3K15A 3U7QB 5M3BA 1FVFA 4F8YA 1ORWA 5CBPA 1GAEO 2C78A 1GUFA 4BO6A 5C8XA 3EFEA 4NK4A 2JAUA 4S1NA 2ONKA 4PRYA 1GPAA 3IQHX 5C81A 3CZRA 3IEKA 4PSCA 5FBHA 1IHOA 4CKZA 3P9IA 1PVVA 2WV7A 3DD5A 3H19A 5BWCA 1RBQA 3H4MA 1VJGA 3N0RA 1PKXA 2R96A 4JZKA 2WD9A 3ZW9A 2VDLB 3RVJA 3SHQA 4D26A 1L4YA 1R9NA 3GLRA 1W75A 3T1NA 2FFBA 3AF5A 4RSRA 5AOAA 5KAPA 5TPWB 1ENZA 4DCSA 5EIEA 5DLQC 3FJOA 3GFVA 5AWFC 2VHUA 3RSSA 4BYMA 5DNDA 2B0CA 4DPMA 3NR2A 5F9FA 2WWIA 2IP2A 4QDJA 4L5IA 2AXPA 4KRGA 2JFXA 3PEFA 1O97D 3PYLA 3HA7A 1FTGA 2ECKA 2GYWA 2NUTB 2ZETA 2BFCB 4FCVA 4UQLA 1ODFA 1BSVA 2H3HA 1P9NA 2C4HA 2XUIA 3NHBA 1V9SA 1AD2A 2OAQ1 3D4BA 3A25A 1Q0QA 1TJ3A 3B51X 3IHTA 4HLUA 3VPGA 5DMXA 2VNKA 1Z2NX 3PUXA 4BVHA 1G64A 4KO8A 4JYPA 4J9UE 2LRHA 3IDSA 3P71T 1RI3A 3LOQA 1SQ5A 1HOXA 4YCAA 1U4OA 2YFKA 1R64A 2RDMA 1BXRB 4I50B 1ELOA 4OKIA 1WKBA 4MR9A 3KYIB 1RWOA 2OCPA 4DZTA 1KFKB 3IMEA 3TLCA 3ZV4A 3GT7A 1KI6A 2HCFA 5G2OA 1D1PA 1YKGA 3K32A 3O4HA 5BO5A 3IE0A 3UXMA 4CR6A 4BQFA 4MUKA 5PGMA 3LSYA 4KXYA 3WRYA 3W5BA 4EA8A 1N77A 1NWCA 2ETXA 3ZTTA 1OH6A 2FJPA 3IKJA 3AVQA 3LECA 1E60A 4NOMA 3SR0A 2GZMA 3MZ0A 1Z25A 4DG9A 2CXRA 4TYMA 1XTTA 1QHYA 4PAQA 1SK9A 1EUCA 3HVHA 1RADA 3K0BA 5HYVA 4WKOA 2JJ2A 3T5PA 4PLWA 3FNHA 3JV7A 4G1CA 4CHGA 2A67A 2BL4A 2QMEA 1MC4A 2ZYAA 1T5BA 3GW8A 4RANA 1U8EA 4JLMA 1DXYA 3WLHA 1X8LA 3ZK9A 1JQ5A 1WPXA 1OIWA 1H0RA 4O0LA 2D0IA 2FYTA 4TRRA 1D5CA 1RKVA 4WINA 5TF4A 4Z7QB 2TRSB 2YL2A 3L8MA 4AUNA 2VSNA 2OE2A 4UDYX 4WKBA 1IIBA 3SOPA 3B9BA 3UK7A 1EU1A 3NC1C 4FMDF 3KR2A 5TT1A 5K0BA 1Y9DA 3OCUA 1BMFD 3EUAA 5LDGA 4TYWA 1I3KA 3UK2A 2MSLA 4AS2A 2HQRA 3GJXC 2GYUA 5JZBA 1VG1A 3L1JA 3CEAA 1JIUA 4M1TA 3AEQB 3T35A 3WKEA 4YMWA 3FMVA 4N03A