2ZI9A

C4s-e247a dck variant of dck in complex with cladribine+adp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
242
structure length
242
Chain Sequence
TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYASLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Deoxycytidine kinase
publication title Elucidation of different binding modes of purine nucleosides to human deoxycytidine kinase
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 242
sequence length 242
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zi9A00
4GOXA 2O5VA 1E3MA 1JAHA 2ZPTX 4CEJB 4C7OA 2ZJ5A 4OQLA 3TW8B 3U7EB 2IYQA 2QT1A 3WNBA 4MUBA 2Z5FA 3LX8A 4HLCA 3BBPA 2FZ4A 2EYUA 4NMMA 2WHXA 3THXB 3WNDA 3M0EA 2CCGA 3IEVA 5TB5A 1VCIA 1W49A 1H8HD 4I1UA 1K8RA 2ZRKA 5E7JA 5J4YA 1KI7A 2OBNA 3TE6A 4ZDJA 2VL7A 2E9SA 5EP1A 1AKYA 3I92A 4QFMA 3NBYC 1Q1ZA 3HJNA 4PHFA 4B34A 4MGKR 3K9HA 1IM2A 5KNCA 3B1VA 4A2WA 1VYTA 1OKKA 1UKVY 4Q03A 5CYOA 4LX0A 1YQTA 2Q6TA 2IYRA 4G1UC 1ZNWA 2A3RA 2WSSA 4PZYA 5KSZA 2AKYA 4C0JA 1GRNA 2ZI6A 2ZS8A 1ZCBA 2OESA 4MYTA 1KJWA 1XB2A 1N6PA 3BAFA 4TQUS 1Z28A 5B58C 5CIWA 3A36A 4DDVA 3NG1A 1C1YA 1JI0A 2O0JA 3WMGA 3RS0A 3RWOA 3LBIA 1E9AA 3PV0A 1ZNYA 5P21A 3QKUA 5BWMA 4QL3A 2X1VA 3AF1A 1P5ZB 1GKUB 2JDIA 4EJSA 1CR1A 2XNSA 2FFQA 2GA8A 1KI2A 3VR6A 4B44A 1DG1G 1JQLB 2Q3HA 2BC9A 4RD3A 1AN0A 3DEFA 4LSGA 4FCVA 4G5SA 5BN3A 2NG1A 4IVQA 2XZPA 4G5GA 1YU9A 2GEVA 4ESHA 2DCUA 3X1XA 3W6OA 4QJ4A 3ZGXA 3GLGA 3AB3A 4UKDA 3WMFA 1N25A 2J1LA 1G4UR 5KYKA 1E98A 5C46F 3KQUA 4RZ3A 4O2RA 2ZI9A 4POAA 2P6RA 2DY1A 4V02A 4IHQA 2GKSA 4DKXA 3BXZA 4ERNA 1JR3D 2BKEA 1YR8A 4NYJR 2IHYA 3CZQA 5JJKA 2AWNA 3GFTA 1NN5A 2XGJA 3NTUA 2VP0A 3CWQA 2QPAA 2C96A 3LQRA 2IS2A 5L3QA 4QM6A 3M4YA 5JS8A 2VA8A 1AZTA 1E2QA 3CX6A 4TLAA 4XOIA 1ZBDA 2W2XA 2EVWX 4WVFA 3VKGA 2QZ4A 1U8ZA 3AVPA 3QENA 1XPOA 2BBSA 3C15C 3K0CA 1G19A 5EXTA 1MRNA 2J7PA 3AKEA 4LBYA 1US8B 4A6PA 3UWOA 2RH5A 4ZPXA 4DHEA 4TSFA 1NLFA 4DBLC 4LBVA 1IY1A 2QMEA 3O47A 4KLNA 3SJBA 4IDHA 2YC2C 4FW9A 1DAIA 2ZRDA 4KVAA 5FPHA 2FA9A 3QY0A 5DHAA 1E0JA 3GPLA 1IXZA 4ACAA 1E0KA 1RRGA 2CHVA 2B8WA 1N6RA 1FUKA 1JXOA 2PX3A 1LFDB 2IK8A 3GJ5A 4YMTA 1NY5A 1H8HA 3QXSA 1GL7A 1HYQA 4X8OA 1P7CA 3GCGA 4RD6A 4X8HA 1SVOA 5EE3A 1G17A 2WJJA 3LW8A 4FD2A 5EJEA 2BMFA 2ZUCA 2KBFA 3L0IB 1QHNA 4HLUA 2GBLA 4AD8A 1FOEB 1MOZA 2ORVA 3FKQA 3OFND 5CDFA 2XXAB 5GJCA 1OT3A 2D2FA 2W58A 4G5OA 4A8JC 3DOFA 3LVQE 1JEDA 3GJ6A 2QMUA 2AFIE 3GJ3A 2AD1A 3W5IA 3L0PA 4A0FA 4Q4JA 1R8QA 3AGQA 5G40A 2RGBA 2GJ8A 3CRW1 4F91B 2BOVA 3PIRA 2KI5A 4BLRA 4BWYA 4LCBA 4Q1FA 1G9XA 1D8TA 4DLUA 4PHGA 1Z6AA 1II8A 1KI6A 1OPXA 3U3RA 1E2HA 1XCPA 2ZJAA 1NVXQ 3QF4A 1WA5A 1T91A 4XVRA 3NIBA 3BB1A 1SVSA 4Q4AA 5KDDA 2ZRIA 2ZYVX 3AP2A 3QOFA 1U98A 2ZAOA 1AS2A 3RANA 2C03A 4PC7A 4D4LA 1FW6A 3LFUA 4B2IA 3CR7A 2QNRA 4JYCA 121PA 4AG5A 1D9ZA 3VHXA 4AYTA 1QHHB 2LKCA 2QE7A 3GJ8A 4GBMA 2VP2A 3PUVA 5FOTA 2QAGB 3GLFA 4IDOA 3FMIA 4LJ4A 1SXJC 3Q7QA 2VHTA 3K09A 5K8TA 4W5WA 2Y8EA 1J90A 2YOGA 1KI3A 3NC1C 1P4SA 4P31A 2O8BB 1UDWA 1T4GA 4Q21A 1CKEA 3CNOA 3TAHA 1OXTA 4IVRA 1ZUHA 2J0VA 5FUYA 2ZR0A 3KJGA 4V0LA 1NLZA 4OI0A 4BFTA 5HCNA 1T9HA 3T35A 4LYHA 3HR7A 1KDTA 1E9EA 4QHSA 1FFHA 1JR3A 1ZM9A 2OZEA 2WZQA 3VFDA 3AVWA 4NHOA 4IDQA 2RMKA 3A1TA 3A4LA 3RWMB 3TRFA 4EKDA 2JAQA 2FZLA 1E69A 5FPYA 5DISB 1W0KD 2LKDA 2CHQA 2GCNA 1YRAA 1VYUA 1U9IA 3JVVA 5CYPA 5JSZA 4Q4HB 2R6GA 2VHCA 3FVQA 1ZAKA 1D5CA 2AN9A 2BEKA 2CMKA 1KK3A 4YDHB 3QUSA 1OH5A 4XH9B 4DLWA 4IFEA 1KZ7B 1KSJA 3O8DA 1XBTA 4PQRA 1G1MA 4HB4A 1G6OA 1Q1BA 4KU4A 4D0GA 1O3YA 4URXR 2MMGA 1PZNA 2F1HA 4AKHA 4M9XA 3DMDA 4JYBA 3U5ZB 4KHZA 4ZI2A 1NP6A 4A1FA 1T5IA 5A0FA 4I81A 2J0UA 3P27A 2ZJBA 2FGJA 3L8YA 2WJHA 3K8YA 2XEXA 2N42A 3BRWD 3LDAA 5F98A 4LJ5A 3VKWA 2GXAA 1RIFA 3K0FA 4LYAA 5EP4A 3TQCA 4Z51A 1OV4A 3B5JA 5AUQA 1D6JA 5G3ZA 4C2UA 4RFSB 5EUMA 4HUQB 5FR1A 1VCNA 2P67A 4FMBB 5LBIA 1T3LA 3KB2A 3OFNA 4TL9A 1DEKA 2WPDD 1CS4C 1KI1A 2QPTA 3AV0B 2IYSA 2OLJA 2VSXA 1GL9B 3GQBA 2GHIA 5KDLA 2IUUA 3WRYC 4UJ5A 4W5JA 3BH6A 3PEYA 4TMTA 4QRHA 3GLHA 3THWB 1DAHA 4KSBA 4H1UA 1G3RA 5KSOA 5A5GA 2ORWA 2IX3A 1CEEA 1KNQA 4JSYA 2GXUA 2HUPA 1XFAA 4AC9A 1XMIA 4LOAA 5HE9A 3ZD7A 2C2HA 3MMPA 2XOKD 3NBFA 1XWIA 3TJZA 1BYUA 1NIPA 2DFTA 3RS4A 3A37A 4WXRA 3BS4A 1E94E 4DCVA 4BEBA 2WKQA 3QKTA 2W6ID 1KSHA 3TVDA 4EUNA 1VIAA 3U7GA 1OFUX 4B35A 1DELA 1W5TA 4C4PA 3CW2A 2H92A 2W83A 4NH0A 1N6KA 1COWA 3GMTA 3CX7A 3ND8A 3NVAA 3VR4A 1UKYA 3DMNA 5CJ2A 4QBHA 5DHFA 3EIEA 3REFA 2DBYA 4C0SA 4G3XA 4URZR 4E09A 2WTUA 1AM4D 2HCJB 3U2QA 1WQ1R 2RKOA 4DCTA 4NCNA 1M6NA 1LTQA 2ZUBA 4PZLA 1XXHB 2ZI5A 2XJ9A 1ZM7A 3QXJA 5GJWC 4ITRC 2JIZD 1LF0A 2ZE5A 4E03A 1VECA 1WB9A 2VYFA 3CWZA 2JLWA 1Q0UA 1SKQA 1T3HA 2VHJA 1VPLA 4M1OA 4ZO4A 5B64A 4PSAA 1ZD8A 4KSCA 1QHXA 1H8ED 3OESA 3QPWA 4M53A 4R71A 4DB2A 2W00A 1E9FA 2Z0MA 1W0KA 3RS5A 1TU4A 2ANCA 1QF9A 3TSOA 4DLYA 1O87A 4YC7A 4BGDA 2C95A 3AF2A 1SVLA 1X8JA 4MRVA 1W4AA 5FL7D 4ZCIA 1FX0A 4OQFA 1KK2A 1VIYA 3FHOA 3PITA 2WIBA 4LC0A 4NZYA 3QKRB 4D0NA 3BB4A 4MGZR 1G6HA 1ZIOA 2O8EA 2I4IA 2JLUA 4NCKA 3T12A 4KCGA 3THOA 4LHYA 1GVNB 2WOJA 2A5DA 4LPSA 2H8KA 1X86B 3FMPB 3J81k 2BM0A 2ZRPA 2KWIA 1VYVA 2WWFA 3ZVMA 1RVDA 1G7SA 1Z08A 3FKSD 1N2CE 3VMFA 2F55A 4RVCA 4UXJA 4ZKEA 5SZHB 5TDHA 1N6NA 2WSMA 3AP3A 2OXCA 3T1OA 5BW8A 5FBVB 3VNVA 1OFIA 5GADl 1KDOA 2F1RA 4F4IA 1R7RA 4PC3A 2IHBA 3BB3A 2XTZA 1I2DA 3CH4B 1OJLA 3IO3A 3NEYA 4XWOA 2H17A 4OHXA 3RRNA 1CIPA 2R65A 4XTCS 1ZD1A 2ODNA 3K0CC 1DG3A 2GCOA 2FMXA 4HDQB 3I32A 4KFSA 3QEOA 2YYZA 3X1WA 2IXGA 1GTVA 2ZSEA 3GD7A 3T5GA 4EFMA 5HZKA 5DN6D 1X6VA 3B1WA 4DUGD 4URVR 2WPDA 1KI8A 4U00A 3ZZTA 2D2EA 2G9NA 4BFUA 4DDWA 1U94A 4QHYA 5H70A 1KO5A 1FL9A 2W0SA 1ELOA 1R5BA 2P3SA 3A4MA 4LDJA 1XXHE 2CXXA 1TQ2A 2R6FA 4JLMA 1IONA 5J4HA 1Q22A 2QM7A 3W3ZB 4QKQA 3CZPA 3P26A 1BO6A 5TVKA 4H1VA 2QTVB 1CULC 2XOKA 3GEEA 4M1MA 5DLQC 1QVRA 2SHKA 3KJHA 4A0RA 1T3SA 1IBRA 4LZZA 2HLDD 4M9SA 4M9ZA 4TMKA 2GBLC 3PEUA 1XD8A 3SJZA 2XITA 2FFHA 4Z1MD 3KFVA 1RKBA 4B75A 4LJ9A 4GZMA 4LYJA 3C41J 1KMHB 3K0SA 3LWNA 3LQQA 3ZZ0A 4OK6A 2NMVA 1CJMA 5TY0A 3HDTA 4QGHA 4PC6A 1XTRA 3EIHA 1OXSC 5BYJA 1E2DA 2AKAB 3IPXA 3SFZA 521PA 3TUZC 2D7DA 2GK7A 1MO5A 3JZMA 4XTRA 5FOVA 2A7QA 4G5QA 3R20A 3BD9A 1RRCA 2REOA 2VF7A 5SZJA 4IOKA 3LRPA 4X8LA 5B57C 5C4MA 1CR0A 5FUXA 2JIZA 4YMUA 4O25A 1SVWA 4BQSA 1T5LA 3B8HA 5EP3A 4ZDKA 4E5UA 1JPJA 3RRYA 1E1QD 1GAJA 4UNPA 1HUQA 1JECA 3BFVA 2ZIAA 3HU2A 4BEJA 3SC3A 3WBJA 1KI9A 4AYXA 4HAVA 1H8EA 3MJHA 1CRQA 1KYIA 1S1MA 4FN5A 4HAWA 1OXUA 4BFWA 3D8BA 3UANA 3SE0A 3K09C 3A4NA 4PANA 1XJQA 1L8QA 3RNLA 3QKSA 1JAIA 4BLSA 5F2EA 3C14C 4M1WA 4DC9A 1QG4A 3KB1A 1HTWA 1S8FA 2G6BA 4BFXA 4QM7A 1DOAA 5FTJA 4D4JA 2D06A 3AVQA 5C4GB 1FTNA 4A8JB 2UZIR 2J7KA 4GI7A 1F3OA 3RABA 3VR5A 2DHRA 1Z6GA 6Q21A 1UKEA 5JWHA 3U44B 5CIQA 5FBQB 1YRBA 1OH7A 2ZJZA 3OF5A 4AURA 1S96A 1PLLA 5TMPA 3FKSA 1T6NA 2JASA 1OXXK 4DEYA 3AVYA 3H84A 1G3UA 2PX0A 4Q9JA 3UG6A 5DI3A 3OIUA 4HYYA 1U9IC 2QM8A 1ZNXA 1A4RA 2X2FA 1FP6A 1FPMA 1MV5A 4NYMQ 3ZLJA 2VSOA 2ZETA 3HU1A 4DT1A 1U90A 1FNMA 2QPOA 5DE3A 1WMSA 2A5YB 2IUTA 4Q9HA 4LV8B 2ZRGA 5KO2A 1SXJB 5AJVB 4FXPA 1BS1A 2G77B 4GP6A 5DN6A 2QU8A 1GG2A 4DUGA 1E2JA 2J0SA 4TYYA 2DWPA 3LNCA 1HT2E 1Z3IX 2ZEJA 5DYGA 3RVBA 2XSZD 4PAOA 3TSZA 2OO7A 3FFBA 2A5FA 1HH4A 4KI0A 2NO9A 3AF4A 2QORA 3IPYA 4P0TA 3ZS8A 4GFDA 1OH8A 3SHWA 1ZINA 3DKVA 2J5XA 5J5CA 1R0YA 4GRAA 1RJ9A 2WBLC 3BGWA 2O0HA 4URWR 3K53A 4AY2A 2C9CA 2YINC 2OCAA 1Z0DA 4W9MC 1ANKA 3LAWA 4OL0A 5JJLA 2WJYA 1M34E 3R8FA 2VF8A 1EX7A 3R8CA 4B2PA 1NG9A 1GSIA 2XX3A 4R9UC 4DLXA 2HLDA 5JMTA 1CRPA 3SQXA 1Z0AA 4D2IA 1J8MF 4Z1MA 2HYIC 3B2EA 1PLKA 2G1JA 3FWYA 1Q3TA 1Z0FA 1P2UA 1SHZA 1XMSA 2ZAMA 5AJWA 1AQUA 2QP4A 1QVAA 3LD9A 3E2IA 1NBMA 2QSYA 4MITA 3IEUA 1XEWX 3A1VA 2P6NA 3PQCA 5TXGA 2H18A 1CLUA 2ZU0C 2AHOA 1KSGA 1YZUA 1RYHA 1QBKC 3PFIA 4DSOA 3TBKA 3DVLA 3M6AA 3K0AA 2OFOA 5JBQA 2ASEA 5DNYB 1VDZA 2QGNA 2VRWA 3GEHA 4G5RA 4Q66C 2JLQA 2JLRA 2VH5R 2ZR7A 1LNZA 1L4YA 2PZGA 3BFXA 5DSZA 1TUIA 3CM0A 1G8FA 4BECA 5KNBA 1E1QA 5EE1A 4PX9A 1XD9A 4QHTA 2JJ8A 4RKFA 3IBGA 2IBMA 1E2PA 1Q57A 5EZ5A 2CJWB 1EG7A 5L3SB 3QG5A 2QBYB 1T0HB 2IYLD 3SOPA 1PUIA 5EQTA 3LW7A 1MT0A 3KKNA 2ZS7A 2OV2A 1A2BA 2I1VB 2PLRA 1W5SA 4JJZA 3Q9LA 1A5TA 3FFAA 3MFYA 5FUWA 3RLFA 4F4JA 1KIMA 3EXAA 2RGCA 5LB2A 1SXJE 1VHLA 4I1OA 1XEXA 4HAUA 1Z83A 4LV5B 4C7OB 1EGAA 3RAPR 1Y63A 3KKQA 3AVUA 4JZKA 4P4TA 4JLBA 4B2LA 3Q5DA 2PLFA 3T1QA 1E2NA 5DIFA 4BFSA 1NKSA 4GNKA 3LV8A 2FPLA 1PVOA 3KJIA 2G0NA 2WWHA 3ADKA 2OCBA 3B85A 3M1IA 2NQ2C 4HZUB 2OXRA 4MYUA 3VKHA 4TLCA 4V0NA 4MUAA 1P62B 1ZC3A 3W9YA 4A92A 1DAEA 3N70A 2ZUDA 1NF3A 5ANRB 5E7MA 4IOLA 4B73A 3CNNA 5FTMA 3SHFA 1ZRHA 2GVZC 4JMPA 1P2TA 2R6DA 1W4RA 4NU0A 4WW0A 1WP9A 1F2UA 2IT1A 4IXMA 4OHVA 1N0VC 1TX4B 4LJ8A 4X8MA 5JWRA 2ZVQX 4ZDIA 2P2LA 4KBGA 4CF7A 5FTNA 2G83A 2QN6A 2IYYA 2KE5A 1VG9B 4D4KA 1L7VC 2YWFA 221PA 1TQ4A 1U0HC 1US8A 1M8PA 1EX6A 1G21E 3PEVA 2BBTA 3QF7A 4QNRA 4C0LA 2XSZA 3BORA 3V4RA 2OHFA 3NHAA 2BKUA 1A2KC 1Z63A 1G41A 3SYNA 2GCPA 4TL6A 4TT3A 3ADBA 2P6UA 1FNNA 2ODEA 2BJVA 1R8SA 4JLAA 2XB2A 2ZE8A 3AEZA 5IHPA 4CRWB 1V5WA 4Q7KA 1YKSA 4JLNA 1XD2A 1E79D 4AYWA 1KTVA 1GKYA 2V1UA 3HYRA 4TMZA 4HB3A 3K0EA 2GESA 4IFBA 1UKZA 4FWIB 1SKYB 2B8TA 2WWWA 3V4FA 3Q72A 3TK1A 2QENA 5HE8A 5HPYB 1NI3A 3T34A 4RJLA 4NONA 3WY9A 1M7GA 2HT1A 4AWXA 2FSFA 1WXQA 2DFNA 4YQFA 1R10A 4M9QA 3C5HA 4Q1CA 4R7ZA 3S1AA 4UNSA 1QRAA 5F3WB 3WP0A 4KBFA 4BUJA 1GNPA 3LH5A 4JLKA 5F9FA 4URUR 1TAGA 4DLTA 4LJYA 4CEIA 5FR2A 3K9LA 2PL3A 3ICEA 2D62A 1VMAA 4QC2A 2CLSA 3EPHA 5L3QB 1TF7A 3QXXA 4DSNA 1HA3A 2JJ1D 3REGA 1WCV1 2QL6A 4TQAA 2NO7A 2A2ZA 3BC1A 3CPHA 3DOEA 2YV5A 3T15A 3IHLA 3GJXC 1RRPA 2D7CA 3F8TA 1JQJC 3C8UA 3E1SA 4HAYA 4YMWA 2BV3A 3MD0A 3EX7C 4MKGA 4TTPA 1NKTA 3RSLA 3CNLA 2W2VA 1Z29A 1QHHA 1PJRA 3T1TA 1GP2A 2B21A 4BFZA 4CGZA 2QAGA 3KUDA 1UADA 1QHSA 3QQ5A 5B30A 4U02A 4O0MA 2EFHB 4QBGB 1JALA 1NIJA 2VQSA 4E07A 2DR3A 4M1YA 2O8BA 2WJVA 4NE2A 3UMSA 4UNRA 1BOFA 2HEIA 1YZTA 2HJVA 3IUYA 4JLOA 2A5JA 4C9BA 5J4KA 1Z2CA 3T61A 1K6MA 5GJBA 2O52A 5LDDC 4LJ6A 3ZIAD 3CRQA 1N6OA 4JKIA 3L8ZA 4LGMA 4B3FX 3WMEA 5FOXA 1N0UA 4C3ZA 4GMDA 3SYLA 4YXWD 1N5LA 1HV8A 4GSYA 3QPUA 2GWHA 1FMLA 1UBGA 1E9CA 2GETA 1JR6A 1J2JA 1UDXA 1SKYE 2A5GA 4Z8YA 4A82A 2ZYWX 1WBBA 3KQLA 4TLEA 3PUXA 2FX3A 2RGNC 2WVJA 2QAJA 4JLJA 3U7HB 2DPXA 4Q4JB 4HAZA 3NH9A 2DWQA 4XJXA 3RC3A 2OAP1 4V0ME 1GOTA 1ZUIA 3GP8A 3IO5A 1J7KA 3X1ZA 1KI6B 3EC1A 1X1SA 2ZJOA 3I72A 4PQFA 3QF4B 3SN6A 3MWJA 4URYR 4OQXA 2B6HA 4PO9A 5KTYA 2QTFA 2ZRJA 4Q4AB 3EARA 3A1WA 5AJYA 5DGXA 5BN4A 2ZSBA 2GAOA 3DM5A 4J0QA 4UNNA 2NZJA 4PO1A 1KO1A 5EP2A 3U3OA 3A58B 1E4YA 1FMJA 2VP5A 1E79A 4EPTA 4II7A 2YWGA 2FEMA 5KOYA 2FN4A 5AR1A 4HDCA 2FJUA 1DAFA 1NMZA 1YZLA 2Q3FA 4IJMA 4F93B 1G5TA 3LLUA 3NDPA 4UJ3A 1QG2A 3WBKA 4F7WA 1XF9A 3Q85A 2NIPA 5FTLA 2G3YA 1E99A 4WOPA 5DH9A 4JKYA 2P65A 1QHGA 3NBXX 2F1JA 3MWKA 1AS3A 3IGFA 2ZI7A 4Q1AA 1F2TA 4A9AA 3DDCA 1G8HA 3QSYA 1F60A 1IAQA 1L2TA 3NBZC 2PT7A 1KHTA 3LBNA 4EPWA 3JVUA 4DB4A 5CB6A 2GXQA 3CPJB 5J4VA 3UATA 5JEDA 1NN0A 3TSWA 3I73A 2NO0A 1X8LA 1YR6A 1X1RA 3LVRE 4ASUD 1HQCA 2ZREA 2ZQ5A 2GZHA 3RYTC 2JJ1A 4US2R 4PPGA 3ZQ6A 5FOUA 2KSQA 3A1UA 3NHBA 4A15A 3SDZA 1UAAA 1R5OA 3KJEA 4OKSA 2YWHA 4RY2A 1GITA 2RCNA 2WJIA 4I4LA 2QUZA 5JEEA 3WHLA 2FU5C 4L4UA 4M21A 2NOAA 3TR5A 2BBOA 4LJAA 5FI0B 1IY0A 2F43A 1CU1A 4UXIA 3RC8A 5HZHA 4IDNA 5CDFE 2VSFA 3RHFA 2ZM5A 2ODBA 3QNUA 4XD7D 3WHKA 3AVXA 4RCYA 1OE0A 3OIVA 4QOSA 4NCIA 1MABA 1RRFA 4S2EA 3VR3A 3NEJA 2ZRBA 2AK3A 2QGZA 2ZYUX 2ECKA 3FMFA 2DYKA 4YMVA 1XTIA 2V1XA 4MDEA 1UEIA 3OEHD 1IN4A 1W36D 4US0R 3GLIA 1CJUC 1P9NA 2X2EA 1A82A 4F4CA 1T0JB 3X1DA 4A2QA 1XTJA 1DAMA 2H16A 2IYZA 4TTRA 2QA5A 3K0FB 3ZIAA 1ZM4A 3LA6A 3DKPA 4TQ9A 2W6JD 4B33A 1IQPA 3PR1A 1DO0A 5CK4A 4ZDWA 3EPJA 2XJ4A 4TZ6A 1NY6A 4OQNA 4OQMA 1CJKC 2EW1A 4PPNA 4YXWA 3CO5A 2MSCB 4Q9LA 1E0AA 4GOKA 4R98A 2JATA 3QVVA 1SZPA 1G291 2Q3MA 4DLZA 4JT2A 1EFTA 2HF9A 1MH1A 3HP1A 1GM5A 1P6XA 4RD4A 1IY2A 1NSTA 2ZXUA 4JL6A 2JLZA 2YKGA 2C8VA 3KDSE 1G3QA 1XEWY 2FOLA 2ZROA 4JBWA 4R2IA 1AJEA 2QG6A 2PCJA 3LX5A 4P3YA 5J40A 3R7WA 1NVVQ 1YZQA 3C4JA 1OB2A 3QKRA 1W0JD 3CRRA 1XTQA 2XTMA 3MCAA 1ZC4A 2JLSA 4UNQA 5AJXA 5EXSA 1E2FA 4GL2A 2ZRFA 4EJSC 2PEZA 1ZU4A 2ERYA 5LD2C 3B9QA 4PQYA 1KO7A 4IDPA 1KAOA 4LRWA 3WXMA 1I4LD 1DAGA 4FMCF 1GNQA 2FF7A 2JA1A 3UIEA 4CVNA 3B6EA 3B1YA 1XZPA 3VX4A 2YC4C 4A0GA 2WV9A 1X8KA 5JWOA 2VTKA 3FDIA 4FIDA 4MRRA 2V6JA 2CNWD 1R0XA 3Q3JB 4M1KA 4BZXA 3NXSA 2QSZA 4DZZA 3EWSA 1OFHA 4QGAA 3NKVA 4Q47A 3MUFA 3SEAA 1XEFA 5FL3A 4DRZA 2AD5A 2ZJYA 3IQWA 4OHZA 3WYGA 4JJKA 1SXJD 5GJVC 3MWLA 2HJGA 3HPRA 3O8CA 1G3IA 2VP9A 2Q9AA 1TEVA 2CL7X 2FSIA 5BXQC 2LWIA 2R44A 2RB4A 3KXLA 2DB3A 1UF9A 3B78A 1P61B 4NCHA 2JLXA 3IIKA 1NLYA 3U4QB 5EE5B 4TLBA 1OSNA 3MG9A 4ARZB 2ATXA 2CL0X 3RS2A 2YNMA 2UVQA 3HWSA 4JT4A 5JRJA 2ATVA 4FINA 4XVQA 1ZP6A 3OHMA 3PUYA 2L0XA 1E4VA 3QVUA 4ASUA 2CL6X 3Q8XB 1NL3A 4IXNA 5FOWA 3TH5A 4ZCMA 2REBA 1S9DA 2OCYC 4JS0A 4UQOA 2Q9BA 3B60A 3BOSA 4YMSA 4BZPA 2ZS9A 4D25A 2P5TB 3K70C 1AKEA 1XCGB 3AKDA 1FX0B 1U8YA 5F9HA 2QRNA 3L82B 3L0SA 3W5JA 1BKDR 2A30A 2RAPA 4RFVA 1E2LA 3QBTA 3W6PA 1G7TA 3KUCA 4XD7A 3UXMA 2FSGA 3AKCA 3TW4A 1XPRA 1JEEA 4RSGA 4L9SA 2Z4SA 3CF0A 2GJAA 2R9VA 3RRZA 4L15A 2EWVA 3I62A 4R2HA 2QP9X 2G88A 4ON9A 3OEHA 3WP1B 1AGPA 2VP4A 1E2GA 4CEHB 3I5YA 4C0KA 4A4DA 2VO1A 5G41A 2W6IA 1K5GA 2P0EA 4HLUC 1RPZA 1KJZA 5D3MB 2Z6VA 2VBCA 2R6AA 4JLPA 4RZ2A 1VCOA 5FTKA 2F7SA 1MO3A 2EYQA 2OLKA 3BFKA 3PUZA 3W8NA 3X2SA 2DWOA 4ACBA 2NO6A 3D7MA 2V8OA 3UK6A 4U5XA 5FBRB 5C18A 2QT0A 1TL7C 4QBIA 4P4SA 3B1XA 1GFIA 2GEDA 4BASA 3CKLA 3UMRA 3V00A 4ZKDA 3U6BA 2EQBA 2QEQA 1HQYE 3W3AA 1SQ5A 3TIFA 3SBEA 1M7BA 3SS8A 3IKJA 3K9NA 4XWAA 2CCJA 4ZIRA 4E22A 1N6LA 4WXPA 3KXIA 2IF0A 4BLOA 3VAAA 4A8JA 1W0JA 4EQ6A 2BHRA 5BYKA 4NYJQ 3B1ZA 2FH5B 4WZBE 2GRJA 2J41A 4CDGA 4IKEA 1KO8A 3U44A 1JJ7A 2J87A 3MJRA 4LWZA 2WKPA 3THYA 4DLSA 1ZIPA 3N2IA 1KJYA 4KYIB 3ZD6A 1D2EA 4OJQA 1P72A 3UMFA 1KDRA 1Z06A 1GRRA 4LJ7A 1YR7A 1U8AA 2FPMA 2JGNA 5FL7A 2CNWA 2E1RA 4JIMA 3TUJC 4FWTA 4D82A 4Q02A 4LI0A 3TVTA 3W8RA 2CE7A 4L9WA 5J47A 1N6IA 2RHDA 1Z07A 4KV9A 3DL0A 2MSEB 2VP6A 1Z0JA 4Q1DA 3RS7A 1GWNA 4B3XA 4Q1EA 3E5HA 1OKKD 1KY2A 1G16A 1SXJA 2QTHA 4BRUA 3IHWA 3MLEA 4PPFA 4Q1BA 3DHWC 3R9XA 4FMCB 5CB8A 1CF4A 3FE2A 1CJVC 1J99A 5CK5A 3L2OB 1D2MA 1E6CA 4BLTA 4IRUB 1W44A 1B23P 1CR4A 2NZ8A 1KK1A 2TMKA 3T1VA 2O8CA 4TZ0A 2CK3D 2Z4RA 2W2TA 1Q1QA 4QBFA 1F48A 3CR8A 1EFCA 1W47A 1YJ5A 3I8SA 2GAAA 5KHOC 1S2MA 5TARA 4DEXA 1CBUA 2KB0A 2QI9C 1KMQA 4DDUA 1NJFA 2I3BA 4GZLA 621PA 4TYPA 1NVUQ 3P4YA 3U3MA 4EIWA 1RC8A 2C04A 3KTAA 5GVSA 1P3JA 4PR0A 1D9XA 3E70C 3TAUA 3QXCA 4EDHA 1AS0A 2Q0HA 2V4ZA 3FGNA 2IXFA 1G64A 1EFHA 4M1SA 4QXAA 4PC2A 2O8FB 1SGWA 5HCIA 1GL6A 4LHVA 2GJ9A 4CEJA 1AA9A 3VU9A 1Z6YA 2XB4A 3ASYA 3GJ0A 2GF9A 2RGGA 5JFGA 1I4TD 2X8AA 2AL7A 1W4CA 3THXA 2PZFA 3ECCA 4K8OA 2IWHA 2RHMA 1CP2A 5DI3B 3I3SR 1HE8B 3AM1A 3T5DA 2AFHE 4KODA 3EG5A 1TU3A 1ZJ6A 4AK9A 4B3DA 1TMKA 3PEWA 4NPHA 5HKKD 1Q44A 1E96A 5FH9A 2ZVPX 1J8YF 2WMNB 4U7DA 3SFVA 2H1LA 3ADDA 1Z22A 1M1YE 1ZNZA 3QG1A 4NYIQ 4F38A 3OIYA 4I1SA 4Q19A 2F1IA 2OT3B 1TNDA 4YDSA 3I61A 2PEYA 4OBEA 3VHLB 1FTSA 1N5KA 2R62A 1YVDA 5KU1A 1DBSA 2ZSAA 3A6PC 4MKIA 1ZYUA 4EPXA 1KOFA 2IW3A 2F3RA 5E7IA 2J7PD 4C0AC 4W7SA 3KKOA 4EAQA 1V43A 1XX6A 2WWXA 5G3YA 2O8DB 4IOMA 3U3JA 4DLVA 1DS6A 1Z5ZA 3PXGA 4C0BA 2GF0A 2XAUA 2KJQA 3F0TA 4Q7LA 5H68A 3AH8A 1WBDA 2OEPA 2J59A 5K8LA 4A36A 1RJ9B 2ZRLA 3DPUA 5SZIA 1TEXA 4DJTA 4TMVA 2A9KA 4N0EA 3BK7A 2HV8A 4B43A 3PG5A 2BEJA 2PH1A 821PA 2O0KA 4HZUA 5DO9A 5FPKA 2FG5A 2F9LA 5C2JB 5JHHB 1ODFA 5FUVA 1VG0B 3Q5EA 2WKRA 1KO4A 1ZVQA 4FCTA 4WA7A 3UKDA 3AUXA 3HR8A 1G8GA 2ZU6A 4MYCA 1D2NA 1JJVA 3K9GA 4Q18A 4A6XA 2ZYTX 4LHWA 4IEEA 2GDJA 2WAXA 3ND9A 3IIJA 3GFPA 5AUNB 1BH2A 3MWYW 3OIWA 2V54A 1GZSA 3FB4A 1W7AA 4HB2A 4LPKA 1E1RD 3R9WA 2K5UA 3K0AB 4LHZA 4DCSA 1DPFA 5CM8B 4PXAA 1UPTA 1XJ0A 3VR1A 3EZ9A 3EASA 3TMKA 2NPFA 2BBWA 2QY9A 2WICA 4D81A 3WYAA 5KSYA 1MO4A 1ZW6A 4DLRA 2V3CC 3EIQA 4IOJA 2CBZA 4D26A 4Q9KA 4DSUA 4LV6A 2CK3A 4Q7MB 1GDDA 5AUOB 1VG8A 5FI1B 4MRSA 1WF3A 3N5CA 2HF8A 4GP7A 5KSPA 2C9OA 1YHNA 2ZRHA 1XTSA 2F9MA 4OI2A 4DIDA 4F92B 1IXRC 4P33A 4Q5IA 3U60B 2QE7D 2WAYA 5BN5A 4ESVA 4D4MA 4B71A 3AQ4A 4C0HA 2AXPA 4PTLA 1FP7A 1R5NA 4M0LA 3H4MA 4V0KA 1XEXB 2DFLA 4HAXA 1W1WA 5DYIA 3B13B 4B3CA 1E9BA 8OHMA 2QP3A 1Z47A 2PBRA 3NC0C 4V0MA 4FI3C 4DCUA 5JLJA 3KQNA 1G7CA 2H57A 1HT1E 2E87A 721PA 1NSFA 3QEJA 1U99A 2IF2A 4PAMA 5IT5A 5FBLB 4N1AA 4EJSB 5LD2B 3EWAA 3L0OA 1G7RA 1ZUNB 4B76A 1KKLA 1ZCAA 5EXXA 2FV8A 3BWDD 4AKIA 4FCWA 2GTPA 3CB4A 4GOJA 2IYUA 4V03A 5HKKA 3FTQA 3LBHA 4MGYR 1SHKA 3BE4A 4NKRA 4GPTA 4LBZA 5IRCD 2PJZA 4A2PA 2PCLA 4MYHA 4Z8XA 3ICQB 5CJPA 2J46A 1R0WA 3EA0A 1F2UB 1Q1EA 2FDCA 3GLGB 3EAQA 5JJIA 1NJGA 3CF2A 2XXAA 1MR3F 1ESMA 2IL1A 4P4UA 3I8XA 4PO8A 1ZM3A 3BH0A 1DAKA 2UKDA 5ELXA 5KNDA 4Q48A 4TMWA 1NBME 3LXRA 4WZ6A 3D3QA 2ZRMA 2HDNB 2D4HA 3A1SA 4QG7A 1W36C 1G5RA 3DZ8A 3FHCB 3PJRA 1KSFX 3AP1A 3H86A 3TQFA 3GEIA 1TTTA 1OIXA 2J0QA 2ZRNA 1II0A 4RD2A 2FNAA 1UEJA 2IS6A 4TYNA 4B48A 1LW7A 1AZSC 2EFCB 2GZAA 3X1YA 5KPDA 1Z0IA 4HLQB 4D80A 2ZE6A 1P75A 2IA5A 1XD2B 2HXSA 1EXMA 5LB4A 4TYQA 1P9WA 2FE4A 3VR2A 1P2SA 2YWEA 3OE7D 4NYMR 5AK0A 1EFUA 1TQDA 2OE2A 1DO2A 1W2GA 3EZ7A 3PUWA 3LXXA 5IF9A 1YR9A 4IVPA 5L3VA 2VEDA 3BJIC 4TLDA 4W5HA 5SZKB 3R9IA 2ERXA 3WNCA 3P32A 2F6RA 2C78A 1IN8A 5FPSA 1LS6A 3K70B 1OLOA 5L3RA 5FFMA 3AVVA 1XNJA 4EFLA 3VQTA 5L8VA 3FOZA 1SVKA 3AGPA 2PMKA 2CVHA 4KAXA 1DE0A 4N3NA 3EPKA 1IN6A 3EA5A 3S1AB 3VU9B 1BMFD 4DCNA 2IXEA 1OYYA 1E1RA 1OW3B 2AK2A 2BDTA 2GZDA 4CIDA 4MGIR 4CEIB 1Z6XA 4QJ5A 4MKFA 2WWGA 1EWQA 1NN1A 4ZCLA 2H7VA 1UFQA 1W48A 4RKEA 5E3HA 1XPUA 2BJWA 1QZXA 2GILA 2X77A 2GNOA 4Q7JB 1E2MA 1PV4A 3CPEA 4OHWA 3IDQA 5TV2A 4ZV4A 2HYDA 4NTZA 4MH0R 3ZVLA 4CZ2A 4Q4HA 1CR2A 4KFUA 2P5SA 4XSHA 1COWD 3FPAA 3B9PA 2JJ2D 4BPBA 5LPNA 1ZU5A 1HEIA 1UM8A 1E9SA 1S0UA 1GUAA 2V7QD 4NYIR 3GLGE 1II8B 2BM1A 1C4OA 2OFWA 5GVRA 4AG6A 2J9RA 3KX2A 4Y0AA 2IEZA 4OI1A 5JI2E 3U6KA 2CVFA 3IQXA 1N3BA 4TMXA 3ZYCA 4C2TA 4GDFA 3BERA 3QJYA 1DARA 4B47A 4P32A 4B74A 3MRSA 2V55B 4L16A 1GRQA 3OAAD 4I1VA 2B7BA 2A78A 5FOSA 4LBWA 3I4LA 3U3KA 3CH5A 3ZH9B 1AQYA 1F6BA 3TNFA 5JZVA 3GLFB 2CEAA 4Y0VA 2FFBA 2XTNA 1M7HA 4CW7A 1A7JA 4AKEA 3KZ1E 4HI0E 4OK3A 3Q7PA 2JEOA 2PT5A 3KKPA 1H65A 2FGKA 2ZANA 2C5LA 4RFSA 4HUQA 1S3SA 5EXPA 4JSTA 3O8RA 1G20E 2PMDA 5H8WA 4B6EA 1JB1A 3ZJYA 1G3MA 3D6TB 4JVNA 4TWZA 1C9KA 5E95A 4MRPA 2F3TA 4EPYA 1YZGA 4JL8A 2IYXA 3SBDA 1SULA 3CF6R 3TR0A 4KJZA 2BCGY 1OIVA 4NL4H 4NBSA 1XDBA 2CLDX 3THWA 4MQBA 3HYTA 1R4AA 3AF0A 3PCRB 1LB1B 2Q21A 1LF5A 1P9RA 3CRMA 3LO5A 1II9A 2JLYA 1IN7A 1UBFA 3C5CA 1QDEA 2NO1A 2R2AA 3WRXC 3WYFA 5A4JA 1WDTA 1LVGA 1XCMA 1XU4A 1AGRA 2EFEB 4L5BA 2AR7A 3MGCA 5JSZB 1U0JA 2ANBA 4M22A 2PZEA 1MO6A 2MSDB 1I2MA 4JVSB 4QGFA 3UWKA 4I99A 3V9PA 1EK0A 3TLXA 2EFGA 2JCSA 2V9PA 4YLGA 1UJ2A 3O8BA 1I4DD 5AJZA 1Z6TA 2QMHA 3CONA 1J70A 4PSKA 2G0TA 4B32A 1G5PA 3OE7A 5EE9A 1YZNA 3SZRA 1LV7A 4Z54A 3W6NA 5JI3E 3ZDQA 1OFTA 1ZD9A 3W90A 3CIOA 5KDOA 3CUEF 3U61B 4HSEA 2XZLA 1RW4A 2ODWA 3B82A 4KFTA 1PUJA 2ZITA 1R2QA 1Q20A 2GXSA 3B7GA 2X19A 2JLVA 2IWRA 1F2TB 1XXHA 2OM2A 1OF1A 2J0UB 1DTSA 2WIAA 1DADA 1ZM2A 1BMFA 1TADA 3ETLA 4KYUA 5E4FA 1G8YA 421PA 2D3WA 1NMXA 3P1JA 4NDZA 3AVOA 2ZE7A 1GNRA 2OILA 2FFAA 1TF5A 4XSGA 5EZ6B 4PZZA 3GJ7A 3P20A 2ZJ2A 4YONB 4Q4LA 3SR0A 2FEOA 1S3GA 5J4LA 4HLDA 4LUCA 4LK2A 3KQHA 3GLFE 3NDBB 4KFRA 2ONKA 5IK2D 2OCPA 3KXKA 4UXHA 3ZZUA 1UBCA 4BFYA 2C77A 2F43B 2KBEA 1ONBA 3G0HA 2CLCX 2BCJQ 2JJ2A 3GLHB 1R0ZA 4ILEA 3CRVA 5CLLA 3AUYA 2BMJA 3LLMA 5JCZA 1Z8FA 4WIAA 2V7QA 1MABB 1LY1A 1CXZA 2FPKA 3ZVNA 1EWRA 1LS1A 3QPVA 4JVMA 1TF2A 4M4SA 1FQKA 1YZKA 4DSTA 4MKHA 2Q9CA 5K8UA 3G82C 1OIWA 1OHHD 4PPQA 2VLIA 3GLIB 5IDVA 1KAGA 1JR3E 1EESA 4NP6A 1QHIA 2GK6A 5HR5A 4HEJA 3EPLA 3KFXA 3OAAA 4LHXA 1RZ3A 3VTKA 1P73A 1U81A 4H9GA 3FHTA 4M1TA 4XIGS 3U4QA 4ARZA 5CM9C 2GEUA 2OBLA 3TUIC 4S35A 2QROA 4Q9IA 1SVIA 4WZAE 1M74A 4K46A 4CT4B 1U0LA 2YOHA 2IS1A 1E2EA 3H1TA 3W34A 1IXSB 5D3QA 1L4UA 1G18A 3RDPA 3AVTA 4G0NA 3SU8A 3SQWA 4OHYA 3OEED 3A8TA 1XJCA 1NN3A 3I5XA 1XZQA 3CLVA 1XMJA 1BYIA 2BMDA 3FYHA 3ZS9A 2GJSA 2RGEA 3R7WB 2V6IA 4JBYA 1N6HA 1B0UA 1DVRA 1NRJB 1KKMA 1Q21A 1TUEA 4DVGA 3F5FA 2VPPA 3T06B 3EC2A 1IOZA 2YHSA 4BLQA 1CJTC 1FZQA 4PC1A 4MRNA 2C99A 1R6BX 3SYKA 4HZIA 3SI7A 4EFNA 2CCKA 3IIMA 5DI9A 2XZOA 4TN1A 2W0MA 3OZXA 2YOFA 4CEHA 2G1KA 1OYWA 1W46A 4DDTA 1TQ6A 1JPNA 4AKGA 2ZI4A 1W4BA 4G01B 3ADCA 4KXFB 5D3MA 4DWJA 3EZ6A 2QRZA 5AWFC 3C7KA 1VKJA 4V0OA 5H1YA 3QIAA 2O8EB 1KMHA 3KKMA 2IYWA 1N5IA 1ETUA 3SNHA 4C30A 4EPRA 3AF3A 3GLHE 4BLPA 3U7FB 3PENA 3DO6A 2C9YA 1EFRD 1WRBA 1XRJA 2QQ0A 4M8NE 1PLJA 1XTKA 4OYHA 4RCZA 1ZMXA 5HTKA 4FMDF 1KI4A 2OBMA 4A0HA 1KY3A 1X3SA 1YE8A 4WAUA 1FUUA 1E0SA 1K5DA 1RYFA 1XMVA 5G53C 3GLIE 1Q3HA 1S4QA 4JVLA 2IYTA 2WMOB 4LY6A 2WWIA 1IN5A 2ZSDA 3L43A 4TL8A 2W6JA 3QXHA 2VHQA 1JBKA 4OK5A 5B2ZA 1P2VA 3MAAC 1KZGB 2FWRA 3G5UA 2GCOB 3SJCA 5EE0A 3VX3A 2C98A 4N0DA 3EW9A 4K81B 2HCBA 2XNDD 2ZJ8A 3QBVA 2QAGC 2Z83A 4C0QC 5JCPA 5CLQA 4O2LA 1Z0KA 2N46A 2WJGA 1N0WA 3DM9B 4L8GA 5IK2A 2HT6A 4Q01A 2OAQ1 5BQ5A 2MMCA 2VHUA 5JHGB 4LC1A 1RE0A 2AXNA 2ZRAA 2YJTD 3SJAA 4B3BA 1TPZA 3QI2A 1KDPA 1ESNA 1Z2AA 1HE1C 1S9HA 1NBMD 5UKDA 4IW3B 2OG2A 2IYVA 4O3MA 2AWOA 4XWKA 4PHHA 4MDFA 1W36B 1OHHA 1Q12A 1MRSA 2OUKA 3QE0A 4BRWA 4XVUA 4DIEA 2BVNA 2EFDB 2NPIA 4AIIA 5C1BA 3FMOB 4KLZA 1VTKA 2D74A 2R8RA 1HY3A 2WOOA 3GJ4A 2R6CA 1KNXA 3H0KA 2RGAA 3F3YA 4KVGA 4ZI3A 1NNEA 1S1CA 3NWJA 2NTYC 3BH7A 4OJKA 5KPJA 1KGDA 3HU3A 3I1FA 1G4AE 3TGPA 1JNYA 2HXYA 2QMOA 3P4XA 4PAQA 1GILA 3H2YA 3JZAA 2PJRA 3K1JA 1E2IA 4TYWA 4D6PA 5JRZA 4P4SB 4JL5A 2IS4A 2Z43A 4PHTA 2REXB 2B7CA 1IJFA 4MA4A 3BIFA 5FPTA 2DFKB 2WSSD 3D31A 3OEEA 2RGDA 3C16C 2ZTSA 2EU8A 2GJKA 2EWWA 1QHYA 4GT1A 3N2EA 4ZIRB 1U2RA 2VIIA 1M2OB 1GIAA 2OSBA 4OI4A 2N1BA 4EQ6B 3TKLA 3IILA 2WWYA 2RGNA 4DXAA 1GKIA 2ZSFA 4BFVA 4TL7A 2O8FA 4BZQA 5KUTA 2ZI3A 3THYB 4BE7B 1WE2A 4JLDA 4US1R 3GFOA 1SVMA 2J45A 2OFXA 4HB0A 4KO8A 1NMYA 2UZ3A 3EZFA 2J3EA 3QKSB 1VHTA 2WM9B 2JDID 4QGGA 1RFLA 4QJ3A 3KL4A 2GVDC 2ONJA 4PSVA 2YZ2A 2FSHA 1E32A 2QQEA 4JLVA 1F5NA 3MSXA 4AI6A 2IC5A 3VNUA 4CT5A 4JBXA 1IHUA 3RS3A 4EPVA 3IBYA 3KQKA 4RD1A 3UPUA 2YVUA 4CYMA 4QNMA 4NCJA 4RD0A 4ABYA 1T8TA 1UBEA 3EZ2A 2ORIA 1E9RA 3NH6A 4B6FA 4HDOB 2B92A 4WBSA 2ZRCA 1JXMA 4TTQA 1EFRA 1OB5A 5JS7A 1NVVR 4HATA 3UG7A 4RZXA 1HURA 1FQJA 3PVSA 1A1VA 4RZUA 2H5EA 2AX4A 1AK2A 4GMXA 1IJEA 2O8DA 2O8CB 1KK0A 2ZR9A 4PFSA 1W2HA 2NGRA 1P60A 2CE2X 4DT1B 1OXVA 2IEYA 3ZQJA 1XP8A 4TT3D 2CHGA 1VCMA 1NVWQ 5EUQB 2RGXA 4LYFA 5AUPB 5JECA 3ONWA 3CBQA 3ZVRA 2XNDA 3LY5A 1BIFA 2LCFA 2CJWA 5M04A 1T8UA 2IUSA 1E2KA 1Y3AA 4M2LA 5L3SA 2QBYA 4B3GA 1CTQA 3CX8A 4IEIA 3HPQA 1E9DA 2BWJA 2I1QA 1G8PA 1AIPA 2BMEA 3KTAB 4Q00A 1OH6A 1NG1A 1N5JA 3AKYA 4FMDB 5K8IA 5FBWB 4D0LB 1VG1A 4TSFD 1MKYA 3RSOA 5CITA 3DZDA 3ASZA 3RRMA 4KITB 2BIFA 3K70D 4HUTA 2CDNA
chains in the Genus database with same CATH superfamily
4GOXA 1SKAA 1EBFA 1X13A 3DFIA 3O3NB 1GA6A 4CEJB 1A8PA 1JV2B 2VAXA 2ZJ5A 2RK6A 1CF2O 3C74A 4OQLA 3RU3A 3ETJA 1DXHA 3KCQA 1UP7A 4OIMA 3ZCVA 4EB3A 4MUBA 3LX8A 1P33A 3ZTYA 4BMDA 2EYUA 1NTOA 4Q3KA 3TQIA 4H27A 3CSUA 3WNDA 3M0EA 3GA7A 4M9UA 2PMFA 3R7DA 1U4OA 3FDFA 5E7JA 1EJ2A 3GLQA 1EP3B 5BT8A 3BN3A 2NPOA 5HNKA 1G8JA 3TE6A 5CHEA 1B6TA 1M72A 1XO1A 4BU1A 4EJMA 4ZFNA 1XLTC 3L7CA 4QFMA 4J9VA 4L78A 4XVHA 5TQ2A 2PU5A 4Z4IA 2HDOA 3SXJA 1BN6A 1M6WA 2JAPA 4WJLA 3TRDA 2P7HA 5JSKA 5JAPA 5F2NA 2PX6A 1IM2A 5A05A 1BCSA 1ECGA 1RZRA 4W8OA 4AJEA 3B1VA 4A2WA 1VYTA 1XELA 1WKVA 3EXG1 1ONNA 4HG2A 4PFJA 3AU9A 4F72A 1WHSB 5CB4B 4G1UC 4RCVA 3I58A 4PZYA 1ML3A 1WXGA 3O1LA 1FNCA 4D42A 1JMVA 2AKYA 1C3OA 3C4VA 1FDRA 1KOGA 4LMBA 2CB9A 3G6WA 1ECFA 2ZI6A 4RORA 4S0XA 4MYTA 2Q6LA 1KJWA 1XB2A 2Q99A 3DTVA 4YJGB 1N6PA 4TQUS 3GJSA 5HX7A 1RR6A 4DDVA 3ZDZB 1GCIA 5ALLA 3OZEA 1JI0A 1CUWA 2FPOA 2JRLA 3WMGA 1M2VA 1XZBA 3QKUA 3H3FA 7ABPA 5K3AA 3SK0A 5IM4F 3GH3A 1Q1NA 1SUPA 2IPXA 3DT8A 3OMXA 4D96A 2R1ZA 5CB4A 4EJSA 2JDIA 2XUHA 1CR1A 3VR6A 2GT1A 1U1DA 1X1AA 2LCQA 3IDSA 2WHPB 1JQLB 4JNKA 4EHDA 5AVTA 2PO5A 3RYCB 4D3SA 1Y7PA 1L7BA 4KDCA 5LBUA 5IBPA 3DEFA 2G8NA 5AVJA 5HFNA 4BRSA 4HXFB 1PT9A 3IUBA 2BF7A 4KE7A 5BN3A 4A3SA 4NVRA 3KYBA 2XZPA 2P9TA 1L5ZA 1R4MB 4G5GA 5HM8A 3ESCA 4ESHA 5I51A 2DCUA 4RWEA 4CIBA 3ZWDA 4IIJB 1BGWA 4X7MA 4OHPA 4UKDA 1D09A 1IY8A 5KYKA 1ES9A 1JDUA 2ZI9A 3RD5A 3T7SA 5I47A 4N48A 1XL1A 2GKSA 4ERNA 3OP1A 3KOWA 5HSGA 2IHYA 2HF7A 2X42A 3GFTA 2XMZA 2XGJA 3NTUA 1F20A 1UKCA 1YMVA 2VP0A 4YUVA 1IE3A 2NT3A 4D56A 4ESEA 4KE9A 2PZ8A 1QQAA 1B73A 4O1HA 3BBLA 1Y7HA 3DMTA 4MGHA 1O95A 2C9ZA 1AZTA 2NYVA 4LMPA 4PLTA 1REQB 1E5LA 3AILA 1WVMA 1ZBDA 2W2XA 5H59A 3GT7A 1AUXA 5DLEA 3BXPA 3EFOB 1U8ZA 1YB7A 2G82A 2PT9A 3W2FA 5KQGA 1B8UA 2BZ0A 3LX6A 3MNFA 1Z5NA 3V7WA 1XPOA 3QV2A 3MCWA 4LA4A 3REQB 1JAYA 2FQXA 2FTKE 2OCKA 2J7PA 2O2JA 3AKEA 4GR5A 4HN9A 4IJ6A 4KH0A 4L5YA 4LBYA 3C8HA 4LXXA 4AO7A 3ROZA 4F60A 5JQGB 1XC7A 2RH5A 2YXBA 3H0CA 1EZZA 1WMDA 2VZ9A 1MB4A 4AMUA 4KXMA 4JXKA 4YFVA 5TT1A 1IY1A 5AHWA 2AE2A 1NZJA 1P0CA 2M32A 4CM8B 4AICA 3MMZA 3FZGA 1GPUA 1F9EA 3N2YA 4HQLA 3NEPX 4N18A 1ST2A 2QSUA 5KJ6A 2Y27A 2YC2C 4ZICA 3M6XA 4F5YA 1Y81A 4V1CA 1UINA 3SLRA 2FA9A 1JQDA 3GPLA 4I7EA 5MFPA 3EZNA 2WLSA 3PNOA 2B8WA 2O0MA 4FEAA 1CQIA 1T5BA 3W4JA 5BNZA 4QFDA 1SZCA 4WN9A 4EHAA 4YMTA 3S40A 4CR8A 1V5IA 3IELA 1CQJA 1MIOB 1NY5A 1U9CA 1QX4A 3H9GA 1R9MA 4Q3CA 3CW8X 3GCGA 3L7YA 4KN8A 1ADJA 5K0ZA 4ND5A 5EE3A 1JP7A 5CFRA 2N47A 2PRZA 2B1JA 3BL8A 3CZ4A 3WLHA 5BSVA 3L0IB 5CCBA 4HLUA 3GA5A 3FCCA 5EJ6A 3L4KA 1ZONA 2XT6A 3GRYA 4GBGA 4EF6A 3C5WP 5GJCA 2UUOA 1RHJA 4D45A 1A77A 1NA5A 2D2FA 4G5OA 2AA3A 3ZWQA 4G84A 1UOPA 4K40A 2GBGA 2R85A 4DANA 4JCCA 3HE3A 1L7MA 4DR4B 5G4LA 3L0PA 3NYRA 4Q4JA 3W5IA 4A0FA 2ZYIA 5HJ7A 2RGBA 2GJ8A 3CRW1 3HXKA 3QJGA 2IHNA 1KBOA 1SCQA 2HY7A 5LP6A 1D8TA 1UM9A 4DLUA 2NO4A 3U3RA 2ZW9A 1ODCA 1E2HA 3VYTB 4GPBA 4UU8A 3Q88A 5LNK1 2Y6VA 4E2YA 2QUKA 3QX8A 2EEPA 2H5JA 1RJDA 3DW3X 2ZYVX 1TJYA 1XRSB 1PZFA 4UBOA 4ZZ0A 3ESYA 2ZAOA 3EGXA 4IIVA 2C03A 3RANA 3H5LA 4K9QA 4CLOA 4MR7B 3CR7A 3ONFA 4H16A 3BWXA 2CFIA 2NSYA 1D9ZA 4YGXB 3TSYA 3ZR4B 4JENA 3Q2KA 5AM4A 3E3LA 1RVV1 1L7EA 2QE7A 4GBMA 3PUVA 3GLFA 3HNPA 3D2AA 5ESXA 1PF7E 1U7DA 1NM5A 4RABA 2MWMA 4NR0A 5A06A 1N5RA 3LUBA 1J90A 2YOGA 4MI6A 1KI3A 1QGYA 3NC1C 4PLPA 1T9GR 1UDWA 1YI0A 2IRWA 2G9ZA 2JVKA 4TKZA 3UNXA 4DWOA 3UWSA 1CKEA 1SXQA 3H6KA 4ZAXA 1OXTA 2R66A 3UJNA 1ZUHA 4CFYA 2XHZA 1XNGA 5CGZA 5DMHA 2EWMA 1Z26A 2O3UA 2QL9A 2JZOA 3KCNA 1N5OX 4ZCPA 3VZSA 3UHOA 1OASA 4YAEA 4BFTA 2BHLA 1GU7A 2XUOA 3EY4A 3I2FA 4IUYA 5HCNA 5CA0F 1U0TA 4KQ2A 3RU2A 3T35A 4LYHA 1P0PA 3ORFA 2YJ3A 4HQFA 1YGYA 4QHSA 1EEHA 1E4EB 1JR3A 1ZM9A 3U7QB 4G41A 1NFQA 3CLUC 4XR9A 5TJHA 4IPTA 3LY9A 5FULA 5AKJA 2I34A 1ZH0A 2NUBA 3PC4A 4EG7A 3OLQA 2B82A 2BMVA 1BCRA 3CXUA 2CDCA 3R0JA 5K3EA 2LKDA 2PV7A 2CHQA 3QJ5A 3ZZNA 5CYPA 2QHXA 3TRHA 3V4SA 2VHCA 2B4RO 5HUHA 1ZAKA 2AN9A 2H0QA 3HS3A 2GI4A 1DNPA 4BJ6A 5HKAA 1SY7A 3HG7A 1W9MA 2ZTUA 4DLWA 3K1ZA 1N2GA 4IFEA 2Y1CA 4QDZA 1KSJA 2BFEA 2XWPA 4RMIA 1XBTA 4BP9A 4XE5A 4YYEA 5ALXA 1IHDA 1ZSVA 2MMGA 4MUMA 4U6QA 2A67A 1VKRA 1X70A 3FROA 1V26A 3C3EA 4M9XA 4ZTUB 3ZNNA 4A10A 1LSJA 4G0MA 3ZW8A 3HKBB 4PYQA 2XR1A 1CY0A 4H60A 1NP6A 4DMRA 2G7MC 4A1FA 1WL8A 3ZGVA 1OPRA 2PZBA 1LH0A 4H0NA 3T4PA 1TE2A 5KC9A 3P27A 3IVMA 2XMSA 3PPWA 4YP5A 2PKYX 4Q3EA 5IANA 4FIZA 3L8YA 2WJHA 3K8YA 2XEXA 3LDAA 4AJPA 5AOBA 3FXAA 2AI1A 2RI6A 1Z5GA 5CLGA 1FLNA 1OV4A 3ZKAA 1ZI6A 3MTBA 5CH8A 3NEAA 4C2UA 1LQ2A 4ND6A 5ELLA 4KIJA 4ZT7A 5EYPB 2GFIA 3VU1A 4KO2S 1DFIA 5HJEA 1IMOA 2AKEA 3E18A 3OCWA 4D46A 3WOHA 2VHEA 2WPDD 3CUKA 2HR1A 2COKA 1CS4C 1KI1A 2PQ6A 2QPTA 3AQIA 2OCLA 2OLJA 1GL9B 3AV0B 3GQBA 3JYQA 3NOVA 4MMXB 4LDRA 2AOVA 1ZPDA 2HQRA 4UJ5A 2QAIA 3SKXA 3BH6A 4PR3A 4JOQA 5FAXA 2Z98A 5C8ZA 2J6BA 2J9FA 4H1UA 1G3RA 1JB9A 1CEEA 2X15A 1FYFA 2XZDA 2GXUA 4WKNA 4F4UA 1EUYA 5ALWA 3NV7A 1MQ8B 1P7ZA 1PZXA 1VKZA 3AZQA 1FMTA 1RM5A 1T0UA 2CKMA 5A9SA 1XWIA 2NU9A 1V5GA 5KX5B 2QVGA 2TSYB 1N3YA 2Z2JA 3A37A 4WXRA 1DKQA 4B87A 4MW2A 3TJRA 1YCGA 3NONA 5LQRA 3EXIA 1GFWA 1LRJA 3D43A 4IUBS 1VZ3A 3O1IC 3P2KA 3P8ZA 4B4WA 1IWOA 3QW2A 1EQUA 5JOQA 5JW6A 3C4QA 1V9LA 1ODLA 1OFUX 1WW2A 1W5TA 4C4PA 3ELBA 3SQOA 4BQIA 2WZDA 1TTHA 2W83A 4IP0A 1N6KA 3HDJA 1COWA 4MUJA 4RJIA 4E46A 3RU7A 3ZU2A 3E22B 4BN4A 2HA3A 4QXOA 3NVAA 3VR4A 4AJ9A 3DMNA 2ZWVA 4QDKA 4GQAA 1X77A 3DLCA 5DHFA 5LU9A 1J23A 4G3XA 4E09A 4CQLA 1AM4D 2WTUA 1GFZA 4Y2QA 2XYGA 3I1JA 5T6BA 3E8XA 3WWEA 1K4KA 5EHGA 4DCMA 4DCTA 4NH4A 2JLXA 1J24A 4NCNA 5AI8A 4BP3A 1M6NA 4DR7B 2O8VA 1MB2A 1KQGA 2IPAB 4HO1X 4ZJUA 2PK3A 1H05A 3W3AD 3RV3A 2W8ZA 1W5FA 5HQTA 1KFBB 4RGYA 1WB9A 3JQGA 4N6GA 3WWCA 3ML1A 4FP9A 1BU8A 3LKDA 2JLWA 3WYCA 1H85A 1T3HA 1F12A 2G70A 3FCOA 5AI9A 1VPLA 4ZO4A 3IVCA 3ENWA 5KEIA 4KPUA 4TM7A 5JSHA 2V4UA 1ZD3A 4J8PA 4M53A 4OKIA 4J75A 5BN1A 2Y3IA 3D9QX 1Y8ZA 5IABA 2ZLBA 4R71A 2W00A 2JAOA 1ECLA 4HQNA 4HWOA 5K3CA 3SE7A 1FFCA 1UFVA 1KOJA 1GYPA 1TU4A 3PKIA 2OXEA 4YC7A 2A4KA 5F3RA 2C95A 3ZK8A 1DP4A 1SVLA 1V25A 4XARA 4F6RB 4DKJA 4MLZA 1W4AA 4WACA 4ZCIA 1FX0A 4GG1A 4JX9A 3UJCA 3FHOA 3AK4A 4Y6OA 3IYLW 4J3JA 3IIEA 4FDLA 4LC0A 2QL7A 2XCLA 3BB4A 4NZ9A 4D0NA 5K3DA 2BUBA 3VR5D 5BW4A 4K3VA 4C4SA 4X44A 4FGKA 3THOA 4LHYA 5IKXA 4LZJA 1UZAA 1T6ZA 4NS1A 2WOJA 1L5LA 1L4LA 3ZY6A 2KLHA 2V65A 2ZRPA 3DUWA 3JQ6A 3SXUA 3OO1A 4DM4A 2WFLB 2ZJ1A 3NWBA 5CLHA 2FQ1A 3HFGA 3HUFA 4UBLA 1CY7A 5TDHA 3AP3A 4KPGA 4LTNA 2NVUA 5C1OA 1A1SA 1SD1A 1HEUA 5LQDA 4H7HA 3A2NA 1KDOA 3B7WA 2F1RA 1U7HA 4V2IA 3COZA 3RSFA 1PU2A 3HEBA 2IHBA 4DMHA 2AV6A 2XTZA 3BB3A 3IO3A 1OJLA 4O33A 1NRIA 1T6YA 4RV5A 1MC5A 2QMZA 3MC1A 1I30A 4XTCS 1SHUX 1WABA 4LXQA 1DG3A 4B4DA 3JATB 2FMXA 2OFPA 3CEAA 3QEOA 4RDCA 2PSFA 3GD7A 1TTQB 3NUZA 3T5GA 4EFMA 5A4DA 3FIUA 4PO3X 5AVWA 1V2GA 4WJZA 5HZKA 2UUCB 5DN6D 3M33A 4L3WA 2CWWA 4DE5A 4URVR 3V6LA 2W6ZA 13PKA 3VI3B 1FRFS 2PANA 3JXEA 1W59A 4PRLA 5U4QA 2D2EA 3QP9A 5KTTA 4UHFA 4BFUA 1DMSA 4DDWA 3E15A 2DQYA 2XE7A 1FL9A 3R0VA 5J1SB 3KVVA 2YIMA 2P3SA 3A4MA 4O0LA 2ODAA 3BXEA 3R3YA 4N3AA 4JT9A 2ZG6A 5J4HA 3KZXA 1BDBA 1IWBB 2BGLA 3UGQA 3JVDA 1Z4QA 1DWPA 3ZV3A 4KUEA 4E21A 1BO6A 4H1VA 3FOFC 1B76A 5DM4A 2CMGA 2XOKA 1RWNA 4MVCA 4D9JA 4J0GA 2I3DA 1VE1A 4LNAA 2H1IA 2R8EA 3GEEA 4M1MA 4RSRA 4S1VA 5AKGA 4HBZA 1T0PA 1DKPA 1QVRA 1XZHA 1OI3A 2IOFK 3HCOA 1FP4A 5GOTA 4BKQA 1IBRA 2ORYA 2LCIA 2P9QA 2VRCA 3QELB 1WVIA 3NWPA 5GGYA 1RZUA 5EWLA 2FPIA 1XD8A 2XITA 2G28A 4GVLA 1GG5A 3KFVA 1JDBB 4MO9A 3GRVA 3LBFA 4GI1A 4MI1A 4B75A 2LGJA 3QUCA 4LJ9A 4BNLA 1ZJYA 1MF7A 4EA7A 5FBKA 3K0SA 2WT8A 2J5RA 1CUXA 3DS8A 5KNCH 4OK6A 1OGYA 5B1SA 4Q3OA 3DUFA 1F7VA 4KREA 3S99A 1ZJZA 4B4VA 3LUFA 4RF5A 5BYJA 1E2DA 2AKAB 3IPXA 5F33A 3HVRA 1PQYA 2PMBA 4YRPA 3NR2A 1MO5A 5FEMA 2RG7A 3LOPA 5KSWB 4M76B 1BX1A 2PX8A 2CFRA 1E77A 3FNGA 2VF7A 3FX2A 4UVHA 4Y9SA 4UUMA 1LBSA 4O25A 4X20B 1T5LA 1SD2A 1AKRA 1K3UB 1WZIA 3E8MA 1BQ4A 3V97A 2WFAA 2WQ7A 3MCVA 4QUKA 1IMJA 2W98A 1GUBA 3RRYA 3HVUA 3DDWA 1JECA 3GW8A 5ITSA 5IC4A 1TYAE 3W7AA 1L5HB 2BH9A 2FZEA 3BULA 2WJZB 4OJYA 2Y71A 4PZEA 1ZXLA 4HAVA 5C1IA 2P77A 4FFDA 4GPIB 4C5CA 4CN9A 1JUDA 1KOLA 1GR0A 1S1MA 1GFSA 5E9AA 1OXUA 4BFWA 3D8BA 1T9CA 2QVZX 1NM5C 3FGOA 3OT5A 4MO2A 3A4NA 3UANA 5K3BA 3R74A 2W4QA 3ASUA 3FSEA 1QFJA 3QKSA 2DT8A 5B7QA 1JAIA 2QX4A 3TBHA 2FVYA 4LRUA 2BGGA 1WD5A 4M1WA 4RF4A 4DC9A 3WZMA 4G81A 3ZWWA 4KVZA 4IWNA 1CS0B 3P9KA 2GRAA 5GY7A 4DG9A 5JIBA 2G6BA 3KEFA 2DERA 3ZCSA 3D64A 4E1BA 4REMA 3CZRA 3AVQA 4K05A 1D6MA 4Y6LA 2LUOA 2DFPA 2UZIR 3BGSA 4GI7A 4A8JB 1RAIA 5GMOA 2ZBUA 1DJLA 2DHRA 1LPPA 5CA1A 1N78A 1GV0A 2JD0A 2D5IA 2PA0A 3RSHA 5CIQA 5CRIA 4ENUA 1NP7A 4MV9A 3KAPA 1IHYA 4KNYA 1QCZA 4KWIA 4JJ8A 2FKNA 1PLLA 4MUNA 3PRJA 4BY9E 3T3MB 5JXIA 4IIEA 4DEYA 1V7PC 1ZLXA 1YIAA 3I37X 4W82A 5LLDA 1MVOA 4Q9JA 3R4VA 5DI3A 1PNRA 4PZAA 1KYXA 1KJQA 1Z33A 2QX9A 1EXNA 1NE2A 3DZBA 3KPVA 3G9QA 4FXOA 4B6OA 3FLAA 3E9YA 3V8BA 4QQKA 1AKTA 3WWYA 2HU7A 5CVVA 1VB5A 4D74A 2UZ4A 5ADUS 2J3IA 3HU1A 5FHQA 3HY3A 2HI0A 4CLRB 1FNMA 1K0FA 4LK3A 1WMSA 4J2HA 4KQHA 4KYVA 1K08A 1SXPA 2ZRGA 5HKBA 4KDFA 1SCIA 2G77B 1GG2A 1WJGA 2H9YA 5T4BA 4RYLA 4TYYA 1BMTA 2QG4A 1ZIDA 2DWPA 3AHFA 3PF9A 1SBIA 3EG9A 2YFHA 3IAEA 4J0FA 5DYGA 5JAQA 4NOJA 1Z8DA 4KI0A 2NO9A 4P0TA 2QORA 3OJLA 3ZK9A 2XCTB 5DBGA 5EMMA 1BFDA 3SHWA 3L4SO 1EIZA 4DDHA 2OORA 1ORWA 2RIRA 4URWR 4AY2A 1M8KA 2Q07A 5JJLA 1V7CA 3O4FA 3SZOA 4P3XA 3DMPA 1EX7A 1PJBA 2GN2A 3HVHA 1UIMA 2FEAA 4R9UC 1NG9A 2QJWA 4HFRA 4MW6A 2GDZA 2VCYA 4MB6A 5JMTA 3SQXA 1L4BA 1H6DA 4Z1MA 2QLMA 3EXHC 2B0CA 3Q3IA 4G4JA 1ODIA 4OB8A 5FUBA 3MHTA 1UQRA 3EBOA 3SHVA 1Q3TA 1LBHA 4PYKA 1P2UA 1XMSA 4XWWA 2QP4A 4CUJA 1N4AA 3A6FA 2C4KA 1QZUA 4QGSA 3RVDA 3H4VA 3PD1A 1XEWX 3A1VA 3PQCA 2P5UA 2BEWA 2R87A 1HTTA 1B8NA 2AHOA 3KJFA 3V6MA 3WGKA 2G0AA 5ADHA 5LQKA 1IVYA 4GNRA 5EKUA 1G6KA 1JTEA 1BHQ1 3H2IA 3M6AA 4OXXA 3SC2B 2OFOA 1XDZA 3GF4A 3MOSA 5EFZA 4G5RA 4C0WA 2A9OA 2Q46A 1FDTA 2IOFA 4MJ3A 1YE5A 2VH5R 2BFWA 1C7RA 3PDIA 4BVAA 1OAOA 1PW7A 1WUIS 4I4TA 4RY9A 4ZAGA 2G36A 4S1TA 4KXQA 1JIXA 1N8TA 1XK7A 5KNBA 4C05A 3JASB 3ENZA 2RJ3A 5JXWA 4PX9A 1HWYA 3ZWKA 1B0ZA 3ST7A 1YDEA 2K2QB 4KQ6A 1VIVA 3DZGA 3RC9A 4RKFA 4LVCA 5H02A 4NZZA 1FTYA 1J6UA 1E7MA 3FJOA 1Z25A 2JFHA 3F46A 1QRTA 1GNSA 4P6VF 5L3SB 1T0HB 1GQSA 1V3QE 3LHDA 5TQ0B 1R6DA 4F71A 4ESOA 3Q3GE 2H2DA 4RENA 1SQGA 1A04A 4YLEA 2OV2A 1A2BA 3N8KA 2PLRA 1SKUA 2NMVA 3HL4A 5FUWA 3E5MA 5H3LA 1K5PA 1K7FB 4RGBA 3ZOKA 3EXAA 3CMCO 2XNKA 2ABWA 4GZ6A 2SNIE 1UWCA 1VE7A 3HEAA 4W1SA 2O6HA 1A4IA 2J30A 3SYTA 4WOJA 4KH1A 3RAPR 3RRXA 4YCMA 1VRVA 1BXRB 3NOOA 5IWAB 5CXQA 3T1QA 3IULA 5DIFA 1NKSA 2CLOB 2I6TA 4GNKA 4AZ0B 3R41A 4WH0A 1GKKA 3GARA 5I7UA 2LZ0A 1A95A 1R0BA 2G0NA 2WWHA 3KJIA 4YJ2F 3L0YA 4PN7A 2QZ9A 3JCZA 4N7BA 1DOHA 4MYUA 4TRJA 3OJEA 2J08A 1T3TA 3DEJA 4IIXA 3I05A 1P62B 3N76A 4RVGA 1H69A 2BRUA 3Q7TA 5ANRB 4IIDA 3B1FA 2OHOA 4FNAA 5INTA 4E33A 1JSLA 3K7EA 3AUTA 3N75A 4YLYA 1ZRHA 1WCWA 4CKZA 2ECQA 2GVZC 2NU7B 2RSLA 4AUKA 2R6DA 3K5WA 4QBTA 4RE6A 4YUZA 1QWSA 5EZSA 3HB0A 3MT0A 1Y8CA 1L4HA 3O1HB 4IKPA 4P3PA 4WW0A 5EEHA 3T9CA 3LYHA 5T64A 4LJ8A 4P3KA 3OQBA 3T3EA 4OHKA 4BNUA 2H59A 1AK1A 3O94A 4HXGA 4KBGA 4CF7A 1Z2OX 2PS1A 1GYRA 1V0JA 5FTNA 5DXAA 4IM7A 2ZIWB 1ZVKA 3FYUA 2QN6A 1SEVA 2IYYA 4PYJA 1VG9B 2PWBA 2WYOA 3DFUA 1U28A 5ALHA 3LK7A 4L3OA 5CNKA 2A8YA 2XMCA 4B8WA 3W0LB 3MJEA 5I8PA 1US8A 1M8PA 2HO4A 3PEVA 4GHWA 4QNRA 4C0LA 1XFDA 4P7BA 4HSGA 2OYCA 4CNBA 5KTNA 3K0HA 4ECAA 2N3ZA 2HIHA 1QP4A 3CNEA 1RRVA 2IPLA 5IG2A 2CLFB 4ZCRA 2YW2A 4QWMA 1WHTB 1FNNA 1RZRD 3AHIA 3G7UA 2XBLA 2JFYA 3L1KA 1ZSNA 4CRWB 3OHSX 3ANMA 3MELA 1EM8B 1O57A 3OQJA 4TUYA 4BMNA 3PDUA 1L4KA 4AMVA 2WYVA 1RAAA 1MB0A 2VAMA 1ZQ1A 4EUEA 1S3FA 1ZGAA 4HB3A 5HUJA 4MAMA 3AM4A 4EUSA 1UKZA 4FWIB 2ADFA 4ZOLA 4R5HA 2G5CA 3JYOA 1X8XA 4F84A 1QQ6A 2BMAA 2OBYA 3AG5A 3P2MA 2V45A 5HPYB 5IFKA 3BF8A 1NI3A 1XDSA 3T34A 1USVA 1M7GA 5AKHA 4DILA 4G67A 3SDSA 2QRVB 1T9GS 4DNQA 1ESEA 3UHJA 4YQFA 1R10A 3S70A 1W96A 1CZHA 2O2GA 2C7QA 4M9QA 3C5HA 1U04A 1C81A 4Q1CA 4R7ZA 3S1AA 1WDLA 3C1TA 3FMGA 4AWAA 4ROSA 5F9FA 4URUR 3U5TA 1BE1A 1WPQA 1X9HA 4FKZA 4QC2A 2X0KA 2PT6A 3MWEA 4ADSG 3KFLA 2ZULA 1HT3A 2JJ1D 3R7NA 4UE3S 4ERXA 2CXUA 4MKRA 1NF2A 1XQXA 2Z6UA 1VYHA 2QL6A 3AY7A 3CVYA 3UAZA 2VVTA 3NASA 3BC1A 3PXEA 1HLFA 2G4VA 4MQ6A 5F76A 4FILA 3UAYA 1T8YA 3GWZA 4RPHA 5DM2A 2YV5A 1M1NB 1XQ6A 3GJXC 1KHHA 1EAMA 1N0HA 1DBVO 1RLOA 3B52X 4QFBA 2C58A 1LEHA 4IF4A 5JPIA 3E1SA 3V5NA 4ENVA 3GRAA 2E4YA 5BYAA 1S2NA 4CN8A 2ZYAA 1OVMA 2GB4A 1UZMA 1KMMA 4TTPA 5LCXA 3RSLA 3W1EA 3T1TA 5F7XA 4BFZA 1PE0A 4D43A 4CGZA 1F0KA 1QHSA 4G1CA 4U02A 2CLKB 2WNIA 1T15A 1I6KA 5HBRA 1NIJA 4BNYA 1YZFA 2SBTA 4M1YA 3LY7A 4K9OA 3TSCA 4NE2A 3VJKA 2YWRA 3FWKA 4NEHB 3UMSA 5NULA 2RAFA 2HJVA 1YZTA 2D0IA 2NNLD 1P0IA 3IUYA 3ONVA 4FSXA 5J4KA 4OGGA 1ZOIA 2NTEA 2FP4A 3AI7A 3O2QB 3ZTWA 5FNVA 2BR3A 5GJBA 4KR0A 4X61A 3LDUA 3H3XA 3UZUA 2MSLA 3WB1A 1SC9A 1N6OA 1SOWA 1W2WB 3PX3A 4JKIA 3MBOA 2BGKA 1QSGA 4LGMA 4MV5A 1YVUA 1P7PA 4D02A 5EIWA 3GLTA 5EZYF 2YVQA 2PRJA 1VMIA 3WIDA 3DMHA 3VSBA 1YJAA 2AC4A 5DLYA 4I2VA 1K89A 2LV8A 3SYLA 3KSDO 3AHGA 1VIMA 4Z53A 4JQZA 3WRWA 4XQEA 2IP1A 2EX1A 1LPAB 2G09A 2GETA 4LRSB 5CBKA 5IARA 5DW3A 4LAFA 2JBWA 1EBBA 3TQQA 1WBBA 5H3HA 5KWJA 3CVUA 4TLEA 3PUXA 2FX3A 5CUQA 3Q3EA 2QAJA 4CQMD 1IJBA 2WU4A 3FRIA 4RM3A 4ZHSA 5GZ3A 1JE1A 3F6CA 1BS2A 5JNWA 3WGUA 3B6ZA 4H7PA 1AURA 3WQHA 3RC3A 4YJ2B 4MV8A 3RJ5A 1J7KA 4FOLA 1KI6B 1AKQA 1X1SA 3OPQA 4PQFA 4G0VA 2GLUA 4HTFB 2VLBA 5AJUA 1QRSA 3SN6A 4CIVA 3JARB 2GMWA 1KZ6A 1T9BA 3TRKA 2ZRJA 3ILXA 4PF1A 1H4VB 3A1WA 1S2OA 3A2LA 4FT2A 3W8FA 4OM7A 5H9WA 3MIIA 4CKYA 3JSAA 3WNQA 4J0QA 4MPRA 2Y1EA 3GT4A 1KO1A 1U2DC 1XJ5A 3AV3A 5EP2A 1C8VB 1MLDA 2A0UA 3A58B 1C0KA 3TI7A 3U3OA 1FMJA 3EZXA 4I4IA 2NYUA 3VHXB 3R6DA 4EPTA 4L9AA 4R2WA 5KOYA 2FN4A 2F1OA 2VHWA 5B2EA 4JYZA 2FJUA 1S89A 3T9AA 1SWVA 1L9KA 2QYOA 1U1EA 4DS3A 1O5IA 3PGA1 3MGKA 4UJ3A 4N47A 2JH3A 2PUWA 2NIPA 4IIGA 3V80A 1QONA 3PHJA 5FTLA 2W48A 1XNHA 4W63A 5J9FA 2AR0A 1AS3A 3ZGZA 4J1SA 3SQLA 5BQXA 1G8HA 3DHNA 4IUDS 3QSYA 4QRIA 3TX6A 2RGRA 1H0HA 2PVPA 4EPWA 3O73A 1X9IA 1T24A 1GHTA 1TCVA 3VDRA 3ZLUA 3OM9A 4Z4CA 3T5PA 4DB4A 1R8XA 4LE1A 2JFBA 1Z2EA 2NUPB 1P80A 4S1OA 1FFAA 1NN0A 2PGXA 3TSWA 4C3OB 3I73A 4I9UA 5E6UA 4CCYA 2WUVA 5FLEX 1CIVA 4TRNA 1X1RA 3K2BA 4P58A 4MGEA 1PT8A 1KTIA 2Q4RA 1N34B 4J4BA 2GNAA 1QTNA 2NSDA 4UUOA 1M2JA 4KHPB 1Z7GA 5CR9A 2H5IA 3N6XA 4JJ6A 1A96A 3EMBA 2P5YA 4L5AA 4RY2A 3CKYA 3A10A 4L7QA 4I4LA 1M6VB 1U0NA 1WCYA 3NHKA 1IVNA 4RELA 2XTAA 1T4MA 4LJAA 1XWFA 1N2SA 1IY0A 2F43A 2P40A 2BKLA 1HC7A 5FI0B 3ITEA 2VZ0A 3AHDA 4IDNA 4Z2YA 5CDFE 4QYMA 3ROPA 4BB9A 3EGOA 1ULZA 4RCYA 2OZLB 4FYYA 4RULA 4NCIA 4FHFA 3OQNA 4S2EA 3CBGA 3HZOA 3VR3A 1AXRA 4M7RA 4EEKA 4ZVRA 4B6JA 3OU6A 1FFGA 1HRKA 2R84A 1XHLA 2MU1A 1AKWA 1Y80A 1OAOC 1U0SY 1UJ4A 2DYKA 2ECKA 2ODQA 3QUAA 3RHTA 1E3SA 1PL0A 4K8RB 5KIAA 4RXTA 3PFFA 3QIVA 1W36D 4B17A 4US0R 4JGIA 1P7WA 3R3UA 2GCGA 4P86A 1MEJA 3SSAA 1NP3A 4KQ9A 2PRIA 3L1IA 4HOYA 3ZCUA 4RDXA 1T0JB 3RK0A 5FLXA 3W5AA 1XTJA 4B6RA 1LBIA 4RTSA 3V4LA 1BJTA 3LPDA 1ODJA 1DLIA 1HNNA 4M8KA 2QA5A 1ZM4A 2C4MA 2GN4A 4L07A 2W6JD 4L8YA 4B33A 3CNHA 1PL7A 2C07A 1DO0A 4LQLA 1ADYA 1A72A 1NY6A 2I87A 2J9XB 4LJLA 4OQNA 4OQMA 5KKAA 1Y1LA 4Q9LA 1E0AA 1WPRA 1NQVA 4R8KA 5AM5A 4ZAFA 3TL6A 3WXBA 2BM9A 3AR7A 3CCFA 3I0NA 2DH6A 3UJ8A 4BNTA 2ZAGA 2GZ3A 1N2HA 2Q3MA 1SKBA 4D9NA 2HF9A 3NDRA 4LNHA 4V0RA 3QWBA 4MR9A 1JG2A 5JVDF 1VPTA 5IJ9B 4HRYA 4JL6A 2YKGA 2C8VA 2XQVA 1J00A 4JBWA 2YIJA 4R2IA 4R9RA 5K03A 3W5CA 5CXUA 1IZYA 4TMYA 5DCLA 3LU1A 2VXOA 2H2GA 5K6AC 1OB2A 2C4TA 2BL4A 3QKRA 1PNTA 2QB5A 3CRRA 4LWOA 3UJAA 3N2ZB 1GNLA 1E2FA 5EZYB 1GZUA 2ZRFA 2ID9A 2JI4A 3HJBA 4PN3A 2PEZA 1YIDA 3QK7A 4QAQA 2ISQA 2ZUTA 5JD6A 3B9QA 2QK4A 5SICE 1X39A 2BRUC 2DHCA 2VDQB 2GH1A 5CHYA 2XCRB 4LRWA 2XUZA 3OVMA 4ZYXA 1I4LD 1DAGA 3G1WA 3I42A 3RQSA 4TV8B 3DKKA 1GNQA 4FMCF 1VQ1A 3EVDA 4CE6A 4L9RA 3VX4A 4UD6A 4A0GA 1AF4A 1FDSA 3CEHA 3E48A 3MF4A 2EC5A 1PJLA 3FDIA 4L72A 4BXOA 4X64B 1NSYA 1CE8B 4GI2A 1P0MA 2R7AA 5CT6A 4LXHA 4KR7A 1AGXA 1KRHA 2AS0A 2YJNA 3BWEA 2QSZA 4RH1A 4AY6A 3EWSA 1HR0B 5EOVA 3C7AA 3PPVA 2IZOA 1W4LA 3MUFA 2VC2B 3G5TA 3NJRA 4MV1A 1U28C 4MYSA 2RARA 3NRCA 4ZOEA 3IQWA 3WYGA 4EKGA 1SXJD 3HDQA 3ZHVA 2PLWA 2XMDA 2Q9AA 3A9WA 1TEVA 2G04A 1ZCFA 4NX2A 4WNYA 5C1PA 2RB4A 2FJ0A 1NUQA 1Y4AE 2A0WA 1UF9A 3OZWA 4NCHA 3NIWA 5CVEA 3U4QB 2HHCA 4ARZB 1D03A 3D2BA 2CL0X 3E7DA 1A50B 3RS2A 3WB9A 4JA0A 5ALOA 5JASA 5JRJA 4H6PA 1TGVA 2C82A 2VXBA 4YALA 5TS3A 4ASUA 5B6IA 2L2QA 3IESA 4FFBA 1K98A 2QTVA 1KU0A 3VPFA 1KH1A 1TM5E 3PE4A 4N49A 5KOJA 1H4SA 5IVPA 2YYSA 1U3VA 1VLJA 4LDAA 1V5FA 2JHCA 2OCYC 4DA7A 1SURA 1UXIA 3O2JA 4UQOA 1W6UA 5CA0B 2H1FA 3K70C 4IHJF 1EQAA 3AKDA 4N9QA 4ZYUA 3I5AA 2MINA 4BV3A 3L0SA 1RBZA 1DCKA 1FBNA 1BKDR 1DOZA 1Y3HA 2A30A 2IXBA 1E2LA 2RAPA 4RFVA 5FWXA 1NGSA 1JHUA 1C2YA 2IKQA 1G7TA 4TT8A 2YJGA 4JP2A 2XRMA 3IXMA 4XD7A 1ILEA 1GRVA 2C31A 1T5OA 3UUGA 1PT7A 3TW4A 1JEEA 4F56A 1QHEA 4DUYB 2Z4SA 4CCWA 2GJAA 3CVJA 1VFNA 4DQUA 2BGUA 4GKKB 4L15A 1PSWA 4W8HA 1WU8A 4EG3A 1MZPA 4MIKA 4RETA 3MTGA 2G88A 4DIFA 1NW7A 2VP4A 3M89A 3BMCB 1Z16A 4CEHB 4C0KA 5JD3A 5EJGA 5JNTA 1RXUA 2H6EA 1L5YA 2OO5A 4AQ7A 3FUTA 4CU2A 3MK31 4KOAA 1M33A 3VKFA 3GVPA 4DOMA 1EB9A 2VBCA 2MTBA 1T1IA 2R6AA 5E6SA 3TDNA 3TBFA 5FTKA 2WG0A 1WMBA 2CNOA 3W8NA 5CVUA 1IL0A 2IXDA 2R7KA 1AK9A 2DWOA 2I3AA 4YWHA 4ACBA 4YRAA 1FNDA 2V8OA 2WQZA 2QF7A 4DRXB 5FBRB 1NOJA 3VJRA 5ICSA 1Y8RB 3HUEA 4FB5A 4QBIA 4A0QA 1I13A 2DQ4A 4D6YA 4DLPA 5DCYA 3AI1A 3KKKA 3B1XA 4WCVA 1GFIA 2GEDA 2OP0A 4BASA 4CJXA 2RBGA 1U5BA 2EQBA 2GTIA 1UWLA 2QXTA 1HQYE 5D84A 3LBAA 3QITA 2ZB4A 2ZSKA 3W3AA 2GASA 3UW1A 3H1GA 4L8WB 2W6MA 4CCSA 2PMEA 4XWAA 4QLBA 3NV9A 2BTQB 3A3YA 4E22A 1UC9A 1N3IA 1W0JA 1SU8A 4GOND 4EQ6A 4LFCB 5JO9A 2EL9A 5F73A 4FBLA 4ZA2A