2ZI9A

C4s-e247a dck variant of dck in complex with cladribine+adp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
242
structure length
242
Chain Sequence
TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYASLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Elucidation of different binding modes of purine nucleosides to human deoxycytidine kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 242
sequence length 242
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zi9A00
3E2IA 4FCWA 1KTVA 3NBFA 4HUQB 2C9CA 2FNAA 3W3AA 3A6PC 2RGNA 1XEWY 1YHNA 2A5YB 2QNRA 2RGCA 3EZ6A 3KKOA 3B1ZA 3TJZA 4PSKA 3HU1A 3VR3A 2QENA 2JLWA 4RKEA 1QG4A 1HUQA 2JIZA 2O8DB 5BN3A 4LPKA 1KO7A 3GFOA 4RFVA 5GJWC 2ORVA 2QTVB 4PQRA 2YOHA 4M53A 3ONWA 1TQ6A 4FXPA 3KQHA 1W0KD 1N6RA 1AS3A 1ZUHA 2CCJA 3REGA 1Z0AA 4DEXA 4DC9A 4TTRA 4TYWA 5J4HA 1NIPA 5KNBA 2ZI6A 2IEZA 4WBSA 4XVRA 1ZIOA 3LY5A 4LRWA 1CEEA 2NOAA 4C3ZA 4CT5A 3QVVA 4HB2A 1OXUA 2R6CA 2DB3A 3CM0A 2WSSD 3P26A 4CGZA 1CJUC 1OE0A 3B8HA 4IEIA 1NJGA 4LHYA 1SXJB 1D2EA 1Q57A 1TF5A 3DVLA 3V4FA 4BRWA 1ONBA 2QE7A 3H2YA 3IIKA 3Q3JB 4LV8B 2WWWA 5JEEA 2G77B 1H8ED 4Q1CA 2O0JA 2HV8A 4LUCA 1BS1A 1N5KA 4O2RA 1ZJ6A 2BM0A 3H0KA 3WRYC 4DCVA 4G1UC 1KI7A 2XXAA 4RD3A 4OI1A 3K09C 2JLRA 4RFSB 3GJ3A 2EW1A 4Q18A 1OKKA 1XFAA 3K1JA 5JWOA 2DYKA 2ZRDA 4NU0A 1VCMA 4MKFA 1E2QA 1L4YA 3IILA 5JWRA 2IC5A 5KTYA 2ZU6A 2GAAA 4EJSC 2WMOB 2PEYA 1FQJA 1HURA 4OHZA 2BEKA 1G4UR 4DEYA 5FTJA 2ZI7A 3FYHA 1N5LA 3AF2A 1X3SA 2C04A 3CF6R 3GJ5A 3WNCA 1RRCA 5IK2D 3IDQA 1W4CA 4CDGA 4DCNA 1Z47A 3GEEA 2QRZA 1X1SA 3CX7A 3Q7PA 1JEDA 1E79A 1KAGA 1YQTA 4ZIRB 2V8OA 4RJLA 4MYCA 5BXQC 4Q1DA 3EZ9A 5IDVA 2AXNA 2XB4A 2AK2A 1JXOA 2ZE8A 3CPJB 3VKGA 4TLBA 2AN9A 3DKVA 4CEJB 3C15C 3H4MA 1YU9A 2X8AA 1GILA 4V0LA 4Q4HA 4EPWA 1XB2A 3BERA 5CYOA 2ZJYA 2B92A 4US2R 1Q44A 2C95A 3QOFA 1KMHB 1CIPA 3HP1A 4XWOA 3I8XA 4RD4A 1AS0A 3CNOA 4B32A 2F1JA 2G88A 4JT2A 2UZ3A 5JHGB 4QBHA 1NLFA 2D2EA 1VG9B 3QKSA 3CO5A 4H9GA 2OZEA 3EZ7A 3MJRA 3NDBB 4UXIA 4V0OA 1W48A 2BC9A 1IHUA 1Z07A 3QXJA 1CR2A 1R10A 2IX3A 4NHOA 1YR6A 1E2HA 3SJCA 1F48A 2OAQ1 3UG7A 1KK3A 1KI3A 1OH8A 3NEJA 3X1YA 2BMDA 1XTQA 3TQFA 3M6AA 3RS0A 4E03A 4EQ6A 2ZRLA 4LCBA 2O8EA 1NVVR 1T0HB 3KQLA 1E0SA 2W6JD 1I4TD 3BH6A 2J7KA 4QGAA 3TVTA 1OH5A 3LD9A 1COWD 2OXRA 4MRVA 4B73A 5KSYA 2R65A 2JLSA 2GCOB 1G6HA 3K70D 4OKSA 3WXMA 1R0ZA 1N6HA 1P9RA 1ZUNB 5DI3B 4Q9LA 2ZJ5A 2PJRA 3M4YA 1YR7A 4NCIA 1XMIA 4C0BA 1HQCA 2V6IA 3OE7D 1E1QD 5DN6A 3B2EA 5EZ5A 2AWNA 3SYNA 2I1VB 3U4QB 1DBSA 3GLHB 1SXJC 2QG6A 4R7ZA 2XNSA 3NTUA 2X2FA 2JJ1D 4LHZA 4A8JA 1NP6A 3NWJA 3NC1C 4OJKA 3K0AB 4BRUA 2P2LA 2D62A 3THXA 5HKKA 1XCPA 2FX3A 2PEZA 4EIWA 2NO7A 1EFHA 2QRNA 4N0DA 4AYWA 1N6IA 3QJYA 3GLIB 2PLRA 2QI9C 2V1XA 4D4KA 3O8CA 4BEBA 3R8CA 3U44A 1R5BA 3VU9A 2MSDB 1TEXA 3UIEA 4UQOA 2J0UB 5F3WB 2ZRNA 2JJ2A 2IHYA 1LS6A 1UBEA 2XOKA 4UKDA 4LJ9A 1ZP6A 2Q3HA 2J41A 2Q3MA 1J2JA 1ZD1A 3TAUA 4HAXA 3TKLA 1WB9A 3VR1A 1JXMA 3NKVA 1WRBA 2RGGA 5P21A 3KJGA 4TMKA 4X8LA 2ZSDA 3D8BA 4C0LA 3L0OA 3MWJA 2EYQA 3C5HA 2A5GA 2ZSEA 3GLIE 2J7PD 2JCSA 4Q4AA 4R2IA 5JBQA 3KKPA 4HLCA 1N0WA 1R7RA 2GCPA 1VMAA 1ZIPA 4BZQA 1YZUA 2GVZC 1KSGA 3PG5A 4B3DA 1U0LA 4M2LA 3ZLJA 2BMJA 3MLEA 2ZVPX 3PENA 2CE2X 1R6BX 3TLXA 4LPSA 1G9XA 2Z4RA 2GESA 3X1ZA 2CE7A 4DBLC 3ZVMA 3K8YA 4BPBA 4S35A 1N6KA 2HF8A 2BHRA 5IT5A 5JS8A 4Z1MA 3B1VA 5G3ZA 3WBKA 2VHCA 2FFHA 1JR3A 1ESMA 2C2HA 5EJEA 4IXNA 4DT1B 2FSFA 3OIVA 2QORA 4RZ3A 1VKJA 1ZM7A 3CB4A 2BBTA 4D81A 2DFLA 3K70B 4GL2A 1MH1A 4AK9A 5G41A 2VH5R 4BLOA 5EZ6B 1E9AA 3RSOA 1SVSA 2ZR9A 3ZS9A 2FSGA 5LB4A 3DDCA 4Q66C 3SC3A 4HAUA 4LI0A 3T15A 4BFUA 4F4IA 4C7OA 4TZ6A 3SZRA 4NP6A 2VA8A 3A1TA 2JLUA 4ERNA 3ZIAA 3U7FB 3CRQA 4D4JA 2QAGA 4LHXA 4P31A 3S1AB 4B6FA 4ASUD 3QF4B 2GAOA 2PCLA 2WKQA 4MKIA 3TRFA 4B44A 5JECA 1XEFA 2IUTA 1P62B 4Q4JB 4A6PA 5FH9A 4PAOA 2RB4A 4B3GA 1QHYA 1DVRA 1RC8A 1FUUA 1GIAA 4DB2A 2GDJA 3TSZA 4ZCLA 4Y0VA 2DWOA 3K53A 3CUEF 1AQYA 4HB4A 4LJ5A 3GJXC 4GSYA 4EPYA 1TAGA 4HYYA 2BJVA 3ZGXA 2JEOA 821PA 1ZBDA 1NN5A 5KOYA 1OFHA 1ZCBA 1N5JA 2OCPA 3BB1A 4WXRA 5AJZA 2EWWA 1FOEB 4P0TA 1OPXA 3LO5A 2LKCA 2ORIA 2WMNB 4HLUC 1DEKA 1WXQA 4KBFA 5JHHB 1XD2A 4B3CA 4YQFA 3LBIA 2WOJA 4C0SA 4QM6A 4Q02A 3QNUA 1GTVA 3AVYA 4PC7A 1R4AA 4DLZA 3QBTA 1O3YA 1G5RA 2AHOA 2B7CA 2OBLA 5E95A 4B47A 3EIQA 1DAFA 3EZFA 1X6VA 4ITRC 2HJVA 4PFSA 2LWIA 4OQNA 1X8KA 5LB2A 2CHGA 3QI2A 4RD2A 5LPNA 2GXAA 1JECA 2ZJ2A 5E4FA 2JLZA 2H8KA 1X86B 2JLVA 4A4DA 4C0HA 3SJBA 1SKYB 4I1VA 4LYFA 2SHKA 5DSZA 5DHAA 3X1WA 1NI3A 1G6OA 2ZANA 2IUSA 5FPSA 1VYUA 2REBA 2I1QA 2B7BA 2OCYC 5JZVA 3C5CA 3HJNA 2ZROA 2IUUA 3QQ5A 2QM8A 1JAHA 1IXRC 4U5XA 2EFHB 3W8RA 2P0EA 4CEHA 4C0AC 1W2GA 1YZKA 2FZLA 4JBYA 4DIDA 2GEDA 3RWOA 1E2JA 1T8TA 3AVVA 4TL7A 3SHWA 1IXZA 2QA5A 2UVQA 1Z0JA 4DLXA 4ZI2A 3ASYA 3GLFA 4RCZA 1OHHA 2NQ2C 2J0QA 2GJKA 1EK0A 2G6BA 3MUFA 1RW4A 1T3HA 4MYUA 2Q3FA 4Q5IA 4EFNA 5JLJA 1O87A 1C9KA 3RS7A 4TYPA 4AIIA 2VP0A 1OT3A 3BAFA 2KI5A 3PEWA 3I61A 3GLGA 1IJFA 2ONKA 1MABA 5FOXA 2QP4A 3ND9A 4H1VA 4Q1EA 1S9DA 3K0SA 4B71A 1OJLA 4ARZA 3LW7A 4D0LB 2HCBA 2Z83A 4NPHA 3ZZTA 3CF2A 1KI1A 3K70C 1P2UA 3TSOA 3EX7C 3O8DA 3VR5A 3MRSA 3PFIA 4BZXA 4JVLA 1D5CA 3Q72A 4TL9A 2IYUA 3DZDA 4NE2A 3RS2A 5H68A 5AJXA 5CJPA 1G4AE 1US8A 3CF0A 2ZRCA 1A2BA 4A0GA 4B3FX 3B7GA 3CWZA 3FPAA 4L9WA 3D7MA 1II9A 2VP9A 3I3SR 3I32A 1P2VA 3ZD7A 4HDQB 4ILEA 3RC8A 3M0EA 4PPGA 2WWXA 2WKRA 1VG1A 3EZ2A 3GCGA 3DKPA 2ZRFA 1U8ZA 2GZHA 4NCJA 5HKKD 2CNWA 1G3QA 3QPUA 3HPRA 1Z6AA 4TL6A 4P32A 2ZR0A 2H18A 1GKIA 4FW9A 2DPXA 2OILA 5AJWA 5C2JB 3MAAC 3AKDA 4LC0A 4FMBB 4TQAA 4OHXA 1E6CA 2H17A 1IY1A 1W44A 1PV4A 1ZMXA 1XX6A 1NNEA 4C2UA 2JJ2D 1FUKA 1XD8A 1GRNA 4DSTA 1WDTA 2XOKD 4V02A 4TZ0A 2C03A 2YWFA 3W90A 1XDBA 1ZRHA 4BQSA 3PVSA 4MDFA 4Z51A 4KFSA 5E7IA 3RC3A 1E9CA 3AKEA 4KSCA 1IQPA 2FDCA 3B5JA 4DJTA 2O8FB 4KVAA 4GFDA 3T1VA 1XMSA 1QVAA 2FF7A 4F4JA 1NY5A 3FHCB 4BFZA 2R6GA 2CVHA 4UNQA 2R2AA 3MMPA 1OFIA 4D0GA 1VG0B 3GQBA 2N1BA 4DWJA 2WV9A 4HZIA 3W6OA 1XEWX 2NPIA 5E7MA 1PLKA 2MSCB 4TLCA 1X8LA 2V6JA 2X1VA 2O0KA 5DH9A 3W6PA 1AKYA 3H86A 3BFVA 2ATXA 2WAXA 1FW6A 3HR7A 4B3BA 4YMVA 1QHSA 4V0NA 3O8BA 1F2UA 4MYHA 1U0HC 3E1SA 3IO3A 3PUXA 5FBWB 4TMXA 1KI9A 2IYTA 5EE1A 3TK1A 2XTMA 2IK8A 1LW7A 3CONA 4Z1MD 1M8PA 1P72A 2JDIA 3MWKA 3DEFA 2O8EB 3AVTA 3PITA 3RS5A 2ZSBA 5K8TA 1NG9A 4DLVA 2GTPA 1NBMD 2IS1A 2ZREA 4MITA 5ANRB 5AJVB 5J4YA 2GXUA 1P60A 2IF2A 4UNNA 2Z5FA 3SJZA 1E2IA 1CJMA 1E94E 1TNDA 4IOJA 1E98A 4GP7A 1BIFA 2XTZA 4M1SA 1J8YF 4DLRA 5FI1B 5L3QA 1NN1A 3UG6A 4F93B 4OHWA 1YKSA 3AGPA 2XZOA 2BCGY 3CW2A 3Q7QA 3WMGA 4TSFD 3ZIAD 1MR3F 3MWYW 4KVGA 5KU1A 2ZM5A 1N0UA 1HV8A 3CWQA 3ICQB 1VYTA 5CDFE 2QP9X 3THXB 5EE5B 4E22A 2VP6A 1P2SA 2ZIAA 1FNNA 5JI3E 3CIOA 2BIFA 1QBKC 3CH4B 2CLSA 3EARA 4BECA 2RGXA 5BYKA 1GITA 4NDZA 1KI4A 3I1FA 1XXHB 2QTFA 4MUAA 3P20A 5JS7A 3U44B 3AUXA 2VF8A 1GZSA 4M1MA 1HY3A 4F38A 4JLMA 1E0AA 2I4IA 2VEDA 1FFHA 4IOLA 2C77A 3TUIC 1GNRA 3BS4A 1HTWA 1KSHA 3D6TB 5G40A 3A4NA 1Z0KA 4A2QA 4MRRA 3MWLA 3SQXA 3LAWA 3QXSA 2EWVA 3WMFA 2ZE5A 1D9XA 2GBLA 2IYWA 3ZD6A 1LTQA 4CF7A 4TL8A 1CR4A 1CF4A 2XJ9A 1TQ4A 1M2OB 2LCFA 3QG5A 4TT3D 1R0WA 1HYQA 2IF0A 2WICA 2P6NA 3BD9A 4D6PA 1D9ZA 1J90A 1G16A 1J70A 1QHXA 1XXHE 3QXHA 5B64A 1Z63A 2OAP1 1TU4A 4I81A 1WMSA 5FR2A 1K5DA 1FP7A 1NSFA 1Z08A 4BFVA 4XJXA 2IXGA 3BH0A 4LJ8A 3L82B 3K0FA 4EJSB 3LFUA 1AK2A 5DIFA 4B3XA 3FMOB 3AUYA 1UAAA 2W2VA 4LZZA 1PJRA 3EG5A 3CBQA 3LX5A 3ECCA 5BW8A 2VIIA 2IA5A 2VLIA 3VHXA 2AWOA 4NYJR 3U7GA 4MRSA 1BMFD 3AGQA 3NHAA 4PXAA 2ODNA 1ZU5A 1CJVC 1FTNA 2YJTD 5KPDA 1P6XA 3NXSA 1OV4A 4JLKA 2HEIA 3ZYCA 1Z0DA 4UNSA 2AKAB 4D4LA 1KI6A 4JLBA 3B1WA 1HEIA 1PUIA 4U00A 1GOTA 1Y3AA 2KE5A 1F2TA 2ZI9A 3ETLA 4JLNA 2ZI5A 4JYCA 3IEVA 3IEUA 3VNVA 2VL7A 2A78A 2XTNA 3IKJA 4JLPA 1KK1A 5HTKA 4GOXA 3SHFA 1G18A 1KK2A 5C4MA 3RWMB 3E70C 3KXKA 4C7OB 2V7QA 4HAZA 4AWXA 4AG5A 2RGDA 3F8TA 1Q20A 5M04A 5FTMA 4S2EA 1HT2E 1D6JA 1OIWA 4Q48A 4D26A 3Q9LA 4ZO4A 2FFQA 4XIGS 5JEDA 2V1UA 1NMYA 1P9WA 4DB4A 1KJYA 1XZQA 3SI7A 4ABYA 1NBME 5TB5A 1E4VA 3SBEA 4F92B 1GRQA 2DY1A 4NYIQ 1LF5A 3O8RA 4BLSA 4KO8A 1LF0A 5TXGA 2IHBA 2F43B 4C30A 2PL3A 2BVNA 2P65A 3I73A 2P5TB 1JAIA 2RGEA 3T1OA 5FUWA 4QGGA 5A5GA 2GNOA 4A8JC 4PHTA 2B8TA 1FPMA 1G3MA 1XTJA 3QIAA 4B2LA 2GKSA 1XD2B 1N6LA 1U81A 5KSZA 4A36A 2HYIC 2WAYA 1E0KA 3WYFA 4YMUA 4PQFA 2B8WA 2YWHA 2R9VA 2CNWD 4Q19A 2WOOA 2K5UA 1E2GA 5FTKA 4A2WA 1R8SA 2YNMA 4HEJA 5FBQB 1EG7A 4TMVA 4W5JA 3AM1A 1T4GA 4NKRA 2WSMA 4NYIR 4K8OA 4YC7A 3FFAA 4JLAA 3ADKA 4P4UA 3GJ7A 1ZW6A 5K8LA 3E5HA 1AJEA 4JLOA 4JVNA 2FN4A 3WNDA 2JLYA 3DO6A 4LJ7A 2OUKA 2OG2A 2W00A 2IL1A 5DO9A 1Q12A 1GNQA 1GSIA 3BXZA 2C78A 2HF9A 4CEHB 2JLQA 4MGZR 4R98A 4Q00A 4C0QC 3LRPA 4DCSA 1XU4A 2WWHA 3TR5A 4LSGA 2J59A 5B58C 1FTSA 5BWMA 1TQ2A 1ZNYA 4WZAE 4TN1A 1XNJA 5GJVC 4EDHA 3HYTA 3OEEA 3FKSA 1KKMA 5SZJA 3RYTC 1QHHA 2H5EA 2WJYA 4P33A 3QPWA 5HCNA 3GLFB 3LLMA 1DO2A 2J45A 2CVFA 4ESHA 1SXJE 2Q9AA 3IIJA 4EFLA 4LJ6A 2QMUA 3EA0A 3OIWA 1OXXK 3B9PA 2ZS8A 3VX4A 2AX4A 1G17A 1KOFA 5EP2A 3RSLA 3PUVA 4IFBA 4M0LA 4Z8XA 1KZ7B 3I92A 3GLGB 4G0NA 2QMEA 1YRAA 4Q7MB 2ZYUX 2NO0A 2ZITA 2CDNA 3TAHA 4N1AA 3EWSA 2QU8A 1SHZA 1S2MA 4PPQA 4QC2A 1C4OA 2OBNA 4ARZB 3PR1A 1Z6XA 8OHMA 1MO3A 2GCNA 1F60A 1ZNXA 2F3TA 4NBSA 5UKDA 3GFTA 5L3RA 4EFMA 1JB1A 3IGFA 3THOA 4XVQA 4PHHA 3C14C 4JL6A 1UM8A 3AF0A 1II8A 4KHZA 4X8MA 1E9SA 1CU1A 4YMTA 2GHIA 5L8VA 5J4KA 4QJ3A 1NVVQ 1YR9A 1TPZA 1RFLA 1US8B 3CX6A 4OQMA 1G21E 1MO6A 1Q1BA 1CRPA 2FPKA 2QAGC 2QQEA 2CK3A 4DSUA 2ZI3A 1RJ9A 1DG1G 1VTKA 1Z5ZA 4Z54A 2CHVA 1TMKA 3BIFA 3RVBA 3U3MA 4M1OA 3AH8A 5FPHA 5TARA 421PA 3LLUA 3HU3A 3C41J 5AUOB 3L2OB 3N2IA 1H8HD 1KIMA 2HLDD 4HB0A 2ZI4A 3ADBA 4URUR 4BEJA 2QTHA 4OK3A 4KYIB 3GEHA 4V0MA 2BKEA 2O5VA 4CRWB 1SVIA 2PBRA 1KY3A 3VX3A 1UPTA 3I8SA 2Q9BA 4PR0A 4A2PA 3EXAA 1LVGA 2MMCA 4KCGA 4XWKA 621PA 1G7CA 1QDEA 4M4SA 1Q22A 4M8NE 2XSZA 4QNMA 2X2EA 5D3QA 4B74A 1N6NA 1GP2A 1UDWA 3CRW1 3K9NA 3OEHA 3JVUA 1E2FA 2FMXA 1U8YA 2W6IA 3TH5A 3U3RA 2REXB 5FUXA 4XSHA 1U8AA 3TUZC 4IOMA 4KBGA 2GF0A 2WPDA 3LQQA 4B2PA 4AYXA 1P4SA 1JPJA 4GPTA 4G01B 3KKQA 2YOGA 2DFTA 1DAKA 4M9QA 4TYNA 2EFCB 2H57A 4KV9A 3SBDA 4XD7A 3WNBA 3EC2A 3MJHA 5AK0A 5G3YA 1D8TA 1F2UB 4IXMA 4LGMA 2H7VA 5HCIA 3UXMA 4QRHA 2ZXUA 1JI0A 2BM1A 3CPEA 1CR1A 4RZXA 3L43A 5AJYA 3U3KA 5F9FA 4QXAA 3U7HB 2CL6X 3F5FA 5SZIA 3L0IB 1NL3A 3PUZA 4QG7A 1HT1E 4BE7B 3ADCA 4WZBE 4XWAA 3VKHA 2C98A 4Q21A 3P1JA 4BFYA 4C2TA 2CEAA 4GRAA 3EIEA 1P3JA 2G83A 2OFXA 3GLHE 3KFXA 2IYZA 2XITA 3OESA 1EX7A 2NO6A 2GETA 4WA7A 1F6BA 2CMKA 2G0NA 5L3QB 3I5XA 4AKIA 4QM7A 2VQSA 3D3QA 3IUYA 3THWA 4JVMA 3PEYA 5H1YA 1NIJA 1E1RA 5HPYB 4AI6A 1T0JB 4ZDJA 1DPFA 4MH0R 4GZLA 1N6OA 2IWRA 5E7JA 4YXWA 2J87A 2VTKA 3W8NA 4ACBA 4Q4LA 2NZ8A 5EP4A 2ZU0C 1GKYA 2VP4A 4JVSB 2FG5A 1OXSC 1SVLA 2F7SA 2ZRJA 1W0JA 2VBCA 4LJAA 5TVKA 3VHLB 1DAMA 4M1KA 1Z0FA 3VFDA 1NRJB 4C9BA 5F9HA 2ODEA 3LW8A 3SFVA 4JMPA 4HAYA 2L0XA 3J81k 1EWQA 1WBDA 4Y0AA 5JJKA 2KB0A 1KAOA 1G5PA 1VHTA 3EWAA 1Q1QA 1G19A 2JIZD 1LY1A 4DZZA 4HSEA 2PCJA 3DZ8A 3QSYA 4NTZA 4JJZA 2XX3A 1VG8A 2JGNA 3B9QA 1CBUA 1OF1A 3BRWD 2IWHA 5C1BA 5J4LA 2EQBA 3TBKA 2A5DA 4JYBA 4OK5A 2ECKA 3BB3A 2Z6VA 2V55B 4UXJA 3O47A 5JMTA 5CIQA 2HDNB 2W58A 3SEAA 3AP2A 5KSPA 3AB3A 5AUQA 1JQLB 5FOSA 3L0SA 4URYR 5CLLA 5KNCA 2AR7A 4JKIA 2J0SA 4E07A 1YZTA 4KODA 5TMPA 1NY6A 5H8WA 2QE7D 1A4RA 3CPHA 4L9SA 1U0JA 3ZZ0A 4OYHA 1L4UA 1EESA 5FOVA 2V3CC 4XH9B 4JSYA 1RRFA 4Q9HA 3SOPA 121PA 4LYHA 4BLTA 4V0KA 3PUYA 1IONA 4YMWA 1OKKD 3QEOA 2HJGA 5EXTA 1KI6B 3OEED 4PZLA 3FKSD 2IEYA 1ZNZA 2GXQA 3B13B 3BGWA 1Z6TA 2IYVA 3CNNA 3T35A 2DHRA 1DG3A 1CJKC 4IFEA 1S96A 1SZPA 1XCGB 3WBJA 3QE0A 4QBIA 2FU5C 2G1JA 4HAWA 1X1RA 1DARA 4BLPA 4GNKA 4MGKR 2RHMA 4FMCF 4BGDA 3CRMA 4IDPA 3R8FA 1IN5A 2F9LA 3KQNA 2YWEA 1W49A 1AIPA 3QXCA 1OYWA 4Q1BA 3ZZUA 2N46A 1QHIA 2GEVA 3NH9A 1E79D 3CX8A 3ZDQA 2FGKA 4AD8A 2OESA 2V4ZA 1G20E 5GVSA 3C7KA 3T5GA 1W5SA 2NZJA 4CT4B 2YINC 5IF9A 3EC1A 2C9OA 1V5WA 1RYHA 2G0TA 1VYVA 3MCAA 4A15A 1Z06A 2ZAMA 2EYUA 2WJIA 4M9SA 5BN4A 3UMSA 2D4HA 3IHWA 2WWFA 1AS2A 2FEOA 2D7DA 3CR7A 4H1UA 3ICEA 4HAVA 2C5LA 1Z2AA 3IQXA 4GMXA 4UJ5A 2BV3A 4JT4A 4PAQA 2HCJB 4B34A 1AM4D 4NZYA 3A36A 4ZV4A 1SKYE 4Q01A 1KMQA 2QSZA 1NVUQ 3C16C 3EW9A 1HH4A 3QKRA 2ONJA 3EPKA 2QY9A 3A4LA 2XNDA 2ZYVX 5CB8A 3N5CA 1JNYA 1QRAA 2O0HA 5C18A 3T1TA 2EFEB 1A1VA 2QMHA 2G9NA 3UPUA 1YZLA 4BFXA 4OI0A 4QHTA 2GBLC 4XOIA 3NVAA 2YC2C 1W36C 1BOFA 2ZQ5A 4P3YA 5EE0A 4HUTA 1MOZA 4PTLA 4B43A 4W5HA 4TYQA 5FOUA 2FWRA 3QKUA 4D2IA 1G8GA 4QGFA 5KO2A 2IS6A 2YHSA 2W6ID 2WIAA 3REFA 2XXAB 1HQYE 1XMVA 1PZNA 1W46A 4RVCA 4M21A 3U7EB 2KSQA 4DUGA 5DN6D 1NF3A 2OEPA 3IO5A 4ESVA 4UNRA 3SR0A 1N5IA 1QHHB 2R8RA 1YE8A 4X8HA 3TSWA 4WXPA 5EUQB 2VO1A 5AWFC 1J7KA 4QHYA 4GI7A 2W0MA 3PIRA 4BFSA 4PC6A 4PO9A 1E9EA 3RRNA 4O0MA 3SDZA 3DL0A 4XD7D 2QROA 2BJWA 4LHVA 1ODFA 1R8QA 3PQCA 1VECA 3SE0A 4RZUA 4JIMA 3IQWA 4PSAA 2F1RA 5KUTA 2RMKA 2P6RA 2OLKA 1AGPA 2IXFA 1W0KA 3WYAA 3B6EA 5BYJA 4UXHA 3I5YA 5FUVA 4QGHA 1U9IC 1DELA 1W1WA 2C99A 3ASZA 5EP3A 2EFDB 4Q4HB 4ZCIA 4E5UA 2ZRIA 4ZDWA 3KXLA 3BC1A 2C8VA 3ZVNA 2WSSA 1RE0A 1QHNA 3RRZA 1FMLA 2BBOA 3R9WA 4XSGA 2YVUA 1M7HA 1ZM2A 1SHKA 1KY2A 1CRQA 3D31A 1SVMA 1E1RD 3VR4A 2X19A 4LK2A 1VDZA 3I72A 1H8EA 3R7WA 1IXSB 1G3UA 4AYTA 1PLLA 5KYKA 3KX2A 3QKSB 1FL9A 1R2QA 3UANA 1AA9A 1U2RA 2Z4SA 3Q5EA 5DI3A 1FMJA 4L5BA 2OM2A 2IYRA 2X77A 1PVOA 1AZTA 3FMPB 1Q0UA 2A3RA 2EVWX 2NIPA 2RCNA 3LNCA 2RGNC 1CP2A 5CM8B 1D2MA 1W0JD 2ERXA 2WTUA 4FIDA 4MKHA 2R6DA 1MKYA 2ZRGA 3W9YA 4EQ6B 4Q03A 4PANA 1G41A 5FI0B 4NONA 4WVFA 1JR3D 1XJ0A 2QGZA 1MO4A 3GEIA 3Q85A 3M1IA 521PA 5GVRA 4BASA 2LKDA 1AQUA 1E9DA 4TLEA 2QPAA 2ERYA 1L2TA 1OW3B 2QMOA 5GJCA 1UF9A 3GLIA 4W5WA 2RKOA 4MA4A 1EGAA 3QF7A 1XPUA 3G82C 1Z3IX 2O52A 3GJ6A 2ZYWX 2Q9CA 5HR5A 2PMKA 3A4MA 4LC1A 1NN3A 1ZYUA 4LYJA 2GK6A 1JPNA 2J46A 4PAMA 4V03A 1OSNA 5FUYA 2RGBA 2GA8A 4A8JB 1UKVY 3AVQA 2ANCA 1XF9A 2P6UA 3EAQA 4AC9A 4JLJA 2QT1A 4RZ2A 1GDDA 1GVNB 2FSIA 1M74A 4FWTA 3FMIA 1UDXA 3OIUA 3VU9B 4F4CA 2ZJAA 2ZAOA 3T61A 5JJIA 1IM2A 2EU8A 3TW4A 1R0YA 2YOFA 3AF1A 5FL7A 2Q6TA 3IPYA 1JBKA 2FPMA 1ZU4A 2Z0MA 1EFUA 1B0UA 2O8BA 4BLRA 4NYJQ 1EFTA 4IOKA 2YYZA 2MMGA 3K0CA 3KXIA 3N2EA 3BB4A 3AKYA 3HPQA 1XTRA 4L8GA 5DYGA 1FZQA 5C4GB 3LA6A 4KFUA 3VNUA 2IYYA 1MV5A 2WHXA 3WRXC 2OE2A 1KK0A 4OL0A 3U3JA 1XTKA 3THWB 1TX4B 1A5TA 3AF4A 4PO1A 4Q4AB 1VCNA 2BCJQ 5LD2C 2ZS9A 3THYA 2A5JA 4O25A 1UEIA 1COWA 3GD7A 2P67A 4A9AA 2CJWA 4QOSA 3JZAA 1UKZA 1V43A 4G5QA 4TMWA 3QVUA 1G291 4LV6A 4PC2A 5DNYB 5KSOA 1TU3A 4FCTA 4LV5B 1FX0A 3AV0B 4NCKA 1G1MA 5EXXA 1W4RA 4DLYA 5SZHB 1TEVA 2ORWA 2IYLD 5TY0A 4E09A 3QY0A 3B1XA 2ANBA 1T8UA 3K9LA 1G3IA 1RKBA 3OF5A 3OFNA 4QKQA 4JLVA 2CCKA 2GJSA 1M7BA 2OFOA 4RSGA 5KDOA 1QHGA 2JJ1A 4NYMR 4Q4JA 4NCNA 1KHTA 2W2XA 3NEYA 3QG1A 1TUIA 1NMXA 4Q7LA 3PJRA 1OIXA 3A1VA 1CR0A 2NO1A 3P27A 4JLDA 5GJBA 2DR3A 2FV8A 2VSOA 1VIAA 1N3BA 1OHHD 2D3WA 3CZPA 3AVPA 5JRJA 1JR6A 4D25A 3NDPA 4A82A 1S9HA 2DWQA 4CEIA 1EX6A 5FTNA 4EPTA 4P4TA 1UEJA 4L16A 1PUJA 1EWRA 1ZM9A 4OQFA 2N42A 1XD9A 1VCOA 2WJVA 2QAGB 1M7GA 5J5CA 1ZC4A 1XMJA 2IYQA 2WJHA 1SGWA 2QZ4A 4GBMA 4W7SA 2A30A 3FWYA 5JCZA 2GF9A 4PX9A 3W34A 5E3HA 1E32A 1XEXA 1OXVA 1JR3E 4Q1FA 1P5ZB 2KBEA 3LDAA 1I2DA 4JKYA 3W6NA 1Z6YA 2OFWA 2PMDA 3BOSA 4TMTA 3UK6A 4TLDA 3PEVA 2J3EA 1M1YE 1NVWQ 2CXXA 1KO8A 2TMKA 1P75A 1MT0A 3FTQA 2AK3A 4D4MA 1G7TA 1S1MA 4IKEA 4A0RA 3T06B 5IRCD 2WM9B 1F3OA 3NC0C 5A4JA 2DWPA 2A5FA 2D06A 4YDHB 1S8FA 5FBRB 3OAAA 4IVPA 5CITA 3V00A 3OZXA 3PXGA 3UKDA 3BFXA 4DUGD 1AN0A 4QL3A 4LJYA 4HI0E 1Z0IA 4MQBA 3T12A 2J5XA 2NGRA 1TL7C 3TW8B 2PLFA 1S3SA 4QJ5A 2O8CA 1IJEA 3BK7A 2MSEB 3DHWC 5TV2A 1GRRA 4TYYA 4CYMA 3JZMA 3H1TA 1T91A 4OI2A 5EQTA 3CRVA 1XRJA 2WWYA 1R5NA 2QEQA 3AQ4A 4A0FA 4HB3A 4KITB 1YRBA 1WCV1 3W5IA 4U02A 5ELXA 1KNQA 2QSYA 4US0R 1AGRA 5FR1A 4I1OA 3BJIC 4IW3B 5DE3A 4I1UA 2ZUBA 1T5IA 5KPJA 4LBWA 2ZJBA 4A0HA 4QNRA 3ZQ6A 1T3LA 3VTKA 4BLQA 3RRYA 1II0A 4ASUA 5KHOC 2ZRPA 3RS4A 4LJ4A 1IN8A 3FDIA 1X8JA 2GZDA 3PV0A 1XTIA 4WZ6A 5L3VA 4DHEA 2ZE6A 3SQWA 1YZQA 1NJFA 1G3RA 3TVDA 3RLFA 2QN6A 1G8FA 2RGAA 5FTLA 2ODWA 3L0PA 3GPLA 3LXXA 4UJ3A 1BKDR 2ZR7A 5BQ5A 3W5JA 1N6PA 3IBYA 5L3SA 5J40A 6Q21A 1TUEA 1E4YA 3NBXX 2C9YA 3QKRB 2FGJA 2ZYTX 1P9NA 4GT1A 3DMDA 5EE3A 2ZETA 3MSXA 5FOTA 1FP6A 2GILA 1E0JA 3KJIA 5JFGA 1SKQA 3FOZA 4Q9IA 1IOZA 1MABB 4U7DA 4HLDA 1TTTA 3DMNA 3BWDD 2ZRBA 1C1YA 1GL7A 1IN7A 2DFKB 2JDID 2E9SA 4KLZA 3GJ0A 2DBYA 4JJKA 4AY2A 5DYIA 5JSZA 1E2EA 3AF3A 3AVUA 2OV2A 3WHKA 1KNXA 1HE8B 4X8OA 1E96A 4RCYA 3A1UA 2HT1A 3GLFE 3FHTA 1N2CE 4M9XA 2HYDA 2KJQA 4ZI3A 3KUCA 1KO1A 4DDUA 1AKEA 3C8UA 3VR2A 3KB2A 3Q5DA 3ZVLA 4B76A 4QJ4A 3QEJA 2YC4C 3VKWA 1NVXQ 2JAQA 1HE1C 3EPHA 3GLGE 2ZSFA 1WBBA 3U3OA 2BMFA 3X1DA 4CIDA 1LB1B 4EPXA 3TNFA 4AKEA 1JEEA 4OI4A 4YMSA 4A92A 2WJJA 3CLVA 2JLXA 3KUDA 4I99A 4GOJA 2O8FA 1DOAA 1E69A 1P73A 1GL6A 2R6FA 3CKLA 2CLDX 2F1IA 3ZJYA 3QKTA 3MFYA 4OQLA 1W47A 3DM9B 1GFIA 4TWZA 1G5TA 5FL7D 4O2LA 2ZUCA 2F55A 4JL8A 4IRUB 1T6NA 2FSHA 2IXEA 3T1QA 4OQXA 3KKMA 4J0QA 3KZ1E 3I62A 2A2ZA 1W36D 3RABA 2ODBA 4NMMA 2FPLA 2B6HA 3R9XA 1E2LA 4QBFA 1CKEA 1G8HA 2BKUA 2OLJA 2YZ2A 3BE4A 2ZJOA 3IBGA 4G3XA 3SJAA 3ADDA 3LBNA 5CDFA 1LFDB 4HDCA 2AFHE 2GEUA 1EFRA 2ZVQX 4B35A 4CZ2A 4DRZA 3MGCA 4WW0A 2IS4A 4DDWA 3R7WB 2ASEA 5JWHA 2W83A 1G8YA 4PZZA 4P4SA 4R2HA 4B75A 1ZUIA 4LBVA 1TF7A 5FBLB 5BN5A 1YR8A 1LNZA 3CRRA 2C96A 3AVOA 1R5OA 3QBVA 4WOPA 2R44A 1DAHA 1DO0A 2W0SA 4DCUA 3C4JA 3UWOA 1OLOA 3SYLA 1S0UA 1UKEA 2OSBA 3JVVA 4KYUA 5CYPA 4URVR 4GOKA 4TLAA 4ZDKA 5F98A 1P2TA 1KDOA 4URWR 4MUBA 1NKTA 2A9KA 3OFND 4I4LA 3CR8A 1KI2A 3ZH9B 1Z8FA 5EP1A 2A7QA 1IY0A 2QPTA 4LX0A 5KDLA 1W4BA 5B2ZA 1ZM3A 3AVXA 4LHWA 1KZGB 2NTYC 3FMFA 5D3MA 4DCTA 4ZKDA 2JASA 3G5UA 2IW3A 3UATA 5AR1A 1RPZA 1S3GA 3V4RA 1XXHA 4BWYA 1K6MA 3NH6A 5EXSA 4HATA 1E2MA 2BDTA 1MRSA 2NPFA 4US1R 3MD0A 2BMEA 2CHQA 4URXR 5DHFA 2V7QD 4F91B 4TQUS 1NSTA 5LDDC 1M6NA 1XJCA 2GK7A 2KWIA 3H84A 4PO8A 3AVWA 3TE6A 3DM5A 4K46A 1QF9A 1ELOA 1JJVA 1E2DA 2NO9A 5J47A 3A1SA 1ESNA 1Z29A 1XWIA 2ZRKA 2E87A 2PZEA 4Z8YA 4AG6A 3WMEA 4G5GA 4KFTA 1EXMA 1SULA 1T9HA 1GG2A 1ZCAA 2OXCA 3K09A 4DLUA 1W2HA 4C0KA 2QAJA 1Q1EA 3VMFA 4FI3C 1N0VC 3KL4A 4AURA 4W9MC 5B30A 4G5RA 3TR0A 1E9RA 5HZKA 2QBYA 1VPLA 4EJSA 1S4QA 3OAAD 4KAXA 3QXXA 1OH6A 2O8BB 4FWIB 1W36B 3RDPA 1BO6A 1NN0A 1GM5A 2RHDA 4YDSA 3U6BA 5C46F 5HZHA 2GJ9A 3AKCA 2BEJA 3HU2A 3P32A 1NLZA 4ON9A 5CIWA 3P4YA 1ZM4A 5CB6A 5KDDA 3F0TA 3TIFA 3FHOA 2PX0A 3P4XA 4PSVA 1N25A 1TQDA 1S1CA 2IBMA 2OT3B 2WBLC 1Q3HA 1A2KC 2FE4A 3QENA 2VHJA 3VQTA 2YKGA 3THYB 3U60B 2FA9A 4B33A 2CJWB 2FFBA 3K0FB 1NBMA 2CL0X 3BBPA 1UJ2A 3EASA 5SZKB 3SS8A 4C4PA 1U98A 4JL5A 3KTAA 3MG9A 2OHFA 2F9MA 1NG1A 1M34E 2GJAA 2HXYA 2PZFA 2WVJA 4JZKA 2CBZA 4IDNA 1FX0B 4LBYA 4DKXA 2IYSA 1CLUA 3SYKA 4ZPXA 3NHBA 4M1TA 3RAPR 4TMZA 4TSFA 2B21A 1L8QA 2FEMA 2ZJZA 3RS3A 2CL7X 1GUAA 3L8ZA 3FGNA 2Q21A 1T3SA 2NG1A 3OHMA 5GADl 4RD1A 1SVKA 3UWKA 2QUZA 1CJTC 4B2IA 1XP8A 2V9PA 2OO7A 4FMDF 5FOWA 3B1YA 2RAPA 4DDTA 4HZUA 1F2TB 5CK4A 4FD2A 1E9BA 4II7A 1NLYA 1RZ3A 2XZLA 1CXZA 2KBFA 4KI0A 1KO4A 4TTPA 4HUQA 2J1LA 1Y63A 4CEIB 2D74A 2ZRHA 2G3YA 4IHQA 4LBZA 2VP2A 1JJ7A 3EIHA 3QPVA 5FBVB 2J9RA 1IBRA 2WIBA 1Q1ZA 3RANA 2F43A 4KFRA 3NG1A 4EKDA 2O8DA 4R9UC 4EAQA 1XCMA 1CULC 1DAIA 2RH5A 3GP8A 1UBGA 3LVQE 4KSBA 4GP6A 3X1XA 1JALA 2IT1A 1XEXB 4FINA 1I4LD 1XJQA 4IJMA 2HXSA 3IIMA 2BOVA 3BH7A 5DLQC 3RNLA 4B48A 2H16A 2AD5A 1UADA 4TT3A 3A37A 1BYUA 2REOA 3CZQA 4QBGB 3LV8A 4F7WA 3FKQA 4OHYA 3F3YA 3VAAA 5FPTA 4LDJA 1OYYA 5KNDA 3GMTA 2QGNA 1SQ5A 3CNLA 2XZPA 4MKGA 4PQYA 2HUPA 3VR6A 4LWZA 3TQCA 3UMFA 1SXJA 1T5LA 2CK3D 3LH5A 1IAQA 4DLSA 1E2KA 1TF2A 1H65A 1RVDA 3LVRE 1HA3A 2JA1A 2WWGA 5AUPB 5AUNB 2PX3A 1IY2A 2CCGA 3GJ4A 2O8CB 1KDRA 2YWGA 1BMFA 3PUWA 4D0NA 1W5TA 2VHQA 2ZEJA 5IHPA 2VF7A 5DGXA 4TTQA 1W4AA 4G5SA 3K0EA 4RFSA 3U61B 3WP0A 1ZINA 2IYXA 2P3SA 2QP3A 4R71A 1XTSA 1RRGA 4PPNA 2ATVA 2FH5B 1FNMA 3NIBA 5LBIA 4B6EA 1OH7A 1KSFX 4JBWA 1RRPA 1W7AA 1J99A 2PJZA 4BFWA 1KGDA 4PPFA 3KFVA 1OIVA 1XBTA 5H70A 3ZQJA 3SU8A 1KI8A 1Z83A 2V54A 3HWSA 4DDVA 2XSZD 3K0CC 4Q7KA 3V9PA 1G8PA 2VHTA 3A8TA 2E1RA 2Y8EA 3LXRA 2YV5A 3OEHD 1L7VC 1WQ1R 1I4DD 1ETUA 2D2FA 2DFNA 3LQRA 4DSNA 1XPRA 2W2TA 3UMRA 2H1LA 4ZIRA 1B23P 3T5DA 4DLWA 1CS4C 4D82A 3BORA 1YJ5A 2VSFA 4IDQA 2FOLA 1EFRD 1KYIA 4RD0A 2WPDD 2GWHA 2VP5A 4O3MA 4CEJA 2FFAA 2GJ8A 1MO5A 2UZIR 1XZPA 2VYFA 2CLCX 3SN6A 2ZTSA 5L3SB 4BZPA 3AP1A 3NBYC 2ZRAA 2BWJA 1ZC3A 4L15A 1OFTA 1DAGA 4BFTA 2G1KA 3DOFA 1KMHA 3X2SA 1VIYA 4WAUA 2H92A 4CW7A 5JI2E 5CJ2A 5LD2B 1UBCA 2NMVA 1E2PA 1E9FA 2ZE7A 4PHGA 4WIAA 4YONB 1D2NA 4NL4H 5JSZB 1J8MF 5CM9C 1WA5A 2OCBA 2J0VA 3TGPA 4D80A 5FPYA 1DE0A 1II8B 1Z22A 4N0EA 3KQUA 2QT0A 3OIYA 3ZVRA 1YVDA 1JQJC 1WF3A 3NBZC 2XJ4A 2OCAA 2JATA 4IVRA 1KO5A 5J4VA 1VHLA 2VRWA 5EXPA 4UNPA 1DS6A 3B78A 1WP9A 1OFUX 3WYGA 2Q0HA 2XAUA 5A0FA 1RJ9B 3DOEA 1BYIA 3T34A 3WY9A 4XVUA 4NCHA 5DISB 4YXWD 5CK5A 2XB2A 1GWNA 2GCOA 2PT5A 2ZPTX 3R9IA 1QZXA 3KJHA 4OBEA 4EPVA 1WE2A 3ND8A 3KQKA 3EPJA 3LX8A 4Q9KA 1QG2A 4PZYA 1Z6GA 5EUMA 2IS2A 4OHVA 4NH0A 4MYTA 1GAJA 4FN5A 1KJWA 1ZD9A 2FJUA 3B82A 1E99A 5F2EA 3GJ8A 5G53C 3U4QA 2R6AA 3GLHA 2QPOA 4PC1A 2WZQA 4GDFA 2UKDA 4HLUA 3K0AA 1ZD8A 4M1WA 1LV7A 4I1SA 5TDHA 1R0XA 1KDPA 1KDTA 1KSJA 1SVWA 4MRPA 4DSOA 2QM7A 4Q1AA 4QHSA 5IK2A 1XPOA 1RIFA 5FFMA 2GZAA 2JJ8A 3KJEA 4G5OA 4IDHA 4L4UA 5FL3A 4RY2A 4A6XA 3IPXA 4N3NA 3U5ZB 3EA5A 2J0UA 5EE9A 4C0JA 1K5GA 4OK6A 4EUNA 3DPUA 4V0ME 2ZSAA 4KXFB 2WKPA 2D7CA 4KLNA 4XTRA 4ACAA 1G64A 2ZUDA 2AFIE 4P4SB 3B85A 2I3BA 1PLJA 1FQKA 2PH1A 4MDEA 3EPLA 1UBFA 1Z2CA 4IVQA 4AKHA 2PZGA 4FCVA 1G7RA 4JS0A 1KJZA 3LWNA 1LS1A 3W3ZB 5JJLA 4M22A 5DI9A 2Z43A 1QVRA 3GFPA 1MRNA 3RHFA 1F5NA 2VSXA 4K81B 1RYFA 3HYRA 1ZVQA 2WJGA 4OJQA 4GMDA 2GRJA 1CTQA 2R62A 2AL7A 5D3MB 3KDSE 1H8HA 2HLDA 5JCPA 1E3MA 3RRMA 4PC3A 4A1FA 1ZNWA 4AKGA 4NYMQ 1OXTA 1NMZA 4IEEA 1GNPA 2DCUA 4JBXA 3SNHA 4GZMA 1DADA 2AXPA 4URZR 3AP3A 2BBSA 2W6JA 4HLQB 4KJZA 1GKUB 1A82A 221PA 4DT1A 1ANKA 3WP1B 2EFGA 3TUJC 2AD1A 5CLQA 4MGIR 2P5SA 4EPRA 4DXAA 3Q8XB 4KU4A 4M1YA 3K9GA 1YZGA 4HDOB 4XTCS 4ZKEA 1Q3TA 1TADA 2VHUA 3FFBA 4ZDIA 2ZRMA 1U90A 1Q21A 3LBHA 3FVQA 3OE7A 1E1QA 3HDTA 4RKFA 1KKLA 4Q7JB 1SVOA 3TMKA 1GL9B 4M9ZA 3U6KA 3B60A 1DAEA 2WWIA 3S1AA 5K8IA 3G0HA 3QF4A 1Z28A 2QBYB 4LOAA 4TQ9A 5K8UA 1BH2A 3A1WA 1AZSC 1SXJD 1K8RA 2ZS7A 2F1HA 1IN4A 4CVNA 2XGJA 3FB4A 721PA 1VCIA 5HE9A 3CH5A 3KB1A 4IDOA 2BBWA 2XNDD 3I4LA 3IHLA 1UKYA 3PEUA 5FPKA 4MGYR 2QQ0A 3SFZA 4PHFA 2FZ4A 3A58B 4QFMA 2PT7A 2AKYA 2GVDC 3HR8A 1U94A 4YLGA 2VPPA 4DLTA 1G7SA 3N70A 4BUJA 1ZAKA 3BFKA 1OB2A 3KTAB 4Q47A 1NKSA 1U9IA 2XEXA 3L8YA 4FMDB 1I2MA 4Q9JA 4LYAA 1DTSA 1P7CA 2F3RA 1IN6A 3PCRB 1E2NA 2OBMA 1U99A 3FE2A 4DVGA 2J7PA 4MRNA 4ZCMA 4JSTA 3KKNA 2GXSA 3QUSA 3AEZA 2HT6A 3ZS8A 4RD6A 5JRZA 1OB5A 1YZNA 4FMCB 2F6RA 4DIEA 3R20A 1P61B 5B57C 1EFCA 2QL6A 3U2QA 1UFQA 4LY6A 3K9HA 2ZJ8A 4HZUB 1A7JA 3WHLA 5HE8A 4POAA
chains in the Genus database with same CATH superfamily
1XAJA 1T5TA 3W5BA 4ONEA 3QEAZ 2SKEA 3JQBC 3S40A 4GYJA 2V98A 4HUQB 4AKTA 5DCLA 2RGNA 3N0WA 1DINA 4ZKDA 4YRMA 2A5YB 5G0VA 2W2MA 3TTVA 3KPWA 4PSKA 1LLFA 1BN7A 2GASA 3HVHA 1UZAA 3L93A 4PSUA 4RKEA 2NSLA 5K8CA 1QG4A 2JIZA 3EVFA 4ZICA 5BN3A 1YR2A 1KO7A 5IAAA 2FG7C 2SKDA 4X7PA 1ZSVA 2AX3A 5ENZA 5HKLA 3I6YA 4D9NA 2ORVA 4AP5A 1A7UA 4LDNA 3O91A 1H3EA 2BL4A 4M53A 3C3XA 1Y8RA 1U04A 1UPFA 1I30A 2XUDA 3M5CA 3WGUA 3HDYA 2CNDA 4FXPA 1JHVA 4A10A 4DEXA 2CCJA 2A0FA 2IPOA 1JZQA 1RJWA 4MMYB 4TTRA 3RVDA 4KWIA 1DDIA 2O7SA 3ENNA 4HFMA 4AMYA 5J4HA 2IEZA 1RC0A 5KTTA 3T3NA 2ZAGA 2ATCA 1RPNA 1ZIOA 4XVRA 5PGMA 4LRWA 2VXYA 2NOAA 3LVFO 5T8KA 3QVVA 4HB2A 4CT5A 2I6QA 2AI3A 3CM0A 5IH3A 3E0QA 1GPUA 4AIRA 4N7MA 1OE0A 3B8HA 3O9MA 2VCHA 3WGHA 4CMIA 1D2EA 1JSLA 1Q57A 1HQKA 1KZ4A 1TF5A 1HQDA 2OCGA 2VF2A 1MGOA 3DE6X 3O84A 4R2LA 4YO7A 3Q3JB 4UBIA 2WWWA 2VJPA 2O1SA 5JEEA 4RE5A 1AX9A 1D2AA 2YUTA 4V3CA 1L5HA 3QJ5A 1IOLA 3MNFA 2IYEA 4PNHA 1P45A 1ZL2A 2ZYIA 4C3OB 1B76A 4ES6A 4Y3UA 4Q3EA 2LUOA 4MVWA 1ISFA 2PM8A 4O2RA 3ON5A 2BM0A 4CU2A 3GQVA 1BJTA 2X9LA 3Q3HA 4KPGA 2X8LA 1YCDA 1PNQA 1KI7A 3S28A 1JQBA 3I9MA 4Z7NB 4HYQA 2XXAA 1K88A 2YDXA 4OI1A 2HMSA 3SIPA 3Q8MA 4MWBA 2ZRDA 5EHQA 5AW0A 5TPWA 3DR3A 3NZEA 1CSEE 4GBJA 4NR0A 2JLCA 3BBLA 2VJDA 1GGKA 4GUDA 4H7HA 3VH1A 3J80A 1CHDA 2WMOB 3TPCA 2PEYA 1B00A 4KW7A 5FIUA 1HURA 3TIVA 3VNQA 1ID1A 5DM60 1U5BB 3HUFA 5FXMA 1QYVA 2FQXA 1WEKA 1TKAA 2ZI7A 3OU6A 4FYJA 3O2SB 1G21B 4MMZB 4BIIA 3FYHA 2C04A 5HWSA 5HF8A 4HGRA 1O97C 4DR7B 3P2YA 5IK2D 4B85A 5F78A 2PY6A 2EP7A 2QRZA 3Q7PA 4GGPA 1WCIA 1GTMA 3V6MA 3ESRA 5CDUA 2PV0A 1KE2A 5I7RA 4PZAA 4MYCA 4HQRA 2AXNA 3MB5A 3T6KA 5A5FA 4TLBA 3W1EA 1ZUWA 5TX7A 4CKWB 3BREA 4X7BA 2X8AA 2L18A 4GVLA 4DTIA 3U7JA 4D8WA 3THSA 3A3YA 4K9NA 3UFXB 1Y7HA 3BERA 5CYOA 3U62A 4CT0A 5EIEA 2ZWOA 2ZJYA 3G9QA 4NG5A 4KO1S 3QOFA 2JGKA 1QK4A 2VXCA 3OZWA 2WZCA 3BMNA 4FDVA 3RC7A 5EQDA 1B2LA 1AS0A 2EV9A 3H7IA 1J06A 5HF6A 2F1JA 5BUQA 5JHGB 3W0LB 2VZEA 4QBHA 3IB3A 5D85A 1R6UA 1T1SA 2K87A 3D3WA 1C8BA 2XGOA 4CUZA 3B6MA 3SC4A 1JFTA 1RYEA 1CEYA 4OFZA 1S2DA 4Y30A 1YS7A 1JKJA 2C57A 4M0DA 5I4IA 1Z07A 4BUCA 1QFSA 3ILSA 3K6KA 3URKA 4RHCA 1TMOA 5JVDF 2QB5A 4NHOA 1OAOA 2E55A 1E2HA 3B6IA 1DV2A 2NYVA 2UXCB 3QOXA 2C0QA 3ELUA 3NEJA 4J9UE 3M6AA 5CXSA 3OUTA 4J16A 5TQ2A 5ICGA 2ZRLA 4KQXA 4HT3B 1LCIA 2W6PA 3G88A 5I9TA 1VE5A 4QULA 4EHIA 1MX1A 2XIQA 1MA0A 4G1BA 1MTOA 1WB5A 2J7KA 4QGAA 2BMVA 2BMAA 4FMPA 3LD9A 1EUZA 1COWD 3L46A 3WYEA 5D7NA 2R65A 5E9JA 4YJGA 3S81A 1QWSA 2LCIA 2P62A 5J2UF 4LF8B 1G6HA 4OKSA 4IGEA 2WJ4A 2GM9A 3VGJA 4GX2A 4Q9LA 1FRNA 2PJRA 1ZRMA 1N33B 3DW3X 3IP3A 2WZDA 2I1WA 3KJZA 4P3OA 3TBHA 4UBKA 3ZWXA 4WZBB 3DBRB 4C6SA 5E4TA 1E1QD 1BE6A 5EZ5A 5B1IA 4JGGA 3ZK7A 3WZMA 4EG3A 1G2QA 1P9LA 2XNSA 4R7ZA 1DFHA 3ZNQA 3EAGA 2UYHA 1AQNA 1WETA 4OJKA 5FFFA 5JAPA 5HKKA 2AQHA 1M6YA 3VOAA 4OGGA 1HZJA 3LP6A 4AYWA 1WVIA 2I76A 3HJUA 5F73A 3SXUB 1N6IA 5F2KA 1XA0A 2QI9C 5I9NA 1P80A 1O6BA 3CZ5A 4ZREA 1N34B 4U2DA 1J7JA 1R5BA 3HYNA 3BTSA 1WF6A 3EEQA 2MSDB 3WKCA 1DC3A 3T1HB 1G66A 3Q40A 2Y1WA 2J0UB 2C7RA 2R3SA 2YJGA 1LXCA 5K3DA 5B37A 5F3WB 3CJQA 3MTDA 1IATA 4ZCPA 1JEQA 2WVGA 1SIWA 3HZHA 3HYCA 4I19A 1FTYA 4QSHA 4CTMA 1AA6A 1UT8A 4A8PA 2J41A 2NTNA 2QRKA 5EN4A 4WEOA 2XYVA 1V71A 3I30X 4R8VA 1TT7A 2R4UA 3L0BA 1V41E 5IM5A 2E49A 5AKJA 4UUNA 4OO3A 3ZW8A 2I55A 4TMKA 1VSQA 1M2OA 4C0LA 3L0OA 2FMTA 1BGVA 4Z4HA 4GZ3A 1QCCA 1ACJA 2CFCA 2ZYGA 3Q41A 3UY4A 2A5GA 2RI0A 4FGWA 4NARA 4XEUA 4ZOQI 2R7KA 2ZSEA 1JKMA 2JGRA 2ZYSA 3EXHA 2I2AA 2JCSA 4R2IA 1ICIA 1MC5A 3E3LA 4FPXA 1K6XA 3VPSA 3KSZO 4HLCA 5ALNA 3ONEA 3VSAA 1ZIPA 3JVIA 3S2SA 1YZUA 4U7JA 4YP5A 1WDLA 4KDFA 3SQLA 3FR8A 3F5QA 1XCLA 1RBYA 2BLNA 4FFSA 1S2IA 4C29A 2ZVPX 4KMMA 4MPTA 1R6BX 4WASA 1MHTA 4D3ZA 3ZWDA 2O3QA 1Y8QB 4LPSA 5EMNA 1CETA 2EX0A 3HYSA 4L3WA 5BO5A 4UBOA 1LPAB 2XWQA 4H1WA 5JS8A 3Q88A 4Z1MA 1OC2A 1P7WA 4I9GA 1DL5A 3WB9A 4TM7A 2VHCA 4XDHA 2BFCA 3HGQA 5CLHA 3EY9A 5ALUA 2C0CA 3QM1A 1XWFA 2UAGA 1M2KA 4IQ8A 4R1NA 4IICA 3FRIA 4UVGA 1LNSA 4B6RA 2FSFA 3W77A 3DQPA 1HC7A 1Z4LA 1VKJA 2I87A 2PZ8A 3CB4A 3P2IA 4EHNA 5C7IO 1OT5A 1J5EB 1TFRA 2DFLA 3AKZA 2QVZX 4YGYA 2FZGA 3MOIA 2NYAA 4LK3A 4Y98A 4BLOA 1ZR2A 4YRZA 2VJMA 1LDBA 4JBNA 5CDGA 3ZS9A 3MMNA 3UAZA 3UGTA 5BW6B 2ZT5A 4BFUA 4TZ6A 1DGQA 3SBOA 3SZRA 2VA8A 2R00A 2CB0A 5DT2A 3CRQA 4LHXA 4PLZA 5KOHA 1K68A 1YDMA 3QF4B 3TRFA 4B44A 1UMDB 5JECA 4DA6A 1XEFA 1Q6YA 1YNSA 3G0CA 4JP1A 3VC1A 5TMBA 5F1KA 4EVSA 3OQIB 1DVRA 4KUEA 5F7XA 1Y80A 3C3CA 5DM1A 5E6UA 1SKBA 1O9BA 4JYMA 3NHUA 4Y0VA 2GVNA 2DWOA 5CH8A 1PDWA 1AQYA 4HB4A 4LJ5A 3W3AH 1B15A 2PX8A 3GJXC 4BNIA 4FEYA 1YMUA 4MWEA 4HYYA 2BJVA 3ZGXA 1GNVA 821PA 3QP9A 3LPCA 3CJTA 2VH2A 4MMXB 1GN8A 2ZAYA 1X77A 2BW0A 4NS1A 5IFKA 5JLAA 1Z68A 1TO2E 2IEGA 5AM4A 4J3NA 5ILOA 4RVNA 4XD2A 4ZVUA 2BZ1A 4FILA 4UCQA 1XQ6A 4Y7DA 3HACA 1KPGA 3ECSA 1C9MA 1FZTA 1DEKA 3CA8A 3WLAA 4Y6LA 1WOMA 4TUYA 1XD2A 4KQJA 5IAKA 2JBWA 3LBIA 3T4PA 1V5GA 4B3CA 5LM3A 3JQ7B 1EK5A 3CIFA 3NORA 4GM4A 3TW8A 4C01A 3CVVA 1QTQA 3RNOA 1R4AA 3PLAE 3FWKA 3AVYA 4QYIB 4MWCA 1G5RA 3E8MA 2OBLA 1E1YA 3IUQA 3EZFA 3KV1A 4INJA 5F9MA 2BP7A 1G5FA 3WJ2A 2YTZA 1RYZA 1ULUA 3I2GA 1R6VA 5LB2A 3C4VA 2A5LA 2QF7A 2ZJ2A 2H8KA 1X86B 3WL8A 4DDHA 1PX0A 3EVAA 2RONA 4C0HA 3ITNA 4YCAA 3X1WA 4L0QA 3VYUB 3KYCA 4J2TA 2IUSA 1UWCA 3B38A 3LT0A 1R64A 1VYUA 2REBA 1U31A 2OCYC 2B7BA 4GWLA 4OXRA 3HJNA 2YXNA 4K8RB 3NEAA 4RS3A 3LTEA 2IUUA 3WS7A 4FEGA 1GY8A 2C2ZA 3BXGA 1IXRC 4DR6B 4D0SA 4CEHA 2FZLA 4DLLA 1DKPA 2GEDA 3RWOA 1N1DA 4P8RA 5KOIA 4PICA 1NRWA 1VXRA 3STVA 1P4RA 1R15A 3AVVA 1E7WA 3VGPA 3HXKA 2QA5A 4N6OA 1ZUD1 2UVQA 4RTPA 1E1MA 2QRPA 3IE0A 3FTDA 1N2XA 2UXBB 2QRLA 3OX3A 3GLFA 2ZPUA 1QIKA 3UJCA 1Z7YA 1Z8DA 1L7MA 3G9XA 4QEKA 5CDYA 3MXOA 1ZD5A 4I9FA 4EFNA 5JLJA 1EFDN 4OHPA 4QYWA 4AIIA 3RAGA 2VP0A 3UBTA 1NC1A 3PEWA 1TJNA 1RJFA 2IZ5A 2RC6A 5CG2A 5IU6A 3I61A 1IJFA 3HSYA 1XSEA 3A1FA 3PPXA 4LQCA 4ENQA 1ADBA 2B82A 5D7BA 4B71A 1U6JA 2AB0A 4D0LB 3WFJA 2C2KA 5K3FB 4K6OA 1L4EA 2Z83A 1PFWA 3FI0A 3OCZA 3ZZTA 1UM9A 2J3IA 3FIUA 4C6RA 2QW8A 1P2UA 1LBIA 2Y99A 1TC1A 1D8AA 2XEDA 3ANMA 2HTEA 3G5LA 3O8DA 3MRSA 3RTCA 3PFIA 5IAGA 1YKFA 4R9NA 1USWA 2PL1A 4FFPA 4JVLA 4WLEA 4QWWA 1I4WA 4BZXA 3HXMA 2IYUA 3DZDA 4NE2A 3RS2A 3NDJA 4EY5A 2JCVA 3L01A 4LGVA 4BO6A 1A95A 1P18A 3B7GA 3GLQA 4IINA 4L9WA 1DRJA 4UPDA 3QLEA 3N6RA 1RLMA 4YP0A 5B36A 1YOVB 4NPCA 2B4YA 3PSAA 5CB4B 7REQB 1OFVA 1XAHA 3ROGA 2BSAA 3WLTA 1P2VA 2WAAA 4O4LF 4ILEA 1H4TA 3HJTA 1QFMA 1TTPB 3AY7A 3M0EA 4MIYA 4PPGA 3ZWAA 3FBWA 2O7VA 3GCGA 1VA5A 4N39A 2ZRFA 3R5SA 1CQJB 3M1YA 4CN9A 4AQ7A 4TL6A 3RYFB 3UB4A 4TV8B 2CXTA 2OILA 2QRMA 5C2JB 3ZZMA 1OTXA 4L6CA 3B3JA 4RL4A 3ROQA 1MIOA 3AOEA 4MR8A 3AJDA 2XQFA 3DT6A 3RVLA 2BH9A 3K94A 4LVUA 1E4EA 1PR0A 3KZOA 1SUWA 1DRWA 3PXBA 4FMBB 1PV4A 3UFBA 4X61A 3I28A 3LQ4A 4C7BA 4C2UA 3DDWA 1SCQA 4H6XA 4F6RA 5JFTA 2ECPA 2PFKA 3AM5A 3OTHA 4ILKA 4KXLA 4V02A 1T4CA 1G8SA 5T41A 4AQYB 2C03A 3VPFA 3W90A 1U2PA 2FZEA 3BK2A 1TEHA 2WM2A 3PVSA 4LXIA 4UTRA 4Z51A 4MDFA 3T38A 3ZBQA 2ESRA 1XTBA 2BGJA 4TZKA 3UH0A 5JD6A 3AKEA 3AUFA 3IEKA 1L8LA 3O1HB 3NQ41 4W4TA 2HPVA 2PS3A 5I3CA 5T4EA 1XMSA 2FF7A 2MSLA 3QFHA 3FHCB 3IUMA 4RNCA 2B6NA 4UNQA 5JNTA 1XCBA 2IU4A 4MYRA 2RKWA 3GQBA 1KQGA 4QJIA 4BVKA 4BMCA 1NVBA 2NPIA 2VJQA 1IWPB 1J2EA 1UBLS 2W93A 2Z2IA 5E7MA 5TC4A 2GERA 2GPYA 2MINA 1K5HA 2FRDA 2X1VA 4WACA 1B2RA 1NTRA 2QTCA 1R4MB 3QVXA 4A6DA 5C8DA 3W6PA 1AKYA 3H86A 3RAFC 4ZQHA 3R9XB 1KORA 4PAWA 3HR7A 3IALA 5EQJB 4N8DA 2IV3A 3ZCPA 4B3BA 3R6DA 1QHSA 2CZQA 5MGNA 1F2UA 3VPHA 4QWMA 3H18A 3R4CA 3KOYA 4HN2A 4W6QA 4YMGA 2BFBB 4F3TA 5FBWB 4DYDA 1KI9A 2DQKA 2IYTA 1OZFA 1Y37A 1XN1A 1ZSYA 4BYGA 1U7ZA 4EVQA 5HKBA 1P72A 2QW0X 3K5IA 3SX0A 1ZH0A 1VKNA 3H5TA 2GPJA 2ZSBA 2JVIA 1CY1A 3CG0A 2PFSA 5K8TA 3HA7A 5BWNA 1QQTA 2FFJA 1JDPA 2G63A 2COKA 2VBGA 2FAXA 2IS1A 5J4YA 1L5RA 4UNNA 5A71A 3F3MA 3RJ9A 5I9IA 3LQ2A 1E98A 2XTZA 4B4UA 1RQPA 2A86A 3IXLA 3VDXA 3PUIA 1NN1A 2CXQA 4F93B 3FVRA 4JU9A 1YKSA 1CX9B 4UTZA 4DOMA 3R3XA 5SYAA 4YT2A 3USCS 2XZOA 3SHTA 5AM2A 3QTLA 4G9GA 4QXQA 3V3TA 4TSFD 3PLNA 2CWDA 3EF3A 3ZIAD 4CKXA 1ULAA 1VL8A 4E33A 4KVGA 5KU1A 2IEBA 3ICQB 4PFQA 5GINE 2WTNA 3ZDYB 1VYTA 2PQ6A 3WL7A 5BR4A 4OP2A 1HETA 3CE9A 4GZ6A 4KE7A 4RGQA 4D8VA 5CDFE 3CVUA 3THXB 2EJCA 2ZIAA 3EVEA 3T9EA 1WULS 2H54A 1P1BA 3VNAA 1QBKC 2PLAA 3ZTWA 2RGXA 2FOIA 3UUWA 1SWVA 1KI4A 1XXHB 4E88A 4MUAA 4D45A 2RD2A 3EVDA 1W19A 1QIIA 1K0UA 2CBGA 1T2EA 3AUXA 3R3ZA 5AI5A 2G4VA 2HA0A 4UAUA 3AX6A 5DBGA 1FFHA 4EBBA 3TUIC 4GPEA 1I1HA 2FTKE 4UPEA 1MLDA 2VUTA 2WTAA 4MRRA 1QIGA 3I1JA 4A2QA 3F3KA 1ADYA 1BKYA 3U1BA 4RPJA 2ZE5A 4NDNE 5ALJA 4BNYA 5CA1F 1LTQA 4E2FA 5A03A 5E0OA 4NBVA 5ICEA 4MHTA 1G5QA 1RADA 2CXPA 3ZHUA 1KU6A 1TZJA 5CG1A 2LCFA 1NX9A 1R0WA 1HYQA 5ARBA 2P6NA 5HKAA 4L28A 4D6PA 4UVHA 1RHJA 2MYNA 1J90A 3KZMA 1XXHE 1JDJA 2OAP1 5GQSA 3BUSA 3HEBA 5FR2A 1K6IA 4UAGA 2JHCA 5BN1A 3WO1A 1FP7A 1NSFA 2A84A 4BFVA 1OV6A 5JDIC 3BH0A 4LJ8A 4RAOA 3L82B 2HSGA 3MWGA 3K0FA 4EJSB 1AK2A 2CHEA 5TGZA 3ESZA 1RQRA 4XQ9A 3CO0S 3EG5A 3CBQA 1YKGA 3ECCA 2BR3A 3BF7A 2FMHA 3GMSA 3YASA 4Z4FA 2HB6A 1JYFA 3DAOA 2VLIA 4QARA 1E5DA 1NUPA 1Y9AA 2YZMA 4D9KA 4PGFA 4KR2A 4DQUA 1MNQA 3K1AB 1J25A 4MRSA 2YJ6A 1BMFD 1X9HA 3KEGA 3PK0A 3R0QA 2O3JA 2UZ0A 1T2NA 2XCIA 1W75A 4PXAA 4MTLA 1HDCA 2CNNA 1FTNA 1P6XA 1VPTA 1DXYA 5J1SB 4ROSA 1REQB 4XCQA 1U1FA 3GDHA 3MJVA 3KU1A 3R40A 4LQDA 1EP1B 1EJBA 1HYGA 1JS1X 2QSUA 1F2TA 3ETLA 4JLNA 2ZI5A 4JYCA 4YUVA 3R76A 4MLPA 1NURA 2ZVJA 2XTNA 4JLPA 1L5GB 4H4DA 3P0FA 1QMGA 4G0YA 2DETA 3PICA 4FD3A 1RMQA 1KK2A 5BR7A 5C4MA 3AOGA 2ZCJA 1TIKA 1B0PA 2F00A 2FZKA 4EKGA 2PH5A 2Z95A 4QIHA 4Y9DA 5ALHA 4JI0B 5JASA 1QGYA 3D3EA 3EEYA 4NY1A 3VR6H 3AF6A 2XT9A 2RGDA 4BNXA 4DXHA 2C8LA 5T57A 1IUPA 2W6NA 4Q48A 3P2KA 1VMDA 4D26A 4ZO4A 1T9GS 3TM5A 1K9VF 2PXCA 4XIGS 4Y0NA 2V1UA 1PGOA 1NMYA 1YUBA 1P9WA 2FWMX 3QVGB 4YAWA 1R9MA 1R1DA 1ZRNA 5B6IA 1J0CA 2O1XA 3SI7A 4ABYA 4MAAA 3AEXA 1XZAA 1WAMA 5LZ7A 4BAZA 4DRYA 1L7AA 1HDXA 3EUEA 3SBEA 1RQNA 5EKXA 1QHEA 4MVJF 2WSLA 4YYEA 2QZSA 2P4UA 2IHBA 3ENVA 2F43B 3G6WA 4WK0B 3T94A 4AROA 4OX9Y 4HDNA 1B6TA 1DT3A 2WE8A 3FPLA 5B3JA 3I73A 4IBOA 3E3OA 5F2NA 2FVYA 2WZBA 4LY3A 4QGGA 5DMHA 2ZYDA 2VXBA 3KR9A 4H7IA 4M0PA 4XB2A 5ENVA 3ZWWA 2B8TA 3QIAA 4B2LA 1Q0PA 3ZYZA 4GF5A 4XCVA 5KSZA 4TWIA 1MHPA 2WAYA 3WYFA 1QDUA 2C2MA 4YMUA 2EKPA 5TQVA 3H2IA 1ZK1A 2C8KA 2R9VA 2CNWD 2BHTA 2H9IA 3GLUA 3GG2A 3T3GA 2OVFA 3HNRA 4OGFA 1GADO 4GC9A 4NOLA 3CEMA 3BQMB 1UP6A 3AM1A 1T4GA 4PLTA 5T7BA 4NKRA 2B2NA 4JDUA 4NYIR 2B36A 4YC7A 5TS2A 2RDMA 5DLPA 1B6SA 1J07A 5JJCA 4XKJA 4PNEA 3STXA 1GTG1 4JLOA 3AZPA 5HJ7A 2OHVA 3LYHA 2YFHA 2FN4A 1CVIA 4ENWA 4GM0A 3JD3A 4LJ7A 2OUKA 4CV2A 2WU3A 3LL4A 2IL1A 1HF3A 2P9HA 3CW8X 1X42A 2BFPA 3OZGA 2ZRQA 3I9FA 4Q00A 1RAHA 1EB9A 3LRPA 3R7NA 1N2IA 5IWAB 3C8DA 4B3IA 4D8TA 4EUEA 5B58C 5BWMA 1TQ2A 1ZNYA 3PQ8A 3I2FA 4B6SA 5CT5A 1U7PA 5SZJA 2P2YA 3RYTC 4KC0A 4EHLA 1YBVA 1GDTA 2H5EA 3WK5A 1GLGA 4P33A 3O95A 3HRKA 3LLMA 2J45A 2CVFA 3KXDA 1SXJE 1GPH1 1IHOA 2YXLA 4HEA1 4INOA 4LJ6A 4QO8A 3F9CA 3H13A 1XZKA 3HKDA 1NOKA 2LTAA 3LDGA 5AVRA 3KK0A 4DNFA 1GPAA 1Y3DE 4Q37A 2X5XA 3UJNA 4GLOA 1XTUA 4AY6A 3PUVA 4EFDA 1AXGA 4CKCB 3KC2A 2J3MA 5I9LA 2QMEA 1YRAA 2ZITA 4IGIA 4QXPA 3C5VA 2FP4B 1FP2A 5TQJA 1DQYA 4PPQA 1WZNA 4QC2A 4ARZB 2OBNA 3M33A 1QUEA 3PR1A 2GTIA 4JP5A 5TNXA 4HVLA 5G4KB 1BSVA 4RKYA 4TMFA 4CIAA 2FP3A 4C1BA 1ZNXA 4KH0A 4BS9A 1YB1A 1Z73A 2BT4A 3MEQA 4XWYA 3OPYI 4XVQA 5KAMA 1UM8A 3TEFA 5HFJA 1C29B 1CU1A 1LDNA 3L8GA 5I9SA 2OHJA 2IYAA 3ZQ4A 3NFRA 1TPZA 2QUKA 2RBGA 3QBDA 3E3NA 1MO6A 4WFKA 1C9DB 4OMDA 4LNUA 3TN7A 3G2OA 3IL2A 4LOKA 4C2AA 1JVNA 2J3KA 2BGKA 2TMYA 4LXQA 2ZI3A 1RJ9A 4RACA 4PE5B 5TMEA 1RHMA 3UV3A 1DG1G 1Z5ZA 1BWQA 3G59A 4KZPA 2R86A 5K0BA 3GLIB 4B9EA 4ND7A 4ZEMA 3ZY5A 3HEAA 4JQOA 4ZI7F 2AJTA 4LYEA 1DHTA 2HA7A 2OLEA 3IRVA 4HFJA 4X44A 3HU3A 5TGDA 5FLYA 2EX1A 5AUOB 5DWDA 3L2OB 3N2IA 1E58A 5CEJA 2HLDD 2I71A 4DA7A 5HK9A 3RADC 2PO5A 4EY8A 3ADBA 4YUXA 2BI4A 3TRHA 1XRRA 3KSAC 3CFYA 3GEHA 4HQKA 4ADSG 3TOCA 4CRWB 2XA2A 4ZZ0A 2VKTA 4M99A 2UZAA 1SVIA 4NZ9A 3AINA 1UPTA 3CLHA 4FEEA 4PR0A 4A2PA 4EQZA 3WIOA 1QVVA 2MMCA 3ESAA 1DV1A 2FYTA 3JSXA 3OM9A 4WK6A 2VCEA 4FYKA 5CX1A 4GW3A 4DCGA 3K20A 3NAMA 2QZ9A 2BI7A 4M8NE 1BX3A 3B3AA 4B83A 4QNMA 2X2EA 1ZPDA 3IC5A 5IBPA 3V8VA 3WADA 1MVOA 2D00A 2UYYA 3P9QA 1M1NA 4JEIA 3ZHRA 2CNOA 1T9KA 3T41A 2MU1A 1QLWA 5JXHA 2BHNA 4IXDA 3CEJA 2JG3A 1DFGA 4YO8A 3CT4A 3OLVA 3U9LA 1TGVA 4TVOA 4XSHA 4BQNA 2D1TA 4Y6PA 4P5EA 3TL6A 1IY8A 2BRUC 4GI5A 4IOMA 3U3ZA 4KBGA 1EDOA 1Z39A 4JASB 3CEAA 1P4SA 2AEJA 1D1SA 2XBMA 2C4KA 2ZTHA 1GYQA 1GCUA 2WW8A 5HW0A 3BXOA 4GPTA 4BMYA 1RHRA 2FSVC 1XXLA 2O05A 3OTIA 4KV9A 4Z53A 3SSAA 4M0CA 5AK0A 1XWWA 1KETA 2TS1A 1D8TA 2BF7A 1KRHA 3IURA 4G81A 1NVFA 5HCIA 4DRXB 4WN3A 4QRHA 3NBKA 2BM1A 1JA9A 3CPEA 4DWWA 2HMTA 1UXKA 4QXAA 3U7HB 3DCIA 1ZVJA 3L0IB 2EIXA 3EGDB 3Q2IA 3BYZA 4QG7A 3OH8A 5F3RA 4N49A 4NCBA 1XKLA 5FWYB 3O94A 4Q21A 3P1JA 4BFYA 2O9JA 5E1BA 2HMWA 3OU2A 2WQ6A 1IVNA 4AZSA 3HVRA 1Z7WA 2G83A 2W6MA 3I37X 5K0CA 1LLCA 3GLHE 2FN8A 1IMJA 1JH8A 3OESA 3DOIA 3A3PA 3MRTA 4X90A 3E84A 4RE6A 2OYRA 3RVQA 1F6BA 1XTZA 4NNJA 5AXDA 1WUIS 1WW2A 5FA6A 1BHSA 4IPTA 4RTRA 3PDHA 4OCZA 2VQSA 4WKCA 4EG0A 1LQUA 5K20A 3L40A 5KOJA 2R48A 1GZVA 3IT3A 1KQNA 1CVLA 5IH7A 5KX5B 1NIJA 3LKVA 3IUNA 3MBOA 4KO3S 5JS6A 4AI6A 4ZDJA 4KGZA 4MH0R 2CNLA 2JI7A 2VF5X 1N6OA 4XFJA 2IWRA 3WGZA 2DLCX 4RABA 3M4XA 4ACBA 4K26A 4XIYA 1VMEA 1V3VA 1FVFA 4F3CA 2IHKA 2JIMA 3JTEA 4M6WB 1AUVA 2WR8A 4BMPB 4CCYB 1HMYA 3FWZA 4F0JA 4ISBA 4NZMA 4NCAA 4ZO8A 1QF7A 1W0JA 1QAMA 2H63A 2YVQA 3PNBA 4M88A 1EGVB 2XYGA 4M1KA 5TVKA 3LRTA 5AXAA 3WWZA 1NRJB 4NBTA 5T5QA 1A5BB 4YJ3B 5HRCA 3WA7A 5JJKA 2R1TA 2L0XA 3BE8A 3J81k 3GJYA 1PWYE 4AJEA 3OIGA 1V11A 5FD8A 4ZVNA 3BTUA 1TM1E 2JIZD 2QUAA 2TRSB 4A8TA 4BKMA 4LDZA 2ACKA 3DZ8A 1HOTA 3SZGA 3U4IA 4Z0TA 3WV4A 4O2AF 1TKRA 2HJWA 4LZNA 1VG8A 1RZUA 2JGNA 4RWZA 2R1VA 4LCEA 1EK6A 1CBUA 2VJCA 3B9QA 1UFRA 2O0MA 3BA1A 1FF9A 4L8VA 1QP8A 2HA6A 1VHJA 2A5DA 4W63A 4OK5A 1TQHA 5FRDA 3KLBA 2V55B 1F1JA 1I14A 2GEJA 3K16A 1BTOA 1MBZA 2HJSA 3O47A 5JMTA 2OQRA 1JV2B 4K1XA 1YIAA 2HDNB 2QQ5A 1VFPA 3I09A 5H02A 5MDHA 2WFAA 4ESOA 4J9VA 3AB3A 1ISPA 1B8OA 2YRFA 2JAWA 3PC6A 1NQAO 4HPWA 2JGMA 5EJ2A 5KYXB 5DJ5A 4A91A 1BEUB 3A04A 4KODA 1FXWA 1QNFA 1NY6A 3WI7A 1W88B 1J0DA 3VXKA 5AVSA 1A4RA 1FYDA 4L9SA 3BMCA 3E82A 4HRXA 3H1FA 2BCEA 2C4TA 1M83A 3ASUA 3FOCA 3OCUA 5DB4A 5I5GA 4ZVTA 3K71B 3NHYA 5FOVA 4DA0A 2V3CC 2WD7A 3SOPA 3UZUA 4D3XA 4ZVOA 3D6HA 4N3BA 2RARA 121PA 1MJGM 2Q9UA 3OTWA 4A03A 1NW6A 3N2GB 3C5WP 4BLTA 1RXYA 2F8TA 3PUYA 1K3TA 3PBKA 4YMWA 3ACCA 4ZT6A 3KXPA 3STWA 5EXTA 5IEBA 1S2GA 2IOYA 3AXSA 2Q6OA 3LUCA 2GFHA 4ZU6X 2GXQA 5EA2A 3DZBA 5FLKA 2GBCA 2IYVA 5IN4A 5H5JA 1DG3A 1CJKC 4IDDA 2X4LA 4IFEA 4N0PA 5F1YA 3WBJA 1T6XA 1GGMA 2FR0A 4QBIA 4XXHA 4B3TB 4CG1A 1GPDG 5DT9A 2I8CA 3FTNA 1T1GA 2DQSA 4FMCF 3FF4A 2B8NA 4IDPA 1IN5A 3RTAA 4JJEA 2F3PA 5B1HA 3UGQA 2V6GA 4K9KA 1AIPA 3D8HA 1OYWA 3ZZUA 5LIPA 2N46A 2HDOA 1YSCA 3NH9A 4XIFA 2ICAA 4U9UA 1CUEA 1BJRE 1CQIB 1GQFA 1H85A 1X1CA 3ETNA 2V4ZA 2FN9A 3F1KA 4AN1A 3RD5A 1DFIA 4PLGA 5EGSA 1N5DA 3CINA 3T5GA 1KL7A 2ZIVB 3EC1A 3BJZA 1UKAA 4QASA 5IKMA 1ZESA 2P0AA 3VOBA 4IHJA 3HCNA 4WKPA 3MT7A 3AG6A 3RIMA 2EJTA 1XVVA 3EQ6A 4M87A 2WJIA 2Q1YA 3SKXA 4OLAA 1EGMB 3DTYA 2LD4A 3UMSA 5I45A 2XB6A 3ZE1B 1HTTA 3K96A 1OZGA 4C1NA 4Q12A 4C4ZA 2D7DA 3CR7A 2O8NA 4H1UA 3OO0A 4WKNA 5BN3B 5ALGA 3S70A 4DZRA 1E3IA 4GMXA 4UJ5A 2NU6B 1LD3A 2HCJB 3SIWA 4RDXA 4CFSA 1VA4A 1Y8RB 3L9WA 1AF7A 2A35A 2DF8A 3DMRA 3PQDA 4IIEA 2HF2A 2V45A 1SKYE 1UCFA 2DKOA 4HNUA 1HH4A 2ONJA 2VHXA 2QY9A 3KELA 1IB6A 2B0JA 2XNDA 3HGMA 4BO5A 2NADA 4DBVO 1EA7A 3LPLA 3GL9A 3N5CA 3EHEA 3CNBA 3G7UA 2HEGA 2KLHA 1A1VA 2PSDA 4XUGB 3V34A 4WERA 3IUPA 1E3EA 2Z2ZA 2R66A 4B5LA 1YZLA 4XDGA 4CQLB 5CFMA 2HA4A 4QHTA 1X7XB 2GBLC 4XOIA 3RIHA 4BV8A 5C1DA 4CLOB 3DONA 2CD9A 5DK6A 1S89A 3HCAA 3JU3A 1UKBA 4K6KA 4LX8A 5EE0A 5LQRA 1I24A 1IZ9A 2H5JA 4UD6A 1CR6A 1WMBA 1WM1A 4LXUA 5FOUA 4AX4A 1VMKA 2FDXA 1G8GA 4QGFA 5FNVF 1SHUX 3UJ3X 5B4UA 3OFJA 5KO2A 2A0WA 4YRDA 1EM6A 2XXAB 3L41A 7MHTA 3G5AA 4NCXA 1OGJA 1UJMA 4OOEA 3DXZA 5A05A 5HJ5A 3MHTA 6LDHA 4Q7QA 3TLGA 2VJNA 2PRKA 3TZEA 1Q83A 1U2QA 1PJLA 3A2MA 4KPFC 3ZDEA 4DUGA 4H31A 4ALMA 4MUYA 4UNRA 3SR0A 4MA0A 1QHHB 3AMVA 5A0VA 4J0KA 4X8HA 1L5MA 4D9HA 3RGGA 1JEYA 1T8YA 2F8MA 2QRHA 2YW9A 2EL9A 3CR3C 4DCOA 4ML3A 1U3FA 1I2BA 5AWFC 4ECAA 3Q15C 5BVGA 4E1VA 1EQUA 4BFSA 2W0MA 5L51A 1CIJA 1MX5A 1USUA 2DFPA 4PC6A 2VYQA 3DL0A 4C0WA 2AFHA 1RCTE 2FW8A 4F4UA 4HO1X 1MB3A 3B3GA 4IIJA 3PQCA 3MXTA 1M2VA 2XADA 4MUMA 3LUGA 1N5RA 2F1RA 1WCIB 3KQWA 1SUPA 2ZZNA 4XGNA 1TA4A 1K6JA 3KCQA 4AMBA 2M9MA 5LU8A 1L8OA 4CL2A 4CU5A 1XTPA 3EGVA 4D5EA 4HEA6 7YASA 2HIHA 3SDBA 3G8BA 3GXBA 1E63A 1W0KA 5I47A 3RYCA 1WZ2A 5BYJA 3TZ6A 3R77A 4RA6A 4G9BA 4E7PA 4D7AA 5IBCA 2C99A 3KVRA 5DYNA 2Q3LA 3ASZA 3PIDA 1Y8CA 2ZPAA 2EF0A 3IQEA 4UCXA 2W8BB 4TQGA 3RASA 1EVZA 2CNKA 1FMLA 1SXGA 3GLKA 2YJ5A 2XBLA 4RFLA 3DSRA 2P9EA 4X95A 2NNLD 4K88A 2PZMA 1DWQA 4IS2A 3T7JA 5EHIA 2FB9A 2BDEA 1X1TA 3KDAA 4ND2A 3D3WB 5EOVA 5G4LA 2NVBA 3DNFA 5WRFA 1LPSA 3UANA 1FRZA 4E4TA 1UJBA 2V0CA 1QPGA 4KP7A 1JKJB 2P41A 2YQZA 1ZUNA 3O4FA 4QNNA 3UOGA 5HQ3B 1OAKA 1S01A 5E2BA 1HYHA 3ZY2A 2OM2A 2ZQYA 1LVUA 1NVEA 2IYRA 2X77A 2XGGA 1AZTA 3CS3A 3DKKA 3DMPA 2EVWX 2QSJA 3FMPB 3LNCA 2WTMA 1CP2A 4UHFA 4QTTB 4X1IB 5EZQA 4CDMA 1CD5A 1O0CA 3W9YA 5CRIA 3LC7O 1G41A 2ECFA 5FI0B 3PQ7A 4NONA 3CF4A 3UHOA 4Y2PA 3UA3A 1PD1A 5KKNB 3NVMB 1MO4A 3A2NA 3GGPA 3CXUA 4O4HB 4C3VA 3ETEA 4MI1A 1YE3A 521PA 2LKDA 2XGSA 2R96A 4TYMA 4DILA 1TT5A 4ZQBA 2IIVA 2Q7OE 3ZK8A 5H83A 4FYHA 5D00A 3PA8A 3T7IA 4RHTA 5GJCA 3GLIA 1IM8A 1YQWA 1QZUA 2FK8A 4QQKA 3CNHA 3EWNA 1XPUA 3P9IA 3GJ6A 1JR2A 4I0WB 4TKVB 1F38A 3ZE7A 1P17A 2YNMC 4AB1A 4JXJA 3JD1A 3L0YA 2QLMA 1ZHFA 4FEAA