2ZI9A

C4s-e247a dck variant of dck in complex with cladribine+adp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
242
structure length
242
Chain Sequence
TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYASLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Elucidation of different binding modes of purine nucleosides to human deoxycytidine kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 242
sequence length 242
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2008-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zi9A00
2HLDA 3B2EA 1OJLA 4LJ4A 3RRZA 2GJAA 2NO9A 2JJ2D 4BEJA 2QBYB 2AN9A 1GZSA 2QNRA 1W4AA 3PFIA 5EUMA 2R6CA 5DHAA 3FPAA 4QJ3A 1KHTA 3Q8XB 2WWWA 1E0JA 1KSHA 3RS2A 3H0KA 2AFIE 3GLHB 5EXSA 2ZIAA 2ZI7A 3ASYA 1JEEA 2HF8A 2FGJA 4OI4A 1V43A 4I1OA 2OESA 4LJAA 3D8BA 4B6FA 1E1QA 2EU8A 3QKRB 4LX0A 2VO1A 1I4LD 421PA 4DT1B 2IYVA 1G3QA 2XNSA 2DHRA 3WY9A 1QRAA 2AK2A 3TVDA 2ANBA 4RD6A 2PZFA 2FEOA 2FPKA 1E0AA 5GJVC 2KI5A 4DB2A 1Z2CA 3CRRA 2O8EB 3CF0A 5DH9A 2G83A 1NIPA 2J87A 1AS2A 4YMVA 1NN3A 1FX0B 1DOAA 1E9BA 2V7QA 3HPRA 5AJVB 2QUZA 1II0A 3GFPA 1G6HA 2FJUA 4US1R 5DE3A 3I8XA 4NMMA 5AK0A 4MUAA 1OB5A 1N6LA 4HZIA 1EX7A 4KJZA 2J0UB 3BFXA 1GAJA 1PLJA 2ZRFA 4HB2A 4B35A 3KB2A 3AP2A 2OBNA 1Q21A 1MABA 2ZITA 3U6BA 5H1YA 3SZRA 1SHZA 5IRCD 3U4QA 2VHQA 2QMHA 1NBME 2ZR9A 5JJLA 2SHKA 2QT0A 4HLUC 2ERXA 1R2QA 2WKQA 3IQXA 3QBTA 4R9UC 1R7RA 1NLZA 3KL4A 4QHSA 4WAUA 4IOKA 3ZIAA 3AH8A 3TUJC 5JMTA 1DO2A 3EC1A 2PEZA 3R8CA 3OFNA 1P2SA 2YV5A 5JJIA 4FCTA 2IYWA 2F1JA 3CH5A 1QHXA 2XSZA 1E9SA 1ZD1A 2QPOA 1S3SA 3TLXA 4HZUB 3ADDA 4IVQA 4DVGA 4M1YA 4EJSC 1COWD 2JLQA 4LJ6A 1XNJA 5HTKA 2F7SA 1W4CA 1E2GA 3T5DA 4BEBA 2WJIA 3ADCA 3ZGXA 1K5DA 1KK0A 2CL6X 4QBFA 4LYAA 4BECA 1P60A 2C9YA 4CEIA 1P62B 5FOTA 4A2QA 2B92A 1LTQA 1RRFA 3X1DA 4GBMA 1II9A 1E1RA 2UVQA 1Q3HA 3AVPA 3DL0A 2FF7A 2P3SA 5K8LA 1CKEA 4LHXA 3WYGA 3BB1A 1TQ4A 4I4LA 4XSGA 2FSFA 5AUNB 4LJ8A 1R0ZA 1CJTC 1E69A 1QF9A 1QHNA 5GJCA 3AF0A 3FB4A 1CJVC 1IN7A 3VKHA 3TKLA 2X19A 2Z0MA 5BQ5A 2FG5A 4I1SA 2ZRGA 4NYMQ 2ZRBA 5G3YA 1G5TA 5AR1A 5AUQA 4IDNA 4XOIA 3PUWA 3JVVA 2Z5FA 3K8YA 4PSKA 5DGXA 3K09C 1WBDA 1ZUHA 3ASZA 2A78A 3H1TA 1GL6A 4PO8A 3FHOA 3P20A 1TQDA 1OFHA 2IXGA 1P7CA 1P2VA 4AIIA 3KJIA 1XMJA 4EPVA 3EWSA 5HKKD 4TYPA 2QM7A 1T3HA 2PX0A 4CIDA 2QE7D 3OHMA 3VR5A 4YXWD 1UPTA 1GL7A 5J4YA 2JLVA 2PT5A 5JHGB 1G291 1Z0AA 1BOFA 1ZBDA 3TRFA 2YWGA 1IXSB 2O0KA 1ZP6A 2OG2A 4O2LA 1G5RA 2ZANA 3AF3A 1IN4A 3ONWA 3KQUA 1E0SA 5BWMA 4U7DA 2RKOA 1XZQA 3B8HA 1W0JA 1Z0IA 1FQKA 3C16C 4GPTA 4HLQB 1SKYE 1XEXB 2ZSAA 2YNMA 4OYHA 1KSFX 1B0UA 1ZW6A 1GKYA 1SVLA 5AWFC 2OILA 4OHVA 4DKXA 1Z5ZA 2MSDB 4MDEA 4QGGA 2QBYA 1IJEA 4JLNA 2VSXA 4UJ3A 3EZ7A 1RFLA 3R8FA 4B3BA 5LDDC 1GNPA 3GLHA 4ZDIA 4C0HA 5EJEA 4DDUA 4KV9A 2D62A 3Q3JB 1MO3A 2V6JA 1QHGA 3KUCA 2GXQA 3OE7D 4LPKA 4DT1A 1OE0A 1FTNA 3OIYA 3VR1A 2DWOA 1P3JA 1LF5A 3CKLA 2A7QA 1DO0A 3K0CA 4IHQA 3SBDA 2LWIA 5JI3E 1LY1A 1TF2A 1Z2AA 2WAYA 3AV0B 1NG1A 3PENA 3MCAA 1G16A 1PVOA 3CF2A 3QSYA 2QORA 1G20E 1JXOA 4LZZA 1OW3B 2O8EA 4PHGA 5B2ZA 2BWJA 3M6AA 1SXJC 1E9DA 5JEEA 2IW3A 3AUXA 4QM6A 2GJKA 5SZKB 2QSZA 1FX0A 2Q9CA 4YLGA 4BZXA 1IXZA 1VG1A 1AM4D 4N0EA 2PMDA 2J5XA 4R71A 4LC1A 2ZETA 3TIFA 1L8QA 2J0UA 5TY0A 3DOEA 3CX6A 4TTRA 1XTIA 1SVWA 1VKJA 3LBNA 2QGNA 2ONKA 2A2ZA 3VMFA 2V55B 5CDFE 3ZH9B 4C9BA 2XZLA 1OH7A 3A4LA 2AHOA 1HUQA 1G64A 1UBEA 2WWXA 2ATXA 3QIAA 4GOXA 3SYKA 4AD8A 4EFNA 4DSTA 4O2RA 1AZSC 2FN4A 1P73A 1C1YA 2X1VA 3L8YA 2IEYA 3G0HA 5HCIA 3IEVA 2GZHA 3U3KA 1W47A 1QHYA 3JVUA 2F1HA 4ZDWA 3CUEF 4HZUA 1YZUA 3RS0A 3GPLA 1T6NA 2N42A 2F43B 2HV8A 3BS4A 4KFSA 4P3YA 4UXHA 4X8OA 4XH9B 4S2EA 2E1RA 1SGWA 4S35A 1EX6A 1OKKA 2A5JA 2JGNA 1OH6A 1GL9B 4URZR 1N6NA 4A9AA 2BCJQ 2J46A 1BIFA 3NBYC 2IBMA 3HJNA 4UNRA 1PUIA 4LI0A 3RS7A 2QQ0A 4M2LA 4TMXA 4RZ2A 2ZE7A 3K9LA 2N1BA 4KU4A 4MKIA 4W5JA 1M74A 1OSNA 3U7GA 3BERA 3FMFA 1TU4A 4N3NA 1KI7A 1J2JA 2YINC 2NZ8A 4E5UA 3K0SA 2WTUA 4DZZA 4YMTA 4DIDA 1Z6GA 2VYFA 4ACBA 4C0LA 4ZI2A 1U94A 1N6IA 3QPWA 4OHWA 3W3ZB 2YVUA 2ZRPA 1H8HD 1GWNA 1U0LA 2IYSA 2GVDC 2OE2A 5B30A 3B1WA 1CJMA 5ANRB 3KKOA 4EFLA 2HCBA 4LV5B 3TQCA 1Z8FA 1HV8A 1UBFA 3PIRA 2KBEA 5F98A 1M7GA 2CK3D 1U0HC 2J59A 1A2BA 3EIEA 4WZAE 3MD0A 4DLUA 4GZLA 3T15A 4HLDA 1W0KA 2R65A 2XJ9A 1GG2A 1ZNZA 1J99A 2V9PA 3WMGA 1YZNA 3PQCA 3VNUA 5TV2A 3WMFA 1P9NA 2RHMA 4MKHA 4Z8XA 4TLAA 2JJ2A 3NEJA 3TE6A 1OXXK 4QHYA 3U60B 1CJUC 3SU8A 4JMPA 3G82C 3N2EA 4D26A 1E9RA 1G8GA 3ZVMA 4V0NA 5K8UA 2NG1A 3MJRA 4QM7A 1RPZA 1XEXA 1FMLA 1XRJA 1D2NA 4RZXA 1YZKA 2IXFA 2OFWA 1XEFA 4TLCA 1HQCA 2G9NA 1G7TA 2BCGY 4DCNA 2QTHA 4PPNA 5FH9A 4AG5A 1FOEB 3ND9A 1W36C 4DUGD 4ZDJA 1KI9A 3SHWA 3THOA 1XTQA 3X2SA 4DJTA 4MRRA 4V0ME 4UXIA 4DSUA 5JEDA 3GFTA 1U81A 1J8MF 2BBTA 1GNQA 2DPXA 4XVQA 1YR8A 1KKLA 5BN3A 1Z07A 3ZZ0A 4G5OA 3KKPA 5JS8A 1NMYA 1W5TA 2PJZA 4MDFA 2Q3HA 5GVSA 2BEJA 4D25A 4FN5A 4QNRA 4PC1A 2GBLC 5FFMA 1JPJA 3TUIC 5J47A 3DDCA 2P65A 2QTVB 1ZMXA 1JPNA 2AXPA 2F1RA 3RS3A 1XMVA 4MA4A 4EPYA 5LBIA 4A1FA 3E5HA 1KJYA 2QRZA 2QI9C 3BRWD 4RSGA 4XIGS 5DI3A 5CJPA 1NSTA 2BDTA 1QVRA 3NBXX 3NIBA 3EAQA 2AFHE 4Q19A 2R6FA 4B33A 4IOLA 2FZLA 5IT5A 3BIFA 2VEDA 4WBSA 5FBRB 4DSOA 1DADA 3BFVA 4CEJB 1D5CA 4Q48A 5EXTA 1FZQA 3GLGB 3N2IA 4OI1A 3CO5A 5F2EA 4Y0VA 2WJJA 3HP1A 4KSCA 4ITRC 3LX5A 2OCAA 3DEFA 4IFEA 2P5SA 4JVMA 4BGDA 2W0MA 4W7SA 3IEUA 1DE0A 3PUZA 1ZM4A 3C7KA 3RWOA 1E2DA 4O25A 5L3RA 1Q22A 1KDTA 2PLRA 5EE1A 3SYNA 5JECA 5CM9C 3T1TA 4A15A 1GILA 3BAFA 3WNCA 2Q3FA 4NL4H 4Q9KA 3W90A 3RABA 4BLTA 4PFSA 4KITB 1Q1ZA 3CH4B 4NYJR 2ZI5A 3KJHA 1O87A 1JXMA 1WMSA 3LWNA 3IKJA 2ZRNA 4HDCA 5IDVA 1EFHA 4AYWA 1S8FA 2ZSDA 1N0UA 2ZSFA 3MFYA 5H70A 2MSCB 5J4VA 1XD2B 5A5GA 1Q44A 3QJYA 2BIFA 3L43A 2ZJ5A 4B76A 4AI6A 4D6PA 5KNCA 4Q1CA 4ASUA 4NKRA 3TQFA 3L0PA 2NIPA 1SXJE 3NHBA 1D9ZA 4J0QA 1JI0A 3ZJYA 4O3MA 4XVRA 4YONB 2L0XA 2V8OA 2WWFA 1Z6XA 3EIQA 4LPSA 4A8JA 4YMWA 4R7ZA 3WHLA 4I1VA 3IBYA 1KTVA 3CNOA 3NBZC 5CB6A 3TSOA 1AS3A 2VLIA 3H86A 2VIIA 5DO9A 5HKKA 5GADl 2IYUA 3AVYA 2JEOA 4TT3D 2QE7A 2ODEA 2XAUA 4Q18A 2FH5B 2V4ZA 2GJ8A 4YXWA 2XX3A 1NMXA 4HAYA 5EP3A 1E79A 3MMPA 2WZQA 3BORA 1CU1A 2W00A 2YWFA 4DDVA 5J4KA 1X8LA 2IS2A 4LUCA 1YVDA 3WYFA 1XJCA 4YMSA 2VSOA 3W9YA 5FI1B 1XP8A 4ZCLA 3RRNA 2X2EA 4C7OA 2YC4C 4DDWA 5FR1A 1BS1A 2VF8A 4MRSA 4M1WA 5FTJA 3X1ZA 2WWIA 3VU9B 5EQTA 3NKVA 3UMSA 5CB8A 5TXGA 4Q02A 2HCJB 1N5KA 4AKGA 4RD2A 1L4UA 1GRQA 1GITA 4LYJA 3PG5A 3QXSA 2LKCA 3UWOA 2C95A 3Q5DA 2ZI6A 5CLQA 4KO8A 4M22A 4Q4AB 3VHXA 1KO4A 3OE7A 1NP6A 4MGZR 2A5FA 4MH0R 4UNPA 2H8KA 4PANA 1W7AA 1U9IA 2Q3MA 1IXRC 2TMKA 2ZRLA 4KYUA 1KDOA 3B9QA 1BMFA 3AF2A 5JWRA 5FUYA 1YRAA 2AKAB 2KJQA 4I81A 4KAXA 4NZYA 4P4UA 5FTLA 4QBHA 3ND8A 1G8HA 5JSZB 2OT3B 1XD9A 1R10A 1ZC4A 4M1SA 1AQUA 2N46A 1SVMA 2C8VA 5D3MA 3VR6A 5DISB 2ZRIA 2ZRMA 4UNNA 4LBYA 3B6EA 3FHTA 4AURA 2P67A 4KVAA 1ZYUA 3UMFA 2WV9A 3SYLA 4BLOA 1KGDA 5EUQB 4M21A 4DLVA 5L3QB 4Z54A 4QOSA 3CNNA 2J7PA 1QBKC 1MO4A 2HF9A 4MGKR 4DLZA 4OQFA 2G3YA 1J7KA 3GMTA 4DLRA 1MRSA 1PLLA 2YOFA 2FFBA 1GP2A 2RGXA 3A4MA 4LJ5A 2WWGA 4HAUA 3QUSA 3F8TA 3W5IA 3G5UA 1GKUB 3REGA 4A36A 5DI9A 1F48A 2FWRA 1NIJA 4CEJA 1QHHB 3GLGA 5C4MA 4TWZA 4LYHA 1SKQA 1KZGB 1CR2A 2O5VA 2GTPA 2R6DA 3C8UA 5L3SB 1F2TB 2GXAA 2HT6A 4KFTA 2CCJA 2JA1A 2QPTA 3T06B 1TPZA 1DARA 2OV2A 4B2PA 2B7BA 1G9XA 1RIFA 2OLKA 2PL3A 3QVUA 4Q03A 3AVXA 3FKSD 1UEIA 1HE1C 1TUEA 3ECCA 4YDHB 1XPRA 3K0AA 3NVAA 1ZD9A 5EXPA 2EYUA 2H16A 1S1MA 4FCVA 4IOJA 4C3ZA 1F5NA 2IWHA 3UKDA 3DKVA 1G7SA 3V00A 5EZ6B 2QAGC 1EG7A 1F2UB 3MG9A 4E22A 1KDRA 2NZJA 1TEVA 3CIOA 3JZAA 4Q1AA 1N0VC 2IA5A 3K1JA 2KB0A 2C9CA 2UZIR 2O0HA 1HE8B 2QQEA 3RS5A 4TMVA 3ZDQA 1RKBA 2RAPA 4A0FA 4TYNA 2F55A 1XD2A 3CZQA 2FOLA 2JCSA 3A1TA 3R20A 1CTQA 2ZS8A 2IT1A 1XPOA 4JLBA 3A4NA 3EPJA 3GLIB 2XITA 2IUSA 2ZS9A 4QNMA 2IK8A 2W83A 3ADBA 1G8PA 1NVUQ 3AVUA 2ZRAA 4JS0A 3ICQB 2A3RA 5FR2A 1ODFA 2JJ1D 5FI0B 3GJ8A 1EWQA 4E09A 2XNDD 1TEXA 2C04A 2V3CC 2A5YB 2RGNA 4TL7A 2CNWD 3P4XA 1FL9A 2PLFA 5HPYB 3KQKA 1UF9A 3QENA 3BB3A 1XFAA 2PMKA 4B43A 3Q9LA 4Z1MD 3MWLA 3GJ3A 3CW2A 4GI7A 3T1OA 2CK3A 2YOHA 2G6BA 2R6AA 2ZROA 1T0JB 2PCJA 1X8KA 4Q66C 5E3HA 3GJ7A 2D74A 3QPVA 1QDEA 2ZU0C 1M7BA 1F6BA 3QVVA 4Q9LA 3NDBB 1Q3TA 2W2XA 1K6MA 3C14C 3C4JA 4JJKA 2WJVA 2HUPA 3FYHA 4LCBA 3J81k 1CR4A 1KMHB 3IIMA 1ZU5A 1N6KA 5DLQC 4BASA 2J45A 1TMKA 1M8PA 2Q6TA 4CW7A 3OAAD 3UG7A 4PC2A 1VIAA 2R62A 4OL0A 4DB4A 4DC9A 2BMJA 3VFDA 1A7JA 3TAHA 1XEWY 3K70C 1OHHD 1UDWA 2FFAA 3NC0C 4QBIA 4K46A 5FL3A 2OO7A 2ZAOA 3SI7A 1S1CA 1NKTA 3IGFA 4D0GA 3O8RA 1CRQA 2EW1A 4DIEA 3THYB 3VU9A 1KO7A 2IXEA 4PAQA 1KOFA 4IXNA 2GF0A 2XTMA 5HE8A 2WVJA 2XZPA 4JYCA 3QF4A 4ON9A 1J90A 1LNZA 5HCNA 3GCGA 1Z08A 5FTNA 4HSEA 4C30A 1W46A 2R6GA 2ZRHA 2D2FA 3N5CA 4Q4AA 3H4MA 2DWQA 5IF9A 2IYYA 1ZAKA 4Q4LA 3EARA 4BZQA 2AK3A 4AYXA 1KYIA 4P4TA 3FMPB 1KNXA 1IN8A 4JSTA 3KFXA 1ZJ6A 2NO6A 2ZSBA 4BFVA 1XMIA 1W48A 3SQWA 2FEMA 5GJBA 5KNBA 1RRCA 5BYJA 2BV3A 1W36D 1WB9A 2EQBA 5JSZA 2CL0X 1EFRA 2YYZA 2GAOA 4QJ5A 4XSHA 4XWKA 4PZLA 3KZ1E 1KNQA 3QBVA 2RMKA 2ZI9A 4F92B 1NMZA 3WXMA 5L3QA 2HJVA 1Z6TA 3ZS9A 2DY1A 2XTZA 1IY0A 1K5GA 2FSHA 1T3SA 4LV6A 1KKMA 4NONA 4NTZA 4TN1A 3EZ2A 4ESHA 2H5EA 3KTAB 4JLOA 4OK5A 3TSWA 2ZJZA 5JHHB 1SVKA 4RY2A 4TSFA 2VP6A 3A37A 2AD1A 4KBGA 1YRBA 4ZO4A 1C4OA 1E0KA 5IK2A 2JASA 2LKDA 2ZRCA 3QEOA 4AG6A 1UJ2A 4G1UC 5FOXA 4QG7A 2GCNA 3FKQA 5KDDA 1QHHA 5CYPA 4YDSA 4QHTA 1VG0B 1XXHB 3AP3A 4IOMA 4W9MC 5L3SA 1F2TA 2ZI3A 3RLFA 1CRPA 4K8OA 4BWYA 1E2IA 3OIVA 4M0LA 1X8JA 1P4SA 5G3ZA 2J7KA 5FUWA 3WRYC 2NO7A 2WICA 1NY6A 3MGCA 2D7CA 2YOGA 2Q0HA 4BLPA 1W49A 2P6NA 3GD7A 3VR2A 4CEHA 3I73A 1GIAA 1RVDA 1T5LA 4OK3A 1SQ5A 3KQNA 4QGHA 2ZUDA 3A1SA 5JZVA 5P21A 2GKSA 3K9HA 2ZM5A 4RKEA 4URYR 2NQ2C 3PEWA 1G1MA 2ZQ5A 2J41A 2WAXA 1AZTA 3B13B 1MR3F 3A1UA 1F2UA 4BFXA 3GLFE 2J0SA 1VCNA 2WSSA 4PPFA 2VBCA 2VRWA 4OQMA 3PUYA 1FTSA 4LSGA 4FINA 4M8NE 2ZI4A 1DTSA 1SVOA 3KJGA 4MQBA 1T0HB 4Q1BA 4URVR 1IONA 4JLAA 2ZUBA 3GLIA 5HZHA 2XXAB 3TK1A 5E7JA 4ILEA 2G1JA 1US8B 2ZU6A 1FQJA 4TMZA 5G40A 3AKCA 1II8B 1DAIA 1NBMD 2PX3A 1IN6A 1JECA 1VG9B 5JFGA 4LBVA 3SBEA 3K0CC 1G5PA 1OT3A 3O8DA 3QKTA 2VHCA 4C0KA 4I1UA 1Q1EA 2WPDA 4LHZA 2REXB 4ZV4A 2ORVA 3DZDA 5TB5A 2NMVA 3CWZA 1XCPA 2D2EA 3V4FA 1G8YA 5JJKA 3I5XA 4FWTA 1KY3A 1A2KC 5TARA 1M2OB 5AJWA 3SJAA 1BKDR 1VHLA 3QOFA 5FPTA 3TVTA 5E4FA 5K8IA 3QKRA 3BOSA 4TTPA 3DM9B 821PA 3BE4A 3QI2A 3Q85A 1DELA 2WJHA 2OXRA 2R2AA 5HR5A 4RZUA 2UZ3A 2QY9A 1M7HA 4HUTA 2EFDB 3L0SA 3RWMB 1OV4A 4TL6A 1HTWA 2GCOB 3ETLA 1O3YA 4XJXA 1IJFA 2WJGA 1P6XA 3BXZA 5E7IA 5F9FA 3B82A 3DKPA 1A82A 3RC3A 2KSQA 1N0WA 4DLYA 2A5DA 3DHWC 5CIWA 4F4IA 4OI2A 2B21A 4JVNA 3THYA 1HT1E 1Z0FA 4LBWA 1T3LA 4NBSA 1Z0DA 4F91B 1IY1A 2RGBA 8OHMA 4NYIR 3LA6A 1Q12A 4GL2A 5FOUA 3N70A 3KB1A 2ZXUA 3UANA 4FCWA 3W8NA 4HB3A 3I8SA 3L82B 4IRUB 2FMXA 1W36B 4H1VA 1E2NA 1B23P 4DLXA 2WJYA 2QMOA 3WP1B 4TQAA 1CJKC 2O8CB 2VP0A 3DMNA 4OHXA 2QN6A 5GJWC 1NN5A 4HLCA 4CEHB 1OLOA 3FE2A 3K0EA 4KVGA 4US0R 1CBUA 2QMUA 1KI4A 3THXB 1UKYA 1JR3A 3R9IA 1I2DA 1VTKA 1KO5A 4G0NA 3CRVA 3PXGA 2Q21A 3IO5A 2FPLA 4OQNA 3TAUA 4OKSA 3QNUA 4RFVA 1DPFA 1EK0A 2F6RA 4WVFA 4C4PA 4G5SA 4HB0A 4JLJA 4B75A 3ZVLA 1UKZA 3F5FA 3U61B 1UKEA 2P6RA 3EWAA 2VTKA 3D6TB 1OB2A 2ZYUX 1MT0A 2D06A 4C0BA 4CT5A 2FSGA 2XZOA 3CBQA 2ASEA 2XOKA 4JLDA 1DG3A 3KTAA 1KZ7B 1JB1A 1KI2A 4BZPA 1E3MA 2WKRA 2DR3A 1X1SA 4HEJA 1TQ2A 2CCGA 4B32A 1TTTA 3QE0A 4GOKA 5FUXA 3TJZA 3TR5A 2BBSA 4GMXA 3U6KA 4W5HA 1GOTA 1YR6A 5KSYA 1GTVA 1Z6YA 4Z51A 1I4DD 1QHSA 3FKSA 3M4YA 1FUUA 4PQYA 5JCPA 4WZ6A 4MYTA 2BVNA 1XXHA 4IDHA 1TQ6A 2VL7A 4B6EA 4K81B 1UAAA 1Z83A 1Z6AA 2F3TA 2V54A 2IL1A 3NXSA 5C4GB 1N6OA 4POAA 4UNSA 4QC2A 2CVFA 3AGQA 3HU1A 1G3MA 1WDTA 5FTKA 3U44B 3CPEA 2ZYTX 2WBLC 1WCV1 4AYTA 1KY2A 2V6IA 3T34A 1X1RA 3VKWA 3C5CA 5BYKA 3LXXA 1ZINA 3LDAA 3QXXA 1CEEA 1ZNWA 2IC5A 1LW7A 4X8LA 4AKHA 4RJLA 1NY5A 1VIYA 3W6OA 4AC9A 1IM2A 1SVSA 1CULC 1DAGA 3PEUA 5LPNA 1E2LA 5D3QA 2IF0A 5KPDA 1FNNA 3FMOB 2CE2X 1E9AA 4Q21A 5CITA 4LYFA 1XTRA 3FTQA 2HLDD 3LBHA 2IWRA 1LS1A 3T1QA 3SHFA 1XJ0A 3KXIA 2RCNA 4ABYA 5KDOA 5DN6D 2XXAA 4P31A 2NO0A 5FBQB 1KI3A 1US8A 4B3FX 1VYUA 2J9RA 2KWIA 4TLDA 3F0TA 1II8A 1KAOA 1G18A 2IYZA 1G17A 2GEUA 3UXMA 2Z83A 3T12A 4GP7A 4LK2A 1IY2A 1E98A 4A8JB 2QENA 1XPUA 2JIZD 1FUKA 3T35A 3I72A 3LXRA 3OAAA 3T5GA 4QGFA 1QZXA 2QG6A 4H9GA 3FGNA 1PZNA 1G3UA 1TAGA 1ZCAA 4OJQA 3KQHA 1S96A 4A2PA 5CJ2A 4F4JA 3RAPR 2QZ4A 2IYXA 3UPUA 1RJ9B 3H84A 3HR7A 3O47A 4CRWB 4U00A 2CVHA 1W4RA 3LH5A 2ATVA 2CMKA 3KUDA 5JI2E 2V7QD 5C1BA 3LQRA 1AJEA 2J0QA 2RH5A 5FUVA 4XTCS 1NF3A 2AL7A 4Q4HB 3W6PA 4CT4B 4DLSA 2C78A 3DMDA 3QXHA 4Q1FA 4M53A 2GCOA 3A1VA 3LW8A 4HAVA 4OQXA 4W5WA 4OHYA 3PJRA 3FWYA 3RRMA 4B74A 5HE9A 2FV8A 2GESA 1RYHA 2NTYC 4Q1EA 2NGRA 4JLKA 4FMCF 4LC0A 4WW0A 2QP4A 3E1SA 1K8RA 4Q7LA 2I1VB 1FMJA 1KK1A 2CHQA 2B6HA 3EZ9A 3SQXA 2BBWA 3NWJA 4LJ9A 4PO1A 1G6OA 4R2IA 1VDZA 2I4IA 1VCOA 2REOA 1N6RA 1OYYA 2WWHA 3HYRA 4GFDA 4EFMA 4BLQA 4F7WA 5JWHA 3P32A 3GLHE 5FOSA 5SZIA 2O8CA 2D7DA 4UKDA 1F3OA 4MGIR 3ADKA 4RKFA 1L2TA 3L0IB 1Y3AA 3SFZA 2C98A 2VHJA 1COWA 1GRRA 1OFIA 1EFCA 5L3VA 3THXA 1BH2A 3K0FB 5LB4A 4BFSA 3MWYW 1P5ZB 4D4KA 3EA5A 4QKQA 3U5ZB 3QKSB 3FOZA 4MRPA 1A5TA 2UKDA 3KKMA 4HI0E 1SKYB 2MMGA 2F43A 2C03A 1KJZA 3SDZA 1E1RD 4PHTA 4X8MA 2AD5A 3NC1C 1DG1G 4DSNA 3CR7A 2ZR7A 2VPPA 1L7VC 3KKNA 1VMAA 2R8RA 3O8CA 3L0OA 4M1OA 3WHKA 5A4JA 4MYHA 4WZBE 1S9DA 3IDQA 1Z28A 5SZJA 4LWZA 1NSFA 1Z29A 2XGJA 5A0FA 1JQLB 4FMCB 2YC2C 2BMEA 1BO6A 3MLEA 4XD7D 2IYTA 2ZE8A 3NDPA 1RRPA 3ICEA 3FDIA 2CBZA 2RGAA 2P5TB 1DBSA 1UFQA 3R7WB 4HAXA 4RD1A 2C2HA 1KK3A 2BKUA 4A4DA 2QSYA 4IEIA 3CRW1 5SZHB 4OK6A 4LY6A 2ONJA 2OCPA 3E70C 4QGAA 1YZTA 3OEED 3OIUA 2OFOA 4TQ9A 2H17A 2G0TA 2OXCA 1YZLA 5JLJA 4L5BA 1CP2A 2IUTA 4GSYA 4NH0A 3VX4A 1YU9A 2PEYA 4R2HA 4F93B 5LD2B 4KYIB 3IILA 3U44A 2RGGA 3TUZC 2EYQA 1AS0A 2CLDX 3WYAA 3ZVNA 4JT2A 4TL8A 2ERYA 4JVSB 2ZJOA 3B9PA 2IS1A 4IKEA 1RYFA 4EPTA 3LLMA 4L9SA 3SOPA 3AM1A 3TGPA 2MMCA 4Z8YA 3Q7PA 4D4LA 2JLXA 4WXPA 4LHYA 1XU4A 3BH7A 1NBMA 1XJQA 3BJIC 4DCTA 1H8ED 3LFUA 5J5CA 3TR0A 3RHFA 1KO8A 1U9IC 3UATA 4B71A 4OBEA 4URWR 3T1VA 3KDSE 5DNYB 4MGYR 1ZM9A 1G3IA 2ZS7A 1S9HA 5TMPA 6Q21A 3SJZA 1L4YA 2PZEA 3RNLA 2Q9AA 4QBGB 3EPLA 3B1XA 1OIXA 3IPXA 3LNCA 4KI0A 1NVVR 1M34E 4Q5IA 4DHEA 1OH8A 1AKYA 3VX3A 2B8WA 1ZD8A 4KFRA 1AGPA 4TLBA 2EFGA 1FPMA 2X8AA 2ZYVX 3FHCB 3I92A 3TSZA 2GCPA 3O8BA 2QP9X 4UXJA 4NP6A 5FOWA 2CXXA 4PAOA 4LJ7A 2EWWA 4JBXA 3F3YA 4HYYA 4NYJQ 1SZPA 1TNDA 3AP1A 4HB4A 1NI3A 2W6ID 1RJ9A 4L9WA 3RVBA 1DS6A 1ZNYA 2BJWA 2WOJA 1ZIPA 2ZPTX 3QXCA 3VR4A 4PAMA 1XMSA 2MSEB 1E2KA 4TMWA 4G5RA 2DBYA 2B7CA 2VF7A 1Z63A 1FP7A 2VP2A 3LY5A 4Q4HA 4X8HA 3P27A 4L16A 2GEDA 1D2MA 2JJ8A 3D3QA 3LRPA 2GJSA 2VP5A 4TZ6A 2IEZA 2Q9BA 2BKEA 4E07A 1E2HA 4QRHA 3PEYA 4TYQA 2JLRA 1ZVQA 5C18A 3B78A 1SXJD 1XB2A 3B7GA 4EPWA 4CF7A 1CR0A 5KDLA 1G41A 4A0RA 3S1AB 2ZJ2A 5H8WA 2ZRDA 3SR0A 4E03A 2OFXA 3TW4A 5BW8A 2W58A 2QEQA 3D7MA 1XDBA 2JDID 4TYYA 5F9HA 1KDPA 4G3XA 2ZJYA 4ZKDA 3QKUA 1NJGA 1N6PA 4G5GA 2CHGA 2H7VA 3AF1A 4PC3A 5EE9A 3K0FA 4JVLA 2GJ9A 1VYVA 1P9RA 1OKKD 4EJSB 1OF1A 2WMNB 4BRUA 1QG4A 4G5QA 5DYGA 1W5SA 5KYKA 1NKSA 1MKYA 1EFUA 3QKSA 4ZCIA 3X1YA 3VAAA 1IAQA 1SULA 3HPQA 3PUXA 2FX3A 1JBKA 1IN5A 3P26A 2IYQA 3QF7A 5KU1A 2RGNC 2IYRA 2OM2A 2A9KA 3AB3A 4RD4A 1XTJA 2WIBA 5KSOA 4RFSB 2Z6VA 1U90A 3CZPA 3HYTA 2OUKA 1NNEA 4DLTA 3NH6A 2DYKA 3KX2A 4KODA 2P0EA 2G77B 4OHZA 5ELXA 1R0XA 2PCLA 4G01B 4KLNA 4LOAA 3R7WA 1NVXQ 4BLRA 2JLSA 3U3JA 5C46F 1WA5A 1H8HA 1WBBA 1SHKA 3VQTA 2HYIC 1OXTA 2QL6A 4JKYA 5FBLB 3M0EA 2OZEA 2BHRA 3CPHA 3OEHD 4URXR 4Q9JA 1RC8A 3W6NA 1LFDB 1YE8A 2VP9A 2VSFA 3PR1A 5KTYA 1YZQA 5KO2A 1GUAA 2HT1A 2BMFA 1UEJA 4H1UA 1GM5A 2OAQ1 1G4UR 4EKDA 4XWAA 3EA0A 4II7A 4C2TA 2QT1A 1KI1A 3C15C 3RSOA 1ETUA 3NG1A 1TADA 2D3WA 1JNYA 4C0SA 2J3EA 2FPMA 4TQUS 4GMDA 1KSGA 1E2QA 5DN6A 5LB2A 2FU5C 3AKYA 2Z4RA 2BBOA 3SS8A 4ACAA 2P6UA 1JAHA 3R9WA 1Z22A 2GXSA 5CK5A 5CDFA 5B58C 4FMBB 4R98A 5M04A 4M9SA 2OBMA 3I61A 3HWSA 4NU0A 1GDDA 1LVGA 4NYMR 3EG5A 2O8DB 3WMEA 2W6JD 1N6HA 3PUVA 3BD9A 1OYWA 4NCHA 2JIZA 4IDPA 4UJ5A 1PUJA 5FL7D 2ORWA 4CYMA 1AN0A 1FP6A 1XWIA 1ZC3A 4DUGA 1XTSA 3IQWA 1XX6A 3V9PA 1D6JA 3U7EB 4PQRA 3MWKA 3NH9A 4UQOA 1D2EA 1EGAA 1ESNA 4B2IA 2FNAA 2V1XA 3GQBA 4PC7A 4PZZA 5B64A 4KBFA 4PZYA 2GWHA 3LLUA 4D4MA 1JQJC 4U02A 4JL6A 5KOYA 3BWDD 1WP9A 1VCMA 2Z43A 4JBWA 4Q47A 1VECA 3AKEA 4XWOA 4LHVA 4Q7MB 4CGZA 3AVTA 1KO1A 1WXQA 521PA 1JEDA 5JWOA 3IIKA 2OBLA 4ZIRB 2RHDA 4KSBA 4OJKA 2G0NA 1D8TA 1NL3A 3IBGA 3W34A 1P2UA 3GEHA 4C0AC 4PTLA 2YWHA 2CLSA 1RE0A 2JATA 2ZREA 3K53A 1SXJB 5KPJA 3U7HB 3QY0A 2AWNA 2K5UA 5GVRA 3GFOA 4PC6A 4MITA 2IHYA 2ZJAA 4Q1DA 3AEZA 3B60A 4JL8A 5EE0A 1RRGA 3EZFA 1LS6A 4HAWA 1ZU4A 1ESMA 3MWJA 5E95A 3IHLA 4WA7A 1CR1A 2I1QA 1MH1A 3HDTA 2ZAMA 1LF0A 4LJYA 4HUQB 2KBFA 1OFUX 2R44A 4BQSA 5JS7A 3LVQE 3GEIA 4LRWA 4TL9A 5EP1A 3S1AA 2ANCA 2JLYA 4JZKA 5KSPA 3B1YA 3V4RA 4PPQA 5IHPA 4HLUA 4BUJA 3BH6A 4P4SB 2DFNA 3B1ZA 5G41A 1MRNA 2EVWX 4FIDA 4NE2A 1A1VA 2AKYA 2FGKA 1P61B 3ZZUA 4PQFA 2BM0A 1XEWX 4Q7JB 4FI3C 4OI0A 4DXAA 721PA 2HEIA 4DBLC 1E6CA 3KJEA 3C41J 5FPYA 5FBVB 3W3AA 2BC9A 2OHFA 4EJSA 1S0UA 3RC8A 5DSZA 1HQYE 4RD3A 4PPGA 1I2MA 1DAKA 1VPLA 2DB3A 5CM8B 4XD7A 1GFIA 3KXLA 1OXUA 2ZUCA 1U8AA 2F1IA 4IEEA 4RZ3A 3MAAC 5CLLA 1R5BA 2ZJ8A 3A1WA 4ASUD 2YZ2A 3I4LA 3MSXA 2QGZA 3GJ0A 1ZM3A 3E2IA 4KLZA 1OIVA 4RFSA 3CWQA 4U5XA 1IHUA 3R9XA 4JT4A 3OEEA 1AGRA 3VTKA 4V0MA 3A36A 3CM0A 3X1WA 3B1VA 1HY3A 2ZR0A 2C5LA 4LHWA 2J1LA 3AQ4A 1U99A 3GLGE 2FFQA 4TT3A 4D81A 2QU8A 4PSAA 1YHNA 4EIWA 3HR8A 3EZ6A 1YKSA 2WWYA 4P32A 1E79D 1JALA 3K09A 5HZKA 2WSMA 4F38A 5AJZA 3FFAA 3UWKA 2ZE6A 4XTRA 5FBWB 2ZVPX 3A6PC 4Y0AA 3KXKA 2JLZA 2VP4A 1KMHA 4PX9A 4NCJA 1H8EA 4JJZA 3WP0A 4A0HA 2DFTA 2GRJA 2ZYWX 4JBYA 3THWB 4MUBA 1E2PA 1DAHA 1JAIA 1HURA 2CDNA 1AQYA 2GHIA 3BB4A 2OCBA 4JLPA 4TZ0A 2IX3A 5G53C 5FOVA 5TDHA 4DWJA 1NRJB 4CVNA 2ZSEA 3SN6A 2WOOA 4RVCA 1UM8A 4WXRA 2DFLA 3CX7A 1EXMA 3KFVA 1Z06A 5JRZA 1HH4A 2CE7A 4XVUA 2O8DA 3BFKA 1KI6B 1W2HA 2B8TA 4URUR 5J4HA 5CK4A 1HYQA 3CX8A 2VHTA 3OESA 1G7CA 3CONA 2D4HA 4I99A 2VA8A 1BMFD 4TYWA 4HDQB 2FSIA 4ZCMA 4JYBA 2EWVA 4Q00A 1CIPA 3D31A 2NPIA 4ZPXA 2KE5A 1GRNA 2W6IA 2XEXA 3B5JA 4JL5A 4HAZA 1HA3A 2CJWB 1WRBA 1RW4A 1V5WA 2HXYA 4RCZA 1Z0KA 1FNMA 1DAEA 3MRSA 1OIWA 5DI3B 3SNHA 4C0JA 3K9NA 1W1WA 4D80A 1E4VA 4Q4JB 4N0DA 2ORIA 4ZI3A 1T5IA 3AVOA 2IHBA 5L8VA 3PV0A 4YC7A 4IDQA 2C77A 2FZ4A 2YHSA 5EP4A 4YMUA 2J7PD 4P0TA 4V03A 3IIJA 5TVKA 4ZIRA 3EXAA 1P75A 4NCKA 1TUIA 3NHAA 5DIFA 4A92A 4JLMA 1T4GA 3CB4A 1A4RA 1SXJA 4KXFB 4IDOA 4M4SA 3UK6A 4D82A 2GZDA 1UKVY 1AA9A 1R0YA 1T8TA 1X6VA 2RB4A 1Q57A 2CL7X 2OEPA 2O8FB 3ZZTA 2IS6A 1ZCBA 5CYOA 4B48A 5EXXA 1G7RA 4HATA 2JDIA 5J40A 2GK6A 3AUYA 4C0QC 2YJTD 5UKDA 4HUQA 1J70A 3UMRA 3U3RA 4NHOA 4B73A 4M1TA 2REBA 1KI8A 2O8BB 3EPKA 1R5OA 4PO9A 2EFCB 2GILA 3GP8A 2QRNA 2GDJA 4IVPA 4DEYA 4P4SA 1WE2A 3EC2A 5FPKA 4YQFA 4MYCA 1KSJA 2HJGA 1J8YF 1U8YA 3JZMA 4PHFA 1N3BA 4BFWA 1C9KA 4RCYA 4A2WA 2BM1A 4DCSA 3IHWA 4L8GA 4B3CA 1N25A 1JJVA 2F9LA 2OCYC 3NEYA 1X86B 3GJXC 4Q7KA 1VG8A 4QXAA 3LQQA 3TW8B 1E2FA 2PBRA 3AKDA 3BK7A 4BFUA 4AY2A 2OAP1 2GXUA 2G1KA 4MRVA 4QL3A 3RYTC 1G21E 5DYIA 1DVRA 1R6BX 4GOJA 1E9EA 4PHHA 5FTMA 1I4TD 1JJ7A 5JRJA 4IVRA 2JJ1A 1PLKA 1RZ3A 2Y8EA 3VR3A 4BFTA 2XNDA 1IOZA 4B44A 3LO5A 2QMEA 2CNWA 2QTFA 4L4UA 4NYIQ 4PXAA 4IFBA 3QPUA 4TLEA 4KHZA 3OEHA 4MKGA 4Z1MA 4JKIA 4LDJA 4DRZA 2RGDA 1HEIA 3REFA 2VH5R 2IYLD 5J4LA 1D9XA 2ZJBA 1E32A 1FFHA 4A0GA 4B47A 1E96A 2P2LA 2QM8A 4LBZA 3TMKA 1E2EA 1G19A 1S2MA 4A6XA 3OIWA 1NVWQ 2NOAA 2CEAA 1UADA 3FFBA 2E9SA 2NO1A 4AKIA 1E1QD 2CHVA 4C7OB 3LD9A 3WBKA 5E7MA 5EP2A 3I5YA 1GNRA 3SJBA 4BLSA 1G4AE 5AJYA 2FFHA 1CLUA 4RD0A 4CZ2A 1OHHA 2DWPA 1X3SA 2BEKA 4V02A 3WNBA 3QQ5A 3EW9A 4IJMA 4HDOB 1ZM7A 2H18A 2CLCX 1NJFA 2H92A 3THWA 3ZYCA 4FXPA 2RGCA 3NTUA 4EDHA 2W6JA 4JLVA 4B34A 121PA 2JAQA 2ZEJA 1ONBA 5FL7A 2ZVQX 1ZUNB 1NN0A 4NCIA 4DEXA 3IUYA 1DAMA 1WF3A 3GLIE 2WKPA 3TBKA 3K70D 4M1KA 2V1UA 5KHOC 5H68A 3AVQA 3QEJA 3LX8A 2C9OA 4GZMA 4IW3B 1LB1B 5D3MB 1EFTA 3P1JA 1KI6A 1VCIA 4Q01A 2JLUA 1IQPA 1N5LA 1VHTA 3EPHA 3EASA 221PA 2I3BA 2JLWA 2GK7A 2GNOA 3ZIAD 3U7FB 3Q5EA 1EESA 1W4BA 2AWOA 3OFND 1KIMA 2BMDA 3C5HA 2GAAA 3DVLA 3GLFB 2CJWA 1EFRD 1KAGA 2FA9A 2BJVA 2C99A 2QROA 2XSZD 3NBFA 1T8UA 3I3SR 3AVVA 2XTNA 4Q4JA 2HDNB 2FE4A 1F60A 3IO3A 1YZGA 3MUFA 3U2QA 1XF9A 2GBLA 3SC3A 1TL7C 1KK2A 2W2VA 1Q0UA 4DLWA 2GA8A 4BRWA 1N2CE 1ELOA 1YJ5A 2DCUA 2YKGA 3SEAA 4L15A 3L2OB 1U8ZA 1CS4C 1R8QA 3AGPA 4ZDKA 4TSFD 1Q1BA 1E9FA 1MO5A 4UNQA 4AKEA 3W5JA 1M1YE 1NLYA 1P2TA 2AR7A 2IS4A 4DCUA 5EZ5A 2ZRKA 3LBIA 5IK2D 3CRQA 4V0LA 2O8FA 2PH1A 1OFTA 1E9CA 1ANKA 1E99A 1U2RA 1TF5A 4QFMA 1E94E 1OXSC 3I1FA 3K0AB 1Z47A 3OZXA 2H1LA 4JIMA 2IF2A 4EQ6B 2O8BA 5FPHA 2PZGA 2BOVA 4FMDF 2QA5A 1U98A 4DDTA 3GJ4A 1YR9A 2H57A 4PSVA 2PJRA 4M1MA 4B3DA 3BGWA 1T9HA 4M9XA 4EPRA 1QHIA 2WMOB 3EIHA 1QVAA 1JR3E 1W2GA 2YWEA 3CF6R 1CXZA 3KKQA 4MRNA 3IPYA 4V0KA 2E87A 4B2LA 2WSSD 3A58B 1LV7A 1E4YA 1IBRA 4ERNA 2QAGB 1HT2E 4IXMA 2GEVA 3VNVA 3A8TA 4ARZB 1YQTA 4EPXA 3QG1A 4US2R 4FW9A 1MV5A 4ESVA 621PA 1U0JA 4DCVA 1Z3IX 4M9ZA 4GRAA 5KSZA 3GEEA 1W0JD 3B85A 3U3OA 1ZNXA 2GZAA 4A8JC 1XZPA 1N5IA 4C2UA 3FVQA 3DOFA 5B57C 2X77A 3UG6A 2ZTSA 1Q1QA 2A5GA 1TX4B 2ECKA 2WPDD 2F9MA 4FMDB 3HU3A 3WNDA 4BFZA 1G8FA 2A30A 1XXHE 1EWRA 2EFEB 3DM5A 3ZD7A 3VKGA 2R9VA 1W44A 5AJXA 3BC1A 1XD8A 1MO6A 3Q7QA 4MYUA 4WIAA 3WBJA 1FW6A 1R0WA 3MJHA 4A6PA 4LGMA 3ZQ6A 2VHUA 3X1XA 3LAWA 4Q9IA 3LVRE 3PCRB 3QG5A 3BBPA 1ZUIA 2QAJA 4AK9A 2ODBA 4JSYA 1M6NA 5KUTA 1TF7A 1T91A 1R8SA 3EX7C 3QF4B 3CLVA 5JCZA 1GSIA 1DEKA 3CR8A 4FD2A 4B3XA 4TTQA 5BN4A 4V0OA 4P33A 4NPHA 3K70B 1MABB 3DZ8A 1OPXA 1H65A 2GF9A 1E2MA 1ZIOA 4M9QA 1SVIA 3CRMA 3VHLB 1XBTA 3HU2A 3U4QB 4BE7B 2NPFA 3RDPA 5KNDA 1Y63A 2PT7A 3RRYA 3W8RA 4BFYA 2ODNA 1MOZA 5CIQA 4F4CA 2HXSA 1NLFA 1UBCA 1JR6A 4QJ4A 1PV4A 1DAFA 1UDXA 3LV8A 3AF4A 4D0NA 2Z4SA 4TMKA 3RANA 3PEVA 3Q72A 3LW7A 2WHXA 5AUPB 1KMQA 1N5JA 1E2JA 3H2YA 3QXJA 1AKEA 2W0SA 1GVNB 2FDCA 3SJCA 1P9WA 1JR3D 3RSLA 3T61A 1CF4A 2ODWA 3PITA 4GP6A 1YR7A 4NCNA 3SFVA 4AWXA 1Q20A 3ZQJA 3CPJB 3GLFA 5EE5B 2J0VA 4CEIB 5EE3A 2AXNA 1VYTA 2EFHB 3FMIA 3GJ6A 1S4QA 2ZE5A 2GETA 2IUUA 5FPSA 3WRXC 3ZS8A 3ZD6A 4Q9HA 2W2TA 1OXVA 2WIAA 1P72A 2WM9B 3SE0A 3UIEA 1BYIA 4ZKEA 4TMTA 4PR0A 4D0LB 2G88A 2XOKD 4WOPA 4A82A 1AIPA 3CNLA 1G3RA 2GVZC 3OF5A 4D4JA 3AVWA 4LV8B 1GKIA 2LCFA 4GDFA 5AUOB 1UBGA 2ZRJA 2OLJA 1PJRA 1TU3A 2RGEA 1QG2A 2QP3A 4GT1A 2DFKB 1XCGB 3I32A 3TNFA 3ZVRA 1BYUA 2O0JA 1R4AA 4BPBA 3RS4A 1Z0JA 2QPAA 3M1IA 1OH5A 5DHFA 3DPUA 2AX4A 2F3RA 4FWIB 3U3MA 1NG9A 4N1AA 5JBQA 4MKFA 1WQ1R 2CCKA 1XTKA 1NVVQ 4EQ6A 5LD2C 3TH5A 4EAQA 3K9GA 2X2FA 2XJ4A 3BH0A 5F3WB 3PVSA 3P4YA 5BXQC 1XCMA 1S3GA 4NDZA 3DO6A 4CDGA 5K8TA 2XB4A 2C96A 4KCGA 4OQLA 1AK2A 3GJ5A 4D2IA 3KQLA 1KJWA 2HYDA 3I62A 4O0MA 4EUNA 5C2JB 1ZRHA 1W0KD 3L8ZA 4B3GA 4KFUA 2OSBA 1NN1A 2VQSA 1ZM2A 2O52A 2QAGA 2XB2A 4GNKA 3ZLJA 5BN5A 4ARZA 1R5NA
chains in the Genus database with same CATH superfamily
4DS3A 3FIUA 4BMOB 5F9HA 1R9JA 2NO9A 3RRZA 2JJ2D 4BEJA 1DO8A 4EP1A 4QRIA 4FFLA 4AZWA 4EOGA 4Y98A 4JYZA 1Q0TA 3HKCB 4J7UA 4LRQA 3O0TA 3TXXA 3OQ1A 1KHTA 2D2IA 1GQ2A 2WWWA 1E0JA 3Q8XB 1SFRA 2C7VA 2F3SA 3H0KA 3I12A 4X1YB 3RS2A 3IOYA 5EXSA 2ZI7A 1L0BA 1VQ1A 1FYWA 3C3PA 1A9QA 2BI8A 3HCNA 1E6KA 1V43A 4RXMA 3RHTA 1UDCA 4ZYLA 3LIPA 2JRLA 2N9UA 3D8BA 4YUWA 2BFCA 2EU8A 1T5OA 3R5JA 4LX0A 4OP2A 2P4SA 4Y2HA 4DT1B 7ABPA 3OE1A 1JL3A 2I2WA 5CFRA 4RELA 2HADA 1Q15A 2Z2JA 2E55A 2A0WA 3F9IA 3TLMA 4QXOA 4N0PA 1SG9A 3CVUA 3HFSA 2FEOA 2FPKA 5SY4A 3UM9A 3BK1A 2KI5A 2LV8A 2NU7B 2VWHA 3R7BA 3SC4A 4N5NA 5AKYA 1DJMA 1U1GA 1P4GA 5A7HA 5HGJA 4ZVVA 4HGRA 1M54A 4EATA 2RGRA 1W8DA 1JG6A 4HWTA 4FYPA 3EAGA 6REQA 1M1XB 3GRAA 1ZCZA 4N6GA 4P82A 3WAKA 2VDOB 5L7TA 2QUZA 3C3BA 1G6HA 1IHPA 2YICA 1IY9A 5A6SA 4WZBB 3CIFA 5DBIA 2JVIA 3PB3A 1N6LA 1RFGE 1YBFA 2QR5A 3COYA 4HZIA 4EHJA 3GRCA 2UXBB 3CINA 2OBNA 3AFNA 1Q21A 1MABA 3KYDA 4L78A 5IRCD 4RHTA 4Y7DA 1FXUA 2ZRQA 1TMGE 1UBTS 2CL5A 1GD1O 5E8JA 5IAKA 2AW5A 2SHKA 5TJ9A 2G8NA 1WVGA 4R9UC 3IQXA 4OB7A 1R7RA 3OCJA 2DBVO 4IOKA 2HSDA 3ZIAA 5BSKA 3AH8A 4IJ6A 3TUJC 1Y4UA 2Y0DA 4UAVA 1DO2A 3WRVA 3OFNA 1WQ4A 4R6XA 4X54A 1HI9A 4QUAA 4DVJA 2IYWA 2UYQA 2OXEA 3CH5A 3EIFA 5MHTA 4CKXA 4PS0A 2QPOA 4X3PA 5TGDA 1U3UA 2HAEA 4KKVA 4DVGA 4IXTA 3X1MA 2PVPA 4UHBA 1YI1A 2XE8A 1Q14A 2FR1A 2VC2B 2I4LA 4MUIA 3ISJA 1VL0A 1PYOA 3NP9A 2W93A 2O2ZA 1UWVA 2DWCA 2Q28A 3T5DA 1K5DA 1DFHA 1M1NA 3E53A 5ARCA 3ADCA 4U7FA 2HWYA 3PL1A 1UBOS 4LYAA 1TZCA 3TLBA 4BECA 4PYOA 5CFMA 4OXNA 1PJCA 1Z73A 1TM3E 2CLLB 5EMJA 2B92A 4A2QA 3ERCA 1RRFA 5C35A 3I39X 1X1AA 1YU6A 2CKMA 4IKOA 4BNXA 3T99A 4OMDA 3RAFC 1QAOA 1HETA 1JQKA 1YASA 5IJAA 4UBNA 4NMXB 3V32A 4DQVA 1DKRA 2PO5A 3TM5A 3FUWA 4ROSA 3QEMB 4DUPA 4FC6A 1CKEA 4LHXA 5H81A 4EYSA 3LHIA 3BB1A 4HVAA 1WKBA 1QLHA 4XSGA 2VDWA 1O0CA 3L7KA 1V71A 2GPJA 1LW6E 1CJTC 3D02A 1CYEA 3R6TA 4IHAA 3WGKA 2XDAA 4YJGA 1CJVC 2GKGA 2I99A 2QJOA 1Y3CE 1RPTA 4WUTA 5CYGA 2PU5A 1DC5A 3N8GA 3I64A 2BISA 4G9BA 1RJGA 1M6HA 3Q9NA 2PD6A 4NYMQ 4XASA 1SBIA 5AUQA 4MQEB 1TCVA 1XNRB 4Y1RB 3EC7A 3JVVA 5LIPA 2HLHA 2E4WA 5DGXA 3K09C 1WBDA 3G79A 2A78A 3ZGVA 4Y2TA 1GL6A 4PO8A 5LP6F 4X20A 2PX8A 1OFHA 2XCRB 2WYVA 4WINA 1E1KA 5BNFA 4MIOA 3VPHA 2GGSA 3DLIA 4MDYA 5H16A 1I6WA 4LQ4A 3DMPA 4YT5A 3W9SA 5ER6A 4DIUA 1DDIA 2X2OA 3SIXA 5DV9A 1O57A 4EPVA 3EWSA 5HKKD 1AHIA 4OAOA 2Q5FA 1M6VB 2QM7A 3IRVA 3G2JA 2QE7D 2GI4A 2OO5A 3OHMA 3L6EA 4F2WA 1Y34E 5I4BA 2QGFA 3FMVA 4I19A 5J4YA 4HT3B 1LLQA 4RMGA 1B6RA 1QX4A 1NLMA 4ZMSA 3ICVA 4RHFA 2BDUA 3BEDA 2IEDA 1XRLA 2ZANA 2W2MA 1B76A 5JMOA 2O5CA 4CG0A 4QYIA 1Q2UA 2CJFA 3NHWA 3QHQA 2RKOA 1X7DA 2ICAA 1W0JA 1Z0IA 2NO4A 2GF2A 2XCUA 3DYIA 5KEIA 2VH1A 1QF6A 3PDIB 1B0UA 1FVHA 1F4LA 1GKYA 2BKVA 3LU1A 4GPAA 4OHVA 3D64A 2DXIA 4IIVA 1IJEA 3JATB 4JLNA 3GH1A 5M3BA 5TMDA 1W93A 5KMGA 5JMWA 4TMYA 3OBIA 1AK9A 1LBIA 3MS2A 2NSLA 5T4BA 4B3BA 2IHNA 2X86A 1GNPA 4YP5A 2C7BA 3FBTA 4DDUA 3GHYA 4UTZA 2V6JA 3KUCA 2WWTA 3QZUA 4CMBA 3WGTA 5JE8A 3OIYA 3VR1A 3WGYA 1OB2A 3DAFA 3UY4A 3CKLA 4AZVA 1V6SA 1NU8A 4B87A 5JI3E 1BGWA 1XKLA 4IDEA 3I42A 1PU2A 3PENA 3ZGOA 3ICCA 1EJ6A 4L57A 4EJ6A 5K7SA 4NECA 1B74A 3HSSA 4QOEA 2QORA 3GWGA 3Q11A 4CM4A 3DHEA 2NU6B 2ZOSA 3E5NA 4UD6A 4ENWA 4XRGA 5IMSA 2O8EA 5T7BA 1RAGA 1PEKE 4HLNA 3SC2B 3M6AA 1W6UA 1CQIA 1E9DA 4MQ4A 3C1UA 3RJMA 5SZKB 1SRRA 1D0IA 3WR5A 4H1TA 2QR3A 3ZCSA 4E1VA 4ALIA 4LYYA 1DGQA 4HNRA 1GPKA 3O73A 4AUEA 4MMXB 1PI3A 3IAS1 2G7MC 2IOFK 1SN7A 4R71A 2QTZA 1Y81A 2J0UA 3I6IA 3CX6A 4GUAA 1JIXA 4KXLA 3HBJA 2FPRA 1DQRA 1VKJA 4QICA 4DSAA 4ZYVA 1NMQA 2IODA 2R84A 3JXEA 5E9AA 4F12A 2ERCA 2W2NA 3VMFA 3S6JA 4RULA 3W2GA 3EHDA 1E1CA 1EEHA 2YFHA 4FK8A 5GMOA 1P1FA 3VYTB 5K3EA 1MO2A 4FHZA 4W5TA 5KYYA 2Q6OA 2VQEB 1PGJA 3BVPA 2VUTA 4QYMA 4KXNA 1FDIA 1OX4B 3KALA 4L1KA 3CRNA 3ZXXA 1V3TA 3FHJA 4KFCA 2VT2A 2WHEA 2LVBA 1QQ7A 2FN4A 1BD3A 1B0ZA 1NM5C 4J03A 2DETA 4P0PB 3K1ZA 1RD4A 2D5CA 1MOQA 3FNHA 1FSZA 3IEVA 2GZHA 2YQ5A 3ZVKA 2R25B 2ZJ7A 4MWZA 4YAOA 2F1HA 4DIFA 2F8TA 3CUEF 3RS0A 1YZUA 4NEGA 2N42A 2QN9A 4KFSA 3VGJA 2LNDA 1EWTA 3ORQA 4DNPA 2H1SA 1D2HA 3R0QA 1H6AA 2A5JA 4XWGA 3TZBA 2DEUA 4UM9D 1BVRA 1GL9B 4PRLA 4N41A 4ZMRA 3Q4GA 2FZVA 1LK5A 5I9SA 3CLHA 1C0KA 1F0NA 4M0MA 2IBMA 3NHJA 2QPLA 2B2CA 3HJNA 4FR2A 1TDJA 3C6KA 4HQFA 3VV2A 1P80A 2OR3A 1JTEA 2ZSUA 2QQ0A 2CDBA 3BULA 4M2LA 1E7QA 1X7WB 5C3MA 3PRHA 3AF6A 1OWPA 3DVQX 1M74A 1OSNA 1ZICA 2PSHA 4L5JA 1BS2A 4OP1A 1HRKA 3LQ4A 5IG2A 3U7GA 4XPIB 4GMHA 4NJEB 3QNWA 4ZANA 1G6KA 4ZODA 2DGDA 5ESXA 4RORA 2XY4A 4Q7EA 4YMTA 2P9CA 3WGGA 5BVGB 4BP8A 4CKZA 5IZCC 4PICA 3A9VA 4C0LA 5EPUA 2VWPA 3O1IC 3MWEB 4HUJA 3RBVA 2WIGA 3Q7SA 5EVCA 2IPXA 2ZRPA 3VV3A 1H8HD 1XCJA 3TR6A 4DXDA 4BQQA 3BT7A 1FBNA 2P8SA 5ANRB 3KKOA 3G5LA 5BURA 5BWBA 3PNQA 3JRWA 3PIRA 5F98A 1M7GA 2CK3D 5C1DA 1ULHA 1T10A 3DLHA 1A2BA 1L8XA 5HIAA 3AR7A 1FLAA 4GZLA 2CLMB 2R11A 4HLDA 1XU7A 1C0IA 4YDRA 3WTCA 1WZ2A 1NT2A 1KZ6A 2X5XA 5MFZA 2JHFA 1GTJ1 5H0IA 2B4RO 2XQVA 3R0XA 4KXUA 5HFNA 5ARBA 3CQ9A 4YUYA 1JEYB 1XDUA 3HACA 4KN6A 3NAZA 5DBHX 3DQQA 3VNUA 4YRBA 1DJPA 3EFHA 3EZGA 2GVNA 4Z8XA 5IVDA 4O59O 4FBGA 3RYCA 2OYCA 3E2MA 3JVDA 3G82C 3ER6A 3SU8A 4K7JA 5F7ZA 3U60B 1QYIA 4AW9A 2QQFA 5LYJF 1XKQA 1E5LA 4RK4A 4V0NA 5K3AA 4EM6A 3DCIA 2E2WA 3F5SA 1VL1A 1E5DA 3DBRA 2O1SA 4L0CA 3F71A 1A9XB 1YZKA 2GYYA 4OD0A 5IT9A 1PRYA 2IXFA 4N5HX 2OFWA 4MMZB 5F33A 3NTVA 4TLCA 3DJFA 4CPDA 5ERGB 4MLPA 4YRRA 4LXTA 1G7TA 1ZK4A 2QTHA 2IIPA 4RACA 5FH9A 3ND9A 1T1EA 2WIDA 1EWVA 1FUIA 4DUGD 4ZDJA 3M81A 3ZU2A 4KQ6A 1XTQA 4MYDA 4UXIA 4EO7A 2CXNA 5IYZB 1U81A 4XVQA 4TKUA 2QVXX 3LCMA 5BN3A 4Y2XA 5KYWA 4XYEA 2NSJA 4F8YA 1XTBA 3KKPA 4O4HA 5TQ0A 1FUYB 3QLVC 1WSWA 3HUFA 5A1TA 4IV0A 1GRVA 5C8VA 5GVSA 1GAXA 3DCNA 3L18A 4RTSA 4Z7JA 3UAYA 1D2RA 3DDCA 1W85A 2QTVB 3JWIA 4LXHA 5D5PA 3UAVA 4WBNF 2F1RA 2ZUWA 5SY9A 3IVXA 4ONEA 1KJYA 2IGBA 4KH1A 3N07A 4XIGS 3ZDAA 1T0PA 4JU9A 3H1GA 4F4FA 5CJPA 4B3SB 5DYYA 1YZHA 4IJVA 5HOQA 3NBXX 3NIBA 4KNYA 3EAQA 1OI3A 4Q19A 1JQ5A 3QYPA 3STWA 4MYSA 4OCZA 4IOLA 1J24A 4UOEA 3WGQA 1KJ8A 2Q2OA 2DUUA 3VSAA 5IT5A 4WBSA 5FBRB 3SVLA 1RJFA 1M83A 3TZQA 3W2IA 3WL6A 4NZZA 3GN1A 4BRZA 3HO1A 4DSOA 3L40A 3WHIA 5D00A 3A14A 5HIKA 4Y1FA 5K0GA 4QECA 4QFCA 4CEJB 1P6UA 3GA0A 4GQBA 4ID3A 4Q48A 4BO6A 3N2IA 3SVZA 2OBFA 1EUDB 5EERA 4BBZA 3CO5A 1Q7BA 4TT8A 3OQHA 5LC1A 1AOXA 4ISCA 4Y2GA 5CXXA 4IFEA 3FPLA 3P9XA 4HOYA 1NDQA 1SUBA 2C4VA 4MCIA 3W4IA 1JIIA 2RHLA 3AHFA 1FNBA 3BXPA 3GOQA 3ILXA 2C42A 3GDGA 3KE8A 4Y3UA 1ZM4A 4OLJA 3SXJA 3GGOA 4JU8A 3PX7A 2IVZA 3UOWA 1XYVA 5L3RA 5AW1A 3EVGA 2F2TA 4HDSA 2I8CA 3OHSX 4MR9A 4HRAA 1HYHA 2C5HA 2Q3FA 4Q9KA 1KQGA 2GPWA 2JIQA 1EM6A 2WNIA 2XUGA 3IEKA 3KJZA 4C22A 5JNUA 4QBKA 4DAEA 1N2ZA 1XC7A 3Q6IA 2QD1A 2CKDA 2ZI5A 3NUGA 1QP8A 1NXVA 3B38A 1XMPA 3EIWA 3PFBA 4G63A 3TNLA 4EF5A 1O9BA 3IKJA 1JEJA 4TKVA 5LQSA 4TTIA 3PFNA 1QIEA 3VR2D 3W5AA 3OZTA 3AEUA 5J4VA 3TSAA 4JBHA 4UPDA 4MV8A 1XD2B 5A5GA 4S04A 3C97A 3QJYA 2OQ2A 5ALEA 3RODA 3PPVA 1SUIA 1X7YA 1KGSA 2JS7A 4JWKA 3BXGA 1J49A 3L0PA 3BPSA 2HO5A 2Y6VA 2NIPA 5AXCA 4J0QA 4O3MA 1V5FA 3Q1LA 1M3SA 1NNI1 1ZUWA 3ZK7A 4JA0A 4MIEA 4YONB 2RKWA 2VEOA 1QQ6A 5REQA 4MUFA 3ES9A 4FE4A 5ITZB 3HHEA 2ALJA 3D6UA 4TKZA 3WLJA 4D3ZA 3WB2A 4YPVA 4QYTA 3CNOA 5G2OA 2OOSA 1EK2A 3R5TA 4KC0A 3C8ZA 3LNTA 3ORHA 3RKSA 1M33A 4WKGA 1NVDA 1JZTA 4YAKA 1AS3A 1RACA 9ATCA 1NPYA 2VLIA 3CLKA 5GADl 1E9VA 1QBGA 4ZI7B 4CHGA 2ODEA 2BGLA 3NEAA 4Q18A 2V4ZA 1VKNA 1U2DA 1GTZA 1QV7A 5EP3A 1BMTA 1VHWA 2HMWA 3F78A 3MMPA 5BNTA 1CU1A 1T5TA 4H7FA 1FYVA 5J4KA 3AEQB 4G56A 2IS2A 3L07A 2I2BA 2DH6A 4DBVO 5DWVA 2Z2KA 3HDGA 5U4XA 4B0PA 4UVEA 5KNCH 3NIDB 5IUJC 3OT1B 2XVYA 3DKRA 4KGVA 5ALUA 5FI1B 1XP8A 4EAAA 2Q7OE 5BOSA 5JXIA 5KVCA 1LPSA 5LFAA 3ESRA 4LFBB 4U3JA 3FCXA 3PTLA 4C06A 4C7JA 1DDOA 4DDWA 1I0IA 2ZYGA 5FR1A 2VF8A 1KP2A 5FTJA 4UE2A 1AMUA 3T7RA 2IH2A 3LTNC 3PJFA 4Q02A 3AU8A 2D1RA 1N5KA 3KHSA 4L07A 2IIVA 1YAHA 3AG5A 1HBJA 4M7PA 1YHZA 4NPCA 2PGLA 1GITA 2D1SA 3HCCA 1ZFNA 3BHJA 5C5DA 2LKCA 4BX3A 4A8HA 3Q5DA 2ZI6A 3CUVA 1C0EA 4DGSA 1FTGA 1STOA 1W5EA 3NZEA 2UVPA 3VNSA 3I9KA 2GHRA 1GYQA 1M0WA 4YO7A 2A5FA 4UNPA 4YRTA 3RIEA 5JJCA 1KJ9A 1W7AA 2TMGA 3FGPA 3PNOA 3ZJ5A 5A02A 1ZJWA 5F7JA 2ZRLA 2OV4A 1KDOA 1BMFA 3PNPA 4DAOA 4E13A 3NUQA 4ZXFA 1CG6A 5E9JA 5FTLA 1JEOA 1KMIY 2I54A 4ZOAA 1NE2A 1I6KA 1G8HA 2CZGA 3CMCO 1N5OX 1FU4A 2Q5LA 1IDOA 1O94A 1VA5A 1GZ3A 1ZC4A 2IXTA 2XUHA 3EGOA 3I4FA 4M7OA 4JC4A 4PCAA 3VR6A 5DISB 2CLIB 1P1HA 5EN4A 1A8HA 1DBRA 1SUPA 2RCYA 4GGPA 4JHXA 2ZRIA 2ZRMA 1WZEA 4YCSA 3H0CA 1M2JA 1OLSB 1X80B 2IYPA 1UDRA 3JTEA 3FHTA 1J9GA 1GQOA 2Q5HA 3V8NA 2P67A 4KVAA 3WLRA 4GQIA 3RUPA 4WHMA 4Y2RA 3FCSB 4KMMA 4B3HA 1NE7A 3BN3A 3MMZA 5L3QB 2A1TS 4YT4A 1Q0HA 4J2TA 1XALA 1QBKC 3PKZA 1MO4A 3UHAA 1CZRA 1O54A 3TIXB 4GYYA 1DLJA 3MBKA 2COUA 1L3BA 2JAXA 2K6GA 4WL0A 3L92A 3KU4A 3G9XA 4PRYA 2Z98A 3CE6A 5K4HA 1NQUA 4MB6A 3P96A 1I94B 2AB0A 1NUSA 3HN7A 2EF1A 2PFGA 4LK3A 4HDMA 2GEFA 4HWSA 4GKJB 4AICA 5MN5A 1SHLA 1TJ3A 2I3GA 4E6EA 2FWRA 3P8ZA 1VSBA 1QHHB 2Z5LA 4FEEA 4GI2A 3A6FA 4KW7A 4QNNA 1RDFA 2FCRA 3ESBA 3LGXA 4TWZA 3OA0A 3HBFA 1BMQA 1KZGB 4QT0A 5DEOA 5FBKA 3M5WA 4YWJA 2GTPA 2WF6A 2X76A 3E81A 2ZWPA 3D6VA 2HHJA 4LXIA 5EESA 1J97A 1THTA 4EL0A 5JAPA 2AS0A 5KBYA 4M1EA 1QRSA 3M1YA 4YREA 2PL3A 2VDQB 3QVUA 3H11A 3FKSD 2XUPA 4MUNA 4F3YA 4TTTS 4WN9A 4OSOA 3NVAA 1NJ6A 3VVMA 3OPVA 3MOSA 2EYUA 2P77A 1C1HA 3LOPA 3RSQA 1OFGA 4MV9A 1G7SA 5AOBA 2D5BA 3DUFA 3P9PA 4HNAA 4J49A 5JW6A 4XM0A 5B7NA 3DWEX 1SBHA 3WYNA 2H4FA 2LE0A 2M1XA 4BJ1A 3Q7TA 1R1DA 1H3NA 5T6MA 3K1JA 2H5LA 2O0HA 3GZJA 2QQEA 3RS5A 1OAAA 2F55A 3PDJA 1Y33E 2Z5VA 1XDGA 3A1TA 1XPOA 1CTQA 1VZ3A 1Y3BE 2G25A 2ZS8A 4JLBA 1YS4A 4QPDA 2XITA 2IUSA 1DV1A 2ZS9A 3N8DA 1GGHA 5HFJA 3ROQA 4UM8B 4IWYA 4KVFA 3WA6A 2PLWA 4CIVA 2WD7A 5K5EA 4JS0A 3ICQB 4DV1B 3AWDA 5FR2A 3CUKA 3LLSA 5FI0B 4CV0A 1EWQA 4WESB 3OP1A 4FYKA 3GFQA 3NNNA 2V3CC 3GC6A 1MX5A 3NT2A 1OUMA 2WE7A 1KE1A 3I28A 1O77A 3P4XA 4E94A 1FL9A 2OFPA 2XWJI 3CZRA 1NBWB 1ZD4A 2F1KA 2PMKA 4Y67A 4C03A 3IBTA 1TT5B 3GH3A 3RTEA 3GJ3A 4Y2UA 4Y2JA 3T1OA 3FOBA 1SEVA 2YOHA 3W8DA 5J2UA 2RK3A 4EKYA 2PMBA 1E5QA 2WLSA 3A32A 3IJEB 3OQIA 5E3HA 3GJ7A 4D9HA 3GEDA 2WUFA 3QPVA 4WNAB 1M7BA 1F6BA 1A9YA 3FX2A 2VHYA 3R3UA 4U2KA 3V2HA 3ZQUA 1JH9A 2W2XA 3RYIB 3TZEA 3SLRA 1RP1A 3C4JA 3DZCA 4LCBA 2WJVA 1RRVA 2HUPA 1HL7A 3PCXA 3DWGA 1CR4A 1KMHB 4OH7A 1ZH2A 3GHHA 4P36A 4CTKA 5KVVA 4Q9AA 1B6GA 4BASA 5LQKA 1QIGA 5JCOA 4CW7A 3D3WA 3P9ZA 4CKEB 1VIAA 3CLRC 1I3KA 3B3GA 4OL0A 2B82A 4DC9A 2BMJA 5PGMA 2CFRA 3CKYA 4G4IA 2DBQA 1XEWY 4L4SA 4CM8B 1S2OA 1OHHD 3LE8A 1FFBA 2FFAA 1REQA 3I2KA 3NC0C 1BQ4A 3YASA 4FS8A 1P3Y1 3KSZO 4E7OA 1N2SA 1Y0BA 4RJJA 2C54A 2OO7A 4YV1A 4U7GA 1NQOA 4JY7A 5AW6A 3O8RA 2XMSA 4DIEA 4EEXA 3Q5GA 3VU9A 1VL5A 2FG7C 1KOFA 1FCJA 2NAPA 3FFTA 3O7WA 1RPZA 3E0QA 3WV5A 4K3UA 2VDMB 3GCGA 1Y4AE 1CSEE 1JZSA 5FTNA 4HSEA 1UPCA 1W46A 2PJDA 2M98A 3JQ7B 1YGYA 3NNDA 3COPA 3R75A 3S27A 3MBOA 2VYNA 1X7GA 4JASB 2D2FA 3T3IA 3VU0A 5IJ9B 5IF9A 2UUAB 2IYYA 3OTQA 1IDN1 3NDIA 1WUHS 4D98A 3FYUC 4OLAA 2E37A 1R8YA 3SS7X 1L4BA 1DHRA 2B4AA 2F59A 5JAHA 4M0DA 2QMQA 1IN8A 1RQ2A 4JSTA 1YBMA 5BR4A 3BHMA 3PXDA 1KYTA 4EMUA 3ZX4A 1EHIA 4BFVA 5GJBA 3SQWA 1QHFA 2AN4A 2QX6A 1I1QB 1PUXA 3BGIA 2YVAA 5BYJA 5BR7A 1W36D 4R8MA 1C9DB 3AUKA 3BRWA 3HNRA 2R1UA 5LMZA 4O33A 1DTEA 3PFKA 1JYSA 1P7YA 2GAOA 2YFKA 5M2QA 4UEWA 4OREX 3TLEA 1NXQA 1CIJA 1JHOA 2SECE 3QBVA 3FPSA 1MIOA 2Q4OA 1SBTA 1QQTA 2P2CA 2RMKA 2FPGA 3E05A 3MYRA 3T95A 3WWZA 3RC1A 2GD0A 3EXHB 3PDCA 3T7TA 4MQMA 2XKJE 2D5IA 2OWEA 1KYQA 2Q0XA 2VH2A 2HZBA 2Z2IA 3OUUA 4IKPA 1KKMA 3L0ZA 4LOLA 1SUDA 4JLOA 1BX1A 5DWQA 1OA1A 4INJA 4TSFA 3V8EA 4CCYA 2VP6A 5J5VA 3PT5A 4HRYA 3UK2A 4ZTZB 4IGIA 2AD1A 5DP1A 3BHNA 5DRYA 5LP1A 5ECGC 4LVNA 1KEVA 1O9HA 1E0KA 3X0DA 3A4TA 4Z4FA 2E4AA 5IK2A 2DKFA 4WBXC 1E5XA 2ZRCA 1ZVJA 3Q2KA 2W2LA 3KVYA 3QHAA 4HXYA 1MV8A 4QASA 4AG6A 1LBEA 3BM5A 5EINA 2DMRA 5KNBH 5KDDA 5CYPA 2VNIA 4LQDA 4BVJA 3EMVA 1Q17A 1J20A 3PK0A 3WYDA 3DO5A 1J0CA 1Q7EA 1R0LA 1RWMA 2AJCA 2O14A 1P5HA 2XCIA 3AP3A 3D4PA 3DEZA 3DDUA 3LWDA 1ZY2A 5L3SA 4CKBB 5E6SB 5AVZA 3FVWA 4BTVA 4AIRA 1V3VA 2DU8A 3OIVA 4M0LA 5C80A 2BH2A 2C4HA 2BR3A 1P4SA 5BSGA 2ZB4A 1G8MA 2BGRA 2VAXA 5EGSA 2NO7A 4EYEA 4YRGA 3EVEA 2WICA 3CLSD 2D7CA 2QUIA 2YOGA 5AIAA 1AKRA 4P3KA 1AGXA 3VPBA 3OJLA 3NTLA 4D99A 1X77A 1JBQA 1JSXA 3I73A 1RVDA 4PNPA 5K3FB 1SQ5A 3ONEA 2YJ4A 4UAJA 5I9LA 3C4VA 1J1UA 4RKEA 5DTEA 2HX1A 2NQ2C 1FIUA 1G1MA 1DL5A 1OAOC 2YRFA 2P9EA 4NH4A 4DPKA 1F2UA 2YNMC 1ZOPA 5FUBA 4Q3NA 2PKYX 4PSCA 3SF0A 3W8FA 1ZH6A 2VBCA 4OQMA 3P9CA 4LY3A 5C9ZA 1P4JA 1M5UA 1UFKA 1QXSA 3ESXA 4QPJC 4RXUA 5ALYA 1LDEA 3GELA 4ENPA 1IYZA 2ZI4A 1DTSA 3MJCA 4LNUB 1I10A 1QB7A 2NZYA 4YROA 3NHYA 4YMHA 2AOXA 1C3OB 1IONA 4JLAA 3TLJA 2ZUBA 3PQDA 4LZLA 2JFPA 3GFVA 3ZEIA 1XCOA 4IM7A 2BELA 1K3FA 1MEEA 2RBEA 2ZU6A 3MT7A 2ZUTA 3KSBC 4QEDA 4WNYA 4INOA 1II8B 5DXFA 1IN6A 1JECA 1O6CA 2FZGA 5LQDA 3RG2A 4DFDA 4GEGA 2AG1A 4LBVA 3K0CC 1ZXBA 3LWBA 1X9IA 3HKBA 4EY7A 4R1TA 3QKTA 3T52A 4CTMA 1Q1EA 3LYAA 1B26A 1ZK2A 4HCJA 2W8BA 5B36A 3DZDA 1MVOA 2D2EA 1G8YA 4YXFA 2IHZA 3LJKA 3QE4A 1Y9DA 2A9OA 1M2OB 5LP6B 1NW3A 1T4CA 3CSUA 1OZGA 4E11A 4MR8A 1BKDR 1VHLA 1JHYA 2QN1A 3QOFA 1LBSA 5FI3A 5AYVA 5K8IA 3OZFA 4HEHA 5DULA 2DPYA 3AEKB 3LC7O 4C05A 2WJHA 4CMIA 2R2AA 3KEMA 1MX3A 5HR5A 4JLWA 4DMKA 1F2VA 2AJLI 3L02A 1FYFA 2QRLA 2QY9A 5T64A 1XVIA 1YRWA 2VDKB 3CV3A 3KVNA 1M75A 1XAHA 2CXUA 2EFDB 3RWMB 2PRSA 1HTWA 2HRDA 1VKZA 5I9BA 3X2FA 1O3YA 3PE4A 1P6XA 3E35A 4ND4A 5E7IA 1QFYA 1TA0A 2PZMA 2NVWA 1NVEA 5HJ7A 1M1YA 3CSSA 3WB1A 1X1QA 2G8LA 4A6DA 1VJRA 1N0WA 4KPUA 1WXEA 3L1VA 4OI2A 4IJKA 1ODSA 1JJIA 1Q7TA 4IXDA 5I6DA 4L2IB 8OHMA 1LLCA 4B82A 2ROQA 3LA6A 3LDHA 3OC0A 1F5SA 3N70A 3OMLA 5FOUA 3WDMA 1Y8RB 3GJTA 3UANA 1YL7A 1LJ8A 2VAMA 1G0OA 1O6BA 2IEGA 3L82B 4WCFC 5G3YA 5AVWA 1JIQA 4YR7A 1MB4A 1A5SB 2QTBA 3WGVA 1Y6RA 4D9CA 3ND5A 1LDBA 4TQAA 4YT2A 2WK1A 2O8CB 3DMNA 4IIEA 3L8GA 5AP9A 1O96A 1OLOA 3FE2A 4TV8F 3TLKA 3RIYA 1YJBA 4PE5B 2A57A 3C8MA 2HRCA 1VKHA 3NRBA 4M0PA 4D9JA 2XA2A 1VTKA 1KO5A 1V9CA 2PZ8A 3CRVA 4G0NA 3O9ZA 2VQ3A 4TLLB 4X64B 2MINB 2OO3A 1NX6A 1K7EB 3NAQA 3QU2A 4OQNA 4HD8A 3TAUA 4RFVA 4BX2A 4W5RA 1BMDA 1TE2A 2F6RA 2XUOA 4R7GA 4BNTA 2AVDA 4G5SA 4HB0A 1UBHS 4MIKA 3LPCA 4W8GA 2ATEA 2CXRA 1UKZA 2B9VA 4QKQA 2UZ0A 1ACLA 1L5SA 1PV1A 4UDYX 4NEQA 2JD2A 3FRIA 5AIBA 3D6TB 2A0KA 1PZMA 2W7TA 1MT0A 1U2PA 2D06A 4ZPJA 3ZHYA 1T2NA 1T35A 1Z0UA 3QX8A 2ASEA 4Q4DA 5HQ3B 1CIVA 5IS2A 1GPBA 3PFHA 3AEXA 2NXJA 5DWDA 5EEHA 3KTAA 5HILA 1UOQA 5GAJA 4X6UA 5KOJA 4IG9A 3L8CA 1JDTA 2O7SA 3JYHA 2P9ZA 2CN1A 1U7DA 2W22A 2NU9A 2O6LA 4GOKA 3EGEA 3TR5A 4BLWA 2BBSA 2GYUA 4AFNA 5IC4A 3U6KA 4U7WA 5KSYA 1KFKB 2YV1A 3EOAI 3H1BA 1HDXA 3L0CA 1QHSA 3M4YA 4U7HA 1L5KA 1FUUA 1NBEA 2AI2A 2DPMA 4ZZ1A 2BVNA 3E3LA 2XCOA 1T34A 4IDHA 2FG6C 4ZRMA 1MC1A 3GT0A 3K94A 1T43A 3KHTA 4BWVA 3GFSA 4OUDA 4QUKA 2G63A 2WZCA 3PFGA 1N6OA 4AM8A 2ZSHA 1MB9A 3M89A 4XDGA 4TV9F 4Y1EA 3IPAA 5AK6A 3PPIA 5FXMA 1E3IA 4B85A 4BO4A 3OO1A 1VLVA 4ZVMA 4FFBB 2QNIA 5EWMB 3U44B 2ZWAA 4QOJA 4CIXA 2G67A 2ZYTX 3A31A 3GZNA 3REQB 4BOYA 1KY2A 1W19A 2CJPA 2V6IA 4JROA 5T4HA 3ETNA 1X1RA 1O0BA 1NVBA 1O1YA 2EL7A 1VIDA 5HP4A 2XHZA 3LDAA 4MTCA 1CEEA 1ZNWA 4X8LA 1VIYA 3W6OA 3ZPXA 4DA7A 1IM2A 1NYTA 1SVSA 3PEUA 4EJMA 4R9SA 4E4RA 5KTNA 1TKAA 1FNNA 1J5PA 3FMOB 2CE2X 1E9AA 3N2GA 3OFKA 4QYWA 5G4KA 5I4IA 4KRXA 1ZH4A 3LBHA 4I14A 1PS8A 1N2HA 4JA2A 5B3JC 5B6PA 5K8JB 3KXIA 1ABFA 2RCNA 1JEAA 2QIOA 1Z3CA 3K3PA 4JELA 4NXNB 4EX7A 1HOXA 2VK1A 4WCDA 3EA4A 5IXSA 3R7NA 1KYXA 2J9RA 5E1DA 4TLDA 4X6YA 3WLLA 2HW8A 4DLAA 1FDRA 2RK6A 4I1PA 4HGNA 2IYZA 1K86A 2DSTA 2E48A 2GEUA 3ORYA 1V6CA 4O4JB 3EGXA 3UXMA 1PR0A 3T12A 4EKNB 3NLLA 3MTBA 4XQEA 4A8JB 1GTG1 3P0RA 3UUWA 3MMSA 2J4CA 1TM7E 1R6VA 1YB6A 1I1NA 4H9GA 1L4LA 3FGNA 2EKQA 1Y3HA 5FUMA 1U6IA 2VNHA 5KAPA 4F4JA 3AFIA 2ZIZA 4KH0A 4W8HA 1EA7A 3KQTA 1IZ9A 3OUTA 2BSXA 3H84A 5FKJA 3WQQA 1ODIA 2CFTA 4QODA 5A7FA 4RQAA 4I50F 2AJBA 3LH5A 5HIMA 1V1RB 3M3PA 2P4HX 1RI1A 2P2YA 2ATVA 1G2QA 3KUDA 1QYCA 5BMOA 4OP3A 2RH5A 5FUVA 1NF3A 2B1IA 4J1TC 2WG1A 3TEMA 4Q4HB 4UU1A 2C78A 4M53A 2GCOA 5ADVA 7YASA 1VYHA 4EW3A 5T3UA 5EQFA 4OHYA 3E84A 4L5YA 4X92A 1A5AB 2FRDC 3S2SA 4DN6A 2FV8A 2GESA 3G8YA 2JCVA 4Q1EA 5ABPA 3CU5A 1YBAA 4GXRA 4O2BB 1EVYA 1GADO 5K0SA 3DEJA 2R6R1 1PWXA 4RC9A 3NANA 3LOUA 1FMJA 1KK1A 4EYQA 3ILYA 2CHQA 2B6HA 3EZ9A 5KU7A 3TGLA 4LJ9A 4PO1A 1G6OA 3QVSA 3IV6A 2I4IA 2Y67A 4K9KA 4F6RA 1OYYA 2BKAA 4ZOLA 3WLQA 3G2QA 3EVAA 5AJTA 1L5FA 3GLHE 2GR9A 2F90A 4IZOA 4PLYA 5U1PA 4B9EA 5DNAA 3TSYA 4UKDA 4CMGA 4YRKA 3P97A 1HF3A 4MGIR 1SVNA 4RKFA 4EHAA 4QXRA 1L2TA 1E5TA 4UCFA 1GRRA 1EFCA 2Q6KA 3I76A 4PONA 3MPOA 1C3VA 4XSVA 4RW0A 5LB4A 3RU2A 3ZWOA 4UM9B 4D4KA 4ZEWA 1F8GA 1JLRA 4KP7A 2W6NA 1U8TA 2ZB3A 1EFAA 4DDHA 1LSUA 3LDFA 4EJ0A 3DJYA 3WQRA 4MRPA 3FOZA 4F21A 5E8RA 1SKYB 4UHKA 3U7JA 3SDZA 3AR9A 3Q3GE 3H04A 4GH5A 4HXFB 3TJRA 3NC1C 4BC1A 4XEUA 4NFYA 3CR7A 2LRHA 2REQB 2QYOA 2Y1XA 3O8CA 3W3AD 5C8ZA 5DBGA 5BNWA 5CEJA 1JDVA 1LC3A 3BICA 4HADA 5FLEX 5A4JA 5BN1A 1S9DA 1Z28A 5L6MB 4LWZA 3GG2A 4LCEA 2XGJA 3LTEA 1YL6A 2NX2A 4HGPA 4OFXA 5EUCA 3N7AA 1NI4A 4B4WA 4XD7D 4MVJI 5EIOA 2AFIA 2DUWA 2ZE8A 2YDYA 5B2FA 1MG0A 3NDPA 4QDJA 4MI3A 4RTJA 4ZCTA 4GXTA 5F2KA 4ARUA 2VJMB 2NADA 3B2NA 4PS1A 3G0OA 1UFQA 5DHSA 4X00A 4F1JA 5HZGA 5HEKA 3DTVB 4RD1A 1DBQA 3HNOA 2C2HA 1Y48E 1KK3A 2HRQA 3FNBA 3ITNA 1UC4B 3PVCA 3KOZA 4RPCA 3V4SA 2QN2A 2WYUA 4B09A 1IVYA 3CRW1 4OK6A 5SZHB 5LSAA 4LY6A 4DZTA 4HWKA 3EFOA 1Y9AA 2Q4TA 2HBYA 3E70C 2KLHA 3FETA 4M6WA 4NK5A 3O1LA 3O4HA 3OIUA 1J4AA 2C57A 2H59A 3KT0A 4I2VA 4NJMB 3P0FA 4DNXA 2H17A 2OK7A 4PXSA 2MDTA 4O29A 1FP4B 1VLZA 3NDJA 1PT9A 2GARA 4OYLA 1WQ3A 3C45A 1S8AA 4YRMA 4I8XA 1YU9A 2PEYA 4R2HA 3FCEA 1XK6A 3BWBA 3E27A 4KYIB 3RD5A 2RGGA 2YFYA 4UZSA 1PZFA 1RM4A 2Q1UA 1GVHA 5IZ4A 2FR0A 3UCEA 2PR7A