4NS1A

Crystal structure of purine nucleoside phosphorylase from porphyromonas gingivalis atcc 33277, nysgrc target 30972
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
273
structure length
267
Chain Sequence
MKLQEQHYHEAASFLSSRLPGDAKTAIILGSGLGELAEKIENKTVIPYNEIPHFAQAKGNIIGGILGGTPVVAMQGRFHYYEGYSMDQVTFPIRVMKLLGIENLFVSNAAGGINTSFKVGDLMIIDHINNLPNPLIGPNMDMFGVRFPDMTRAYDREFIAKAKGIAQELNIPVKEGVYVGLTGPSYETPAEYKFWGQVGGDAIGMSTVPEVIVARHTGIRVFGMSVITNEGYHFADDFVNDEQDVIRAANAASEKMGAIFARLIAAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
publication title Crystal structure of purine nucleoside phosphorylase from Porphyromonas gingivalis ATCC 33277, NYSGRC Target 30972.
rcsb
source organism Porphyromonas gingivalis
total genus 76
structure length 267
sequence length 273
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2013-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ns1A00
5CXSA 2RJ3A 1RXUA 2OC4A 1V2HE 3EEIA 1FXUA 1ZOSA 4LZWA 1LVUA 1TCUA 3DJFA 2A0XA 3F8WA 3O4VA 4L5CA 1A9SA 3BSFA 3DPSA 2OECA 3GB9A 1I80A 1Z33A 1JDVA 4DANA 1V4NA 5K1ZA 5B7PA 4DA0A 3OOHA 4R31A 4DA6A 3OZBA 4OJTA 4P54A 1ULBA 4LNAA 3K8OE 4I2VA 5EFOA 4BMXA 4LNHA 3EUFA 2I8AA 1B8NA 3IOMA 4BMZA 3E9RA 2HWUA 4EARA 4QARA 3OOEA 3KHSA 1NC1A 3DDOA 4G89A 4QFBA 4JWTA 5IU6A 2AI1A 1YRYE 1YQQA 3EMVA 4DA8A 3C74A 3BGSA 3DP9A 1RT9A 1A9OA 1JDSA 1JPVA 5KB3A 1U1GA 1U1FA 2XRFA 1TD1A 4OGLA 1VHWA 1RCTE 4DAEA 3LBAA 3OZEA 3EUEA 5DK6A 2H8GA 4H1TA 3OZCA 1PR5A 1OUMA 1K3FA 4D9HA 1T8SA 1RXYA 1QE5A 1K9SA 1JP7A 1OU4A 1Z39A 1NC3A 1Y1RA 1PR0A 3INYA 3QPBA 4QASA 1OTYA 3D1VA 3E0QA 3OPVA 2OXFA 1G2OA 4TXHA 3MB8A 1PBNA 4G8JA 3OCCA 2AI2A 1JDTA 1VMKA 3U40A 4PR3A 1A9TA 4QATA 1T8RA 1PK9A 2PGAA 1T0UA 4WKPA 2AI3A 1VFNA 3KVRA 5EPUA 4WKNA 3O6VA 4M1EA 4F3CA 1ODKA 3KU4A 4OGKA 1ODLA 1OV6A 4PNPA 5CYGA 2B94A 1ZL2A 1N3IA 2QPLA 3UT6A 3FB1A 4TS3A 3FOWA 1OVGA 4D8YA 4DA7A 5CXQA 1Z36A 1Y6RA 4LDNA 4YO8A 4QEZA 3K8QA 4MARA 4F1WA 1ECPA 4L6IA 1B8OA 4YJKA 1RR6A 2A0YA 3BL6A 1TGYA 1SD1A 1Z38A 4L0MA 5B7GA 1V3QE 1PR6A 1V48A 1OTXA 4GKAA 4NY1A 5FAKA 3NM6B 4F2WA 1RFGE 4GLFA 1Z34A 2IQ5A 1PKEA 2QSUA 3FNQA 5F7ZA 1PWYE 4OEHA 2HSWA 4D8VA 3MMSA 3PHCA 1Z5NA 2OC9A 3TL6A 1Y1SA 4IP0A 3DF9A 4WKCA 1U1DA 1A9RA 5F7JA 3FAZA 3PHBE 5B7QA 3PNSA 5B7NA 2ISCA 2ON6A 1M73E 3UAYA 2GUWA 5CYFA 4JOSA 3OF3A 1CB0A 1T8WA 4F2PA 4BMYA 4LKRA 1TCVA 4RJ2A 5CCDA 4ECEA 5EUBA 1NW4A 5F78A 3LA8A 2P4SA 3KVVA 1JYSA 1ODJA 1SD2A 1A69A 4G41A 1SQ6A 3NM4A 3P0EA 4OF4A 4R2WA 1CG6A 3BJEA 3UAXA 5F77A 3P0FA 1Z5OA 1A9PA 4L5YA 1JE0A 1PK7A 1Z5PA 1LV8A 4U2KA 4TTAA 1Y1TA 2AC7A 2Q7OE 1V41E 1JDUA 2A0WA 3GGSA 1XE3A 1WTAA 4BN0A 4M7WA 1RSZA 3ENZA 4YMLA 1U1EA 5F7XA 5CCEA 3FUCA 4L5AA 1K27A 4DAOA 5I3CA 4TS9A 4TYMA 4TTJA 4DABA 4TXLA 1PR1A 4MCIA 4UC0A 5F73A 3NBQA 5ETJA 3PNPA 4D98A 2I4TA 3E9ZA 1LX7A 1VHJA 4M3NA 1JDZA 2HRDA 1YR3A 2QTGA 1RXSA 1JE1A 1YQUA 4TXNA 1Q1GA 3KVYA 4GMHA 1RXCA 1PR2A 1PW7A 1V45E 1Z35A 1RYZA 4D8XA 5C80A 4JP5A 1PF7E 3FWPA 2HN9A 3UAZA 1YBFA 1Y1QA 5JPCA 4MCHA 4NS1A 4F3KA 5F7OA 1Z37A 2QTTA 4E1VA 5IFKA 2A8YA 4R2XA 1A9QA 3SCZA 1PR4A 3UAWA 1ODIA 1Y6QA 3ONVA 3KUKA 2BSXA 4OY3A 1T8YA 3OZDA 4X24A 3LGSA 2QDKA 4GLJA 3ODGA 4KN5A 3NM5A 4YNBA 4TXJA 1TGVA 1C3XA 3T94A 5F76A 4DARA 4WKBA 4QAQA 4WKOA 4FFSA 3IEXA 4TXMA 1ULAA 4NSNA 1U1CA 4K6OA 4EB8A 1SJ9A 3UAVA 4TTIA
chains in the Genus database with same CATH superfamily
3Q10A 5D3ZA 3NT5A 4FP9A 5ALUA 2J33A 5TQJA 3Q8KA 1SD5A 1VYVA 2BUCA 1MJ5A 1JIQA 2VYQA 4RCYA 1I6LA 3TPCA 2P9HA 1FS6A 1OA1A 5TVKA 3DB1A 1LI7A 3N07A 1ZOSA 3UJ7A 4IDQA 2CXUA 2Y1WA 2C42A 4UU1A 1TCUA 4X63A 1PFKA 2J67A 4PLHA 3EXG2 3HYRA 4JLJA 3TPFA 5ALTA 1K7CA 1LZKA 1FNMA 5JSUA 5MN4A 1OT3A 2REOA 3ELYA 3ELBA 2HLNA 4JEUA 4CNQA 4M21A 3T0FA 3OZXA 1X13A 2QWXA 5FUXA 2Y27A 1GVHA 5EJ5A 3ACDA 4B7CA 2FSVA 4J7CA 4RPGA 4U2EA 5E1BA 1JVSA 2UVPB 2C54A 1YZKA 4C21A 4F91B 1DELA 4C7OA 3A4NA 2VXOA 4IL5A 4W5HA 5CRIA 4RFLA 4DLBA 5DBHX 2G67A 2YYAA 4E4RA 1G66A 2HWWA 3C16C 3PXGA 2CNDA 4GPZA 1O0BA 2JGKA 1E18A 3KOWA 4K2AA 3REQA 1FMLA 2JIDA 2QGFA 3DMFA 2H63A 1AMUA 3OZSA 1DMRA 5EFOA 3KLOA 2WFLB 4TLAA 3RBAA 4MGZR 3FCEA 1E3SA 4KQEA 2GN8A 5F9HA 3DULA 3PUYA 1IG0A 2YS6A 4CMKA 4OUDA 2G3YA 2XAAA 3IDSA 1YS1X 2OLKA 1NRXA 2FETA 2PWYA 1BU8A 2WJYA 5DSZA 3H2ZA 1BX0A 2P69A 2PUHA 3WYBA 4PHCA 1YHNA 3B2QA 1T5HX 4H27A 3K72B 4MRVA 1WQ1R 4R8KA 4ZO9A 4EI8A 2Q6OA 3E9QA 2GM9A 4IOKA 4R9SA 4RV4A 5H7XA 4JWTA 3OE1A 5COAA 2AOXA 1PJ4A 4LY9A 4AKEA 3DNMA 3BGWA 4ZAWA 5KOJA 1ZR4A 2HW8A 4XWOA 4R1TA 5F23A 4Q9DA 3QH4A 4EJ6A 1MC4A 3GGDA 2BL4A 5IKOA 1S8FA 2E37A 5LZ9A 1G3IA 5AXDA 4NBRA 3V8MA 1FRFS 4RXMA 1I6WA 1IRXA 2O8CB 2D1YA 4H08A 3DP9A 4P4GA 3WO0A 1N6LA 2WA2A 2XWBF 4K6HA 4KLCA 3GLHE 5BVHB 1YB4A 2Q4BA 1Y37A 2XUIA 4EF6A 2FDRA 2NIPA 2WSLA 4BNFA 4UW9A 5JNTA 1QPGA 1CUHA 3STUA 1E1MA 2FPUA 2D1SA 3MJRA 3AJDA 3OZEA 5U1PA 1M0EA 1WY7A 2C4VA 2WVAA 3ZD6A 1KAOA 4M7OA 4N49A 5EGSA 1GZSA 3G0CA 1M8FA 1PR5A 1R5NA 3NBUA 4YXFA 4S1TA 1VCOA 5JE8A 3QEBZ 4M98A 4E13A 2IIQA 5FA8A 5C8DA 2HDNB 2O9JA 3TW0A 2PFSA 4CMJA 1LLFA 4PN3A 5K05A 4UNPA 5LWHA 4P4LA 1BCRA 2Q49A 4AMUA 4Q3DA 1I7LA 2KHZA 2CDRA 4GC5A 1YHZA 3IV9A 4EDFA 4AKIA 1IHPA 2VAMA 3I4CA 3DL0A 1ZRNA 4HXGA 5AW4A 1GXSA 4HD8A 2FPPA 2IRWA 2V6BA 2OCBA 4QUKA 1TCCA 1ZHHA 2YWRA 3D1VA 4IHJB 3DEAA 3PVZA 5BSRA 3I1YA 3HM2A 4MV1A 1P2DA 1MD9A 4FCVA 4P08A 1F0YA 5ALJA 4BWVA 2BRUC 5ENDA 4QOHA 5LP6C 4AMZA 4CQMD 4WZBB 2HHHB 2PRYA 1A7KA 1R0YA 1UH5A 3DAYA 4N3AA 1DX6A 3AR7A 4TWBA 5DGIA 1W48A 4D9FA 5K3OA 1FUKA 1I8TA 3HCEA 3R3XA 1P45A 2WSSA 3Q2OA 3IKJA 4N5IX 4F97A 2H2IA 2WTXA 3M9LA 4ZARA 3LY8A 2IE0A 3R3ZA 4G5SA 5T3YA 2J4CA 5HKKA 3L84A 5DVZA 4W9RA 4DCSA 2ZBQA 1OLUA 3B1JA 3GQBB 2XTNA 3PT5A 4DIBA 3BERA 3IIEA 4RQAA 4II7A 1B1AA 3I2KA 4NG5A 5ALWA 1NSFA 5LKAA 2VCHA 2H52A 1JBQA 5ED4A 3P2IA 2QYTA 2A1IA 1L4BA 1E3LA 3I5UA 3UBMA 2E4WA 1UDBA 2VJMB 2O8BB 2CVQA 2PVCA 1OPXA 3L4BC 3O8BA 4NBWA 3R7WB 4RZUA 4X94A 1BXRB 1J1IA 4NI5A 4HVLA 1VQ1A 2O3RA 2M6SA 2Q6LA 3ZGVA 1W36B 4KAJA 4PNHA 2B69A 2WJ4A 4OBWA 3ZZTA 5IHPA 3L8CA 4TTPA 3EEYA 1G3UA 1R6TA 1P1HA 1A8IA 3T3IA 3COVA 5BYKA 2I4IA 4XH9B 3O6VA 1GDDA 1BN7A 2QI9F 3CR3C 2XMPA 3PQ3A 3BMOB 2X7HA 2IHVA 3FF4A 3MUOA 1QP8A 3O95A 2AG5A 2NZVG 4OGKA 1II8B 4AURA 5IC4A 3KB8A 4DNFA 3CN7A 1E0AA 3M9XA 1HDEA 3NLLA 2F2TA 1T25A 4X20A 4NFLA 2P9EA 3I9FA 4LJYA 4R83A 4G1VA 1CR4A 3NATA 3VHXB 1L7AA 3D1LA 4H6VA 4HDSA 4FYMA 3WKAA 4DUGA 2BEUB 1Z0ZA 3TRFA 3FM9A 4RVUA 2R00A 1N2SA 1N25A 1UQTA 1PD1A 1XRPA 2A4MA 2XGMA 2VQSA 3HB0A 1NVTA 3L7IA 3IRVA 4Q9NA 4UULA 3WP0A 1DKLA 2I91A 2NO1A 1C1YA 1XA3A 2FLKA 3SYLA 1JSLA 1T6YA 1SZDA 4K86A 3ZNNA 3HP7A 1IQUA 2WIGA 3GN1A 3K09A 4XIIA 2NU9B 3Q3GE 3C6MA 4BX3A 3B89A 2QTVB 2RCNA 3N7AA 5AW9A 5BNIA 5KYGA 3GJ8A 3E22A 2AKEA 2G8LA 3SEFA 3A6FA 4WUTA 1BE0A 3ZHQA 2P77A 2OSVA 2ADMA 2J9GA 1QHYA 1TO6A 5C2JB 1GTRA 4BV3A 4AS1A 4OXIA 1YNSA 1FDWA 1GIAA 5EIAA 3ONEA 4FKMA 1GQYA 2J9FA 3I01A 1NUPA 4JDPA 1J8QA 4KXVA 4ZCSA 4F92B 4UNQA 4RTPA 1LZLA 2BFCB 3GGGA 2Y1EA 4ZT5A 4AJOA 1PVDA 4MQ6A 2J3MA 3ZDFA 4NIMA 1SK9A 2E6KA 2W2QA 1Q22A 2JBAA 1D6SA 1O94D 4X44A 1RJEA 5DN6D 1RRGA 3MBOA 2QN3A 3EPLA 1QVZA 2PWAA 5DCYA 4CCWA 1KPGA 1OLSA 2JZCA 1UK7A 3FSGA 2P90A 1GPUA 4LOJA 1FVFA 2AOTA 4AICA 2AUMA 1K3UB 2QLLA 4KHZA 3E03A 3OKAA 4L02A 2JLRA 3EPRA 5EGNA 1GZUA 1V7CA 3GAZA 2F8MA 4ZA2A 2BLNA 1ECFA 2JLSA 4P82A 5DW3A 4REOA 5BPFA 1JU9A 4YRNA 1AKMA 3Q9SA 4XX0A 1NU8A 1XEWX 3R7AA 3WVNA 4GI5A 1JWAB 1WWKA 4XPZA 1Z7EA 2H06A 3A1NA 3O4GA 4P7FA 4XIJA 4CTMA 3HCBA 4DIUA 3GT3A 4O33A 3AKEA 3GEBA 5GJWC 3HLKA 4IMIB 3FVQA 3G8BA 3K4HA 5A5GA 2ZUTA 1JJ7A 1W2WB 1N5IA 2CUNA 2VP5A 3KQQA 4FU0A 2DUWA 3IUMA 3W4JA 3WQBA 4CU5A 3T12A 3AHEA 4CRWB 4EG5A 3DWEX 3MMSA 3RJZA 3TLBA 3M1IA 4BO5A 5TPZD 4PRZA 5CLHA 1JU4A 3HWRA 1GO2A 4HJXA 4KVAA 4MP8A 4W5TA 1ZU5A 3IR6A 1QF7A 2LCFA 5B37A 1Q84A 3SEQA 1FFSA 2P4QA 5KCMA 4C43A 1WBBA 1DBVO 1O5OA 4P83A 4B0PA 4BP1A 1SUBA 5FI5A 5GOZA 4B3GA 2DPLA 2O8FB 1D4AA 1QOZA 5G53C 1O03A 5EJ8A 2BJVA 3B9PA 3X1MA 1S89A 4MKIA 3HFRA 2DR3A 1CZOA 1W5SA 1EH5A 1BVUA 2BBOA 3ESYA 1T8WA 4BMYA 2JBHA 3LHFA 4J29A 4LV5B 5IXJA 3F6RA 3QJ5A 4O25A 2VZ8A 4ED9A 1Y9ZA 4AMBA 4NV1A 3UWOA 1YZNA 1E1YA 3E48A 3RU2A 1Q1ZA 1SRRA 2PPLA 2C5BA 3CZCA 3B1YA 3UV6A 3DL4A 4Q4DA 3ZY4A 1OSNA 2QV7A 3A7EA 3QV1A 4HGOA 5FWAA 2HA4A 2R2GA 1NASA 2WUWE 3B52X 4ER6A 1N0WA 2QD5A 2AZTA 3QIVA 2WI8A 2Z5VA 2YY5A 1ND6A 5BSUA 2QQFA 2WKSA 5LL6P 1GZ6A 4HDAA 1ZBQA 3GY0A 2G8NA 4M8LA 2O8DA 2O07A 4L8YA 1NOKA 1NATA 4Y1GA 4YQYA 2ID8A 4PC1A 1SQ0A 3A6PC 2FH5B 4BVFA 1QPBA 1QO9A 4DMRA 4DG9A 4N9QA 1FX0A 1XR3A 3K9QO 3AF6A 1SGWA 3P0FA 2I7TA 3O1LA 1GGVA 4I3FA 5CK4A 3LUFA 1OQAA 4Y2VA 5DCLA 2IBTA 4HWOA 4L5YA 4F5DA 1PQWA 4OHRA 5UKDA 4TV8F 4AL4A 4WCDA 3E82A 3GQVA 4LWZA 1JNXX 1MNAA 1ISGA 1RDFA 1S1CA 3ECSA 4MB2A 2QZ9A 3JRWA 3J81k 3I04A 4HMPA 3CLUC 5EXXA 3SZRA 2ZBEA 1JEDA 2JAHA 2FSGA 4HH0A 2Q7DA 2JBWA 4GVXA 1US8A 4LEIA 5A7FA 2ZT8A 1LBHA 3LYAA 1CW2B 1W0KA 3SJZA 1BYUA 4GYWA 2GF2A 2PZBA 5E7JA 1X1EA 1G3QA 3AH8A 2VCYA 1MO4A 2PGXA 5EOVA 4J0FA 4M9SA 4O2BB 4Z9XA 1ZIYA 4CIDA 2F1JA 2G40A 2EWMA 2JA1A 3EXFA 5LC1A 3THYB 2FPIA 1BXGB 2QLNA 3CZPA 3IQZA 1DX9A 4Z9FA 2NN3C 1WEKA 4DDVA 5M2QA 5TMPA 1P4SA 3F98A 1HDGO 4ES6A 4H7KA 5ICFA 2Q21A 3T52A 4YCCA 5C1BA 2HPAA 5I3CA 3M5CA 3AGQA 4EVIA 3SQWA 3VNVA 1J99A 5BOVA 5H1YA 3TZKA 2CMGA 4UC0A 4AULA 1GRVA 1AUXA 3CIOA 4JT9A 1MQ9A 3GOQA 4B73A 2ZU0C 3IP5A 3TFWA 1KEKA 3IJPA 2NQ2C 3K6SA 5ULLA 6CHYA 1F9AA 2AV6A 4EI2A 3GCGA 1VXOA 4J1QA 1RVDA 1VHJA 2VPQA 3BSWA 1J00A 1YQWA 3AOEC 4Y9UA 1XVIA 2GFQA 3EVGA 5E3HA 3KZVA 2XOKD 2X2FA 2IIPA 5HDQA 3GRKA 2IPXA 3UK0A 2X8LA 7MHTA 4AUMA 4U2GA 1L7MA 1CJKC 1L1EA 1YRHA 3G3EA 3MAAC 2MR6A 2WFZA 1IZ9A 4E94A 5A9SA 3LYUA 3HJFA 1TAHA 2GJAA 4EKGA 1Z35A 4RJTA 5LQNA 2RCYA 3MGGA 5K45A 1IDN1 2JD2A 1ECLA 2LR0A 5NULA 3VNUA 2GLXA 5LFAA 4LRWA 4UU8A 1VDZA 2XTJA 3HKCB 2RGRA 1F2UB 4I81A 5D51S 5A9TA 3T5BA 4PG6A 4ZYXA 3MT8A 4IOMA 4NDNE 4HDCA 3L8GA 4NJMA 3IESA 1CZRA 1KC1A 4ZYUA 1SUIA 4RKEA 5HCNA 4URUR 3MLBA 1QHEA 3MTIA 1ENYA 3CEJA 1J5EB 4NEGA 1IATA 2H8KA 1FSGA 1P8JA 2ZYSA 3FX2A 5IVDA 4XDHA 5SYMA 4A03A 1WPGA 2CFOA 5JDCA 1E3DA 1PZFA 2ZBVA 2BJHA 3ORQA 4S1OA 2HQ1A 2EBFX 2OZLA 4P3PA 2OM2A 1H23A 3D4OA 2B92A 1MJGM 4LY6A 4OA5A 3LYHA 1AM4D 2B25A 2G4LA 3N0WA 5HJ7A 1YFJA 2O54A 3DSRA 3O2NA 4GFDA 1FS4A 4HL6A 2JLVA 3OX2A 1QU3A 4MIKA 4KE7A 4KPFC 4R7ZA 1ACLA 5JC8A 5TGZA 3NDRA 4GIBA 2CXHA 3VAAA 3FKSD 5EJ4A 1PT8A 4QXQA 5TV2A 5EHXA 3KKKA 3KQWA 5DP1A 3UGJA 3F4LA 2BE7A 1SCJA 1Q0HA 5TJ9A 2FHSA 1N6NA 4IZIA 5IZCC 2B5VA 2C4UA 3RC2A 2PRSA 4XYBA 2ZIAA 1X74A 2KE5A 2O0MA 1WG8A 4IKOA 3TZ6A 3VM6A 2QHXA 4FFSA 4PRLA 3UJPA 4ZHQA 4QC2A 2Z30A 1FK8A 1SNYA 4CM4B 5C8VA 2ZYHA 4YRZA 1K7FB 4C3UA 2A7QA 1YVPA 2E9SA 1W1UA 1OXSC 2RMKA 3WGUA 2IEIA 2EJCA 1NSTA 3IMKA 4ZEVA 4FYHA 4TWAA 3ENQA 4ZOAA 1MCZA 3QWFA 1ABEA 3UAVA 1REQA 1JPUA 1XTQA 5HGXA 3QUSA 4B81A 1HA3A 2OM6A 2C58A 3RRZA 2ZPUA 4W7HA 4XKJA 5KMGB 3D3WB 1SA0B 3T34A 4Q4AA 1PSWA 2QG4A 2G09A 4F7WA 1ORVA 5ARBA 4KWTA 3KYCB 4DC9A 3W9UA 2ZYVX 4HNSA 4LWOA 2KM1A 2TECE 3P9RA 5ALIA 1ONOA 2G71A 2WZDA 1LS6A 1Z6ZA 2E4AA 4XGIA 3RYHA 4RKYA 4C89A 3WDKA 1I94B 4RSMA 3LJKA 3IXQA 3NGLA 3UM9A 2G88A 1WZCA 1PAUA 1ZCZA 3PHHA 4KDRA 3EY9A 2GX6A 2XSZA 1I3KA 3MJSA 2JHFA 5K0BA 3FWKA 4IUDS 3NNNA 3IUJA 4KTVE 2GJSA 4UCWA 2RG7A 3GB9A 3OOJA 4ZDIA 4DR2B 1JDVA 2VJAA 3MAJA 5AR1A 4Y2SA 1GYQA 4JYBA 4F3TA 1QDLB 2WTEA 1P1JA 3VO2A 1X1CA 2Z3WA 4GG1A 4LYYA 4OJYA 4BRUA 3NTVA 1CETA 1G8FA 4WZAA 4YRAA 4KB5A 5DLEA 2R5NA 2D0OB 3SXPA 5D3MB 3V7UA 4D80A 1Z3CA 4MHSA 2XUAA 4HKTA 1N2XA 4OJTA 1N0HA 3AW9A 1MC5A 1H6DA 4JH0A 3FIJA 1P9RA 4TKMA 1H9CA 1WABA 4JFAA 2A14A 1BWSA 5DXJA 2COUA 1OXKB 1YMVA 4LZPA 1R6UA 4RSRA 2HJGA 1NF3A 5TQ0B 3ZNPA 3G0IA 3ZPXA 1TM3E 2GCEA 2I7DA 2A5GA 3MWLA 2ZAIA 5JR3A 4BFTA 2R87A 1T43A 2REBA 1GUDA 3WGKA 1VIMA 3DE6X 4XWYA 3PF8A 4HRXA 5CU7A 3WWCA 3EHDA 3ZE1B 4AF7A 4W5QA 1DKUA 2MSEB 2ZXUA 1FJHA 5EERA 2APJA 2Z3ZA 2C7QA 1Z5VA 1C7JA 3HKDA 1WZEA 1TM1E 2YQZA 3BIXA 4LJ5A 5EQFA 2BAGA 1M34B 4OQ4A 3KETA 1RYBA 4FBGA 2VWQA 1JQDA 1NRJB 4NFYA 5SYNA 1KE1A 1T9HA 1TQ2A 5FHRA 4HDNA 5G3YA 5JNSA 2GN0A 3SFVA 3UKJA 1O97D 5JEDA 4OMCA 2RK4A 5KOHA 2P91A 3L0BA 4I4NA 5ECGC 2PX0A 4IEEA 2LDBA 2P2LA 4DR6B 3WGTA 4NICA 4BQQA 1V0JA 2FWNA 4HNAA 1CNMA 2UYOA 4IDPA 3C5EA 3A9WA 3S44A 4OKIA 1RCTE 3B60A 1JVBA 3OM0A 4D3DA 5JECA 1Y3FE 1KQOA 1UP6A 3BMCA 4AJ2A 4PW0A 5FOXA 4YRPA 3VI3B 4DTIA 4I1SA 4P7JA 3N39C 3TE6A 5JZ9A 1UAAA 2YW2A 4UBJA 2VF2A 1QVVA 3KAQA 4CMBA 4CLDA 4FIDA 4R4JA 1HXHA 5EWLA 4FC7A 3BZBA 5LXTB 1V26A 1JP7A 2BZ1A 4MW4A 4C0BA 1NBEA 3EFOA 3ZGOA 1SULA 3RUPA 4ZCRA 3BE6A 3CSDA 4H3KB 1IJKA 3D5EA 3G8YA 4RD4A 1J22A 2AJLI 3K05A 3TIIA 4YLYA 2I4NA 1J8FA 5DWQA 4OX9B 4XLLA 2W2LA 1SXPA 4UDXX 4XQGA 5FL7A 3SZGA 5AVUA 3L7YA 2P40A 2WTMA 3Q15C 1F4PA 5AVZA 1BE6A 1MAAA 1VKJA 2FSPA 3BF7A 3C5WP 4A36A 5G1PA 5HUQA 1RTTA 3RKUA 2VYND 3P20A 4FMDF 1J8YF 1JQEA 3E8XA 1KYWA 2F17A 2I2WA 2PQ6A 4LHXA 4A8JA 3PU6A 1EGMB 2JI6A 3B3QA 1FNSA 1B4DA 1XRJA 3MPOA 4JK3A 1GNTA 3EVTA 1FB5A 2QVGA 2ZJAA 3FCYA 3FNFA 1P7VA 4IH1A 2HUNA 4MLPA 4HO1X 3OLXA 4RFVA 3WLFA 4CM9A 4D99A 4DIMA 1J2EA 3ASUA 3OCCA 4D9EA 2P7HA 1UZNA 3U44A 5DMXA 1PFUA 3B3JA 5IRCD 2WJAA 2G82A 3EUAA 2HCBA 1PNTA 3P0JA 1UCFA 3ZWCA 4ASUA 3N7TA 2R62A 1E7YA 1OX4B 3EVFA 3B12A 1Y5LA 4R16A 4JR0A 4OPMA 1HLPA 3SC2A 4LBZA 4CG3A 1HDZA 4JMPA 4GXQA 2VHUA 3O91A 5DLDA 1KP9A 3U40A 5F64A 4O1MA 5FOUA 5FUVA 4PYJA 2IYTA 1EWYA 4ZCPA 4EGSA 1OAAA 4OXKA 1ZISA 1QTRA 3U1BA 4E30A 3DKPA 4RL6A 1SXIA 2VA8A 3GMIA 4B8WA 3L1JA 2H1FA 3PGLA 5GAJA 4C1NA 1LPBB 5T4EA 2QX7A 1F1JA 1KSFX 4E5SA 5LKRA 1RPNA 4KR7A 4NPCA 2L17A 3L05A 3NVMB 1KAGA 1WDMA 1G3RA 3FZYA 1LBEA 3MGCA 4LPKA 4QU8A 2H4YA 4TKVA 4J43A 2C0QA 2AHOA 3PNQA 1Q7RA 4JHXA 821PA 2RC5A 1ZGJA 2AR0A 2F9FA 4RVHA 1XPUA 2O3SA 5BUSA 2WT8A 2GGSA 3HL0A 5F35A 3DWIA 1NQUA 3ODPA 1YJXA 1ZNWA 5C4IA 2NVUA 3UOAB 4L57A 2GM3A 3EY4A 1Y98A 4PX2A 4CZ2A 4E2YA 2VQ3A 4LF6B 3UYKA 4G1CA 2GZRA 1ABBA 3B1VA 1SXQA 1Z8FA 2X9LA 1P8AA 2J9XB 3CONA 5CA1F 4D26A 3UT5A 4ZI3A 1B23P 2EIHA 4DNPA 1MGOA 4Z7NB 5HKOA 2IUTA 2C9BA 3EOZA 3NHFA 5A6SB 3GDFA 4PSUA 4I9UA 4DA7A 3KB2A 5CXQA 3LWNA 4K88A 1ZHFA 2PZJA 3PI6A 1JQAA 3OQ6A 1PD0A 3W6NA 3MPUA 3JWIA 1U9CA 1R4MA 1VHQA 3O1HB 5TMBA 1RI2A 1O6GA 1Q2XA 1WJGA 2FR1A 1QHNA 3M4ZA 2HLHA 3IEIA 4DQUA 1C29B 1XZNA 1ZG3A 3LBYA 3VU9B 4L51A 2CN1A 3PD7A 4KOEC 4U3JA 1DBWA 2BGJA 2BWJA 2ZUVA 3BIJA 2QU7A 3IT0A 3OZVA 3QBJA 4INPA 3AIOA 4CKEB 1JR2A 1QE0A 3A0RB 4OMUA 2FDCA 1B8OA 3I3SR 3I73A 2YBEA 2CC2A 1XRMA 4GPTA 3IURA 3BL6A 4RD0A 1UBJS 4HGPA 3SZOA 3KJZA 3FAKA 4JZKA 4B6JA 1SZCA 2I6UA 4Q7JB 2EOAA 4UBKA 1U7ZA 1S6YA 1XL0A 4JHLA 5BN5B 4L0MA 4MS4A 5J2UB 1PR6A 5F3RA 1T1EA 3GRFA 4JBNA 3MIIA 4OAPA 3ROQA 4E5UA 2CF6A 3EDOA 3LVFO 4NY1A 4KR3A 3I5XA 4RIFA 4RKQA 3RU3A 1Y4ZA 2Q3FA 2V98A 1GT6A 1WB6A 2XH8A 3RODA 1NBIA 3MJVA 5FAKA 2CV0A 1IBKB 3SP1A 4EG4A 1RWVA 3I3OA 5KNCA 4FYKA 4MRMB 3U2QA 3W2IA 1T9GR 2Z9DA 5F1PA 1L9XA 1YUBA 4J91A 3ONWA 1XHLA 2FUCA 2GJKA 3ITDA 4HNRA 1N9ZA 3B2EA 3BUSA 4KC0A 3V4ZA 3M9WA 3WL6A 4RD6A 4EBBA 3FDFA 4WZBE 4E5YA 2DB3A 3OICA 4QJ3A 1QRUA 2FP3A 3K70D 4Z4QA 3E4DA 1X7HA 2M98A 3DYIA 2B4YA 1O58A 1X7XB 5E0OA 4IAOA 3LCRA 4IMJB 5I4BA 1WETA 1UDXA 1EP3B 3LXUX 2ZBGA 3LOPA 3MS4A 1QTQA 1FUIA 4NL4H 3FJ1A 4IP0A 3RARA 4EFKA 5JEEA 1MB9A 3PPXA 1J39A 4TV9F 3H6GA 1WVIA 3WZ2A 3K0CC 5GV7A 1S2LA 3TRHA 2IFTA 1J33A 3VR6A 4YAKA 4XWKA 2J3HA 3MMNA 3QKSA 3QU2A 5LA6A 2NPIA 3RVPA 4DFDA 2A1TR 3LVBA 2EX0A 3UOWA 4YT2A 3PWTA 3PNSA 3QVUA 3SMVA 5ARCA 3K1JA 4B5LA 4E1BA 4MEAA 2IODA 2VDVE 3RDPA 5EESA 2CLMB 4FSXA 3UAYA 1MN6A 3SXUA 3VZBA 5J2TA 3K0BA 1C9EA 2VI5A 1A1SA 2RB5A 2QRGA 5IF3A 1E96A 1OI2A 2AX4A 2J6BA 4UQPA 4FIZA 2VUIB 2PMKA 2EP5A 1G16A 3QBVA 2R7LA 2GEFA 2OAQ1 3EGXB 4L3WA 3ZHYA 3KFLA 4Q7KA 3OQBA 5AOBA 5T3UA 1UK9A 2IJGX 2M1XA 1AK9A 1KEEB 5F3DA 3N5CA 3ZCTA 2AZDA 3KRTA 2V3WA 1U8YA 5TGTA 2Q41A 5EJGA 1MRSA 3UKDA 4Z54A 2C2YA 5ICGA 4CL2A 4M7PA 1ODJA 3AILA 1U2PA 1YDFA 1SD2A 1WHTB 3QBEA 2ODAA 1SQ6A 3COYA 3QSGA 4PLPA 3ZN2A 4Q01A 5KWJA 4P80A 2DJ5A 1GM5A 1G60A 1H85A 3QU4A 1GP2A 1U9YA 1SBNE 1Y8CA 2DFVA 4CLRA 2J3DA 3GZNA 3OI7A 3TCKA 1S2GA 1SG9A 3AB8A 4KQFA 1CG6A 2M6KA 4BL5A 3VPSA 4MLZA 2PV0A 4M36A 1VLHA 5ELXA 1M0WA 1ACJA 4W1PA 1I0IA 3AUUA 2BISA 4R69A 1B41A 1U0SY 3L0DA 1E0SA 1KAEA 5IH3A 4H0FA 4RVDA 3O8NA 4DLVA 3AVTA 1S3IA 4MUYA 1VDMA 3CZAA 3BL8A 4G0QA 1A5SB 3UEOA 1UPTA 3BFXA 1XU7A 3GFRA 3WLSA 1WLYA 3EXEA 4H1VA 4MMZB 1WSDA 5CNJA 3WMRA 2OFWA 2IUFA 4GUDA 2P3QA 3AV3A 2Y66A 4NCJA 1ISPA 2IOQA 4PFSA 4PSKA 5JJCA 3S2FA 5HS6A 4W9NA 1AMOA 3RUEA 2V45A 2NM0A 5GWXA 4Q21A 1LVGA 1QFSA 1Y8QA 4EMBA 1AKVA 1NYLA 3CRRA 5K8IA 2IDMA 4PQRA 4BLWA 4DBVO 5GIPE 3AVWA 1RSZA 1JMVA 2GWHA 1HOXA 3PLNA 3SSOA 4ZCTA 1VBMA 2JKZA 2Q0XA 2X0NA 3G79A 2Y3IA 4CYMA 3K1ZA 1IUNA 1TD9A 3B78A 4HT3B 4MQLA 5AM5A 2AMJA 4ENQA 1WXGA 3N2IA 5YASA 4F96A 3PD0A 2PGIA 1T26A 3NGMA 4QU9A 1E8DA 1T5BA 2XZDA 4ETWA 2CYCA 5K7SA 1RWKA 2RHMA 4AAYA 1EEXB 1ZSNA 4ZYTA 5ETJA 1EFLA 3H84A 3L9WA 1C0PA 2F3UA 4QQRA 1DEKA 3CIFA 3GDGA 4G67A 4OP1A 1CRWG 2I4TA 2L0XA 1OMOA 4TVOA 5FO1A 4CLOA 3RFTA 4M3NA 1UJ5A 3K6RA 2OYRA 1YS7A 3N2GB 4KAFA 1WRBA 4CEIA 4B4DA 5KREA 4UJ5A 4GT1A 4HGYA 1KIAA 1XJQA 2PD3A 3HB9A 2I6SA 5DH9A 3ROGA 2PU5A 3U7HB 2X77A 3RVNA 1EVEA 2EJWA 1RXCA 4LBWA 4HFNA 4JXKA 4O2RA 3RCBA 2RHBA 3QVLA 4QJBA 2WLTA 5A5DA 3GELA 1G38A 2VJQA 5L51A 3KQHA 3BDIA 3ZQ6A 2DSTA 2A5LA 2HJRA 2FEPA 2JJYA 2GA8A 3UMRA 3VUEA 2FMIA 4C87A 3LCMA 4UPDA 5K5EA 3FE2A 4HB2A 5KYWB 4PLYA 4FFNA 3FYUC 5ITZB 1MX1A 1PGQA 1KAHA 4OH7A 5EP2A 4A0HA 4DUGD 3WI7A 4K7JA 3EZ7A 3S40A 3GRPA 4RULA 2Q46A 4QYIB 2CCKA 3DBHB 3DDSA 2GVZC 2V7GA 4KKXB 4P98A 1ZXXA 4LJ4A 1EE9A 1E5QA 4YMVA 4WESA 4DUYB 1EZ4A 1USIA 3SCZA 3ZCVA 2NUTB 4G63A 2G76A 3CNBA 4S35A 2QKYA 2H4XA 4R9RA 1E4VA 3A6GA 4O3FA 3B6ZA 1GU0A 4W5NA 2BCJQ 2D8MA 1S2DA 2J6HA 3CEAA 4HMOA 4JLAA 4JUBA 3IPYA 4RH1A 1T8YA 5AKIA 4ZEMA 1NFRA 4IIXA 1KJQA 5KTNA 2YYYA 4YJ2A 1ITZA 3IRUA 3CMCO 2XADA 1EJ6A 3LBHA 4BKMA 4Y2UA 4LRSB 4TXJA 4EHJA 2QI9C 4HBZA 1DB3A 5EZYA 1CR2A 4HX5A 4C0KA 3AERA 3IAS1 1I2CA 2UYQA 3ONNA 3UMSA 2QZJA 4C6TA 4D0RA 1CD5A 4HPWA 4AIIA 2BEWA 3HC7A 1GNRA 2Z5GA 3D6UA 2IHBA 1EUDB 1RKXA 4EX6A 1EA7A 1GG8A 1MC8A 2FUG1 4IS2A 3SNKA 4BGVA 3CLHA 3EGWA 2HF2A 5EKTA 3DMTC 2I5PO 1AX9A 1UZMA 3E9DA 1INLA 3HGTA 1AHIA 2A0KA 3O2QB 1THGA 3TZHA 1V5EA 1LY1A 1TA4A 1VCHA 1VG8A 4NSNA 4WFKA 4PEVA 3ECAA 5D7NA 5IC6A 5K3SA 3O47A 1AQYA 6GPBA 2I2CA 1G21A 4MW6A 4TKUB 1BCSA 3V4PB 5ALHA 3U19A 4C05A 3EPPA 5LOVA 1YGPA 3RROA 2ZSBA 4Y7DA 2RHRA 2JRCA 2KB0A 2E5LB 4XJXA 1EVQA 2HB6A 3MTDA 4TTIA 1WVGA 3ROXA 5KYXB 2ZXEA 4D42A 3EPKA 4UAGA 3E2PA 4PAMA 3L92A 2XLBA 3ZK9A 4KPEC 4ESEA 1TJYA 4B3RB 2ZI6A 5L3QB 3P9CA 4GWKA 3TI7A 4QWWA 4MKRA 1FXUA 3LT4A 4LXUA 4GLBA 2CXQA 3ABOB 3EC7A 4NQZA 3DFFA 3QELB 2BGIA 2HV8A 3LK6A 4I55F 5KU7A 2Q5LA 1P33A 4PQYA 2HPHA 4NESA 1L0BA 1BROA 1DCFA 1U0EA 5D3QA 3BSFA 3DPSA 3GVHA 3GF4A 4V3BA 5FTMA 1PVVA 3Q9UA 2FPXA 1SC4A 3F5QA 4PXAA 5H5JA 2JGRA 3T7IA 3WLQA 2LIVA 4YMUA 5HTOA 5JZSA 2QYOA 5LP6B 1XZQA 4BIMA 3C48A 3D2LA 3IOCA 3PRKE 1M6NA 3JQFA 4R1NA 4U2DA 4YJHB 5D5QA 5LBTA 5KQRA 4XA8A 5FHQA 1DI0A 4H9GA 3VOSA 4MI6A 1WXEA 1UXIA 4J49A 3L82B 1FVXA 4Z2YA 1E6WA 4N3GA 3STYA 3TQHA 3U4AA 1NKVA 3CX3A 5BV8A 4P4NA 5AW2A 3VKHA 2HFJA 2HX1A 3COWA 4TUYA 5JRDS 3OEHD 1XCGB 4R9NA 3UFXA 2FW8A 2JASA 4F4IA 1PW5A 3SQDA 1RXVA 2ZWVA 3IR5A 3MCWA 2GAFA 2XUPA 5DNCA 2B34A 3TD2A 1FFEA 2AGVA 5G4KB 2IP4A 1C7QA 3IXLA 1JLLB 2NVWA 2WP8J 4LQ4A 1XK6A 3O73A 5AI5A 3COSA 2G0NA 1NXQA 3FMIA 4FCWA 4TGLA 1E2NA 4J16C 5JAOA 3D2AA 1DAMA 1N5LA 4KQIA 4MV6A 2VDRB 4HNHA 4CEJA 1Y5IA 4PZAA 3CV3A 1DTWA 4A8TA 5BN3A 1SCUA 3QKUA 3PWZA 1TAUA 4GGMX 4YK7A 4J2TA 1BE8A 1PEDA 3IAFA 1Y0BA 2QPTA 2PZGA 4GS5A 1WUKS 1MJGA 1S5PA 1WMBA 4FINA 3VC7A 5C18A 1PJRA 3DE1X 4QEKA 3SVZA 2XB6A 1KY2A 2YR0A 2R1ZA 1QC5B 1H0RA 5K6AA 1LWNA 4S0ZA 3R2JA 3M6VA 4LFBB 5SYAA 2YHSA 2PS0A 5BY2A 2QRZA 1ZUIA 3EMVA 1LUAA 3PX2A 4DA8A 4MVJH 2Q4OA 1OA0A 2DWOA 4N0EA 1RT9A 1ZM7A 3AXTA 4YUWA 4R0NA 1JPVA 4ENTA 5EJ9A 1U1GA 5JD6A 2C2ZA 3H83A 2FSFA 5IDVA 5B3AA 3WS7A 3EEQA 4DT1B 4ZOLA 4CLHA 1A76A 4BY9E 3VR4D 1Y8AA 4RHTA 2AKAB 2OHFA 1M6WA 4IH4A 4LWQA 2IITA 1ADGA 1BHQ1 1CULC 4MUBA 2H8GA 2TMKA 3I39X 5KWSA 2OXEA 4N4AA 3BWBA 2XMSA 3EGVA 3KKPA 4RNCA 3P7MA 4WLUA 1N2OA 1T1IA 1W88A 1E4EB 3OE7D 4WBNA 4ZK6A 1Z8HA 5ARDA 4D9HA 4ESHA 2FXVA 2C8KA 3S68A 1DUVG 3U3JA 2WG1A 4O4IB 5HE9A 4B4OA 1UBHS 1QYWA 4I36A 4MWDA 3ROPA 1YR2A 1Z39A 4H18A 4EZIA 3COPA 5EHZA 1RWBA 1E1CA 2H29A 3KJGA 5AJVB 5J4HA 4IIJA 2PN1A 3CLSD 4UEWA 2D2VA 1YJAA 3KWMA 4QASA 1N9GB 2XUOA 3OQIA 3GJSA 4RVNA 1T5IA 2RK3A 3ZVKA 2BI7A 1NW5A 1C41A 2AL7A 4L7VA 3P97A 2QAGC 2QMUA 2FKNA 2Q0QA 3PXUA 3IEVA 1H9AA 2FZVA 2IYPA 4XPIB 3WLOA 3R7NA 4D81A 4KR0A 4EYKA 3OCVA 4MR7B 5JT1A 4JCOA 3BFJA 2PUEA 2I2FA 3CH5A 1BWRA 3MC1A 4FUTA 5ITSA 1UBCA 3H87A 4JGGA 3WTCA 1NR1A 2H7CA 1J0BA 3LAWA 5C5IA 3H5AA 1YIOA 3WL8A 3T6KA 5AM0A 1I0ZA 1UKAA 5ANRB 1WDKA 3RSCA 1QYXA 4AF6A 4AS3A 2IYOA 5IVHA 2PYZA 4M1SA 4C0SA 2X4DA 2X5NA 5IP5A 2Q6TA 1RAAA 1K97A 2DMRA 2Q7XA 2QR5A 4LZLA 4MHOA 1PDOA 4OAQA 5IBQA 4AJ9A 3U7FB 3I32A 1XVLA 1NF9A 4H7EA 4BFUA 1JHOA 2SCUA 2HMYB 3GLHA 1PTJC 1V4VA 2R84A 5A4AA 1EP9A 3LDHA 3CW9A 2XYQA 1KARA 1TCAA 1MUUA 2ET6A 4LOIA 2HDHA 2JAQA 1RHMA 2O5EA 3IPCA 4RK6A 1OILA 1T2AA 1FC0A 2EYQA 1PJQA 1FS5A 1LFAA 2FWPA 3MINB 1QS0B 1PK9A 1V37A 4N5DA 1KE2A 3RGWS 1T0UA 1R16A 5HYVA 2QIOA 1G19A 4ARUA 4S04A 1L7OA 4JLDA 3GGCA 3E5HA 3O8QA 4XUCA 5J5VA 1AV7A 1NN5A 5BSTA 5FTLA 1G17A 2FN9A 1EHIA 1ZMOA 2GLUA 3FHCB 1W85B 3BG5A 1CLEA 4GI2A 1YXMA 2WAOA 1GV1A 3I53A 2QUJA 2H1OA 2PH1A 3O8CA 1K9VF 3BRCA 4ZQCB 1X7YA 2NT4A 1RYMA 1TOAA 2UZ0A 3LE8A 3U6KA 2AG1A 3DFKA 3QTBA 1SCQA 1ZL2A 2DPXA 1M34E 2FN4A 2XI4A 1NW8A 3GLRA 1I2MA 2J09A 2ZIFA 4OMDA 3VZCA 3SM9A 3X2FA 1CE8A 3OHMA 4KVFA 2P9TA 3MCVA 5AVRA 3SU8A 1CR6A 3U81A 5H3LA 3RAJA 5IMBA 2OUIA 4RHXA 2E1RA 1JYEA 1UDAA 4MR9A 3SIXA 1T6XA 2HLDA 4CTJA 4JL5A 4Y9DA 4DJDC 1KKUA 3JZMA 1RD4A 3O3NB 1MAVA 4W8HA 2H1VA 1OCEA 4Q3CA 1RIFA 2O2ZA 2P9GA 5DBIA 5J9FA 4ARAA 2AJTA 2MMGA 2X0RA 4RMHA 1UWCA 4A1OA 5A4MS 2ECOA 2UXCB 1QIFA 3CZ4A 3S28A 5CB4A 1YB1A 1JMYA 2YN0A 4OJNA 5BV0A 4I3GA 4QX6A 2CVFA 4DCUA 5KJ1A 3VPHA 4J07A 1DWPA 1YH3A 3PC8C 3Q1LA 5K0LA 3E70C 4LNUB 2YNMA 1P31A 4R51A 4JU9A 4RVGA 4QPNA 3G1UA 3W3ZB 1T5TA 1NG9A 3QYAA 5A05A 2FJUA 2Z9CA 1V3QE 5DM1A 3JATB 1E3MA 4MK4A 2UZ1B 2HJ9A 4G9GA 2CD9A 1RHUA 1XA0A 4YUZA 2HR1A 1LH0A 2GFIA 1QHXA 4XASA 3TSWA 5HRAA 1ESMA 2JEZA 5KVSA 2WHRA 4RK1A 1Y6ZA 4RFSA 1FYWA 3W2EA 1PQYA 4JT2A 4U7FA 1RFGE 4YT8A 2J5XA 4F11A 2HMAA 4LTDA 1H94A 1WXIA 2R60A 3GVPA 4HXFB 4MITA 4OHMA 3VO9A 3WHKA 4CMIA 3FOEC 2WF8A 4MIEA 1O77A 1SVUA 4CV3A 4AG3A 4KRFA 2YQ5A 1A8SA 1NP3A 3IIIA 3FCUB 4MS1B 4QPDA 5CT4A 4CR8A 1O08A 3H5WA 5AQ1A 4KPYA 2PSSA 1DO2A 3P5SA 3O8LA 3WRWA 3Q4GA 2DWQA 1DOAA 1EXMA 3DVSX 3IDFA 4TMFA 4XD2A 5A03A 2AA3A 1RLMA 2NSDA 2OD2A 2YHAA 4RKFA 3V55A 2IUEA 3V8RA 1PV1A 2XZPA 1PNOA 1KO5A 3NPMA 1FLVA 2OC9A 3W8RA 1OYWA 2R7AA 4MRNA 4GPIB 3G82C 2B1QA 5BURA 3OCYA 4G5HA 4OKSA 3P2JA 5FPSA 4BZPA 3HI6A 1VG1A 4MX8A 2H2AA 4KBYA 4KXLA 5DHUA 4PYKA 1RPAA 1VM6A 2DWPA 3R5TA 4WFIA 1PV2A 3G59A 1GADO 4XQ9A 1BJRE 2ACWA 1W2HA 3OMXA 1QV7A 1XCOA 2YHIB 3H2BA 1GZ4A 1Q74A 1KYIA 1ZJ4A 1JALA 4OP3A 4BNUA 5DHFA 1AU9A 4TSFD 3Q7RA 1YJ8A 5DT2A 4CMHA 3K6KA 3IMGA 4G56A 4Q1AA 4RS3A 2QTBA 3G88A 5EJEA 2PJRA 4CTKA 4N6OA 1XCJA 2FN7A 2XNDA 2V3CC 2WW8A 2WR8A 4QUEA 3AR2A 2JVKA 5FPQA 3AHDA 3AR9A 2WHEA 3E18A 1ZHOA 3LS2A 3U60B 3O8OA 5I7FA 4OJMX 1EQ2A 5T5QA 4I4TA 2VQFB 4MV3A 2ECFA 3OAAD 4EKEA 4GQIA 1XEXB 3TNYA 4CI9A 2PD6A 2IYAA 3KVVA 2ZUDA 3HLYA 1E1KA 1XEAA 2R8EA 3LU1A 3AEZA 2WDZA 2QDXA 5KCZA 1XP8A 1RZRA 5ALXA 3TPZA 2OHGA 1A69A 1AS0A 2ID4A 5CP8A 4J94A 2PSEA 1I2BA 3BMXA 4C08A 4NXMB 4I8IA 4JR1A 4F93B 2J5QA 3KQOA 4MJ3A 1Y6GA 3MRTA 3WNCA 4R8VA 3WIVA 2I3AA 4HAIA 3PFWO 4DV1B 3BMNB 3ILVA 1VLJA 4PSVA 2CW5A 4LX0A 1HR0B 2EFEB 1J7KA 3JVVA 2ZGVA 1SCBA 2PA3A 1T3ZA 3IVGA 2YXBA 1SY7A 2ZWOA 2QE7A 1RQNA 1ZMBA 2AR7A 1JDBC 1T9DA 2C5HA 2I8CA 3DBRA 4G24A 1P1FA 4HDRB 3RGGA 1WOMA 2GUGA 5LU9A 2R3SA 1M8JA 2I65A 4FOPA 1WD5A 1DQSA 3BWDD 5IAJA 3UOGA 3HACA 1Q92A 1ZZGA 3O4JA 5DRTA 1NU6A 3LLSA 3NHPA 2VKTA 3GNTA 5GVRA 4IUYA 3Q88A 4BPBA 3T9BA 1TM5E 5B1HA 1PWHA 1H6CA 4KNWA 3H2GA 3DOUA 3FHJA 1K6XA 5F9MA 4WDQA 3ZDBA 5CR9A 1XKQA 3PL5A 4ICIA 4N0DA 1W25A 3NU1A 2PUWA 4WY8A 3UHPA 1C7ZA 4B82A 3M4YA 1R9JA 5C51B 1IK6A 1R5BA 1TO2E 4ZU3A 1AIPA 4D1YA 3RTAA 4LGMA 5JVDB 5JAQA 5AK4A 5JZVA 1V8DA 721PA 3MJEA 4KDEA 1DTEA 1FBNA 2E55A 2KI5A 3GYGA 3EQ2A 3VH1A 1WXXA 1H2AS 3M8KA 4DLWA 4B6RA 3EZNA 3EF3A 3JQ9C 3LPLA 1P7PA 4LHZA 2VJBA 1AURA 2DLNA 3R7FA 2GZ1A 3W7VA 4EUKA 2DR2A 4DGQA 1YBAA 3KM0A 1KAMA 2R47A 2TMYA 3BGIA 2GTIA 5J5AA 4HEA6 2HU7A 3UCEA 4HNTA 1OI3A 2I9PA 2XR1A 2QEQA 4U6SA 5HZMA 1DE0A 3A1WA 4G01B 2EF0A 5DGTA 5LDHA 1E60A 4R8LA 2AXPA 2P2YA 4FMPA 1UT6A 1L5YA 2PGNA 2DBYA 5AD1A 4Z9YA 2WHYA 4IF4A 3HSYA 1DIGA 4TTSA 1T9AA 5FV7A 1PCXA 2VDPB 2Z4SA 1CRZA 4DNOA 4GICA 1TK2A 3TR6A 5DB4A 1CXZA 3K2BA 4CF7A 1G55A 1VCMA 3C5CA 1CFJA 2G80A 3C85A 4WNIA 5ALPA 3QUBA 5IAAA 1ULUA 1NJFA 4Q1EA 3LZ6A 3WMWA 3ZV4A 3B6MA 4MKFA 2XY4A 1U0LA 3ITKA 4NU5A 4OB6A 3VVLA 5HQ3A 4RS4A 3W5VA 3AJ9A 4YJFA 1E6CA 3R9XA 2VPYA 5MFPA 2BN4A 2HK6A 3K8ZA 4NH4A 1HUQA 3WRVA 4AWBA 2OFPA 4RM2A 3X2EA 4BNDA 2YASA 5J1TB 1D8TA 1ND5A 1V9SA 3OEWA 1V1RA 2HN9A 3AY3A 1N2CB 3NBXX 4LISA 1JA1A 2W00A 3WHPA 1YB7A 1Z2DA 2X1VA 3DO8A 3QMPA 3WIOA 3SQOA 4UXHA 1BW9B 4RZXA 1M6VB 2G5GX 1RZUA 3GJZA 3AETA 3DMYA 3VDQA 2OENG 4XR4A 3UYLA 4ATNA 3ESDA 4TYNA 3VKFA 4KN9S 2B7BA 1VPTA 3JYQA 5IFKA 3NHRA 4OK5A 4MXDA 1A9QA 2R48A 3UHFA 2G17A 5AH0A 3F78A 1QZ3A 2GERA 4F6LA 3IB3A 3JYNA 1D4OA 3H7AA 4R8RA 5EMHA 5L3RA 4YR7A 5I01A 3NS7A 4Z0TA 1GTZA 4IVNA 3FGPA 4CM6A 5H82A 1Q12A 2X86A 1NDQA 4FNMA 3EWSA 1C8BA 1L8OA 5B1IA 4IWYA 1USUA 4LFCB 1SCNE 2OP1A 3FUUA 1Y3AA 4YO7A 1TGVA 1T2FA 4I1IA 2X14A 4IDGA 4N47A 3GXBA 2CUZA 2Q8PA 3ON5A 4UEQA 4KIGA 4ZJPA 3W6PA 4BQOA 5AM2A 4OQNA 2I2BA 3F6EX 3OLVA 3ZU5A 4A91A 3FWHA 5GV8A 1KQFA 5FA6A 3BJZA 2GK3A 4NQRA 2ZAMA 4KMRA 4QAQA 2DGDA 5KHOC 3U4GA 4GX1A 1AN0A 1U94A 1Z7WA 3CVVA 1SCIA 2OO5C 3NFYA 3ZZUA 5AKGA 3GDWA 1JJIA 1NE2A 4LHYA 4DOMA 2OA0A 3DV2A 2PO7A 3GUYA 2QTLA 3LX8A 5KNCD 1L5GB 3OJEA 4EL0A 2ZPAA 1RJDA 3LT1A 5EVJA 3CZRA 1N34B 4OK6A 1ML4A 3GP3A 1O95A 4RX1A 2C8LA 1J9EA 2W11A 1II9A 2I7XA 3G9UA 3VDXA 3V7FA 1W73A 1V2GA 3U4QB 4ARIA 3IV7A 2WTBA 2DYKA 3C1OA 4IJMA 3VVBA 3AI1A 1RJGA 2WJJA 3KIPA 4HDMB 4PANA 4AN0A 4QVKA 4UCFA 4L78A 2FEXA 3C4QA 2B8EA 1XYVA 4F4HA 3ZXIA 2X15A 1R4NA 3G2HA 3W5IA 3OTHA 1KSHA 4Q15A 3WGIA 1Y3BE 4Y9SA 4IRUB 5BSGA 4QL3A 1KEUA 1TF5A 1U0FA 4DF3A 2A0XA 2VCEA 1K98A 2Y0EA 3L77A 3OZWA 1RHKA 1W29A 3WKEA 2CLDX 2IUSA 2GZ3A 3JPYA 4L5CA 1E0JA 5LPNA 2Z6AA 1ILWA 3DLBA 2R79A 5ESDA 1IQRA 1N7IA 1C30A 2CNNA 1T2UA 3OFNA 1SC9A 3WHIA 4EUHA 1SKQA 3CB2A 4CV2A 5TXGA 2HU8A 4IKPA 1WVMA 2J30A 4B3TB 1Z45A 2LW7A 1DWQA 1TAQA 2CZGA 2XUDA 5AICA 3DAHA 1XD2A 3HCOA 5HM8A 2DXIA 1NUAA 2BR4A 4QOEA 3CZ9A 3IBSA 1E2JA 1D09A 4HV4A 5JATA 2VHWA 1VHDA 4DZZA 1MB4A 2XVMA 3LO5A 3SE7A 3CT4A 4A15A 3NHMA 1E1NA 3WNZA 2JLBA 4IH9A 4YX9A 3JQAA 1IOVA 3EAQA 1I4EB 2ZK7A 1L5MA 5LYJF 2VTBA 2X19A 2NP6A 4KTTE 1L4FA 4G2TA 3RTBA 2P0AA 2GCNA 4LF9B 1XWFA 1CNEA 1IN8A 1NMYA 2X6QA 2WRZA 3JASA 1JKMA 3PP8A 2JFUA 4YRRA 4YUXA 3R23A 4ZI2A 3HP1A 3QX9A 4EQ6B 3IOMA 3KJXA 4PSAA 2YIDA 3MCAA 4D3XA 1O94C 4NOJA 3V8EA 2KBEA 1N2GA 4BNVA 1J21A 1NX9A 3BIFA 3TXYA 2EQ5A 4RELA 2PT6A 1ZK4A 2VLBA 4RZ3A 1JZSA 1O6ZA 4AJIA 3DCIA 3EWIA 2H17A 4I4IA 2R1VA 2GF0A 4L4UA 3UXMA 4RV5A 2FY8A 4F4JA 9LDBA 5BV7A 3N76A 3IUYA 1K8XB 5I5EA 3A1TA 4CG1A 3E4CA 2X7XA 2H48A 1WE2A 1BHSA 2GYVA 1MG5A 2RARA 1H69A 1XTZA 1PWEA 2EBWA 2WZQA 2YYZA 1R10A 2EU8A 4LY3A 2ZFUA 4M9RA 3D6AA 3VC1A 3GAFA 1VJ5A 3VAYA 4GNKA 2G1UA 1XQXA 2Q3EA 3DQQA 1YIAA 5BSHA 1RBMA 5EG5A 3F73A 1USWA 4AQ7A 4U6QA 4YRSA 4P86A 4E5MA 2JZNA 1QG2A 2GN9A 2YVQA 1WX1A 4KR6A 1DBPA 2B37A 1VIAA 2LCIA 3BHIA 1H2FA 1N5KA 3FI9A 4IRXA 4OQEA 4V38A 4DAEA 2QYHA 2OXCA 3FTQA 1JZTA 4ESVA 4K81B 2WIKA 5ED0A 1IZYA 3E1KA 3A1CA 1ZUNB 3QF4B 4QXOA 4FXPA 2RDMA 3DM9B 4UAUA 4V0ME 4YRJA 3ICQB 4P33A 1UOOA 3FPLA 5DM0A 4ZO6A 3LBNA 2HJSA 1K9SA 3W5AA 1E6MA 1J7JA 4D4HA 3FKJA 1I6MA 3OP4A 1E1RD 1SOVA 2D0PB 4M88A 5IM4F 1QUEA 2YVKA 2IV3A 2E2WA 4WN9A 3H11B 5BUZA 4IJ5A 1ZNXA 1FZTA 4UUOA 4XAQA 4ZQEA 1O8BA 5B4TA 4BEBA 3ZDAA 1E2KA 2I3GA 5DGDA 1PT9A 4IQ0A 2ZVJA 3FFWA 1HYBA 4ZT6A 5H0IA 5TX7A 3ZNQA 4QG7A 3QNWA 3EVAA 1K7EB 4G9BA 2DTEA 2H4WA 1VJGA 2Q1UA 1U3TA 3WLPA 3T1TA 5IARA 3L7MA 1VLVA 2HQOA 1AA6A 3ZLBA 5HW0A 4R41A 1NI4A 5KHLB 1J0DA 3PFCA 2QY9A 2F4VB 3BH7A 3PC3A 4FOOA 3GA0A 3LW8A 1CR1A 2JKYA 3GJRA 3KQSA 2JLUA 2IH4A 5JQGB 3W3AA 2XNJA 5HVNA 4Q7EA 1CHNA 2IP1A 2IP2A 3INNA 3HADA 1G4UR 5HA5A 4CM8A 5ERYA 1RLTA 3HN6A 1XDWA 4B3CA 3CPJB 1Y81A 4DV0B 1R64A 2HI0A 3D0KA 2A5FA 3Q0IA 5KAPA 5SV2A 4JENA 4S12A 4TYQA 3BB3A 2ODPA 1A9TA 2C98A 1EU1A 5COBA 2VRWA 3IJRA 1NNEA 4XTRA 2BW0A 1T8RA 1YE5A 1TKCA 4G5OA 1YDWA 1ZN9A 4S2UA 5F1KA 4AUKA 1W5AA 3AI3A 3BGDA 1R18A 2XXBA 1L4NA 3T7AA 3NVDA 1NQAO 4M0MA 5JTTA 4KZKA 3DM5A 2FW1A 3V4OA 1FFXA 2POCA 4GO1A 4BKRA 1O6BA 2B82A 4F9EA 1XF9A 3LOUA 4JP8A 1QZUA 4MI1A 1VP9A 5C7LO 4WKNA 1DWOA 2C61A 3A05A 4Q0MA 3TGWA 1E9RA 2TS1A 3TQOA 2GEDA 3USES 3KU4A 1TC1A 1GLVA 3QJGA 4OHFA 1M2EA 1WUYA 3FCCA 2RGNA 5DK4A 2BFWA 3VISA 2VPXA 3FI0A 4BNTA 1ST3A 3SLKA 1JAXA 2HHLA 3EJ6A 4P22A 1YTLA 2B94A 3UCFA 3KT0A 4TLMB 3TVDA 2WFAA 6PFKA 4KE9A 1M8GA 3BXPA 3SF0A 4BQEA 3QMMA 4MQEB 4UCQA 3FJOA 3QXSA 4NX2A 1VI6A 1YU6A 1ZK1A 4BE4A 1Y80A 4D9IA 4YCLA 3ZTTA 1JFSA 1SO8A 1ENPA 1AQLA 2XDQB 2W2PA 2XOXA 3OC0A 2KPOA 4GMGA 3GL9A 3GXOA 2IY7A 5EEHA 4RTLA 2HADA 5L7WA 2I76A 3DEFA 4QUGA 3PEWA 5K4GA 1ZO8A 5GINE 3F7OA 4RZIA 2VPWA 4ENSA 1EFCA 3VTKA 13PKA 1ZN7A 5D2CA 1H5QA 2CYAA 4IGAA 1KJYA 3GVIA 2I0FA 4I1UA 2VK2A 4DV6B 3IP1A 3NX4A 2FCRA 2XYPA 2FG6C 3BOSA 4OHCA 5IDWA 3KJNA 2CB9A 2Q3LA 4PXYA 5CXXA 2B1IA 3AG5A 2G5CA 5FOVA 4AB1A 5EIXA 2QM7A 3NEYA 1O89A 1WZUA 1KK3A 1L4UA 3W9YA 1P7ZA 2YZ2A 2H16A 1B6TA 3KPVA 1TRHA 4OB7A 2UVPA 4V24A 5AVXA 4J1SA 4B6EA 1R3DA 4TXHA 4AG5A 4EHDA 2P4EA 3CCFA 3AWDA 3GFOA 5FI3A 1OTXA 3TEMA 4EPRA 5CFPA 1DCTA 4DCVA 4DLLA 1H8HA 2OORA 1MVLA 1XJ5A 1TO1E 1WUJS 4X1KA 4R2KA 1WMEA 2CLKB 2X3UA 3BHJA 2YRFA 3KB1A 4LXHA 1SUSA 4XEHA 4ERNA 3WGGA 2WFLA 3VJRA 3QTTA 4F0JA 2M32A 5B1YA 3HEMA 1TM4E 2Q29A 2VJKA 3KXKA 1G8KA 1M2NA 4HGNA 4NR0A 4PYNA 4D0NA 2C00A 4PG4A 3GCZA 1SIOA 3SR4A 4UM5A 3WNDA 2PXXA 2QGZA 4UEJA 2BR5A 1RXIA 1OFIA 3HNRA 3P2OA 3S2GA 3LQ1A 4N0MA 2NPOA 3D3JA 4PO8A 2A30A 5GGYA 3HV0A 4FX2A 4OEHA 4JVMA 5SY6A 3OHSX 4W99A 4O0LA 3W7AA 2DPMA 3NHSA 4CUJA 4OHBA 3CZMA 5D1NA 3PZBA 4NWIA 4Y2RA 3U4DA 1GZ3A 4CQLB 5JAHA 1SQSA 2WWHA 2R97A 3UFBA 5KNDA 1UKEA 3U4CA 3A7DA 4TL6A 3K5PA 4IVQA 3LFTA 5E38A 4C5BA 2Z8XA 2HF9A 3V1UA 3CYFA 3C8ZA 3GRYA 4NYIR 2HREA 2HXGA 2XXJA 1N6KA 2O8CA 2VAXA 3JQDA 1F8GA 3FYHA 3ZVMA 2AIRA 1NMSA 3TUIC 1WXFA 2QZSA 5BVHA 1A9RA 3GC6A 2VQ6A 1UJBA 1V7PC 1Y7IA 1GZHB 4DN6A 5JWRA 4Z3DA 3GFFA 3ND6A 3LH5A 1Z4LA 1XMXA 2ON6A 1ZD2P 3IJ5A 1KP3A 2GN4A 1NJ5A 1EFVB 4FFBB 1NJGA 1W5FA 2YZNA 4IJKA 4UUPA 5FJIA 1GNVA 1XZ8A 3EXG1 3LQQA 4HLUC 3R77A 4OLBA 3CGWA 5FWDA 2ZYDA 3RQSA 4Q4HB 2VDLB 3L01A 3LUKA 2HMVA 1IWPB 1HRDA 2M6LA 2RFLA 3Q9LA 1RPZA 1Z2OX 3WP1B 3H4MA 2X8JB 4BMSA 1B2LA 1Q44A 5EXSA 1HX7A 5F78A 3IVCA 1DAFA 3LA8A 4ALLA 2I03A 4Q4JB 3R3HA 4IILA 2VTDA 4COOA 2WBLC 8ABPA 3I4FA 4RD3A 1QTNA 2O2XA 3QVOA 4QDUA 3KPWA 1DRKA 1FP1D 4IHJA 4OK3A 1R0ZA 1U02A 1Z22A 1W93A 2A9JA 1J90A 1GSHA 1K68A 2D5IA 1P5FA 2OK7A 4XR9A 3ZW8A 1K3TA 5GGXA 4QEDA 1P9OA 1O1YA 1GL6A 3QW4B 1XZIA 2HM7A 4WZBA 3UQYS 4AU1A 4BO8A 3RYCA 1Z5OA 2ONJA 1G64A 1A5TA 3QVMA 3ZE2B 3I52A 3RYIB 1JE0A 1KFCB 3EZFA 2GN1A 2NTNA 1Z18A 3CLTD 1FF9A 4PU0A 1ZOPA 3OPNA 4MWEA 3L41A 4EA8A 3P32A 5JISA 3NDBB 1FSSA 4M1KA 1P9LA 4P34A 5ICEA 5G1NA 5B5SA 3TGPA 4B4WA 3B82A 5C8YB 1THTA 3GQBA 3VYWA 2AB0A 1JDUA 2FWIA 2DLCX 2VLIA 4UEOA 2BEKA 1JVNA 3OKPA 4H7FA 4XJTA 5AM1A 2DAPA 4JYZA 2ZJ0A 1WTAA 1YASA 3ZE0B 5AUPB 4HUTA 2X6RA 4Q9KA 3C6ZA 1Y5RA 2BMWA 4BN0A 4BLSA 3HZRA 1QH8B 2CXPA 1KDTA 2VOJA 4C7KA 2ZUEA 2JAXA 2QZZA 2VJMA 1SCDA 2JGFA 3JYPA 4TTVA 3R7WA 4B7XA 3K35A 2O8BA 4C0JA 1JKFA 2YVUA 4TT8A 1BXRA 2O3TA 4AUNA 1KPHA 1ZMXA 3V1KA 4IYRA 5B12A 3UY4A 1W0CA 1GFSA 2FGJA 2RGBA 2WAAA 2XYGA 5DI9A 3WK5A 1URPA 3WYEA 2F3PA 4GMXA 4KRGA 1XEWY 1VIDA 1YCDA 2RHCA 2VHQA 4PTYA 4CI0B 3P19A 4K40A 2NUBA 3BMOA 2ICAA 1II8A 3HB4X 4F9FA 4DABA 3E7FA 4MWCA 4CEHB 2ORYA 4MW0A 1XJWA 3KO8A 1RXEA 5TEVA 3U0VA 4L85A 1GDTA 3VHXA 3S3TA 1O57A 5HMLA 5IT0A 1VBKA 2BEUA 1MB0A 1YONA 2ZIXB 3U7EB 3UH1A 3WA7A 1LI5A 3G9ZA 3HYLA 2D5AA 5JQGA 3EX7C 3MWFA 1NUSA 4MJLA 2HMSA 3JAWB 5KC8A 2J59A 2GS9A 3ANYB 3QPDA 4J4BA 4NABA 2VZ9A 1RXSA 5D6OA 1HQKA 2NU9A 4NBVA 4URWR 1QIHA 4Q1VA 3X1KA 1TYZA 1E92A 1Z8DA 3HUFA 1EM8B 3IPAA 2QTVA 4IZ6A 5EZSA 4DMFA 5L4SA 4E7PA 1PV4A 4GMHA 1EFHA 3MTBA 3F6BX 4M1WA 5EN4A 1P1CA 2OYCA 2R6AA 3VNBA 3R9WA 1TQHA 2COEA 3OWHA 4P5PA 3S8EA 3KWLA 2HRQA 2QRMA 2P3LA 2DFTA 4HTFB 2XYVA 1BMFD 2C3PA 2BFCA 4NK4A 1RAIA 1ENOA 3ISJA 3A26A 4OSOA 3STHA 4B35A 3MD0A 5A02A 3P2YA 3MK31 1GR0A 3L1HA 3KKLA 5GY7A 1TZ2A 3WBFA 4HP8A 2B1JA 5F5NA 3ZLVA 1QG4A 1Z37A 2JJ2A 4C06A 2HRRA 8ATCA 3AFOA 2A8YA 2YUIA 3ROMA 4F1JA 4RY0A 1T35A 3PFGA 4QFMA 3Q72A 4E0BA 2G9RA 2SBTA 5AK3A 5LDDC 2HLDD 2ZZNA 2VL7A 3A10A 3WJ7A 1F6DA 3KUKA 5DM4A 3PDHA 4MGIR 2XCSB 4HEJA 1E8MA 1WULS 4YYEA 2PY6A 1P91A 4C4ZA 2G7MC 4N7BA 4P31A 2B6NA 2ZDGA 3EZYA 1FFHA 2GD1O 3Q3HA 2YICA 4EJ0A 1XTSA 3A4LA 3LG2A 3UXYA 2WJIA 2DP4E 3Q7SA 3OWXA 5ALZA 1K63A 5CH3A 3FBWA 4DR4B 2JIQA 1U4OA 2H1CA 1JW9B 2QTZA 1UC9A 3IDAA 3FW1A 3T94A 5I9LA 4ZQIA 2CDNA 3Q1KA 3CWCA 2FSIA 4HUJA 1QRTA 3DUFB 3EF0A 3G8AA 3S5UA 5AHXA 2GWRA 1KQNA 3RBVA 4IMPA 4BNGA 1EK2A 4XM1A 2ZR8A 1WCWA 1UJ2A 5BR4A 5ICSA 4BMPB 2ACKA 2Y4OA 1NXOA 1MZVA 2OGWA 5FPYA 1PS0A 1SUEA 4P3XA 5KOIA 2TSYB 4RIIA 4K6OA 5FLKA 3G2OA 4WLOA 5JSKA 4BKPA 1XDZA 2O8FA 3OTWA 3NYQA 3R3SA 2ATCA 4KUEA 1K66A 4LRQA 4MWOA 2R44A 4B6FA 1TJNA 1UMKA 4P3NA 5B3KA 5BN4B 4EY6A 1K6JA 1CY8A 3I5AA 2JD0A 3NT2A 2NPFA 5JPIA 4UPEA 1AGYA 1LBQA 3K53A 2X0FA 5FPTA 4MICA 2LUOA 2PRJA 2V6MA 3VOTA 2IL1A 3AR5A 3ZCRA 3A6ZA 4UCXA 2JA2A 1FRQA 5IYZF 3DF7A 1OGIA 1OAKA 4LMRA 4LE1A 1PFWA 4V0SA 2ZE6A 3ZYCA 5AVSA 5IJZA 4NXNB 2HDOA 5IVKA 1A9ZA 1HFJA 1CZLA 1E66A 4FWTA 2GPSA 2HH9A 3MSXA 3Q8XB 4RO0A 4YRGA 1DKOA 1NOJA 1N2IA 1MDFA 1YL7A 3HBLA 1J8MF 1A2KC 3ZCUA 3QKWA 4XVUA 1ZESA 3SVTA 2EJUA 2RHWA 2XV1A 2VNAA 2UUBB 4JJ7A 3VBEA 1K2VN 2MTBA 2V03A 1I10A 1CVIA 4Z2AA 4J0CA 7REQB 2ZQ5A 4G2NA 3K6JA 1FYDA 3LCCA 1QYVA 1QXSA 1XMOB 2QAJA 4J8PA 2J3QA 4FHFA 3QIAA 1C3LA 3DLCA 3WKCA 2VSQA 3VC3A 5IC5A 3E1SA 2QBYB 3WMGA 1DLIA 4KQMA 3ADOA 3LKDA 3HP4A 3I9V1 3OZBA 1BG6A 1H0KA 4K6KA 3UGQA 1NUQA 4CR6A 4EATA 4J3JA 1N2HA 1VMIA 1MG0A 2C5SA 3PQ7A 5K8LA 1V7QA 2W6JA 1AKQA 1NAIA 5CB6A 1D2EA 4KXYA 2H9AA 1W5TA 2NADA 1HOTA 1JSCA 2W8ZA 4I1RA 4NZPA 5D3KA 3WXBA 4DCTA 1QV9A 3DYBA 1X77A 4OUKX 1SVIA 2IOHA 3EC1A 3V2HA 1XZHA 6NULA 2QNIA 3R3UA 4FLFA 1L7EA 1IZ0A 1N2CE 3OJCA 5CX4A 2RGXA 3GJQA 4YR9A 5LJLA 3VR2A 4EEZA 2J3LA 1TKAA 2HXSA 1M2KA 5D5PA 4EO7A 1G0OA 5I4CA 1IVYA 3ZHSA 2YV3A 3RVBA 1UADA 1UJCA 3FRHA 1J97A 1IUOA 5JPDA 4O2BA 2WKRA 4NP6A 1C4OA 5IU6A 3QTLA 3HCDA 1KBOA 1VSBA 2ZRCA 2DWCA 3THYA 1BXGA 2FVYA 3Q7IA 3S81A 4LTNA 1YQQA 3DT6A 2ZSJA 5IYZA 3D4BA 3IAM1 4HAYA 3NAMA 2HMWA 1YA8A 1QORA 4ZVOA 2PKEA 1QIKA 2RGCA 4MVJP 1JDSA 3P4YA 1P2TA 2N46A 3PGMA 4LTMA 4PPGA 2H5EA 3S2ZA 5K51A 1EXDA 2ZIWB 1KZ9A 1XQ9A 4M76B 4U0KA 2FSHA 4EF5A 1TFRA 1QFJA 2AUNA 4UNNA 2HU2A 3CJQA 5K3EA 3ERCA 4HPXB 1RMYA 3NO4A 3IVRA 1SG0A 1QG0A 1Z4IA 3GZ4A 5ALLA 1V8ZA 5KNBA 1RIIA 2DBRA 4W5OA 2VN8A 3L4JA 1TADA 221PA 2BZ0A 1ZRHA 2HO5A 4MUXA 4WNCA 1WU7A 2BSQA 2XB2A 2RI0A 3HDQA 3GBSA 3SZMA 2H65A 2QQGA 2N1MA 3I0NA 3LXMA 1YRAA 1QK5A 3FPAA 1G6Q1 1TDJA 5EIBC 2SHKA 3Q85A 2C4TA 3UAOA 1YQGA 5JRZA 3NTLA 2OZKA 3L5KA 4LDJA 1D2NA 2OK8A 4P2BA 1N5OX 5T4HA 4B2YA 4HB3A 4EFMA 4DLKA 1O54A 4YXWD 2W6MA 1T5SA 2QMHA 3SPXA 1Y1RA 2GBPA 3CX4A 1F1BA 2HUPA 4WACA 3HKCA 3QPUA 2IS2A 1F2UA 5FXMA 2H0AA 2NSYA 3PX7A 1GPAA 3RVKA 2H07A 4NZ9A 1OZGA 3HU2A 1ZH4A 2UZIR 4G0NA 4S1VA 1XMPA 1YB2A 3ILYA 2MT9A 1VKNA 1G2OA 3DA8A 3PUKA 3VC2A 1DG3A 4RJIA 1AT1A 1BFUA 1JDNA 2BJWA 4WXMA 4CKBB 3FOFC 1QIMA 2X8BA 3IPLA 3ONFA 4GLLA 4LW8A 1Y9DA 1IRIA 1T1GA 3DXFA 4WE3A 2F62A 2C9DA 2WEKA 3KKZA 1I7QB 3RT7A 2WF9A 5ADVA 3GRAA 1HDOA 4Q3AA 3P26A 4G97A 1CY0A 1ZGHA 5A7GA 2VIIA 5D85A 4B7AA 1Z6QA 3PUVA 3LUPA 3CE6A 5T4BA 5SZJA 3SHQA 1Q15A 2BDTA 5FLEX 3UT0A 2P6RA 2HT6A 5C5DA 1ISRA 4IXMA 4UOEA 1CJUC 1VMAA 4Y0NA 1VMKA 2PQ2A 5IJ9B 3CWZA 3U7IA 4PR3A 1C8KA 3RVOA 1T3SA 1TF7A 2WG0A 5ES3A 4BVBA 1SR8A 1Z5WA 1RYHA 1UDCA 5HF9A 3TTTA 2CUKA 3NQ41 4JKYA 4O2LA 4P4UA 1ZICA 3FZGA 5DF1A 4B8ZA 3AFNA 2H1IA 2WAMA 1EWQA 1XEFA 4RMGA 1MLDA 1NYTA 4B76A 4KDFA 2Q8NA 3PPVA 3SAJA 2ZJBA 4DC1A 1ZVVA 4AKHA 5GM1A 1NR7A 2GHRA 1KOJA 4R6WA 1VFNA 2Q2OA 4LXGA 4P58A 4Z9AA 4CM4A 2HSZA 3SLGA 2XAUA 3MHPA 1NDHA 3GWGA 2OHXA 3EG9B 4QDZA 4BFSA 4ZN6A 5A3JA 4I8DA 2ZU6A 4EQZA 1WCYA 1E9DA 3P27A 2SKCA 4MB0A 4G36A 3PBKA 2PX8A 4DMMA 3ZD7A 1U8TA 1OV6A 1JR3E 2HRBA 1SU8A 4PNPA 4AYWA 2ORIA 4BBPA 3Q3EA 1JH9A 1NBOA 1WD7A 5ELLA 2ZRPA 1ULSA 3D3WA 1SA0A 1H2EA 4JYCA 4L8FA 1MX5A 4HC4A 4RAQA 1DAIA 2NUPB 2W37A 1EFDN 5L6LB 2O19A 1CF2O 1DJPA 4DMKA 3KYCA 1PWZA 3FB1A 1PGPA 2QZ4A 1MQ8B 2WVGA 3DO6A 2JH8A 3NANA 1BVRA 1UEIA 3IOEA 2GLTA 4IG4A 4F3YA 4H1HA 4B3FX 2A9VA 3P0RA 4CT5A 1L5OA 1PR9A 2IY8A 3MOSA 5EA2A 5C35A 3O8RA 1CRQA 4I5IA 5ESXA 2FZWA 4R68A 3T0GA 3ZWVA 4RXTA 3PA6A 4BGUA 2GJ4A 3PFBA 4TOIA 3MLEA 3CN9A 4FR5A 5DE3A 1CQJB 2E4YA 2FZKA 2R8ZA 1D2MA 3AVPA 4HB0A 3UPDA 4G65A 1K0UA 1TYBE 4O8ZA 1HLDA 1A95A 1E89A 2I66A 2FFQA 4M89A 2QMOA 1J23A 4NYIQ 4G23A 2IKQA 3AEQB 4LXIA 1H1DA 1ZH2A 3JQGB 5HM6A 4X41A 4BFYA 4QQ8A 5E8JA 3OBIA 4QUAA 2V65A 4RKWA 5FTWA 4N3NA 3PEVA 4GC9A 3ZWBA 1B6GA 5D3MA 3VV3A 3FRJA 1TUIA 3GUCA 3OQPA 4BECA 1JDBB 2GYWA 2JLQA 3D8NA 2ORED 4G5XA 1JFTA 2C4WA 3VGJA 5BMOA 4IVPA 1NI5A 3FHOA 4GP9A 3C3JA 4HLNA 4Z4EA 1XP5A 4KKVA 2OHIA 4PO9A 5SZKB 3AIMA 1IAVA 1NJ2A 5TQ0A 1U28C 2I1QA 5EZYF 1SMKA 1XPOA 2VBIA 3ENNA 4GM4A 5DLPA 2ZR0A 1EDDA 1GOTA 1K4MA 1FQKA 2QR2A 3KQUA 1HT2E 3FPGA 3R5SA 1GRCA 4XQCA 2QXUA 3HKEB 2YZ7A 4QXMA 2VBGA 4DRZA 3ACBA 3BHMA 5E4FA 3HJHA 3TOZA 3H4VA 1A96A 3OEYA 2BPOA 5F7ZA 1GGHA 2J6IA 2PA0A 1NVBA 5EWJB 3PFHA 4CW7A 1QHIA 4BEJA 1M34A 1WAMA 2GZAA 4HQFA 3RIGA 3FZEA 4QLOA 2SKEA 1MOZA 3K09C 3LRXA 5FV4A 1U8AA 3ADKA 2VH5R 4TN5A 5FR1A 1P2FA 2VQDA 4O2AB 1AO3A 3CX6A 1C1DB 1H8EA 4X60A 1N33B 1LPAB 1DUSA 3FWZA 4FZJA 3M2PA 4B3BA 2YS7A 3DF9A 1DVRA 4N0QA 5HE8A 4M87A 2BGRA 1BQ4A 1ZM4A 2Q4EA 2X42A 3H9EO 4HNQA 3ED1A 1SZJG 5BN1A 4I0WB 1RPTA 1UC5B 1N3BA 1PEAA 3L8DA 1UMCB 1Q0RA 1XKTA 4YFYA 3SS8A 2G6TA 3OHPA 1CB0A 1DU4A 5TS3A 3VVMA 1G4AE 3DWFA 4FKBA 3SE0A 3GJXC 5JFGA 4HAUA 5EUCA 3LXXA 5JXGA 4NCIA 4XTCS 1XRLA 2PYDA 1DIHA 1EE2A 4TL8A 5HBRA 1ORTA 1FU4A 4YFVA 3ORSA 5BNZA 3KSAC 3A1SA 1CQIB 5BSVA 3PCXA 1H1LB 2WAXA 1ECCA 1NW4A 2XF2A 1QE3A 3MUEA 3EVCA 4J90A 1KDRA 1VLZA 4IDHA 3BCRA 4IO1A 1SXHA 4M0UA 5CDUA 2ZP1A 3L8FA 3CSUA 3P0EA 2EKLA 4JU8A 2F55A 1L7DA 3HGQA 4EFNA 1JHQA 4GD3Q 3A1EA 4TUYF 1WZIA 3SSAA 2CJXA 3NHWA 4R2WA 3R8XA 4ZFNA 5IUJC 3UPTA 1OC4A 5A4KA 2R11A 2BOVA 1YAHA 3DDWA 2XMDA 3WA6A 4EJMA 4EZEA 4UM9D 4DMGA 3BS4A 2MDTA 3NBZC 1QTIA 2BDUA 2IOYA 5CA0A 4ITVA 1PK7A 3KR0A 1X38A 4ON9A 4YI3A 2NZYA 4KGDA 4U2KA 1N1EA 3HZHA 1D6MA 5I4KA 1E3WA 1OAOC 3HXKA 5IZ4A 1ICEA 2AC7A 4F4DA 3NRJA 3OQOA 1OX4A 4CMEA 2PUAA 4GBMA 3VTFA 1SBCA 2XIQA 1G5QA 2JDID 4R05A 1X1QA 4EKDA 3H8WA 4YROA 5E9JA 4Y0VA 3AB7A 3HV2A 4G1EB 5AI4A 2PXAA 2VTVA 2ZROA 3DZJA 1E8NA 4R2IA 4R5MA 1E7WA 1R8JA 3CQ9A 4H7HA 3DONA 4EHAA 1XZFA 2WPDD 1E1QD 3P45A 1Y1PA 2MINB 4ILKA 2QJWA 1C1XB 1XUOA 1AZSC 5CA1B 1UJNA 1R27A 3B9RA 3HY4A 3Q7EA 3J80A 3II6X 2FSSA 2J08A 1Q95A 4RMJA 5EHQA 5FBLB 3W3AD 1EVLA 4WWHA 2X7JA 1NBMD 3K31A 4BHTA 1TVCA 3HYTA 3NOOA 4TS9A 1Q19A 2CDAA 3R3YA 5JZOA 3LFHA 4KQKA 2W93A 3OEED 4L08A 3W04A 5JXWA 2GBFA 2IYLD 1W4BA 1K6EA 2ISSD 2OVFA 4L1KA 2F8TA 4LMAA 2EKZA 4AQDA 1HDCA 3NCTA 2GBCA 5EE3A 1U2GA 3FUVA 1G7SA 4TRMA 4JUDX 1PP4A 1SEPA 1D8AA 2DUJA 2HWKA 2NXWA 2YXDA 3B3FA 3G2KA 4UKDA 1NVDA 3L43A 2DF8A 2PL9A 2EKDA 5A6SA 4J03A 3HU3A 1MHPA 3KHKA 3PCRB 4DTCA 4H16A 4HS4A 1NOIA 2WIBA 3EGDB 2PBZA 3F0TA 2VSNA 3TSZA 2WSMA 5JBNA 1K92A 4WXHA 4ODIA 1V45E 2FEWB 3PGVA 3VR6H 4BWFB 3VU9A 2WC1A 4JBYA 4W1QA 4QGSA 1LTQA 2BHTA 2OO7A 3M1LA 2D7CA 4BX8A 4C7VA 1KR5A 5EJMA 1QKJA 5FNVF 3CUUA 3FZNA 1RW4A 2V7TA 1FEZA 2JL1A 3PUJA 4JBXA 3QHPA 2ARKA 3L1KA 1AXEA 1DAKA 4FFRA 1N4AA 3W6UA 4BNIA 4F3KA 2YXEA 5J2UA 3H5TA 2C5EA 3GP5A 3RJMA 2PKCA 2DHQA 2AG6A 3QGMA 5CFLA 4RTKA 2X40A 1KI1A 2XNHA 3WLNA 1OXUA 2Z8YM 4A2CA 1SU4A 3N8DA 4UD2A 1A8HA 5CD1A 5JYCA 3ONVA 3INGA 3DTVD 4QRHA 2XQFA 3CLSC 2H2WA 3DPUA 3T3EA 1DSSG 4JLVA 2IH5A 3T0IA 4MRMA 5KTYA 4BGDA 2QTNA 3QM1A 1XYGA 4NBKA 3ZXXA 2ONYA 3PXDA 4TV9B 2E0IA 4Z53A 4RK0A 4KNYA 4WNYA 4Z7OB 1JKJB 1DJNA 4BRSA 4CF6A 4MRAA 2R6R1 3SOPA 1L1QA 3RIHA 3CG0A 3U31A 4HR7A 5U4QA 1U04A 2Z56A 4W6ZA 1P7YA 2VWPA 3L0CA 5K0CA 4F8YA 5KTRA 1PDVA 1X7XA 1EYZA 3USZA 1G8JA 4FE7A 5CVCA 1AKTA 4UFOA 3AUAA 4V0RA 3MFQA 3OQVA 4ZTUB 1AZLA 4B2IA 4DARA 4CV0A 1C7IA 5KTPA 4WKOA 1I7PA 4IG9A 2E7ZA 2EC5A 4MV7A 3A1VA 1H8HD 3FBGA 3FPHA 3IXMA 1M7HA 1P2UA 1V8FA 4PR0A 2ASVA 1WPRA 1W75A 2ZM6B 4YWHA 3ZTYA 3W8FA 4F56A 2FSUA 1R66A 1HV8A 2WV9A 4MO9A 2X9VA 4DR5B 3Q7QA 4YJDA 1O5TA 1T91A 2J48A 1CERA 1U9JA 2ZREA 3BK2A