3R20A

Crystal structure of cytidylate kinase from mycobacterium smegmatis
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
217
structure length
217
Chain Sequence
SLVVAVDGPAGTGKSSVSRGLARALGARYLDTGAMYRIATLAVLRAGADLTDPAAIEKAAADAEIGVGSDPDVDAAFLAGEDVSSEIRGDAVTGAVSAVSAVPAVRTRLVDIQRKLATEGGRVVVEGRDIGTVVLPDADVKIFLTASAEERARRRNAQNVANGLPDDYATVLADVQRRDHLDSTRPVSPLRAADDALVVDTSDMDQAQVIAHLLDLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
molecule keywords Cytidylate kinase
total genus 82
structure length 217
sequence length 217
ec nomenclature ec 2.7.4.14: UMP/CMP kinase.
pdb deposition date 2011-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3r20A00
3AGPA 1FP6A 3R9XA 3QKRB 4DLZA 1KMHA 1NMZA 4IDQA 4IOJA 3B9PA 3CRVA 1Z07A 4KHZA 5AJWA 1ELOA 1E2PA 3GP8A 2VHUA 1EWRA 4GP6A 2CNWD 2GZHA 1DELA 2HUPA 2RGNA 3P20A 5EP1A 1R0YA 2CLSA 3CBQA 3THYB 2WWWA 1CP2A 1XTQA 3U7FB 2ZEJA 1T91A 1W5TA 5CJ2A 1AKYA 4B75A 2XNSA 3QJYA 4GNKA 1RIFA 4MQBA 2BCGY 1V43A 4X8HA 4Z54A 1CXZA 2W6JA 4PSAA 4B73A 2FX3A 5M04A 4D82A 1ANKA 4XJXA 1OFTA 2EFCB 3KJHA 4B76A 3ADBA 1W36C 4Q66C 2BKUA 5CM9C 3U3KA 1OXVA 2N42A 1XPOA 1MABB 2RGAA 1ZD9A 2WKRA 1N6OA 5LD2B 4ZKEA 3CX8A 3IDQA 5AR1A 1OLOA 3VX3A 2QZ4A 2CCGA 4V03A 1KK1A 3H86A 4TYYA 1KJWA 2LKCA 1ZVQA 4NU0A 2WWYA 1FOEB 1WBBA 1NL3A 3K8YA 4G5QA 2EFEB 4CZ2A 1RRFA 2GEUA 5GJCA 5JEDA 3MRSA 3OIUA 3KJGA 5CM8B 1ZW6A 4Q4HB 3UKDA 2QRNA 1JJ7A 1MO3A 4JZKA 2HJVA 4LHXA 4Q02A 4A0FA 2C04A 4Q21A 2DHRA 1F3OA 5B57C 4C2TA 4F91B 2J41A 2ZU0C 3KQLA 5HKKD 1US8B 3RWMB 1KDOA 4HLUC 2GKSA 3R9WA 3VHXA 2CVFA 1IAQA 2QUZA 1MO4A 2XSZD 1TAGA 4G5GA 2VP5A 4N1AA 5ELXA 1VCMA 3IQXA 1A4RA 4OI4A 4P4SB 5FTNA 5J4VA 3RABA 4WA7A 2FSGA 3DPUA 2MSCB 1NG1A 4OI1A 1FUUA 2WTUA 3E2IA 3FVQA 1UFQA 4DWJA 4HUTA 1CULC 3OESA 3CH5A 4TLCA 3CF2A 1A1VA 2G0NA 1VIAA 2W6IA 4C4PA 4RCZA 3I61A 4PR0A 5CDFA 2QAGC 4ZIRB 2EVWX 1CRPA 2RGDA 2L0XA 1VHLA 3K0EA 4Q9KA 1K6MA 1FP7A 3VR3A 4GZMA 1R2QA 3P27A 3BC1A 1JJVA 4PSKA 3GJ0A 4TMZA 1OXXK 1XF9A 3TUZC 3VR6A 2BHRA 4I1OA 4QGHA 4DBLC 3OHMA 5J40A 4DDUA 5JECA 2ZJ2A 1XB2A 4PO9A 1HY3A 4IOMA 3OAAD 4C0JA 1U81A 4KLZA 3BS4A 4A9AA 1E2JA 2ATXA 1G8HA 2J7PD 1JAIA 3R8FA 5JZVA 4BRWA 2BOVA 2WWIA 3QXJA 1D2NA 1SXJE 2JJ1D 2F1IA 3DKPA 1DO2A 1II0A 3Q7PA 2F3RA 2O8EA 5KDLA 2PH1A 2XB2A 2FOLA 1XJCA 4XIGS 2IEYA 2V4ZA 5CLQA 4ZCIA 1RPZA 1M6NA 4H9GA 4GL2A 2HJGA 3OEHA 4TL9A 1Z47A 4MUBA 2ODWA 3BFVA 1ZYUA 1G3MA 2VF7A 2HCJB 3GEEA 2IUUA 4BFSA 4D0GA 3U5ZB 2GBLA 4NKRA 3EARA 1Q0UA 2C99A 5FTMA 1ZD8A 3WY9A 2GESA 5KSOA 1J7KA 3LD9A 3EA0A 2VP2A 4DZZA 2NGRA 1SVIA 3ND9A 3KUCA 3VKWA 3MLEA 1EXMA 1N6PA 3SJCA 1LW7A 1NN3A 1G7SA 3QKSA 4F4JA 2YVUA 3FKSA 3EIEA 3TBKA 1KZGB 3QEOA 2O8BA 5KDDA 3W6PA 1KYIA 4AURA 3RS7A 2DWOA 3GFPA 2E1RA 1DE0A 4XSGA 5AJXA 2WOJA 3GQBA 3RANA 4BQSA 2BMEA 2RGCA 5EP4A 2FJUA 3NXSA 4JLKA 1AJEA 5A4JA 1EK0A 4IDPA 1D2MA 1QVAA 2R62A 3E1SA 4BFWA 4M2LA 2JLRA 1U2RA 1ZINA 4TQAA 4HAYA 5EE3A 2I1QA 4LJ7A 2PLRA 2ZR9A 4QM6A 3C4JA 2NO9A 1G5PA 4LJYA 4Q7MB 4RKEA 3S1AA 3PXGA 2OFWA 3K0CC 3MJHA 1W2GA 2GXSA 3CNOA 2J7PA 4A15A 1U90A 1W4RA 4WW0A 4BLPA 3U44B 3KXLA 1P60A 1XPUA 1ZU5A 3VTKA 1JXMA 4Q9JA 3CR8A 4N0DA 4B34A 1GL9B 2NPIA 1CEEA 3HU3A 3I73A 3OF5A 1TUIA 1QF9A 3TR5A 2IW3A 1LVGA 4AG5A 3I5YA 3TUJC 3SU8A 1NIPA 5HCIA 4Q1CA 4V0OA 2CCKA 1AGRA 2AXPA 3CZPA 4LWZA 4QBHA 1KK0A 4KV9A 1FNNA 1GNRA 3WP0A 4GT1A 4CF7A 4C9BA 2C96A 2N46A 1JNYA 3TVDA 3IILA 4CEJB 1KO8A 4PC1A 4ZCMA 3TSOA 4IEIA 2BM1A 3GLFA 4EQ6B 4A0GA 1DAKA 4AY2A 4HUQA 2QL6A 4FCWA 4AIIA 2AK3A 4RCYA 3WYGA 1VMAA 1UF9A 1XMJA 2SHKA 3UMRA 1E1RA 4EPRA 1M74A 2EU8A 3E5HA 3V9PA 1W0JA 3ICEA 3S1AB 3FHTA 2XTMA 1DVRA 5FUVA 2GA8A 3FGNA 2ZJYA 1E2IA 3U7EB 4DDVA 5J47A 2GAOA 2ZE6A 3KKQA 3R20A 3R7WB 2DR3A 4TZ0A 1LNZA 1N2CE 2YHSA 3GFOA 4Q7LA 1C1YA 2ZUDA 2DFNA 4K8OA 3I62A 2IYXA 5CIWA 3AF3A 2FSHA 3FHCB 1LTQA 2W00A 3Q5DA 5BN3A 3LAWA 4TMXA 2JJ8A 1TQ2A 3WMGA 2UVQA 5DI9A 2CJWB 2ZITA 2FFHA 4BPBA 2EW1A 1AGPA 1CJTC 1JALA 1RYHA 1XD9A 2JIZA 1N5IA 2ZE5A 4YMWA 4R71A 4D26A 1IXZA 4PXAA 2D06A 2CJWA 1E9SA 1OXSC 2YNMA 2YWFA 4GMDA 1U99A 1E2DA 1ZNZA 3LQRA 1XEXB 2X1VA 4OQMA 2H17A 4B3XA 4BWYA 1LF0A 4DCNA 1BIFA 1DAMA 2JATA 3QXXA 3CPHA 2YOHA 1DEKA 2GBLC 3AEZA 4RY2A 4UNRA 3RC8A 2WKPA 1ZUNB 2F1RA 1X6VA 4F7WA 2F1JA 4NHOA 3GJ7A 4A6XA 2RGBA 2OUKA 1W48A 2XNDD 4QJ4A 1D9XA 1AQUA 3QXHA 2IT1A 2QM8A 1KDRA 1XMIA 4GI7A 4C3ZA 2B8WA 2PCLA 4B3DA 4HSEA 2F43A 3GPLA 1J8YF 2D4HA 5LPNA 4OQNA 1KOFA 2D7CA 2IK8A 2ZI5A 4OHZA 1ZNXA 2ZRAA 1CJUC 1GILA 3OIYA 4M22A 4EUNA 1P9NA 1SVWA 1TX4B 4TTPA 3TAUA 4BRUA 4EJSB 3NBYC 4R7ZA 2OBLA 2ZR7A 1KI6B 3IHWA 3GJXC 1VECA 2WJYA 3D8BA 1F60A 4FWIB 4HB3A 5DYIA 4Z1MD 2CBZA 2F9LA 3B13B 3PITA 3W9YA 3QI2A 1OB5A 2G9NA 4NBSA 2CL6X 1QRAA 1U0LA 4DDTA 2PX0A 4TN1A 2IHBA 2QAGA 3FTQA 1G4UR 2NZJA 4NCJA 3B82A 3VQTA 2TMKA 4CEJA 4HB2A 3AH8A 3MG9A 1HUQA 4JSYA 2DWQA 2QP9X 4U02A 1FW6A 1DAFA 3VKGA 2CK3A 1N6LA 4BE7B 4IFEA 3UATA 2ZRPA 1OKKA 4HB4A 5E95A 2REOA 2JLSA 3U61B 2CEAA 1SVKA 2QPTA 4FMDF 1E0SA 3WMEA 3FFAA 1KI1A 4Q1BA 2ZRHA 3OFND 3T5DA 1DADA 2OLJA 2VPPA 2RB4A 3QSYA 3AVUA 3A1WA 3L0IB 3EWSA 1JEDA 1YR9A 1TU3A 2D74A 2DPXA 2H16A 2HLDD 3BJIC 3BH0A 1TNDA 3BIFA 2ONJA 1T0HB 1XCGB 4BUJA 2P65A 3O8DA 2D62A 1KNXA 2FGKA 5IRCD 2Q9AA 1XX6A 2R8RA 1T9HA 3GLFE 4C0QC 4RZUA 4DLUA 1QHGA 3RS4A 5KSZA 1L4UA 2ZREA 5GVRA 4S2EA 1IBRA 4M1YA 5FBQB 2HT1A 2Z5FA 2XB4A 1Z2AA 2R6GA 1Q1EA 3EG5A 3SFVA 4KBFA 2GK6A 3GLHE 1E6CA 1KY2A 2XJ9A 5FOUA 4RFSB 4FXPA 4BEBA 3VU9B 4M1KA 2ERYA 3QKTA 3G82C 2ZU6A 4XD7A 4TLBA 3KKPA 4Q1AA 1W5SA 2I4IA 2AD5A 4UNQA 2ZI7A 5FTKA 2OBMA 1OIVA 1OH6A 1VYTA 1GNQA 4AKGA 2XGJA 3RS3A 1ESMA 1P9WA 4MYUA 4PO1A 4BFZA 5LBIA 1NVUQ 5G3YA 4CIDA 4D2IA 4TZ6A 1KO5A 2H18A 721PA 1Q1BA 4CT4B 1TADA 5CB6A 5IT5A 5EE1A 4IEEA 1F5NA 4MRPA 2BIFA 1KK2A 1OF1A 3L2OB 3NEJA 3RYTC 3A58B 1QVRA 2KWIA 4A6PA 1KDTA 4E22A 2O52A 2ZE7A 4FINA 1W1WA 1TPZA 2JDIA 3CRMA 1T3SA 4JLOA 1E2NA 1XXHB 2A5DA 3IO3A 4MUAA 5JCPA 1S9DA 2VP6A 1MT0A 1FNMA 1HE8B 2XZPA 3QKSB 1AK2A 1SVSA 1N5JA 4QHSA 2WPDD 1KSJA 3RSLA 3OZXA 1X1SA 3I3SR 4KSCA 1VG0B 2ZSFA 1VG8A 4M1SA 1W4AA 4GBMA 3SYNA 3SR0A 4TQ9A 5EZ6B 5JSZA 2WIBA 1SHKA 3EPJA 2Q9CA 5DN6A 2QMEA 5F9HA 3I72A 2KBFA 4EFMA 1NN5A 1Q3HA 1TF7A 4TMVA 2WHXA 1R5BA 2F3TA 1AN0A 3RRZA 4Q4HA 2NQ2C 1F2UA 1I4TD 1ZRHA 4P31A 1KI2A 4RD3A 2PBRA 1CR1A 4TYQA 2DFLA 2IYZA 2MMGA 1FL9A 2VQSA 2ZANA 3HWSA 4FI3C 4XTCS 1E2QA 3X1XA 3Q3JB 1UM8A 5G3ZA 2QGZA 1S1MA 2ZSBA 1I2MA 4DKXA 3X1ZA 4M1OA 5FBVB 1NG9A 3ZIAD 2Q21A 3B1YA 4P3YA 3IEVA 3ZVRA 1NVWQ 3B1VA 4QRHA 3DZ8A 2DYKA 3GLHA 3VKHA 3CZQA 4ILEA 4JJKA 3CWQA 3PIRA 5KOYA 3QY0A 4B3GA 2OCAA 4DVGA 1U8ZA 1II8B 1TTTA 5FBWB 1VTKA 4H1UA 2EFHB 1RFLA 4XD7D 4R9UC 2FGJA 2H5EA 2VA8A 2IYVA 4IXNA 4NDZA 1J2JA 1E2FA 2BM0A 4Q1DA 3K09A 5DE3A 1GRQA 2ANCA 2IUSA 1UKYA 1ZUIA 4PHFA 5KYKA 1NVVR 5FOVA 5LB2A 3A8TA 3EZ2A 1Z6GA 1XEWX 5H70A 4G5SA 4LV5B 1ESNA 3QF4B 4JLBA 2OAP1 3QPWA 3AP3A 1ZM9A 2J3EA 2JDID 2WJGA 5KUTA 1IXSB 3DDCA 1BO6A 4GOXA 4DEYA 1Z6YA 3M1IA 3P26A 1G64A 3DHWC 4ASUD 4LYHA 4NONA 4E09A 2JLXA 2CCJA 5FUYA 4DCTA 2FMXA 1CJKC 4OHXA 5KO2A 1GRRA 2NO6A 3RC3A 3D3QA 2XJ4A 2QAJA 4LX0A 2HLDA 2VEDA 4YMSA 5EP2A 4B2LA 5P21A 1XU4A 2J0VA 3AKCA 4QFMA 4URWR 1QDEA 4ZDKA 4C2UA 4CVNA 4DCUA 1KSHA 5FBRB 4A82A 2A5GA 5AUOB 1N5LA 2XZLA 4AYTA 2G88A 2PZGA 3EW9A 4NYIR 4EPXA 3ASYA 1GNPA 4ZKDA 5EUQB 3HYRA 3I5XA 3ASZA 1VIYA 4MYTA 3LX5A 1V5WA 3I8XA 2RGXA 1EGAA 2WJVA 1P62B 1Y3AA 4L8GA 3W3AA 5GJVC 2VSOA 2GETA 3OEED 4Y0VA 3ONWA 5FH9A 1Q20A 5L3QB 3BOSA 1R5NA 2GJSA 4ZV4A 1PVOA 3FMFA 4OKSA 2V55B 3TVTA 4OHYA 3UMSA 3W5JA 3THXA 1TL7C 4QBFA 3BXZA 4HLUA 1G6OA 3NBFA 5FOXA 3AF0A 4U7DA 4JLNA 2ZR0A 3BRWD 2ZJZA 1E32A 1ZC3A 2A30A 4JKIA 2IWHA 2QPOA 2P6NA 3WRXC 5B2ZA 1HEIA 3V4FA 4NYMQ 2PT7A 4IKEA 3C7KA 4DXAA 5EJEA 1NY5A 2IBMA 4LI0A 4YLGA 2C03A 2PCJA 1NKSA 5DISB 4YMVA 1XTJA 1E79A 5DSZA 5HCNA 1SULA 2ZRJA 4M1TA 2NIPA 2VLIA 3RWOA 3HP1A 2BVNA 2QE7D 3PUXA 4B3FX 4PAMA 2BBWA 2YJTD 2E87A 4B47A 4B32A 4LBVA 4M9XA 5HTKA 1NVXQ 3HU2A 1EFHA 3CF6R 3Q8XB 3DOEA 3QPVA 2V54A 2ZSDA 1MRSA 4W5JA 2WPDA 3T1QA 2WSSA 1QZXA 1P9RA 4JLPA 3FMPB 3NH6A 3LX8A 2FV8A 4A4DA 1P3JA 1Z5ZA 3VX4A 2QE7A 3GLGB 3F8TA 3UANA 4JVNA 3QG5A 5C1BA 2F6RA 1E96A 1UBCA 1E9RA 1Z06A 3IUYA 3U7HB 4B2IA 4P4UA 3KJIA 1NY6A 1G3RA 4IDNA 3MD0A 2KBEA 4WOPA 3SJBA 1ZCBA 1JR3A 1HT1E 3CUEF 2WICA 4US1R 1GM5A 3AF1A 1TQ6A 3Q7QA 1IY1A 2GK7A 1YR8A 2G0TA 2ZAOA 121PA 2ZAMA 2AKAB 3DM5A 4G3XA 2WMOB 4DIEA 1S3SA 2ATVA 5LD2C 3AVOA 2DFTA 4JL8A 1OFIA 4IVRA 3TE6A 1E3MA 1QHYA 4MYHA 4V0ME 3EX7C 2LCFA 3EAQA 2LWIA 4OL0A 1IY0A 2D3WA 4KFTA 1OHHA 2FG5A 3NC1C 1I4LD 5IK2D 3N70A 2YOFA 1P5ZB 4QM7A 4NPHA 3K9HA 1XTRA 5DNYB 3BAFA 1CBUA 3OIVA 1KHTA 4RZXA 5FOSA 3K09C 3X1DA 1N0VC 1DAIA 4Q9LA 2QMUA 4A2QA 4C0AC 2MMCA 1COWA 3RS0A 4EPWA 1UKZA 3W3ZB 4DDWA 1L2TA 4OHVA 1PLLA 1XTKA 3NHAA 1E9CA 2QN6A 3U2QA 1E2MA 1TU4A 3WXMA 4URYR 2PMDA 3FKQA 3P32A 3B78A 3GJ4A 4DUGA 4B43A 4TL6A 4HAVA 2AHOA 1GKYA 4KFUA 2GJ8A 2HDNB 5C4GB 1L7VC 2W6JD 2DB3A 3MAAC 3TQCA 2A5YB 1JR3D 1KGDA 4HZUA 2W0SA 1Q12A 3UG7A 2IX3A 3O8RA 3MGCA 4IJMA 1KJYA 1ZC4A 2FE4A 5AJZA 4JS0A 3NKVA 3MWKA 2AD1A 2G77B 2PEYA 2QAGB 1IN7A 4ZO4A 4PC7A 3LO5A 5TMPA 1GL7A 3LNCA 1NLFA 3F5FA 5JMTA 4UNPA 1M7GA 2IYTA 4F4IA 4M8NE 4B48A 2ORVA 4DLSA 4TL8A 2IL1A 1P73A 2Z6VA 4QJ5A 1KZ7B 4O2RA 1XMVA 2QORA 4C0KA 5K8TA 3LBHA 5FL7D 1JQJC 4LBYA 2YYZA 3LXXA 3NBXX 4NCHA 2X2FA 2ZETA 4I99A 4HB0A 4GOJA 1FFHA 2J45A 2WV9A 3LH5A 1CR4A 1VPLA 2IHYA 5FFMA 5L3SB 3KQHA 1EX6A 1R8SA 1Z8FA 2P0EA 3KKNA 4ON9A 3AVTA 3SOPA 4FCVA 2WOOA 4Q9HA 2OLKA 1UAAA 4TLDA 1UDXA 2V9PA 5ANRB 4M1WA 5CDFE 1IN6A 4A8JC 4ARZA 2P3SA 4WZAE 4PX9A 1JB1A 1E1QD 4B33A 2ZE8A 4FMCB 1KKMA 1L8QA 1K5DA 2IA5A 1T6NA 2PMKA 5JHHB 3B9QA 4GP7A 2C5LA 2V6IA 2YC4C 1OHHD 5AUNB 4G01B 5J4YA 1FX0B 2BDTA 2PJRA 2OZEA 3THOA 3NWJA 1OXTA 3RS5A 5DH9A 1G4AE 4LRWA 2DBYA 3CIOA 2GAAA 2IYRA 3LBIA 4RD6A 4LHYA 1N6IA 2R44A 3N2EA 4UXHA 5FOWA 1CR0A 3A1TA 2C8VA 2WAYA 1O87A 3I92A 3VAAA 1E2GA 4D0LB 1J90A 1FQJA 4Z51A 2OT3B 3A6PC 2Q3MA 4NCNA 3GEHA 4BFVA 5B30A 4A92A 1UJ2A 1BS1A 3EASA 3KDSE 4I1UA 2J0QA 1UEJA 3OEHD 2NG1A 4JSTA 4CEHB 2Z43A 2H1LA 4GZLA 4LV6A 3WHLA 1M7HA 1XNJA 1Q21A 1SQ5A 4K46A 1D6JA 4CDGA 4ZDJA 2BMFA 4HAXA 2NZ8A 3I8SA 3ZS8A 2VYFA 2NO1A 1HH4A 4Q4AB 4HYYA 1MR3F 3HJNA 2RHMA 2G6BA 4XVUA 1IN4A 5KHOC 4PHHA 5C4MA 3FB4A 3AM1A 5FL3A 2KSQA 4DLYA 4LHVA 3NDBB 3D7MA 2AR7A 1RRGA 5KPDA 5GJBA 3J81k 1YZUA 3T1OA 2KI5A 1GL6A 821PA 1EFCA 3CNLA 1D2EA 5A0FA 1OH7A 421PA 5SZKB 4CRWB 5DI3B 3QKUA 2OHFA 1HE1C 1XEXA 1J70A 1S4QA 3W8NA 2B6HA 2ASEA 1A82A 2RKOA 3A4NA 2H92A 1W7AA 5JJKA 3KTAA 4V0MA 4QXAA 4JBXA 2GXUA 2PT5A 4QGFA 1KKLA 4IDHA 4MGYR 3A36A 5BW8A 3AB3A 4EQ6A 4OBEA 2ZYVX 2K5UA 3QNUA 2ORWA 4FIDA 1XPRA 5H1YA 1OYYA 2JLWA 3X2SA 3DMDA 4KU4A 4KSBA 4IHQA 3BGWA 2ZRMA 2VBCA 2V7QD 2QGNA 1P2SA 3GLFB 1RKBA 3WHKA 2ZI4A 2XZOA 4XSHA 3SHWA 4TTRA 1FMLA 3KXIA 3LW7A 3PEUA 4QG7A 3QBTA 5IF9A 2OCYC 5SZHB 2QA5A 3ZJYA 3A4LA 3CRQA 2IXEA 1C9KA 1LB1B 3DOFA 1N5KA 2B7BA 3TW8B 5CK4A 1N6KA 4DLVA 2EFDB 1BYUA 1E2EA 3Q9LA 4R2IA 4F93B 5HR5A 3NEYA 1A5TA 1UBEA 2JIZD 1T5LA 1CLUA 4Q4LA 4DLRA 1S3GA 4GDFA 3SFZA 3CB4A 4BFTA 4CYMA 2AWNA 2P5SA 2HT6A 1M1YE 5E7JA 1RVDA 1FX0A 1PV4A 3QVVA 2REBA 3NVAA 2WJJA 4DSOA 2VF8A 3FHOA 5L3VA 1TEVA 3IGFA 3QQ5A 2ZYWX 3LFUA 1UDWA 1FUKA 4PANA 5AJYA 5EUMA 1N25A 5SZIA 3RLFA 1GAJA 3C8UA 1G18A 4DRZA 4YDHB 3SQXA 2WMNB 1KO4A 2XSZA 1XXHE 2O8EB 4KLNA 2GJKA 3C41J 2JLZA 3GLIA 3QG1A 4Q7JB 4EPTA 4MKFA 1YKSA 4X8OA 2GEDA 4TQUS 4A36A 1SHZA 4PC2A 5L3SA 4QNMA 5DLQC 1GOTA 5B58C 2X2EA 1VCOA 5FPHA 5H68A 3TQFA 3EPHA 5JLJA 4IXMA 1G1MA 4IVPA 4TMKA 1D8TA 4LJ5A 2G3YA 2W2XA 2G83A 1Z0JA 2WJHA 4LJ6A 1GKUB 4ERNA 1RC8A 2CE2X 4ZCLA 5LDDC 2O8DB 5JWRA 4MGKR 1NJFA 3U3OA 2ZS8A 1UBFA 4HZIA 2JLYA 2YKGA 1FTSA 1SXJD 1I2DA 3IHLA 1ZM7A 2RCNA 2PX3A 3LQQA 2J59A 3PCRB 4IFBA 1CJVC 1CS4C 1O3YA 1Q57A 2X8AA 2XOKD 4C7OA 1CJMA 5D3MA 5CIQA 3AV0B 4NH0A 1P72A 1NRJB 4PC6A 3P4XA 5KDOA 4ESVA 5FI0B 2Z4SA 1XD2B 1IJFA 1IN5A 3D6TB 4QC2A 3AUYA 2J0SA 1IJEA 2CL7X 3W6NA 4YMTA 1MO5A 2C9CA 4KFRA 2FSIA 3QF7A 2RMKA 3PEYA 1G7RA 1OFUX 4QGAA 1EFUA 3OEEA 2AFIE 3KKMA 3QF4A 1LY1A 1WP9A 1KDPA 3TKLA 1DAEA 2OXCA 4OQXA 5FUWA 3T12A 5G40A 1KJZA 4JIMA 2NO7A 4ESHA 1QHXA 1MRNA 1G6HA 4LPSA 4QKQA 4LUCA 1NIJA 2ZJ5A 3GEIA 1FQKA 4MGIR 1IM2A 1JPNA 3PFIA 4C0LA 4A2PA 3K70C 4PFSA 5FR1A 3R9IA 2AWOA 4JLMA 2AFHE 4CEIB 2FZLA 1PUIA 4L15A 4BFYA 3N2IA 3EIHA 3U6BA 1Z2CA 4LCBA 1IONA 1P2TA 1WB9A 2VL7A 1QHHA 4NCKA 3L0PA 4XVRA 3VHLB 4BECA 1B0UA 2YOGA 4P4SA 1E9EA 2OEPA 5CYOA 4M9QA 1VG9B 1GSIA 3SYKA 2FH5B 1RW4A 1E0JA 2YWHA 2V3CC 2O8CA 4B35A 3U60B 5IK2A 5HPYB 4OYHA 1WDTA 3BE4A 1AS2A 1FTNA 3V00A 5KNBA 2VP4A 1RE0A 2GTPA 2ECKA 1W36D 221PA 1F2UB 4KCGA 2W83A 3LLUA 5E4FA 3UWOA 1RRPA 1Q1QA 3K1JA 4KODA 2X19A 4RSGA 5TDHA 3RS2A 1YRBA 4FMCF 4D81A 1N0WA 3UXMA 3TMKA 5JI3E 3ZVLA 3THYA 4UXIA 5CITA 1Z0KA 2GVDC 4AYWA 2JJ2D 1WXQA 4AWXA 3OE7D 1Z28A 4LK2A 3KB1A 3W5IA 2QBYB 4PHTA 1W4BA 5FOTA 2QQ0A 3PVSA 4L5BA 2NMVA 2P67A 3TH5A 1KI4A 4IW3B 1E9AA 4PHGA 4BASA 4AC9A 1X8KA 2JLUA 4DB2A 5D3QA 1AKEA 4A8JB 4IOKA 4TWZA 1HTWA 4WXPA 2FPMA 4HLQB 5EE5B 5FUXA 1EFRA 3V4RA 1SXJB 2GNOA 2WM9B 1II9A 2Z4RA 2GVZC 5J4HA 1F6BA 1N3BA 1HT2E 3LXRA 3ZD7A 2O8DA 4YQFA 3JVUA 4TLAA 1YZLA 1W46A 2FSFA 2EYQA 2HV8A 2VP9A 3WNCA 1YHNA 1CF4A 4EKDA 5JWOA 1XXHA 2DY1A 4WAUA 2H7VA 4O0MA 5BN4A 2ZTSA 2WSSD 2OBNA 4JKYA 5CJPA 1IY2A 1ZCAA 1G8PA 2OV2A 3SEAA 1ZIPA 1IQPA 4LJ4A 4C0BA 1KI9A 2O8CB 2V8OA 1YU9A 4BEJA 4LYAA 3THWB 4Q01A 1YZKA 4MKIA 2WZQA 4P33A 3KX2A 3QVUA 521PA 1IHUA 2CLDX 3TSZA 2AK2A 2QENA 4BFUA 3EZFA 3U4QA 5FBLB 3CR7A 2A3RA 3M0EA 4LSGA 4MITA 4WVFA 1JECA 3PEWA 2QNRA 2C77A 2KJQA 3F3YA 3SN6A 5EXPA 1SVLA 2IYSA 1KTVA 4EFNA 3W6OA 2ZQ5A 1JAHA 4HDCA 1M7BA 1DOAA 4LJ8A 2BV3A 5G53C 5AK0A 3T34A 5KNCA 3MUFA 3BH7A 2PLFA 2OFOA 2CE7A 2ZJAA 2C9YA 2GILA 3KFVA 4TSFD 3AKYA 4TT3A 3ZZUA 1Z0AA 3ADDA 1GTVA 4BLQA 3K53A 3QBVA 1SKYB 1G20E 1CU1A 4UJ3A 1SZPA 1UKVY 3NDPA 3GLIE 3CKLA 3C14C 4UQOA 2OSBA 1Z08A 2QP4A 1M8PA 1G5RA 1Z6TA 5C18A 1OXUA 2ZRFA 5FPTA 4LY6A 3OAAA 4TYNA 4CGZA 2D7DA 4I4LA 1A2BA 4Q4AA 2FPKA 2WAXA 1VKJA 1E98A 1H8EA 1P7CA 3VR2A 3KB2A 1EFTA 2R6FA 1HQYE 3CONA 3DMNA 3P1JA 1OT3A 3VU9A 1G17A 1XJ0A 4DT1A 3JZAA 2QROA 3QPUA 4FMBB 5DN6D 1G16A 3M6AA 1MH1A 4ZDIA 4C0SA 4FN5A 1WRBA 2WWFA 2YZ2A 3BH6A 1J99A 4KBGA 2VHCA 1VDZA 3LV8A 1XTSA 1FPMA 4G0NA 3MWYW 1QHHB 5D3MB 5J4LA 4L16A 4C30A 3A1UA 1H8ED 4DUGD 1XD8A 2ZJOA 3IQWA 5E3HA 3L0SA 4MA4A 2HYIC 4KO8A 4KITB 2O5VA 4DLWA 1GFIA 1TUEA 3U3JA 1SXJC 4M9ZA 1NLZA 2ZVQX 3EZ9A 2QMOA 1R4AA 1W49A 2ZUBA 1NKTA 3NIBA 5HKKA 3KZ1E 2D2FA 3M4YA 2ODBA 3FE2A 1BKDR 5BYKA 5DIFA 1NJGA 4AG6A 4BFXA 3ZZTA 4ACBA 1TF5A 1XJQA 2CHVA 3IBYA 1LF5A 5TVKA 2X77A 1PZNA 2HXSA 1IXRC 4OJKA 3TR0A 3CPJB 4YONB 4PO8A 4PZLA 1DAHA 4RD1A 3TJZA 2H8KA 5BN5A 3K9NA 1HYQA 1GKIA 2FPLA 2WWHA 3IKJA 1ZU4A 1DPFA 5F2EA 1E9FA 3ECCA 1G291 1X86B 4JT4A 3HYTA 3EIQA 4U5XA 3K70D 2JLVA 3IIKA 4AD8A 3TW4A 3KQNA 2BEKA 5CK5A 1WE2A 2A78A 4L4UA 4KYUA 4LYJA 5EXSA 4S35A 4N3NA 1RJ9A 1JR3E 4BZPA 1B23P 1G41A 4OI2A 4MDEA 1KI3A 3SE0A 4OJQA 4RFVA 1YZQA 3IBGA 3RHFA 1NN0A 2Q9BA 4JL5A 4M53A 4RFSA 3PUZA 3JZMA 1PLKA 2HYDA 1ZIOA 3FFBA 2ZSAA 2HEIA 3FDIA 4D4KA 2JASA 3QXSA 2ERXA 4GPTA 3CPEA 3AKDA 3KTAB 4FW9A 2ZUCA 1KIMA 4B6FA 2R6DA 3ETLA 1Y63A 4PSVA 4NCIA 5FPSA 2GXQA 5EP3A 5BXQC 2WVJA 1NMYA 1G3QA 2AL7A 2CLCX 4JYBA 3QXCA 5JS7A 2A7QA 4IDOA 2REXB 1TEXA 2F9MA 2OE2A 1DBSA 4LBWA 4YC7A 3ZQJA 3EPLA 1NBMA 1NBMD 3REGA 4TTQA 4D6PA 1Q3TA 1ZUHA 4M4SA 5E7MA 1DARA 4B74A 1EESA 1MV5A 1WBDA 1Z0DA 3EZ6A 4LDJA 1I4DD 4EJSA 1RZ3A 1PUJA 3DZDA 2XITA 4RD2A 1HA3A 1LS1A 2G1JA 4PAOA 1H65A 2GDJA 4URUR 1N6HA 4DIDA 1BOFA 3ZS9A 4M9SA 1OPXA 1P6XA 1XWIA 3PUYA 4HDQB 4EDHA 4ZI2A 3MFYA 1X8LA 1KAOA 3WYAA 1U0JA 3QE0A 5A5GA 1W47A 3RRYA 3SQWA 1RJ9B 2HF8A 2J46A 2IS4A 3FPAA 1QBKC 4Q7KA 2Q0HA 4PPGA 4BLOA 2ZPTX 4O2LA 3R7WA 1R0WA 4QHTA 4H1VA 3L8YA 1KI7A 5J4KA 4JBWA 2OXRA 3E70C 1T3HA 4PQYA 2MSEB 3U3MA 2UZ3A 3U44A 1R5OA 1ODFA 1JR6A 2QTHA 4CEHA 4A0HA 2Z0MA 4EFLA 1OH5A 4II7A 4R2HA 2J9RA 3KL4A 2VP0A 2QSYA 1AS3A 3REFA 3T1VA 4G1UC 1OB2A 4JMPA 2OAQ1 2QSZA 4HZUB 3N5CA 5HE8A 2EWWA 3SJZA 1KO7A 4XVQA 1P2VA 2MSDB 5HE9A 1OKKD 2WSMA 2ZI6A 4MRNA 4V0NA 5JFGA 4JL6A 5FTJA 2CVHA 5FI1B 2HCBA 4JVMA 4UJ5A 2C78A 5FL7A 1HV8A 3VR1A 4KYIB 1JBKA 3PQCA 2ZRNA 4F92B 4FD2A 4OK3A 4Y0AA 5DGXA 4HEJA 2R6AA 1T3LA 3AKEA 5JRZA 5TARA 2H57A 3BFXA 1BYIA 1U8YA 4OQFA 1Q1ZA 3O8BA 1EWQA 4MRVA 621PA 3K0AB 4D4JA 1GVNB 2FEMA 3VR4A 4Q4JB 4HAUA 4HUQB 4DJTA 4DT1B 3CWZA 1LS6A 2VSFA 3CX7A 1RYFA 5G41A 3SDZA 1NSTA 3ZH9B 5J5CA 2DWPA 4D4MA 1YR7A 5BYJA 1NSFA 1NP6A 1YVDA 4ZPXA 4C0HA 3K70B 2VIIA 2W58A 4KAXA 4GMXA 2ZS9A 2XTZA 1XCPA 3DVLA 4OK5A 2E9SA 4A2WA 4DHEA 2QRZA 4LOAA 3ZIAA 4BGDA 2XAUA 3NTUA 4BLSA 4D80A 2CL0X 2JLQA 4W7SA 4A8JA 3LVQE 2AXNA 5KPJA 3EXAA 3VNUA 1E0KA 1TQ4A 2QTFA 4PZZA 4K81B 2B7CA 1TF2A 4AK9A 4LHWA 3U7GA 4QHYA 2ZS7A 1H8HA 3K9LA 1R6BX 1AA9A 4B3BA 3WYFA 2BJWA 2QY9A 4E5UA 2O8FB 2IXGA 3BK7A 3MWJA 4D0NA 1EG7A 2W2TA 4M1MA 4JT2A 3H84A 3MMPA 3ND8A 4OHWA 4F38A 2QG6A 5JS8A 3W34A 1QHNA 5KNDA 4W9MC 4KVGA 1IOZA 4CT5A 4HAZA 5H8WA 4TYPA 4OK6A 3KQUA 1T8TA 3EZ7A 1T0JB 2O0KA 3SI7A 3HR7A 2QM7A 1R10A 1WQ1R 2GCOB 3LA6A 4ITRC 4Q5IA 1QG4A 2GZDA 4MH0R 3WP1B 2O8BB 1NMXA 1Z22A 2RH5A 2QT0A 1VHTA 1GRNA 2G1KA 2P2LA 3C15C 4QGGA 5AWFC 1DS6A 3CW2A 3QUSA 1JQLB 1YJ5A 1Z6AA 4Q19A 3DM9B 1ETUA 1AZTA 2HF9A 2IYQA 5GVSA 2QU8A 2ZJBA 4WIAA 4BLRA 1C4OA 3AVQA 2CHQA 2EYUA 4Q03A 1P75A 2ZRLA 2GJ9A 1E99A 4LC1A 1S2MA 1U9IA 2WJIA 2NPFA 2FEOA 4WZ6A 4GOKA 2A9KA 3B2EA 1U94A 1UPTA 1GDDA 3GLGA 2DFKB 3IPYA 2ZIAA 3LY5A 2QMHA 5F98A 5EXTA 2D2EA 3R8CA 3SZRA 5JJIA 4JLVA 2OCPA 2BJVA 3I32A 4GRAA 4WZBE 4I81A 1W44A 4LZZA 1VCNA 1XD2A 2VRWA 3L8ZA 3QEJA 4PTLA 5CLLA 4A1FA 1WCV1 1XCMA 2PZEA 3THXB 3H0KA 3ZLJA 4XWKA 3ZVNA 3BB4A 3THWA 1DTSA 2CDNA 3HPRA 1T4GA 4C7OB 3CH4B 1T5IA 1FZQA 1R0ZA 2WBLC 1YZGA 3KKOA 1G7TA 4MDFA 4YXWD 4PC3A 2IEZA 3AGQA 1NN1A 2OCBA 1R8QA 3UK6A 1G5TA 2JCSA 1HURA 1UKEA 4PAQA 2ZRCA 4Q1EA 3TSWA 4ZDWA 2C9OA 3LDAA 1GIAA 2OESA 1P4SA 2AKYA 1S1CA 1D5CA 3UMFA 3DEFA 2GEVA 4RZ2A 1UEIA 5DHFA 5F3WB 3K0SA 1E9BA 2AX4A 1N6NA 1SVOA 1F48A 3ADCA 1KY3A 3LBNA 4JLJA 1LFDB 3T61A 1OV4A 1II8A 2IXFA 4QNRA 4DCSA 4FWTA 1XZQA 1QHSA 2YWGA 3T15A 1OIWA 4KVAA 3RAPR 1SXJA 1X3SA 3LWNA 2W6ID 1XEWY 4V0LA 3ZVMA 1N6RA 3GD7A 2Z83A 3CX6A 1OJLA 1JI0A 5FPKA 1OSNA 1W0KD 4Z8XA 4XWOA 5C46F 5K8UA 3GCGA 2A2ZA 2CXXA 3T06B 1XDBA 4AKEA 2C98A 3TGPA 3EPKA 3PJRA 3AVPA 3QENA 3K0CA 2FWRA 3PUVA 5DYGA 2BKEA 3F0TA 4UXJA 2JGNA 1US8A 1U98A 3RSOA 2QT1A 2ODNA 4MKHA 1XFAA 3B5JA 2Q3HA 4LGMA 1PJRA 4PPNA 3DL0A 1H8HD 1KMQA 4QBGB 4WXRA 8OHMA 3GLHB 2NOAA 3K0AA 1ZBDA 4NMMA 4ZI3A 2OM2A 4XOIA 3C16C 1N0UA 5EXXA 3SC3A 2KB0A 4PPQA 1K8RA 2GCNA 2OG2A 2I1VB 2BBTA 1YZNA 2ONKA 2FU5C 5L3QA 2VH5R 4RZ3A 4DSUA 4CEIA 4MYCA 3ZDQA 2UKDA 1E2KA 1MABA 3LRPA 3ZZ0A 1AIPA 1Q44A 4EAQA 4MKGA 3ZQ6A 3CRW1 4IVQA 5EQTA 4Q1FA 2ZXUA 3CO5A 1S96A 4TSFA 1QG2A 2GCOA 4EPYA 3OIWA 2OO7A 1WMSA 4KI0A 5FTLA 3BORA 4LJAA 2FA9A 4TMTA 2ZYTX 3WNDA 4M0LA 3PV0A 4BLTA 3ADKA 1AZSC 4US0R 5SZJA 1GUAA 4RD4A 5DO9A 4A0RA 1GG2A 3W90A 4YDSA 4AYXA 4B2PA 3EC2A 1W0JD 3VMFA 4ABYA 4GFDA 2F1HA 4POAA 2PL3A 2GCPA 2GF0A 2GRJA 4NYMR 1OFHA 2ZROA 4N0EA 1Z3IX 1KMHB 4AI6A 4V02A 4Q48A 5TY0A 4NE2A 4P4TA 2VTKA 3HR8A 5LB4A 3GJ6A 1E4VA 2R65A 3Q72A 2QBYA 5JRJA 2YWEA 2B92A 1U8AA 3GJ3A 4JYCA 2V1UA 3GLGE 4AKIA 2BMJA 3GJ5A 1KK3A 2IC5A 4RVCA 4UNNA 3X1YA 1QHIA 5GADl 1E0AA 3RVBA 3PR1A 3TUIC 2J87A 4E07A 2V6JA 3GJ8A 1MO6A 3PEVA 3SBDA 4DB4A 1S9HA 2FNAA 5JSZB 2XTNA 3TIFA 1Q22A 4P32A 2XEXA 4HLDA 4B3CA 1AQYA 4DLTA 4HDOB 1NLYA 2PJZA 4PQFA 4LYFA 1Z6XA 1NVVQ 2BBSA 2GJAA 3T5GA 3U6KA 3B60A 2QTVB 2PZFA 2CHGA 3JVVA 4QOSA 5JJLA 1FMJA 4KJZA 2O8FA 1E1RD 2GZAA 4Q00A 2YC2C 2XXAA 4MGZR 2J0UA 2ZI9A 3IPXA 2F7SA 1ZNWA 1XTIA 1G3IA 3QKRA 3GFTA 1G8FA 1TMKA 4P0TA 3T1TA 3OFNA 3K0FA 4V0KA 1S8FA 2BMDA 2P6UA 4PZYA 1E94E 2R9VA 1YE8A 5KTYA 1KI6A 4JLDA 5AUQA 1G19A 4I1SA 3AVXA 3AVVA 3TLXA 2CK3D 3LLMA 1M34E 4Q4JA 2WWXA 1DO0A 3SHFA 3BERA 2Q6TA 4URVR 1ZMXA 3TK1A 3B1WA 1SKYE 2VHJA 2F43B 2DCUA 5JWHA 3IO5A 3GLIB 1EX7A 1E4YA 3KFXA 4JLAA 2FZ4A 1R0XA 5UKDA 4NYIQ 3VR5A 1E2HA 1LV7A 5FPYA 3UPUA 1E79D 3H1TA 1W0KA 1XEFA 5TB5A 4TMWA 2QEQA 3DKVA 4MRRA 3SBEA 4IOLA 4D4LA 2WIAA 2IS6A 2RHDA 3BWDD 1BMFD 3I1FA 4UKDA 4UNSA 5L3RA 3DO6A 1ZM2A 3KUDA 2OFXA 3EWAA 3BFKA 2R6CA 3SJAA 1DAGA 1U9IC 3TNFA 2Q3FA 4WBSA 4IRUB 1XMSA 1Z63A 1OH8A 4X8MA 2B8TA 2IF0A 1G8YA 4URXR 4I1VA 4B6EA 3W8RA 4LV8B 1A7JA 2QPAA 3U3RA 2HXYA 2BC9A 4Q18A 1NBME 1F2TA 6Q21A 5L8VA 2P6RA 3CF0A 3QOFA 1ZD1A 2ANBA 3WBJA 3FWYA 1KSFX 1CRQA 2ZRBA 5JHGB 1F2TB 3Q85A 5DI3A 2ZI3A 4ACAA 3WRYC 5E7IA 4OQLA 2RGNC 4L9WA 4O25A 4G5OA 4B44A 5HZKA 2RGGA 2ORIA 2OILA 4TLEA 3ZGXA 2ZRDA 4GSYA 4BZQA 1OW3B 2UZIR 2LKDA 2N1BA 3AF2A 4Z1MA 3LVRE 4TL7A 2ZYUX 1UBGA 5IDVA 4US2R 3X1WA 4OI0A 1G3UA 5JEEA 3B8HA 1OE0A 5KSYA 1ONBA 3CRRA 1SVMA 4O3MA 3CM0A 3AUXA 2ODEA 4RKFA 1G8GA 3MJRA 3FMOB 5BWMA 3WBKA 4ARZB 1VYUA 3KQKA 4Q47A 3G0HA 4ASUA 4F4CA 2GXAA 1PLJA 4D25A 2W2VA 2EQBA 3KXKA 4LC0A 3T35A 1MKYA 2CMKA 3EA5A 2O0JA 1GP2A 3QIAA 1L4YA 3ZYCA 3K9GA 1X8JA 1XZPA 1YZTA 4DSTA 2XOKA 5C2JB 3A1VA 4J0QA 1VYVA 2IYWA 3TRFA 3NHBA 3B6EA 3P4YA 5K8IA 3IIJA 4L9SA 4LJ9A 2YINC 3SYLA 1BH2A 2EWVA 2PEZA 5B64A 1MOZA 3IEUA 5AJVB 1Z29A 3AP1A 4KXFB 1G7CA 1GWNA 1ZM3A 1SGWA 2EFGA 2FF7A 3K0FB 2C95A 4JVLA 3L0OA 1D9ZA 5GJWC 1JPJA 5BQ5A 2I3BA 3HU1A 2IF2A 4LBZA 3WNBA 3MCAA 1OIXA 1JXOA 1BMFA 2YV5A 2RAPA 1Z0FA 3FMIA 2C2HA 1ZP6A 1TQDA 3TAHA 3NC0C 1T8UA 2J1LA 3O8CA 1KO1A 2BWJA 2J5XA 5K8LA 3H4MA 1G21E 2R2AA 3BD9A 3RDPA 1K5GA 1VCIA 5KSPA 1NNEA 2ZVPX 1A2KC 4HATA 1X1RA 2J7KA 3B7GA 2QI9C 2ZRIA 2O0HA 3AF4A 1COWD 1P2UA 1W2HA 4EIWA 3A1SA 4FMDB 1CIPA 5EE9A 4B71A 3NG1A 4DC9A 5CYPA 4DEXA 2V7QA 3VFDA 3HPQA 4YXWA 2FN4A 1RRCA 2IUTA 3B1XA 2F55A 3LW8A 5HZHA 2VSXA 4EJSC 2IYYA 1JEEA 1E2LA 1NF3A 3C5CA 1YR6A 1ZJ6A 2WKQA 3BB1A 4CW7A 4HI0E 1HQCA 2ZSEA 2ZJ8A 4LHZA 2JEOA 1UADA 4Z8YA 2FDCA 1G9XA 2IYUA 2VHTA 1IN8A 4PQRA 4QL3A 2XXAB 3HDTA 5CB8A 1OYWA 2JJ2A 2IS1A 2GF9A 3L43A 4QJ3A 5JI2E 2FFQA 2W0MA 5AUPB 3G5UA 2ZRGA 3MWLA 1P61B 2AN9A 1KNQA 4MRSA 4E03A 1GZSA 1ZAKA 1Z83A 2FFAA 1AS0A 1YRAA 4RJLA 3RNLA 2V1XA 1WA5A 3EC1A 3PENA 4R98A 4TYWA 2GHIA 3UG6A 1SKQA 1R7RA 1CKEA 4XH9B 1WF3A 1DG3A 4JVSB 3RRMA 4EPVA 2VO1A 2J0UB 4FCTA 3O47A 5JCZA 4NP6A 2CNWA 3SNHA 1W36B 4W5HA 2GWHA 3NH9A 5JBQA 1XBTA 3B85A 4HLCA 1ZNYA 1Z0IA 2BEJA 2KE5A 2P5TB 5EZ5A 1KSGA 3AVWA 4BZXA 1U0HC 3ZD6A 2XX3A 2B21A 3FYHA 4DCVA 2QP3A 3Q5EA 4NYJR 1CR2A 1AM4D 3UWKA 3ICQB 3MSXA 3PG5A 4JBYA 3VNVA 4Q9IA 3NBZC 2IYLD 2RGEA 3B1ZA 4XWAA 1J8MF 4JJZA 5FR2A 3IIMA 1XP8A 3U4QB 1KAGA 2XNDA 3D31A 1EFRD 1NI3A 2NTYC 3L82B 4U00A 5F9FA 1M2OB 3BB3A 3AP2A 2NO0A 5TV2A 4NL4H 4AKHA 3FKSD 2A5FA 2A5JA 3CNNA 4NTZA 4HAWA 1W4CA 2IWRA 5TXGA 4DSNA 1E9DA 3GMTA 2IS2A 4ZIRA 1KI8A 2Y8EA 3PUWA 4RD0A 4TT3D 3AVYA 4PPFA 4G5RA 2VHQA 3I4LA 3C5HA 3OE7A 4QBIA 4YMUA 2JAQA 1E1QA 5DHAA 1VG1A 3FOZA 2QQEA 4XTRA 1CTQA 2BBOA 4NZYA 4M21A 4DLXA 3AQ4A 2BCJQ 3KJEA 4LPKA 4W5WA 4X8LA 3SS8A 5IHPA 3H2YA 1YQTA 1ZM4A 2ZRKA 1XRJA 3A4MA 2WWGA 1DG1G 4NYJQ 2ZM5A 1S0UA 3RRNA 1E69A 3WMFA 2JJ1A 2FFBA 1GITA 3CLVA 4URZR 5EE0A 3A37A 5KU1A 2JA1A 4KFSA 3BBPA 3UIEA
chains in the Genus database with same CATH superfamily
3BMXA 3DE6X 4IQFA 4GYWA 4J4HA 3ZV3A 5I51A 3R9XA 1UT6A 5ALQA 3PHJA 1MC1A 1KMHA 4G1FA 4G26A 4IOJA 2UUAB 3GP8A 1Z07A 3RSFA 1T35A 2RGNA 2VAPA 5EP1A 1QWSA 2CLSA 1RQGA 2WWWA 1CP2A 1B7GO 4MA0A 2Z2ZA 3GFVA 1E63A 2QXUA 3DR3A 3N0RA 1T91A 2TYSB 5LZ2A 3FCOA 3QSGA 5CJ2A 4HPWA 1F8XA 4ZP1A 4B75A 3QJYA 5AMXA 2XMZA 1XK6A 1RIFA 5FYQA 5CDHA 4MQBA 1V43A 2PL9A 3GRZA 4M76B 2GFHA 1ULUA 3EY9A 1VBKA 1O89A 2WJ3A 3BK2A 3WIVA 4Z9AA 4XJXA 1OFTA 1CT9A 2EFCB 2ZFUA 4HNGA 4JJGA 5EKUA 4F6CA 2O3JA 3BA1A 3D3NA 4GRIA 4Q66C 4BU0A 4S12A 6ABPA 2C2OA 2BM9A 2GPAA 3U3KA 3CCFA 2J4CA 1CY6A 3TD6A 3TPZA 2N42A 4ZJZA 5F1YA 1MABB 5F12A 4FJ0A 1SC1A 3HBMA 3KE8A 4DQVA 3CH6A 1D2CA 2BMVA 4YP1A 5AR1A 3AUSA 4Y6OA 1RFGE 1OLOA 2CCGA 5EEGA 4N3GA 3H86A 2LKCA 2UU9B 2WNHA 3EFBA 2ALJA 1FOEB 3HWWA 3OOYA 5HFJA 1RRFA 5GJCA 1TZMA 5JEDA 2O59A 1EVKA 1DJQA 3HKDA 4D43A 3BCSA 3UKDA 4BC0A 3FPFA 4BNFA 2QRNA 1C7ZA 1WB4A 4UFNA 1N5DA 1MO3A 5CEJA 1UQRA 2WFMA 5I8ZA 3H5IA 4XJSA 4NJEB 2QVGA 4JYAB 2Q1WA 4FDAA 4X95A 2W7TA 4BNTA 2C04A 1UP6A 1HT3A 1EZZA 2BGNA 3EMKA 3MWDB 2IYPA 1GPYA 4BZZA 2R25B 3ZI0A 2DFDA 2WIJA 4FK8A 4P6VF 1T25A 4LTNA 3GOHA 3KT8A 4WA8A 3OBIA 4BNLA 1HK7A 5ECDA 5LMZA 2GKSA 4I55F 3R9WA 3LYHA 1AO0A 3EOAI 2CVFA 4P3XA 2QUZA 3ZXIA 2XSZD 3IV7A 4BGIA 2AYXA 5ELXA 1VCMA 4XW2A 4P4SB 3UAOA 3I42A 5KREA 2VWQA 3RABA 4U7JA 5IJ0B 4M7OA 3FPSA 1R6TA 5I45A 4B31A 1G0OA 2VT6A 3A9TA 2I1LA 4BV3A 3PQFA 1J0BA 3AFNA 3C3CA 3FVQA 1DAOA 1FDOA 3MCTA 2CZQA 4HN4B 2LCQA 4MRAA 3ENQA 3V4VB 3M6UA 1HKUA 2WJWA 1QLWA 2CV1A 1NXOA 4LXYA 1Q7BA 1IUKA 2RHTA 5BR7A 4MJXA 1VIAA 4O2BA 1FZTA 3GRFA 4RCZA 3I61A 4Y2XA 1CRWG 2QAGC 1EUDB 3LQKA 2QLLA 2YIVX 4Q0MA 4RK6A 1CYEA 2L0XA 3EF0A 3O4VA 3X0DA 3CBGA 1RMYA 1SPXA 1K6MA 1N2CA 3ACBA 5DWQA 5B1DA 3BT7A 3N3BC 4BUCA 1AQNA 4ZO6A 4JR1A 4GZMA 3P27A 3AJ8A 1AX9A 2PQ2A 2WQ6A 1W1UA 1IYZA 1P7VA 2IY8A 4CR7A 3TUZC 2BHRA 2WEKA 3L7NA 2EGHA 5J40A 2Q1SA 4DDUA 5KTRA 1IG3A 4PO9A 5KVAA 1SXPA 2XD9A 4ZC1A 2IP1A 3I2FA 3SX4A 2ATXA 3F71A 1G8HA 1RAIA 1PT8A 4KQHA 1XQXA 4BRWA 4V1CA 1R66A 2WWIA 3L6DA 4H08A 3L8DA 3NGMA 1SZDA 1GY8A 2YMQA 4KGZA 3GPCA 1Z34A 2UUOA 3CZCA 1DDOA 1CUUA 1II0A 1PWYE 1W581 3Q7PA 4FYJA 4QUEA 2PH1A 3S29A 3UTDA 5IKEA 5CT8A 1QP0A 3S2EA 1XJCA 4XIGS 2VF2A 1QIHA 3H04A 3NRCA 2DQ4A 5BT8A 1HLPA 1RPZA 3U7RA 5E1BA 2PFKA 1JGTA 4E5MA 1NQTA 1FW8A 5MN6A 3PU6A 3BBLA 3FYUC 3GRKA 5JD4A 1ZYUA 3FOWA 2DC1A 2VDNB 2GZRA 1RLMA 2HCJB 3IHTA 4HGOA 1HZZA 1J0DA 3TLCA 4KREA 4D9HA 1RE1A 2RHCA 4L2IA 1YBHA 2WJ6A 3FNGA 5FTMA 1L7EA 2KPOA 1C7QA 2V5AA 1KMNA 3WY9A 3G2PA 1J7KA 5KSOA 1Y4AE 2VP2A 3U4IA 3HCCA 1SVIA 3ETDA 3HBJA 4RJIA 1FJXA 1TJPB 3IERA 4HQRA 1C0KA 1OLSA 3LP6A 1L5FA 2O6LA 3V8RA 1LW7A 5LDHA 3C6BA 1G7SA 2V7GA 2ZTVA 4MS1A 2XCUA 3Q11A 3IQDB 3VDMA 2Q49A 2C3PA 2RHOA 5T5QA 1SIWA 4Z5XA 5HVNA 1Z8NA 5BQFA 3TBKA 1KZGB 1S8AA 3V4SA 3ZWWA 5KDDA 1JHVA 4R68A 4D9EA 3KCNA 4M0PA 5FKJA 2ZUSA 3EN0A 2XGSA 1SHTX 3ICOA 5AJXA 2WOJA 1P9LA 4IEFB 4IIXA 5K0NA 3WFIA 1U7HA 1ZESA 2ZWMA 3NXSA 3VO1A 1TVKB 4WMLA 4I9GA 1CY2A 2VXBA 3MZ0A 1H2FA 3UH1A 4C14A 1IZ8A 3MJ4A 3PX2A 1CRLA 1R12A 3N8IA 5EJ8A 1RHMA 2CL5A 3DHYA 4ZOLF 1J2TA 4QM6A 2VUUA 1BE6A 3X44A 1C9EA 3PFWO 3IQGX 4W7IA 3ZE2B 4JP3A 2OFWA 2W6QA 4ZI7F 1GTZA 1B0ZA 3GFBA 1X92A 3SFTA 2GD2A 2Y71A 3V8PA 4WW0A 5B3LA 4RJ2A 3ODGA 3WC4A 1P60A 5JMWA 3DLAA 2H7YA 2WJPA 3AOEA 1Z17A 1YKFA 1ADYA 3O0DA 3QLVC 4Q12A 4R51A 3VTKA 4CDNA 3CR8A 3O4GA 3P2EA 2VWPA 5L7YA 3B3QA 1E5VA 3HU3A 2XCIA 3I73A 4PXYA 5AW9A 1JZTA 2WYOA 2UYYA 3F4KA 5KJCA 2JVKA 2G4CA 4HK4A 1LVGA 1AOXA 1SCUB 3RJMA 2GRAA 4V0OA 2Q8NA 4HOYA 3RS9A 3CO0S 4TWIA 4ENRA 1JVBA 2INGX 4OHKA 3NB0A 2HKIA 1FFYA 4TV8B 1K0FA 4UUQA 1M2OA 4J16C 3TVDA 4P7FA 3T5BA 3UCEA 1VMIA 1XKQA 4EA9A 2BM1A 2GUWA 3OOHA 4DJFC 3GLFA 1UXJA 4A0GA 2XIQA 3FF1A 2PAFA 3JD4A 3RHSA 1MAVA 2ZWPA 2QL6A 3IIIA 1KE1A 3SDBA 1H0KA 1SIOA 2AK3A 1N8TA 5EYPA 3NWEA 1UF9A 2FN8A 5C7YA 2OOSA 5KQPA 3Q88A 3P97A 1EP3B 4FU0A 1E3TA 4YAIA 3WLSA 1B8VA 1FX1A 2NZUG 3E5HA 3MILA 4HEA1 5IXJA 4RA9B 2F17A 3Q3HA 4FZJA 2XTMA 4I4TB 3A2KA 2QUBA 2GA8A 3IPLA 4W8HA 5K8VA 5B37A 1L4EA 1QTIA 3NZEA 4NZOA 3R20A 4GR5A 4XEHA 5FIUA 2DR3A 1I6LA 1N2CE 3GFOA 1BDMA 1MO2A 1GAWA 2ZUDA 1V48A 4KXMA 1JUDA 1Y80A 1ORTA 4OGWA 3GLGB 2PIDA 4BKRA 4DW8A 3EVNA 1HLGA 3AF3A 3NT5A 4CCYB 3Q5DA 3BD7A 3H2IA 3F9RA 1LLCA 2C57A 4AO6A 2WB4A 3WMGA 5FEUA 4NOKA 2C9DA 5BW5A 2V59A 1RI2A 3ZLVA 4YACA 4BPBA 4RTKA 1RYHA 3V48A 2ZE5A 2JIZA 4R71A 2BLNA 2I3ZA 4QOIA 1OI3A 4DCCA 1E6WA 1KETA 2ZZKA 2EGGA 4GYYA 1OLSB 3O3NB 4QXQA 2PXHA 5A2QA 1U99A 1E2DA 1ORHA 1KOLA 4OQMA 1FU8A 4YLEA 2DULA 2V9CA 3WGKA 4F06A 4KNYA 1GD1O 3F4LA 5ITWA 3E5RA 1IK6A 1DAMA 3GZNB 5EINA 3R7AA 1Q92A 4EJFA 3PIIA 3QXXA 4CLHA 2PKCA 4DCJA 4OGFA 1JFFB 1GUZA 1Y8QA 3D7LA 4UNRA 4EO9A 2WKPA 4RMHA 4LXIA 2AJ8A 2F1RA 4YRMA 3JZIA 3ZWDA 3P9IA 4NHOA 4G41A 4AZ3A 4TVBA 5EJ7A 1OWMA 5JBNA 4PONA 1CQXA 4DA6A 1TYZA 1Y3BE 2XNDD 2OBFA 4QJ4A 4YH1A 3VHRA 2IT1A 3DMTC 2IP4A 2B8WA 4B3DA 3BCHA 5F4BA 1OGYA 4PFJA 5AM1A 4BMPB 4HSEA 1ZOIA 5KYYA 1L7NA 1R1DA 4HNRA 4NQZA 4OQNA 1KOFA 2D7CA 5E6UA 4N41A 1ZNXA 4OLAA 1GILA 3V55A 3AOEC 2XNHA 3RCBA 1TX4B 4QA9A 4QJBA 3NBYC 4H18A 4MQ5A 1IDOA 2XQFA 2ZR7A 1KZ6A 1JG4A 3E05A 3GJXC 4U9IS 3B6JA 3C5VA 2C2WA 1HDCA 4FI3F 5CVJA 2CBZA 2NU9B 2ICAA 2OCDA 1UXKA 2HSJA 3W9YA 1OB5A 1EUCB 3FCXA 3NXKA 2CL6X 1QRAA 1I01A 3DZCA 1U0LA 4TN1A 1VIVA 4YXFA 1PFVA 1V9CA 2IHBA 1CB7A 1CC1S 3FTQA 4N03A 5AK3A 4B87A 1GR0A 3B82A 5H59A 3UWDA 4CEJA 4TWJA 3AH8A 2NUAB 4XE5A 5IFKA 3G2KA 5LQJA 2WU8A 6PFKA 5IUNC 4OCZA 5TJ9A 4UW9A 1YIAA 4BE7B 4IFEA 2E89A 1I80A 5GONF 3B3FA 5JXWA 2ZRPA 1HM5A 1CDEA 5HK9A 5E95A 1SXGA 4JU8A 3U61B 2Y4OA 1WU8A 1SVKA 2DKNA 3LDUA 1Y8RB 4MR7A 1TAQA 4INZA 3ZHTA 3WMEA 3WYCA 3TD2A 3DLIA 1SELA 4DFDA 2YVKA 3ZHBA 1EVLA 3NTLA 2VSYA 1DADA 3CB2A 4X1YA 2UXDB 2DQSA 2AUNA 1PZXA 1AHPA 2HLDD 2DPXA 4ZMRA 3BIFA 3U09A 1DTEA 4RQBA 1TNDA 3ELWA 1TM3E 1OVGA 3V1NA 1OX6A 3E22B 4UM7A 1U6IA 4BUJA 2G9RA 2HA7A 2D62A 3SR4A 1W34A 2Q9AA 4PYMA 1UPUA 1XX6A 2R8RA 1R8JA 4EG8A 2JHAA 2NU6B 3OSZA 2VHYA 4K2AA 1A96A 3A9RA 5B4VA 1E2UA 4XQ9A 3H17A 1J21A 2BGUA 2GGSA 3AHDA 4RVSA 1ISFA 4PFKA 5DGTA 3BF7A 4M6WB 5GVRA 1A9SA 1IBRA 2B4QA 4NENA 3KWJA 4Y2QA 1V11A 5DGIA 5BY2A 3F8SA 2R6GA 1MNQA 2EDCA 5FB3A 2OXTA 4UMFA 3KNZA 3SFVA 4BVEA 1AV6A 4B8WA 1GKLA 1M1NA 2GK6A 3U4MA 1AQ6A 1Q3KA 1UQUA 3IQIX 3TXAA 2OQIA 4QJIA 2FUNB 2ERYA 4P86A 5EIFA 2Q4EA 1QC5A 1IB0A 2OC4A 3Q12A 3QKTA 3PVZA 4PZPA 2UUBB 4XD7A 2XA9A 1Z4JA 3EF1A 5C7OO 5C51B 1HNXB 4UNQA 2FDXA 1HFJA 3KXPA 2HJ9A 1GNQA 4IZ6A 4IUBS 4AKGA 5F5LA 1CEXA 1WVMA 1XTTA 4LQDA 3UN1A 4A23A 4DGSA 3A6LA 3E5NA 4IIHA 3VYUB 1ZKDA 2FB9A 5JMOA 1MIOB 1SFRA 1NVUQ 4X1IB 4C4AA 1SCIA 1JX6A 4K26A 4CIDA 3C8ZA 2H18A 2KLHA 4PY2A 5FO1A 5ITZA 2HRQA 4TZ6A 1KH2A 5JSYA 4D4GA 4URFA 1YULA 4YAJA 4JGIA 5CB6A 1WOYA 2GYUA 5KQMA 5JSQA 4I66A 3IDZA 1F5NA 1P4RA 1HTTA 1NQVA 1U0FA 1KK2A 1OF1A 1MA3A 3FUWA 3IQHX 4G8DA 4YJ3B 4HS4A 1MG0A 3L2OB 4P38A 4ZXFA 3RYTC 1RI3A 1F0YA 4IR7A 5BRAA 3QEBZ 4MVJH 1W1WA 3AYXB 1T3SA 4A91A 1XRNA 3IO3A 4V0QA 3HC7A 5JCPA 5LQCA 2VP6A 4OY3A 4D98A 4YQEA 1N5JA 2O48X 3RSLA 2FSVC 3ZTWA 3DNFA 4MUFA 1XQVA 2HZBA 2IEIA 4UTXA 10MHA 3I0ZA 5CGQB 4UHDA 1K4MA 1IM5A 4D0RA 1SR8A 5KCZA 1QJCA 4MYRA 1SHKA 4MAMA 3EPJA 3QU2A 3MGAA 2B4YA 2BDEA 3D6AA 2QMEA 2BP7B 1ADGA 1OCEA 4EFMA 3PNSA 1ECCA 2J9FA 3EYAA 3H5VA 4P93A 4TMVA 3DD5A 4YN3A 2J9GA 5SV2A 1R8YA 2KQUA 2WM2A 2XI4A 2HO4A 1AN0A 1R0KA 1SIBE 1NVFA 2HZ7A 3BHIA 3EH2A 4JUDX 4Q4HA 5ENZA 2NQ2C 4BX9A 4EUEA 2JIOA 2DVMA 4QARA 4IZIA 3ZHUA 1KI2A 1YAJA 2VT7A 1J8FA 4NZPA 2DFLA 3DLCA 3EG9A 3N2GA 4JXJA 5EHZA 1RBQA 4MV1A 2WNSA 3WKDA 4DQLA 4ZYWA 3DZKA 4K6GA 4DA7A 2UVDA 3AY0A 2NYVA 5KTOA 1UM8A 3JYNA 2HI0A 3NAZA 1H6BA 4DKXA 4EGCB 5A4KA 3X1ZA 5J9FA 4MVYA 4AJNA 4QU0A 4B7XA 5THXA 5FBVB 4HDKA 3L1VA 3B1VA 1I24A 3S7TA 2IE0A 1ONNA 1Z2EA 3VPGA 2HR1A 4DDHA 1JB9A 3GJZA 3Q1KA 3P9SA 4ILEA 5EIWA 2PV7A 1JXAA 2EATA 3CWQA 2O19A 4B3GA 2OCAA 3FR8A 4DVGA 1DIAA 1II8B 1U8ZA 4ARAA 1VTKA 4Y2SA 5CVVA 3H97A 2B99A 4HO1X 5H3CA 1P4AA 1T1IA 3FBWA 3A9CA 2FGJA 4FKZA 4JJ4A 5G1OA 1EG2A 2PS1A 2IYVA 2PGDA 3Q9NA 4IXNA 4XVCA 1UT8A 3MERA 1SURA 3RGGA 3CE6A 1GRQA 1J2UA 3VJRA 1UKYA 5KYKA 1NVVR 5CDYA 4D9KA 4ZZ1A 3H1FA 3KAPA 4Q3OA 3EZ2A 2I9KA 1VP9A 1X94A 5TSDA 1Z6GA 1IATA 4NWIA 2J6IA 2VDMB 1ESNA 3QW4B 1X7ZA 2OAP1 3OZEA 2WJGA 3FFTA 4XX1A 2VQEB 1KARA 2XQVA 1BO6A 4GOXA 1L8XA 4TGLA 4EMSA 2EV9A 1F6WA 4ZTBA 3P26A 4HGQA 3DHWC 3RC2A 2HRRA 4HFRA 2YASA 5FUYA 5C31A 2VDQB 1DUVG 3IR7A 2FMXA 2QW0X 3B38A 3JRXA 5F2OA 1CJKC 3JAWA 4GW3A 3HV2A 1HE5A 1JE0A 3PI6A 4J2HA 1XN4A 1U2GC 4UM5A 4MWTA 3ZGVA 1B1AA 2EIHA 4YMSA 2YDXA 2J9FB 2DUJA 5G0SA 4RK7A 1RHRA 1WXIA 2CNBA 3DWFA 4PSCA 2CLMB 1QDEA 4ZDKA 4I3GA 4P84A 5M29A 1L4MA 4ZQCB 3WO0A 1XE3A 2GMWA 2VRCA 4PXSA 4R83A 5M34A 3CVUA 4E33A 3BSFA 1M6WA 2A5GA 2HREA 1EJBA 1ZD2P 3GLSA 2OCKA 3EULA 4OJNA 3DDHA 1L8LA 5CA0A 3VNAA 3EW9A 4HFMA 4XRGA 5L6LB 3U40A 2Q5JA 4IHJB 2ZDQA 1G55A 1YC2A 3INTA 1G2IA 2WG2A 1TYAE 1QYCA 1REQB 3KJZA 3LX5A 4GR9A 5K6AC 4L8GA 1EGAA 1P62B 4FBGA 5EWJA 3W3AA 4OFBA 4TVOA 2VNJA 5GJVC 2GETA 3OEED 1KZ9A 5JAHA 4ID3A 1P2GA 5L3QB 3CH7A 1R5NA 4FNGA 5HILA 2RGYA 1KXJA 1J24A 2HHAA 3U3DA 3U3ZA 4OKSA 1XYVA 1L5KA 5ISMA 2V55B 3DZIA 4GPEA 3O3CA 2C1EA 1Y1TA 4QLOA 4WERA 2Q41A 1L5GB 5CLJA 3THXA 5BR4A 2A1IA 2O4CA 1JXQA 4LEIA 3GD5A 3CJQA 5FNVB 3ZOZA 3FX2A 2CXOA 3UHFA 1PR5A 3V33A 4WD3A 1RRVA 3VAZA 3WLIA 1ZC3A 4C76A 5B2ZA 1HEIA 4DXAA 1N2OA 3C7KA 4KQMA 2ZIWB 4YLGA 4ESOA 5DISB 4R0NA 3NT4A 3OJLA 2O8NA 5BYBA 1SMKA 5L3ZA 3T9FA 2ZRJA 3AQIA 2H4FA 3HP1A 3OIFA 4RGYA 1U3CA 2JD2A 1CF2O 1X7HA 2GPTA 4PAMA 1QLHA 1S5PA 1DNPA 1JHUA 2F90A 2HIGA 2H0QA 3I6MA 3B7WA 4B32A 4EO7A 3DL4A 3NP7A 1NVXQ 2GD6A 1EFHA 3QBJA 3IUQA 2JGRA 1RPJA 3DOEA 3QPVA 4B80A 3ETHA 4LHSA 4MV0A 3HA7A 4JI3B 2WUFA 5U9CA 4JLPA 2DHEA 2PHZA 3I83A 3NH6A 1DCMA 1Z5ZA 1OV6A 2O2JA 1Y3CE 3JR7A 4U2EA 3HE3A 3QG5A 3NFRA 4L95C 4LDNA 5FORA 3U4HA 4XYLA 1E9RA 1CUFA 3IUYA 4WASA 4RPHA 2AUMA 5AH0A 1TECE 1YQEA 1JA9A 1YC5A 2H85A 4ZD6A 3E7PA 1F0KA 1Y3DE 2OSVA 3HBAA 3MD0A 1JQKA 3OZRA 4ALMA 1ZCBA 2SNIE 3UJ3X 1TI7A 4OXIA 3PDIA 4QNNA 1TA0A 3RARA 1XZ8A 1KVUA 5B3JC 3L77A 2X0KA 4WJZA 3G8DA 1UC4B 4UU8A 1MIOA 4X1IA 2ZAMA 3DM5A 3VU0A 3UTCA 4DIEA 2TMGA 1W5BA 3MBKA 1RYZA 3NM5A 5THQA 3WLPA 3PVCA 4RWZA 1NW8A 2OXIA 4I0WB 3VU3A 4RVNA 4N7MA 2X6RA 5KS2A 2RIRA 1OFIA 4S05A 5E6UB 4LWQA 1IEQA 2I67A 3EEOA 1ZEJA 2HPVA 3K9WA 1ISSA 2IHZA 2FHSA 3ETCA 3MD9A 4BKMA 4QUGA 2FG5A 2OENG 3AESA 3NC1C 4ZMBA 3IUNA 1RYEA 1P5ZB 1W94A 3NCTA 4HX9A 2G9UA 3PFCA 1KEUA 2GYWA 5DNYB 5EUCA 2VK1A 1DAIA 1C8LA 1O4WA 5HKAA 4C78A 5HF6A 2JIMA 3S68A 5TQ0B 3U37A 1G9TA 1L2TA 1P8JA 2Q5HA 3EXHC 1XTKA 3KTDA 1JFFA 3NHAA 1PVVA 2J30A 4AN4A 4EQZA 4DN6A 1TU4A 5C1OA 3ILHA 3F7NA 4FNOA 3SLGA 3OO0A 1WNTA 4URYR 1SC4A 4RHCA 3ED5A 4U7HA 1QRDA 3K35A 4B43A 4HXEB 4FW8A 2VBFA 5KWIA 1B2LA 2AHOA 1GKYA 2P9ZA 2XNJA 4H7IA 4HVLA 1TW2A 5LN1A 3GG2A 1L7VC 5ALGA 3MAAC 3BDAA 1PBTA 1POXA 2A5YB 2IRWA 1KGDA 1IEVA 2XXBA 3AUKA 4KP7A 1I3LA 2OZKA 2J3LA 4HZUA 2AI2A 4IV5A 4YI5A 3UJCA 2F2TA 2X23A 4GI5A 1HYGA 2GPYA 1CZNA 2XKKA 1ZC4A 3MWKA 4WKNA 3U9LA 3UJBA 2QAGB 4MS4B 3JQDA 4B4UA 5EMHA 4E1AA 4PC7A 3LO5A 3SEQA 1JG6A 1GL7A 1Y1LA 3W0LB 3F5FA 4UNPA 2W6MA 3EQ9A 1A9XB 2IYTA 2QX7A 3FDJA 3TRJA 3N74A 1NXPA 1F14A 1YHZA 2ORVA 3F98A 1I8TA 4Z53A 3M7IA 1PGPA 3PP8A 4CHGA 1I2AA 1S2IA 1NWCA 3H5LA 4DABA 4HSGA 4CPDA 4QPCA 5D00A 4RKRA 5LMNB 3UFXA 3NBXX 4FFLA 4DG5A 2X2FA 2ZETA 3KO8A 3AY3A 5JNUA 2DKOA 1NSYA 3KTOA 4FQ7A 3I6ZA 5L3SB 2IHYA 3HDJA 4Z4FA 3KQHA 3GWGA 1EX6A 1FSPA 4FFMA 3RVNA 1PI3A 3EIUA 4H35A 4S1NA 1UINA 4ZARA 3V8MA 2QRPA 3VHQA 3RUAA 1X74A 5FNZA 3SOPA 4Q9HA 3ZK9A 3RREA 1JQDA 3P2YA 4BTLA 5CDFE 3RAFC 1IN6A 2E5LB 2J08A 2VI5A 1V8DA 3DXYA 4GLOA 3AI7A 3RUIA 1SCDA 1JB1A 3UGQA 4B8YA 1ADCA 3G0IA 4REOA 4B33A 2ZE8A 4D0SA 4UUAA 2HC9A 2IA5A 3KSRA 5DHRA 4YT2A 2VNSA 2PMKA 5AXCA 5A6SA 2OQ2A 3FVRA 4ZAWA 3DBIA 4FM9A 4BNWA 3VR0A 1K6IA 1X0XA 4DPKA 4YPVA 5BSUA 2OZVA 5BYAA 2FZKA 2EX4A 1GJRA 3OZIA 3CIOA 1NBEA 2G7ZA 3AI3A 3OM1A 4FMPA 4LHYA 4QO8A 3UKJA 4D3XA 1NVKA 4OU4A 1DDGA 2BCEA 5JS6A 1XLTC 3NALA 4UXHA 1ES9A 5LKAA 3AFOA 2JEZA 3BVPA 3I92A 1O87A 2RHHA 3D2LA 3H75A 1Y4UA 3A6DA 2GR9A 4E5YA 1CFJA 3ZY3A 4YJDA 1V26A 3GZTB 4HL6A 2X0NA 3PK0A 1CNMA 3JALB 4ZQIA 4OP3A 5TPWA 1JR4A 3TW6A 1UJ2A 2HB6A 3EASA 4BFVA 5ICGA 2OCIA 1GZ3A 2P1ZA 3OEHD 4JSTA 4PGFA 1DOZA 2H1LA 2QN8A 2YVAA 4K46A 3OECA 4WL0A 4W99A 1I5RA 3PC8C 4HG2A 2X76A 4HAXA 5JAZA 4ZV9A 3U17A 1ABBA 2X6TA 1SWWA 3OPYI 3K9CA 2HAEA 4XVUA 1IN4A 4OJYA 1EB8A 3ORFA 3KPWA 4WKCA 1RRGA 3NPAA 3J81k 1K9SA 3FGOA 1QQBA 1GL6A 3A6FA 1GPBA 3CNLA 4GSLA 5FWDA 2DT5A 1QFJA 2CB9A 4IIEA 4B7CA 4DANA 3AFMA 3DYIA 5FUMA 5BSGA 1U6KA 2W90A 2OYRA 4IS3A 2L2QA 4FIZA 4G07A 3WJ1A 3BGOS 3KDAA 2UUCB 4BN0A 4JH0A 4F9FA 2RKOA 1TYEB 3A4NA 2VAVA 3MT8A 1V1MA 5CGZA 1MCZA 4V0MA 4QXAA 1GGEA 2IGBA 4EHIA 3P9ZA 5C35A 3VDXA 4XQ0A 4RH3A 2RBEA 3DZFA 1XYYA 3ZWPA 2AOXA 1XIVA 5BW8A 3ECAA 3AB3A 5DHTA 5JFTA 4EQ6A 3IQZA 1NW4A 4CV2A 2ORWA 1E5LA 5H1YA 3NLLA 2JBAA 2XUKA 4KSBA 4IHQA 3PRYA 4F1JA 1HZJA 3EXHA 2CJFA 1XWFA 1BTOA 3TTUA 4FS8A 5KTTA 2J8ZA 5LQNA 5ABPA 2OXFA 4KL8S 1VMKA 4ZT7A 5IHXA 3AIOA 4BMZA 1TTHA 3GLFB 2VAXA 4ZO9A 1QQTA 3LW7A 5BW4A 1YJXA 1LH0A 2QJOA 5IF9A 2Q46A 4G0YA 3EIXA 4H60A 5SZHB 2QA5A 5CVDA 3TDKA 3FA2A 4YIHA 3B9RA 1RTKA 3JWHA 4MKXA 2IXEA 2PL5A 3YASA 3ZDCA 1F8FA 2C7GA 2QV0A 3C3JA 1N4DA 3IIEA 5ECGC 4DLVA 3JYLA 4PYLA 2DT8A 4EELA 5FLXA 5JTTA 3B20A 1WUJS 3PYMA 3UMYA 4BWVA 5A5EA 1K7FB 1E2EA 3EUAA 5HR5A 3CZ9A 2GZ3A 1XZHA 3QV1A 1M9NA 3HUEA 1H1DA 1CLUA 4Q4LA 4JBLA 3RSSA 2ZJ1A 1T2CA 1Q2XA 3OZCA 3C85A 4X6XA 5JZ9A 3WNVA 4QODA 2IUFA 1AXRA 2R6HA 2HT6A 2C8KA 3A6JA 1J0XO 3BPSA 3EFOA 4ZVQA 3P7MA 2BGTA 3EE6A 1XZEA 3O31A 3QVVA 2REBA 3T95A 1HORA 2WJJA 4EHLA 5B2FA 4OPMA 5LQAA 5HZMA 1WLSA 3RKUA 3V1LA 5JNWA 5CFQA 4R7GA 1R9NA 3QQ5A 2ZYWX 3MFQA 3LFUA 5SYAA 2EBHX 1I1QB 4PANA 2ZBDA 4ITVA 3EEIA 1J9GA 5IBRA 1N25A 2X42A 5SZIA 3V7UA 5CT4A 1GAJA 3C8UA 1G18A 1BNCA 4YDHB 3W5JA 2XSZA 4FFBA 5CG2A 4PLYA 1X7DA 2A84A 3GLIA 1DGQA 2WT9A 3NT2A 5EVJA 5LA6A 2QVLA 1N2CB 4OXYA 3NV7A 1KWKA 1VYHA 4TTVA 4B4OA 1WZNA 1M2JA 3AXTA 3FOFC 2ZM5A 3DWEX 4KEAA 3OFKA 1WKBA 1AHIA 4R9SA 5GGXA 5L3SA 1GOTA 1NT2A 4YRPA 4LQ4A 3LX6A 1VCOA 3DUWA 2O1SA 3TQFA 3WO1A 2H65A 4X90A 2PXXA 3D4IA 4IVPA 2W2XA 3BL8A 2DH5A 4ERNA 1GKUB 1XHFA 3GMSA 3H4VA 2F3PA 1RC8A 1MQAA 2G04A 4M49A 2E1PA 5HM6A 2O8DB 1UBSB 1PNRA 2WWTA 1V41E 4EM6A 1Y1PA 3W79A 4F6LA 1QYXA 2WD9A 2JLYA 2NYUA 1DQPA 2C7VA 4KIGA 3V2UA 3IHLA 4XCXA 5KNCD 1ZM7A 3T5TA 1YVUA 3WRXA 3ASUA 1QGYA 3PL1A 5D3MA 9ABPA 1N3IA 2QAIA 4QEKA 4WJLA 2HU5A 1Q7GA 1V7CA 3IKMB 1XCLA 4G37A 4R3WA 5AM3A 3VUEA 1MDBA 2YQ4A 3BK1A 3L7OA 3P4XA 2Z4SA 3PNPA 2QZ9A 4O4JF 4BJ3A 4D42A 3I2HA 1IEXA 4YMTA 2J0SA 3Q87B 3A3PA 3T7EA 4N9WA 4RTLA 1G7RA 4MQFA 1EFUA 3AJ9A 3QPCA 2AFIE 1BDHA 1M1XB 1D6NA 4V0SA 1WP9A 3DE2X 4QQKA 1TLFA 1F8GA 1RQRA 1DAEA 2JGDB 2AZTA 3BMQA 4LJLA 5G40A 3IEXA 2VJLA 3HYSA 4R2JA 1QHXA 1H4VB 3AB7A 3FYTA 1GPLA 4JUIA 3MTAA 3GA5A 4QKQA 2R8EA 5IMSA 1Z45A 1ZOLA 2ZJ5A 2E7ZA 2HRCA 2PTHA 2QSUA 1J5PA 3OEWA 3E8MA 5AW2A 4MGIR 3BA6A 2P2ZA 3BMQB 5H3HA 3ZGYA 1A04A 1ZFNA 3ZNPA 5ALVA 5C81A 5FDFA 3OY2A 3I8OA 4TTIA 4JLMA 1C9JA 3DCYA 4HWTA 5BWOA 2XQJA 4BFYA 4DADA 5BSHA 5LQDA 2WAAA 1NOJA 1IBSA 1LBTA 2ZATA 4BKUA 3UJ7A 2VZEA 1IONA 1O94D 2Q0QA 3G8AA 3NHSA 4BECA 3G8YA 1B0UA 1D6MA 2YOGA 5CYOA 2OEPA 4FE3A 4XGQA 3RK0A 3S44A 1VG9B 2PYIA 3SYKA 2JGEA 1F2VA 1RW4A 5CLGA 5CDSA 1BVHA 1WEHA 3A4VA 2YJNA 4RA6B 1ZICA 2C54A 2XVXA 3V00A 3WDMA 1FTNA 4D99A 4BFLA 1RAAA 2V3WA 3NHYA 4QUJA 2WJ4A 2ZQZA 1WZUA 1NBIA 221PA 3RTCA 3MA0A 3VPDA 1ZGJA 1VRVA 1XRRA 4RXTA 5E4FA 2DFPA 3UWOA 1MBZA 1Q1QA 4MW0A 4WNYA 1THMA 4CMAA 1EAYA 1FFEA 1R0RE 4KODA 3ID6C 4RSGA 4CMHA 1MNAA 3RS2A 3VZCA 1E3WB 4PCVA 3T1YB 5J2UF 3TMKA 1Q0HA 1IXKA 5AW1A 3WKBA 5CITA 2GVDC 1K5HA 3OE7D 3W5IA 3KB1A 2QBYB 5KWSA 1W4BA 4UZSA 1QNLA 2AN4A 2XT6A 3NTXA 3V1UA 2Q4BA 3PVSA 3H0CA 2VP3A 4J0FA 3SXJA 1A9OA 1SCAA 3A6HA 1X9GA 3ND6A 4AC9A 4Q3CA 4BASA 2BRUA 2XCSB 1AKEA 4C7KA 4XD2A 3CKKA 3OJFA 4HLNA 4IIDA 4FX2A 4WXPA 1SD1A 3L41A 5EE5B 1K7EB 2WRZA 3V4RA 1C4WA 3V1KA 4EX7A 4LC9A 4YJ2F 1EP2B 2VLBA 3KVRA 4ML3A 4XIFA 5J4HA 1C9DB 1F6BA 1N3BA 4C3UA 1NXQA 1LU9A 4MI6A 4HWSA 3FI0A 4M0MA 3JVUA 1WS6A 2PXCA 2H9IA 4YWHA 3LPDA 3K4QA 4DILA 3SM3A 4YCLA 2J9YB 1FTGA 1W46A 2D54A 1ZA2A 2VP9A 1L5WA 3WNCA 4E08A 1XNQB 4RIFA 1CF4A 3V6LA 4WLEA 2IZ1A 3C7DB 2XXJA 1PQ4A 3L4EA 4X1KA 2O2XA 3ZY6A 1D1QA 1Z36A 3N3AC 3MB5A 3G5AA 2E4XA 2IU0A 3SC2A 4CL2A 2X8JA 2ZTSA 1AKUA 3K8OE 3AJEA 1E1DA 4JKYA 4OBXA 4RGQA 5HUQA 2IH5A 4YFYA 1JIKA 3PHBE 1P77A 2Q5IA 1B73A 4L74A 1IQPA 4LJ4A 4KZPA 1BC5A 2EFYA 2CMGA 3E4CA 3EDOA 4E5KA 2BGMA 1S2DA 2O8CB 1YU9A 4CT0A 2IJGX 3OTIA 3N2GB 2XLCA 1Z33A 2VHZA 4J1SA 1VKHA 2AHRA 4Q01A 1GXSA 1CUWA 1YZKA 4MKIA 4P33A 3KX2A 1S2LA 5C5DA 4K7JA 3R75A 3U7JA 2N0SA 3VR2D 1OOEA 3MRXA 3U4QA 3DQQA 1HYEA 4RMJA 5FBLB 3HYCA 2HH9A 3M0EA 3FKJA 1G59A 2IZ5A 2FWIA 3S6JA 2HTFA 3A7DA 1LWNA 3HRKA 2PLWA 3L8MA 1NVMB 1CP3A 1UZMA 1VE5A 3D7SA 3R6LA 1IE3A 3T5CA 3SN6A 2QYSA 1EINA 1RLOA 2IYSA 4HFNA 3DCIA 4ZEVA 1NI4B 3W6OA 4FUTA 3KHUA 2W2LA 4EHBA 3UK2A 1JAHA 2P9TA 4D8VA 4OAOA 2ZAIA 3KZXA 4LJ8A 3ZJ5A 2Q4TA 2Y6UA 1NQWA 3H2SA 4BNYA 2FW9A 2OFOA 2EKQA 4AMGA 4CODB 5AQ1A 1XUOA 2ZJAA 1SEVA 2GILA 3IV9A 4K03A 4R05A 2LNDA 3B6ZA 5ESWA 5EMKA 2X0FA 3TLGB 3QV2A 1U1DA 1U3WA 5FFNA 4Z1OA 1I51A 3U16A 4EF4A 1G20E 2AE2A 5F3DA 1CU1A 5PGMA 1N4AA 4YY3B 1SZPA 3INNA 2AOUA 2I6QA 2ZTMA 3CNEA 1VJGA 1MAUA 2EWMA 3W04A 5GZ6A 4UUBA 2QP4A 4JQOA 5B5SA 1JLLB 1PQPA 4XSVA 1VJTA 1Z6TA 3L7YA 4PVCA 4BN4A 2UAGA 2ZRFA 1P4HA 1VL0A 4TYNA 1E7MA 4FDLA 4EEZA 4CGZA 1G5IA 2G1AA 2D13A 2IELA 4I4LA 1CZRA 2O7SA 2FR1A 2FPKA 2BY4A 2QF7A 2WAXA 4JBGA 2I55A 4BQEA 3VR2A 1P45A 1V7PC 1JS1X 1K89A 2A7XA 1NT4A 1RWXA 2YCLA 3WKAA 1QC5B 3CONA 3CUYA 3GP5A 2UZ0A 2FDRA 1TAHA 4R1PA 3WLNA 3ESBA 1Y4SA 3JZAA 3QPUA 3KOUA 5DN6D 3UBTA 1IBLB 3ROEA 1IZ9A 3QWIA 4C0SA 4PG6A 2AC4A 4MRMA 3DLBA