3R20A

Crystal structure of cytidylate kinase from mycobacterium smegmatis
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
217
structure length
217
Chain Sequence
b'SLVVAVDGPAGTGKSSVSRGLARALGARYLDTGAMYRIATLAVLRAGADLTDPAAIEKAAADAEIGVGSDPDVDAAFLAGEDVSSEIRGDAVTGAVSAVSAVPAVRTRLVDIQRKLATEGGRVVVEGRDIGTVVLPDADVKIFLTASAEERARRRNAQNVANGLPDDYATVLADVQRRDHLDSTRPVSPLRAADDALVVDTSDMDQAQVIAHLLDLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytidylate kinase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
total genus 82
structure length 217
sequence length 217
ec nomenclature ec 2.7.4.14: UMP/CMP kinase.
pdb deposition date 2011-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3r20A00
5AUQA 1Q44A 4A82A 3ADCA 1W36D 1W46A 2ZI3A 3O8BA 1XPRA 4OQMA 2GETA 4TTQA 2IK8A 3U6KA 3QY0A 1KI6B 5LPNA 1UBFA 2CBZA 4NYJQ 5IT5A 3PUWA 1GIAA 4O2RA 2YWHA 5JLJA 1SVOA 4BLTA 1QHHB 1OXTA 2JJ8A 3CPJB 4HATA 1SXJD 3A36A 5D3MA 3AP2A 1P9RA 4EKDA 1XEWY 4IVPA 2CE2X 4URYR 5DN6D 4LJ4A 5P21A 3ZQJA 1U98A 5UKDA 2XTZA 2YOFA 4TMWA 2ZRAA 4V0KA 4Q4JA 1NVXQ 1WDTA 1LS1A 3AUYA 1ZUIA 1XDBA 2DWPA 4MKHA 3KQUA 1XEFA 3BE4A 2YWEA 1NKSA 1EFHA 2D74A 2QSZA 3G82C 3CRW1 4IDPA 4ZKDA 1DG3A 3W8RA 4GMXA 3WRXC 5KPDA 4KJZA 2FFAA 3D31A 1HY3A 4DLRA 4TLCA 2ZVQX 4NCKA 4WZAE 4O0MA 3ZLJA 4O2LA 1XJCA 3T1QA 5BYKA 1KK2A 1N6PA 1XD2B 3WMEA 4IXNA 2P65A 4YDHB 1Q1ZA 1LW7A 3U7FB 3GJ3A 4EFLA 4RD1A 2VIIA 4A36A 4PSAA 2QRNA 2VRWA 1WBBA 1NBMD 1NIJA 1E94E 2QL6A 5J4LA 4DB2A 1P72A 5F9HA 2HUPA 1WQ1R 3ADKA 3LLUA 2A30A 4TTPA 1N6OA 2GK7A 1AZSC 4JVNA 1M7BA 3MD0A 1KO8A 1XXHB 2RGDA 4G3XA 1RIFA 3GLGE 1S3SA 5BN4A 4G01B 2ZPTX 3JZMA 3R9XA 2AK3A 1ELOA 2W6JA 2WHXA 2AKYA 1IXZA 1FTNA 2CJWA 4HZIA 2V7QD 2WWHA 1E2LA 4HB0A 3NXSA 4G5QA 4BZPA 1DAFA 1XWIA 4M1WA 1N25A 3NC1C 1KNXA 1G7RA 3HDTA 4DSOA 4EUNA 5CM8B 5EXPA 1CKEA 1E79A 2XNDA 2ZS7A 3K9GA 4KITB 1OIXA 3ZD7A 4AD8A 2C9OA 4UJ3A 3C41J 1II8B 1ZIPA 4W5JA 3MG9A 2PJRA 2CDNA 5F98A 2ZRDA 2BEJA 1PV4A 2GJSA 2ZVPX 3U3MA 4JKIA 1T8TA 1EX6A 2A5JA 2NTYC 1EXMA 3ND8A 2R2AA 3CF6R 5B64A 5IHPA 1BYIA 3AVYA 3B9QA 2WIAA 2OZEA 1M74A 1XEXB 2IS2A 1H65A 5JWOA 4TL9A 2DPXA 4KFUA 1HURA 4NDZA 2K5UA 4QM6A 3RS2A 4Q9JA 2ZAOA 1PLLA 3Q5EA 3B1VA 3BH7A 4CF7A 3DOFA 4QHSA 3DVLA 5JSZB 2KBFA 1D2NA 2CK3D 3W5IA 1IJEA 3EW9A 3QKTA 4LPSA 1DADA 2CLSA 2JJ2A 4TYPA 4LRWA 1Z6TA 2DR3A 1TU4A 4KLNA 4UNRA 2D3WA 2GKSA 1BO6A 2XZOA 3K0AB 1EFRA 1EGAA 1NKTA 4HZUB 2AWOA 4HAVA 4BLPA 3UATA 3GJ5A 2HDNB 5FTMA 3F3YA 4MRVA 2J46A 4POAA 4C0JA 5JCPA 4JYBA 5FI1B 2CVHA 1A1VA 4PC1A 4V03A 3LLMA 1H8HA 2ZRMA 3CH4B 4FMDB 4BEBA 3A37A 1FNNA 5HTKA 3W6PA 1OFHA 4LJ8A 5LBIA 2GAAA 3CZQA 1U8ZA 3LWNA 5L3SA 1IONA 5HZKA 3GLIB 1QF9A 4JLMA 2FDCA 1CR1A 4Q1BA 1X1SA 2IXEA 1GL9B 1GNRA 2A5DA 2R9VA 3KKMA 4IEEA 1Z29A 1FX0A 1MABA 1Z07A 4URXR 4TL7A 3HPQA 3KQNA 1Z3IX 1ZINA 3K1JA 3SZRA 1IN4A 4QGFA 4UXIA 1T0JB 3TQCA 3EIHA 4TTRA 2VL7A 2EFGA 2J9RA 2BIFA 1GITA 4Q7MB 2WM9B 2N1BA 2RCNA 2C99A 3AF0A 4QNMA 3QPUA 1MO6A 1X8LA 4IDNA 3T61A 1Q12A 1G6HA 1OYWA 4TYYA 3B78A 4OI1A 3C8UA 3GJ7A 5JS7A 5ANRB 3QG1A 4M9ZA 1DELA 4M1OA 4UNPA 1LS6A 3B85A 2ZI4A 1QHSA 1TUEA 3IHLA 3TUIC 2QG6A 5JFGA 2OCPA 4HLUA 1Q3HA 1KDOA 2BMFA 2G0NA 3QEOA 4US1R 4BEJA 4QKQA 3LY5A 4LWZA 3THYB 3PEYA 1CU1A 2B92A 2D62A 1D8TA 2V55B 1N6LA 1NLZA 1TL7C 2J1LA 3FVQA 2JJ1A 2ORWA 1FNMA 4OKSA 2CMKA 2D2FA 1HT1E 3MFYA 5BXQC 5DI3A 5HKKD 4GP6A 1CTQA 1N0VC 3VU9A 2CCKA 2Q6TA 4OHWA 5EP4A 4ABYA 5KNBA 2XSZD 1P6XA 3R9WA 4EPRA 3NWJA 2C04A 3VKHA 2ZR0A 2ZRIA 4NL4H 4B2LA 4PO8A 2Z83A 1U0HC 1W0KA 3K9NA 1YJ5A 4OQXA 3LBIA 1PUJA 1P2TA 2A5FA 2EYQA 1DAKA 2Q21A 3B1WA 4IDQA 1NMZA 2HJVA 3LH5A 4P4SA 1NN0A 3R8CA 2CHVA 3UIEA 2WWXA 2UZ3A 4V0LA 1HH4A 2QBYA 4C7OB 3H1TA 3BIFA 4QBGB 1TQ4A 3GJ8A 2ZS8A 4JLNA 1F60A 3RS4A 1SZPA 4KBGA 4KVAA 2PMKA 4B3XA 3V4RA 2R65A 2ZRPA 3AGQA 4Q4AB 2XZLA 1Q57A 3IKJA 4DDUA 3KKNA 3F5FA 2YHSA 3W90A 3PIRA 2XB2A 4GNKA 3I92A 1XMSA 2CL0X 3KDSE 1JXMA 2IYUA 2BDTA 4RCZA 2P6UA 4KLZA 3GLHA 3R7WB 5KSOA 4MKGA 2QZ4A 1K8RA 2ZSAA 4ZCMA 4FINA 5K8UA 4DSNA 4ACBA 5BWMA 2KB0A 3AV0B 2HXYA 1E0JA 3AKDA 4IFEA 1GNQA 4LI0A 4CEHA 3MMPA 1S96A 2Z0MA 3KKOA 4EPWA 2O8FB 1K5DA 4L5BA 3GFPA 4ZDWA 3WNCA 3MWKA 4R9UC 5G3YA 4NP6A 2VEDA 1OIWA 4Z8YA 2V1UA 1YZKA 3L82B 1ZW6A 3BGWA 2CHGA 3PCRB 2GXAA 4Q18A 1MKYA 1KI4A 2HXSA 2VHUA 3I1FA 5FL3A 2WMNB 3AGPA 1J70A 2OAQ1 1JJVA 1P3JA 3B1ZA 3B9PA 4LJ5A 2GCNA 2R62A 3QKRA 221PA 1F48A 5TARA 1KDRA 5JS8A 5JZVA 2YZ2A 4WIAA 1AM4D 4DIDA 1LV7A 3RYTC 5E7JA 4K81B 1GRNA 1NBMA 3CPEA 5CB6A 3FHTA 4DB4A 4QHYA 2IYZA 1GNPA 3ZD6A 3AF2A 3U60B 1D2EA 2ZRNA 1SVIA 1NY6A 3WMGA 1OSNA 1H8ED 3AKYA 4C0SA 3FKQA 1XEWX 2RHDA 4B3DA 1P60A 1YHNA 2MSEB 4RFVA 2J7KA 4WAUA 2YC4C 4KXFB 4CT5A 2F1RA 2CE7A 2V7QA 2ASEA 4W5WA 2QAGA 2IX3A 3G5UA 4B74A 2EWVA 3B8HA 1G1MA 4Q7KA 4TMXA 2WJIA 4M1MA 1G5TA 2XNSA 3Q5DA 1KTVA 1VG8A 3N5CA 4JBXA 1RZ3A 3IO3A 3U3JA 2OCYC 1CRQA 2WAXA 4RJLA 3VX3A 4L16A 4TYWA 1M7HA 1CEEA 3VTKA 2XTMA 3IBGA 2RH5A 1IN6A 1ZU4A 3EZ2A 1GG2A 1WRBA 1P2SA 4ZDIA 4BGDA 4ESHA 4ZDJA 4HYYA 2VYFA 5KDDA 4PZLA 2MMCA 3NBZC 4MH0R 3P26A 3RLFA 3K0SA 2F55A 4NTZA 2LKDA 2OE2A 1OHHD 1UKEA 5GJVC 1KY2A 4MRPA 3I5YA 2J0SA 2E1RA 2H5EA 4M1KA 1IQPA 4D2IA 4DSUA 4RD4A 3FTQA 3WHKA 1JECA 2XOKD 1FQKA 4YMTA 2V1XA 3DHWC 4PAQA 3VR2A 3IUYA 5FTKA 1ANKA 1HTWA 5BQ5A 1VG9B 2H1LA 4HB3A 2CK3A 3TSWA 2DFTA 1SXJE 2ZSEA 3RS5A 4XIGS 4C0HA 821PA 1Q22A 2C98A 4HB2A 1VECA 1AS3A 1JEDA 2FJUA 2Q3MA 1C4OA 1OXVA 3FMOB 1IY0A 2EFDB 4KFTA 4MYCA 2PZEA 1W5TA 1KO4A 1EWRA 3BBPA 4RKFA 1T5IA 5AR1A 2VH5R 5FI0B 3HPRA 4KVGA 2GDJA 1E6CA 2E87A 2ZJ2A 3KKPA 3DPUA 3FHCB 3W8NA 3ZIAD 2WJVA 3M1IA 4C0BA 5BN3A 2IYLD 2IS1A 2ZANA 4I1VA 3RVBA 1XZPA 1II0A 4XVQA 2ZUDA 3CR8A 3LX5A 1QBKC 2VF8A 4GDFA 3EIQA 2NIPA 3GMTA 4B71A 4CEJA 1T3HA 5TMPA 1ZNWA 3LBNA 4Q9LA 1RRCA 2QE7D 1P2VA 4UXHA 1G3QA 2E9SA 2ZS9A 2DWQA 4HLCA 4X8HA 3SJCA 4PZYA 4AG6A 1LNZA 4LV8B 1RJ9B 3PVSA 1KKLA 1GUAA 1YZNA 3OEED 2XITA 2ZEJA 3K09A 3KTAA 3VHXA 5AUOB 1G4UR 3Q9LA 4LUCA 3LAWA 4IJMA 1VMAA 2O0KA 4NZYA 3DKPA 5AUNB 4CT4B 5KPJA 4QXAA 3LW7A 4QBHA 2AX4A 3NEJA 3L8ZA 5IDVA 3THXB 3K8YA 4F4JA 4V0MA 4QJ3A 1CR2A 2NZJA 4NKRA 2CCJA 5L3RA 4A0RA 4TLDA 8OHMA 1DO2A 3P20A 4M4SA 4Q02A 1SVWA 4AKEA 5K8TA 5G40A 4CVNA 1A82A 1VTKA 4IVRA 4JSYA 5E3HA 3KKQA 2Q9CA 4JLBA 2IYVA 2CL7X 4AKHA 4DDTA 2ZRBA 2ZJ8A 1JQJC 1QHNA 4G5RA 3KB1A 5FTJA 4CEIB 1N6RA 1VCOA 2JLUA 2EW1A 4ERNA 2QPTA 4PQRA 1G3UA 4JT2A 4R98A 3W3AA 2EFCB 2VHTA 2GTPA 2OG2A 2LKCA 5HKKA 4TYNA 2WV9A 1EK0A 3TBKA 3TMKA 3DEFA 3RWMB 2JLRA 2CEAA 3SR0A 2G88A 2X19A 4TMZA 3T1TA 2QP3A 2IS6A 1VHLA 2FG5A 2VF7A 4L8GA 1ZD9A 4WXRA 5JRJA 1NVWQ 4DSTA 3CB4A 1KMHB 1KK3A 2IT1A 2VHQA 3BD9A 4HAWA 3WNDA 1E0SA 721PA 4UXJA 2G1JA 1G64A 2F43A 2HT6A 3NHAA 4TQAA 4BRWA 4IOKA 1Z0FA 4Q21A 5AWFC 3HYRA 4M21A 3Q7PA 1QVAA 1YR7A 3K0FA 1KKMA 3RRYA 3QEJA 1ESMA 4LYAA 2QORA 2DFKB 2CHQA 1MH1A 2PX0A 2WSSD 1UKYA 2D7CA 1L2TA 5IK2A 4G5SA 3U4QA 3MAAC 1WMSA 3I8XA 4IOLA 1OIVA 1LF0A 2JIZA 3PXGA 4XTCS 1GKUB 1VCIA 4B6EA 1DVRA 2VP2A 3QG5A 4MDFA 5J40A 1XX6A 5TY0A 4HAXA 4V0OA 1XCPA 2H7VA 5JI2E 2OBNA 1E0AA 2BOVA 1B0UA 4C30A 1GRQA 5JEEA 4R2IA 1AGRA 3CNLA 4ZIRA 1E98A 1XBTA 4CRWB 1EG7A 3ZS8A 1E0KA 3CF0A 4GT1A 3SYNA 4WA7A 2O8BB 1YZQA 3EXAA 2V9PA 1R8QA 2JATA 2ODEA 3TNFA 2GZDA 1YZGA 2AXNA 3FKSA 3ICEA 4PC6A 4AKIA 4MGIR 1NP6A 1F2UA 5G41A 1U8AA 2PLRA 4TN1A 3RHFA 3WYGA 1DTSA 4GP7A 1AQUA 4AYWA 4C0AC 3LW8A 4US2R 4NCNA 4IVQA 3OEHD 3I3SR 1I2MA 4WZBE 4LGMA 4QM7A 5FPSA 3UWOA 4UKDA 4C0LA 5C4MA 4XVUA 4TZ6A 1YVDA 3WP0A 2HCJB 2BM0A 4RD0A 1OB2A 1ZC4A 5K8LA 2F9MA 3CZPA 2ZM5A 1TQDA 3SN6A 3MGCA 1VG0B 521PA 3EPJA 3EPLA 1XJ0A 2GA8A 4DBLC 4XWKA 1JR6A 4UNQA 2NO1A 2EFEB 1E4YA 4D0LB 3I61A 1AS0A 1OXUA 2Z4RA 3KFVA 4FCWA 1TMKA 5GVRA 1WCV1 3EAQA 1CJUC 2X1VA 4AC9A 2R8RA 2CNWD 2ZSFA 2WSMA 5C18A 4PAOA 2OLJA 3GLGA 4G5OA 4RCYA 1VIAA 4EPTA 3ZH9B 4BLSA 2B6HA 5GJWC 3IHWA 3JZAA 1SHKA 3H0KA 3IGFA 1XEXA 1FP7A 3F0TA 4X8LA 3KL4A 4C4PA 4M9XA 2F1IA 3MCAA 4D4MA 2YVUA 2XAUA 2OUKA 2XZPA 1LTQA 1TF7A 2LWIA 2QPOA 4Q7LA 4LDJA 1OFTA 1E2FA 2ZJBA 1SKYB 3OFND 3QBVA 2RB4A 3HJNA 2AR7A 1GL6A 3EIEA 1YKSA 4IFBA 4LHVA 3S1AB 4B35A 1KJYA 2OHFA 1CRPA 1KIMA 5G3ZA 1OHHA 1GM5A 2QTFA 2G77B 3B1XA 6Q21A 1BS1A 4HDQB 5BYJA 1FUUA 2J59A 2IHBA 2ZI9A 1X8KA 3NVAA 4BASA 1W0JD 1G8HA 2XOKA 5CK4A 2RGXA 2ZROA 4MRRA 3T34A 4EPVA 3KJEA 5EE1A 3HP1A 5EXXA 1ZUNB 4J0QA 1OXXK 3VHLB 5K8IA 1Z6AA 5CIQA 2GRJA 2MSDB 4NE2A 2BCJQ 2RKOA 1HQYE 2J5XA 4ESVA 4IOJA 2FSHA 5DH9A 5HCIA 4Z1MD 2O8EA 4MA4A 1C1YA 1DAEA 4NHOA 1NN3A 1Q1QA 1R0XA 1Z06A 1XCMA 3ZYCA 3DMDA 1N0UA 3UPUA 1Z0AA 4M0LA 4LHXA 2VPPA 4KODA 1NVVR 1GFIA 4DIEA 1XXHE 3B60A 1W4CA 2ZYTX 2VP4A 3AF4A 2WIBA 3EZ7A 2KBEA 1XNJA 1YR8A 2EFHB 2QE7A 3IEVA 3BH6A 4G5GA 3EC1A 4M1TA 5KSYA 4K46A 2IUSA 3U44B 3PG5A 2RGBA 4Q1DA 1RC8A 1AS2A 3OEEA 3EA5A 5LB2A 1OH5A 2JDID 4DKXA 4ZI3A 5FH9A 3THYA 2WPDD 3A8TA 4D26A 3VX4A 4ZI2A 1MV5A 4Q7JB 2FE4A 3BFKA 5E95A 4W9MC 1GP2A 4XOIA 4FMDF 2VO1A 4B3GA 2P6RA 1QG2A 5EQTA 2DB3A 4Q4HB 3ZZTA 3DZ8A 1NNEA 2WBLC 1QG4A 3MLEA 3PEVA 4PQFA 4ACAA 2A7QA 4LJ7A 2V3CC 4DCNA 5A4JA 3C14C 4RFSA 2YJTD 2ZYWX 3PENA 3PFIA 1G5RA 1P9WA 1ZU5A 3NH6A 2ZRFA 3THWA 5AJXA 1OKKD 5AJYA 5DNYB 4PSVA 2IYWA 3O8DA 4PHGA 2B7CA 2XXAB 3I4LA 4OK5A 2ORIA 4HAZA 5CYPA 1N6IA 1I4LD 4M22A 2Z4SA 4JJZA 2R6DA 2I1VB 2XEXA 4UJ5A 4F38A 4MDEA 2JCSA 2IL1A 4EPXA 2IUTA 5TVKA 4D25A 1Z2AA 2HYDA 4YC7A 4B6FA 4Q4LA 2PZGA 1V5WA 3P4XA 5EE0A 2QGNA 1R5NA 5EXSA 2O8DA 5JHGB 2AN9A 1E2DA 1RW4A 1MO5A 1W2GA 4GOJA 1P2UA 1D6JA 1UBEA 3LVQE 4JLKA 3UANA 1KSFX 2REOA 4H9GA 4B47A 3A58B 4BLOA 1DBSA 3IBYA 2ORVA 3MSXA 2J0QA 3A1WA 3C7KA 621PA 4BFXA 5G53C 1E2JA 3ETLA 1T9HA 3GFOA 2XX3A 4FMBB 2FEMA 3MRSA 2WVJA 4A4DA 3CRQA 3PV0A 5CIWA 4FCTA 1O87A 2WSSA 1ZCAA 1Z0DA 2ZI6A 3KJIA 3LV8A 1E9AA 4NYJR 4TMVA 1US8A 1ZM7A 2YINC 3IEUA 4OHZA 4P0TA 3W9YA 3KJHA 4A6PA 3GLIE 3BRWD 4MGZR 5JEDA 3U7HB 2WWWA 4DCUA 4PANA 4XJXA 1YR9A 1Z22A 1U81A 3AKCA 4EPYA 3GEHA 2AFHE 1T5LA 3AVVA 1L7VC 5H1YA 3L0SA 3EWAA 1KI8A 3SFZA 2CL6X 1SULA 4CGZA 5B2ZA 1ODFA 1X8JA 4QL3A 1JAHA 2FZ4A 4BLQA 3K0EA 3AVXA 3QXJA 1A2KC 1G17A 3EZ9A 4FD2A 2GCOA 1EFCA 2AKAB 4Z51A 4HLUC 4HDCA 3U6BA 1ZNYA 1TPZA 4QC2A 3RABA 1XPOA 2FNAA 1KGDA 3TQFA 1XP8A 1X6VA 3PJRA 1YZLA 1GDDA 3QSYA 1A2BA 1EX7A 3PEUA 1KO5A 1XTRA 3FMIA 2VLIA 4M9QA 1RRPA 3OEHA 4KFRA 3TK1A 4EFMA 4DT1B 4DEXA 2GNOA 3N70A 3LQRA 4NYMQ 4A8JA 1SVSA 1W2HA 4QNRA 3LXXA 1OH7A 2BBWA 4AYXA 3PUVA 4DCTA 5FBLB 2YV5A 1XCGB 3SOPA 2YC2C 3VFDA 2P0EA 2ZSDA 3UMFA 5FOTA 4OHYA 3IPXA 1UKVY 1NJGA 2PEZA 2BEKA 1IJFA 3WXMA 4DJTA 4EIWA 1XMJA 2FMXA 5GADl 3N2EA 4NCJA 2OT3B 2CNWA 4BE7B 5CJPA 5FOSA 5C4GB 3QXHA 1MT0A 2AWNA 4I1OA 3D6TB 3FOZA 1G19A 4QJ5A 5L3QB 5JJIA 2AL7A 4KYUA 4LCBA 1E2QA 2C95A 2GJ8A 4JVSB 5C46F 4C3ZA 4Q4JB 2ANCA 1EWQA 1S3GA 5JCZA 1XD8A 1F2TB 4PQYA 1HT2E 1R4AA 4B32A 1UBGA 5JWHA 5CYOA 4XTRA 5EUQB 4ARZA 5FTNA 2C5LA 2ZREA 4LBVA 1A5TA 3OFNA 2JLYA 1CIPA 1E9CA 4TT3D 1N6NA 4FWIB 5HE9A 1Q20A 4JLJA 2A5GA 3TGPA 2GILA 2NZ8A 1JJ7A 4RZXA 5TXGA 4P33A 3AQ4A 3IO5A 3NBYC 4Q9KA 3RS7A 3GCGA 2OFOA 1KZGB 1W0JA 1BKDR 1V43A 2D06A 3ZS9A 2W6ID 1J8MF 3AKEA 1JPJA 4KYIB 2KWIA 2FSGA 1PZNA 4KU4A 5KDOA 2DY1A 2QENA 1JR3E 2ZJOA 3WP1B 3K0CA 4OQNA 1GSIA 4CYMA 5CDFE 4QHTA 2P3SA 1KSJA 1TX4B 4Z1MA 3CONA 3L8YA 3VR3A 4BZQA 4LX0A 4O3MA 1SXJA 3UKDA 4RY2A 2ERYA 3M6AA 4IXMA 4GPTA 1J90A 1N6HA 2JASA 2EWWA 5DN6A 2RGEA 4F4IA 5AJVB 2GVDC 2ZR9A 1G4AE 1DAIA 2PH1A 3G0HA 3CR7A 2VP5A 3LX8A 1JALA 4BRUA 3ZGXA 1DPFA 2BJWA 3BC1A 3CPHA 2OBMA 2ZR7A 1ETUA 3REGA 3R8FA 1ZM4A 2ZRLA 3P4YA 3T15A 2IYSA 2RGCA 4Q1EA 1E96A 1LF5A 1NN1A 4OYHA 5DI9A 3NKVA 2OFWA 1CR4A 3Q85A 4D81A 3NC0C 2W83A 2JDIA 1WP9A 2OLKA 4RZ3A 5FUYA 2WWYA 3VR1A 4PFSA 3CF2A 1P4SA 4NBSA 3B2EA 3IIMA 1D2MA 3DOEA 3QENA 4PPFA 4MITA 3KQHA 2VHCA 3PUZA 2VSOA 4LBYA 3VQTA 3AVOA 3R20A 3QKSA 3SU8A 1TU3A 4A1FA 4P32A 1MRSA 1EFTA 1YQTA 2ZJYA 2OCBA 3AVTA 1L8QA 3W34A 1OKKA 4GBMA 1E1QD 5HZHA 3RRMA 4B48A 1KJWA 1P5ZB 3U3RA 1F5NA 3P1JA 1W1WA 5F2EA 3RAPR 3X1WA 2BV3A 5H8WA 4KFSA 3OAAD 2WTUA 2ZSBA 3FFAA 5FR1A 4B73A 2X2EA 5J4YA 4Q1FA 1IN7A 2FWRA 1R5OA 2B21A 4TQUS 2J45A 2J7PD 2J0UB 3KUCA 1NVUQ 4LV5B 4IRUB 1E3MA 2F3TA 1II9A 2DHRA 4XSGA 1XD9A 2F9LA 1FTSA 1IY1A 4PX9A 1JI0A 5E7IA 3X1DA 1U90A 3OE7D 3OZXA 2N42A 3RC3A 3MWYW 2EVWX 1X1RA 5IRCD 5DHAA 1RYFA 4G0NA 3KFXA 5HE8A 1JNYA 4DHEA 2D4HA 2QM7A 4GOXA 2EQBA 3GFTA 4JSTA 4A2QA 3GQBA 1MR3F 4EQ6B 4FMCF 1W5SA 5EE9A 3TIFA 1GRRA 1WXQA 2OAP1 2GBLC 1ZJ6A 4FI3C 1K5GA 3A1UA 1OE0A 3NG1A 2ZRJA 4D4LA 4YMUA 5AJWA 2DBYA 3EPKA 3SEAA 2KE5A 3QXCA 1VCNA 2H16A 2C96A 3AVUA 3TVDA 3QE0A 5JRZA 1IN5A 1IAQA 1DO0A 1RKBA 1PLJA 1GWNA 1VG1A 4LHZA 1ZVQA 3ZVRA 4DLVA 1KO7A 1W48A 4LV6A 2ZYUX 3CUEF 4I81A 5EE3A 4LHYA 2FN4A 4A0HA 2QAJA 1JPNA 2ZITA 2GWHA 1OPXA 4LBWA 2OO7A 3FDIA 4DZZA 3IILA 3B82A 1RRGA 4Q03A 1P73A 4GL2A 2GEVA 4JLVA 1XFAA 2BMDA 2FH5B 3RSLA 2FU5C 1J7KA 4PTLA 4RZ2A 3QPVA 2G0TA 1I4DD 3GEEA 3HU1A 5DI3B 4HLQB 1DARA 1KHTA 4Q9HA 4DCVA 4YLGA 4EJSC 2REXB 1XMIA 4M53A 4WZ6A 4JVLA 5LB4A 3VU9B 3X1ZA 3RS3A 1Z8FA 2WWFA 1BYUA 2IS4A 5TV2A 1FPMA 4Q9IA 5J4VA 4I99A 1L4UA 3ASYA 3W6OA 2I4IA 2NQ2C 4PPNA 4URWR 3GJXC 2GXSA 3BFXA 1UM8A 5KU1A 4JL8A 1HEIA 2X8AA 1M1YE 4I4LA 3QF7A 3QQ5A 3T5DA 2BHRA 1KOFA 1G41A 4P4SB 4NU0A 2IXFA 4MRNA 4QGGA 2Q9BA 2QBYB 2QQEA 2BM1A 2QN6A 4LSGA 1OW3B 3SYLA 5JWRA 1W36B 2C2HA 5DYGA 2GXQA 2AFIE 2FSIA 3O47A 2J41A 1E99A 1W47A 4BWYA 1W44A 4URVR 121PA 4D80A 3N2IA 2WZQA 4JVMA 2AD1A 1ZYUA 4JJKA 3TR0A 5J47A 2IYXA 3K70C 4M1SA 1NSTA 1XTKA 4B43A 1N5IA 1G291 2PCLA 4F93B 2B7BA 3GLHB 4N0EA 4NH0A 3OIYA 4NYIQ 1ZP6A 1JB1A 2C9YA 5JJLA 3EWSA 2QEQA 4CEHB 2ERXA 3SHFA 4M2LA 4DLWA 2WJYA 5J4KA 1CULC 4PHTA 1R7RA 1AQYA 4PC7A 4JLPA 4C0KA 5CJ2A 3L0OA 3C5CA 2NO9A 4KBFA 4WVFA 4QGHA 4TT3A 3PITA 1KI6A 4HAYA 3QI2A 4LYFA 2XSZA 4XH9B 4YXWD 1Z0JA 2A2ZA 3P27A 3NH9A 5FBWB 1O3YA 5DIFA 5KSZA 2NGRA 1R2QA 1IBRA 2JEOA 1QHHA 4PPQA 4BFSA 1ZD1A 2O8CB 5CM9C 2QQ0A 4TMKA 3QKUA 3O8CA 3ZQ6A 4B3BA 4G1UC 4R7ZA 2AHOA 2WICA 3IDQA 4O25A 4A0GA 1XF9A 3SE0A 3C16C 2WAYA 1Z6XA 2IW3A 1OV4A 4U00A 4PR0A 2QTHA 1E1RD 2ATXA 2QM8A 2BKEA 4D4JA 5HR5A 1XRJA 1VYTA 4ON9A 2C78A 2YWFA 4Q47A 3U44A 4P3YA 2RGNC 1J8YF 4LK2A 1JR3D 2QAGB 3H2YA 3PEWA 4RVCA 1UAAA 3QBTA 4E5UA 3NDBB 4US0R 2QSYA 2ZJAA 1U8YA 4NCHA 3E5HA 1XD2A 3OIWA 3DM9B 4U7DA 1TUIA 2W0SA 1XTSA 4JKYA 5JECA 1KDPA 5FL7D 1NMXA 1ZUHA 4JIMA 4PHFA 3TLXA 3TAHA 4A15A 2RGGA 2QRZA 3I8SA 2P5TB 5FOUA 1XXHA 3ZVNA 4DUGD 2XB4A 2JJ2D 3F8TA 1TF5A 1R0YA 3SJBA 5SZJA 2PL3A 2H57A 4HSEA 3M4YA 4JBYA 2IWHA 1NF3A 3PR1A 5EP3A 1SHZA 1JXOA 4OBEA 4R2HA 4L15A 4A2WA 3AH8A 2GK6A 2O0JA 1G5PA 1OJLA 2GCPA 4MYUA 3AEZA 3GD7A 1U9IA 4YMWA 5AK0A 2ONJA 3SHWA 4D0GA 4ZCIA 1Q1BA 3R9IA 4RD2A 5FOWA 1SKYE 1A4RA 3E1SA 3UG7A 1N2CE 1R6BX 3SBEA 1VDZA 4II7A 5CITA 1M7GA 1IOZA 3A1SA 1FQJA 4PPGA 2HCBA 4Q48A 3T35A 1H8EA 4DXAA 3L0PA 3UK6A 4BFTA 4TYQA 1LY1A 1II8A 1Z5ZA 2YYZA 4R71A 1KDTA 3DO6A 4PC3A 1FMLA 2YWGA 2F1JA 4QOSA 4KSCA 2G6BA 4B3FX 1OXSC 3SJZA 1M2OB 2P5SA 4D4KA 4PO9A 2AXPA 2NG1A 2BKUA 1D5CA 2PEYA 2J7PA 4GZMA 5DGXA 4AYTA 1U99A 4IW3B 1WBDA 2FSFA 2JA1A 2VBCA 3OE7A 1AIPA 1R8SA 1S1MA 2C8VA 2DFLA 4L4UA 4E03A 2ANBA 3BB3A 4U5XA 2BMEA 3NDPA 5J5CA 3NTUA 1YE8A 2NO7A 4OJQA 2MMGA 5AUPB 5KTYA 5KYKA 1X3SA 2GF9A 3K9LA 3ZZUA 3SYKA 5JSZA 3H84A 4M9SA 3EARA 3SDZA 3KTAB 1T91A 2EU8A 4GOKA 1IN8A 4YONB 5FR2A 5EZ5A 4H1UA 1C9KA 1RVDA 1KJZA 1DS6A 1KO1A 3K0AA 4HZUA 1T0HB 4IEIA 3J81k 4OQFA 3DL0A 3B6EA 4EFNA 3W3ZB 1Q21A 4B33A 4BPBA 4PAMA 3IPYA 3KJGA 4BFUA 1UKZA 3ADDA 3KUDA 4LZZA 4JLOA 3JVVA 2QA5A 2QU8A 5FPKA 2YOHA 1W4RA 1S8FA 2ZU0C 1G7SA 4EJSB 5B58C 4QBFA 1T8UA 1F3OA 1OB5A 2ZE6A 4KAXA 3GLIA 2O0HA 5M04A 3BH0A 1P62B 1W0KD 3LQQA 5HPYB 4AG5A 4HUQB 5KUTA 3TSZA 2F7SA 5A5GA 3CH5A 3ZIAA 2QMEA 1KK1A 1PLKA 4BFVA 1N3BA 3Q7QA 1W4AA 1COWD 1S0UA 1P7CA 1JQLB 2N46A 3U7EB 1R0ZA 4LHWA 1ZM2A 1F6BA 2OCAA 1HE8B 1RYHA 4BUJA 5KNDA 3I73A 3Q3JB 1G7TA 1W49A 5EUMA 1X86B 2F43B 3NBXX 2Q9AA 3SQWA 3TJZA 1G6OA 2G3YA 2UKDA 5JMTA 1XJQA 2RHMA 4W5HA 1Y63A 4ILEA 3ICQB 2WKQA 5L3QA 3K70B 2GVZC 3UXMA 3K0FB 4Q1AA 2KSQA 4KCGA 1M34E 3CW2A 3CX6A 4KHZA 3LXRA 1F2TA 4BLRA 1XZQA 1MRNA 1Q1EA 2BBOA 1DEKA 2FFHA 4KI0A 2HF9A 2ZTSA 1KZ7B 3U4QB 1HUQA 1KY3A 2DYKA 3MJRA 5CLLA 3EG5A 4JLDA 4A9AA 4Q5IA 2BBTA 4LY6A 1Z2CA 1YRAA 3FB4A 4F92B 3D8BA 1IY2A 1E4VA 1U2RA 4LBZA 3GP8A 2ZI7A 3LFUA 1MO3A 4UNNA 3RC8A 4DLTA 4AKGA 1M6NA 3C15C 4QFMA 3RSOA 4DEYA 3KX2A 3P32A 3UWKA 5SZIA 1KSHA 4ZIRB 3E70C 1PJRA 4YMSA 5HCNA 3VR6A 4C7OA 2IUUA 3QXXA 5TB5A 1WE2A 1Z0KA 1S4QA 3BFVA 3ND9A 1MOZA 3AVWA 2C03A 2O52A 3VR5A 2RMKA 4JLAA 5EE5B 2GJAA 1NJFA 3VKGA 4LYHA 4YXWA 1F2UB 3NIBA 1GOTA 2I1QA 1AGPA 4Q4AA 4V0NA 4Z8XA 5LDDC 5L3VA 3CRRA 4W7SA 421PA 4ITRC 3U2QA 4NMMA 3GJ4A 3KZ1E 3NEYA 4M8NE 1R10A 2QUZA 1UEIA 2ZYVX 3OESA 3R7WA 5GVSA 1UBCA 1YR6A 4GMDA 2JLVA 1KAOA 2JLQA 3WRYC 1N5KA 2QTVB 5JHHB 3LVRE 3EX7C 2F3RA 1TEXA 1ZCBA 1UADA 1UPTA 1I2DA 1Z08A 2J87A 1E1RA 4C2TA 3GLFE 2O8FA 2PLFA 4A8JC 1G16A 1AA9A 4RSGA 1OH8A 1XB2A 5KOYA 1TTTA 4PSKA 1JR3A 3EZ6A 5FPYA 3THOA 4E22A 4LJ9A 4EDHA 5CDFA 2H92A 4JL6A 2FF7A 4BFYA 3GLGB 2QMHA 3DDCA 3MWJA 3VR4A 3IIKA 2ZXUA 1RRFA 3A4NA 1ZC3A 4OI4A 3BJIC 3K9HA 1DAMA 1KK0A 1YU9A 4D82A 3U5ZB 2FOLA 3SNHA 4V02A 1TQ6A 4JZKA 3HU3A 2WMOB 4B3CA 2SHKA 2FPMA 3A1VA 5FL7A 1R0WA 2GXUA 5F3WB 1Z63A 4Q00A 1U0JA 1AKEA 3IQXA 4RD3A 1G8YA 3FHOA 4FWTA 1XTJA 5B30A 4DUGA 2ONKA 1FFHA 3EASA 3RRZA 3GLFB 1ZBDA 4JS0A 3CWZA 1RE0A 4HAUA 4ZPXA 3NBFA 3QF4B 1S2MA 4HLDA 4OL0A 2IYTA 3B7GA 2H18A 2UZIR 3DMNA 4LYJA 5DSZA 1PVOA 2BC9A 5A0FA 3KXIA 2A9KA 4KO8A 2J0UA 4A0FA 4TMTA 3SBDA 4MUBA 4WBSA 5FUVA 1Q3TA 5AJZA 1ESNA 4S2EA 5DE3A 3PQCA 3ZJYA 4JT4A 1GKYA 5FBVB 1U94A 2BCGY 4OK3A 2B8TA 1E2MA 4AURA 4B75A 1VYUA 2O8EB 4B2PA 4LJAA 4EQ6A 4URUR 4ZKEA 4BQSA 1W36C 3QPWA 5D3MB 4Q66C 5JI3E 4H1VA 4FXPA 2Z5FA 1CJKC 1E9RA 1QVRA 4Z54A 1OF1A 2R44A 1LFDB 3K0CC 2QROA 4WXPA 3KXKA 1KYIA 2REBA 2GESA 5FFMA 3WBKA 1E2IA 4Y0VA 2VSFA 4P4TA 4DLYA 4L9SA 4F4CA 3E2IA 3LD9A 1E2NA 4CDGA 4PO1A 3I5XA 1G20E 1SXJC 2KJQA 3OHMA 3CBQA 2F6RA 4E09A 2CLCX 3CX7A 3D3QA 1YZTA 3AP3A 1IHUA 2QT1A 4TLAA 2PZFA 1GVNB 1T3SA 2I3BA 3BERA 4WW0A 2R6GA 1XU4A 1G21E 1BMFD 2IEYA 2PCJA 4FW9A 4IDHA 5BW8A 1UDWA 2IYQA 2OXRA 3RS0A 2R6CA 4RKEA 1QHXA 3T06B 2WOJA 2GZHA 3C5HA 2BVNA 2C9CA 2IHYA 3W6NA 5DO9A 2FEOA 1UJ2A 1Z6YA 2OBLA 4MKIA 4NONA 1IXSB 1QDEA 4MYTA 4RFSB 5C1BA 4QGAA 1N5LA 2W2TA 1NRJB 1G8FA 3THWB 3K53A 4I1UA 4JBWA 1NI3A 4OHVA 3CLVA 2ZRKA 1AK2A 3T1OA 4DLXA 2OV2A 1ZMXA 3TSOA 3U3OA 2W58A 3EZFA 2WJJA 2FX3A 2CJWB 1RJ9A 2OXCA 4KV9A 2L0XA 2X2FA 4K8OA 2QPAA 5H70A 2HF8A 3K70D 2PT5A 1GTVA 3ONWA 2YKGA 2IA5A 3AF1A 5GJBA 1COWA 1RFLA 4FIDA 4N0DA 4C2UA 3THXA 2O8DB 2ZU6A 4GFDA 2IC5A 2AD5A 3FMFA 1FOEB 4LJ6A 5IK2D 2Q3FA 2QAGC 3AUXA 3ECCA 5JJKA 3CWQA 4ZDKA 1GZSA 2GEDA 4Q01A 2JIZD 2OESA 3EC2A 3RWOA 1CF4A 2OEPA 2JLWA 4URZR 3AF3A 1T6NA 2IEZA 1ZM3A 3FGNA 1QHGA 3AVQA 4OI2A 3U7GA 3SC3A 4NYMR 1HQCA 4TSFD 3CNNA 3NHBA 1J2JA 2Q0HA 4XD7D 5ELXA 5KSPA 1JEEA 2WPDA 3D7MA 1EESA 1HA3A 3ADBA 2ZRHA 2BBSA 4HEJA 4IKEA 2XJ9A 4CEIA 3IIJA 2ZIAA 4ZCLA 4X8MA 3VMFA 2YOGA 3L43A 2QI9C 4PZZA 4QG7A 3UMRA 3B1YA 2QMOA 1US8B 2QY9A 2DCUA 3FWYA 1E2GA 4C0QC 5LD2C 3DKVA 3QVUA 3FKSD 3HU2A 3VAAA 2P6NA 2GJ9A 2P67A 4EAQA 2PMDA 4LOAA 4KSBA 3WHLA 2IYYA 1S9HA 3U61B 1VPLA 2XTNA 2OSBA 1KMHA 2NO6A 2FFQA 1NLFA 3TW8B 1KMQA 5GJCA 2O8CA 1NN5A 4CW7A 4IOMA 1L4YA 2GAOA 3H86A 2GCOB 3OIVA 1FMJA 3C4JA 2V6IA 5D3QA 3SFVA 2R6FA 4N1AA 1E32A 2FPLA 5FOXA 2FA9A 4BFZA 1MO4A 3L2OB 3FFBA 5L3SB 1E2KA 2HJGA 4LJYA 4AY2A 2JGNA 2ODBA 1DAHA 5FUXA 4PC2A 3GEIA 4DCSA 3BAFA 2WOOA 2GHIA 1FX0B 1MABB 3A1TA 2QMUA 3TRFA 4A8JB 3PUXA 5KO2A 3HYTA 5CK5A 3Q8XB 5FTLA 4M1YA 3AM1A 3ZVMA 1KNQA 3CIOA 1T4GA 2FV8A 1AN0A 1CJTC 3SI7A 1DAGA 3QJYA 2HLDD 4RZUA 4MGYR 1Z0IA 2DWOA 3BB4A 1CP2A 1NSFA 3Q72A 3FE2A 1E9SA 5FBRB 4Q1CA 1D9ZA 4P31A 3IQWA 2LCFA 3KQLA 2ZUBA 2XGJA 3OIUA 1E69A 1TADA 1S9DA 3U3KA 2O8BA 2VQSA 3K09C 1JBKA 1ZIOA 5DISB 3LRPA 2UVQA 2WKPA 2WWIA 4MGKR 2ZE8A 1QZXA 4PXAA 1KI7A 5DLQC 5EZ6B 1ZNXA 2Y8EA 2YNMA 1LVGA 3SS8A 1ZD8A 4XVRA 4DVGA 4GSYA 1YZUA 5C2JB 1AKYA 3VNUA 1G3MA 4ASUD 4PHHA 4DLUA 1OFIA 1VYVA 5B57C 1CS4C 3BWDD 2FGJA 1AZTA 4B44A 2AK2A 4P4UA 3A4LA 4ARZB 1GAJA 1SVMA 1Z47A 4LC0A 2CCGA 4X8OA 1PUIA 1P9NA 1K6MA 3RNLA 2BJVA 2FGKA 4ZV4A 3EPHA 1B23P 1Z83A 1FP6A 2IWRA 3ZDQA 3BOSA 2WJHA 4AIIA 2A78A 1HV8A 3GLHE 3QXSA 2G9NA 1IXRC 1W7AA 3T1VA 2WJGA 2VP0A 2DFNA 1WB9A 3UG6A 2ODNA 1TEVA 4DWJA 3I72A 3OF5A 3CO5A 2ZUCA 4NPHA 3WY9A 1CBUA 1SKQA 4IDOA 3KQKA 2GBLA 3I32A 3BS4A 1DG1G 3RANA 3LO5A 1OYYA 3UMSA 3GJ6A 1CR0A 5J4HA 4HB4A 1G3RA 5EXTA 2C77A 1E9DA 2H17A 3CRMA 3FMPB 1KI2A 3B5JA 1GKIA 1KI9A 3VKWA 3ZVLA 3ZZ0A 1I4TD 2QP4A 4YQFA 5L8VA 4YDSA 4S35A 1SXJB 4JMPA 2ODWA 3S1AA 1P61B 1ZNZA 3TAUA 1SVKA 2H8KA 2Z43A 1NBME 3CKLA 3WNBA 1NY5A 3QVVA 1NG1A 2JLZA 2QP9X 1CLUA 2NOAA 1D9XA 2IF2A 1BOFA 3V4FA 2NMVA 2V8OA 4Y0AA 2FPKA 3TR5A 5KNCA 2WKRA 3X1YA 4UQOA 3LNCA 5FPTA 2HV8A 2ZRGA 3WYAA 1KAGA 4A2PA 5KHOC 1P75A 4GRAA 1N6KA 4LC1A 5E7MA 1E2PA 2ATVA 2OM2A 3HR7A 4TLBA 1TNDA 4DRZA 1GILA 5H68A 1RPZA 2A3RA 4FCVA 1YRBA 1VKJA 2ZETA 4EJSA 1QHIA 2ZE5A 3CRVA 2OILA 3JVUA 1G9XA 2V54A 2ZRCA 2GEUA 3BB1A 2W6JD 5JBQA 3KXLA 4FMCB 1BMFA 3QKRB 1XTQA 2CXXA 2QT0A 3WBJA 4GI7A 5EP1A 4XWOA 1A7JA 3TE6A 1N5JA 2ZJ5A 4HUQA 3TUJC 1SQ5A 3DZDA 1KSGA 2P2LA 1WA5A 2W6IA 2X77A 1G18A 2VP6A 2PJZA 2RGAA 1JAIA 3QKSB 2VSXA 4QBIA 3TH5A 3V00A 4MRSA 1AJEA 3TW4A 4FN5A 3WYFA 5E4FA 1E79D 2JAQA 2XNDD 1CXZA 2J0VA 3H4MA 5TDHA 5FUWA 2W00A 2RAPA 2NPFA 4BECA 4IHQA 1Y3AA 2J3EA 3AVPA 1ZM9A 3L0IB 3V9PA 3T12A 1UEJA 2ZQ5A 1U9IC 3BXZA 3PUYA 1NLYA 2IYRA 2Q3HA 1SGWA 1NIPA 1TQ2A 3LBHA 4TZ0A 3M0EA 1Z28A 4OQLA 4TL6A 1CJVC 3B13B 2BWJA 2ZI5A 4CIDA 4WOPA 1CJMA 1BIFA 1OT3A 2QGZA 2ZJZA 2IXGA 4D0NA 2JLSA 1DE0A 2W0MA 3MJHA 5DYIA 4B76A 4Q4HA 1Q0UA 2HYIC 2IBMA 4MQBA 4C9BA 5SZHB 1N0WA 2MSCB 2OFXA 1FZQA 4DDWA 4XSHA 5EP2A 4AK9A 3BORA 4L9WA 3T5GA 4A6XA 4TSFA 3VNVA 5LD2B 1E2EA 4XD7A 2ECKA 5FBQB 2XXAA 1TF2A 1DOAA 1R5BA 1E9BA 1E9EA 1S1CA 3MUFA 4JYCA 4CZ2A 1EFRD 4JL5A 1KI3A 1LB1B 2F1HA 1UDXA 2GF0A 1HYQA 2NO0A 1G7CA 2HEIA 4TL8A 1KI1A 1FUKA 4U02A 2ZAMA 1TAGA 2ZE7A 3I62A 2WWGA 2EYUA 2IF0A 1NVVQ 1Z6GA 3RDPA 2VA8A 4RD6A 1OH6A 1H8HD 4F91B 4Q19A 1XPUA 1G8PA 4OK6A 1QRAA 3QNUA 5DHFA 4A92A 1FW6A 1E1QA 4QJ4A 2HT1A 1E9FA 1U0LA 4DLZA 2JLXA 3TUZC 1T3LA 2B8WA 5EJEA 4NYIR 2D7DA 1WF3A 4I1SA 4YMVA 4MYHA 3OAAA 2O5VA 1W4BA 3W5JA 4B34A 3LA6A 3FYHA 2V4ZA 4BZXA 4ZO4A 5IF9A 1G8GA 4LPKA 4V0ME 3TKLA 1GL7A 2Z6VA 3KB2A 1ZAKA 2RGNA 4TWZA 4D6PA 4N3NA 4DDVA 4TLEA 2A5YB 5FPHA 1BH2A 2PX3A 3CM0A 3GJ0A 4AI6A 2PBRA 3BK7A 3QIAA 3DM5A 3X2SA 5CB8A 3MWLA 1VIYA 1SVLA 4DLSA 1XTIA 5F9FA 3LDAA 4CEJB 2R6AA 4TQ9A 1G3IA 1NG9A 2D2EA 3X1XA 2VP9A 4UNSA 3SQXA 2QNRA 1VHTA 3EA0A 3A4MA 2NPIA 3GPLA 1ONBA 5KDLA 3REFA 4B2IA 4HUTA 3O8RA 3SJAA 5BN5A 1HE1C 4OHXA 4NCIA 4QRHA 2CVFA 4DC9A 1UFQA 2HLDA 4E07A 1UF9A 2GZAA 1XMVA 2JJ1D 4BFWA 4MKFA 4OJKA 2V6JA 2W2XA 1OLOA 5SZKB 1M8PA 3A6PC 2TMKA 1ZRHA 1OFUX 3AB3A 2G83A 2FZLA 3CX8A 3QUSA 3FPAA 2VTKA 4MUAA 3RRNA 2XJ4A 3GLFA 4XWAA 2GJKA 2BMJA 1NL3A 1EFUA 1FL9A 1VCMA 1NMYA 2CLDX 1QHYA 2FFBA 3HR8A 4F7WA 1IM2A 2VHJA 3QOFA 2G1KA 2PT7A 5CLQA 3QF4A 4GZLA 2W2VA 4DT1A 3WMFA 4ASUA 3CNOA 1E2HA 3HWSA 1J99A 4HDOB 3ASZA 4AWXA 5FOVA 3TVTA 2KI5A 4HI0E 3AP1A 4OI0A
chains in the Genus database with same CATH superfamily
1QYIA 4A82A 3ZW9A 1HWYA 3STVA 4XD2A 4D9CA 2V65A 1XPRA 3VJLA 4EVQA 2PK3A 3HJRA 3LOPA 4E2XA 1GPDG 2CFTA 1KI6B 1EVEA 1UBFA 1L5FA 4R1SA 1V16A 3KJQA 5DSTA 3PUWA 1I2CA 1GIAA 4F1WA 2BSAA 2IOYA 1SVOA 3SJBA 5BSWA 2GYWA 2O9JA 5EPUA 1FE8A 1XRSB 3QNWA 4HQOA 1QHHB 4KPUB 4PHCA 1OXTA 5U1PA 2QV7A 3B6KA 5AI5A 5L45A 2YRWA 3A05A 4QZVA 1T25A 4EKDA 4RTPA 1N8SA 3GFSA 2OK8A 1JBQA 1NULA 4R69A 3LLSA 4AMUA 1DTEA 5HK9A 4DV6B 3N0TA 1U98A 4H7IA 4QAQA 2DT5A 4TMWA 2ZRAA 1NGSA 1I36A 2ZUSA 3TNLA 3PWKA 1Y3DE 4GYJA 4LS3A 3AUYA 3STWA 1VJ1A 4AQ7A 2YWEA 3A9UA 3QVGB 1NKSA 5JMPA 2BI8A 1N8NA 2QSZA 6NULA 2CVZA 1EG2A 3AUFA 3WRXC 4OQYA 2JI4A 2D5BA 3HEBA 4QPCA 3FZGA 4YT2A 3BCUA 1J39A 1MB3A 2CXRA 4FTWA 4NCKA 4TLCA 1NQAO 4WZAE 4OTZA 4O0MA 1S89A 4OHBA 3FLAA 2H52A 4YJ3B 1MTOA 1VMKA 3NWOA 2YMMA 3B7PA 1BVRA 4JI0B 3T1QA 5BYKA 1KK2A 4OHRA 1RTTA 1FFDA 3WMEA 4IXNA 3U9LA 4YDHB 2O3QA 4DDHA 1B73A 3J7TA 4BFCA 5LMZA 2EBFX 1O94D 2VRWA 4KQFA 1WBBA 2A3NA 3RNOA 3AG6A 3TOZA 2OC9A 2D54A 4DB2A 4ZVTA 2LCQA 3ADKA 1WQ1R 3L6UA 4XYEA 3QLUA 4J8PA 4P7JA 3VM6A 4LZOA 4ROTA 4AUNA 3RVSA 1M7BA 1NJSA 1KO8A 3MD0A 3VVLA 1XXHB 4I5EA 4JUDX 4BQEA 3NRCA 2WAMA 2B2XA 1ZOPA 2X5KO 1S3SA 3DEHA 1JL3A 1CQIA 4ZAFA 1FLVA 1QUEA 1XMQB 2WHXA 3SLRA 2VTBA 5LQMA 4F6RB 5FUBA 1CQXA 1FTNA 1C3LA 3HKEA 4WE3A 3IJPA 4HZIA 3NHMA 3G8YA 4RHFA 3UAVA 3ZJ4A 3HM2A 1JKMA 3NTOA 4YRKA 2BM8A 3H6HA 4HB0A 5K0GA 2I4MA 4G0ZA 4MB2A 2JFUA 2GHQA 5HJ2A 4BZPA 5KCMA 3ORRA 4KG7A 5G4KA 1KNXA 2H4HA 3QX7A 1LI7A 4Q3OA 4ZV7A 5G0WA 1NP7A 2XNDA 2BMAA 3BIJA 4B9EA 3AIKA 5EJ4A 3WJAA 4KITB 3FOFC 2NVBA 2IXTA 5CURA 1V48A 1LK5A 3GEDA 3WFJA 5BWBA 1G8MA 4UJ3A 1II8B 1ZIPA 5CT4A 5K3CA 2QE6A 3BT7A 2AQIA 3K9QO 1X42A 3OQBA 2BEJA 1PV4A 3FDFA 5JVDB 1JE0A 2JB9A 2J09A 4QQ8A 3U3MA 1CUJA 3ANNA 4MTCA 2O59A 4B80A 2F3UA 1N7GA 1XCLA 1P1BA 3EXHB 1GA6A 1EXMA 2Y76A 2R2AA 3A9WA 3AIIA 3BTSA 2COUA 3DFFA 3LVBA 1BYIA 4X3OA 3AY7A 3TTSA 4YCCA 4DNOA 1FFBA 1RRKA 3J7AC 4CTKA 4N5IX 2IS2A 2YS7A 5JWOA 4OXYA 3T5AA 1WU7A 1RQGA 1Q3KA 4TL9A 3ZXXA 2DPXA 5KINB 1PL0A 1D2GA 3PPVA 2G9VA 4BEWA 3CIFA 1KYWA 2O8VA 8MHTA 1BQ3A 2WU1A 2ZAOA 2G08A 1DRUA 3A4YA 3BH7A 3DVRX 3D3WA 3K35A 1KJJA 4KQHA 2XB6A 2PV0A 3G8DA 4RENA 2R85A 2CK3D 3S2SA 3RC7A 4KGXA 2VDMB 2YVQA 1NXTA 2JJ2A 3L04A 3NBAA 3KYBA 4XCXA 5ALGA 3A3YA 3AUKA 3PDWA 5FORA 5I7WA 2DR3A 2P2SA 3KSUA 1WV0A 4W5QA 1N1DA 2AWOA 3BILA 4BJ6A 2YFYA 2Q50A 1XMPA 3KQOA 4YVFA 2E7ZA 5FI1B 3RK4A 3ZHXA 1A1VA 2B69A 3V8VA 1BG6A 3JPYA 4CLRA 1TXGA 3L4SO 3W2EA 3SEFA 5IG2A 4E5NA 4OO3A 5HF8A 4U7PB 2Z3WA 1OFHA 3ZV6A 1JI3A 3T3PB 2GAAA 5FJJA 1C3XA 3JQ7A 4P35A 4YJDA 3WRYA 2YYSA 2B1QA 1B0ZA 2P9ZA 2XGSA 3NTLA 1QF9A 1H0HA 2ZBQA 1SG6A 4U7WA 1EQ2A 5IT4A 2ZT5A 3SQDA 1GL9B 1GNRA 1S8NA 3KKMA 2DXIA 4IMJB 1MABA 1Z07A 2P9YA 1I3NA 1TVEA 1F6WA 2I1LA 3DCJA 2ZTLA 5LVAA 5EHZA 3KQNA 1LC3A 4B6SA 1SUIA 4U9UA 1Z3IX 3K1JA 4F4IA 4ZZ1A 1GZ6A 1IRXA 1U1DA 1NDUA 3LSYA 4UXIA 4II3A 3UMJA 3WLLA 4B31A 1VPEA 5GGXA 1EFDN 1MA0A 1OWPA 4KTVE 1H2WA 1SBCA 4MQEA 1KAHA 2C20A 2WM9B 3PUHA 3RUHA 3BAZA 2Q4BA 3N07A 3RBZA 3AF0A 1BE0A 2WM2A 3MWDB 4QNMA 3D8NA 5L7WA 4NENA 1GCUA 3TINA 1RPNA 1Y34E 3T61A 2BPOA 1G6HA 1RQLA 3TEFA 3WIDA 4EEZA 3U56A 5DTJA 4QDTA 3SHOA 5TEVA 4L0MA 4EZBA 2OVFA 3GJ7A 4ND4A 3UKJA 3U17A 4QTXA 5ENDA 4HS9A 3NT2A 4F6LA 1LS6A 2H54A 3IHLA 4HRXA 3UC9A 3V7WA 2QG6A 2VT7A 4DQVA 2OCPA 1LW6E 3QFFA 2BFMA 4HLUA 2BMFA 5H81A 1XRMA 4TS3A 2H29A 4LWZA 3WLFA 2B92A 1SFRA 1D8TA 1L7QA 4F4FA 3O4GA 1PHRA 1NLZA 2JFPA 3LYUA 2J1LA 2ORWA 2AEFA 3H0EA 3IRUA 5T67A 3I6ZA 4EBBA 2CMKA 3M9XA 1Y4SA 3TRDA 4AJJA 5DI3A 1P0FA 1E1DA 1D2HA 4K26A 4A8HA 3BGSA 4GP6A 5HKLA 5L4LA 1Y6GA 4UPEA 1CX9B 3VU9A 2CCKA 2Q6TA 1V96A 3SJUA 4EJMA 5MFZA 4Z4EA 2HI0A 2HRCA 1DRWA 4ABYA 1O5IA 2E2WA 3ILSA 3R9WA 1M76A 3CG0A 2O50A 2AG0A 5J63A 3C8ZA 4PINA 3TQOA 3ZZMA 5CCXA 2O5EA 5EYPB 1V25A 5HUHA 3NEPX 2I6UA 2QN2A 3EY9A 4QE3A 2V5VA 4ZOCA 1EVJA 2O5CA 3NIGB 3GJRA 1JFFA 3EMVA 1GFWA 4UU8A 4TS9A 3TIFA 3HY4A 4C1BA 1UIRA 5KVVA 4P4SA 3R8CA 1NN0A 3UIEA 5IASA 1TFUA 2NWQA 2UZ3A 4V0LA 5LWQA 1SBQA 4UULA 4C7OB 1KA9H 1NVKA 3ZDCA 4AZ3B 3GJ8A 3E22B 2BFFA 4JLNA 1F60A 2A0KA 4W1SA 2K4MA 2PUCA 1JU9A 2PMKA 1U7PA 3VV3A 5DYWA 4YP9A 2WHYA 2QRPA 2WVAA 2EKPA 3IC5A 3QBEA 1VLJA 2QRGA 3G0CA 2R65A 3MSCA 3AGQA 1O9GA 1Q57A 4YJHA 5BRJA 5EIFA 5MN5A 1O54A 2C4UA 2ZT8A 4G41A 3W90A 1PRYA 4IS3A 1Z33A 2OO5A 3UZUA 5JNWA 3F4LA 3KD3A 4NS4A 4OGWA 2XB2A 2B61A 3RTBA 1K63A 1V6CA 2BDTA 3QHQA 4M98A 4OGFA 1Y4UA 2P6UA 3DMTC 3ESDA 4QEZA 1Z16A 1U1FA 4RCZA 1HE3A 1KR2A 4DTIA 2XNHA 4FINA 2VK4A 4DSNA 4WJLA 4PVDA 1YOVB 3V7UA 4LI0A 4CEHA 1WEHA 3MMPA 3RJ9A 1S96A 1DKPA 2QYOA 2RHCA 1K5DA 1TYBE 4KYVA 4EY8A 3VDMA 3OQPA 3DQQA 2Y99A 1B00A 1TD9A 2BZSA 4Z8YA 2BI4A 2D8MA 3IPAA 1YZKA 4LG1A 4BO5A 4COOA 2Z6QA 3HJFA 4CIAA 1P33A 2VHUA 4Y2HA 1QVVA 2G9ZA 1PR1A 3JQFC 3VISA 1WZIA 1H5QA 4RM3A 3QUAA 4P83A 3SX0A 1JSRA 5ICFA 3B70A 1J70A 3T7CA 2RAUA 3AFHA 5B53A 4EECA 5A5DA 5BNWA 4MIEA 2GCNA 1WP4A 2R62A 3QKRA 221PA 1PE0A 4DRZA 2YZ2A 3AB7A 3C3JA 4WIAA 1Y9EA 3ZJTA 2C5GA 1VB5A 3VZRA 3L9WA 2G63A 5E7JA 3CPEA 5CB6A 2R3SA 3QVXA 4QSMA 1ACMA 3UH0A 4I5FA 2IYZA 2ETVA 1JKIA 2ZPUA 1O7JA 2P7IA 3P71T 3AF2A 4I6JA 4YJFB 5FULA 1ULAA 1WXGA 4OXKA 4RF3A 4YT5A 2FP4B 3WMGA 2JIDA 2WZBA 4GKAA 4H4CA 3R44A 5H59A 3U09A 3AKYA 2DEUA 1Q16A 1R27A 3RARA 3VPBA 4PRZA 2H2HA 3B89A 3H87A 4J3FA 4QXQA 3P9XA 2MSEB 4RF4A 4B3DA 1RHJA 3G2HA 4C4AA 4EA7A 4KXFB 1RWKA 5HEKA 1KMMA 1X39A 3FY4A 2AGVA 3PQ5A 5I7SA 2CE7A 4ZQIA 3TFWA 1YNSA 4JJAA 4CCSA 4OXQA 1KEZA 2IX3A 4B74A 4AJKA 4D8TA 3B8HA 2P69A 2QM0A 2HZBA 5CW1A 3V7FA 1ENYA 1QQ5A 4BGIA 2R4TA 3DC2A 3CSDA 3BCSA 2Y1KA 3Q5DA 2VUSA 5BSFA 1TEHA 4RPGA 1EGHA 5IWCA 4B3MB 1VG8A 2G06A 3OF3A 4WPGA 3U3JA 5G0UA 2OCYC 1N9KA 1M7HA 2EAUA 4Y2UA 2E3JA 1S3IA 1FRFS 3I45A 4AKSA 1IN6A 1H69A 2AFVA 3EZ2A 3ZY2A 1N78A 1BX1A 1WRBA 5T8KA 3WK5A 1PGNA 4AU1A 3PTAA 1C1DB 3LQYA 1ZOOA 1SIOA 1XQXA 1TK2A 4IJKA 2JKZA 5GV7A 4W5NA 3WLNA 2MMCA 3CLSD 4F8EA 4Y1GA 3GRVA 4NTZA 3LPDA 1U2DC 2OE2A 3C2QA 2ZFUA 4C3VA 1UKEA 3JWHA 1EWVA 10MHA 1KY2A 1GD1O 1B6TA 2OB2A 5GMOA 3H5VA 3QSYA 2NV0A 3AHHA 2YQ5A 3GR6A 4M1KA 4LVCA 5COQA 2R1VB 1QIEA 4DSUA 2PKYX 1N9GB 1L5OA 4GKJB 3C6ZA 3D4PA 5BRNA 4PLFA 1FQKA 1RAFA 4KACA 3WKAA 1Q7GA 1VE9A 1Q0HA 1SCKA 3EXG1 3O9ZA 2GEJA 2GEFA 2IPNA 3N76A 3QV1A 4P53A 3ES9A 4RK1A 5K0EA 4JQCA 4PYRA 4BO2A 2QMYA 5J3JA 3BJMA 2JAUA 3GROA 1CUCA 2IY7A 1HLDA 4R0VA 2CK3A 2YFKA 3ZBQA 2WAAA 3EA4A 3EMKA 4J2OA 1SEPA 1O89A 1JEDA 1VECA 2GPBA 3HDQA 1C4OA 3E7WA 5JUWA 3V7NA 3GVPA 1PBTA 1CUIA 1IY0A 1T2FA 1PJCA 3O83A 4KFTA 4TGLA 1MRZA 1Z7EA 2A58A 1A9YA 1KO4A 1I24A 4LTDA 1KEEA 3O3MB 3BBPA 3JASB 3L05A 3WBFA 2DWUA 4RIGA 4ENPA 2DPHA 5AR1A 5JXHA 4EJFA 4MP8A 3GAMA 2GDJA 5BSMA 2OXEA 4HBGA 5BN3A 3ZIAD 1OX4A 2Z08A 3TKYA 4ILKA 1F0NA 3AXTA 3KOOA 2ZANA 5BSRA 3RVBA 1M1NA 2QD4A 3UYKA 5DGTA 2ZUDA 4HDNB 4Z3DA 2V6GA 1QC5B 4UTPA 2F3PA 3GMTA 3B38A 3FNBA 2QE7D 5CG2A 5EWJA 1PJTA 2DWQA 2GN9A 2TYSB 4OQ4A 3VO1A 1DAPA 1PW7A 3NJRA 5A1JA 2WV7A 2QGFA 2ZSIA 1KKLA 3UHAA 2G09A 4JB0A 4E2WA 1YZNA 3RRBA 1B26A 2CWWA 3VHXA 3WGGA 1DAOA 1S01A 2IHJA 4B1FA 5EZYB 1D2RA 1VMAA 1V2GA 4PEVA 3SD7A 1X9HA 2EGHA 1TC1A 3LWDA 3V4OA 1PT8A 2VF4X 2VYND 4XB6B 3DD1A 3OX3A 4O5AA 4D9EA 3HCCA 3M4ZA 1FCJA 1KL7A 3K0HA 3LW7A 4QBHA 3NEJA 4RORA 3NUQA 4FW8A 4TM8A 5IDVA 3NASA 3KQSA 2I29A 4QJ3A 2NZJA 2QJRA 5L3RA 4IHJA 2PMBA 3P20A 3F1LA 2GPSA 1DQPA 4QJIA 4CFYA 3H11B 2VHZA 1PEYA 4CN9A 1W59A 3ZXUB 4JSYA 3LCJA 1NURA 2BEVA 3BWEA 3KKQA 4KVFA 5BT9A 3AM3A 2B37A 3EFEA 1NW8A 4YRGA 2W8ZA 1A88A 2ID9A 3I9OA 2ZJ8A 1REQB 4RK0A 1QO0D 4HFJA 5EINA 4ZGWA 3KYCB 5FTJA 4KNYA 4QYMA 4MGHA 2J3IA 1E3JA 2C7OA 1AQLA 3HNRA 3CYFA 1U4OA 3UJBA 2LVBA 2JLUA 3I23A 1N9ZA 3MRXA 2QPTA 5KMGB 4PQRA 8GPBA 1WDLA 4JT2A 4XFDA 5BMVF 1M2VA 2YWJA 5H4HA 1MP0A 2GTPA 1D2AA 2UXCB 1XTBA 4GZ3A 3DYIA 2AFIB 1BCRA 3TMKA 1U2SA 4OY3A 2CEAA 4MIOA 1UMDA 4IX1A 2QN3A 3T1TA 5K3FA 1VHLA 4DR3B 1TT5B 3IQZA 2VPXA 1L8AA 1NVWQ 2WF8A 2IT1A 721PA 4K9DA 3ADDA 2PE5A 3OTWA 4LRTB 1ISJA 2Q45A 2AZTA 4YMIA 3LGSA 3DLTA 4BRWA 4IOKA 2FEAA 3MERA 5CB4B 3RU2A 2YIJA 4YRTA 3Q7PA 3NXKA 5E3JA 4RBNA 3RO7A 1X80B 3WLIA 3INTA 2C4KA 2GTIA 3OJFA 3ORHA 5A4IS 4B82A 3QEJA 1ESMA 1YJ8A 5KYNA 5DNUA 1C7FA 1SWVA 2J9GA 3ECAA 2DFKB 3FCCA 3GFGA 1OZGA 2H8GA 3CLRC 1XIVA 3KR0A 1GV1A 1DINA 3ZNPA 4FXOA 1WXDA 2OCKA 1OGJA 5IK2A 4G5SA 2JAXA 1IQ0A 2TMDA 2L19A 3G3EA 1DC7A 1NX9A 1OIVA 1Q0ZA 2GD1O 2G70A 2Q4TA 3GGDA 4TRMA 3KKEA 3PXGA 2BGWA 4O2BF 2R60A 2XR1A 1DVRA 3TQRA 1K9SA 4MDFA 4GVXA 4WESB 1FFXB 4X1KB 3RVLA 2QZSA 5TY0A 3TW0A 2QLMA 1XVUA 4GPEA 3WC4A 4V0OA 1YD7A 3FMGA 2H7VA 1RYMA 2FMKA 5HIIA 1KP3A 1E0AA 1YQXA 1E1LA 1GRQA 3PP8A 2IHUA 4R2IA 1AGRA 1QMPA 1ZRNA 1E98A 3H16A 5THQA 3CF0A 3D0RA 3I4CA 1C2TA 3SYNA 2GPAA 4A5SA 2NNWB 1KVUA 1T10A 3M83A 1RYBA 2LZ0A 2ODEA 1ODCA 1S2NA 3AFIA 4FK8A 4N39A 2FUEA 3CLKA 3MLBA 3VZCA 1G5FA 5AHXA 1QQTA 2WFMA 1Y3BE 2BFEB 4O5OA 5YASA 4MGIR 4CBVA 1BDJA 2EIHA 1E2BA 4UHHA 4C08A 3IKLA 1WD7A 3RHFA 4GP7A 3L92A 4US2R 1VBKA 4I8IA 1JG4A 4FX2A 4L74A 3WI7A 4WZBE 2I8AA 1USWA 5FPSA 4C07A 5KTPA 1BXGB 1GA1A 1R4MA 4XVUA 3WP0A 4RD0A 4JYAB 1E5VA 2Z57A 3H5RA 5CLGA 3HXMA 3CZPA 2QNBA 4KQXA 1TQDA 2LIVA 1AKQA 4YRMA 1T2CA 1XJ0A 2GA8A 4KXNA 2LIPA 5K0BA 3HDJA 1UBOS 3IQEA 3TZHA 3KCNA 3M3DA 1E1CA 3RSSA 1D4FA 3HHPA 3JQ8B 3O74A 4X9XA 1TMKA 2C9MA 4CKEB 3UMGA 4HH4A 1CJUC 2DKFA 4C29A 4EB6A 2H2FA 4MMZB 5AHRA 5DXJA 1YVRA 2WU0A 4RGVA 5CYGA 2I6GA 2OL4A 3H5TA 3MT0A 4X95A 3GLGA 4EPTA 1VIAA 1WWKA 3CKYA 4QARA 4GU5A 1LDYA 1YCDA 1MGPA 4CKCA 5GJWC 1KZYC 3IHWA 3ABSB 1GG8A 1WW8A 3EISA 3GWZA 3JZAA 3VGPA 4BIIA 3IGFA 3G68A 3O4FA 4RXTA 4R1PA 5H02A 4MX8A 3TZ6A 4CUJA 4M9XA 4AUEA 2VF2A 3HZRA 4OFWA 2MYUA 2VP3A 4EMTA 4ZYXA 2JFXA 3VR5D 3WIOA 5EXDA 4MB6A 1OFTA 1LLQA 1I1NA 2ZJBA 1XRRA 3OKFA 2WHPB 5LQCA 2DE0X 3OFND 3HC7A 4QYIB 3P52A 4D74A 1U8TA 3HJNA 4ZHQA 1N2OA 2P91A 3EIEA 3HH8A 3O3NB 4IFBA 4NE7A 4B35A 3IEIA 2PX6A 3OTHA 2PD6A 1R66A 1M2KA 5BURA 3TLAA 1TYCA 5E0OA 6Q21A 3LBAA 2XD9A 4HDQB 2R7MA 3DJYA 1AV6A 1CFZA 1FUUA 3PLAE 2IPAB 3MCWA 1SCUB 3D0KA 4Z2YA 3AR7A 1SHUX 3A9VA 3B6JA 3GRRA 4AX4A 2IBTA 1RAIA 1SZJG 2ZP1A 5CK4A 2ZROA 3W5SA 4YAKA 1I7SB 3MJCA 1X1AA 2CD7A 2BFPA 1W96A 1IY8A 2H2DA 1I0IA 2H4XA 2HFKA 3E6AA 4RHYA 1OXXK 2QLJA 3LYLA 5EXXA 1IG3A 4OP2A 4OA8A 4X61A 3LPMA 4XKJA 1QLJA 2RKOA 2J5XA 3AZQA 4LVUA 3S2FA 4IOJA 1T9BA 5HDBB 3A25A 2M6KA 4C6RA 2WB2A 2AG5A 4HGYA 5M29A 2V6MA 4LOJA 4PSCA 5DH9A 4ZYWA 3KHTA 1MEOA 1IG0A 2PJUA 3VR3D 4NHOA 1BD3A 2R47A 4GG1A 2PZMA 4TV9F 4AM8A 2BFBB 3PE4A 5AVTA 3FRIA 4EA6A 5AIAA 1E3DA 4MVJM 4JYPA 4FFSA 4DJFC 4GXTA 4LHXA 2OQRA 4PYNA 2UXBB 4KODA 1HDOA 1H4VB 1KU0A 3T9DA 2D1RA 2A33A 2JFGA 1HQKA 4BO9A 3MUOA 1RU3A 3UJNA 3BA1A 2ZYTX 3MXOA 3AF4A 2PUFA 4ZT4A 4A73A 2KBEA 2CSXA 5CDYA 2EFHB 2QE7A 3K6SB 3UJPA 1DKRA 1NW3A 1RJFA 2IP2A 2AXQA 3TR6A 1XZHA 2B3TA 3NI2A 3P9QA 4PFKA 3ZU6A 1AS2A 5JD5A 3AIMA 4YCSA 4EGQA 4ZI3A 5FH9A 4TYWA 4PGGA 2G4VA 3THYA 3A8TA 2C9DA 1DJOA 2XKKA 4C6TA 2UU9B 4TKVA 1WL8A 4Q7JB 3LTEA 5E95A 1GP2A 2VO1A 2W4QA 3KKZA 5M3BA 1KRWA 4DILA 3UTDA 3DO8A 4K9KA 3ZZTA 3PVCA 5NLLA 5K3EA 2XUFA 3PEVA 3RRJA 4AT1A 3SG0A 3V8BA 4EW6A 4ZV9A 4DWVA 4RFSA 1C5KA 2YJTD 2ZYWX 3HJCA 4R8SA 3EH2A 3N2ZB 1P9WA 1ZU5A 5FA8A 4KLAA 4DC0A 1BHQ1 1T5OA 4RDXA 5HUQA 1OKKD 5AJYA 1TYDE 3O8OB 1FXWA 2IYWA 2IXAA 2VK2A 3BDIA 3O8DA 1GEGA 1N2JA 2ECQA 4LJSA 1ZN9A 1HL7A 4HAZA 3Q2KA 2HRDA 2ZIUB 4FGLA 4OI0A 4LRYA 3NKLA 2Z4SA 4Z0PA 2XGGA 2R6DA 4MJ7A 2I1VB 5D5QA 4MDEA 2EJWA 2IUTA 3LQKA 2Y27A 1Z2AA 1ZH6A 2Q5EA 3IKVA 4B6FA 4Q4LA 1WJGA 1LSJA 4BO6A 2YZMA 4RTQA 1STOA 4OM8A 1C1HA 4KXQA 2WFZA 2OLEA 5EXSA 4Y6GB 5CCEA 2O8DA 1U2GC 4NU6A 2PGOA 1W2GA 3OZSA 3CNQS 4GOJA 5CXXA 5E6UB 3R0XA 5EERA 4BRSA 3AHDA 4JLKA 2P9EA 3BD8A 4KUEA 1Z8HA 1T9CA 1SUSA 4ODIA 1DKQA 1K6IA 3UCXA 2VOEA 5KQLA 2OCGA 1N4AA 1Z88A 1COZA 4QBTA 4YRAA 5ESXA 1U3CA 3C7KA 5AKJA 5G53C 4D42A 1E2JA 1FTWA 3CUWA 5C80A 3ETLA 4N7BA 2AC7A 3EIFA 4QDJA 3TTYA 2XCTB 1ZQ9A 1CJSA 4MUFA 2LPMA 1O87A 2NZYA 1Y1KE 3OMLA 3LV8A 1TA4A 4TMVA 1E9AA 1SCQA 4OHZA 3BREA 4R40A 4P0TA 5HGJA 3I37X 1BJTA 3KJHA 4MK4A 3WZMA 3HDVA 3GLIE 2SCUA 2CHUA 1Q7TA 5JEDA 3W2FA 4DCUA 5IUJC 4PANA 1G60A 1YR9A 3AKCA 3AO0B 4I1IA 2QVCA 3FTCA 4PNPA 2OMKA 1SCAA 2CKDA 1CSEE 3M82A 3WKBA 5ALXA 2Q27A 5H1YA 5BN5B 4A91A 2FW1A 3EWAA 1XA3A 4JBGA 1KI8A 5JG7A 3ZHUA 3H2ZA 3WR5A 2FYTA 4CGZA 2GHTA 1NAHA 3F6BX 3NX4A 3TLKA 3A9SA 3USES 4V1CB 4QVGA 3DAOA 1A2KC 1JSLA 1O9BA 1Z5PA 1E5TA 2AMYA 1DC8A 2GCOA 4FD2A 4U7TB 2DQSA 2ZSJA 3C87A 3IB3A 5TQ0B 1HEUA 1YL6A 3K5PA 3U1BA 1L5HA 1ZNYA 2RBEA 4BMVA 5IZ4A 3AXSA 4A0QA 3WNQA 4NPAA 3ZY4A 3ZWCA 3QVOA 1YZLA 3OOYA 4ZO7A 3QOWA 4CLEA 1CZLA 1O95C 2CBGA 3W4JA 3QV2A 4ZU6X 1ZA2A 5L40A 3MCUA 4BVLA 3CU5A 3HL4A 5KKAA 1DUVG 1WCIA 1GGFA 3LQRA 4OOEA 2POQX 1W2HA 2AOUB 3T3EA 4AYXA 3PUVA 4TN5A 1W5EA 3HN2A 1QIFA 1LDMA 3VFDA 2H3EA 1Y8RB 1SZDA 1S2IA 2P0EA 2ZSDA 3RYHA 3UMFA 2HMTA 1MA3A 5JXJA 2BR3A 2JIOA 5A4AA 4OHYA 1VL0A 3IPXA 3SKXA 3PKJA 4JI8B 1AKMA 1HLGA 1E3LA 4GMGA 2I6TA 4JR1A 1MC4A 3QELB 4KH1A 1BHSA 1THZA 5TMBA 4L78A 2PEZA 1MAAA 1UKAA 1YL7A 4KQIA 3RGWS 2BEKA 1FFAA 2N75A 3BDVA 3SWWA 1N2HA 1R9NA 2TS1A 3D8UA 1OBOA 3E9ZA 3KEMA 5F78A 2IUYA 2RIRA 4R31A 3SCZA 3WK6A 1NVTA 5GADl 2Y0PA 3R3JA 4QTZA 3N74A 4QPNA 1RZVA 4JCCA 2PRKA 3A11A 1UR5A 3W2HA 1YVUA 1NF2A 3LT1A 1MT0A 2AWNA 1NM5C 3D6TB 3QXHA 1T9ZA 4HG2A 3MHPA 4U2FA 2AL7A 1I9CA 4LCBA 4M86A 5BPFA 2C95A 3LT2A 5U4QA 4JVSB 3ZCRA 1X15A 4B79A 4C05A 3GAFA 3MN1A 4B32A 1HT2E 1P1FA 2C1XA 2XGOA 2IHZA 4BNUA 4ZMRA 1EKXA 1URPA 4O8CA 4PS1A 2DBVO 5CYOA 4ZOLA 5EUQB 3T4UA 4EYSA 3DNPA 3JVEA 3U0VA 2H31A 3PGLA 3RSZA 1I7DA 5ED4A 2ZYGA 3NAZA 3EZNA 1EUDA 5DM70 1GCOA 1YDHA 3OFNA 5L6LB 3OY2A 3F3KA 2J33A 3VC1A 1E9CA 1V1MB 1N6NA 3IXQA 2IZ6A 5JDCC 2VBGA 3NUGA 1JDUA 1K6XA 3A32A 5KYGA 1BGXT 3ZU2A 2YFHA 1VE7A 4FFBB 1YA6A 1EHCA 1I2BA 1XLTA 4X7MA 2IYNA 4INJA 1VMEA 4OYLA 4P33A 4MWSA 4MVXA 4OQDA 4B84A 3I28A 1HDEA 3HABA 4ZK6A 1P80A 4N5LA 4HNGA 3GCGA 5HBGA 4F4HA 3AMVA 1WNTA 1V43A 3LFHA 1VM6A 1BKYA 3M70A 5FFFA 1HOXA 2ICAA 4GOOD 4KU4A 4ZVPA 1JB9A 4L4YA 2DY1A 4AP9A 2AHRA 1MB9A 1T5HX 5CDFE 1DBVO 3LOQA 4D79A 1T8SA 2D1SA 3SR4A 5BN4B 2Z9DA 5SV2A 1FS6A 2OTCA 1UJCA 1DRVA 3QLJA 5K4AA 5HP4A 1UMCA 3VR3A 4BZQA 4LX0A 3AR3A 4O3MA 1SXJA 4J07A 4RY2A 1I5RA 4E11A 1AZWA 1Q74A 4FEAA 4DIOA 1R50A 1GY8A 3N28A 2BR4A 1Q77A 2GVDC 1J07A 2W6ZA 4NVRA 5AVRA 4KHPB 3FKJA 4ENRA 3LXMA 3CR7A 2VP5A 3E7PA 3UN1A 1H23A 2O4UX 3KBOA 5JAIA 1JALA 1HF3A 3ASVA 3MUEA 4RPIA 4R9SA 2C2XA 2EIXA 3BC1A 4OP3A 4C7BA 4Z9FA 1ECPA 5KTNA 3FN4A 4B09A 1G42A 1BE8A 3AOEA 1K66A 3VJMA 3IAXA 3KHUA 3P4YA 4FEEA 4Q1EA 3T15A 1MD9A 3GA0A 3I4FA 4HRYA 1LF5A 4C4ZA 2X8LA 2X0IA 1APBA 5E6RA 4XDYA 4ZMBA 2QJTA 4G4SP 4KYTA 3TX6A 3DULA 2KPOA 3JTEA 1V8OA 2ZIXB 4R9VA 5EMKA 2FDRA 3IKMB 1OI4A 4B5KA 4EHJA 1CUSA 4MV1A 1WP9A 5I8ZA 3RVNA 5KVAA 2BGKA 2OLKA 5LCXA 4R9RA 4H7EA 2TECE 4RZQA 4UEOA 4PFSA 2BEUA 4NBSA 4UMVA 3SSOA 2E48A 4D4IA 5JRDS 1W0CA 3VOBA 3OQIB 3WYAA 3I9MA 3QENA 3A6HA 4O02B 3KAQA 1QGUB 1WULS 2YXBA 1H9CA 4MR9B 4Q6BA 3L8MA 4AJOA 2VSOA 3AVOA 5DEIA 3R20A 2W4IA 1T5TA 1GSOA 3QKSA 3SU8A 1PJBA 4BX9A 5JNUA 4PWZA 1JWBB 1P0MA 4NJOA 4PNEA 1G0NA 1ORHA 4P32A 2ZJYA 3AVTA 3MTEA 1L8QA 1SPBS 2A4KA 1CZHA 5CVVA 4IRXA 1OKKA 4GBMA 4OXRA 2ODPA 3W34A 3OPYA 4B48A 3ZWAA 4D7AA 4NATA 2JFYA 4U63A 2XRZA 3EDRA 3ENVA 3P1JA 1W1WA 2NXWA 2OGZA 2ZBVA 2AG1A 3RAPR 3T0FA 3H17A 3OAAD 1E58A 3K30A 4KFSA 5I7OA 4XUEA 2ZSBA 3FFAA 5KOJB 5E4YA 3IALA 4G24A 3WGKA 4BJ1A 3AERB 3O7WA 4HXGA 4M0MA 1YXMA 2FWRA 4AF6A 4EGJA 1H6AA 1XYYA 4TQUS 2J7PD 3UAOA 4RJ2A 1NVUQ 1RBZA 1E3MA 4RESA 1U7HA 1HX7A 2VNAA 1II9A 1U28A 2DHRA 2WQZA 3C3CA 2C5AA 4GEKA 2F9LA 4XSGA 4C78A 5I7HA 2R4UA 1W581 1U90A 3FPGA 3RK0A 1ZCZA 5BW5A 3RFCA 5ARDA 4DTCA 2G40A 2FSSA 2EVWX 5JMOA 5DHAA 1VIVA 1PFVA 5HE8A 4DHEA 4GBJA 4AJIA 3GFTA 3ADPA 1RNLA 3AL2A 3LKBA 3WWEA 3JQ9A 1GRRA 1WXQA 1FTGA 3C6XA 1AA6A 2WQ7A 1VZ3A 1JT9A 3ZV4A 1ABFA 4BBAA 3HUTA 5JXWA 1A9SA 1JZTA 2Y92A 1O6CA 4MTLA 4YMUA 1M75A 3DHYA 2DBYA 5A3RA 4HXEB 3SEAA 1QQAA 1UBSB 1LPBB 1YBVA 2KE5A 3H7IA 5IP5A 3FYTA 5I6DA 1WO8A 3S28A 1Z7BA 1EQUA 3AVUA 1RMTA 1X9IA 4EI2A 1IAQA 2XYQA 4Y9RA 1PLJA 1K3UB 1R0BA 1VG1A 4FUTA 2IZ7A 4MR7B 5AD1A 4YV0A 5CITA 3HXQA 1SR8A 1ID8A 4F3YA 1J8FA 1KO7A 3F7OA 3GEPA 2NPOA 2MSKA 3HR4A 2BZ1A 2V9CA 3DS8A 5EE3A 3ROFA 4DWWA 5I45A 3NMUF 4WKCA 4ZYTA 2G4CA 2FPGB 4GLLA 3D43A 1HPLA 5TGTA 4GLOA 3DG9A 1TO1E 4CQLB 1OPXA 3Q2OA 5BWNA 4FE3A 2OO7A 1MPTA 3L8HA 5LA6A 1K86A 3IQDB 3B82A 2OPHA 4CDNA 2XE7A 5KYWB 4P82A 4KV7A 4JJ6A 2Q2NA 2O07A 3HS3A 3E4DA 4I1PA 1BE1A 2X13A 3RSLA 1A3CA 3M7IA 4RMIA 3F8SA 4JQZA 1Q92A 1GN9A 1WB5A 3LK7A 3ZV5A 2E4WA 1AHPA 3GGOA 2CBXA 1Q6YA 4KI7A 1I5OA 3KNZA 5AKKA 1Z8FA 2WWFA 2X58A 4MKRA 1T36B 2WJZB 4DGQA 5DULA 5TV2A 4DA8A 2O3JA 4S0XA 2VZLA 1L4UA 1UXOA 1C4KA 2DPGA 2NXJA 3GFFA 2NQ2C 1EK6A 4PPNA 4URWR 1AHHA 1I9GA 3B3QA 2GXSA 3GJXC 5BV0A 2KHZA 2CL5A 3K92A 5ALQA 1S8OA 3EXFB 4MCAA 3QF7A 3LBFA 3CY6A 1ZA1A 5FXMA 4W6ZA 1ACLA 4NU0A 3IJEB 4MA5A 4MRNA 2QN6A 5DLYA 1PUXA 5IZCA 3GCWA 5DB4A 2GXQA 2YHIB 3WL5A 4UOZA 2FSIA 3O47A 5CLIA 3Q88A 4Y9SA 4MQMA 1PNRA 4O2AA 4C43A 2V7UA 4U3JA 1V6SA 2ONCA 3N2IA 5H4GA 1Q14A 2FJ0A 2IU3A 3UJAA 5I7RA 1FTYA 4G0XA 5EIOA 1VJ5A 3ZWYA 3G9QA 3URMA 1XTKA 4EHBA 1CHDA 1X7XA 2ODTX 3X1JA 4M60A 1F8XA 2NT3A 4QO8A 2I67A 3ZV3A 2B7BA 4F93B 2VTEA 3FPBA 1JFLA 4N0EA 4PFJA 4AXXA 1WCWA 3F3SA 4NH0A 3IP8A 4MVJE 1VBMA 4NPCA 3CVWA 1F20A 1PR2A 1GPBA 4JHLA 4FR2A 3L6OO 4BB0A 4F86A 1L7EA 2C9YA 2YN2A 2VJMA 1VE5A 4M8KA 1E8MA 4XLZA 1NMEA 2XBMA 4S1WA 1DTWA 1F4VA 3NQ41 1C3EA 1QCYA 3SHFA 3WBBA 2WJYA 3D02A 3NFYA 3GNSA 3LQFA 3OKCA 1PX0A 2E6KA 1DWQA 2XDWA 1O6BA 5CJ2A 4QTYA 3OMXA 4DDMA 4EAAA 4QGHA 4YCNA 1KI6A 1Z7GA 3LP6A 4P93A 2FETA 1ZLYA 2ZSUA 2FWPA 4YRQA 5E4TA 2A2ZA 4GKKB 3CVVA 3NH9A 4UZFA 1QAMA 3INYA 5IVIA 4BLUA 1ZJWA 1OI7A 1YE3A 2C4WA 2H5IA 2NGRA 1J2TA 4G25A 1J33A 1IBRA 2AMJA 3G2QA 4Q82A 1QHHA 4CM8A 4EHHA 3BXHA 3IPRA 2O8CB 5I7VA 3DBRB 5CNMA 3W9BA 3GPBA 1FSSA 1Y8QA 3ZQ6A 2VUTA 2UYHA