3R20A

Crystal structure of cytidylate kinase from mycobacterium smegmatis
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
217
structure length
217
Chain Sequence
SLVVAVDGPAGTGKSSVSRGLARALGARYLDTGAMYRIATLAVLRAGADLTDPAAIEKAAADAEIGVGSDPDVDAAFLAGEDVSSEIRGDAVTGAVSAVSAVPAVRTRLVDIQRKLATEGGRVVVEGRDIGTVVLPDADVKIFLTASAEERARRRNAQNVANGLPDDYATVLADVQRRDHLDSTRPVSPLRAADDALVVDTSDMDQAQVIAHLLDLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
molecule keywords Cytidylate kinase
total genus 82
structure length 217
sequence length 217
ec nomenclature ec 2.7.4.14: UMP/CMP kinase.
pdb deposition date 2011-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3r20A00
4M9QA 1CJVC 3LLUA 1JECA 3REGA 1OHHA 4MKIA 4UNPA 2IS6A 4L4UA 2WMOB 3PUZA 3FTQA 1M74A 2OCAA 3K70C 2H16A 4XIGS 821PA 1GSIA 3VTKA 3PENA 3ZLJA 2ZI6A 1ESNA 2IHYA 3K09A 3LX5A 3B1XA 4OBEA 4CEIB 1I4DD 1KI9A 2V7QD 4DLSA 5CYOA 4S2EA 1NY5A 2XTNA 3A1UA 4ABYA 1VG8A 3K9GA 5DI3B 2IYRA 3RVBA 2E1RA 3SFZA 3NEYA 1TF2A 2ZJAA 2FFAA 4TLAA 2QZ4A 2K5UA 1KHTA 2Q3HA 2IS2A 2WBLC 1TPZA 3NC0C 4HLCA 5GJVC 3FHCB 5L3RA 1G4AE 4P4TA 1R10A 2OM2A 3UANA 5D3MA 3BGWA 1LFDB 4B35A 1XJ0A 3AP2A 1NY6A 1W5SA 3QF4B 1D2NA 5J5CA 1NJGA 1NN1A 2J0VA 5AJYA 3WP0A 1NVWQ 4Z51A 3O8DA 4BRUA 4F4CA 4LHXA 2JLVA 2PT7A 1EFRD 3T5DA 3HDTA 4GBMA 3ZS8A 2CHQA 3K0FA 1KO4A 2HLDD 2GKSA 3MWKA 1FTSA 4QBHA 3VAAA 5FUWA 2P0EA 3PVSA 4R2HA 2ECKA 2EFEB 2JLRA 2ZRIA 3I8SA 1OH5A 3VU9B 1UBCA 2ZJZA 1E94E 4JVNA 4Q21A 5JHGB 1FMLA 1CXZA 2ZI5A 2GBLC 2ZS8A 3L0IB 1OIWA 4BE7B 2EW1A 4D4JA 2BDTA 3B1ZA 4G3XA 2IYTA 1OH6A 1E0KA 1Q12A 1QHGA 2FNAA 1M7BA 5EJEA 1ZM4A 1RKBA 3KQUA 3KTAA 1SVKA 2J87A 3CZPA 3WNBA 3Q9LA 2YOFA 2AN9A 3BJIC 4YLGA 3R7WA 2GK7A 3U3RA 1II9A 4MYTA 3VQTA 1XTRA 1ZU4A 4G0NA 4TYWA 4EPWA 2BCJQ 4AIIA 2VYFA 1R4AA 1DAKA 2YWFA 4LCBA 1ZM9A 4URWR 2EYUA 2A2ZA 3EW9A 3D3QA 3SC3A 1UKZA 2CXXA 4MITA 4P31A 4PQRA 4Q48A 3WNCA 3B78A 2OO7A 1FW6A 2J7KA 1E2MA 3AVQA 3L0OA 5P21A 2AWNA 2ZREA 1FP7A 2KSQA 3CPJB 4JVSB 4DB2A 4P4SA 4O2RA 3AV0B 5CLLA 4PX9A 1CBUA 5EE1A 2OZEA 1HYQA 2HV8A 3EZ7A 1SKQA 1P2VA 2OUKA 2OFWA 3SQWA 4OHWA 1EWRA 1CU1A 3GJ0A 2UKDA 1D9XA 1ZP6A 1WB9A 3KQKA 4N0DA 2ZSEA 2V3CC 3FHOA 5FL3A 1KSHA 1VYTA 4AI6A 1XJQA 2X2FA 2IYYA 5D3QA 4AG5A 3LQRA 5JZVA 1OLOA 1W0JD 1X8LA 1MO5A 4HZUB 3O8RA 2W6JA 4NZYA 4DZZA 1G3QA 1JALA 3EPKA 1NVXQ 1T91A 2IT1A 2RMKA 1HQYE 2DR3A 2GXUA 1NP6A 1W4BA 1OV4A 2G1KA 3IPXA 5GJCA 5LD2C 3OE7D 1ZM7A 4CEHA 4AKHA 3CLVA 3LY5A 4QG7A 3E5HA 3U3KA 2QAGA 1XMVA 4KVAA 2BMFA 2ZE8A 2ZRNA 4EJSB 4URXR 2JAQA 4JBXA 4U5XA 4HYYA 1P2SA 3T1QA 5IK2D 2R44A 1NN0A 2JIZA 1EESA 4Q4HB 1YU9A 1GRNA 3ADDA 2ZRBA 4HAUA 1GL6A 1E0JA 4JYBA 1P9RA 4AURA 1KKMA 5LPNA 1DAHA 3DZDA 4F4JA 5CK4A 1GKIA 1YJ5A 4LJYA 2ZVPX 4LYAA 3KKQA 2FE4A 3P26A 4KU4A 4HB4A 3SJCA 1E79D 1XPRA 3PCRB 1VKJA 2I4IA 3AQ4A 4HUTA 5CB8A 2C9YA 2R6FA 4M53A 1EX6A 1GAJA 5KO2A 3AVUA 2C96A 4DDWA 3EX7C 4B6EA 4PHGA 1Z22A 4LJ7A 4Q18A 3UKDA 2ZJOA 4OYHA 5JHHB 1MO6A 1JNYA 4H9GA 4BFZA 3TNFA 2RGNC 4A8JB 1OJLA 3LBIA 2HUPA 1KYIA 3T35A 2IUTA 1KI8A 4LHVA 1KK1A 3GFTA 2ZUDA 2FJUA 3Q3JB 1XMJA 5IHPA 2YOGA 3GJ5A 2QAGB 2WAXA 3S1AA 4BZXA 2QMHA 2XZOA 4G5QA 1FFHA 2IK8A 1N6HA 4DB4A 1Z0IA 4TYYA 4NHOA 5JCPA 3AVWA 4CVNA 2WOOA 1FQJA 2RH5A 3FKSD 1UKEA 2YKGA 5CLQA 2A5YB 2GXAA 5HE9A 2ZRHA 2QGNA 1XPOA 2WJJA 1JR3E 4TYNA 4IDQA 3K0CA 3CNOA 3GLGE 1N5JA 2ZYUX 3GJ7A 4ZV4A 5C2JB 3CRMA 2Q9BA 2R9VA 4HAYA 2HDNB 3IPYA 1PLJA 2XNDA 4ZKEA 4YONB 3RANA 2QTFA 4RD0A 1RJ9A 5EP2A 1MH1A 1Y3AA 5EXXA 5TVKA 3X2SA 1F5NA 1N6IA 5DI3A 1LVGA 2G0NA 5KSZA 3LAWA 5CM8B 3TAHA 2DYKA 2OE2A 2J45A 5FFMA 4Q01A 2FWRA 4DT1B 2PZEA 1VG0B 3BBPA 1ZNYA 4JBYA 1GDDA 4DSNA 5JMTA 5FI0B 3AF4A 1OT3A 3EASA 3ZQJA 4ON9A 5AUPB 1CF4A 2G88A 3K8YA 4LBWA 3MMPA 3R8FA 2O8BB 1N6KA 3IHWA 1KZGB 2J1LA 3TQCA 5DO9A 3ZJYA 3VNVA 1NNEA 5FBQB 2C77A 3G0HA 4P32A 3MRSA 3GP8A 2QM7A 4BPBA 2OAQ1 3EA0A 3G82C 1L4UA 3B9PA 1FUUA 4DBLC 2AD1A 3FOZA 1KI3A 1VCNA 1LNZA 3CNNA 3CKLA 4RZUA 4R7ZA 4ZCIA 1I4TD 3AP1A 1GOTA 4IDHA 2YOHA 2W6ID 1U2RA 4KHZA 1M2OB 2JLUA 1AZTA 1RYHA 3BK7A 4M1SA 1N25A 3QVUA 3RAPR 4GSYA 4MGKR 2GZHA 2NG1A 1GFIA 3AM1A 1G291 1UKVY 1ZC3A 3D6TB 4D26A 2I3BA 2NPIA 4GMDA 5LBIA 2VIIA 3CX6A 1YR8A 4DCSA 3FMPB 5FI1B 4BECA 4M4SA 1XMIA 1YR9A 2YWEA 4N1AA 4AYTA 5AUNB 4AD8A 1E2HA 4LSGA 1S3GA 2ZUBA 1CKEA 3V00A 3K70D 2CCKA 2GETA 3KJGA 1K5GA 1XBTA 2EWVA 2V9PA 1EFUA 4LPKA 3SHFA 2ANCA 4A2PA 2V6IA 1OXXK 1P72A 2ZRCA 4M9XA 4PZYA 2W83A 5ANRB 3U44A 5DYGA 4CT4B 3CIOA 1CRQA 4M1KA 2ORWA 1A7JA 1G3IA 1LTQA 2Z6VA 3O8BA 1Q3HA 5DHFA 1Z0KA 4PQYA 1W4RA 3FMFA 1RPZA 4HAVA 4DSOA 4QM7A 1EFRA 2ZANA 1XEFA 1U0LA 2BWJA 4JS0A 4NYJQ 3GFPA 1BMFA 3CRRA 4WXPA 2WZQA 5EE5B 3RSLA 4D80A 4ZIRB 3U7FB 4O0MA 3CF0A 4DWJA 1W0JA 2VHQA 4YMTA 1FL9A 3C4JA 4MRSA 4OQXA 3F8TA 4TMVA 5FL7D 2OEPA 3F3YA 2IYLD 4GP6A 5HKKA 2CBZA 4KCGA 1NL3A 3QPUA 1JR6A 2GBLA 2AWOA 2Q3FA 3LDAA 4C0BA 1UBFA 1KK0A 1UM8A 4PC3A 2ZRGA 1G1MA 4EQ6A 3BH0A 2B8WA 1N6PA 3K0AA 4LJ9A 4TL8A 2JJ8A 1MOZA 1OPXA 4FMBB 4PHFA 2DCUA 4RCYA 4FMDB 3OFNA 4KSBA 1GNPA 1T8TA 3N2EA 2XOKD 4LBVA 4GI7A 3KFXA 2GTPA 4B2IA 2CE2X 4R71A 1G17A 2GJKA 3AGQA 2P67A 3FMOB 1P60A 4NONA 1VMAA 3JVUA 5JWRA 4KO8A 1X3SA 2PJZA 3BH6A 2W6JD 2BIFA 3DKPA 3BAFA 3PR1A 1W2GA 1XX6A 5J4KA 4DJTA 2X8AA 1CR2A 3PG5A 1NVVQ 4PPNA 1KO1A 2WPDA 2R6AA 3FVQA 1FNNA 4MRVA 5C1BA 3AP3A 3EWSA 1UADA 2NO9A 4LUCA 4X8OA 1AGRA 4A0FA 1F60A 2XXAB 2F43B 1H8ED 4NL4H 2C2HA 2W2VA 4LBZA 2OFOA 4JBWA 2AXPA 3H0KA 4W5JA 3KKMA 4P0TA 1JPJA 1E1QA 3LVRE 4JL8A 4NE2A 2O8BA 1P2UA 3K09C 5AJVB 1XFAA 1ZIOA 4YXWA 4V03A 2FPLA 5IDVA 4EFLA 5JECA 4QNMA 1VTKA 3MGCA 2E87A 3NH6A 4RVCA 3VHLB 3DM9B 2BJVA 3NTUA 4D82A 5KNDA 1N5IA 1FZQA 1GITA 2ZSBA 3THWA 1QG4A 4LHWA 2Z83A 3HU1A 4FMDF 3WHLA 4AY2A 3JZAA 4WOPA 3QXJA 3EG5A 4CYMA 1E69A 1RRPA 2QT0A 2MMGA 4GPTA 3Q5EA 4DLYA 3NXSA 1Z0FA 2C95A 1WE2A 3PEWA 1E9EA 1FNMA 1HURA 4KYIB 1F2TA 3QG1A 1CJMA 4HSEA 4QBIA 1GILA 1UJ2A 3I3SR 4B44A 2ERYA 3X1XA 3UXMA 4LY6A 2P5TB 2R8RA 1XCMA 2FGJA 1TL7C 3OIWA 4K81B 4LK2A 2JLXA 5C4GB 1TF7A 5J4HA 5DHAA 3MJHA 2G6BA 3OAAD 2XAUA 2D62A 4TQUS 3RHFA 3L2OB 2XZLA 1FUKA 5IF9A 2Z0MA 1TU3A 5H68A 4B3XA 3ZQ6A 4GDFA 3I73A 3KL4A 4U00A 1W0KA 4BFTA 1Z63A 3W8RA 3NDBB 1MR3F 4LJ6A 3CM0A 2BM0A 2NO0A 3BWDD 1NLYA 3WY9A 3TUZC 3U7HB 3ZVNA 2ZI4A 1E9BA 2GEDA 4Q9HA 3KUDA 4QBGB 3N70A 5KNBA 4BLQA 4UKDA 1NVVR 2F9MA 5JS7A 2F1RA 3IDQA 4AYWA 1US8B 1BH2A 4AK9A 3KXIA 4KLZA 4LZZA 3FWYA 3MWJA 2JLZA 1FX0B 2B7CA 4Q02A 4BFXA 1KTVA 4AKGA 1XD8A 4XD7A 5SZJA 4TMXA 1KSJA 5FTNA 3GLIB 3BE4A 2YJTD 2QI9C 3SQXA 3B85A 4TWZA 4NYMR 1P73A 4IOLA 1W36D 2JDIA 2WWIA 3RYTC 5CIQA 4PC1A 4HZIA 2JLQA 1G8FA 3SJBA 4CEJA 1VPLA 5AK0A 2GESA 1E3MA 1KNQA 3T12A 3B2EA 3GPLA 2YZ2A 5FOXA 4C9BA 4RZXA 4RD6A 4BUJA 4NKRA 2ONKA 1W46A 2VHUA 1CS4C 5F2EA 3A1SA 4S35A 2WKQA 3LQQA 1UBEA 1ONBA 4QM6A 3C15C 3K0EA 4B32A 1HA3A 2VQSA 4Q1EA 3PEVA 5GJWC 2CL0X 1ZJ6A 3K70B 2VH5R 2XJ4A 5CDFE 1EFHA 4NYMQ 3TMKA 5JSZB 1EK0A 2G1JA 2NGRA 5A5GA 2QBYB 1HH4A 2VP9A 2IWRA 3DOEA 2H5EA 4R9UC 5LDDC 1MRNA 3W8NA 3GD7A 4V0ME 1NLFA 4KAXA 1KY2A 5IT5A 2GXSA 4B48A 3ZGXA 4LJ4A 4MRPA 1VHLA 3GEEA 1IXZA 1DOAA 1BO6A 1RFLA 2W0SA 2IW3A 5SZHB 1CR1A 1ZNXA 2FPKA 4HAZA 4QGGA 1YHNA 4TMKA 1P9WA 2FSFA 4KI0A 2ZJBA 1QVAA 2WVJA 1G3UA 2GCPA 2WWGA 4JLJA 3PUYA 3TW4A 1IQPA 3D31A 5BWMA 4TTRA 4CEIA 1Z0AA 3NG1A 5F9FA 5HTKA 3KQLA 4RFSB 3P27A 2EYQA 4HDOB 4FD2A 4LC0A 4RD4A 3P32A 4UNNA 2QPOA 3RNLA 4KFTA 5K8LA 1ZW6A 2OLJA 2OXCA 1B0UA 1DO2A 2V8OA 2ZITA 3AKEA 5EUQB 1W4AA 4Y0AA 1DAEA 1YVDA 3MFYA 1D5CA 4XOIA 3PEYA 1S0UA 4M8NE 4OK3A 4ARZB 1I2MA 3W3ZB 5KHOC 5FL7A 4HAXA 4P4SB 4UXIA 5FOTA 4GOXA 2XB4A 3GCGA 2XTZA 4DLRA 1G18A 2MSDB 3KQNA 2BBOA 1LY1A 4IOJA 4FINA 2LCFA 1E2JA 2FN4A 1K6MA 3TJZA 4KBGA 4A82A 3LXXA 5F3WB 4OQLA 4GZMA 3RLFA 1LS6A 2FEOA 1DE0A 1XEXA 2OLKA 1KSFX 3HR8A 2HLDA 2NZ8A 1HE1C 2QNRA 1II8A 3BFKA 4UQOA 1P4SA 4US0R 4X8LA 3BB3A 3QKSA 4KV9A 3RC3A 3QVVA 5B64A 3EPHA 4RCZA 3RS3A 3PIRA 3KTAB 3ADCA 4UNQA 3SNHA 5EP4A 3KZ1E 1SKYB 3SYNA 3B6EA 1F48A 1M7GA 1TQ6A 3CBQA 3CO5A 2PEYA 4JLKA 4HUQA 4D4LA 2JASA 2LKCA 2GF0A 4IW3B 1KI7A 3S1AB 5JSZA 5KYKA 1V5WA 2B21A 1AIPA 2O0HA 1Z6TA 3KXLA 1IN6A 3K9LA 3NBFA 1SGWA 1UDXA 3TE6A 4BEBA 4D0GA 1X8KA 4KBFA 1IAQA 3I61A 2FV8A 4JYCA 2O8FA 4Y0VA 3T34A 4PZLA 3UG7A 1FOEB 4PPQA 4BLTA 4G5OA 2AR7A 3LNCA 4M1YA 2PZFA 2QMOA 5M04A 3LXRA 2VL7A 2GILA 3VKWA 1G7TA 1XTIA 4CIDA 4US2R 1DELA 1SXJC 3GJ3A 3IQWA 5FTKA 3SJAA 2J9RA 4DSUA 1R0XA 2IYXA 1C1YA 4BLSA 5L8VA 4LBYA 4YMWA 2HCBA 2FFBA 5LB4A 2YC2C 4B74A 2ZI7A 1NN3A 5B2ZA 5EUMA 1Z47A 3ADBA 5FUVA 3SYKA 1G16A 1NG1A 1NLZA 2QORA 4B71A 4AG6A 4M1WA 3L43A 4NTZA 1MKYA 2P5SA 1JPNA 1DO0A 1S8FA 1T0JB 3DMNA 4XSGA 3AF0A 1GNRA 1QHSA 1TQDA 4GFDA 4HB3A 1IONA 3B9QA 4Q4LA 4LJAA 2OILA 4PAQA 3AVTA 1PLLA 4CEHB 1Q21A 2D06A 1JBKA 2V4ZA 1R6BX 2C5LA 3TLXA 1Z28A 4OI2A 4C0AC 3VR6A 3OZXA 1T9HA 5FR2A 4ZPXA 3NIBA 1AJEA 4Q1BA 1R5BA 4HB2A 1CR4A 2ZI9A 4GZLA 3RRYA 4X8HA 1IOZA 5E7IA 3VR1A 1MO3A 1OFIA 3CF2A 2GJ8A 5CDFA 2W2XA 2CVHA 3E1SA 1KI2A 3PUVA 1E9CA 3I4LA 4PPGA 1DAMA 1S96A 5FPYA 2ONJA 3TUJC 3U3MA 4DLTA 2BC9A 4A8JC 2C04A 5KOYA 1E9AA 3WYAA 5DNYB 4LPSA 1AA9A 4IDOA 1ZU5A 3VKHA 5TXGA 4M0LA 1XXHE 4RZ3A 1OYWA 1G41A 6Q21A 2ATXA 2VHCA 4BRWA 1L7VC 4V0NA 5FR1A 5TB5A 3THXA 4TL9A 4Q00A 1AQYA 4IRUB 3DM5A 1NSTA 4Z54A 5EP3A 1XF9A 5KPDA 2NO6A 4IEIA 2H1LA 1SVOA 2F43A 5EE0A 3EC1A 1N6OA 3R9WA 1LF5A 2OSBA 1Z8FA 3GJXC 4DCVA 4A1FA 2AL7A 3ASZA 4XD7D 1FMJA 2VHJA 2ZSFA 2REOA 1JR3D 2FPMA 4ZI2A 2VA8A 3WMGA 1BYUA 2QPTA 5HR5A 3THXB 1Z29A 2Z43A 1E2EA 2MSEB 3VR3A 1F3OA 5LD2B 4BFYA 1IHUA 4B43A 3NBXX 5TARA 3THOA 4MUAA 3OEHD 3LRPA 3ZVRA 1SKYE 2IF0A 3HU2A 2Q0HA 4PFSA 3F0TA 4D6PA 3DHWC 5H1YA 3T1OA 421PA 4ACAA 3IIMA 4L15A 3AVPA 5SZIA 1VCMA 2G0TA 1BOFA 1NIPA 4K46A 4Q5IA 1R0YA 2GNOA 2H8KA 3KFVA 2BEKA 2D74A 2BKEA 5TY0A 4DLUA 4MYCA 5EXSA 2XB2A 1KIMA 2Q21A 1NVUQ 3LW8A 1YZLA 3OHMA 4PHTA 4PZZA 2IUUA 4YDSA 3SOPA 3T61A 4Q03A 4PR0A 3RRMA 2FDCA 4DRZA 3CRVA 1KNXA 1W1WA 2DWOA 4BFSA 4F92B 5FOVA 2BEJA 2WSSD 2QMEA 4HLUC 4PSVA 1KGDA 3UWOA 1CULC 1DVRA 5G3YA 3WBJA 3RABA 3ZS9A 4QJ3A 3PITA 4PC7A 4UNRA 4BZQA 4RD3A 4K8OA 4LJ5A 3FMIA 1IM2A 2CL6X 1R7RA 2Q6TA 2WICA 3A8TA 4DXAA 1I2DA 3W6NA 3ZD7A 2QSYA 1XJCA 5FUYA 1E32A 1KO8A 1GVNB 1QF9A 1S9HA 4DLXA 4XWKA 2WAYA 1T5IA 2P65A 1Y63A 1L4YA 1JAHA 2V55B 1KJYA 3NBZC 3ZVLA 1DG1G 3W6PA 4ZIRA 4BQSA 1KDOA 3KKNA 1A1VA 3VU9A 4WXRA 4NU0A 3EIQA 4FCWA 1OIXA 1KDRA 2JJ1A 2PX0A 1RRGA 2YNMA 3AKYA 4V0KA 1Z07A 3U6BA 2BMDA 3R9XA 2EFGA 3W90A 3C5CA 4QHYA 4XTRA 1Q1ZA 2BOVA 2X19A 2VHTA 3ZIAA 1ZD8A 3MD0A 3WP1B 2ZEJA 4A6XA 4NYIQ 1JR3A 3SJZA 3GLGA 3CH4B 2ZRJA 1T4GA 3UMSA 4HUQB 3T1TA 4C0JA 4OK6A 3MCAA 3KQHA 4TQAA 5F9HA 3GFOA 3U5ZB 2R62A 4V0MA 3C14C 3M0EA 1W36B 1NIJA 1R0ZA 1NKTA 3EARA 1KK3A 4XVRA 2VP6A 5DN6A 2ZROA 1U99A 1TUEA 4N3NA 4B47A 3QIAA 4MGYR 1YZQA 2HT6A 4LHZA 4OL0A 5AR1A 1J70A 1AQUA 4A4DA 2A3RA 2H7VA 3DPUA 2VO1A 4DEYA 4HB0A 1E98A 3MUFA 4V0LA 3AVXA 1KOFA 1E2LA 1T3HA 2HJGA 2J41A 4G5RA 1E99A 2GWHA 4IVQA 1KDPA 4UXHA 3NBYC 2Z4SA 3BS4A 2J0UB 3EWAA 4QOSA 2JGNA 1OXSC 2QE7A 1E6CA 2CJWB 2BM1A 5J4LA 4TYQA 4M9ZA 1E9DA 1IY2A 3QXCA 3UMRA 1QG2A 3LO5A 4EPTA 2QPAA 3I62A 2O8CA 1BYIA 1G8PA 5FPSA 3SZRA 3QI2A 1E0SA 3RC8A 1P7CA 3RS7A 4Q1AA 1AM4D 3WYGA 4MRNA 4F91B 2QU8A 4Q4JB 2FSIA 3U7EB 4A6PA 1QHXA 1G3RA 5B30A 4GL2A 2W00A 3D7MA 1SXJE 1AS3A 1JB1A 3Q5DA 4JL6A 2J0UA 2XOKA 4QKQA 3C5HA 2ERXA 4IFEA 2RGCA 2DBYA 1A2BA 5DLQC 1XRJA 1NMZA 2ZUCA 2QL6A 4EJSC 4TN1A 1WBBA 2GVDC 3TR0A 3ZZUA 4D0LB 3FYHA 2X77A 3W3AA 1FQKA 4Q7KA 1J7KA 3EZ6A 2ZRLA 4DKXA 1XTJA 1DG3A 2GAAA 2FG5A 2NIPA 2F6RA 4IVRA 2ASEA 1M7HA 3TR5A 5JRJA 2P6UA 2ZPTX 2V7QA 4OI4A 2EVWX 1PVOA 2NTYC 4KSCA 3B13B 3H2YA 2B7BA 4DLZA 1CJUC 1YKSA 3THYB 2X2EA 1TAGA 3TVTA 5DN6D 1NMXA 2ZU0C 4DDVA 3B60A 4NDZA 3EIEA 5E4FA 1OB2A 1E2NA 3BFVA 1MABB 3OESA 2LKDA 1T8UA 2WJYA 3NHBA 2KE5A 2ZSDA 4D2IA 3H1TA 5KDLA 4Z1MD 2F9LA 1E9RA 1US8A 1AS2A 2GA8A 2OT3B 621PA 2YVUA 1RRFA 1H8HD 2KJQA 2A7QA 4NP6A 3THYA 4JLMA 2ZQ5A 2ZTSA 1R0WA 1IY1A 2VP2A 1GTVA 3GLIA 4CF7A 4Q4HA 4E09A 3FDIA 3R20A 1QRAA 4OJKA 4WIAA 1COWA 1GIAA 4F38A 1XDBA 2ZE6A 4URYR 1Z5ZA 3KDSE 1HUQA 4A0RA 2G83A 3G5UA 5DH9A 2O5VA 1A5TA 1P6XA 1XEXB 3TIFA 2WJVA 4OHZA 4DEXA 4YMUA 1XEWX 4BLPA 2ATVA 5EZ5A 4KVGA 4GRAA 2IS1A 4QJ5A 1NJFA 4DC9A 2HXSA 1G64A 5JFGA 4OKSA 2RGBA 1ZBDA 2PBRA 3QENA 4BFVA 2NMVA 2ZYWX 3KJIA 3QXHA 2VF8A 4BLRA 3QUSA 4Q7MB 4M2LA 2ZRMA 2KB0A 3EXAA 1XZQA 3TKLA 2AFIE 2RHMA 4JJZA 4IXNA 3U3JA 3ONWA 3GLHB 1F6BA 2ZE7A 4ZDWA 1BS1A 1AGPA 2RHDA 2UZIR 2IA5A 4LX0A 2O8DA 2JJ1D 2N1BA 4NMMA 1OKKD 5EZ6B 2GJSA 3CWZA 1EX7A 2CHVA 4EPRA 1XWIA 3DL0A 3RSOA 4B2LA 4B6FA 1JXMA 4D4MA 1II0A 1OH8A 5J47A 3AVYA 5KDDA 2WJIA 2QEQA 3TK1A 3CH5A 4M21A 2KWIA 3SEAA 4P3YA 1X86B 1YZKA 4EPVA 4MKHA 3A58B 1P61B 4BFUA 1W36C 3OEHA 4LJ8A 3KJHA 4WBSA 2VSXA 2IUSA 4YMVA 4KJZA 1KI6A 1QHYA 2RKOA 1QHHA 4PC2A 4Q66C 3JVVA 3O47A 1J8MF 4GMXA 4QBFA 3SYLA 4C4PA 4C2TA 1KK2A 1R2QA 2JDID 3OAAA 4M1MA 1DBSA 1OB5A 3BIFA 4IHQA 5KSOA 5TMPA 3QKUA 3GJ4A 3RS0A 2BMEA 1KMQA 3REFA 1YZUA 1KY3A 4JMPA 4B2PA 4E5UA 2RGGA 2J59A 1SHZA 3UPUA 2VTKA 4CZ2A 2N42A 4BASA 1ETUA 2QRZA 2QN6A 4U02A 1H8HA 2OESA 3OIUA 1XD9A 1G6OA 4ITRC 3HP1A 3A1TA 4FI3C 1PLKA 3CF6R 5L3QB 1OYYA 2GVZC 2HF9A 5G41A 2RCNA 2V6JA 1TU4A 4II7A 1SVSA 2J3EA 4DIEA 1DEKA 2QE7D 5L3VA 3BXZA 4RY2A 3VX3A 2FZ4A 1C4OA 1GUAA 5FOWA 2GDJA 1Q1EA 2I1VB 3H4MA 1T6NA 1L2TA 1S1MA 1WCV1 4N0EA 3K0FB 2OXRA 1FX0A 1LB1B 4ZO4A 4W7SA 4D4KA 3IIJA 2XGJA 2GCOA 4OQMA 3P4YA 2YV5A 3IO3A 1PV4A 2O8FB 3NKVA 3A4MA 5D3MB 4TLBA 2H92A 2CK3A 3OFND 4JLBA 2XITA 4MKFA 4IXMA 3U61B 1VECA 3SR0A 2IC5A 2IXFA 4JLNA 3WHKA 4H1UA 2ODEA 1IY0A 2NOAA 1V43A 1W47A 2JCSA 1DADA 1EGAA 4US1R 3FE2A 1E9SA 2CL7X 4TLEA 3CPHA 1E4VA 3VMFA 3MJRA 1XEWY 2ZAMA 4XJXA 5JJKA 2YWGA 3LBHA 4PANA 3ZZ0A 2AXNA 1WP9A 4Q4AA 2QT1A 3I72A 3E2IA 1Z2CA 5FTLA 4LDJA 2IYWA 2O0JA 4QGHA 3GLIE 1RC8A 4TT3A 2CLDX 1N0WA 2AK2A 2O8CB 3HYRA 4A0GA 1H8EA 2NO7A 3CX8A 3QY0A 1UPTA 2XSZA 3KKOA 5L3QA 1EG7A 4Z8XA 2WHXA 4LYJA 4NCKA 4JT4A 4CW7A 1HE8B 2D4HA 2RB4A 5JWOA 1QBKC 4JVLA 1RW4A 4FCVA 1I4LD 3H84A 4JLAA 5CJ2A 3TGPA 4WA7A 2FOLA 4M1TA 3FFAA 2OBMA 1E4YA 4PAOA 3KB2A 2B8TA 4Q9JA 2PH1A 3GJ6A 3FHTA 2QROA 1N5KA 2V1UA 3HYTA 1U90A 3EAQA 4NCHA 4Z1MA 2OFXA 5HZKA 3U7GA 2CVFA 3QXXA 3CW2A 4EKDA 1M6NA 5KTYA 4JL5A 2XNDD 1DAIA 5DIFA 3Q7QA 4PO8A 2WWYA 1VHTA 4B3CA 3QKSB 1DTSA 3RRNA 5KNCA 4URUR 2VF7A 2WKRA 5L3SB 1Z6XA 3CR8A 5FH9A 1IN8A 1S9DA 4A9AA 4DHEA 3ASYA 4R98A 3FPAA 2F1IA 3GMTA 2AX4A 2QRNA 2L0XA 1J90A 3AKCA 4NYJR 3SI7A 1WF3A 1Z3IX 4POAA 1D6JA 3Q8XB 2D2EA 1G9XA 3CPEA 3MAAC 4RFSA 5C46F 2CK3D 1KI1A 3WYFA 1X6VA 1G7CA 4G5GA 4B3FX 1KAOA 4I1UA 2MMCA 3IQXA 2BCGY 1YZTA 2FA9A 2ZRDA 4JLPA 4ESVA 2XEXA 3IO5A 2CEAA 1XTQA 4B3DA 1XMSA 2RGEA 4OJQA 5J4YA 5TDHA 1AS0A 3C7KA 1SVIA 1UKYA 1S3SA 3LVQE 5JBQA 2OHFA 3QE0A 4M9SA 4C0KA 2TMKA 2QA5A 1CRPA 4ESHA 3NEJA 4RD2A 5E3HA 4C3ZA 1WBDA 1Z6GA 2ZJYA 1Q20A 1NI3A 2FMXA 4OK5A 4RJLA 5EE9A 1LS1A 4URVR 3ECCA 2QSZA 1UAAA 3QXSA 5GVSA 1U94A 3ICQB 1X8JA 2WIAA 3A37A 4C30A 3JZMA 1Q3TA 2H17A 221PA 3FFBA 2ODWA 2C9CA 2RGNA 5KSYA 1TNDA 2Q9AA 5JEEA 1IN4A 4TL6A 2QMUA 2PX3A 1ZVQA 1E96A 1IN5A 2C8VA 1U9IC 5HE8A 2PMDA 3IBGA 4FXPA 4XVQA 5FBLB 4NBSA 1ZUIA 1Z06A 3CRQA 1E0AA 2QG6A 3FKSA 2KI5A 1S2MA 2OBLA 1ZINA 2JJ2A 1C9KA 4PQFA 3EZ9A 4R2IA 5DISB 3ZYCA 3BRWD 2F7SA 3CONA 1FTNA 5CK5A 3LW7A 1M34E 2QP3A 3W34A 4QL3A 1KI4A 5GVRA 2YHSA 1S1CA 2ZJ5A 1HT1E 4OHXA 1G7SA 3CRW1 3PV0A 4PO9A 1MT0A 5HKKD 1W5TA 2EU8A 2WMNB 4ERNA 3LBNA 4XH9B 1OFUX 4KFUA 4MA4A 4JLVA 3OEED 2EFHB 2J0SA 4AYXA 1SVWA 2Z4RA 1PJRA 3ZD6A 1W2HA 3U4QB 2HEIA 1GNQA 3VFDA 1TX4B 1OXVA 1YRBA 2ZR0A 5BXQC 2NQ2C 3EIHA 3AF2A 3QOFA 5SZKB 2ZAOA 1SVLA 4L9SA 2GCNA 4AWXA 2R65A 2G3YA 4AC9A 3KKPA 2RGDA 2IYUA 4OQNA 1R8SA 4HDCA 1HT2E 4B76A 2CNWD 2ZETA 4MGZR 1XXHA 1AN0A 5F98A 1KKLA 2WWWA 2O8DB 1ANKA 2KBEA 2ODBA 2D3WA 4Q9IA 3TRFA 4PPFA 3T15A 1UFQA 5C4MA 2ZE5A 4O25A 1GKYA 4XVUA 3B5JA 2XTMA 3DO6A 1TADA 5FUXA 1WXQA 1R5NA 1QDEA 2DPXA 3KUCA 1KAGA 5J40A 2JEOA 1RYFA 1FP6A 4TMTA 3T06B 2GZDA 1YE8A 3UWKA 5J4VA 3PEUA 3GLHA 3PUWA 4YMSA 1ZM3A 3I8XA 5G53C 4PO1A 1XCPA 3IGFA 5HZHA 1U98A 3SHWA 3AUXA 3L8YA 1NBMD 3TW8B 1OW3B 2GEUA 1WA5A 4TSFD 4ZCLA 1YR7A 2FEMA 4FCTA 2DFKB 3ADKA 4JKYA 1KMHA 1LW7A 3BOSA 3B82A 4ZCMA 4B34A 2QTHA 4MRRA 1TEVA 1ZNZA 3MWYW 5K8TA 3THWB 3EZ2A 2WJHA 4DCTA 1OH7A 4TLDA 4DUGA 4EDHA 5JI3E 3AUYA 4WVFA 4O2LA 5EXPA 3AF1A 2QP4A 2N46A 1AKYA 1JJ7A 1UEJA 2RGXA 4AKEA 1Z2AA 2PCLA 3R9IA 3AKDA 3M6AA 3TAUA 2XX3A 4AKIA 4RD1A 3ND9A 1VYVA 1ODFA 5H70A 3U4QA 4L16A 3QF7A 1T0HB 2HCJB 4RSGA 1OFTA 3FB4A 1XTSA 2GCOB 1QHNA 1ELOA 4LV5B 4D0NA 1SULA 2HYIC 4NH0A 4GOJA 1OE0A 1XD2A 1Q57A 4HLUA 3GEIA 1CEEA 3HR7A 5FOSA 3ZDQA 1DPFA 1ESMA 4FMCF 1W7AA 5CIWA 5UKDA 3N2IA 2A5FA 2ZXUA 1XB2A 4HI0E 3HPRA 4CEJB 2ZR9A 4IFBA 4OQFA 3RWMB 1DS6A 2RGAA 2ZSAA 4PSKA 3WBKA 4DCUA 2FH5B 3LLMA 2VEDA 2IX3A 1SVMA 3RRZA 1OHHD 1E79A 2IEZA 3NDPA 2WOJA 2ANBA 1KO5A 2FFHA 4E07A 1U0JA 4ZDJA 3GLFA 721PA 4TTPA 1N6LA 2GJ9A 3TSOA 2AKAB 1QHIA 1PUJA 4EFNA 2BHRA 2G9NA 1AZSC 3B7GA 3VNUA 1AKEA 1G8HA 4P4UA 1VIAA 2QTVB 2W58A 1TQ2A 2AFHE 3HWSA 2F1JA 4Q4JA 3WRXC 1NBMA 2BBSA 1ZCBA 3O8CA 5HPYB 3WXMA 2D2FA 4MKGA 2C98A 5E95A 4Q7JB 4Q1CA 1B23P 1G7RA 3AVVA 1XP8A 2ZRKA 3QBTA 4YQFA 4QGFA 4JSTA 4QXAA 1ZUHA 2QUZA 3ICEA 2VPPA 2SHKA 5JLJA 3U44B 5A4JA 3K0CC 4NYIR 4A0HA 1Z0DA 4DUGD 3W6OA 1FPMA 2J0QA 4A2WA 5GJBA 4DT1A 2VP4A 2C78A 1ZNWA 1CIPA 2IF2A 3GEHA 5JWHA 1Z83A 2FU5C 1G8GA 1N5LA 4QGAA 1E2FA 2R2AA 4F93B 1WMSA 2CLCX 1G5RA 3I1FA 3A1WA 5AJWA 2F55A 1QHHB 4RFVA 4DSTA 1G5TA 1Q44A 2QAGC 2FFQA 2JLWA 1W4CA 3FKQA 4D25A 5G40A 4ILEA 4KLNA 4WW0A 3CZQA 1KMHB 5H8WA 4QHSA 1JQLB 2F3RA 2F1HA 3NVAA 4Q19A 2IBMA 3Q85A 4XWOA 4NCIA 3GLGB 1NKSA 4DDTA 3UIEA 3BERA 3AB3A 2UZ3A 3T1VA 1YZNA 3RS5A 4OHYA 2QP9X 4LV6A 5EXTA 4JLOA 1UEIA 5GADl 4OHVA 4YDHB 1ZMXA 3IEUA 5K8IA 3IBYA 1SZPA 2WSSA 5DI9A 2IXGA 5BW8A 1G3MA 4UJ5A 3QNUA 1E2IA 3TH5A 4UJ3A 3K9HA 1KJZA 4GNKA 2ZVQX 1RJ9B 1COWD 5BQ5A 1NMYA 4W9MC 1J8YF 2B92A 1F2UA 2OAP1 4TTQA 3LX8A 5KSPA 4BEJA 2IWHA 2GHIA 4O3MA 4BLOA 3HJNA 4EQ6B 4WZAE 1A2KC 2BKUA 1G21E 4Q1FA 4TL7A 5BN5A 1ZAKA 2W2TA 3VR4A 1E9FA 1TQ4A 1QVRA 2NZJA 1NSFA 5IK2A 1UF9A 4I1OA 1E1RA 1EFTA 4IDPA 1J2JA 2A5JA 4KFSA 4OI1A 2EWWA 4C0SA 1L8QA 4EFMA 2DFNA 4L9WA 4HLQB 4JZKA 1U8AA 1CTQA 2AKYA 1P9NA 4YC7A 1CR0A 3PXGA 3QG5A 3ZIAD 3PFIA 1N0UA 3QKRA 4IOMA 5JJLA 1OKKA 1N6RA 2IYQA 3I5XA 1Z6AA 2DWPA 3M4YA 2OG2A 3K53A 4W5HA 2GZAA 2PL3A 1GZSA 3CX7A 3EPJA 3DMDA 2ZJ2A 4TMZA 3OEEA 5IRCD 4EIWA 2WJGA 2A5GA 5JS8A 2O0KA 5FOUA 4NPHA 2CHGA 2ZI3A 4CDGA 1WRBA 3FGNA 2R6CA 3KJEA 2ZR7A 3PUXA 2OCBA 1RZ3A 3P20A 3GLFE 3CNLA 3MLEA 5E7MA 5JRZA 1D8TA 2JIZD 1XNJA 2ZYTX 2ZM5A 1GL9B 1OXUA 2PLRA 3CUEF 3QEJA 5AUQA 1KO7A 3OIVA 4PAMA 1IJEA 1JI0A 1KDTA 5FPKA 3A36A 3X1WA 1IN7A 3C8UA 2YINC 2IYSA 1N3BA 5EQTA 2JLYA 2CNWA 1W49A 1RRCA 2ORVA 4CRWB 1IXRC 4Q47A 1A4RA 4TZ6A 1UDWA 4A15A 1KI6B 3NHAA 1AK2A 1E2GA 4I1VA 2GAOA 4IJMA 1VCOA 5LB2A 3RWOA 4KYUA 3Q72A 2AK3A 3TQFA 1E2PA 2QQ0A 2ZYVX 2P6RA 3P4XA 1P2TA 2HF8A 2REBA 2RAPA 1G19A 3CR7A 5FBWB 2FSGA 2ZJ8A 2NO1A 1IXSB 3L8ZA 1W48A 4C2UA 3TVDA 2PJRA 3B1YA 4HZUA 3B1WA 5AJZA 4DLWA 4OI0A 3V9PA 2ZU6A 3QEOA 4BWYA 4LGMA 5KU1A 1G4UR 1RIFA 2CCGA 1SHKA 4XSHA 3Q7PA 2ZIAA 2PMKA 5EE3A 1GKUB 4ZDKA 4EPXA 2I1QA 4B75A 4L5BA 4ARZA 2PZGA 1E1RD 4RZ2A 5CB6A 4C0HA 4WZ6A 2VP0A 1VG1A 3A1VA 4MGIR 1ZIPA 3BORA 2IEYA 3A4LA 3L0PA 4IDNA 2VSFA 1XTKA 3MWLA 5ELXA 1MV5A 4I99A 1XXHB 4URZR 2OV2A 2WIBA 4TYPA 4Q4AB 4C7OA 1R8QA 2FF7A 2DHRA 2HXYA 1U9IA 1O3YA 3I5YA 4FWTA 4XWAA 4QRHA 2DB3A 1Q1QA 4I1SA 2BBWA 4Q9KA 2WWXA 3C16C 2V1XA 2WV9A 4UXJA 4I4LA 3EC2A 3HU3A 3ND8A 4JT2A 5BN3A 2QBYA 1U0HC 3AVOA 4DLVA 2EQBA 4IKEA 4JKIA 4D81A 1BKDR 2J5XA 4IOKA 3BFXA 3GJ8A 1JEDA 2DFTA 2XSZD 1ZYUA 2QQEA 3U2QA 4LHYA 8OHMA 2O52A 1VYUA 1SQ5A 4L8GA 4C0QC 2WTUA 3DEFA 3UK6A 2IHBA 1P3JA 2IYVA 1N6NA 1YZGA 1Q22A 4HATA 4U7DA 2DWQA 1HV8A 2PEZA 3EZFA 3AH8A 3NH9A 3QBVA 3UMFA 3PQCA 3LWNA 2LWIA 4B73A 1A82A 1X1RA 4KITB 2Q3MA 4XTCS 3SN6A 3CB4A 1HQCA 1Z0JA 1XD2B 2H57A 2W6IA 3M1IA 1PUIA 2GRJA 5DGXA 1MABA 4PSAA 1BMFD 1Z6YA 2A5DA 4GP7A 4ACBA 3RDPA 1HEIA 1TUIA 3AF3A 1GG2A 2YYZA 4LYFA 2FSHA 2GEVA 4B3GA 2IS4A 4HEJA 3KXKA 3VHXA 3SDZA 3QKRB 1NBME 1ZD1A 4TT3D 5AWFC 4E22A 3SBDA 3H86A 1OSNA 3B8HA 4NCJA 4ASUA 5JCZA 2P3SA 3E70C 5E7JA 3T5GA 1NG9A 4LI0A 1D2EA 1N2CE 2WWHA 1P62B 4GOKA 5TV2A 1VDZA 2WM9B 1S4QA 2JLSA 5JI2E 2HT1A 2CMKA 1W44A 2OCYC 1Q1BA 1TF5A 3A4NA 2EFCB 3SU8A 521PA 3W5IA 3IKJA 2ZRAA 1U8YA 2R6GA 3N5CA 3QF4A 2QAJA 4HAWA 1YQTA 4TLCA 1TMKA 4PHHA 3BH7A 4C7OB 4DCNA 1G8YA 4Q7LA 1P75A 3ZH9B 3SE0A 3TSWA 3IILA 1JJVA 3BB1A 4RKFA 3DVLA 1CP2A 1JQJC 1T3LA 1EFCA 3BB4A 4DDUA 3LFUA 4FIDA 3U6KA 3UG6A 1N0VC 4JSYA 3IUYA 1F2UB 2C9OA 2MSCB 3P1JA 3LV8A 1RE0A 1ZM2A 5C18A 2YWHA 4FMCB 1G6HA 3ETLA 4G5SA 3MSXA 2WPDD 5BYJA 3VR5A 4GT1A 3TUIC 2CJWA 4B33A 2JATA 1MRSA 3RS4A 3I32A 2VSOA 4DIDA 1SXJD 2E9SA 1M8PA 5B57C 3RS2A 4JJKA 2QENA 1F2TB 2H18A 2VRWA 3W5JA 2V54A 1NF3A 1VG9B 2D7CA 2CCJA 3LA6A 1EWQA 4ZDIA 2ZRFA 1XCGB 4LV8B 2HJVA 3SS8A 1E1QD 5KUTA 2J46A 4BFWA 1ZRHA 1GL7A 1ZC4A 3L0SA 3DDCA 1NN5A 3X1ZA 3ZZTA 4TZ0A 2BBTA 1KJWA 4QFMA 1K8RA 4TMWA 2PLFA 4JIMA 2PCJA 3A6PC 3F5FA 4BZPA 1X1SA 3QJYA 4LC1A 2D7DA 4MDFA 4WZBE 3WMFA 1TEXA 5CJPA 3R8CA 1DAGA 4EUNA 5BN4A 2ODNA 2XNSA 2YC4C 1E2DA 3C41J 4EAQA 3WMEA 5DSZA 1R5OA 2IYZA 4P33A 2QM8A 3GLFB 1E2QA 3KB1A 3SFVA 4F4IA 5KPJA 3OF5A 4A8JA 4C0LA 3PJRA 1WQ1R 1OF1A 3K9NA 1VIYA 5BYKA 1H65A 1ZUNB 3IIKA 5DE3A 5A0FA 3TBKA 2XZPA 2ORIA 2IL1A 3DKVA 1GRRA 4QJ4A 2AD5A 5FBVB 2OBNA 2DFLA 4NCNA 3OE7A 1Z08A 4KODA 1OFHA 1DAFA 1KSGA 5CYPA 1DARA 4FWIB 3MG9A 4QNRA 2P6NA 1Q0UA 3EA5A 5G3ZA 4YXWD 2Q9CA 5KDOA 5FPTA 2GF9A 2A9KA 4MH0R 2C03A 2J7PD 1VCIA 3NWJA 3VX4A 4G01B 4CGZA 1K5DA 1YR6A 2JJ2D 4F7WA 1IBRA 1PZNA 2R6DA 3WRYC 3V4RA 4RKEA 1XU4A 2VP5A 3NC1C 4MUBA 3I92A 4FW9A 5DYIA 3K0AB 4M1OA 1SXJB 2O8EB 2A78A 2A30A 121PA 2GK6A 3L82B 5FPHA 3VKGA 4EJSA 1UBGA 3U3OA 4PTLA 1CLUA 2ZRPA 2VLIA 4LRWA 5FTMA 4BGDA 5JJIA 4B3BA 4MDEA 3VR2A 1XPUA 2XJ9A 2Z5FA 4ZKDA 4Q9LA 1JXOA 2QGZA 1GRQA 4HLDA 1GP2A 1YRAA 3IHLA 3DZ8A 5B58C 2G77B 1T3SA 2CDNA 1LF0A 2BJWA 3GQBA 5CM9C 3DOFA 1SXJA 2O8EA 1G5PA 3KX2A 1ZD9A 4KFRA 4M22A 4UNSA 3UATA 3V4FA 4MQBA 2QY9A 4CT5A 4E03A 1CJTC 4V02A 2JA1A 2WKPA 3AEZA 4FN5A 3IEVA 2AHOA 2OCPA 2FZLA 3CWQA 3K1JA 4LYHA 1P5ZB 2P2LA 4LWZA 3X1DA 1W0KD 1HTWA 2KBFA 4X8MA 3QPVA 3QQ5A 4MYUA 1MO4A 1GM5A 3D8BA 1BIFA 2ZS7A 1G20E 3ZVMA 2FGKA 4G1UC 3BD9A 1D9ZA 1EXMA 3HPQA 2BV3A 1CJKC 4PC6A 4TQ9A 4V0OA 4A92A 4A2QA 4PXAA 1JAIA 1GWNA 1D2MA 4H1VA 4A36A 4J0QA 5FTJA 4ZI3A 1KZ7B 5K8UA 4IEEA 2FX3A 2BVNA 1HY3A 2NPFA 4DVGA 4EPYA 4IVPA 1ZCAA 4KXFB 5AUOB 2CLSA 3WNDA 2Y8EA 3QKTA 5AJXA 1QZXA 3X1YA 2IXEA 3U60B 2UVQA 1OIVA 2WSMA 3QSYA 1JEEA 3GLHE 1IJFA 1WDTA 2ZS9A 2W0MA 2X1VA 1XZPA 2DY1A 4MYHA 1TTTA 4HDQB 3EPLA 2BMJA 5L3SA 1LV7A 3W9YA 3K0SA 3AGPA 5HCIA 4ASUD 2XXAA 2C99A 4WAUA 3B1VA 4I81A 4TSFA 1OXTA 2CE7A 1J99A 2GXQA 4LOAA 1U81A 1E2KA 2VBCA 2B6HA 3LD9A 2EFDB 3TSZA 3SBEA 1O87A 1II8B 2J7PA 4JVMA 4Q1DA 2PT5A 4QC2A 4JLDA 2F3TA 5FBRB 1RVDA 1T5LA 2HYDA 4W5WA 3R7WB 1NRJB 3LH5A 3OIYA 5JEDA 4Z8YA 3QPWA 3J81k 4QHTA 2REXB 1M1YE 1U8ZA 3BC1A 2GJAA 2WWFA 5CITA 5EP1A 5HCNA
chains in the Genus database with same CATH superfamily
1NRWA 1OHHA 2JCBA 4B0PA 4PIVA 3LY9A 4KH1A 5I9MA 3FTQA 3OJFA 1KE2A 1M74A 4IUBS 1UZUA 3VPBA 4DE5A 2NN3C 3LX5A 2A59A 3EFBA 3FSEA 1SQFA 3OF2A 3B1XA 4I50B 4KQ1A 5KWJA 4CEIB 1IYZA 3HC7A 5IH7A 2DRIA 1U8UA 4MAAA 1XCOA 3FRJA 1IVYA 5LWQA 3RYCA 2WWVD 5DI3B 2IYRA 3SFZA 1A4XA 2F8TA 3RM3A 1TF2A 3I5UA 4LFBB 3LCVB 5DK6A 3WSTA 2ZATA 4TLAA 1W1IA 1Z4LA 1WHSA 3H17A 4FX2A 5CVEA 3UCEA 1JEQA 3RRXA 4AZ3B 1IE3A 3HG7A 3Q6MA 1CY4A 2K5UA 4HL6A 1YIDA 2Q3HA 3V7UA 1TPZA 5TPWA 2O14A 1ORTA 1THZA 2WYVA 1G4AE 5DNDA 3PPWA 1R10A 4BGVA 1FFSA 2XHZA 3UO8B 3R7FA 2V0NA 2XY4A 3B89A 3BGWA 3QLJA 4KIWA 4B35A 3AP2A 5D6OA 2CUKA 4R8KA 3QF4B 3E82A 5AESA 5SYAA 3K71B 5AJYA 4RC9A 1JHDA 2FEWB 2CC2A 5I7WA 3M8KA 4RO0A 3KEMA 4RSHA 4ITUA 1IZ9A 2W11A 4KNYA 4CIAA 5DNEA 2VYCA 3C7CB 2PT7A 2JLVA 1TM2A 1OZGA 3HDTA 4GBMA 5BMVA 2EZ4A 4EHLA 1VRWA 2WLTA 4RQAA 5KJ6A 3PEFA 2QTLA 2WMYA 2OG1A 4ZPJA 3T9CA 4DY4A 1KO4A 3PJEA 4JB3A 4QBHA 3GGSA 3JD1A 2DQ4A 4K87A 4MPDA 5FUWA 1QNFA 3PVSA 1M2VB 1PFWA 2ECKA 1YWGO 2EFEB 2JLRA 2ZRIA 3OCJA 1WCIB 2I99A 4MYDA 4XYEA 2NO5A 3JQAA 3OOYA 5F5LA 1BVRA 2ID7A 4CLHA 2O5EA 4XEHA 1UBCA 1HRKA 2RHOA 1V7QA 2ZS8A 3L0IB 3Q1KA 2JVIA 1OIWA 2R60A 2VBIA 3H1PA 3LF2A 4J0CA 4QPNA 4D4JA 3B9RA 2BDTA 3B1ZA 4G3XA 4IQGA 2IYTA 2XBUA 1V25A 1X80B 1QSGA 1UBNA 2FNAA 1M7BA 2P1RA 5LLDA 3CZPA 2H4JA 3Q9LA 1W9HA 4ZMSA 2VJCA 2PL5A 3BJIC 2XKKA 1SUPA 3FSJX 5ES3A 3COSA 2D0OB 3H6HA 3NBQA 3T4PA 1OGJA 3PGKA 1VKNA 3VHRA 3EVZA 3WJ7A 10MHA 5EIHA 4WH0A 1S4MA 1WOMA 4EPWA 1MNQA 4KWIA 4DCJA 4O2AB 4EKGA 1LSUA 1OD6A 4PONA 2NU7B 5E6SA 1UKBA 3VDXA 4ZICA 4WBNB 3MWGA 2ABWA 1UPUA 1USUA 4LXQA 2CUTA 3T7TA 2BE7A 2YWFA 2AVNA 4LQLA 1QV6A 2A2ZA 1CUJA 3R3SA 3EZNA 3EW9A 3HA2A 4OJYA 4WV3A 3SC3A 4PQRA 4MITA 3WNCA 2VATA 1CV2A 1E58A 1FFDA 1T4CA 3CNHA 2Z3VA 3L7BA 1XU7A 4INOA 4K9DA 5HKBA 1NMSA 2X5NA 4DV5B 5JSYA 4NXMB 3I1YA 1UWVA 1JN0A 1A0OA 2Q1YA 2WD7B 3AVQA 4F1JA 3T5PA 4PGFA 1FP7A 2KSQA 4JVSB 4E3ZA 4AJ1A 4O2RA 5CLLA 3OQHA 5HUQA 4LY3A 1B6SA 4TGLA 5KHLB 1TM3E 1KR5A 2OFWA 2OUKA 2YIJA 3NIFB 1GD1O 2YBEA 3MPOA 4ZTUB 4YCJA 1EWRA 4UHHA 3R0IA 2R8YA 4QFBA 3DC2A 2BHTA 1M1YA 1WB9A 2EKZA 2ZSEA 3PBKA 3OEYA 5FL3A 4ALNA 4G4SP 4Q05A 4BNNA 3DOCA 5CYFA 1VYTA 1CRZA 1H4QA 4OBBA 1XQ6A 2G1AA 4BUZA 4AG5A 3LQRA 1B15A 2J67A 3OKAA 3ZU5A 3ISVA 1K6JA 1KJ8A 4FDUA 3UOGA 1STOA 2B8NA 4NZYA 3O8RA 4WZBA 3VOTA 1JALA 2AGVA 1KZ6A 2IUYA 3KELA 2EKBA 1DL5A 1V1MA 1T91A 2Q4RA 2YRXA 3OG9A 4I5DA 4RHFA 2R1UA 3ELYA 5CM2Z 1SG6A 5C8VA 1PNTA 1XZHA 2PGIA 2B5OA 1HQYE 2QQFA 2DR3A 1JIUA 1WPGA 2GXUA 4I5IA 1KEKA 5L3ZA 1HNZB 1T13A 3IPXA 4GXNA 1ZM7A 2H0RA 1Z73A 3RKSA 3C5WP 1MQ8B 3CLVA 3C1TA 4Y9SA 4KVAA 1E62A 1YAJA 1V5IA 5K4GA 4WBNF 4GR5A 4XR4A 5B37A 3Q5GA 4JYMA 3GARA 2JIZA 2BN4A 2QVYX 2WFAA 2PGDA 4YFVA 5HTOA 1SU7A 1YDGA 3G9UA 1Y98A 3P9XA 2DX7A 2DJIA 3X43A 3ZGYA 4DUZB 4PLZA 4FILA 4KUGA 4ER5A 4EI8A 4OPMA 5AD1A 1E0JA 3A7DA 4FUTA 4OH7A 1DSSG 1KKMA 4BKUA 4DJEC 1D07A 1DAHA 1E1LA 4YAUA 5LPNA 1FSSA 1BD3A 2IY8A 2VUHB 4GOMD 4ECEA 2O3UA 1YJ5A 3F47A 4LJYA 4E1VA 2FE4A 3P26A 3HSKA 4ZOAA 2IDMA 3SJCA 1E79D 2PN1A 4KMRA 4ZZ0A 4ED9A 2IU4A 4D8UA 3GRKA 5CB8A 3K2IA 1UK7A 3JAKB 1GAJA 3DNMA 2C96A 2IYEA 2YWJA 3VUEA 3EX7C 2A9RA 4PHGA 1RAAA 4RMNA 4MUHA 4UZFA 4YIHA 4ARCA 5DHRA 2WABA 1MO6A 4BB9A 1PI3A 3OWXA 1P0FA 1ZUWA 4R68A 3Q10A 1RLJA 4EJ0A 2YR0A 4TMFA 3GUVA 5JZMA 1EFLA 1OJLA 1T9GR 3AF5A 4MDFA 2HUPA 1UOQA 4MX8A 2IUTA 3NJRA 4Q6BA 3GFTA 2ZUDA 4Y1RB 5FPYA 5IHPA 5JH7B 3CUKA 4OHMA 1FFHA 1W25A 4HRVA 1V8FA 5J2TB 4RK6A 1N6HA 1CERA 1ACMA 4RELA 1A8HA 1J0XO 2Q62A 1AKMA 4PYIA 4HV4A 4LQCA 1ISHA 2X6RA 4CVNA 2WOOA 3F74A 2RH5A 3PK0A 1UKEA 4RKQA 5CLQA 3JTEA 1AUXA 2CXQA 4JXXA 1EUYA 3H3JA 3OZDA 4N40A 2VXBA 3KHTA 2QGNA 3L6OO 4TYNA 3WJ2A 3R0JA 5AK3A 1NFQA 2JD1A 3GJ7A 1MX1A 4NICA 2BDEA 1W6RA 3R5FA 2HRDA 2XYVA 2PQ2A 1URPA 3FWZA 4KRYA 3VOAA 2Q9BA 4RSMA 1RYYA 5K0BA 2N3ZA 3C39A 5IH3A 1X13A 1WUTA 4HAYA 4BU0A 3FTFA 3IPYA 1A9SA 9LDBA 2VTBA 1CSEE 1HFWA 3LUAA 3EEFA 2HM7A 2VXCA 2PUAA 4YONB 1J0CA 1MDBA 2QTFA 5TVKA 4NPAA 1MH1A 1Y3AA 5EP2A 2ZSHA 1F5NA 4AN4A 4LOLA 4YAEA 2XYQA 1LVGA 2IW1A 3STWA 2IOYA 3LAWA 3W4IA 3ECSA 5K0LA 2OE2A 5J43A 5FFMA 1SH7A 1EP2B 1ZL2A 2O48X 3BMQA 2GN8A 1B3BA 1QO7A 3HP7A 2C7PA 4X41A 4JBYA 1O95D 5IHXA 1GDDA 3J80A 3AF4A 1T36A 5A1JA 1R8YA 5EIEA 4DJAA 4YRDA 1NC1A 4YEDA 2IKQA 2G88A 1Q50A 2PRKA 3LRTA 3EK2A 5BV0A 2ATIA 4MS3A 3KSRA 1KZGB 1L7MA 1U0OC 3WB9A 3HABA 1R6UA 5FBQB 2C77A 3DUWA 2ZIWB 1A4UA 3DDHA 5F2NA 5L40A 2OAQ1 3HFJA 3EA0A 3KYCA 4H7DA 3KYDB 3RI3A 1GN8A 3WWDA 1J8DA 2UUCB 2AD1A 1VCNA 1LNZA 3CNNA 3CKLA 4RZUA 5TQ2A 3N8GA 3PUKA 4PW0A 4B1FA 2F3PA 1HFJA 3AP1A 2NUBA 3CJTA 2VI5A 4IDHA 4KRFA 2YOHA 2AJTA 2W6ID 3HJRA 2X14A 4DPMA 3TOSA 2V45A 3A1EA 1M2OB 2X8WA 4YRTA 3TIXB 3TVYA 4CLXA 3BK7A 3KWJA 4M1SA 2FW8A 4EYSA 5IM4A 2GPJA 3OZFA 4GSYA 1L7XA 5DTRA 3S99A 5DVZA 4DUYB 1Z8NA 3KCNA 4NU5A 2VJMA 4KSYA 1NX6A 1KQNA 1OCEA 1KQ3A 2ZCJA 4BGUA 4LGYA 1RMTA 1TMGE 5C35A 2CLEB 5BSFA 4I2NA 4OUDB 1RMYA 2BKAA 3IQZA 3T7RA 1ZXLA 1RBMA 1VMKA 4YLYA 1KZYC 4AD8A 4LSGA 4WZAA 1S3GA 1E5QA 2GPWA 1TZMA 2BPOA 3RAJA 3K70D 2GETA 3C24A 4ZAFA 4XEUA 1XBTA 2EWVA 1Q92A 2V9PA 2WF7A 4P80A 2KX7A 3G8DA 4LPKA 4DKXA 4FVTA 1QE3A 4UAGA 3OX2A 1MVNA 2E4XA 2WUDA 4U4AA 3TIIA 3U44A 4CT4B 1CRQA 1A7JA 3ZHYA 1WDMA 4MGEA 5D85A 5DHFA 5LQNA 1NI4A 1SQ6A 1W4RA 2Q8NA 1RPZA 1XHLA 3JASB 3RUFA 5GM2A 1EFRA 2DSTA 2ZANA 3CJQA 3V1MA 4RZSA 2QX7A 1ZHHA 3QMPA 2WZCA 3OOWA 1U2TA 3PWKA 4NYJQ 4D80A 2PYZA 4GG1A 4BQPA 1HWYA 3ZLTA 1P0CA 1HNNA 3CF0A 1F6WA 4YDQA 3PEWA 4OQXA 3K6SA 4Q93A 4D9IA 3F8TA 3N0WA 1ABEA 4N5LA 3USES 3IL2A 1PTJC 1T25A 3F3YA 2CBZA 2VT6A 2Y1GA 1WHSB 4KCGA 4LA4A 3VYWA 3OJ0A 4TRNA 5I9TA 4ZAXA 3TDMA 4M0CA 4UDNA 1Y4UA 1KK0A 1UM8A 1CY7A 3IXLA 3ZCUA 4DZRA 5B2EA 3BFJA 3E5RA 1SXPA 2CD7A 2B8WA 1H94A 3K0AA 5TQ0A 4LJ9A 2LZ0A 3D5QA 4DPKA 5HRUA 1Q7GA 2XVXA 1MOZA 4RJIA 5EJIA 1OPXA 3RSZA 5ICGA 1YF3A 2NU9B 1GLNA 2DCUA 4TPKA 1SUIA 2Q5CA 4WNCA 4TLMB 1NOIA 4LNUA 2ZUEA 4KSBA 4N49A 2PRZA 3JATB 3T54A 3KFXA 2OSVA 2HSEA 2VLBA 4KK4A 4MVJP 4YAFA 5B7NA 1MQ9A 2VHVA 4QQNA 2QD4A 1T2DA 4AM8A 3FOCA 3DFMA 3D54D 2E4VA 4TROA 1IUPA 3S7ZA 4NONA 1EDOA 1O97D 2IOQA 2C82A 5FKJA 2UYOA 4F9TA 3OZBA 4PO3X 1XROA 3MJ4A 2QG9A 1T9BA 4MB6A 1X3SA 4ARAA 4CNQA 4YMGA 3LFTA 4CDRA 2W6JD 4GQBA 3DKPA 3GCZA 2GFIA 3WLJA 3PR1A 4TWIA 4GOND 2E5WA 4DR6B 2E6KA 4NNJA 4WECA 3PQ7A 3O8QB 3PR3A 4LX8A 5ENVA 3HVHA 4ZOCA 3VTFA 4D79A 1H2XA 5C5DA 2XQVA 4PPNA 5BSRA 4E08A 4OUDA 1GYQA 5DX1A 4C3VA 2R6AA 4HWPA 3MBOA 4C78A 4EWLA 4PLVA 3VC3A 1VZ2A 3NORA 1Z4KA 4RGYA 1CQJB 4DG9A 3LFHA 4RQUA 4CN8A 1ZVKA 1GL3A 3QW4B 4IXDA 1AGRA 1Q0ZA 4NV1A 1WDLA 2IY7A 5HOEA 3JWJA 4NL4H 1TYAE 4K7JA 1DXQA 3N0VA 1XZLA 2ZAGA 3R0XA 4JBWA 1B8NA 2AXPA 4W5JA 4P0TA 2FOXA 2JAOA 3FLBA 3LVRE 3QLVC 3K09C 3HBNA 3O38A 2EZ8A 1ZIOA 2WF5A 1TQ8A 3GDHA 4RVCA 2E87A 2H2FA 4FEYA 2UXDB 1N5IA 2H2AA 4HBGA 2M6RA 1QG4A 3THWA 4IGAA 5AW4A 3OT4A 1EUQA 4MCIA 2V0CA 2YQZA 2Z83A 1W88B 4KQEA 3TOCA 2HZBA 1OWPA 5FHQA 4IDAA 3JZAA 3NNDA 1UT6A 1WWKA 2W22A 5KAPA 3REQA 2CMDA 1MXFA 2I4NA 2R5WA 2VKQA 3EG5A 2QT0A 3ISTA 3P9PA 2ZFUA 4WD3A 4C20A 3JAMA 4HMPA 3LBYA 1W5AA 2VHEA 1Z0FA 2C95A 1WDKA 4HGYA 3V7WA 2QM3A 3C8MA 4QBIA 3QG1A 1CJMA 1H1TA 1U7UA 4GC5A 3I3SR 3K0KA 2OXTA 1QZZA 4FFLA 5AM5A 4CIBA 4ZJUA 4UUBA 3VZCA 3ZJ4A 2JRLA 1EHYA 2G5GX 1V2HE 3WDLA 2DGDA 4GI2A 5IAOA 1E6EA 4K81B 4LK2A 1J1UA 3OC0A 1TF7A 3WK9A 5J4HA 3OJCA 5ICSA 3A6ZA 2G6BA 3EQ9A 2PKYX 4N6GA 3LL7A 3VU0A 4CM8B 3OHSX 2KW5A 2W2MA 2IP2A 2ODTX 1FUKA 1MBZA 5IF9A 4M0PA 3B7WA 5H68A 4B3XA 1VBMA 1OX6A 3U4IA 5K1ZA 1Q0LA 1PO7A 1T0IA 4ZRNA 1T4CB 4BO3A 1L5RA 1P4AA 3HJCA 3NKLA 1DIBA 3OFKA 1L5YA 3EHDA 4GZ6A 3Q0IA 2D1FA 5TEWA 2NO0A 1BMDA 3M6LA 4DAOA 2Y66A 1SBYA 2HKIA 3AG5A 1C3EA 2G76A 3H0EA 4M8LA 3W5HA 5D84A 5KNBA 2LW7A 2FCAA 5A9SA 4MO2A 3GEDA 2PKEA 2PT9A 1SBCA 2Z57A 3DTTA 3KXIA 4AK9A 4B09A 2HK7A 2JLZA 1FX0B 4Z99A 1A1SA 5HQ3B 1YE5A 1WUKS 4Q39A 4WRRA 1BEUB 3FNGA 5SZJA 3LP6A 5HW0A 1R6XA 3GT4A 5MN5A 4BZWA 3WDMA 2BFWA 1USWA 3SQXA 3A6EA 4NYMR 4KXVA 2QX6A 1U4SA 3KWMA 4JB0A 3G5LA 1KYWA 6NULA 3O2NA 4ZOQI 4HF7A 4MWOA 2EX1A 2WWIA 3EVCA 3HEAA 2G6TA 1Q7TA 3GUZA 2JLQA 3LY7A 4HZIA 4PFQA 3RYTC 1JHPA 3HVUA 4C7JA 5IJ9A 4CEJA 2G63A 3EUFA 3QV1A 3WICA 1GA1A 2WVHA 5BNIA 1K63A 3B2EA 4I9GA 4C9BA 1HK7A 2P3QA 4C4XA 2O19A 2VDLB 2DFVA 2NADA 1QK4A 2V7VA 3DPIA 3A1SA 1QDLB 2WU1A 2PMEA 2WKQA 3BL6A 3LHSA 1UXJA 1GAQA 4E12A 3H5RA 1CUIA 2HQOA 1YH3A 1LPAB 3K0EA 1U0RA 4KFCA 4GZ3A 1FPQA 1YGYA 4B32A 3ZQ4A 1U8TA 3PEVA 1PS0A 3BN3A 4XQCA 5DLYA 2JFNA 1V26A 1ZJ6A 5E0KB 1IMJA 2VH5R 4R0VA 5GJWC 1OXBB 4LIPD 4ZT3A 1T29A 2PQ0A 4NYMQ 3TMKA 1CE8B 1RLTA 2IZ1A 1HH4A 3G8CA 3NC4A 4R2JA 2VP9A 1RAFA 5KX5A 3DOEA 4J91A 3H4TA 5LDDC 3R76A 1HETA 3KLPX 4HDAA 3E9DA 1EP3B 1T2UA 3GH1A 1PSZA 4KAXA 3HCFA 1YTLA 4LJKA 5IT5A 3AETA 3HZRA 2DC1A 3HDJA 1KRXA 2ZYAA 1VHLA 4MRPA 3GEEA 6YASA 3CZRA 4QXOA 4QU9A 1BO6A 3B51X 3C3EA 4Q7EA 4TKUB 2J9FB 1ADGA 2IW3A 1CR1A 2W0SA 3JQDA 4UD6A 2FPKA 3HKEA 3BDIA 2UUAB 3HADA 3GDWA 4DR7B 2OPBA 3H3XA 4M0FA 3UYKA 2CLOB 2PO5A 2WVJA 4ZI7B 4WKPA 1D0VA 4WZBB 4D96A 1QFMA 4XB2A 2WWGA 4PSDA 4YUZA 3B9BA 3AILA 1GFWA 1XU9A 1FRZA 2DPLA 3HL0A 3UAOA 4CEIA 2DERA 4RD4A 1V8OA 3IUQA 3WYDA 3P9IA 3G2NA 3WLNA 4BC0A 4RF5A 3RAEC 1UWLA 3CJRA 4CKEB 4LRUA 2OLJA 5CNJA 2V8OA 1V47A 1A5ZA 3AKEA 3GXBA 3H13A 3JAWA 4Y0AA 1T1RA 4NFYA 3UWSA 5LYJB 3W5DA 3AETB 3PEYA 5KYXB 4M8NE 1SA0B 5EHNA 5KHOC 2FP4B 3AY6A 1CC1S 4HAXA 5JQGF 2HPAA 1CUSA 3IQEA 1G18A 3E0XA 3R5JA 2BBOA 1LY1A 3A1CA 5IBPA 1G1AA 5F3WB 2FN4A 4A82A 1P4RA 3KPUA 3A11A 1E20A 1E6KA 1KQPA 3L1VA 4JA2A 3RLFA 1ODIA 3GL9A 3TJRA 4KPGA 3AR2A 4QFCA 1II8A 1RAIA 1UM9B 3QKSA 1I4WA 5B64A 3EA4A 5BSGA 3IE0A 3NETA 3GVHA 3KTAB 3PIRA 4UNQA 3ADCA 3SNHA 4BLWA 1IQUA 5EP4A 1Q16A 2HA0A 3B6EA 2H2GA 1TQ6A 5I45A 2AUMA 2JASA 3CURA 4EG6A 2LKCA 3HCPA 3PZBA 4FBGA 2EW8A 4MEJA 1V5WA 1AIPA 3JX9A 2O0HA 4L8WB 2X58A 3TE6A 4PY2A 4D3XA 1MT3A 4GKBA 4O5OA 4LNHA 2N0SA 5HMMA 4BNFA 4AJHA 4HDSB 4JYCA 2O8FA 3M5PA 2NACA 3B5IA 3DS8A 5CFQA 4Y6OA 1V41E 4X91A 2SECE 2GPBA 1G60A 4G5OA 4BLTA 1L1EA 3OFJA 2IYFA 5A9RA 1WNFA 3DFZA 4FGZA 4M1YA 2PZFA 4OG2A 4QSHA 4Q3EA 1Z4OA 4DMUB 4FGKA 1F38A 2QMOA 2XUOA 1WB4A 4JLWA 1X7ZB 2VL7A 2Z9BA 3LXRA 1G7TA 3VKWA 1JILA 1DELA 4Q12A 1E60A 1TYZA 1U5CA 5LP1A 3UB3A 1IZ0A 2EL7A 3NEPX 3R5HA 1GPUA 4RPKA 4RA9B 2WFLA 4RF4A 1JWBB 3LECA 1P5JA 2EDAA 1ZOIA 5LB4A 2F8MA 2YC2C 4B3HA 2FUNB 3F1KA 4YV1A 2QVGA 1CEYA 1NG1A 3LC0A 4J8PA 4PQGA 2VSNA 4AG6A 2CFOA 2EBHX 3IPRA 3KS9A 4M1WA 1S2DA 5HBRA 4HNTA 1MKYA 1Y82A 4AO7A 2XCTB 3ZK7A 4IDCA 1T0JB 5FULA 3R7LA 1RAEA 2MSWA 5FWYB 5KVVA 2XYHA 3AF0A 3GXOA 1BJRE 1QWOA 4I4TA 3V4VB 4GFDA 3HJAA 3ZGVA 2ILTA 4Q4LA 4KE8A 2WU3A 2I8CA 4X6XA 3FPEA 4LJAA 1KA9H 1PLLA 3H1BA 4L1KA 5HXAA 3H2GA 1YQUA 4RQBA 4E6PA 1UC9A 1C2YA 4EQZA 3L7JA 3K8OE 4E2WA 1VJ1A 3TLXA 3QX3A 1KC1A 4BTEA 3PYMA 2ZBGA 4OI2A 2CNBA 5HS4A 3O8OB 3IQGX 1RBZA 3QU7A 4JN6B 4Q6WA 1D1SA 5I8ZA 2WK1A 5CA1F 4ZPXA 2HZ7A 3NOVA 3NIBA 3QFSA 1Z4QA 2HREA 5DDIP 3BL8A 4AAYA 4MVJM 4Q1BA 1AJEA 1R5BA 3NJ8A 3PE6A 3RRYA 3VR1A 2IIPA 2P68A 4C2BA 4R2WA 2Q2NA 1WNTA 4DLTA 4UTRA 3V1UA 1T2CA 2BC9A 3AERA 5HIAA 5IYZA 4R2MA 4U9HS 5KOYA 3H5WA 3SQNA 1XTZA 4LPSA 4NZMA 2WF9A 5BNFA 3VKHA 3H4IA 2HMTA 4NENA 5F4ZA 3SSOA 4K28A 1KVSA 4GQIA 5AVVA 4M0LA 5ESDA 3RUPA 3NUZA 2FLKA 1O7JA 3BHMA 2AA3A 2AQHA 5DKFA 3M2PA 3KTDA 3T9AA 1G41A 2VK1A 3LDHA 1W88A 2QIPA 1E6WA 2VHCA 4IO0A 4CTNA 4BO5A 2ZIVB 4IRUB 2WB4A 3DM5A 2XPCA 5G0TA 1ZIDA 2VZLA 5EP3A 1ORHA 1RPJA 4YREA 3T8YA 4Z54A 1K92A 3A6HA 4WASA 1ISPA 4JI3B 4EP1A 5TMEA 3EC1A 3R9WA 3CSUA 4CNBA 1XL1A 2BTQA 2NP6A 3WYEA 4JGBA 2AL7A 4YR9A 4Y30A 1CQJA 1Q6ZA 3HWRA 4GX1A 3LTEA 3RF6A 2ZZNA 1CYDA 1ULSA 4XPIB 1JU3A 4FOPA 4IHAA 1QC5A 1JR3D 1T5OA 3ET5A 1YCDA 4TKZA 4UMFA 3T52A 3WMGA 3PXXA 5G4LA 5E6UB 4ZI2A 2BUBA 2C2WA 2YIMA 2Z43A 4J43A 4LOHA 3ESRA 3JQBA 3WZLA 4DR2B 2ZYDA 3VR3A 1OAOC 3ROXA 3WTBA 5LD2B 1VIVA 4KGVA 1IHUA 4DTIA 3M5DA 3HBMA 3HN7A 3TTWA 4BTLA 1SZCA 2YW2A 5DIZA 1RHKA 3JWPA 3UXHA 3ZYZA 3F0TA 4WGGA 2DUUA 3JQ8A 5H1YA 3IIMA 3N8NA 5JVDB 5BPFA 4K6KA 5SZIA 3EWNA 1R88A 1OBFO 2E2WA 2G0TA 1BOFA 2HLNA 2Y93A 2YHIA 1PD1A 4IVNA 2H8KA 3DGEC 3KFVA 2J3QA 4FS8A 4G81A 4R1LA 4HMQA 2ENWA 4P2BA 1KFCB 4DLUA 5TY0A 2OWEA 1NVUQ 2Q21A 2ZQYA 2ISCA 3OHMA 3MB5A 3NHJA 1XUOA 1AA6A 4Q03A 1U3GA 2A9VA 2JEZA 1QJ4A 4DRZA 2R68A 2J9XB 3CRVA 3IURA 2UZ4A 2F59A 2CVPA 2VDWA 3BTSA 1W1WA 2ZYRA 4BFSA 4BCDA 5GONF 2BGWA 3E2PA 4RJTA 3T3NA 1CIJA 1HZZC 1PR0A 4RIFA 2RGUA 3GNLA 4LNUB 1POXA 3GRPA 4CMHA 1DVRA 4ZGWA 1BDMA 5ADUS 2IPAB 3TF5A 1MN6A 3ID6C 4UEJA 2Q5OA 4PC7A 3IR5A 4IX9A 2QLJA 1TFUA 5HDQA 1T8WA 2DQYA 2PZBA 3I28A 3K6SB 1GPH1 2QSYA 3EVNA 2IHNA 1XJCA 3WAGA 2GYUA 4RA6B 2XUJA 1KO8A 3MT9A 3LIPA 2AC7A 2DVMA 4RGQA 4MK4A 4JKOA 1LLQA 2CFIA 5F21A 5IUJC 3SMVA 2FN3A 1Y63A 1L4YA 4JBNA 1ZEMA 3ZVLA 2TS1A 3W6PA 4PLPA 4LYYA 3KQQA 1XCJA 3LTNC 3H5TA 4P93A 1DX4A 1R9MA 1JG2A 3CMMA 2P9QA 4F3KA 2YNMA 3AU8A 3T3EA 3TR6A 4GH5A 4IV0A 2X0FA 4D6XA 4D9EA 3U6BA 2BMDA 2OUIA 1XTVA 1PSWA 3VYTB 3C5CA 3KTFA 3VVLA 3DFUA 1L7EA 3ZIAA 3QFTA 4JQCA 4R69A 3STVA 5AMXA 2OHHA 3QK7A 3EZXA 3UTCA 2ZEJA 2ZWPA 4MR9B 2RI0A 4UZSA 1A5AB 3GLGA 1T2FA 1O0SA 4JK3A 3ZV5A 4C0JA 1QIMA 3MCAA 4JP8A 4RXTA 4N3BA 4TQAA 5INTA 3OA0A 3RVPA 4C03A 3FYUA 2R62A 3U5ZB 3ABRB 4V0MA 3C14C 3M0EA 4HP8A 1NIJA 2NWQA 4MV9A 4NNOA 3QBDA 3CLHA 2CV2A 4BGIA 4XVRA 2FPPB 3QWBA 1IUKA 3QBJA 3HXOA 2C9ZA 3ND7A 2YFQA 2X9VA 1YZQA 3H19A 3KV1A 1NVDA 2OWDA 1EZ1A 2W2LD 3HN6A 3R3YA 3LT2A 4JNCA 2H7VA 1CVRA 2RB5A 2VN8A 4XCQA 3SXUA 2B3DA 4GBED 3MUFA 5KYKA 1TUGA 3P97A 1QP0A 3N07A 1LDNA 4G5RA 1JJBA 4N5NA 2E18A 4QDXA 2J0UB 3PQ3A 1YONA 4FPXA 4QOSA 1OXSC 1E6CA 2WA1A 3BA6A 2CYBA 4V3BA 2CMFA 5JS2A 2PSFA 4E3WA 3EUEA 2I8AA 1BDJA 3M7IA 1D04A 1X77A 1LNSA 1DKRA 1CW2B 1ZRSA 3NUGA 3A6DA 1TCCA 4YALA 5ALNA 1E0SA 1Q7CA 4H3KB 1HNWB 5FI3A 3E3LA 4UM8B 4EKNB 4BXOB 4JLUA 5TGZA 5JYDA 3RC8A 1DCKA 1L7PA 5CVDA 1VBKA 3WYGA 1JI3A 4B9EA 2QU8A 3GLRA 1F8UA 3U7EB 4A6PA 5K2MA 4AU1A 4DMRA 1QO0A 4YRCA 1AK9A 3FTNA 1BVUA 2VZEA 5I3CA 5KKCA 1DPGA 1E3WB 4EA7A 4UHBA 4BVJA 2QRLA 2VHWA 4ZRMA 3SEZA 4P1ZA 1AS3A 2VJDA 4CODB 3Q5DA 2J0UA 2K4MA 4R1UA 1IWBB 4ABTA 1U7TA 3GUHA 5ECDA 2V5VA 3DHEA 2XOKA 4O4HA 3T3GA 3TYXA 2O5CA 3TKYA 2ERXA 4BKQA 5JDCA 5LFAA 5EIAA 1A2BA 1XZGA 1JDPA 1WOYA 1ZGBA 5DLQC 4FFRA 1NDUA 1QQ6A 4LE1A 5HJ2A 1KOJA 3SXPA 4YV2A 2ZUCA 5JU6A 1QIJA 4Y1RA 3R0ZA 2P6MA 3LKBA 1SOMA 2MYTA 1N0IA 1EPUA 5KCMA 1HDIA 2WA2A 4RPJA 2DU8A 4Z4GA 4LZZA 5DASA 4Q7KA 4GMGA 4AVYA 4J16A 4D3ZA 4J3NA 4KBYA 2I0FA 4LE0A 1ISGA 4JUBA 3ZHSA 3SHVA 1GUZA 5EEGA 3QQPA 3PFFA 2NIPA 4FX5A 2ZW9A 3TZKA 3V1LA 3RADC 4ZVRA 5DTJA 1QU3A 3N53A 4WWHA 2ZPTX 4FZVA 4HQOA 3R7NA 3VSDA 3WOHA 2D0IA 5JRJA 2VPXA 1PVOA 3HB7A 1DWQA 4FR0A 2NTYC 4HQFA 4KSCA 3B13B 5EGSA 7GPBA 4J4TA 2RBKA 1KWGA 4OSEA 1HLDA 1XO1A 4YJFB 4WY8A 1TAGA 3TD2A 2J9ZB 3ASVA 3TVTA 3WRXA 4QUBA 3VHXB 3K05A 4IYJA 4DDVA 3ND6A 2CXRA 5JPDA 3F3SA 3QUAA 1FQOA 1QCCA 3P0RA 3PJDA 3QUTA 1CT9A 2EP8A 1MABB 1T8UA 1PZHA 3FLAA 3OVMA 1A9XB 1LSOA 3BYZA 3HFGA 4H27A 1CY1A 1LRJA 2BGLA 2ZSDA 3IP6A 4D2IA 2YWDA 3ILVA 5KDLA 2G9UA 1E9RA 2GA8A 1AS2A 3D0OA 1J56A 2OT3B 2YVUA 4KGXA 4P3KA 7MHTA 3P0JA 5THKA 4XYLA 2ZWMA 4X60A 5HVNA 3EB9A 5AW8A 3GGGA 3KOWA 5G0SA 1BS9A 2XNHA 4O4JB 4G0QA 4ENTA 4FGWA 1DIAA 1I7PA 3HDYA 3FPBA 3R20A 4IRMA 4ZAYA 4WLVA 2P2ZA 2VOJA 3W7VA 1FFYA 1M73E 3N39C 4HS9A 1GR1A 1XDBA 2ZE6A 4URYR 4F38A 3BD6A 2VWPA 1WIWA 1ZK2A 1VI2A 4FNAA 5D8DA 2HU2A 1MB4A 1Z17A 3OSUA 3QFRA 4LFCB 4ALLA 1NDQA 3EAFA 4XGKA 2H31A 3TRHA 3BK2A 1N8TA 4QOGA 3P0HA 5LYJA 3WS7A 1XEWX 3IVCA 5J5AA 1ULZA 1RS0A 4GRAA 2JFHA 4QJ5A 2P9HA 4WNYA 2HXSA 1G64A 4DC9A 3ZJUA 1H3EA 4PINA 2C5BA 1EHIA 2POQX 2C1ZA 4RL4A 4BFVA 3QEMA 2ZCVA 2VF8A 3GT7A 1XRMA 2NVBA 4BLRA 4Q7MB 5ILGA 4M2LA 3BMNB 1OLUA 3E2MA 3EXAA 1IBMB 5JVDA 3TKLA 2J33A 4RE6A 2RHMA 4O63O 4IXNA 3IPCA 1F6BA 3UJNA 2ZE7A 3MM4A 1BS1A 2EEPA 3OT1B 2A9JA 4FYPA 4G09A 5KB3A 4NDNE 1GSOA 2JIQA 2GT1A 2N1BA 3G8AA 4N7JA 1JQAA 3RSOA 1JYSA 4FW8A 4B6FA 4BX9A 1JXMA 1FXWA 4D4MA 3AUSA 4R1MA 1II0A 3LPCA 4KVZA 5E9JA 1U3DA 3ZG6A 3AVYA 1P7PA 1YBAA 2QEQA 4YQZA 2DHCA 3FW1A 1GTZA 1SC4A 2FWPA 2QTTA 3ETHA 5A9TA 4YRPA 1E7WA 1DJLA 2HV9A 4P58A 2A0FA 4EPVA 2NO4A 3I6BA 1U6IA 2ACEA 4ITVA 2H65A 4PS1A 4YIKA 4BFUA 6GPBA 3HRHA 3GY0A 3PA6A 5JSQA 3KJHA 2DT8A 1K97A 4M0UA 1CUEA 3CUUA 4CCWA 5F1YA 4ENQA 3S2GA 3IQDB 3O84A 1FVOA 1JSRA 4KUEA 1QFSA 4D44A 4EATA 1CUZA 1EU1A 3ABZA 3JVVA 1J8MF 3FOBA 3EIOA 3O47A 2G8NA 4C4PA 4M1MA 1R2QA 1PNQA 3L0BA 3AVXA 4NU6A 3F5MA 4IHQA 5EMKA 3HA7A 4X1OA 3ZCVA 5CG1A 2IE0A 1LBEA 4L7QA 1NUAA 3BSFA 4YRKA 1GTMA 1KKUA 1T1IA 4RLQA 2TMGA 3K9CA 4EZEA 4K8RB 1SHZA 3A1NA 3GC6A 3K31A 4FYKA 2AOVA 4RM2A 1T34A 4Q3NA 2QTGA 2BTOA 1H8HA 2QXTA 5FWNA 2YXBA 2AYXA 5JNVA 1G6OA 2W8BB 1PLKA 3CF6R 4J7CA 1OYYA 1XAHA 3HDHA 2I55A 3GNTA 1YI0A 2RCNA 4AG3A 1O1YA 2JHCA 3DT8A 4P84A 4NBVA 3DLBA 2SCUB 2VF2A 2QE7D 4K5QA 5CH3A 2HQ1A 2W2KB 4RY2A 2FZ4A 2C4WA 3ANLA 3H8WA 3Q3VA 1WXFA 4Z2YA 4IG9A 3G89A 3WHIA 4ZTBA 4F45A 5AKXA 4RY9A 4N0EA 1WCV1 2YZGA 2YUIA 3HUEA 3CCFA 3NYWA 4EUSA 2OXRA 2XGJA 3IIJA 4KW7A 2DKOA 2C4NA 3IO3A 1UWKA 2AZ4A 3EVAA 1F8YA 1F0KA 3NS7A 1OXKB 3NKVA 2P9JA 1SUFA 4DIKA 2Q49A 3A4MA 3O93A 1EDBA 1B14A 1E3QA 2H92A 2CK3A 1T8YA 3KPVA 1A04A 2XITA 1MVLA 4Q9NA 4B5KA 1NATA 5IDQA 4OGWA 4RYDA 3B1FA 2P7IA 4IXMA 1E1MA 2ECQA 3BKWA 4J2OA 5IS2A 3VNSA 4JLNA 4LTNA 1GGJA 1VC2A 4H1UA 4DJ5X 4ICIA 2NOAA 1EFDN 4CMGA 1YCHA 3LQFA 1BMQA 1RTTA 3C6XA 3H1AA 1E9SA 2B35A 4TLEA 5KS2A 3OU2A 2QPLA 1KIAA 3R5XA 1XEWY 1W85A 2J07A 2QV0A 2ZAMA 2UV8A 3HKBA 4HX5A 4S1VA 5LBUA 2WTAA 3VZQA 4P2GA 5EVCA 1DINA 4I3GA 4QYSA 3RB8A 5BR1A 3FTCA 2YWGA 4HEA6 2XWSA 2W90A 2PV7A 2JCYA 3F1LA 5A2GA 2G7MC 5F1OA 3ZZ0A 3H2ZA 3E8MA 2QT1A 3GLIE 3K30A 2PGXA 2IYWA 3AI2A 5C31A 1FVXA 4ER0A 2QNIA 3C2QA 1G0OA 3JQGA 4J1TC 1D4OA 1XQVA 3HYRA 2AH5A 4P3OA 1H8EA 2ZTMA 2QK4A 3CX8A 5TF4A 2V59A 1Z16A 1S5PA 3F98A 3RIXA 4XVHA 2QQGA 2YJZA 3R3JA 2WHXA 3FUVA 4JAVC 3VV2A 5L3QA 4S1PA 5ALPA 1HE8B 2MDTA