3R20A

Crystal structure of cytidylate kinase from mycobacterium smegmatis
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
217
structure length
217
Chain Sequence
SLVVAVDGPAGTGKSSVSRGLARALGARYLDTGAMYRIATLAVLRAGADLTDPAAIEKAAADAEIGVGSDPDVDAAFLAGEDVSSEIRGDAVTGAVSAVSAVPAVRTRLVDIQRKLATEGGRVVVEGRDIGTVVLPDADVKIFLTASAEERARRRNAQNVANGLPDDYATVLADVQRRDHLDSTRPVSPLRAADDALVVDTSDMDQAQVIAHLLDLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
molecule keywords Cytidylate kinase
total genus 82
structure length 217
sequence length 217
ec nomenclature ec 2.7.4.14: UMP/CMP kinase.
pdb deposition date 2011-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3r20A00
3ZIAD 1KO5A 5JJKA 1LVGA 1M7BA 2CLDX 3KQNA 1C4OA 1E2FA 4EQ6B 3MCAA 4M0LA 3QIAA 1IN7A 1G4UR 1DO0A 1ZVQA 2VH5R 1FPMA 3NG1A 3D6TB 1BKDR 3QXCA 2QP4A 3HU1A 4MYUA 1IXSB 4TT3A 4DDWA 2OEPA 4JL6A 1L4YA 2WBLC 1ZD1A 1F6BA 1TF5A 2DFLA 1NY5A 5CLQA 1EESA 1EFHA 2ZQ5A 1XWIA 3O8RA 2PT5A 1YZKA 4URZR 4KFTA 4DT1B 5DSZA 2GKSA 1VTKA 2OM2A 4UKDA 2HEIA 3WMFA 3TUZC 4DB4A 1E0JA 5CM8B 1XBTA 2EVWX 3ZZ0A 1R0YA 4BECA 3L8ZA 2ZJZA 3P27A 4IOMA 3THWB 3R8FA 4RKFA 5TXGA 3A8TA 3KFVA 4FMCB 1W5SA 2YYZA 2ZE5A 4GSYA 2GAAA 1FL9A 2YOGA 4I1VA 2HYDA 1LF0A 1RRGA 1SKQA 1QBKC 2Z6VA 4CYMA 2BEKA 2PLRA 4E5UA 3PUXA 1Z0JA 3LQRA 4UNQA 3H1TA 3CWZA 5DN6D 4HLCA 1XD2B 3P1JA 1LV7A 2F7SA 4K46A 2OT3B 4IDHA 3GD7A 4XVRA 3QG1A 3VU9B 1XMVA 4TLDA 3SFVA 4LPSA 4YMWA 2ZROA 4MKGA 4JVSB 3RWOA 5JMTA 1W4AA 3U7FB 2JJ1D 1KK3A 3BB4A 1DE0A 1IN5A 3OIVA 4LJ5A 4OJKA 2GJKA 3IO5A 4U02A 4IOJA 4LBYA 2FSFA 2ZVQX 5HCIA 4B48A 4R2IA 1IY1A 2G1KA 3P4XA 4NTZA 4RCYA 5JEDA 1IXZA 3TQFA 2IXEA 4TSFA 3LA6A 4HAZA 4GP7A 2NO0A 5FI1B 3RS5A 4IVQA 4TSFD 4YLGA 3HJNA 1DTSA 3K0CC 1M1YE 1GZSA 3QVVA 2J46A 2EWWA 2PZGA 2ZREA 2XX3A 4L4UA 5E7MA 4BLRA 4GZLA 2A5YB 3GP8A 3LW8A 1YHNA 4OL0A 2JLVA 1VYUA 2B8WA 2R6DA 2WJVA 2IF0A 4TLEA 2GRJA 4MKHA 2REBA 3OEED 3FGNA 4BFXA 3IIMA 2CMKA 1FTSA 1S9HA 2GF9A 1G6OA 2D62A 4KJZA 4OK5A 1XTQA 2VRWA 3MWJA 1KO1A 2HLDD 2QE7D 4XD7A 4EFNA 4KV9A 4NMMA 5DLQC 2RAPA 3RC3A 4CVNA 3ZQ6A 3KKNA 5G53C 4N1AA 2BV3A 2GZAA 3LH5A 5IK2D 1G4AE 3ZDQA 4HUTA 2G0NA 4XOIA 1K5DA 5BN4A 3GEIA 1U8YA 1AKYA 2IYWA 3A58B 3NEJA 2HF9A 2QSYA 4JZKA 3D31A 4R9UC 3AV0B 5B64A 4M53A 1R4AA 2JJ2D 3P20A 4L15A 5GADl 2ZUCA 2JCSA 2UKDA 3T1OA 5KNDA 1W5TA 2ZITA 3EWAA 4QNMA 1E1QD 3CPEA 5P21A 3BB3A 1AS2A 1LTQA 2GCPA 1AK2A 3KB1A 4DLYA 2VHCA 2WHXA 4GOXA 4QBIA 4JJKA 1RKBA 2IHBA 3Q3JB 3MWKA 3CH5A 1GDDA 2UZ3A 2ZRGA 3D8BA 3A4LA 2WWWA 3IBYA 1TU3A 2Q9BA 4OHZA 2IS1A 3VTKA 1FMLA 1G20E 1Z22A 3QXJA 4Z54A 1YKSA 4RD1A 3ADKA 1S4QA 3OFND 421PA 1ZNWA 1FW6A 4PANA 1XU4A 1S3SA 1Z6AA 4XVQA 1IAQA 3IIJA 1J90A 1F5NA 2OESA 1KMQA 2WWFA 3NH6A 2XZLA 1P7CA 4TL6A 5CB6A 4D4KA 2UZIR 2QEQA 2ZRNA 3ZGXA 3O47A 1CRQA 2BBSA 3M1IA 1WCV1 3A1TA 5L3RA 1P2SA 4PPQA 4TLCA 3OIUA 2Y8EA 2VYFA 3VHLB 4OBEA 4BQSA 3AKYA 3PCRB 1TF2A 1W36C 1VCMA 2ZETA 5EXSA 3ND8A 3KQHA 1ZBDA 2IUTA 1R8SA 3R7WB 1SVWA 2BJWA 4DKXA 1ZNYA 4EIWA 4X8OA 1SULA 2K5UA 4CEHB 4MDFA 3SS8A 3I61A 4PC1A 5EUQB 2QAJA 3EW9A 2ONKA 1GNRA 3A37A 3KKMA 1HQYE 3AF4A 5EZ5A 1Q12A 2C77A 4BRWA 5JJLA 1SHKA 2V1UA 1FMJA 1KZGB 4DC9A 2W6ID 2DR3A 3RNLA 3RVBA 4PHTA 1WA5A 5DISB 3P26A 4Q1DA 1AS3A 2R2AA 1US8A 2JEOA 2JJ8A 3GLGE 4IEIA 1DADA 3DMDA 1YQTA 4CDGA 5JWOA 1Z8FA 5GVRA 5B30A 4A8JA 2QT0A 3EPKA 1C1YA 3IDQA 2NG1A 1RZ3A 1OIWA 1SVOA 1CJUC 2VO1A 4KO8A 2ZSAA 4HLQB 1HT1E 4IJMA 3W3AA 1NL3A 2R62A 3GJ8A 4D25A 1U81A 1AIPA 4PSVA 1CKEA 3OAAA 3F0TA 3OAAD 2C8VA 5GJBA 1A82A 4RZXA 5EE5B 4RVCA 3CR7A 3KTAA 4C0BA 2GA8A 2C04A 1R5OA 1RW4A 4JLAA 2OAQ1 2J0UA 4FINA 1NMXA 5FL3A 5JHGB 1KJYA 1ZM7A 2IK8A 4FCWA 4US2R 4KVGA 4OQNA 2ZI9A 1E3MA 4X8LA 5KDLA 3PR1A 2P0EA 1MO4A 1VHLA 4CEIA 1SVKA 3CX6A 3JZMA 1XTRA 2QPAA 3EARA 3U60B 4G01B 3OF5A 1KSFX 2ATVA 4MQBA 4DUGA 2AHOA 1MO5A 3N5CA 2GTPA 3MG9A 2AK2A 2B7BA 3U4QB 2GEVA 1T3SA 4W5WA 1XNJA 4G5SA 5EP4A 4F91B 4M22A 4D4LA 1P2UA 2FFAA 2XSZA 2IYRA 4FMCF 2RGNA 4Q00A 4XTRA 3BGWA 1G5RA 1A2BA 1VG1A 2OCAA 6Q21A 2BM1A 4KSCA 2D3WA 4WZAE 1DAIA 1QHYA 4HAWA 3GJ5A 3KZ1E 4IDPA 3AQ4A 1XTSA 3MMPA 4C0SA 1DG3A 3AF1A 4D6PA 5EJEA 1I4LD 1EFRD 2ZYTX 4TQ9A 3WRYC 2P3SA 2BDTA 5F98A 2BVNA 2GZHA 2WOJA 5FOVA 2OBLA 5KDOA 3ETLA 4UXJA 1AGPA 2AK3A 4NKRA 4Z1MD 3A6PC 1OXSC 4B73A 2DHRA 4ZIRB 4Z1MA 4B6EA 4XVUA 4FWTA 3RRMA 2W0SA 1UBGA 4LOAA 2OZEA 3SFZA 1TL7C 2YJTD 1WF3A 1Z0AA 5DO9A 2RB4A 1T6NA 2ODNA 3CW2A 4ERNA 3AUXA 4O2RA 1E9RA 1COWD 3AVTA 1E2HA 4XWAA 4GPTA 2A5DA 2AKYA 2J7PD 3LW7A 5B2ZA 1AJEA 1T5IA 4B75A 3IQWA 5JSZA 1NJGA 4Q47A 2DY1A 5FPHA 4LX0A 1NVWQ 2C78A 2PMDA 1KI3A 3CM0A 4XSGA 3QPVA 2KB0A 3DHWC 5EZ6B 1X3SA 1JJ7A 1KDRA 1E9EA 2C2HA 1GUAA 4LBVA 1KSJA 3I8SA 3TUJC 1E79D 4BFWA 1Q22A 1ONBA 4YMUA 5DH9A 4D4JA 4C7OA 1M74A 4TYWA 3Q7QA 4BZPA 2NPFA 5JI2E 2C9YA 2ZE8A 3H86A 4OQXA 2CK3D 2IYXA 1M8PA 2ZRBA 5FH9A 2W00A 1PLJA 4PO8A 4DLXA 2J59A 1N2CE 2CL6X 3F3YA 4DIDA 3ICQB 3RANA 2H92A 1FOEB 3TLXA 1NY6A 1GAJA 4QKQA 1IM2A 1E0SA 2IBMA 3VMFA 1EXMA 3RS0A 5LD2B 4LJ8A 2CCJA 2IA5A 3X2SA 1HQCA 2CEAA 5GJCA 4G5QA 3MD0A 4RCZA 2QGZA 2B8TA 1R5NA 4TYYA 4M1SA 2P2LA 1YR6A 4EFMA 4LJ4A 4ZDWA 1N3BA 4P4SA 2KSQA 1KNXA 4RJLA 3IKJA 3PJRA 3THWA 2BM0A 1E6CA 1NRJB 2QPTA 2FFBA 4US0R 4EPTA 2XGJA 4DDVA 2TMKA 1TNDA 4IXNA 2DWOA 2PZEA 4M9SA 5H8WA 3DO6A 4JVNA 2LCFA 1H8HD 3WYFA 4L16A 5HR5A 1XEWX 3B6EA 1N0WA 1KZ7B 4NYIR 4RD6A 1HH4A 2OUKA 3SOPA 4G1UC 1J70A 1O3YA 4S2EA 1XD2A 2DFTA 3A1VA 1A1VA 1YE8A 4M4SA 4HB0A 4PR0A 4LPKA 1GTVA 2CHGA 3AP1A 3REGA 2WWXA 1FP6A 2JDIA 3GJ6A 1OH5A 1F48A 1Z6YA 4B34A 4IEEA 4C3ZA 4FI3C 3J81k 2NTYC 3B2EA 1MABB 4BZQA 3GEEA 4CF7A 2WKQA 3THYB 1Q3HA 1ESMA 3SU8A 2KBFA 1ZAKA 2OV2A 1AN0A 2REOA 1Z0IA 5FOTA 4GRAA 2CNWD 1XCMA 2R6GA 3DOEA 3OZXA 1G8YA 4ZCIA 1IQPA 5G41A 1HTWA 4W5HA 2Q0HA 1T0JB 2NZJA 1H8ED 1R7RA 4URYR 3L0OA 2MSCB 3CPHA 5IK2A 3TQCA 1P9WA 2OFXA 2RMKA 1D8TA 3AVOA 3TSZA 5TV2A 2YV5A 2J9RA 3TH5A 2GBLA 3GJ7A 2ZRCA 4NYMR 1VDZA 5J4VA 3M4YA 4KU4A 4Q4LA 2RHDA 5EXXA 4DJTA 2ZE7A 3Q5DA 3KUDA 4WZ6A 1BMFD 2ZR0A 1S1MA 1X1RA 1X6VA 4BASA 1OXTA 4R71A 1E2QA 2ODBA 1E2PA 3DM5A 2WMOB 4U5XA 4AIIA 1XDBA 2XTZA 4AYXA 4Q7MB 4HI0E 3TGPA 5LD2C 1JECA 1NVXQ 4MRSA 1OH8A 3QKRB 2QBYA 3PUWA 4QM6A 4A1FA 5KTYA 3GJ0A 3LNCA 3W8NA 3TE6A 2VQSA 2HV8A 1Z6TA 5HKKA 3NTUA 2RKOA 3UWOA 4S35A 1Z3IX 1II8B 3QXSA 4JLPA 4GP6A 2IWRA 2F6RA 1F2UA 2FGJA 2PCLA 2GK7A 2IS6A 1Z2CA 1R8QA 2HF8A 4GL2A 1AS0A 3W3ZB 3GJXC 1RYFA 1W7AA 4HEJA 1E9BA 3Q72A 3TK1A 5JJIA 1RVDA 5J4YA 1CEEA 1U9IC 4EJSB 2NO1A 4ZKEA 4JLNA 1G17A 2GXQA 4TMWA 3IPXA 1VECA 1CJMA 3WRXC 4CT4B 1ZIOA 2QENA 4O0MA 3AEZA 5HE9A 3EWSA 3BD9A 4IKEA 2W6IA 5AJXA 4PAMA 5LPNA 3DOFA 3GLHA 4RSGA 2PX3A 3RS2A 2IYLD 1GRRA 5ANRB 3FVQA 2VIIA 1OFTA 2CJWB 3PIRA 4CT5A 3AVYA 1JPNA 2ODWA 4F4IA 3GMTA 1JXOA 4DXAA 2ZM5A 2C9CA 5CYOA 1Y3AA 2ZJYA 4NCKA 1Y63A 1W36D 3TVDA 2GXAA 1MV5A 2DYKA 2OBNA 3B1VA 4MGZR 2ANCA 3I5XA 3VKGA 3L8YA 2ZVPX 2ZJBA 2QAGB 2J3EA 2FF7A 1NVUQ 3GLIB 2D7DA 3EXAA 2HDNB 2R6CA 1M2OB 4E22A 5JEEA 5JS8A 4MKFA 1QRAA 2PJZA 1ZW6A 4TMKA 2DBYA 4JLKA 4HZIA 1CBUA 2CL0X 2HLDA 2QE7A 3SJBA 4OJQA 1YR8A 3O8BA 1SHZA 4G5GA 3ZD6A 2FPKA 2OG2A 1YU9A 1R2QA 4NCHA 3VHXA 1KY2A 3QKSA 2W2VA 2XOKD 4DDTA 5EXTA 1AGRA 2AWOA 1XPOA 3W6PA 2ZRMA 3U3OA 5CJPA 1Q3TA 2ERXA 2P6NA 4MRNA 1KTVA 2GNOA 1J8YF 4AD8A 2OHFA 4Q1CA 4FIDA 1GIAA 3THXB 3EC2A 3OIWA 3THXA 1CULC 4DSUA 1UJ2A 4TL7A 3JVVA 3U5ZB 3I4LA 1G18A 5IF9A 1LS6A 1M7HA 4GFDA 4B3CA 2R44A 4HUQB 2P67A 2YWGA 1CR0A 4H9GA 3CKLA 2A78A 2FZ4A 2AN9A 2ZYVX 2ZJ8A 1X8KA 3MWYW 1LS1A 5AUPB 1UF9A 2IF2A 2V6JA 1BH2A 5TARA 1VYVA 1HYQA 1E96A 1D9ZA 2J0VA 1X86B 1TEVA 4W7SA 2A3RA 2QUZA 2WM9B 3PEYA 2GXSA 1NMYA 2ZUBA 2FV8A 5FI0B 4TYNA 2YNMA 2BHRA 5FR1A 5K8IA 2DB3A 4ARZB 1QVRA 2VF8A 4MRRA 3QEJA 2AR7A 4B33A 4DLRA 1KK1A 1SVLA 3B8HA 4KSBA 1MO6A 2JA1A 4Y0AA 1FQJA 4PX9A 2NO6A 4URWR 5KPDA 5EE9A 3KQUA 4XD7D 1W47A 2HJVA 1UEJA 2ZRFA 2Z4RA 3EAQA 2ZPTX 3LDAA 1U98A 1EK0A 1Q57A 3L82B 1NVVR 4HB2A 3SE0A 3JVUA 3VR1A 2OCPA 2IUUA 4O25A 3TKLA 1DAGA 4EPRA 1LB1B 1YZQA 3FKQA 4JJZA 3RABA 1Z47A 2BJVA 2V54A 3L43A 3SNHA 3B1ZA 3W5JA 4NCIA 1ZU5A 2P6RA 1SKYE 4D81A 3AVQA 3CO5A 1ZP6A 4WIAA 3H0KA 1E98A 4ITRC 3AGPA 4PSAA 4UNPA 3C5CA 4G3XA 3K0CA 3LBHA 3LY5A 1E1QA 1KGDA 3KXIA 2NMVA 1IJFA 1DS6A 4HDOB 1VG8A 2O5VA 4D80A 2Z43A 2XNDA 3DPUA 3HU3A 5FTMA 2JLUA 2GESA 2CCKA 4ZCLA 2C95A 1G64A 1XD9A 4TZ0A 1ZCBA 2A5GA 2O8DB 4N3NA 1OF1A 2AFIE 2GVDC 1LY1A 1UBFA 3NBXX 5KSYA 1IY0A 4MDEA 1OKKA 2I4IA 1G3UA 1VPLA 4RZ2A 1ZNZA 3IIKA 2EQBA 2IYVA 1FX0A 4BGDA 4RFSA 3C5HA 3KJIA 3QPUA 5DI9A 4C7OB 4JL5A 5CK4A 4F38A 1SXJA 4JIMA 4MA4A 2P65A 3FMFA 2FSIA 3SR0A 2IS2A 1K5GA 1OT3A 4LY6A 1F3OA 4M9ZA 5D3QA 2ASEA 5HE8A 4DCUA 4C2UA 2A30A 1ZU4A 2FH5B 4KODA 4W5JA 5FTKA 1E2JA 2ZANA 2ZRDA 3HYTA 4QOSA 4B47A 4OI0A 4M1OA 2OAP1 1EGAA 4OQMA 1UEIA 1WP9A 4ACAA 4B2LA 4URUR 1E79A 5AJYA 2YZ2A 4DUGD 4BLOA 4LBWA 3N70A 1J7KA 1MRNA 4EAQA 2QGNA 4UXHA 1EG7A 1NNEA 4C2TA 2IT1A 2ZI5A 1SVIA 3BORA 4LC0A 4LC1A 4C0HA 2HT6A 1M6NA 1W44A 4KLZA 4YMVA 3UKDA 2J0SA 4WAUA 5FR2A 1G6HA 4LDJA 1IHUA 5AK0A 3H84A 1S9DA 4DHEA 3AF0A 2QM8A 4EPWA 5JHHB 2XXAA 1Z83A 1L2TA 4US1R 1JNYA 1P5ZB 5BW8A 2WJIA 1SQ5A 2IS4A 5BWMA 1NN3A 1CIPA 5AUOB 1DBSA 2ZRIA 3PV0A 4ACBA 1UPTA 5K8LA 1WRBA 3N2IA 2BCJQ 3NHAA 4IDQA 4HATA 3LVQE 4ILEA 3GEHA 3NBZC 4JVMA 5J40A 4C4PA 1UADA 4BE7B 4GDFA 2ZI4A 4OKSA 3K1JA 1OH6A 4IDNA 2Q3FA 2ZSDA 2W58A 4PO1A 2NGRA 1WQ1R 1F2TA 4P33A 2KWIA 2WJGA 1I4TD 2ZR7A 3TMKA 1OFIA 4Q02A 4BEJA 1JR6A 1Z28A 1YRAA 4LJ6A 3KKQA 1OLOA 4JMPA 3U7GA 1ZCAA 3B60A 3WYAA 4DRZA 4CRWB 4IDOA 3RYTC 4URXR 1YZTA 3WNCA 5J47A 4DBLC 1JR3E 3VNVA 4Q9LA 1E9CA 3SHWA 2Q9AA 1P2VA 4B2IA 3EPLA 1P73A 1AZTA 2ZS9A 5G3YA 3VR4A 1A4RA 1PJRA 2VP6A 3KJEA 2Z0MA 3HDTA 3DZDA 1VG0B 2A2ZA 4HDQB 4PC6A 2GJAA 1Q0UA 3LBNA 1TQ6A 3K0SA 4RD0A 5DIFA 4I1UA 3VNUA 2BEJA 3K0AA 1QHHA 1BS1A 2IXGA 1Q1ZA 1JPJA 1LW7A 3U4QA 1YR7A 3SJZA 4QJ3A 4LSGA 1FUKA 1P60A 2CL7X 1JR3A 2EYQA 3GLFE 5KSOA 4A2PA 4D82A 2F1IA 2W83A 4NCNA 4Z51A 1CR2A 1OHHD 3BIFA 1HV8A 5AUNB 4NYMQ 3EZFA 4OQLA 1OIVA 4D0NA 1CJTC 2O0HA 4ESVA 3LRPA 2Z5FA 3QENA 5FUVA 4QC2A 4CW7A 3C8UA 4V0MA 4Q1BA 4ABYA 2ZU0C 4ARZA 3B7GA 1XB2A 2ZI7A 3EA5A 3K70D 5FUXA 3TIFA 4D0LB 2PEZA 3KUCA 2X2FA 1OPXA 5JZVA 2VPPA 3K9GA 3UWKA 5KO2A 3BE4A 2WVJA 1L7VC 4EPVA 5FBVB 2AXPA 5L3SB 3QF7A 4C0LA 5A5GA 4LGMA 2R65A 2REXB 4GMXA 2PEYA 4NBSA 4TL8A 5FUYA 4DZZA 4DDUA 2GF0A 2FDCA 1ZJ6A 4A8JB 4JYCA 3UG7A 5CDFA 4JBYA 1E4YA 2BMFA 4P4SB 4OI1A 4B3BA 4WA7A 1Z06A 1ELOA 1ZINA 1S2MA 3B9PA 3K0AB 3BBPA 4IRUB 4JT4A 2ZU6A 5KU1A 3IQXA 3UANA 3RSLA 5BXQC 2J7PA 2QNRA 4AURA 3TUIC 2VL7A 4Q01A 3SC3A 1BO6A 3SHFA 1BIFA 2FEOA 5FOXA 2GDJA 821PA 3X1WA 3ASZA 2BBWA 1KI9A 2GCOA 2G9NA 3U6KA 1S1CA 1TUEA 3CX7A 1OHHA 1E1RA 2WJJA 2F43A 4DCNA 1NKSA 4BZXA 3VR5A 2I1VB 3AVPA 3W90A 3IO3A 5JS7A 3AF3A 4LJYA 1SXJC 5L3QA 2O8BB 3OEEA 4A0HA 2QZ4A 2IYYA 2CNWA 2DPXA 1JBKA 1FNMA 3B82A 3SJCA 4Q9KA 2QI9C 1CTQA 1AZSC 5HKKD 3UMFA 3QSYA 3OHMA 1KI7A 2GHIA 3TSOA 1GSIA 1G19A 2V9PA 3RSOA 3H4MA 2ZSBA 4AYTA 2FNAA 2KI5A 1RYHA 2J45A 3PVSA 1V5WA 3BFKA 3QKUA 2JLZA 1MRSA 1Z6GA 3BH7A 3PUZA 2O8DA 4IXMA 4V0ME 1XZQA 1G8PA 1OFHA 3T5DA 2YOHA 4FMDF 4TL9A 4E07A 5JWHA 1QHNA 1W2GA 1U94A 3W8RA 4KHZA 2I3BA 4YDHB 3JZAA 3FYHA 4B74A 3KXLA 4RKEA 3WBJA 2ZRHA 3NC0C 1N6KA 2GAOA 4KVAA 1E2LA 3BB1A 3MLEA 1SXJB 3QQ5A 4TWZA 4B35A 2PJRA 4AWXA 4LYJA 5GJVC 4RFSB 5TY0A 1E4VA 2OO7A 1I2DA 2YC2C 4B3FX 1RPZA 4Q9IA 1G21E 1N5KA 2RH5A 1YR9A 2O52A 2WMNB 4NPHA 5BYKA 1Z29A 5CM9C 2QQEA 2WIAA 2ZXUA 2ECKA 1DEKA 4KI0A 4A6PA 4Q48A 1G7CA 2FEMA 1J8MF 4LHXA 4N0DA 4EFLA 4KFSA 4QHSA 2GJ9A 1RC8A 3BS4A 3HYRA 4F92B 3NH9A 4L5BA 4WOPA 4IFEA 1E1RD 4POAA 1OYWA 2NPIA 2B7CA 2MMGA 1VCOA 2YVUA 3K70B 2IXFA 4QGFA 1CR1A 2YHSA 4Q1FA 2YINC 4K8OA 1X8JA 4DCVA 1GKYA 1WXQA 4AK9A 2QMOA 1SZPA 4QBFA 2FPLA 2VF7A 2IEYA 3I92A 4MKIA 3EZ9A 1FQKA 3QBTA 1PUJA 1JEDA 4JLJA 3NEYA 1ZUNB 1DAHA 4PQRA 5L8VA 3VQTA 2OE2A 2A9KA 2XSZD 4H1VA 5CYPA 2I1QA 3PXGA 2JLWA 3I73A 5G3ZA 3PENA 1U8ZA 3VAAA 1YVDA 2D74A 4GMDA 2P5SA 3BWDD 3U3RA 3K9LA 1TUIA 3B9QA 2H18A 4XSHA 5F9FA 2FE4A 2YOFA 1NVVQ 2PH1A 3W34A 3QBVA 2W2TA 2LKCA 3CWQA 3ZZUA 1TMKA 1XEFA 3C41J 4OI2A 4BLSA 2O8CA 3ZVLA 2F3RA 4TLAA 5IT5A 2WV9A 2YWHA 4FCVA 2ZJ2A 1TX4B 3I3SR 1XMIA 2HYIC 1P2TA 2F9MA 3CZPA 4HAUA 2GEDA 5F3WB 2PMKA 3MAAC 2XTNA 1Z2AA 4R2HA 2GBLC 3W6NA 3RWMB 3M0EA 5SZKB 1HE8B 5JI3E 1NKTA 3PUYA 2QU8A 4HLUA 5H1YA 4JLDA 1XEXB 4PQFA 1OXUA 3A1WA 2WICA 1AM4D 2CLCX 1VIAA 3TJZA 2WZQA 3NIBA 5KNCA 2D2FA 1G3RA 2QP3A 3DEFA 4M1WA 2NO7A 2WKPA 3G5UA 2YWEA 3CUEF 3SBEA 1GM5A 2WSSA 1CRPA 1QZXA 4KBFA 5IHPA 3T06B 4KFRA 2ZS7A 4PSKA 5DI3A 2RGAA 5M04A 2W6JA 3GLGB 5EP3A 4ZCMA 4R7ZA 1QG2A 3EC1A 2D4HA 2X19A 1FUUA 5JRJA 4GNKA 1XEXA 4A2QA 4QNRA 3DL0A 1W0JA 4ZPXA 4B43A 3AKEA 3OIYA 1DG1G 1GRQA 4QGHA 4O2LA 1HA3A 1NP6A 3L0PA 5D3MB 1XMSA 3GJ3A 1KY3A 3DDCA 2DFNA 2H1LA 3VR6A 1Q44A 5HCNA 4AYWA 4BPBA 4Y0VA 2D06A 4AI6A 3T15A 3TRFA 3SQWA 1ZD8A 3QG5A 2GCNA 3RS3A 3DM9B 2WWGA 2P6UA 2JATA 4DLUA 1KI6A 1ANKA 1IN8A 1Q21A 3LX5A 1MO3A 3MWLA 2XJ9A 3CZQA 3SI7A 2C5LA 2VHJA 4BLTA 3UIEA 4DLTA 3WXMA 2PL3A 2EFGA 3KQLA 4AKHA 4LRWA 1UM8A 4ZDIA 1WBBA 2G1JA 3QOFA 1YZGA 1W0KA 4KFUA 1II9A 4DVGA 1HUQA 5DGXA 4B3XA 3NC1C 3FFAA 3Q8XB 1D6JA 2G88A 1SXJD 1JQJC 5DNYB 2VP4A 5J4KA 4M8NE 2B6HA 3K0FA 3FPAA 3P32A 2V3CC 3FHTA 3EIHA 4JT2A 4B76A 3A1UA 2R6FA 4MRPA 1CS4C 3CRMA 4YMTA 2ZRJA 4IVPA 2CCGA 4M1MA 3EPJA 1X1SA 3IEUA 1UKYA 3VKWA 3PUVA 1U99A 2ZIAA 3AKDA 3I32A 1E0KA 1T8TA 4BEBA 1YZLA 1W4CA 2AXNA 4EUNA 2BMEA 3NVAA 3V00A 2GVZC 4LUCA 4AKEA 5A4JA 3TNFA 3HP1A 1II8A 1N0UA 1E9AA 2OCBA 3VU9A 2G83A 1JR3D 3OEHA 4GBMA 4D2IA 5JCPA 1G1MA 4V0LA 3OEHD 1N6RA 5KPJA 5A0FA 3C16C 3W6OA 1VCIA 1TQ2A 3QNUA 3EZ6A 4OHVA 1PLLA 3TW8B 2V4ZA 2FSHA 2FG5A 4FMDB 2QY9A 5BQ5A 4AKIA 1WE2A 2ZI3A 1G8HA 4W9MC 1G3IA 1Z63A 1ETUA 2J5XA 1E0AA 5FOUA 4URVR 4PPNA 5FTLA 2F1JA 2W2XA 3OE7D 4ESHA 4M1KA 4P32A 2CHQA 3B78A 4Q1AA 4BUJA 4EDHA 3TAUA 1AA9A 2IHYA 2P5TB 2D2EA 2QQ0A 3FWYA 3FKSA 4Q66C 1MOZA 4GOKA 1KO4A 4LBZA 1NI3A 3ECCA 1H8HA 3SYNA 4EJSC 2JLYA 1VCNA 2ZSFA 2VSXA 3EA0A 1YRBA 2ZJOA 2GCOB 1OW3B 4B6FA 4D4MA 2A7QA 3WP1B 2JJ1A 5AJWA 4I1SA 4AC9A 4TQUS 4EPYA 1UBCA 2FOLA 4G5RA 1E2GA 3X1ZA 2IYSA 2ZTSA 4C30A 2FMXA 2HCJB 2PT7A 2O0KA 2QTHA 1Z08A 4BRUA 2DWQA 3SJAA 1T3HA 1FP7A 4GOJA 4UJ3A 5IRCD 2QTVB 2ONJA 1KNQA 3U3JA 2Z4SA 1R0XA 2WKRA 1CJKC 1HE1C 1DAKA 3ZVMA 4Q4AB 5TVKA 4B2PA 4PZZA 3LXXA 1XPRA 1TPZA 1E32A 2IC5A 3EZ2A 2VP9A 4JS0A 3KKOA 3GLFB 3AVWA 2QBYB 1TTTA 4LK2A 1B23P 4Q4HA 2D7CA 2OLKA 5FUWA 2RGNC 4B3GA 3EIQA 4LHVA 2Z83A 1VKJA 3KQKA 3BH0A 1JEEA 1OXVA 4JSTA 3GLIA 2F9LA 2BKUA 4I4LA 2O8FA 2BBOA 2X77A 3CF6R 3WHLA 2V8OA 4M1TA 3AVXA 1IXRC 2X8AA 4MGYR 4B44A 4P31A 3EZ7A 2ORVA 1R5BA 3CONA 4PPFA 2MSDB 3R20A 3VX3A 1SVMA 1XJQA 4IOLA 4Q03A 2J7KA 2ZYUX 4JKIA 5SZHB 1Z5ZA 5FPTA 1Q1BA 2IYTA 4PHHA 1GRNA 3CNNA 2H8KA 3ZJYA 4P0TA 3UPUA 2WOOA 4TT3D 5FBQB 1KHTA 1EWRA 2OLJA 3FTQA 4YQFA 4QL3A 2GK6A 5EQTA 5FBLB 2O8FB 5UKDA 3V9PA 1NSFA 1TU4A 2NQ2C 1KYIA 4LV8B 1DAEA 3GFTA 4PC2A 3KJGA 2V6IA 5CJ2A 2VBCA 2ZRKA 5KOYA 3ZVRA 4DEYA 1F60A 4MYHA 1E2IA 1TADA 2RGBA 2BKEA 521PA 2AL7A 1SXJE 2XB4A 3R7WA 4L9WA 1QF9A 4YDSA 1NF3A 1SKYB 3LFUA 4NH0A 4LCBA 1N5LA 4RZUA 2N1BA 1KJZA 2GJSA 1L4UA 3QJYA 2WJYA 5GVSA 1BYIA 1KAGA 1O87A 3T12A 3ADBA 3WHKA 3TR0A 2IYQA 5JRZA 4N0EA 3DKPA 1OIXA 2GWHA 2J87A 1G7RA 3UMRA 1US8B 1G9XA 1E9SA 4Q4JA 1UKVY 5SZIA 4PZLA 1QHXA 2O8EB 5EE3A 1A5TA 1ODFA 2LWIA 2QTFA 1V43A 3FFBA 3Q5EA 4AG6A 1OFUX 2DWPA 2KBEA 2ANBA 5GJWC 3K70C 4NYJQ 1IBRA 4PFSA 1CXZA 2ZS8A 1XD8A 3PEUA 8OHMA 2QROA 3A4MA 3WY9A 1F2UB 221PA 2BMJA 3TW4A 3I8XA 1T5LA 4BFSA 1GG2A 3ZIAA 2XJ4A 4ZDKA 2ZE6A 2IL1A 2JIZA 4A0GA 4BLQA 4D26A 2MMCA 3LWNA 2JLSA 3IPYA 1UFQA 3N2EA 2XZPA 2VSFA 2WIBA 2JAQA 3B1YA 1BYUA 4CGZA 4Q7KA 5L3QB 1OB2A 3TVTA 3A1SA 4PHFA 3PEVA 1QHGA 1K6MA 3EIEA 3I72A 2IWHA 2C9OA 1KO8A 3R9IA 3AVUA 1U0HC 3NBYC 3T1TA 1OJLA 4NYIQ 3LBIA 3K09A 4PPGA 1RRPA 1VIYA 3ONWA 2WWIA 3HPQA 3QKTA 4KYIB 3QPWA 2AD1A 1XTKA 2WAYA 3WP0A 1IN6A 2BIFA 4Z8XA 4BFVA 4FWIB 4QRHA 4M9XA 2HXYA 2ZRAA 1IOZA 3PQCA 1G7TA 1G7SA 4ZI2A 4XJXA 4NP6A 1P4SA 1T8UA 2G0TA 4LJ7A 3FB4A 3EPHA 721PA 2WSSD 3BRWD 1UDWA 5KUTA 4DWJA 1G5TA 2QM7A 4CEIB 5JFGA 3FHCB 1JALA 3LD9A 4A2WA 1FTNA 5FTJA 2BCGY 3RHFA 3H2YA 3RAPR 1RJ9B 5K8UA 1BOFA 1WB9A 4ZIRA 3T5GA 3KTAB 4NL4H 1FFHA 1TQDA 2HT1A 4TZ6A 2H57A 4E09A 5DYGA 3X1DA 3MGCA 2OXCA 5E95A 2Q6TA 2FA9A 1NN0A 5HTKA 2FX3A 4CIDA 1K8RA 4DSNA 1HY3A 4RZ3A 2JIZD 4P3YA 4QHYA 3BFVA 3DVLA 3KX2A 1G3QA 5TB5A 3O8DA 3NXSA 1XXHA 5EUMA 1WDTA 1IJEA 4Q21A 2OFWA 3FOZA 4DLSA 3PG5A 3I1FA 4LYAA 2VP5A 3QXXA 3CRQA 1VHTA 2CBZA 4B3DA 4PC7A 1M34E 1E2NA 1T0HB 3VR3A 2L0XA 2NZ8A 4LJ9A 2XOKA 1XJ0A 4LJAA 2ZAMA 4UNSA 5BN5A 1N5IA 4Q7LA 4OHYA 2VHQA 5LB2A 1ZM4A 5TDHA 1ZM2A 4LHZA 4A92A 5HPYB 4A82A 5HZHA 3NHBA 1W1WA 1NN5A 4DCSA 1NIPA 3NWJA 2WWYA 3R8CA 4CEJB 1DELA 3MJRA 4TMTA 2GJ8A 2KJQA 1UAAA 1W2HA 3K09C 2ZSEA 1NBMD 2WPDA 2YWFA 1AQYA 3QUSA 1E69A 3L0IB 3CPJB 4BFZA 3C4JA 3SEAA 1U0JA 3TR5A 4NONA 4O3MA 2W6JD 3IILA 2GZDA 2F3TA 3CRVA 3F8TA 3AM1A 2XNDD 4OHWA 2X2EA 3BH6A 1JAIA 4MITA 2PCJA 1W4RA 4I81A 4EKDA 4CEHA 3GLFA 3LAWA 4WBSA 4XTCS 3GCGA 1EFTA 1G291 1D9XA 4AKGA 3U44A 1EFRA 1R10A 3ZH9B 3VR2A 1W49A 3ZVNA 1E2KA 3ZS9A 2XEXA 1MKYA 2NOAA 4NZYA 1R0ZA 4TYQA 3CIOA 2YC4C 3RLFA 1GL6A 2XB2A 2VA8A 1M7GA 1OH7A 2XAUA 3L2OB 2O8CB 2VLIA 1RJ9A 4RD4A 2E9SA 4TYPA 3X1XA 1P72A 3HU2A 1W4BA 1JJVA 5HZKA 1U2RA 1P9NA 2H7VA 4PHGA 1CLUA 1G16A 2EWVA 5B57C 1NLYA 3UK6A 1D2MA 5BYJA 1QG4A 2VEDA 2OILA 4JKYA 3BJIC 3AUYA 4H1UA 2QAGA 1NLFA 1XP8A 2ORWA 4OK6A 4TMVA 1YZNA 4Q18A 1PV4A 1XXHB 2XXAB 4UQOA 3NDBB 1KMHB 1KKLA 4BFUA 2V55B 3NKVA 4MUAA 4E03A 1Z0DA 3U61B 1AKEA 1GNQA 3IGFA 2W0MA 1GL7A 1ESNA 1MT0A 1XZPA 4CEJA 2ZJ5A 1A2KC 1NSTA 1UKEA 1VYTA 3PEWA 3SBDA 1N25A 5C18A 4Q5IA 2J1LA 3SZRA 1KDOA 5E3HA 3QEOA 1Z0KA 2C99A 1YJ5A 1OB5A 2EFDB 3G82C 2PX0A 2ZAOA 1DAFA 3V4FA 2J0QA 4PO9A 1QDEA 2CDNA 1D2NA 1FZQA 3KDSE 4QHTA 3RRZA 3U2QA 1MH1A 1OKKD 2CVFA 2IX3A 1N6NA 3T61A 3ICEA 5J4HA 3AP3A 4FW9A 1DOAA 2WSMA 4WW0A 1KJWA 1ZD9A 1PLKA 4Q9JA 1VMAA 5IDVA 3X1YA 2BOVA 4FCTA 4F4JA 3C14C 3WMGA 1XRJA 2CJWA 1SGWA 1U0LA 3CRW1 3SN6A 3ZD7A 1G5PA 3FKSD 2ZRPA 2AD5A 5FL7A 3REFA 1DVRA 1F2TB 3L0SA 4XWOA 2ODEA 2JASA 5CIQA 1I4DD 4V02A 1COWA 1U90A 1OYYA 2MSEB 4JVLA 1GP2A 3U44B 2GXUA 3KFXA 4M9QA 4TN1A 4KXFB 3CBQA 4HLUC 2AWNA 2EW1A 4V0NA 5D3MA 4HAVA 2N42A 4A15A 4LYFA 1RRFA 2FFQA 4KCGA 1EFUA 5CB8A 2FWRA 1GKUB 2V7QD 1CF4A 1RFLA 1QHSA 4IHQA 1A7JA 3C7KA 3LQQA 4A8JC 1RIFA 4OYHA 4QBGB 3T34A 1XCGB 3IBGA 1KI6B 2QL6A 3R9XA 3QY0A 4V0KA 1B0UA 1S8FA 5FFMA 3HWSA 4JYBA 2Q21A 5AJZA 1IN4A 4AY2A 2ZI6A 5TMPA 1KMHA 4KBGA 4TMXA 1EFCA 4FN5A 2KE5A 1T3LA 1NG9A 2CE7A 1VG9B 5H70A 2RHMA 1DO2A 1JQLB 4DT1A 4F93B 2WTUA 3EG5A 1IY2A 1TQ4A 3OESA 1N6LA 3WMEA 4DSTA 5AUQA 4IW3B 1KO7A 1GL9B 3UATA 5FL7D 1GWNA 3PFIA 2C96A 2GILA 2Q3HA 2FU5C 3NBFA 3CNOA 5G40A 1NLZA 1GITA 1GOTA 1T4GA 2G77B 1NJFA 1WMSA 4EQ6A 4HB4A 3CX8A 1ZYUA 3LO5A 4A4DA 4FD2A 4FMBB 1MABA 2JGNA 4G5OA 3RS7A 1W36B 4HYYA 3CLVA 4ZKDA 5J4LA 2H17A 3ND9A 3WYGA 1P62B 2VP2A 5CLLA 3B1XA 4YONB 1Q20A 2IYUA 3P4YA 4PZYA 2O8EA 3ZLJA 3AH8A 2DCUA 4IOKA 3MUFA 5DYIA 2OSBA 2GEUA 1X8LA 2QRZA 4P4TA 4A6XA 5FPSA 3U7EB 2BWJA 3K9HA 1T9HA 4X8HA 4DLVA 3Q9LA 4HLDA 3AVVA 4Z8YA 3Q85A 4TTRA 2ZUDA 1CJVC 1U8AA 2FFHA 1S96A 1J99A 2VHUA 3FDIA 4MGIR 3CF0A 5JCZA 4ZDJA 3SQXA 2IYZA 2FPMA 2ZEJA 3I5YA 2HXSA 2NO9A 2VHTA 3QF4B 4NYJR 4G0NA 1N6HA 2FGKA 4JBXA 3BC1A 1UDXA 4WXPA 4HDCA 4Q9HA 1LNZA 4DIEA 4LV6A 5CITA 3WNDA 3BERA 1JB1A 3BXZA 2BBTA 3TBKA 3BAFA 1KK0A 3ZYCA 4LI0A 2XTMA 4QBHA 2QT1A 2QN6A 1T91A 3Q7PA 1C9KA 1II0A 4M21A 1N6OA 2G6BA 5CDFE 1FNNA 1P6XA 3RDPA 4A0RA 2FSGA 4ASUA 4QM7A 3QKSB 4L9SA 3BK7A 4IVRA 5DE3A 1KOFA 5DN6A 3NDPA 4NDZA 4QXAA 1U9IA 3C15C 3UMSA 2BC9A 2QP9X 3HPRA 2PLFA 5SZJA 1KAOA 1Q1EA 2OBMA 3IUYA 4I1OA 5LDDC 4J0QA 1OXXK 2E1RA 3LV8A 4A0FA 5BN3A 3BOSA 4F4CA 3VFDA 2R8RA 1PUIA 4I99A 3U3KA 2FZLA 4C0JA 4C0KA 3S1AA 4OQFA 4HUQA 4D0GA 5EP1A 2NIPA 2XITA 5LBIA 3ADDA 3B13B 1KDTA 4K81B 1KSHA 2HCBA 3MFYA 1N6IA 1GFIA 4JLOA 1UBEA 3MSXA 5DHAA 1N0VC 3K53A 4A9AA 3KB2A 1W48A 1G3MA 3I62A 4JLVA 5JECA 5C4MA 1G8FA 4QJ4A 5E7JA 2AKAB 5KSPA 5C4GB 1ZM3A 3U7HB 3U3MA 5KNBA 1ZUHA 1QVAA 2BMDA 3UG6A 1Q1QA 4NU0A 1CU1A 1ZUIA 4LYHA 1N5JA 1ZC4A 1S0UA 3GQBA 4KITB 3EASA 3E5HA 4JSYA 5CK5A 1ZRHA 3AKCA 1AQUA 5JLJA 1TF7A 1GKIA 1E2DA 3RRNA 3IHWA 4EJSA 1XJCA 4HAYA 5K8TA 1E2EA 1W46A 2F43B 2CE2X 2A5FA 3GPLA 3QE0A 4ZI3A 3K0EA 4NHOA 3SYLA 2X1VA 4AG5A 1IONA 4BFYA 2Q3MA 2ZRLA 5EE0A 4UNRA 2B92A 3QVUA 4TMZA 3T35A 1RRCA 4Q4JB 1RE0A 2ZR9A 5AR1A 2PZFA 3WNBA 1JXMA 1I2MA 2AX4A 4QG7A 3VKHA 5FBWB 4TLBA 2EFCB 1SVSA 2N46A 1R6BX 4QGGA 1E94E 4BFTA 5J5CA 1XXHE 3CF2A 4PAOA 1BMFA 2QMUA 3E2IA 2JLRA 4JBWA 1NG1A 2LKDA 2HUPA 1NBME 2RGDA 5E7IA 2QG6A 1WBDA 1Z07A 4BWYA 3A4NA 2O8BA 3B1WA 4QFMA 1DARA 1E99A 2ERYA 3QXHA 1ZMXA 1ZIPA 2GETA 3GFPA 3KJHA 4U00A 5EE1A 3T1QA 4ON9A 4JL8A 4HZUA 4UNNA 4HZUB 4R98A 621PA 5DI3B 3GLGA 3SYKA 3FHOA 2HJGA 4WXRA 4C9BA 2FN4A 1FX0B 1PVOA 2F55A 3F5FA 3FE2A 3THYA 3AP2A 3AF2A 1G41A 2CVHA 4U7DA 2ZJAA 1XMJA 4KYUA 4Q4HB 3D3QA 2OFOA 2G3YA 4BLPA 2FJUA 1YZUA 1P61B 2QRNA 5L3SA 3IHLA 4F7WA 2VP0A 3BFXA 1DPFA 1KKMA 3E70C 4GI7A 4UXIA 2CXXA 1EX6A 2RGXA 2JJ2A 3SDZA 1EX7A 1Z6XA 2QORA 1E2MA 2Q9CA 1QHHB 1XF9A 2J0UB 2C03A 1MR3F 2F1RA 2IW3A 5FTNA 3DZ8A 2CK3A 2VSOA 4YC7A 3CH4B 1KDPA 5FPKA 3EX7C 5EP2A 2WPDD 1TAGA 3THOA 3TAHA 4OI4A 4UJ5A 1P75A 1XEWY 5L3VA 1CP2A 1LF5A 4Q1EA 3LLUA 3ZZTA 1GILA 5JBQA 3O8CA 2A5JA 4IFBA 3IEVA 4PC3A 1E9DA 5KDDA 4P4UA 4DLZA 3OFNA 2QSZA 2SHKA 4LWZA 4CZ2A 2IUSA 1KI2A 4QGAA 2VTKA 5E4FA 3B5JA 2DFKB 3VX4A 5JWRA 4RD2A 1JAHA 2ORIA 4MYTA 4II7A 2ATXA 1HT2E 3B85A 3K9NA 4GZMA 2IEZA 2CHVA 3ADCA 1W0KD 3AB3A 1JI0A 4HB3A 4M2LA 4KAXA 4YXWD 5C2JB 5C46F 3AGQA 3CB4A 1KK2A 1KI4A 3A36A 4X8MA 4ZO4A 5F9HA 4OK3A 1CR4A 5FOSA 1H65A 2WAXA 3RC8A 2QMHA 2QMEA 3RRYA 1ZNXA 2H16A 4WZBE 2CLSA 3CRRA 4L8GA 1NBMA 5AJVB 3WBKA 4MH0R 3ASYA 2WJHA 5FOWA 5KSZA 1EWQA 4KLNA 4DCTA 1XPUA 3RS4A 1D5CA 2JLQA 4YMSA 4RD3A 4NCJA 1NIJA 4A36A 1P3JA 4M1YA 4B32A 4ZV4A 4LHWA 4C0QC 1GVNB 5AWFC 3LVRE 1N6PA 2WWHA 5H68A 3U6BA 3CR8A 2QAGC 4RFVA 2RCNA 3K0FB 4C0AC 5KYKA 5FBRB 3FMOB 4LZZA 3T1VA 4PTLA 3MJHA 4PQYA 4TQAA 1D2EA 4Q4AA 2EFEB 1XCPA 1NN1A 3CNLA 4OHXA 2B21A 5F2EA 1TEXA 2R9VA 4DLWA 5B58C 1PZNA 1LFDB 5FPYA 4DEXA 4XH9B 2XNSA 3V4RA 1NMZA 4V03A 1S3GA 3QF4A 1J2JA 4MUBA 5CIWA 4Q7JB 5JSZB 3KL4A 4B71A 1R0WA 2AFHE 4GT1A 1QHIA 2UVQA 1G8GA 3HR7A 5ELXA 3GLHB 1XFAA 2E87A 1XX6A 1KSGA 1E9FA 3LXRA 2R6AA 1DAMA 3FMIA 1OE0A 4YXWA 2V7QA 2C98A 4MRVA 4LHYA 3ZQJA 4EPXA 3DKVA 3S1AB 3W5IA 4MGKR 3GLIE 1HURA 4HAXA 2H5EA 4XIGS 5EXPA 4DB2A 4TTPA 3W9YA 3GFOA 2YKGA 1W0JD 3LX8A 4FXPA 1KIMA 2RGGA 3MRSA 2QPOA 3QI2A 2EFHB 2JDID 3TSWA 2PBRA 1ZM9A 3R9WA 5KHOC 3ZS8A 1Z0FA 4MYCA 2V1XA 3GJ4A 1KI1A 3PITA 4PXAA 2QA5A 2OXRA 3E1SA 3M6AA 1HEIA 1KI8A 1ZC3A 2EU8A 3D7MA 1XTIA 2RGCA 3FMPB 4HSEA 4TTQA 3K8YA 4JLBA 3QKRA 121PA 3HR8A 5C1BA 2J41A 4PAQA 4Q19A 2ZYWX 3KXKA 3OE7A 1H8EA 4RY2A 3UXMA 2JLXA 1UKZA 2EYUA 2RGEA 3DMNA 4V0OA 4NE2A 2O0JA 3KKPA 4DSOA 1L8QA 3GLHE 4XWKA 5DHFA 1OV4A 5LB4A 1P9RA 1OSNA 2F1HA 4QJ5A 4LV5B 4ASUD 2OCYC 4JLMA 3G0HA 4WVFA 1XTJA 1GNPA 2XZOA 3LLMA
chains in the Genus database with same CATH superfamily
3UMMA 3PXAA 3ZIAD 3E7WA 3NHRA 3ZQUA 2CLDX 1WB6A 1XZIA 1JWLA 2Y1WA 5HIIA 3OT4A 3BIJA 2I33A 1G4UR 3GGJA 1KXZA 1ZVQA 1AURA 3ITKA 1N1GA 3QIAA 3S27A 3D6TB 3UOGA 3HU1A 1W75A 3V1MA 4TT3A 4MAFA 1REQA 2OEPA 4X1IA 4NMHA 3U48A 2NU7A 1M73E 4YR9A 2Q50A 1E5DA 2I78A 3FFTA 1SC4A 3GW8A 4G41A 1IK4A 4XAQA 4H7DA 1EESA 3NBKA 3WO0A 4B7CA 2B2XA 1EFHA 5BSUA 1SCUA 2LP4Y 3IPRA 4URZR 1JSZA 2W6OA 5D1HA 1RXSA 5DSZA 1T9BA 4MS3B 3TUZC 1E0JA 3RS9A 2WJ6A 5IG2A 3LVBA 3UM9A 4F97A 3ZZ0A 3SHTA 3USZA 3L8ZA 3RT7A 5CXUA 2AN1A 3IAS6 1KP3A 1ZH2A 3R8FA 1ZA1A 3DOJA 3THWB 4OATA 3IOCA 3PFHA 4HDNA 4HN9A 3KFVA 4FMCB 1W5SA 4GSYA 2B0JA 4TN5A 3V1UA 3FKJA 1KS2A 1Q14A 4ZTZB 3TW0A 4DNPA 4NMXB 1GU7A 1MZVA 2HYDA 3ZNOA 1QBKC 4UFNA 5CLIA 3MD9A 4PU0A 4N41A 2YWRA 1YF3A 4UNQA 1RR6A 3H1TA 1QG6A 4KZPA 2GH1A 3NAZA 2IPLA 2YIDA 3OKFA 4FBGA 4HLCA 4JC0A 4MUNA 1BGVA 3EVNA 5HS6A 2OT3B 1KH3A 4IDHA 1E8MA 2CVPA 1FFYA 4TLDA 4R1UA 3SFVA 4LPSA 1MAAA 4K6CA 3T9EA 4XGRA 2L17A 3UXHA 3U13A 5IT9A 3CKYA 2O54A 3UF0A 3U7FB 2GFIA 2YXNA 3AJDA 5C1PA 1JWAB 2JFPA 1IN5A 2X15A 2ZAIA 2GJKA 4UUQA 2HJSA 2CLMB 4WN9A 3N2YA 3VPFA 3SLKA 5HCIA 2J48A 2IXDA 4NEHB 2XQVA 2OMEA 3P4XA 2JIMA 3KJZA 3O93A 1IXZA 4NTZA 4KDCA 3MT7A 1PX0A 2WIKA 4KG7A 5I3CA 3B36A 5FI1B 4BKPA 3B89A 5IKPA 4IVQA 4TSFD 4YLGA 3WLJA 3RBXA 4EHBA 3K0CC 1AVTA 3HV0A 1GGEA 5DN9A 3N0TA 2YY5A 4YRAA 1M1YE 1ZUNA 2HQ1A 1AT1A 2EWWA 4BLRA 2XX3A 4DCCA 2A5YB 4E5SA 3LW8A 2OD7A 1ECPA 4OL0A 5LMNB 3EXEB 2B8WA 4PRLA 1ISPA 4NABA 5FORA 2GRJA 4MKHA 3U4HA 3KEQA 3FGNA 1QK5A 4HQ6A 1ZK0A 4BFXA 4KVZA 1FTSA 1LPAB 1XTQA 3EDOA 4MV8A 1MC1A 1PG5A 1Q0HA 1U4NA 2Q0SA 2VRWA 2XIJA 3L6RA 3C6KA 3Q7IA 1FTWA 3ELUA 4UU0A 3KQOA 1D2CA 3TD6A 5GY7A 2YQZA 4CVNA 2QR5A 4ZO8A 4DMFA 2QZJA 4JI0B 2GZAA 2O1SA 1W34A 2IV7A 1D6NA 1GUBA 1G4AE 3TTSA 3AL0C 2KW5A 3OWHA 2FG6C 1V11A 2PD6A 3JQ8A 4GOOD 5THQA 1R6DA 3MTEA 4D1YA 3GEIA 4B82A 4DEVA 5LMUB 4TV8A 5AP9A 3NEJA 4M8IA 1M9NA 4OFWA 5A2QA 2XXBA 5KYGA 1MAHA 5F3DA 4JZKA 5K5EA 4NENB 2NSYA 3OTGA 4JP2A 4M53A 2GK3A 2JJ2D 3QWHA 4QDTA 5GADl 2ZUCA 2JCSA 1VGVA 1S7GA 2R85A 4OFXA 1YQQA 4RWZA 4CTNA 5KNDA 4MPJA 1E1QD 4O29A 4YT8A 3HMKA 1LTQA 4C2BA 3FMVA 1M6VA 4R41A 4C1NA 4DLYA 5FUMA 4GOXA 2DPGA 4Z99A 1BE8A 1A8IA 1VKOA 3MXOA 2IHBA 3Q3JB 3CH5A 1GDDA 2UZ3A 4J94A 4PBTA 2WWWA 2CBXA 3CRZA 3IBYA 4F8EA 1CYEA 2FN7A 2ZLBA 1Z7YA 1BE6A 1CF9A 1FMLA 2JAPA 2A88A 1ZFNA 2GEKA 3MB8A 3QXJA 5JAQA 3W3AD 4IO1A 4RD1A 2AJDA 2UVPB 3ADKA 4BNHA 1S4QA 5BN3B 2F59A 421PA 1ULTA 4IUCS 4PANA 1XR3A 1S3SA 3S2YA 3TLMA 2KS6A 4EG7A 1AO3A 1IAQA 3U4AA 4RTQA 3PKJA 4FDUA 2VJYA 1VJCA 4I7EA 4EKYA 1AHHA 1TCUA 1MRZA 2OB2A 2EHDA 4LDRA 4OM8A 4TL6A 5I8ZA 4D4KA 2L2QA 1FJHA 2UZIR 1SXQA 1X0VA 2CKDA 3FHJA 2EZUA 4A91A 5BUZA 5KCMA 3WGZA 3KEGA 3H5RA 4MR9B 3M1IA 5M34A 4LKOA 1WCV1 3D6NB 2VHZA 3HXTA 4PPQA 3PHBE 1HO3A 3DB2A 4OSEA 4Y98A 3VHLB 1DP4A 1MT3A 4TXMA 1AHIA 1TF2A 1ODCA 2HK7A 3KO8A 2ZETA 5DHRA 1JG2A 3CO0S 3GK3A 5EXSA 3JASA 1ZBDA 3MHTA 1RBYA 1SVWA 2BJWA 4ENRA 4X8OA 1U7OA 1IY8A 4CEHB 4MIEA 5U4QA 3SS8A 4PC1A 5EUQB 3EQ9A 1C30B 2PQ6A 2VYVA 2VAXA 3AF4A 3KKMA 2JGDA 4MVJI 3G2QA 4DCGA 5JJLA 2V1UA 4D3SA 1K7SN 2BL4A 2W6ID 4N76A 3MJEA 1FB5A 3IKLA 2RHWA 4RPLA 2PL5A 4HMPA 3L93A 4NR0A 1MAUA 4Q1DA 1VPEA 1P1JA 2JEOA 3CTMA 4WZAB 4A1OA 1DADA 1IBSA 2P35A 4HGZA 4TKLA 1WSBA 3K05A 1Z8FA 4MRMB 4C4TA 2PRZA 2XKAA 5B30A 6LDHA 3A6FA 3RSGA 5BQFA 1EQAA 1PGPA 3O83A 5AKKA 2HA7A 2QT0A 3EPKA 1X38A 1C30A 4HYEA 4B40A 4KO8A 1SVOA 1UBHS 2QTWB 4B5KA 3L4JA 4YP9A 1HT1E 3ZWXA 1MV8A 3TLCA 3DMRA 2V45A 1YRQA 2OZKA 2R62A 4HNTA 1NOIA 4CN8A 2QPLA 1ZSYA 3JD3A 2IGTA 3EMVA 3QYJA 1Y5NA 1AIPA 2QZSA 3AU8A 5I9NA 4RK7A 3OAAA 2QR3A 1KVRA 4MCHA 4ZV9A 3U9SA 4LF6B 2PDAA 3OAAD 2VTBB 2C8VA 4RZXA 5EE5B 2H54A 1R4MB 3B3QA 3SZLA 1PD1A 1IHYA 2JHCA 4I36A 2AOVA 1R5OA 1GEGA 1RW4A 1MH9A 5DF1A 5A9RA 1S2LA 2ACWA 1N2HA 1X14A 4ZYVA 3D3KA 4PZCA 1DFHA 4G84A 5LOVF 1T2DA 2IK8A 4US2R 4KVGA 4XLZA 2HWKA 3KPVA 5KDLA 4MPDA 2D1FA 2CVZA 1UC9A 1ZKMA 3EARA 4G01B 3WLAA 1CUWA 4FFLA 4D0SA 1MO5A 4TX1A 3SSOA 2AK2A 2GEVA 3BWCA 3DYVA 1L4NA 4Z2YA 1C41A 2ZBEA 4G5SA 5EP4A 3SJUA 1T5OA 1GV0A 3BWYA 2IW1A 3EGXB 3NIDB 1UXGA 1X1QA 2ECOA 3DCYA 4FR0A 2WQ6A 2OHIA 4FOTA 1Z2NX 2R60A 4QBKA 2B78A 3H2JA 4C22A 4FMCF 3M6VA 2OXTA 2VI5A 1UJ6A 4AJ1A 2FQQA 1OFVA 2MSLA 4IIBA 4OQZA 4AZ3A 3KQYA 3LCUA 1DBPA 3DHNA 1EGVB 1P45A 4BAUA 4CI0B 5ALIA 1E5VA 1GCGA 4RA9B 3GHYA 4FGSA 1NFRA 5F2OA 5LP1A 3EPPA 1WZ2A 1UXJA 1I51A 1QGED 1CT9A 1L4MA 2FCAA 3AZQA 1DAIA 3IPCA 3QVXA 4D8XA 2JFQA 1JDSA 2V58A 1XYVA 1J0CA 1QHYA 4FFWA 3EGEA 3GJ5A 3R1IA 4HAWA 3MMPA 3ZCPA 1DG3A 1Q92A 3WGOA 4IJKA 3UGTA 3NGXA 3KEOA 2P4QA 1EFRD 4DAEA 4EUEA 2ZYTX 4H59A 3IB6A 4R8RA 4FZRA 5F98A 2X9GA 4OAOA 1UMCB 5K0NA 5ALKA 2GZHA 4RTSA 2OBLA 1NDUA 2CXOA 2AK3A 1QH8B 4NKRA 2HDWA 2NPOA 3BSWA 5KMGA 1VP3A 2B69A 1OVMA 4WRRA 3RRMA 2W0SA 3FD8A 2A3NA 4GXRA 2VP3A 4LOAA 3TSYA 1GFSA 4BNIA 5CA0F 1BXRA 1EINA 1Z0AA 2RB4A 1T6NA 1WS6A 2I71A 2X1HA 3CBGA 3CW2A 3I9V6 2IEGA 5LIRA 1COWD 5BY2A 3FIUA 1A9OA 1NI5A 4XWAA 3IMEA 2AKYA 4GPTA 2J7PD 3WSVA 1T5IA 1DRJA 3GYGA 5ILGA 3UQYS 4B75A 4XSGA 2C78A 3P2IA 2J3JA 2G0AA 3CM0A 1JIJA 3JD4A 4MV0A 4YCAA 4YQEA 5T6BA 1RXVA 4LF4B 3DHWC 4U7HA 1TCCA 13PKA 4JC5A 5ADVA 3GH1A 2FZVA 2CLIB 4G36A 1WD7A 4KHPB 3B6ZA 3TUJC 5JPCA 1KQOA 4WOCA 2J33A 1Q22A 5H4HA 4AZWA 1ONBA 4YMUA 2ZW9A 4MAMA 4D4JA 5E1BA 2OAEA 3U26A 3ZCVA 3HL0A 2NLOA 5AICA 3MT8A 3PPVA 4S24A 1TZMA 2NXNA 1OBOA 3B53X 3MC1A 2VFAA 4G86A 3MK31 4YDQA 5JI2E 1FDOA 1X92A 3MJSA 2Z2KA 4OHUA 2O05A 1ZD3A 2IYXA 1FFDA 2UZAA 2PJUA 1Q15A 4K9DA 2W00A 1PLJA 4PO8A 1IVNA 1LBSA 2G9VA 3PJDA 4N65A 1VZ2A 4Y2VA 5TIIA 2H92A 3G5TA 3U4MA 3TLXA 2O5CA 1J06A 1NY6A 4KQXA 2JFUA 3QFRA 2QVYX 3U31A 2ADFA 2G1AA 1IM2A 3R6GA 4I2NA 3UK0A 1F0PA 1L5WA 4MUGA 1R4NA 3EZXA 3DBHB 4ZAGA 4PM4A 4BGUA 1UK9A 4G5QA 4MLZA 3CLTC 4PCUA 5C9ZA 2H11A 2XF2A 1EVLA 1NRXA 5J1TB 3COZA 3K6KA 5LXTA 2JIQA 4NK5A 4AROA 5DM60 3RAFC 3U39A 4DQKA 5F5XA 1U8XX 4HF7A 4ZDWA 3NIWA 1HT0A 4RJLA 3IKJA 3G79A 4RVHA 1HNNA 3THWA 2WC1A 1NRJB 2QPTA 2QN9A 4R2LA 3ICCA 1ILWA 4J1QA 2R6ZA 3L6OO 4Z9FA 3UH0A 1C3EA 4IX1A 4RQUA 3U9LA 3LPNA 4IXNA 1TZ2A 1L1QA 1DQSA 3JRWA 3PNVA 4C03A 3ZE7A 4JVNA 2GEJA 3EVFA 5EHIA 2LCFA 1ZZEA 3WYFA 1KP2A 1GYPA 4L16A 4MPTA 3FNEA 1H23A 2F1KA 2GTHA 2XA1A 1MVOA 3V55A 3FBWA 1FBTA 1ML4A 1ZNQO 2OUKA 3PHHA 4P5PA 4BNKA 3QZUA 1QQTA 1Z0SA 2JCGA 1L4LA 1S2GA 4P9NA 4U63A 4GKVA 4M4SA 5ERGB 4LGVA 4LPKA 2CWDA 1GTVA 1OVGA 2XE4A 3JQEA 1MA0A 3REGA 1J56A 3WL3A 4O08A 4BGIA 1KEEB 2FW6A 4CUJA 3CY6A 4HEA1 3CZ9A 4B3TB 2R5FA 1AV7A 1Y42X 2VATA 2Z5GA 1F48A 1NULA 4C3ZA 4IEEA 3IRUA 4FI3C 3KBOA 3RGGA 1MABB 4CF7A 3GEEA 5K6AA 2HXGA 2O3TA 3ISVA 7REQA 1YB4A 2CFIA 2RBKA 4RDHA 3THYB 4EEKA 2DOKA 5AIAA 2I4RA 2AZXA 4WTOA 4R8LA 4DKJA 1RM0A 2DLNA 2O2EA 4L0MA 4GRAA 1T2EA 3SS9X 3UHPA 1XCMA 4W4TA 4WZAA 3OZXA 3O8LA 3TGWA 4KQGA 2I4OA 3DYIA 3FX2A 5G41A 4Y1GA 3DBOB 3HM2A 5I7WA 2Q0HA 3G2KA 1BCSB 3BK1A 4XQGA 1R7RA 1UZLA 5EHXA 3NRBA 2H1IA 3H0CA 3CPHA 2J3LA 3C1OA 2FSSA 3ETJA 3Q40A 1U6KA 1WLYA 1P9WA 1XXLA 1Z25A 1UT5A 2OFXA 2QQ5A 5FQNA 3RFXA 3F46A 2BGTA 1OY1A 2EAUA 5HVNA 1M5UA 3FBGA 1D0SA 3MXTA 2WYVA 1LWNA 1G8SA 5LLDA 2NP7A 1RHKA 4LJLA 3I9MA 1OI4A 1D03A 4PIPA 3V2UA 5I01A 1NBEA 3T4EA 2IZ6A 1NYRA 2AZ4A 2RONA 2ZRCA 1W85A 4YIHA 1YI1A 4BNGA 5JXWA 5ES3A 1M2KA 1GQOA 1T2CA 5DNEA 3TKAA 4AECA 5EXXA 2A57A 2ZE7A 4IXWA 2HU2A 3R7NA 3KUDA 5JSFA 2BGGA 2ZDHA 1RWXA 1OXTA 3S2SA 5A2GA 2BZSA 3KTFA 1IPHA 2JEYA 2AZMA 4XGKA 2DM6A 5CB4F 1E2PA 2HQSA 1K89A 4KMRA 4ID3A 2QUKA 4Z7OB 3TNJA 2BFOA 3KG2A 3TLAA 5LM3A 4KE6A 3TGPA 1TUGA 1ST2A 3UQZA 4JVOA 4MVXA 3DZHA 3QKRB 4XZ3A 2XMQA 2PR2A 2VUTA 3GJ0A 3W8NA 3T5PA 3RFVA 3TE6A 1T1JA 2YJZA 3LT5A 2HV8A 4HVCA 2RHOA 3HY4A 1KPHA 3M7IA 4MP8A 4YLYA 2OORA 1W5FA 4CQLB 1R0KA 2RKOA 3UWOA 3AR8A 3NYQA 4NS1A 1U3UA 2YHAA 3C87A 1JDUA 3GT7A 3QXSA 3GZNA 1DOZA 4XM2A 3JVDA 1JS1X 4EHHA 2IY7A 2UZ0A 4I5FA 2XD9A 2PRIA 3P9RA 1GYRA 4Q3OA 3HFSA 2Y0PA 2GK7A 2NAPA 2Y67A 3T38A 8ADHA 3D59A 1GCUA 2YYSA 3JD1A 4KO4S 4NBWA 1Q74A 3VXKA 4E0BA 4GL2A 1AS0A 4JOBA 2ZWOA 4ZJUA 1QTQA 2OGSA 5BYKA 1XLUA 4J2OA 1PEKE 4FFOA 4F8JA 1J7JA 5DWDA 4XJSA 4HEJA 5AXBA 1C9YA 3X2EA 2D2XA 5JJIA 1RVDA 1RAEA 4WCFB 3VOAA 1U9IC 3VHQA 3WLIA 4BC0A 4ENSA 1H3NA 3LUJA 1GPWB 2UAGA 4LXGA 4CV1A 4JLNA 5AW1A 2GXQA 4TMWA 4BO1A 3GJRA 3IPXA 2FN3A 1FFXA 1VECA 1SELA 2P27A 3EWNA 1FS6A 1ZIOA 2CD9A 3OPYA 4FFBA 3AEZA 4JR0A 3EWSA 4NBTA 5AJXA 5LPNA 2WE8A 4PAMA 1TEZA 1XQXA 3DOFA 5EQJB 2D1TA 2JLBA 3BDVA 5FP0A 5CA1B 1VE1A 2XDYA 3H19A 1XWWA 1GRRA 4J0CA 2LRHA 3FSJX 4KQMA 4RK0A 3WKDA 4F5WA 1G6KA 5JNUA 2VSQA 3Q98A 1DWPA 2CJWB 2WKSA 3PIDA 4CT5A 5KTKA 5CCEA 1NW8A 3KWLA 4RZSA 3GMTA 1TI7A 5ITZB 3AUJB 2Q6OA 3IDZA 1U0TA 1ZJ5A 4KQHA 2FEAA 2C9CA 1GPNA 2C20A 4H35A 2GX6A 2ZJYA 1FFXB 4QXQA 2GXAA 1N4DA 4HTFB 1ORHA 1QO9A 2DYKA 1BW9B 1FS5A 2HTFA 3GAZA 3CT4A 4LEIA 1T1RA 3EY9A 4H7HA 2J3IA 4JJEA 4B6SA 2QAGB 2PYIA 1JSRA 2FF7A 1ZGBA 3EXAA 2NSLA 2Q8PA 1UOOA 2FZWA 2ASVA 4XA8A 5HA5A 1DJOA 3M6IA 1JV2B 1QRAA 3TRKA 4TMKA 3U17A 2VRBA 4D6XA 4ZAYA 4PXSA 4WK2B 4ZTUB 4PPYA 1T4MA 2EBHX 1TO1E 4BMPB 4IXDA 4HZIA 5EPEA 2AYXA 3O1HB 3U3ZA 4G5GA 3DMTC 4JB0A 2FPKA 4AP5A 1YU9A 2ZXFA 3GRCA 3O0DA 2I6XA 1IDN1 3FRJA 3VHXA 4DDTA 3OBIA 4J6EA 5EXTA 5CTAA 2VBIA 2WNSA 2AXEA 3E7XA 1ZJWA 1Q6YA 5CFZA 3T4XA 5K0FA 1TM2A 1E92A 1KFEB 4R1PA 3U3OA 4D9JA 3B2QA 1XPOA 4G5YA 5CJPA 3WLHA 2GNOA 2HREA 1WETA 5HBRA 2G1UA 4Q7EA 2WTBA 3JWGA 4CL0A 2YXEA 3THXB 2Z9DA 4F2GA 3ESXA 1QIDA 4TL7A 1H1DA 1I7NA 1OX4B 1TYDE 3GDGA 1G20B 3T52A 4ALMA 3WMWA 5I9IA 2HLPA 1G18A 1LS6A 4L4XA 4MJXA 1VI5A 1SRQA 1ISSA 1XQ6A 1W25A 1XRQA 2IPNA 4H31A 4RLSA 4B3CA 5A9SB 4LRYA 1CRWG 2YWGA 4H9GA 3CKLA 2A78A 2O3SA 1PQYA 1RQ2A 3DD5A 4OMFG 3X1KA 3LSTA 3ZWKA 2ZJ8A 4LNUA 4YMLA 3PICA 4YAEA 1LS1A 4BIIA 1G2QA 2X8BA 4JJ4A 3ZWOA 2W6MA 2PNFA 1HYQA 4LXUA 1D9ZA 4IR7A 4MV7A 4NF2A 3CV3A 2YIVX 4D98A 3ZCXA 1TEVA 3JAKA 1UFKA 3WGJA 5ADUS 1T8SA 3IBTA 1PNRA 2CZQA 2F8SA 3DT8A 2J9ZB 2WM9B 4HJRA 3SC6A 5HQ3B 4L5YA 1YB6A 1MEJA 3S28A 2BHRA 1OBVA 4K8RB 4G07A 5HCUA 1M2OA 1OZ0A 2GEFA 1U3CA 3WKEA 5JDIC 4JBGA 4QBTA 1BFKA 3H4TA 1A8HA 3N8NA 2CV1A 1AUXA 3FETA 2CLOB 4WLUA 5IHXA 5KNLA 1GPLA 4GUAA 2R6JA 4N4AA 3T0IA 1KK1A 1OWLA 1SVLA 3B8HA 3UUWA 4E5MA 1JJIA 2JA1A 2HJHA 2NO6A 4FGUA 5KPDA 1H93A 4QE3A 4XD7D 4QA9A 1EFVA 3VPDA 1N0IA 3KQUA 2YHBA 1T9GS 3FROA 1N33B 4DDHA 1FVHA 1UEJA 3EAFA 3ZBPA 2YJ5A 4ZAZA 1U98A 4YJ3A 5IAKA 3P71T 4P8RA 3ASUA 2EGHA 1EK0A 1Q57A 1WPXA 3L82B 4HB2A 4UPVA 5DXAA 2K2WA 3JVUA 3VR1A 2OCPA 2IUUA 4O25A 4Y18A 3PSAA 1HNWB 4OQYA 4EPRA 1EP2B 2YWDA 1LV8A 5EUCA 3RABA 2WSYB 1Z47A 2BJVA 1R6UA 2P6RA 3W5JA 3B1ZA 1WD5A 4D81A 1V8PA 5EKDA 3C8ZA 3ICWA 1USIA 3GPIA 1E98A 2E4YA 3LECA 4UNPA 5DTIA 4BO2A 1XJ5A 3GPDG 2V7WA 1KGDA 1DV2A 3LBHA 4QPDA 2VDOB 1IJFA 2V6MA 4XWYA 3KJQA 4YREA 1L8XA 2A0KA 3DTTA 5K51A 1QONA 3GA0A 1XHFA 3HU3A 1B8UA 1HG1A 3RJMA 4GNRA 3BMNB 1G6Q1 3OVMA 4MTLA 1I94B 4L7VA 1PV2A 2XIQA 2F9FA 1QQ6A 1ZCBA 3FCUB 3OUTA 1OF1A 2GVDC 2JKYA 2QD3A 3KYDA 1J8QA 5F78A 4OPMA 5U1PA 4AN1A 2EF1A 1VPLA 5EJ9A 3T3DA 4JB8A 1MJNA 5IPFA 5WRFA 2QN1A 1SWWA 2EQBA 4H0NA 3PDCA 4JU9A 2M32A 4R2XA 4AJKA 3R3UA 4FGWA 4RFSA 2ZBPA 3B1JA 4UZEA 2OC9A 4JL5A 2AG8A 4JIMA 2Y93A 3SR0A 2QLMA 5E2BA 4JU8A 1F3OA 5D3QA 1T5SA 2ASEA 3QVGA 4JJAA 3DLHA 1YZYA 5FTKA 1T6YA 1WXEA 2FR0A 2FRDA 3ID6C 3R5HA 3GNQA 4N6GA 1DKLA 5H81A 1L5GB 3TX6A 3OETA 4M1OA 3QLUA 3PX3A 1TT5B 4N8EA 1A3CA 4B47A 4OBBA 3DEHA 1TJ5A 4GD3Q 2O0LA 3GMSA 2QX7A 4OQMA 3X2FA 1WP9A 4WI1A 4ACAA 4ZVQA 1K88A 2MSKA 4REQB 5F7ZA 1G98A 4DUGD 4XX0A 4LBWA 3N70A 1V8OA 1MRNA 3TFQA 4ZYLA 1NNEA 3H18A 1SVIA 3JTEA 2HT6A 1M66A 3FFXA 3UKDA 3V33A 5FR2A 4X0EA 4YMVA 5JALA 5AK0A 2OZLA 3ASVA 3H84A 4QO7A 1YB2A 2QM8A 3F7OA 1L7AA 2PXCA 5JHHB 3OZEA 1Z83A 3TXYA 5AXDA 4M0DA 1H94A 3GVXA 3R3WA 3GJZA 3RYIB 5ALQA 2GPTA 4PYKA 1CDZA 4BMYA 4CV2A 1DBSA 1L4BA 2B98A 1KBZA 2R8BA 3DDSA 3I9FA 3LMKA 4J90A 2JI8A 4IYRA 1TZBA 1WRBA 4QUEA 1KC1A 5FWAA 4AUKA 2BCJQ 2BHLA 4M54A 1KP9A 2HRZA 4ILEA 1UADA 2ZI4A 3GLVA 4KN5A 3KSBC 4RK4A 3DLAA 2PUWA 4IQFA 3EVGA 1QH8A 3E61A 1NM5A 1R0RE 2ZSDA 3EULA 4YP1A 1BS9A 4WBNB 1FDTA 4L5IA 4DA0A 1WQ1R 1F2TA 1JE1A 1SUEA 4XUGB 1HM5A 4P33A 1Z7GA 1ZD2P 1E66A 1RBMA 3S3TA 1SCJA 3GBVA 1I4TD 3CSUA 3JRNA 3G9UA 1JVNA 1IUPA 1Z28A 2Q5QA 2WFZA 4JMPA 1JQ5A 4TZKA 5CLJA 4P3XA 2I34A 3B60A 1RYMA 3LQFA 3WYAA 1E5TA 4WCDA 4IDOA 3VR4H 3HVJA 3LK7A 1H4TA 1YZTA 1GEEA 2AR9A 4BUCA 4URXR 4DIMA 1XAJA 1FX1A 3VNVA 1RE1A 4RLQA 2Q9AA 2PUGA 1AZTA 3F71A 3M9WA 3VR4A 4CQJA 1PJRA 2WUEA 3KJEA 2PUEA 2H2WA 1X1CA 4B2YA 4TUYA 4KYVA 4Y1RB 2A2ZA 2XZDA 3LT4A 3UHJA 3A1EA 4JA2A 4O02B 2PIAA 4RD0A 1Y8CA 3NHMA 3O3MB 3PHCA 3K0SA 4RSHA 3CVUA 4PYOA 1YT5A 4RGQA 1QHHA 2I6FA 5DM2A 2X1MA 5DBOA 2J6IA 5E6RB 1LW7A 1Y9AA 2HMTA 1WDMA 2CSUA 2QK4A 5ECYA 2Y0DA 1UXOA 2FJPA 1ETHA 1ZIYA 1V16B 1VJGA 4OCZA 1P60A 1TAHA 3B6MA 2EYQA 2WWVD 2WHPA 1JT2A 3OJWA 4NCNA 1IM8A 5IKEA 1KEUA 2A9VA 4NYMQ 3H8VA 3C3DA 3ON5A 3V9AA 4XQ0A 2VF4X 5CW2A 1SEVA 2O0HA 3G7SA 3RQSA 5DSXA 3JYPA 4EZBA 1QKKA 3F4LA 4D3ZA 1LLQA 3OEWA 2QL5A 1UOPA 3GPCA 3LCMA 1CD5A 3EMKA 4X7PA 3ODGA 3ZXYA 1F8GA 2WJZB 3KUCA 2AOWA 5EIXA 1H2BA 1OPXA 1JG1A 2BFAA 3GRAA 3I9NA 3LGAA 3U1VA 4DDMA 2FK8A 4LG1A 2A4MA 2PQ2A 3MIZA 1KAEA 2WVJA 1YBAA 4RDCA 3WX0A 1Z35A 3WK6A 1RXCA 5DJ5A 4DR1B 1AU9A 3MOIA 2Q6LA 4A23A 5FUYA 1A7AA 1Z5WA 4HRAA 2GF0A 4DDUA 1ENZA 3K1ZA 5JW6A 4P4SB 4DR6B 1ELOA 2UXCB 3B9PA 1HDOA 2DT5A 1IXKA 4CU5A 3IBCA 1Y8RB 2ZU6A 1A1SA 2QB5A 3UANA 4U7PB 4I4TB 3C3CA 2Y0BA 3TW6A 4QFBA 1SZJG 1H2RS 2XOXA 1Y7IA 1LPOA 4GGPA 1OI3A 1BO6A 3SHFA 2GWRA 4DAOA 5I45A 3DDWA 1SBZA 3IIIA 4I4NA 3X1WA 3L7DA 3K9QO 1ZQ9A 4YK7A 2G9NA 2XGJA 3KAQA 2HRRA 1QP4A 3TL3A 4DCNA 1OHHA 2F43A 1P6UA 3VR5A 4HVLA 5TVGA 3W90A 3TRDA 2X5JO 3IO3A 6ABPA 3AF3A 3T9AA 2XVAA 3OEEA 4A0HA 3ZWCA 1KMMA 2IYYA 2OC4A 4TV9F 3RG2A 2B1IA 1QIEA 2CNWA 3PUIA 3SJCA 3SEZA 2HC9A 3SXJA 1YOBA 4QZVA 1H4QA 2QLLA 1M8FA 1AZSC 2WFLB 2Y1XA 4JEUA 3EC7A 4MQUA 5HKKD 2HNKA 1KI7A 3OHMA 4GEGA 2ACVA 2JI6A 1J22A 5JLAA 1JFTA 5ARDA 3RV3A 1GSIA 1GUDA 2COUA 3DNPA 2XMCA 4K26A 4AYTA 5CDSA 2J45A 3VV3A 3NBUA 1MRSA 3PUZA 1TB4A 2VAMA 4IXMA 1JG4A 1XZQA 4NI5A 4ARAA 2PH3A 2GK4A 2ZT5A 3BAZA 3T5DA 5FHRA 1JIXA 4E07A 5KSWB 2ZZMA 4GMHA 5JWHA 5LZ4A 4HXGA 1W2GA 1U94A 1AXRA 2M6RA 3W8RA 1F38A 2JLXA 3JZAA 2FWMX 1X7YB 5LVAA 5C53B 1IH8A 3WBJA 1J49A 4ND6A 2ID8A 4KVAA 2GAOA 3FNHA 5L45A 5DGIA 5IVHA 4J3NA 1GARA 3UMJA 1CVRA 4NU5A 5AKLA 5LQNA 5GJVC 1FLAA 2O23A 4UAUA 3U56A 5JPDA 3BHJA 2D5BA 1I2DA 2QUBA 3DVAB 4B3FX 1RQGA 1VGRA 1N5KA 5E3JA 4O4LB 4U2FA 1L7PA 3ZHBA 4Y2RA 5BSHA 1XK7A 2ZXUA 2O8VA 2CXUA 2D1RA 4OQQA 4ZHSA 1W59A 5AW4A 4MVJG 4F6CA 1L5OA 2FEMA 2W37A 2XR1A 2JRCA 2P9YA 4TWJA 4L07A 5JO9A 4J7CA 5JZMA 1NF2A 1PEYA 3N74A 1DEAA 3WBFA 4CLEA 4KFSA 4JFAA 4DNQA 3CE6A 4EFLA 4LNHA 5LNK1 5KCZA 2XECA 1T34A 4Z3DA 4F92B 3PK0A 1C1HA 5ENDA 2BEUA 1CUBA 4BAGA 3IJEB 2YVUA 1E7QA 1Y98A 1OV6A 1Y5MA 2QD2A 1PZXA 5H3CA 4G9BA 3UMGA 3AIMA 4RAQA 1GVHA 2PMWB 1SZPA 4ND2A 2Y1CA 1WVMA 2AEMA 2QYHA 2VF7A 5K9ZA 3AJEA 4HPJB 3Q9NA 1XVLA 2GOYA 4JJ7A 1KYTA 2FP4B 2WD7B 4MKIA 4CIAA 2J0EA 3IMGA 4C4OA 1FQKA 3VI4B 3DNFA 1PUJA 3LDHA 5HQJA 1KJQA 3CE9A 1A4IA 2OZVA 2QM3A 4U2EA 4YTEA 1ZUNB 1DAHA 4PQRA 4HWRA 5J2UA 2XWSA 2BM8A 2Y66A 4JT8A 3N5KA 4DUZB 1NUPA 5CYPA 1K1EA 4YRCA 4WL0A 1UBRS 1QTIA 1AX9A 3I73A 3PENA 1JT9A 4C4SA 4L73A 4I9NA 3EIOA 4GYYA 4W5QA 1MG5A 2GBFA 2QOEA 3K6SA 5DNAA 3BM5A 4MWZA 5DYTA 3ZBUA 1TUIA 2FW0A 3GDFA 4D9CA 1W8DA 5ESDA 2FE4A 1CUSA 5F9FA 5EAIA 2M6KA 1Y6ZA 3KVNA 1QVVA 1UBUS 3CUKA 1C14A 5BVHA 5C51B 4D97A 1DZIA 2WSIA 3PD1A 3QBVA 4G1CA 1OD6A 3QUTA 4RHFA 3W0LB 3I2IA 1GQFA 3ZZUA 3GP3A 4G67A 2NXEA 1TXGA 4GYKA 5TS2A 2ZJ6A 2WV9A 4FCVA 1TYCA 5LN1A 2YCLA 2J3MA 5CK5A 2C7RA 4GBJA 3WAGA 3CZPA 2AI3A 4LF8B 3BMCB 5J3JA 2GEDA 2CVQA 4CCSA 1IZ9A 2FR8C 2XH8A 4ZZ3A 5EHQA 2GBLC 4IS3A 1VHJA 4BMXA 2YHIA 1XMOB 3FPFA 2R4UA 4F6RB 4HLUA 2BF7A 3R4CA 4JLDA 1J8FA 1XEXB 4C78A 4I4IA 4PG7A 2R7KA 1NVKA 1P7YA 4P6VF 5AW3A 3LC2O 5H9WA 4Y3UA 4C3VA 4A2CA 2Z6QA 1YKGA 5HP4A 1L5QA 1N2ZA 2WZQA 1RWNA 2BUAA 5EPOA 2IPMA 3C8DA 1QC5B 4B8ZA 3EVDA 5C7YA 1XV5A 3MJFA 2AEEA 3ZKWB 1PKEA 4PFJA 1NQTA 1K9SA 3DFZA 2Y9PB 3PJGA 2E49A 4ERXA 3HACA 2X13A 4HKTA 5BURA 1B6RA 1E3WA 3CX3A 1DEHA 5L3ZA 4TT8A 1M8JA 2ZSUA 3G0GA 3GLGB 5M04A 2W6JA 3F97A 4ZT4A 5EP3A 3A6ZA 3PFKA 1QG2A 3I6BA 3R5TA 4R7ZA 5KOJA 1FUUA 2Y1GA 3FDFA 3W7VA 3FUVA 4A2QA 4QNRA 3DL0A 4C3OB 5JC1A 1GRQA 2XUFA 8ATCA 1HA3A 1NP6A 4ROSA 1QH9A 2DFNA 4EI7A 1JL3A 4JXZA 2XUIA 4CIXA 4Y0VA 3IDFA 2D06A 3GFBA 3LUHA 4EW1A 3RYHB 1MW9X 4NRDA 1DWQA 1ZD8A 3QG5A 1BX1A 1ZN8A 2GCNA 3RS3A 3DM9B 2WWGA 2VDQB 4W1RA 1YC5A 2P6UA 2I22A 1ANKA 3BTVA 3MF4A 3IAAA 1Q21A 1AKQA 3R7FA 2VUHB 4CHTA 3RVLA 4NBKA 2XJ9A 5FWXA 1ND6A 4OL9A 1SKUA 2VJPA 2WM2A 1RI1A 3EVZA 2ZG6A 3GG2A 3ZKWA 1X1EA 3SZMA 4ZJYA 4P7GA 5BMVB 3WWYA 4LRWA 1PIWA 1A04A 1UM8A 3VI3B 5CEEA 5CUQA 4KLAA 1VOTA 2P2ZA 1II9A 2ZOSA 1HUQA 2GPYA 4DCMA 2ACEA 3VYVA 5C81A 1X1DA 3Q8XB 4XJTA 4RPCA 3TG8A 1SXJD 1JQJC 1RJFA 3EEQA 4PSDA 1KJ9A 1VZ3A 1N1MA 5ICMA 3FHTA 3FPAA 3P32A 2O1WA 3CINA 3EIHA 3P9KA 5BN4B 2P7IA 1K68A 2G70A 3U9TA 2R6FA 4FUTA 1CS4C 4YMTA 1HKHA 1WMBA 9GPBA 4EY3A 3IQZA 5C8YB 1V5FA 2XYQA 2IFTA 3K15A 5FV4A 1I3KA 3A1CA 1X1SA 4FFDA 2O2CA 5DCWA 4D74A 2O57A 3R7BA 3I32A 1E0KA 1NXXA 4X5OA 3PWZA 2RCYA 3V00A 1NNUA 4DTCA 5K3EA 5CHEA 3EHEA 3I53A 3P94A 3SE7A 1JTEA 3TNFA 4FFBB 1MAWA 2WR8A 1RS0A 3I6ZA 4JD5A 2PBZA 3HGTA 2G83A 5F1PA 3OEHA 3PB3A 2VEOA 3DUWA 4GBMA 4V0LA 4ZV7A 4X20A 1FUYB 3T5MA 1B0PA 3W77A 1V3VA 1EFPB 3S6JA 4II2A 4YUXA 1KVTA 2FLKA 2OYSA 1XN1A 3JXEA 4BBAA 2CZCA 3QNUA 4WXHA 4KRFA 4IF6A 3EGOA 2V4ZA 1LDBA 2FSHA 3OZVA 4K88A 4ZEXA 1FTYA 2CUNA 5BQ5A 4ARIA 2WVAA 2Z3VA 3IEKA 4X3OA 2WVGA 3SM9A 4EYSA 4PX2A 3X0DA 1H4VB 2RHJA 4G4GA 2R7AA 3AUAA 4LVNA 1CZKA 1QQ5A 3EYWA 2ZUVA 1ETUA 2J5XA 1E0AA 4XCXA 1ZKDA 1NOKA 3SIXA 3T1HB 1K4MA 5K6AC 4ESHA 2IYOA 1R1DA 4K40A 1YFZA 4AF8A 3AUSA 2YXPX 1O03A 2Q41A 3ETEA 3F5MA 4UD2A 4UU8A 2QL7A 4FFMA 2D2EA 3FWYA 1JA0A 5G4LA