3R20A

Crystal structure of cytidylate kinase from mycobacterium smegmatis
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
217
structure length
217
Chain Sequence
SLVVAVDGPAGTGKSSVSRGLARALGARYLDTGAMYRIATLAVLRAGADLTDPAAIEKAAADAEIGVGSDPDVDAAFLAGEDVSSEIRGDAVTGAVSAVSAVPAVRTRLVDIQRKLATEGGRVVVEGRDIGTVVLPDADVKIFLTASAEERARRRNAQNVANGLPDDYATVLADVQRRDHLDSTRPVSPLRAADDALVVDTSDMDQAQVIAHLLDLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytidylate kinase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
total genus 82
structure length 217
sequence length 217
ec nomenclature ec 2.7.4.14: UMP/CMP kinase.
pdb deposition date 2011-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3r20A00
2C96A 1WCV1 5F9HA 3FYHA 4OQXA 2FZ4A 1SKYB 2PMKA 4ZDWA 1ELOA 3N70A 4YMUA 3KJEA 1Y3AA 2O0JA 3VKWA 1KI4A 2YC2C 5FR1A 3WMEA 4A8JC 5K8TA 5HKKD 1Z63A 3T12A 1Z2CA 3PITA 2VP4A 4PO8A 4QM7A 2IUUA 2D3WA 4RVCA 3B5JA 3RS7A 1R0ZA 1ZYUA 1AQUA 1KO5A 3KQNA 1BYIA 2HUPA 2GKSA 4HDQB 4KI0A 3UMSA 1COWD 5CLQA 2JLZA 2XXAB 1A7JA 1NMXA 2G1KA 1IJFA 3DKPA 4LWZA 1C1YA 5DO9A 1OH8A 4JJKA 4AKHA 4ASUA 1G6OA 4D4JA 3KQLA 2GVZC 4B6FA 2QAGC 2WJIA 4F4IA 1N6NA 1M1YE 3W3AA 2CVFA 4KSBA 4HB3A 3ADBA 1GG2A 3QQ5A 4EDHA 3AKYA 1B23P 4Y0AA 1W4BA 1DAEA 4F4CA 3VR2A 3P1JA 4NP6A 4LJ6A 4NYIQ 1L8QA 4TTRA 1SHZA 1CKEA 1CU1A 2ZAMA 3BJIC 4MA4A 2QT1A 3TW8B 3B9QA 1W1WA 1TU3A 3ICQB 3H4MA 2NOAA 3NBFA 4U7DA 3GP8A 3LBIA 5HCNA 1DAMA 4LBYA 2HYIC 1S0UA 5FUXA 2JLSA 4DSTA 4NHOA 4D0NA 4WXRA 2ZSBA 1XPUA 2MSDB 2HXYA 3W90A 3IUYA 3OZXA 3LLUA 2EFEB 4LYJA 2R62A 4BFZA 1XEXB 1ZVQA 2I1VB 2ZJAA 4A82A 3T15A 4URWR 3ASZA 5DISB 2OUKA 1FUKA 3SEAA 2JJ2A 1UDXA 1Z47A 1JECA 1DPFA 2I1QA 2EWWA 4MYUA 3RWMB 1BMFA 1W5SA 3CF6R 1G4AE 1W4AA 5G3ZA 2VLIA 1H8HD 2OFOA 1CRQA 2G6BA 1QHXA 1M6NA 5EQTA 3UWOA 4RZ2A 2DYKA 1ZM9A 4K81B 1N6LA 4M9SA 4YDHB 3KUDA 2FPKA 3NVAA 2JIZD 2DFLA 1RJ9A 1GFIA 3N2IA 3LW8A 3FHOA 5FOUA 4QBHA 4GPTA 121PA 1GZSA 3GJ5A 5B30A 1ZNXA 3SI7A 2DWQA 3LW7A 4NYMR 3I5YA 3TJZA 1Q1EA 3I3SR 4GRAA 2WMNB 2WVJA 1LW7A 2FGKA 3CH4B 4JLVA 1OV4A 4DCNA 5JHGB 3EPJA 4MDFA 4M21A 3SJCA 3REGA 4PHTA 1KK0A 5DIFA 2WM9B 4DLSA 3PCRB 4C0HA 2CHGA 3AEZA 1FQKA 4Q02A 2BMDA 1XCGB 3K0FB 3EZFA 5HKKA 5J4HA 5AJZA 2AL7A 3PR1A 4MH0R 5KU1A 2ZPTX 1QBKC 2Q3HA 4UJ3A 3R7WB 1ZP6A 3FKSD 2G88A 4JBXA 4I1VA 1MO3A 5BYKA 4CEIB 1NY5A 2X2EA 3PUXA 1L2TA 5JEEA 3ZGXA 1HT1E 3NDPA 2EVWX 4URUR 4LYAA 2HDNB 1GSIA 1QHHA 5HZKA 3NEJA 4NCKA 1P2VA 3IDQA 3LX8A 1S9HA 5FPSA 2QMEA 3QJYA 2ZRNA 2G77B 4V0LA 4MKGA 3C15C 3RC8A 3T1VA 1KI8A 4PZYA 3MMPA 2X8AA 4I1UA 4FMDB 3OFNA 2HXSA 4M1WA 3QF4B 2QROA 3N2EA 1CF4A 2W0MA 4L8GA 4CEJA 3Q72A 4XSGA 5CIWA 2A2ZA 1P6XA 2IYLD 2E87A 4GZLA 5IRCD 2AKYA 3B1ZA 3EWAA 2ZI6A 5FL7A 4G01B 3KTAB 4ILEA 3RSLA 3C5CA 2BCGY 1N6RA 3QKRA 4MQBA 3W6PA 4YDSA 5M04A 1JJVA 3NH9A 2HV8A 4L16A 2O52A 1E9BA 1MKYA 4FMCF 3GLIB 2IL1A 2ZRDA 2D62A 5FL3A 3TVDA 4KJZA 1NJFA 3CW2A 2P0EA 3IIMA 2LWIA 1OHHA 2QGZA 4BECA 3QBTA 4R7ZA 2EW1A 2P67A 3QPVA 4TL7A 2XSZA 2HT6A 4JKIA 1XD2B 3Q5DA 4V02A 4HSEA 4UNRA 4TSFD 1U0JA 4AC9A 3ND8A 2QBYA 2UKDA 4Q4AB 5AK0A 1VIAA 2OBMA 6Q21A 4AURA 4PR0A 2BC9A 1D9ZA 4HLQB 2JCSA 5CYOA 5B64A 1XTJA 3UXMA 2IK8A 1J7KA 3WMGA 3CX8A 1GNRA 5CLLA 3KJIA 1U8ZA 4DCSA 4OKSA 4JMPA 1AKYA 3TAHA 2IW3A 621PA 3UATA 4DLXA 1OIXA 1XCPA 4BUJA 2VP9A 4A6XA 1WRBA 1EFTA 2ZEJA 3K53A 1BS1A 1T8UA 3MCAA 2YYZA 5B57C 3KXIA 3U3KA 1P7CA 1CP2A 2Q21A 2CLSA 4I81A 2F55A 2CJWB 3CIOA 5EE9A 2QG6A 3CX7A 3GLFB 1P9RA 1UDWA 5H8WA 1C9KA 3CLVA 2XNDD 5CK4A 1T5LA 1R5BA 4D80A 1P75A 1U0HC 2REBA 3AVPA 1VYVA 1NY6A 3GFOA 4UKDA 3RVBA 3ZVLA 1D2EA 3ZZTA 1IN5A 4R98A 4C0QC 2FJUA 1EWRA 2B7BA 1VCOA 4RKFA 3EPLA 1CIPA 2EU8A 2XTZA 4LHXA 3GJ6A 3U3OA 3EG5A 1S9DA 3B1YA 1XDBA 3BGWA 5LD2C 1O87A 4GNKA 1F60A 4LBZA 2IS1A 1Q22A 4NH0A 2ORVA 3TRFA 1A2BA 2ATXA 3AP3A 1P60A 1A2KC 2PEYA 3C14C 1KSGA 4KHZA 3RSOA 4D0GA 5L3QB 4CVNA 1OKKD 4FI3C 1CR1A 3GJ3A 1E96A 1ONBA 2OESA 2YWHA 2AXPA 3PUWA 3Q9LA 3LRPA 4JLPA 3U4QB 1YR9A 2ZAOA 3CF2A 2GJ8A 1CULC 1YZQA 4MGZR 4A0RA 1ZIOA 4BLPA 2REOA 1T9HA 1DO0A 1XEXA 3IGFA 3SNHA 4JLJA 5KPDA 1WBBA 1JR3D 3QIAA 4P4TA 4WXPA 4CT4B 4LJ5A 4O2LA 4DUGD 3E2IA 2KBEA 1FTSA 3GCGA 4TLBA 3WBKA 4RD1A 1HYQA 2ZRPA 4M0LA 4DLUA 1FX0B 2QORA 3HU2A 2IYQA 1Z6YA 2PJZA 4IFBA 1E0KA 2UZ3A 3BH6A 4M9ZA 5CB6A 4IXNA 5D3MA 4WBSA 4FN5A 3MWLA 5IHPA 3LQQA 1Z0DA 5FPHA 4JT2A 2A5FA 4BFYA 4Z1MA 1II9A 2YOHA 2OCYC 4OK3A 4GDFA 4X8LA 2N46A 3AB3A 3QUSA 1CJKC 5EP3A 2IYWA 5DLQC 4Q1CA 4V0KA 1E79A 2ZRKA 4Q03A 1Q0UA 4QJ3A 1A5TA 1VDZA 3EIEA 3EX7C 2BJWA 4H1UA 4PSAA 3U6BA 1RVDA 1UEJA 3KKMA 5L3SA 3PEWA 3U7GA 1Z6XA 3THYB 1Z0KA 4I1OA 2HT1A 2E9SA 2J9RA 2YINC 2OILA 3C8UA 4KSCA 2FSIA 1KSFX 3QENA 5J40A 3NH6A 2QPAA 2IC5A 4OQFA 4CEHA 3Q85A 4JKYA 4M1TA 2WICA 2NO7A 4Q1FA 5CM8B 1ZD1A 3PIRA 1CXZA 4B2PA 2CK3D 2D2EA 4TLCA 2OXCA 4B3FX 1Z0IA 2A7QA 1G64A 2IYZA 3R9XA 1L4YA 2ZYUX 5FFMA 1TEVA 4KITB 2J0VA 3QXHA 2QTVB 4LHYA 4WVFA 4L9SA 4IW3B 3IHWA 3K8YA 4DSNA 4D81A 1SVLA 2AD5A 4TLEA 5C2JB 2IYTA 4JL5A 4DKXA 2ERYA 5IT5A 4LV5B 2OSBA 2EYUA 1ZNWA 2P6UA 1KDOA 1HY3A 5JRZA 3QF7A 5JBQA 1OFTA 2G83A 2YHSA 2CL0X 1N3BA 4XD7D 1N6OA 2QP4A 4DC9A 5FI1B 2X2FA 1PLJA 1R8SA 5ANRB 5KSPA 2Z0MA 3T35A 3VU9B 3B9PA 3KKNA 2IEZA 5FUWA 4XWOA 4TZ6A 1OIVA 4RFVA 2QP3A 1BYUA 3SBEA 5JHHB 4BLRA 5IF9A 4RD2A 3EA0A 4LRWA 2BHRA 3OEHA 2YOFA 5KSOA 1NBMD 3AF0A 4L9WA 1NLFA 2ZRBA 1II8B 2EYQA 2V7QD 1KHTA 2ZRCA 2VH5R 1QG4A 1LFDB 3NG1A 1MV5A 4C30A 5FR2A 1IM2A 2FN4A 3SHWA 4PXAA 1RRFA 4Q1AA 2MMCA 5HE9A 4YMWA 5FBLB 3K70B 2VHJA 3RDPA 3DOFA 3PEVA 1XEFA 2JA1A 3THXA 1U9IA 1IONA 4QGFA 4TYPA 2ZETA 4AKGA 1KO7A 4RZXA 4Q48A 1N6PA 2CXXA 4IOLA 4YQFA 5KDDA 3R20A 3VFDA 1KKMA 2G0TA 1VPLA 1ZCAA 3DO6A 4EUNA 1R0XA 2IUSA 1TQDA 1OH7A 2C5LA 3VKGA 1XU4A 3AUYA 1BH2A 4DLWA 5EUMA 3GMTA 1NN5A 1KDTA 3A1UA 1SXJE 1OXUA 1P9WA 4QL3A 1HT2E 5DHAA 2QE7A 4Q47A 3Q3JB 4PC7A 3VNVA 3FPAA 2OE2A 1FZQA 1U99A 1X3SA 2NO0A 3H2YA 1E2EA 5KDLA 3R9WA 4BFTA 1NG9A 2AHOA 3GLGE 4BQSA 1P61B 3L0SA 4IVPA 2P6RA 2Q9CA 2FWRA 3L2OB 3UKDA 3W8RA 4FMCB 2CJWA 3C5HA 4UNQA 2WKQA 3C41J 5JS8A 2ZYTX 2HCJB 2GXAA 3TGPA 4D4KA 3RWOA 1QHIA 4Q9HA 1EFRD 4MUAA 4TYNA 1HUQA 4PC6A 2IHYA 1G8GA 3MUFA 1P5ZB 1JXOA 1E2MA 2BEKA 5EE1A 3VQTA 1U2RA 4B48A 2GCOA 5BWMA 2I4IA 1VYTA 4M2LA 3SBDA 4NKRA 4Q66C 3ZVRA 5HCIA 2XZLA 1MR3F 4IVRA 4YLGA 3WY9A 4WA7A 1DE0A 2RB4A 1ZC3A 1JI0A 1F3OA 1QDEA 1YRAA 4DXAA 2WAYA 4P3YA 1E1QD 4AYWA 4OI0A 1YR8A 3TUZC 3LX5A 3MAAC 4RD3A 2GETA 2V54A 1MT0A 3UMRA 2V1XA 5CDFE 1A82A 1SVIA 2D7CA 2JDID 3U4QA 4LZZA 4A4DA 1VHTA 4QKQA 2OHFA 1ZM3A 3NKVA 5C4GB 1JPNA 1ZU5A 2F9MA 1HQYE 4P32A 1VG1A 2WKPA 1G5TA 1OFHA 3K70D 2OV2A 2AK2A 1RJ9B 4A2WA 1WMSA 4JS0A 3QEOA 2ZREA 3CRRA 4D26A 1FP7A 4C2UA 5AR1A 1T4GA 3K0AA 3ZD7A 3TSWA 5FUYA 4JLNA 1LNZA 5G40A 4EJSC 1NRJB 1XZQA 2D74A 5B2ZA 5TARA 2GF0A 5E7JA 3CRQA 3P20A 2DCUA 1P62B 4XTRA 1EWQA 3LA6A 3GEHA 2BBSA 1EFCA 2VQSA 3FVQA 3VX4A 4ASUD 2FSGA 1E3MA 3DOEA 4XIGS 3HYTA 2ZUDA 3ADDA 4QBFA 1K5DA 1N0WA 1P4SA 2OZEA 1G3MA 5AJWA 4LC0A 1FUUA 4GBMA 4IDOA 3WRYC 4BZPA 1UBEA 1R7RA 4ZV4A 3V9PA 4LBWA 2YZ2A 4QBGB 4XTCS 4AG5A 4C7OA 2FF7A 4HAUA 4A92A 4B47A 5SZIA 2ZSFA 5HTKA 4W7SA 4LYHA 1IHUA 5LB2A 3NIBA 2WWHA 1W0KA 4IVQA 5C4MA 1AS3A 4OBEA 2BM1A 1QHHB 1QHGA 2ZUCA 2ZI4A 3KZ1E 3OE7A 3OAAA 3A6PC 1J8YF 4G5RA 3TUJC 1UBGA 3D7MA 2HJVA 3LQRA 1TF2A 2VEDA 2Q3MA 4W9MC 2B21A 4IXMA 5FUVA 4GFDA 1ODFA 5DGXA 1W5TA 4PQRA 1YU9A 1ZU4A 5DYGA 4OI2A 4ESVA 2BMEA 4LHVA 4HEJA 4HDCA 3VR3A 4XWKA 2QN6A 1EFHA 2JJ2D 2ERXA 4HDOB 4LPKA 3DMNA 3KQUA 2FX3A 3I1FA 4PTLA 1OXTA 5JCPA 1I4DD 5FTKA 3CF0A 2XOKA 1BMFD 3I72A 3QXXA 1KO4A 4JT4A 4C0LA 1UBCA 2RAPA 1KI7A 2IA5A 3T61A 2PBRA 1KK2A 1R0YA 3X1ZA 2PZGA 5TMPA 2O5VA 1E1RA 3F0TA 4TL8A 1S3SA 2J0UB 3EARA 5GJBA 1OFUX 2VF8A 1QHYA 3AF4A 3T1QA 2OT3B 5FTJA 1OJLA 3CPHA 4MUBA 4BFWA 5HE8A 3VU9A 3LY5A 4AIIA 1YR6A 2JLUA 4RKEA 3A1SA 1CR2A 2W0SA 1HEIA 4B6EA 3K09C 3C7KA 3EZ2A 4ZCLA 2CMKA 4AK9A 1PLKA 2ATVA 3LXRA 3BH7A 4FD2A 2DFKB 1R10A 1Z5ZA 2ZS8A 1CS4C 2OCAA 2BMFA 2V6IA 4OYHA 2ZRHA 1MABA 3AVUA 2V55B 4OK5A 3RAPR 2VRWA 2ZM5A 2FSFA 4N0DA 4NDZA 1E2GA 1Y63A 4Q4JA 4EPTA 4TMWA 2H5EA 5FOWA 1TF5A 1XRJA 2WWFA 3VR4A 2ORIA 3K0CC 3NEYA 4A0FA 1KSJA 2DWOA 3NC0C 4LV8B 4GL2A 1SQ5A 2MSEB 4Q7JB 2BBOA 3IO5A 1KY2A 3TR5A 1VG0B 1TNDA 3L0OA 3VR5A 4Q00A 4QHTA 2WSSA 3MLEA 3LDAA 5FTNA 2A5JA 3EA5A 3BK7A 1OXXK 2NPIA 5TVKA 4HB4A 1M7GA 2FE4A 2C98A 4Q7MB 1JQJC 3T1OA 5JZVA 2RH5A 3KB1A 1KJZA 4D4MA 2QUZA 2C9YA 2PMDA 4KVGA 2HYDA 3KKQA 3QKUA 2F9LA 3WXMA 3B8HA 1XPRA 4G0NA 1GILA 4KU4A 3KX2A 4LYFA 3OFND 4BZXA 4DSUA 4A2QA 2QMOA 5DN6A 4EKDA 2GCPA 3L0PA 1S2MA 3T5GA 3DZ8A 5JLJA 2UVQA 4C0JA 4PAOA 2W2XA 1ZUNB 4AYXA 1DEKA 5FL7D 4E5UA 2JLQA 2IYSA 1UKZA 4DDVA 3IQXA 3TMKA 1G5RA 3SDZA 1GP2A 3PENA 1KJYA 3QNUA 3REFA 1KSHA 4KYUA 2W83A 3TSOA 2WSMA 4M1SA 2IBMA 4EFNA 1FMJA 5KHOC 1SULA 1KDPA 3OIWA 1PUIA 1S96A 2AFIE 3B82A 2BBTA 4PHGA 1KK3A 1WDTA 2F1IA 2Z5FA 1OHHD 2QU8A 4JVLA 1R8QA 1GRQA 2XSZD 5FOXA 4BLSA 1ZD9A 1P73A 1W48A 2FFBA 3IPXA 4ZI2A 2ZJ5A 3UK6A 4ON9A 4B71A 3OEEA 2ONJA 1XEWX 2IYXA 1E2PA 2XZPA 3K9GA 1AK2A 2FA9A 3RANA 4Q9JA 1RPZA 3O8DA 1Q3TA 1O3YA 2YVUA 1ZW6A 5D3MB 1WP9A 1YE8A 4ZDIA 1FNMA 1NLZA 3NHAA 4K8OA 4KLNA 1WF3A 2AKAB 4M1YA 1NKSA 1W0JA 3N5CA 4Q18A 2J41A 3DZDA 2IT1A 1NI3A 4YONB 1DTSA 2PLRA 2HF9A 4UNSA 3TUIC 2ZR0A 5K8IA 2WOOA 3V4RA 1F6BA 4XWAA 5EXXA 3U44A 1Q1QA 3I8XA 1XMSA 1EG7A 2AD1A 1F5NA 5L3SB 3B1WA 1K6MA 5JJIA 3V4FA 1AS2A 2ZI7A 5FPKA 1GAJA 4QJ4A 3KL4A 5ELXA 5JWHA 2MSCB 1GL6A 4CEHB 1SKQA 1DAFA 5D3QA 5JI2E 3VNUA 1Q21A 1XMVA 1YZNA 3OIYA 2ANBA 3CR8A 2QSZA 2F43A 3T06B 3G5UA 2WJYA 1E32A 4P4SA 1SXJA 2C8VA 4FWIB 5JMTA 3TNFA 2PLFA 3MJHA 1CJMA 2RCNA 4M1OA 5LDDC 4TYQA 2HJGA 1JXMA 2OO7A 4MKFA 3GLGA 2ZE7A 3DKVA 3ND9A 1TX4B 2QMUA 5FTMA 2QNRA 1R5OA 2XEXA 4JZKA 4QFMA 3P32A 2AR7A 3VMFA 5BQ5A 4ZI3A 2PT5A 1GITA 1M74A 4N3NA 2JLWA 5FOVA 4NL4H 1PUJA 4F38A 3TAUA 2O0KA 1M2OB 2C9CA 2VIIA 3AGQA 2O8BA 4ZPXA 2PEZA 2CLDX 1NN3A 4A0HA 2IUTA 3FE2A 2GVDC 1Q44A 3B2EA 4DEXA 1FOEB 1G20E 3IIJA 1GOTA 3AF2A 4ZKDA 2LKDA 4LX0A 4N0EA 4Q01A 2HCBA 4KBGA 3QOFA 4QGGA 4Q9IA 4NZYA 4UXIA 1SVWA 3FDIA 4QBIA 3B13B 3K9HA 4RZ3A 4NCIA 4LSGA 4JSYA 3KKOA 4X8HA 4KYIB 4TTQA 5AUOB 2CNWA 2RGNC 4HAYA 1R6BX 1D2NA 2J3EA 5DI9A 2J0UA 1T0JB 3R9IA 5CDFA 3HU1A 3SOPA 4Z1MD 3UMFA 2W58A 2H17A 1G291 4OK6A 3ZH9B 3THXB 2O8DA 1ZD8A 3A1TA 1UPTA 4DLYA 4OI1A 1UAAA 1NLYA 1E79D 1W44A 1YZKA 1Z6GA 2DY1A 2W00A 3B6EA 5UKDA 3ZZUA 5JEDA 1GNQA 4OQLA 4UNPA 1PVOA 2ZJZA 2GK7A 1GL9B 4DCUA 4BFVA 1VYUA 2EQBA 1HA3A 4CDGA 1MRSA 2AWOA 3TBKA 4IDNA 1M8PA 3K70C 4B43A 2VA8A 3CR7A 2ZYVX 1MO5A 4Q9KA 4EQ6A 2YC4C 1IOZA 1E94E 4US1R 4Z8XA 2EFCB 4IRUB 2YNMA 1LF0A 3WBJA 4D82A 4R71A 4IOJA 1Q1ZA 2P6NA 4TL6A 5CJ2A 4DB2A 2BWJA 4NYIR 3X2SA 4ZDKA 2XZOA 1IN6A 3ADCA 4JVSB 4EPWA 1ZIPA 3CZQA 4LUCA 5JRJA 1YZLA 2GA8A 3KUCA 1TPZA 2VP6A 2G0NA 3B7GA 4PC2A 1HE8B 1T3LA 5DH9A 3VTKA 4DJTA 1XTKA 4A15A 1P2SA 1S1MA 2KI5A 2EFGA 4LGMA 4HZUA 2IXEA 3QPWA 2YJTD 1J90A 1NVVQ 3L43A 3RC3A 1MO6A 4IEIA 3I4LA 2NIPA 5BN5A 1F2TA 4TWZA 3AKDA 2QAGB 4JLKA 3AQ4A 1YZTA 2NPFA 1CBUA 1QHNA 3BD9A 1YZGA 3KQHA 1TMKA 1Q20A 2GCOB 4PQFA 3QVVA 4O2RA 4PANA 1K8RA 3SYNA 4ITRC 4PPNA 3NXSA 4QXAA 3E1SA 4HB2A 4M9XA 4X8MA 2I3BA 3R8CA 4V0ME 4CGZA 2O8EB 1S8FA 5F9FA 2V1UA 5FBWB 1GDDA 2A3RA 3EAQA 3AUXA 1OYWA 3OEHD 3ZD6A 1JB1A 4W5JA 3B60A 4E03A 4IEEA 1AIPA 1KDRA 1Z0JA 1T3HA 3HU3A 5FBVB 1H8EA 1YKSA 2AK3A 5C46F 4LJ8A 4WZ6A 3U61B 2B92A 3LWNA 2W6IA 3NTUA 4D25A 3PV0A 1XJ0A 1Z6AA 2WIAA 4AY2A 3UANA 3F3YA 2AXNA 3BFVA 1EK0A 4EFMA 1VTKA 1TADA 5P21A 3FGNA 4IOMA 1II0A 2GXSA 3K0AB 1NMZA 1CTQA 5L8VA 2H18A 2RGDA 3CRW1 5L3VA 1M7BA 3W6NA 1KJWA 2W2VA 1BKDR 2CVHA 5LPNA 2XNSA 1RE0A 1OSNA 2VHUA 1WBDA 2IYUA 1SZPA 2R6AA 1NNEA 3VHLB 8OHMA 2QE7D 1X1RA 2B8WA 2GHIA 5AUPB 4JBWA 4QGAA 1TQ2A 3HYRA 4AKIA 3DEFA 4RZUA 2P5TB 1B0UA 1G4UR 4B3XA 5IK2A 4BFUA 5GVSA 4B2LA 2BDTA 3CKLA 2J1LA 1KMQA 3EZ6A 3EZ9A 2ZI5A 5FBRB 4HLUC 1T6NA 3AVWA 1ZCBA 4R2IA 2VL7A 2VP2A 3CWZA 2JLXA 3K0SA 4C7OB 4EJSA 1LS1A 3CRMA 3GFTA 1IXRC 3AF3A 2QQEA 2L0XA 3MWKA 2JEOA 1YQTA 1UKEA 2R44A 3BFXA 4I99A 2GBLA 5DI3A 4O3MA 3FHCB 1LF5A 2KSQA 2FH5B 1G3UA 4LPSA 5EP2A 1W36B 2RHMA 3SR0A 2WJGA 2VF7A 2ZROA 3AH8A 1T5IA 4CT5A 3KXLA 1VECA 4B74A 821PA 3CNLA 1QVRA 2GXUA 3O47A 3VHXA 1N0VC 2ZE8A 2HLDA 3PFIA 5FOTA 3Q7QA 3CM0A 5IDVA 1ANKA 1TUIA 4R2HA 3IILA 4JL6A 4Q9LA 3KFXA 3P4YA 2D2FA 5LBIA 3H0KA 2C95A 4PHFA 3ZIAA 1G18A 1AA9A 2QY9A 2V9PA 2VYFA 2WWIA 3IQWA 3LH5A 3AM1A 1N5KA 2BV3A 3OHMA 2RGXA 1XXHE 3QKSB 1G6HA 4TL9A 5B58C 2F1RA 1XBTA 1ZRHA 2R6DA 721PA 4C3ZA 5JCZA 3QXJA 4WOPA 3ZS8A 2WMOB 3S1AB 1JEEA 4YC7A 1AJEA 1ESNA 2F6RA 3E70C 3HPQA 4JSTA 3SJAA 3H84A 1NG1A 2CL6X 2J5XA 2OBLA 4KFSA 3ASYA 5A0FA 1OW3B 3U7FB 1GNPA 4TTPA 2LCFA 1GRRA 4URVR 3KJHA 4C2TA 4KODA 2KBFA 1P72A 2F3RA 3DVLA 3BERA 2AN9A 2FPLA 1MABB 2G1JA 2QI9C 3MG9A 4RFSA 4XJXA 2QEQA 1HV8A 1G5PA 4GOXA 4PPFA 1E2KA 5EXTA 4Q4JB 4NYJQ 2GEDA 4JJZA 1ZM4A 1N6IA 4POAA 1UM8A 5J4YA 3A1VA 1DBSA 2VBCA 3LVQE 2F1HA 3JZAA 5JECA 4GOJA 1OFIA 1S4QA 3RABA 1ZINA 5KPJA 1EX7A 1Q1BA 1UF9A 3P4XA 4OJKA 2CEAA 1E69A 1Q12A 3ZVMA 4H1VA 4LJ4A 5J5CA 1FPMA 1GWNA 1W0KD 1ETUA 4Z51A 5KDOA 4D4LA 2VTKA 2WWYA 221PA 3OE7D 4DCVA 1G7CA 3OAAD 2ZXUA 2DBYA 1TQ6A 4M4SA 2VSFA 1W36D 3KDSE 5KNBA 2GEVA 2GK6A 4A8JA 5AUNB 2W6JA 3WHLA 2J7PA 4QHSA 4PHHA 3AVYA 1XD8A 4CW7A 3HJNA 1UEIA 2XITA 1KIMA 2EFHB 5FTLA 4M1KA 2ZSAA 1DAKA 3U3JA 2GAAA 1GM5A 2J59A 4DVGA 1OPXA 4B3GA 4IDPA 1S3GA 2XOKD 1PJRA 2QTFA 1CEEA 1KI3A 2GILA 2HF8A 2QGNA 3WP1B 5EE3A 1I4LD 2GJAA 4D2IA 3EWSA 5C1BA 2WKRA 2Y8EA 4TLAA 2K5UA 1KY3A 1E1RD 1KYIA 1V5WA 2QAGA 4LV6A 4LY6A 4M22A 3SN6A 1RC8A 2V3CC 3CZPA 1RW4A 4LBVA 4V03A 4DSOA 2DPXA 3F8TA 1R0WA 4ZDJA 2NZ8A 5F3WB 2O8FB 1XTRA 4KCGA 4A36A 1LTQA 2FZLA 2CL7X 2PCLA 4BEBA 4DDUA 4ZCIA 2ZI3A 5LD2B 2Z4RA 4FW9A 2DWPA 1X8JA 2O8EA 2FV8A 5G3YA 2ONKA 1PLLA 2B8TA 2ZJBA 4MGIR 2ZU0C 3I62A 3GEEA 4Q5IA 2RGAA 1E2FA 3X1XA 3K9LA 3PJRA 1ZUHA 4HB0A 2UZIR 2VP0A 4KVAA 5JJLA 3QI2A 5H1YA 5TDHA 3SFZA 2QP9X 5EE0A 4B32A 2A9KA 2ZVQX 2OLKA 2ECKA 5EE5B 3I61A 1KAOA 2NQ2C 2V4ZA 2BKEA 2GJKA 4MITA 4PZZA 4RD4A 5SZKB 5J4KA 3O8CA 1ZC4A 4UQOA 2IS6A 4EIWA 2IWHA 1CJUC 2FU5C 3U44B 2PL3A 4DHEA 1LS6A 2GZDA 4MDEA 1P2TA 2CE2X 2ZR7A 2WSSD 2D4HA 5DYIA 4FMBB 4B75A 4BFSA 4RCYA 2D7DA 3K9NA 2WWXA 5JFGA 2AX4A 1EESA 2EWVA 2FOLA 4CF7A 3FMOB 3JVUA 3LBHA 1L4UA 1HURA 4PSVA 2ZQ5A 1E0AA 4ACBA 5DE3A 4DEYA 2YWGA 2CBZA 2GJ9A 3ZYCA 5J4LA 2OEPA 2F43B 4L5BA 4P4SB 1SXJB 2JJ8A 3AVQA 3EZ7A 1SKYE 4F93B 2WPDA 5SZJA 4S2EA 4DT1B 5DN6D 4NTZA 4K46A 4TLDA 4IJMA 4TYYA 2IXGA 1U94A 1E9EA 2CHVA 1QRAA 3GLGB 2W2TA 2YOGA 1Z8FA 4D0LB 3BIFA 3CPJB 3I8SA 1SVSA 1VCNA 1FNNA 3AKCA 1KI1A 4GSYA 3EIQA 2XTNA 2FGJA 3VKHA 4OQNA 1M7HA 2OCBA 5DHFA 3ZVNA 2O8BB 4BLTA 2NO9A 4GOKA 2DFTA 1N6KA 2ZIAA 3CPEA 3IHLA 3GLHE 4XVUA 4DB4A 2J45A 3M6AA 2CCKA 4Q1BA 5EXSA 4WZBE 2FFAA 3BFKA 2VSOA 3BAFA 3MGCA 1E9RA 2X1VA 3ONWA 4U00A 4NYMQ 5CK5A 4G5GA 2A5GA 2OCPA 3DHWC 2VP5A 3NWJA 3TW4A 1MOZA 2ZS9A 3OEED 3RS4A 1QVAA 4ZIRA 3RNLA 4DZZA 4WZAE 5E4FA 5BN3A 4C4PA 2IHBA 4B73A 4X8OA 5A5GA 1AQYA 4N1AA 1N5IA 2QENA 4UJ5A 3FTQA 1JALA 4V0MA 4QRHA 2VHCA 3A4MA 1RIFA 3QKSA 5JSZA 2H92A 4HUQA 3SQWA 1GVNB 4TMKA 5BN4A 1KNQA 1DG3A 1W0JD 2ZRAA 3PXGA 3S1AA 1KZGB 3H1TA 2O8DB 4PC3A 3CBQA 1Z0AA 4QC2A 1JQLB 1OB5A 3BB1A 4E22A 1E9DA 4JYBA 1NKTA 1DAGA 1NN0A 4AWXA 1T3SA 1ZUIA 4KAXA 2GWHA 5TB5A 1RRGA 3BS4A 1N2CE 1KOFA 2WIBA 1TEXA 3U60B 4I4LA 3LLMA 3WNCA 2IF0A 1IY0A 3KJGA 3X1YA 2GDJA 2ZJ8A 3EC2A 3FB4A 4R9UC 4EQ6B 3CONA 1U9IC 2R6FA 2JJ1A 5E3HA 1A1VA 2NGRA 3ADKA 4LJ7A 2ZE5A 1ESMA 2B7CA 3M0EA 3LFUA 2N1BA 5E95A 4CIDA 2G3YA 1SXJD 2DHRA 1RZ3A 5EP1A 5TV2A 1X8LA 1F2UA 2E1RA 5HR5A 4G1UC 5KO2A 3FFBA 4TYWA 3I32A 3SE0A 4WAUA 1Z28A 4Z8YA 2J0SA 1A4RA 4ZKEA 4GT1A 4Q7KA 4J0QA 2R6GA 4HZUB 3U5ZB 2XTMA 3R8FA 4FXPA 2FSHA 1IAQA 5KNCA 1KMHA 3FFAA 3PEUA 3K0EA 1F2TB 2PX3A 2ZANA 4A0GA 4PO9A 2OG2A 3I92A 1RRCA 3M4YA 2IYVA 4IDHA 4II7A 2ZI9A 4JLMA 5HZHA 4LJYA 4E07A 1DVRA 4IHQA 2P5SA 4ARZB 3U7HB 4PPQA 2CCJA 2JATA 2ODBA 5BYJA 1XPOA 1U81A 4MKHA 1N6HA 4PPGA 4JVNA 2ODNA 3GLHB 3GJ0A 3QBVA 2O8CA 1XFAA 4TN1A 4FWTA 2QMHA 3WNDA 4B33A 1EX6A 5C18A 3L8YA 2PT7A 2G9NA 5CB8A 2H7VA 3A4NA 4PFSA 2B6HA 4NBSA 2CNWD 2Z43A 1VCIA 1QG2A 1AN0A 1G19A 3KFVA 4YXWA 4BLOA 2FDCA 1DARA 1W46A 1DAHA 3F5FA 3WRXC 1FMLA 2PX0A 3GQBA 4Q1EA 1SHKA 2O8FA 1WB9A 3U3RA 5L3RA 3D31A 3G82C 1XXHA 3L0IB 3TR0A 2R9VA 4HYYA 2Q0HA 3Q7PA 4KFTA 5E7MA 5FI0B 3TIFA 1OXSC 4W5WA 1FTNA 2DR3A 1YHNA 4PAQA 4EPVA 4LDJA 3TE6A 2CDNA 2XAUA 1US8A 1E9AA 2PJRA 3FHTA 3C4JA 1JBKA 3IO3A 2ZRFA 1G3RA 1X86B 3LO5A 2BOVA 2BBWA 3KB2A 1IY1A 2IYYA 3PQCA 4G3XA 1E2JA 1SVOA 4XSHA 2WHXA 3BB3A 2IEYA 4P4UA 2N42A 2REXB 3T34A 3GLIE 1VG9B 3THOA 1TF7A 3BB4A 3CNOA 3AF1A 4MYTA 4V0OA 2IF2A 1OLOA 5FBQB 1OYYA 1WQ1R 1HE1C 1JR3E 1LB1B 3MSXA 4LJAA 2WWGA 4US0R 3VAAA 5EZ6B 4B3BA 4EJSB 1OIWA 3MD0A 5K8LA 1XB2A 1Z29A 2H1LA 2QQ0A 3A36A 4DWJA 1DADA 3PUYA 5HPYB 1KGDA 3WYFA 5KOYA 3SQXA 1UKYA 5DI3B 4NCNA 1MRNA 1HQCA 1EXMA 5J47A 1JJ7A 5E7IA 2ZRIA 3WYAA 1G3QA 3EW9A 3AP1A 3GJ4A 1Z07A 4URXR 3W8NA 4L15A 4BFXA 2ZVPX 4LI0A 4DT1A 4DIEA 3HR7A 2CE7A 4OI4A 4Q21A 4OHZA 4HLUA 1Q3HA 4NMMA 4LK2A 4DRZA 5FPYA 2QAJA 1WA5A 2FEOA 3NC1C 1NP6A 3THWA 4YMSA 4MGKR 1N0UA 3NDBB 1DS6A 3GD7A 3IEVA 3E5HA 4OHYA 2IX3A 4Q1DA 1W36C 4XVRA 3RRNA 3EPHA 5AWFC 2QM8A 3RS0A 4OHVA 4EAQA 2OAP1 3IPYA 3GLFE 3ZZ0A 1LVGA 2ANCA 1KZ7B 1W47A 2BJVA 2IYRA 2JAQA 4XVQA 3TLXA 1H8ED 2WJJA 2YKGA 1EGAA 2OFXA 2IXFA 3W6OA 1Z0FA 2W6ID 4MRVA 3X1DA 3PEYA 1COWA 4B76A 1IY2A 4Q19A 2WJHA 4Q4HA 3GJ7A 4QOSA 2Q3FA 4URYR 3V00A 1GUAA 2C2HA 4F4JA 1J8MF 1LV7A 3BH0A 4HAXA 3WP0A 2A5YB 2H57A 3AKEA 3MRSA 5FH9A 1X8KA 2BKUA 3RS5A 5CITA 1TUEA 1BIFA 4ACAA 3SYKA 4RFSB 1G8HA 2ZE6A 3CH5A 4FIDA 4U5XA 2FEMA 2ZR9A 4OHXA 1NN1A 1XF9A 1J2JA 2ASEA 3TKLA 5GJVC 4XH9B 3W5JA 1E2DA 2QM7A 3LNCA 1UADA 2FMXA 1OE0A 1TL7C 2BEJA 2GXQA 5IK2D 4IOKA 1YVDA 1QZXA 1AM4D 4IDQA 4PX9A 3P27A 3QSYA 4UNNA 5KSZA 4DDWA 1I2DA 1YJ5A 4Q4LA 3AVTA 3RS2A 2WOJA 1HH4A 4PQYA 1TQ4A 4QNMA 3G0HA 5LB4A 1E6CA 5EXPA 2QRZA 4MGYR 1NBME 3ZQJA 1E4VA 3IBYA 4M8NE 4PC1A 4NU0A 1X6VA 1R2QA 2WJVA 2ZRGA 2FFHA 1NSFA 4JLAA 4A8JB 1H8HA 3M1IA 4HLCA 2C78A 3LV8A 2CCGA 4CYMA 1E99A 3MWYW 4V0NA 4H9GA 3VR6A 4AKEA 4B35A 2HLDD 1IBRA 3SFVA 1JAIA 1E0SA 3OIVA 1XMIA 2QTHA 5EZ5A 4DLZA 4EFLA 3BRWD 1D6JA 3QE0A 1Z6TA 4HI0E 4MRNA 2KE5A 3ZQ6A 4BRUA 2JIZA 3W34A 3FOZA 2C99A 4NCJA 4MRPA 1U8YA 3SYLA 2GRJA 3RLFA 3ZIAD 1R5NA 3ICEA 3QEJA 1E2LA 2Q9BA 3BWDD 2WWWA 1T91A 4P33A 1GKIA 1CR0A 4ARZA 4M1MA 4Z54A 3T1TA 2J7KA 5AJXA 4HLDA 4MYHA 3QY0A 3B85A 4D6PA 2OFWA 3BXZA 3TSZA 3BOSA 2QZ4A 3VX3A 2XXAA 1GTVA 3GLHA 1DAIA 3SZRA 2PZEA 3UWKA 4LC1A 3I73A 2OXRA 3WNBA 1AZTA 3OESA 1E9SA 2QPTA 1V43A 1RKBA 1DO2A 1ZAKA 2BCJQ 3LD9A 5JWOA 3HPRA 3SS8A 1PV4A 3FWYA 2R8RA 3FKSA 3PG5A 4GMXA 1IXSB 1GIAA 2Z4SA 5H68A 1Z22A 1J99A 1RYHA 4URZR 5JJKA 1G7TA 5JI3E 1W2HA 3SJZA 1ZMXA 3DL0A 4O25A 5BW8A 1Z83A 1NIPA 3U3MA 4PO1A 2RHDA 1OH6A 4P31A 2NG1A 2Q6TA 1I4TD 3QPUA 4F91B 4NCHA 2Z6VA 1XMJA 5SZHB 4NONA 2BVNA 2ZRLA 3SJBA 1AGRA 2O0HA 1KI9A 3RS3A 3L82B 5FOSA 4B3DA 3EIHA 2QA5A 2J46A 2QPOA 4PZLA 1IJEA 2PZFA 3RHFA 2ZJ2A 1TAGA 1P9NA 4WW0A 1GRNA 2W6JD 2ODEA 2J7PD 4GMDA 3VR1A 4KXFB 4EPXA 1MH1A 4LCBA 4M9QA 3B1XA 4AG6A 1S1CA 1N25A 4JL8A 1D9XA 1E98A 2RMKA 2GESA 4DLVA 1XP8A 2VSXA 1XCMA 4GZMA 2DB3A 2XX3A 4TZ0A 3DPUA 1CRPA 2NO6A 3UPUA 3NBXX 1G41A 4ABYA 1FQJA 1XJCA 4JLOA 3WHKA 1Z06A 3WYGA 4TSFA 1SXJC 4BRWA 1CJTC 4G5QA 4YMVA 1D5CA 1UKVY 2P65A 2FNAA 4AYTA 4E09A 2ODWA 2QSYA 3ETLA 4TMTA 1KI2A 1K5GA 1E2QA 2JLYA 2HEIA 1JR6A 1GKYA 1RRPA 4TMVA 2A5DA 2GEUA 1DELA 2VPPA 2QRNA 4TQ9A 5EP4A 1NIJA 4KV9A 3D3QA 4ZIRB 4JYCA 4L4UA 4BZQA 3NBZC 1G1MA 3KXKA 3UG6A 3K0FA 4B34A 1J70A 1VCMA 2IS4A 1P3JA 3CO5A 2CLCX 3O8RA 2JASA 3CNNA 3R7WA 2ZITA 2BMJA 1E9CA 4HUQB 5JSZB 3P26A 4DBLC 2GNOA 3AGPA 3QVUA 1AGPA 3U7EB 4PSKA 4CEIA 3KQKA 4DCTA 3OF5A 1ZM2A 2LKCA 1W49A 3GFPA 3GEIA 4G5OA 1AKEA 3IEUA 5DNYB 1IN4A 1F48A 1OB2A 3A4LA 4QG7A 3ECCA 4KO8A 2XNDA 1NVUQ 4EPRA 1KI6B 2VO1A 3DDCA 4ZCMA 1SGWA 2RGEA 1CLUA 2BM0A 2ZUBA 3OIUA 1NMYA 2NZJA 1ZM7A 2ZYWX 4TQUS 2GCNA 1YRBA 1G8YA 1OH5A 2KWIA 2R2AA 1U98A 3B1VA 3QF4A 3SU8A 1YR7A 3LAWA 2AFHE 3FMIA 4B2IA 2QT0A 5KSYA 4OQMA 4UXHA 1PZNA 5CIQA 4GI7A 1XJQA 3GJ8A 2XJ4A 3I5XA 4CZ2A 1ZNYA 2ZS7A 1G7SA 3QG1A 1G7RA 3K09A 3KTAA 1OKKA 4TT3D 1F2UB 4HAWA 1ZBDA 1NVVR 2AWNA 2WPDD 521PA 4ERNA 3BE4A 2A78A 4A1FA 3L8ZA 4NE2A 1QHSA 5CJPA 1E4YA 5GJCA 1LY1A 3ZS9A 1U90A 3EXAA 3DM5A 1FP6A 1KNXA 3C16C 3IBGA 4O0MA 3GLIA 1C4OA 5EUQB 1KMHB 2YV5A 3CUEF 3A58B 4QHYA 4AI6A 4KBFA 1XD2A 1KAGA 2R6CA 1JR3A 1KKLA 1VIYA 2NO1A 1OT3A 4Q4AA 4QM6A 3K0CA 4DUGA 1UBFA 1XX6A 3JZMA 1VMAA 1X1SA 2TMKA 4GP6A 4RD0A 4NPHA 1AZSC 3HWSA 4MYCA 1G16A 1JAHA 5AJYA 3W3ZB 4FCVA 1XWIA 2KB0A 3SHFA 2O8CB 4YMTA 5TXGA 2QL6A 3B78A 4HAVA 5EJEA 5FPTA 4WIAA 1XTIA 2RGBA 1E2HA 4QNRA 1R4AA 3NHBA 4C0KA 1GKUB 2RGGA 1FL9A 1L7VC 3FKQA 4P0TA 5DSZA 2XB4A 2EFDB 1VKJA 2GZAA 1OXVA 4KFUA 2XGJA 3BBPA 3EC1A 3J81k 3BC1A 1G9XA 2VHTA 1JPJA 2DFNA 2OAQ1 2C04A 2H8KA 4IFEA 4JLDA 1D2MA 1XTQA 4OL0A 4FCWA 4QGHA 1FFHA 2P3SA 4HAZA 3GLFA 1IQPA 3D6TB 2Q9AA 2OBNA 4HZIA 1XXHB 1WXQA 1G3IA 3K1JA 4A2PA 5K8UA 1CR4A 4XOIA 5JS7A 1U8AA 4BLQA 4BPBA 3X1WA 1W2GA 4RD6A 1XEWY 2JLRA 3QXSA 2A30A 2GTPA 4TQAA 4JVMA 2FPMA 2ZRMA 2ZJYA 2CK3A 1US8B 2CHQA 1G8FA 1JEDA 1E2NA 1OF1A 4MRSA 1E0JA 3CRVA 5CYPA 421PA 1ZNZA 1H65A 5KYKA 2C9OA 2JJ1D 1SVMA 3U6KA 4CRWB 2WV9A 3WMFA 4HATA 1NVXQ 5J4VA 4C0SA 1ZJ6A 3RRZA 2WZQA 3JVVA 1KO8A 5L3QA 5JWRA 4JBYA 4TMXA 2GJSA 4OJQA 4C0BA 4MRRA 2ZU6A 3FMFA 3DM9B 2WBLC 2JLVA 5KTYA 1E2IA 1IN8A 5BXQC 1SVKA 2V6JA 1XZPA 4OHWA 2XJ9A 4XD7A 5GJWC 3W9YA 1N5JA 1Z08A 2ZTSA 1RYFA 3LXXA 3W5IA 4S35A 3UIEA 1M34E 3T5DA 3TQFA 1NL3A 4QJ5A 2WAXA 4C9BA 3UG7A 1EFUA 1Z3IX 4RY2A 3MWJA 4FMDF 4TT3A 3GPLA 1FX0A 1QF9A 4G5SA 1NVWQ 3Q8XB 4F7WA 1NBMA 4RSGA 3PVSA 3AVXA 1W7AA 3H86A 4DLRA 1U0LA 2V7QA 4DLTA 2X19A 4ESHA 2FG5A 4DIDA 2ZSDA 2ZJOA 3A1WA 5A4JA 4BWYA 1UFQA 1KO1A 3FMPB 3MFYA 3THWB 5F2EA 2GBLC 1W4RA 1BOFA 1G8PA 1NF3A 3TQCA 2PH1A 3AV0B 3AVOA 2FFQA 1E9FA 2ZSEA 2BIFA 4GP7A 1AS0A 1IN7A 1MO4A 2H16A 3KKPA 5H70A 2IS2A 4LOAA 1T8TA 1UJ2A 5GADl 2ORWA 2WTUA 1JNYA 3HP1A 4YXWD 3BORA 4LHWA 2JGNA 2J0QA 1DOAA 1TTTA 3TVTA 3HR8A 4IKEA 1RFLA 2GZHA 4RCZA 3RYTC 2F7SA 4B44A 3THYA 1TU4A 2GF9A 4F92B 4US2R 2XB2A 1NJGA 2KJQA 4Q4HB 4A9AA 4PAMA 1P2UA 1FW6A 2R65A 3AP2A 3PUVA 3GJXC 1Z2AA 3Q5EA 1NSTA 1XD9A 3MJRA 4W5HA 3A37A 3CB4A 3LBNA 4FCTA 5G41A 3IIKA 5GVRA 5KUTA 3RRYA 5KNDA 1KK1A 4NYJR 3QKTA 2P2LA 4Q7LA 4AD8A 1N5LA 3AVVA 1G21E 1XNJA 2RKOA 3SC3A 1VG8A 4JLBA 1KTVA 3QG5A 1I2MA 4CEJB 1Q57A 4Y0VA 4BGDA 4LJ9A 2X77A 5CM9C 2NTYC 3D8BA 2F3TA 2ZRJA 1G17A 3QXCA 2VHQA 3IKJA 4JIMA 2V8OA 5AJVB 1KI6A 1EFRA 3HDTA 4FINA 4I1SA 4BEJA 2YWEA 3QKRB 2C77A 1XTSA 4U02A 1DG1G 3ZDQA 1WE2A 2YWFA 1T0HB 1CJVC 1IXZA 2C03A 2RGNA 3PUZA 2IWRA 3RRMA 3CX6A 2OLJA 2MMGA 3ZJYA 4HUTA 2RGCA 4UXJA 4M53A 4LHZA 1BO6A 3TK1A 4EPYA 4B3CA 3EASA 1HTWA 5G53C 3NBYC 2Z83A 4ZO4A 4TMZA 2J87A 3O8BA 4RJLA 4KFRA 2GAOA 2QBYB 1VHLA 4KLZA 1D8TA 1E1QA 2F1JA 5TY0A 2NMVA 2OM2A 2PCJA 3TH5A 3DMDA 3U2QA 4BASA 4BE7B 3ZLJA 5F98A 1YZUA 2JDIA 4A6PA 3EPKA 3CWQA 4DDTA 1W4CA 5AUQA 4C0AC 1II8A 1GL7A 2SHKA 4MKIA 2D06A 3LVRE 3A8TA
chains in the Genus database with same CATH superfamily
2C96A 3OFKA 3FPCA 4UARA 2WR8A 3TPCA 3FYHA 2FZ4A 4N0PA 2V97A 1ELOA 3QU9A 4Q15A 1JSCA 1P7PA 1SD5A 3OX3A 4WDQA 4N54A 5DM60 2CVZA 5DBOA 1PFVA 3VKWA 1KI4A 3KWMA 5FR1A 5HIIA 4BQQA 1MFPA 5GONA 3MVEA 5DFAA 2XVYA 1BE0A 5EG5A 4BO2A 5HKKD 2ZIGA 1CNEA 1Z2CA 1VLMA 2XI4A 1NJSA 1ISFA 2VP4A 3BHJA 4LJRA 3UV7A 2IUUA 4YAKA 1U3GA 4NFLA 5I7UA 3QVOA 1J8FA 2H65A 1LI5A 1SC3A 3MILA 3WL7A 5JALA 1H4SA 3I37X 2E55A 1XOIA 5DNUA 1BYIA 1BRMA 3FFXA 3TL3A 3UMSA 4DG8A 1PJ8A 1UUFA 1EVQA 1XK6A 2QYSA 4PR3A 4BO1A 2XXAB 3FTCA 2QJTA 4K6CA 3PRJA 4LWZA 5AIBA 4B80A 1XVTA 1BHSA 1BVYF 2XIJA 2C4MA 3ICVA 3KQLA 4ZEMA 3LCCA 1XZJA 1ZJ4A 3M1LA 3OMXA 2ZWPA 1M1YE 3W3AA 1ZXLA 1SEVA 4MIEA 1LDNA 2DUUA 3A28A 1GG2A 4W7IA 4Y0AA 3SZOA 1W4BA 4WZAB 2BGWA 5GGYA 4RL4A 3IA2A 5LQUA 2DR0A 4MVJE 4TTRA 3JTEA 4RDIA 4N3CA 5HMMA 1HTTA 4MA4A 2QT1A 4NRDA 5IAAA 1W1WA 1I01A 4L74A 4F06A 1BA3A 1H94A 2EG5A 3NR2A 4KN5A 4RXUA 4GNRA 1HPLA 3DZJA 4U7DA 3BCRA 4EJ0A 2J6HA 4LBYA 4R1PA 1YQXA 3G2QA 2FYTA 2I78A 3P7MA 2JLSA 4RGYA 4EELA 5JH7A 4XPIA 4DQUA 2XUZA 2O5EA 4HWPA 1XPUA 1FY2A 2HXYA 3LTEA 4ZYWA 3PEEA 4EKGA 4NJMA 5F73A 4EMSA 2ZCJA 1SCAA 4M88A 3T15A 4URWR 3AZOA 1J49A 1FYXA 4NQZA 3EVGA 4ZEVA 2BFDB 1UDXA 5TF4A 4DM4A 1IEWA 2ZLBA 1EFVA 4PCUA 1C3VA 3B3GA 2DU8A 1C8LA 3RWMB 3EVEA 1BMFA 3TD6A 1R0SA 3FCAA 4BLVA 5T4EA 2AFHA 3B5EA 5G3ZA 1C7RA 5NLLA 2VLIA 3T5PA 2OFOA 2BLNA 1Z4OA 2IPOA 2VJAA 2YQ5A 3O9MA 3VR6D 4GH5A 1M6NA 5I8PA 4JC8A 1VRCA 1V8BA 3FG9A 1Z73A 4KIFA 3HVKA 4KRXA 4BCCA 4CTKA 4UHEA 4BJ5A 3DQPA 1N6LA 3CNQS 4YMIA 2G40A 2FPKA 9LDBA 5IJ9B 1NHGA 2GZMA 4PO3X 4CMCA 3LW8A 1GXSB 2E4UA 4MEBA 4DA8A 1VBNA 3QFFA 1JIQA 4GPTA 1TYDE 1MQAA 4QQKA 4RGQA 1RC0A 4NYMR 4IMRA 4IIBA 1A96A 2IP2A 4IIYA 3MWGA 1XMXA 3NAZA 1IEXA 2FGKA 2ZJFA 4W5OA 1X7DA 1SQ0A 2XR1A 5TR9A 3LSYA 2X8JA 3W2GA 2PMWB 3H83A 4M21A 4A7PA 1KK0A 1O7JA 2HZ7A 1KXJA 3WZ2A 4C0HA 4CM7A 4UPDA 2NU9A 2EATA 4JYZA 3AEZA 3DZKA 3NT2A 1MX9A 1TYAE 1UANA 1AUXA 1N1GA 2B4YA 3CLUD 2OC4A 3D02A 5AKLA 1CZNA 2VAMA 3VNSA 5HKKA 2PGIA 1ULSA 5ERYA 4C01A 4DMRA 1DQRA 2Q3HA 2JBWA 5E4TA 3S2GA 4UD6A 2VG8A 3DV0B 1HFWA 3R3VA 4X20B 3ECAA 4I1VA 3RSQA 3GZ4A 5BYKA 2QRGA 1F0PA 2EX4A 1YUBA 1AY0A 3PUXA 2ZFUA 1BQ3A 4E5KA 3D6JA 3GDHA 2RGUA 2EVWX 1FDIA 2FTKE 2EZ9A 2WUDA 1SOUA 1ZQ1A 1O9HA 1GSIA 1QHHA 5TF0A 1RCUA 1WTCA 1GA4A 1O8CA 4NCKA 3LX8A 5HZKA 2O2HA 4LW8A 5IBRA 2MCFA 4UVIA 4BNXA 4S2UA 4NBLA 3LQ2A 1KZYC 3F5QA 4HXGA 4ZQFA 3IAFA 3QA3E 1PS9A 3M5WA 4RH3A 3S2ZA 5FEUA 2PR7A 1BX1A 3OFNA 4ND8A 3N2EA 4UHHA 1DDIA 1EDEA 5CIWA 5A1TA 5GTDA 1T10A 3PWSA 4FKBA 2IYLD 1W34A 2AMLA 2B1JA 2E87A 3TTVA 1QXSA 2GD1O 1CDZA 3EWAA 2GNAA 2VA9A 2BFFA 5FHQA 4AMBA 2ZI6A 1X1BA 2GUWA 2X0JA 3AU9A 3O0TA 1MGOA 4AICA 1QB7A 2XVAA 4FE3A 1Y6QA 2XMPA 5FL7A 5I7WA 4CM8A 3KTAB 5AH0A 1ORHA 2YCLA 3RSLA 1CF9A 4PLWA 1JPVA 4WLNA 2Z95A 3W6PA 1FTGA 1KOGA 1O97D 2PFKA 4BLWA 2XE4A 1C7IA 1JHDA 1WXDA 4CKBA 4LNHA 1QJCA 6REQA 1EP1B 1E9BA 1L4EA 4OXKA 1NR7A 4DEVA 5CXUA 1DKQA 1BE1A 1XZNA 3TVDA 2D62A 3NPAA 4RS4A 2HMUA 2IIVA 3CW2A 2VJPA 5JJCA 4R7ZA 1CVIA 2WFAA 3V48A 2P67A 1ZUWA 1XZCA 2QRMA 1JP7A 1YRHA 1Z34A 2QLBA 3QPVA 5F9MA 4BYMA 5B1YA 3HRHA 4TSFD 1U0JA 4AC9A 1I7SB 2QBYA 2FHSA 1BDMA 1QR2A 3AHJA 3PLNA 2Q5CA 4AMYA 2HWWA 1RBQA 1TVKA 1W88A 2OBMA 6Q21A 4NX2A 4KXNA 4PR0A 1U6JA 4CIAA 5FNVF 3WGLA 3EIWA 2JCSA 3OOSA 5CYOA 1JVBA 5CNMA 3RSHA 1IHYA 3LWBA 2IK8A 1L1QA 4HRVA 1RABA 3ZCRA 4D9MA 2VQFB 4G97A 4OKSA 4HNUA 1AKYA 2X4DA 3RFVA 2PZMA 5K4AA 3TD9A 5ALMA 1E5VA 2PV0A 4D3ZA 4HO1X 2ZYRA 4BUJA 3E61A 2VP9A 4GPEA 4DA6A 1DAPA 5IXSA 5JCXA 1VSBA 1WRBA 3FMGA 2UZAA 2RK6A 1EFTA 5HK8A 2NSLA 4PLHA 2PSFA 3ZIDA 5JTUA 2VAXA 3K53A 1T8UA 2W48A 5GIOE 5IAJA 2G4LA 2EKBA 3JQCA 2H59A 2YYZA 5IFLA 2YWBA 4RTMA 5B57C 1OQAA 3KXIA 1CP2A 2Q21A 2NZYA 4ATNA 2QRQA 4I81A 2CJWB 3SC2A 3CIOA 5EE9A 1TMGE 2QG6A 3C3AA 5LZ4A 4MW9A 3GLFB 1X94A 3MAGA 3L4SO 1CD5A 1C9KA 3WWCA 5H8WA 3NMUF 3F4KA 3FPHA 3ML1A 3OQPA 4NENA 1V5FA 3T9EA 3L79A 2H1OA 1U1IA 2VATA 1U0HC 3U39A 3FCUB 2VK4A 3OHSX 1ZK4A 4WTOA 3ZZTA 1IN5A 2IQ5A 4LKRA 5JFOA 1DOZA 2FJUA 4V0QA 1W19A 1SOAA 2BD0A 3Q3CA 4J94A 4I14A 2EU8A 1T43A 2ATIA 4FFBA 4M99A 1L3BA 3EG5A 3ZHYA 2C0CA 5I47A 16PKA 3DMHA 2HHAA 3TOSA 3VTZA 1TD1A 4QUAA 3Q9SA 2R3SA 4GNKA 3SC6A 5LP6F 2OGWA 5HUJA 3TRFA 3TW8A 5KWEA 1P9LA 2EV9A 1RXSA 1H6DA 2BM9A 2PEYA 4MEJA 3W9SA 5BY2A 4CVNA 2TECE 4FI3C 4JI4B 1CR1A 1XZFA 1E96A 1XL1A 3CU5A 3GJ3A 4JLPA 3Q9LA 4QUKA 3LRPA 5CW1A 3BN3A 3UHJA 4CLRB 1CNFA 5DHSA 3B70A 1HE4A 4EY4A 1VZ2A 4CXMA 1VHQA 1YZQA 1XQ1A 4QQ8A 3WRWA 3BCSA 3WK6A 2REOA 1VKZA 4DVJA 3RF6A 3QYJA 4WEOA 3F2VA 1XEXA 4B3MB 2XUFA 3SNHA 1JFVA 1THMA 3CLKA 4FHZA 4NNPA 4DBVO 5KPDA 4BCDA 1F12A 3B3FA 1JR3D 4C06A 4P4TA 4WXPA 4CT4B 4DV7B 2FG6C 2Q5HA 3GCGA 1LA2A 2KBEA 4TLBA 3WBKA 3B51X 3U09A 2JJYA 4RD1A 3ZDXB 3VPFA 2ZRPA 3EYWA 4DLUA 1E1YA 1FX0B 3U80A 3FBWA 1KZ4A 1FS4A 1RJWA 1Z6YA 1KYWA 2BFNA 2UZ3A 2O2CA 3QVMA 4QU0A 3CJTA 1PK8A 2CV2A 3KYCA 1F0KA 1YNOA 4IXNA 4WBSA 2QV0A 3MWLA 5C7LO 2VJOA 3HZRA 5IHPA 5K0TA 1J06A 4UHBA 5FPHA 4AKTA 3PF8A 1C3EA 4JA2A 1K63A 2IW1A 4XVUA 1CHDA 5COAA 5ESWA 1QM5A 1C3JA 1QAMA 3V9AA 3AI3A 1MORA 3QUSA 3VYTB 2J6CA 1IBCA 4UEJA 2AXEA 5EP3A 4IX1A 4Q1CA 4V0KA 4Q4CA 1RHMA 2CXQA 3TBFA 2X3YA 4PONA 4QJ3A 3EIEA 4OQYA 1Y82A 1LLQA 1OVMA 2XQKA 3DMFA 1JQDA 3DNPA 3RUPA 5JU6A 4H1UA 4PSAA 1H9CA 3MT7A 5AW7A 3THYB 3ZOKA 1Y3IA 2MSLA 2E9SA 2J9RA 1SUCA 3S2FA 1BXZA 3C8UA 4B45A 4KSCA 1TJ5A 2FSIA 1R1DA 1P91A 3D8SA 1F3LA 5CDTA 4LMBA 4OQFA 2PM8A 4CEHA 1Q7TA 1W59A 4HGZA 4L07A 4CI9A 4KIUA 3T0FA 4B2PA 2AFVA 1K97A 2OZLB 3HB5X 5T4BA 3MCTA 4D6XA 1DBIA 2WF6A 4OHMA 3GY0A 1Z8HA 2IYZA 3A9TA 3MA0A 4KWIA 3R9XA 3KQNA 2ZYUX 3EWNA 2YHIA 3CVWA 1U1FA 3C3EA 3GUUA 3OLZA 3JQ9A 3QXHA 4L9SA 4YFYA 3PXCX 3SOZA 5ADUS 4X92A 4GM1A 1IWOA 4C1BA 3OOEA 4EYQA 1BN7A 3O8OA 3GOQA 4UU7A 4BWGA 1X80B 3HO6A 1OBFO 4BVGA 2KX7A 3QVTA 4JL5A 4X84A 5AT1A 4RV9A 4DKXA 2OBXA 1Y1RA 2AG0A 2VLBA 4LV5B 4EG1A 1N7GA 3CN9A 1KVRA 1T1IA 4K9QA 4MGEA 5JBQA 2CL0X 2NXNA 3CN7A 1A76A 1N3BA 4XD7D 2B1RA 5F2NA 2W6MA 3S2EA 3T5MA 4LRTB 4MPTA 5FI1B 5FOQA 1J9GA 1ODKA 3T35A 1UK6A 2IYEA 3NBKA 1OJ7A 1AK9A 5M29A 2PUJA 3G9ZA 4XWOA 4EYKA 4YRIA 5CDSA 1NKVA 1OIVA 1BYUA 3PQEA 3SBEA 3EDYA 1KP9A 2G0AA 4LRUA 1P4RA 4BLRA 4WY2A 4EGJA 2BHRA 4KN8A 1L5MA 4F60A 4YAFA 4L9WA 3VA7A 3OTOB 4AVYA 1LVUA 3IVGA 2WVAA 4OM8A 2EYQA 3JQ6A 1KHTA 5EERA 3NBMA 2C9BA 4C30A 2P9BA 1Q0TA 1BGWA 1P4HA 3CF4G 1YFLA 1SXGA 3NFRA 4PXAA 1RRFA 1R27A 3AMVA 1RPTA 4Q1AA 4EF4A 1BTOA 3FWNA 2YMLA 4YMWA 1Q19A 5ILGA 2F64A 2MDTA 3DOFA 3PEVA 2HBRA 4G0PA 4KQKA 1REQB 1FVOA 1XEFA 2I7TA 4RH0A 3THXA 2ARKA 4IJQA 5BRJA 2I9PA 1XNGA 1XYVA 4RM3A 4AKGA 4UBMA 3BKWA 3I1JA 2IYPA 1VMKA 1DOHA 4PZ9A 3TAXA 2ZIWB 4WWHA 5B5SA 1ORDA 2W22A 1CZHA 2G0TA 1C0KA 3DO6A 3TLGB 5GZ1A 1SCJA 1XZEA 1TQDA 4N40A 1QSGA 2BF4A 4G41A 4NZNA 3PGMA 3R7SA 1QYVA 1FXUA 2YXPX 4GOLD 1VL6A 1Z4MA 4QPZA 1PZXA 5EUMA 4FGJA 1RWWA 3FYSA 3GMTA 3RE1A 4JYMA 4UUMA 4QL3A 2FMFA 2I80A 4ZU1X 5SICE 1HT2E 4XQ0A 5JAOA 3NVDA 4FCCA 1WSWA 3OZIA 4E21A 3DULA 4H4EA 4L8LA 1EM6A 2NO0A 1E2EA 3EXHA 2HN9A 1YWGO 2VJBA 1G2IA 3IXLA 3F97A 4FB5A 3OOHA 3W05A 3JVIA 2GF2A 2OAEA 3GLGE 2PLNA 2C5FA 4E46A 1Z18A 4EZIA 1XSEA 2P6RA 5CCDA 3OZRA 4ZVRA 1WDWB 3V7FA 3V8RA 3L2OB 3DNMA 3VR3D 3FZEA 4JA0A 5BSVA 3D4LA 1SURA 4II3A 3C5HA 3IUQA 2WKQA 4RXTA 5BR4A 3NUQA 2ZYTX 5I7EA 1YDWA 5F4ZA 4LECA 5A3SA 4B46A 3RVOA 4M49A 1HUQA 1I6KA 3IVCA 3KQQA 3MUFA 2A58A 2FZKA 1QO9A 4KN9S 1EIZA 1TO1E 3DWEX 1V8OA 1OX4B 3E81A 4MV0A 3S70A 1G2OA 1RJFA 2DULA 3VQTA 3M2TA 2GCEA 1UK7A 2YQ4A 3D0QA 3DE1X 1YNSA 1GQFA 1X1QA 1VYTA 4M2LA 2QJFA 4OCZA 3PD0A 3MYYA 3QLUA 1QYIA 3QNMA 4K28A 4R0MA 5KQMA 5F52A 2XRZA 2FUNB 3FR7A 1MR3F 1YB6A 4IVRA 4YLGA 2RB4A 5BWNA 1F3OA 1QDEA 2JAPA 3RYHA 1PZMA 2J3LA 4P3YA 4DV6B 1YR8A 1UJ4A 2FRDA 4N7JA 1B6TA 2V54A 1R12A 1MT0A 2XDWA 3GL9A 4FS3A 4RD3A 1M66A 2D7CA 2JHGA 2VQEB 4YRRA 1YI1A 3TYXA 4OQPA 5KU7A 1F1BA 1T3ZA 1I3NA 1T9BA 1U0GA 4QKQA 3EJ6A 2SCUA 4XPZA 1XMOB 1FJGB 5FA8A 3NKVA 5C4GB 4KXWA 3ZY3A 4P32A 3QELA 4BMDA 4IKOA 3E58A 1X0VA 2XYRA 3OTWA 5TGTA 1WV1A 4CM9A 1NXQA 5B6PA 1EE9A 1A8PA 1EGHA 1RJ9B 2ZTMA 1YMUA 2ZREA 1M9NA 4K9KA 4ZHQB 5K8CA 4C2UA 1K0FA 9LDTA 5FUYA 1WVMA 3ZV5A 1ZISA 1LNZA 1P1IA 1BVRA 4MI1A 4EJSC 1NRJB 4OHBA 4KFCA 3HKEA 3A04A 3BXOA 3LFTA 3L6BA 9GPBA 3RFCA 3E3LA 4HGQA 3E4DA 5A2QA 1EWQA 1PS8A 1EM8A 2ES4A 1FC0A 4D9EA 3BXPA 3FVQA 3L7IA 3OQIB 4BO4A 4L1KA 3VX4A 3I9KA 1W1UA 3F9IA 3UJ7A 4AUKA 1Z9BA 2WYHA 3AEKB 4XARA 3RC2A 1KWKA 3ADDA 1L9KA 3QV2A 2VI5A 2Q4BA 1WUJS 1LRKA 5T4HA 4WLUA 1B93A 3F5MA 2HNBA 1HNZB 4XIIA 1E1MA 1TM1E 5I51A 1CQPA 3IJPA 3O84A 4MS3B 3VR2D 1T2VA 3V9PA 4DJJA 4DMFA 1Y9ZA 2ILVA 5BVHB 4YREA 5DB4A 5CEEA 2FEKA 3OZFA 4REMA 1IM5A 3QUQA 3HSKA 1W0KA 5HMLA 2ZKLA 3GFQA 3D1JA 2XMGA 7REQB 1ORWA 1PJQA 1QHGA 1TA0A 1V7QA 1J8YF 2YDXA 3EEIA 4MA0A 4L22A 1NQOA 3DOOA 3Q6NA 3TUJC 4E5YA 1NZFA 3EZGA 3V3TA 2G4CA 2G8NA 3EAGA 1ZXXA 3NTLA 3UJ9A 2QX6A 4QASA 4MB0A 4D92A 1WPXA 5IKEA 1I6WA 3C3PA 1M8JA 1OAOC 4MDHA 4BUCA 1O6BA 1IBLB 5KHAA 1DQSA 4FYKA 4AS3A 2VHZA 5DGCA 1SPXA 1ULBA 1O94C 2JARA 3A3YA 4MSUA 5DYGA 2BMEA 3DS8A 3M5DA 3GRUA 4HDCA 3KTDA 3VR3A 3WJ1A 3W4IA 2I4OA 1E2UA 2QN6A 1EFHA 5GOTA 2ERXA 1NVFA 3DMNA 3KQUA 2FX3A 3I1FA 1RLTA 2D4AA 1XRPA 1JLLA 2IUFA 2JIDA 1DO8A 1F20A 3AEUB 1PQWA 2XOKA 3I72A 3KOUA 1KO4A 3QXXA 4RH1A 4EY7A 4V1CB 3WA7A 1UBCA 1KI7A 3T61A 2A1TS 1NYLA 3FGZA 5J59A 2PBRA 4LRYA 4G2NA 5K8VA 4FTWA 1GV1A 2OV8A 3PXEA 2BKAA 2XV1A 3AF4A 3ISVA 1AKTA 2OT3B 3GA7A 4FYJA 2A0XA 1TQHA 1UBOS 2PMFA 4YFVA 5DBHX 3RSSA 1NQWA 5CURA 4BFWA 4IQGA 4D79A 2RIPA 2VRBA 1BQEA 1YR6A 3G2HA 2JLUA 4B1FA 3IXQA 3O94A 3A1SA 1GT6A 1K9SA 3EVNA 4BNZA 2XKKA 4KDFA 4BKQA 3IUMA 4B6EA 4D5GA 3NBQA 5JASA 2CMKA 4C20A 1O03A 5KAPA 3FM9A 4AJ4A 5CDYA 2RHTA 4N6OA 5MN5A 3BH7A 4QYWA 1M2EA 4ZVUA 4NK4A 1OLUA 4HMPA 4RNDB 3WGTA 1KBOA 2ZS8A 3BQMB 3KC2A 5B1HA 3EFEA 3JAWB 3B12A 3ZDRA 4KZPA 1G9TA 4QO8A 4LFCB 4DNQA 4CQLB 1JFLA 5EHIA 3EMBA 1BC5A 2B5OA 4R1OA 4WN3A 1BS2A 2I6TA 2VRWA 2MYPA 1NMQA 1SNYA 4TSKA 2ZM5A 2P3QA 3O75A 5E6UA 3GQVA 5EJ4A 1S02A 4NDNE 4BGVA 1W73A 1Y63A 3SSAA 4TMWA 1HZJA 4JLUA 2KHZA 2O0MA 2ORIA 2YWJA 3HCOA 4L5AA 4F6RB 5BOSA 2Q28A 3VSAA 4HFJA 2WD8A 3RFTA 1C4KA 3R5KA 1WX1A 4R2WA 2C84A 3RSZA 2ENWA 1OZHA 2MSEB 2DSNA 5BSRA 2R66A 4PXSA 2PAAA 1TNDA 3H3FA 4PN7A 1YZFA 3EFBA 3MLEA 3LDAA 4MW1A 4R6XA 1CUHA 3BK7A 5B3LA 1OXXK 4OQ4A 2OBYA 1SHUX 1O89A 4IDFA 3O3MB 5FCDA 2JL1A 3ZWYA 1JQJC 1CY1A 3IQHX 1D4OA 2ODAA 5B53A 3I6BA 1KJZA 2JG3A 1XGKA 4D4MA 4KNVA 1F0NA 2A94A 1VP3A 2PMDA 4G9GA 4KR9A 1M2VA 1X38A 4BB9A 3QKUA 4RMHA 2YQZA 3TRDA 4DPKA 4OHUA 1P5JA 1C7EA 2B4AA 2FUEA 3A3OA 1O08A 5EZYF 1ZAYA 1YA4A 1RRMA 3AERB 8GPBA 4JH0A 2FSSA 4BZXA 5GIPE 3LC7O 4QICA 4MQLA 1BA2A 2H2GA 1J0EA 2BLLA 3C3DA 3WHIA 3AI1A 3L4JA 5I8WA 2UVQA 1A9PA 1SUBA 1Q1GA 4C0JA 4PAOA 4AYXA 1DEKA 1KIFA 4E5UA 4DUYB 2IYSA 4EEXA 3S55A 1DJPA 3NATA 5FJIA 1I2AA 2J4DA 4Z0PA 3OIDA 1GGEA 3SZUA 3SDZA 4B3JA 1Y6FA 1E2BA 5DCWA 4B3HA 1K4YA 3CG0A 4MZXA 2A1IA 2GCIA 3S3TA 2Z6QA 1K92A 4MTLA 4M1SA 1ODTC 2EEZA 3MBKA 3UXEA 1JKJA 3S0JA 1R00A 4AZ3B 4EVIA 4DR1B 1TC1A 3FPJA 2AFIE 2DFVA 1AQJA 4LQLA 5EUBA 3QFCA 3NHWA 4RA6A 4ZVNA 1YB2A 3RU2A 1AHPA 3UGQA 1ULAA 1ZESA 1DKLA 1KERA 1RLIA 2XSZD 3L0CA 5FOXA 4BLSA 2H1SA 3JQ7B 1ZD9A 2I34A 3BGVA 3IPXA 4MRMB 4TXJA 5HKBA 5AFSA 2ZJ5A 4H60A 4ZV9A 4B71A 5CB0A 1MIOA 3OEEA 1RKXA 5CA0F 1JT9A 3AOEA 2R1VB 3K9GA 2QN2A 5TSDA 1H2WA 3WC4A 4V3BA 3NTQA 1J2YA 1RPZA 3E82A 2B1IA 2IBSA 1O3YA 4Q39A 4IV0A 4WK0B 5D3MB 4ZDIA 1AHHA 4LF8B 1NLZA 3VNQA 4NBNA 1T2DA 5CTAA 4CMHA 4GYJA 4D3DA 1I1OA 3RBAA 4D0SA 1Q0RA 5H5JA 4LKOA 3DZDA 4AXXA 3GGOA 2IT1A 4F72A 1DU4A 4ECAA 3TMYA 3U3ZA 5I4IA 5K8IA 1JEQA 2A6PA 3R5XA 3PGA1 5EXXA 1Q1QA 5LN1A 3EBLA 1PZFA 3NPMA 3LX6A 2Y4NA 4Q3LA 3I8XA 3EUFA 1J24A 2P7HA 2IZ5A 4TKUA 3WLQA 4FOLA 4I5DA 4BYGA 4I5EA 4YHHB 3OICA 4LXTA 2OXIA 1E3JA 3CNHA 5AVUA 4QJ4A 4G8DA 1AV7A 1JT2A 2M98A 4KREA 3GRCA 1GL6A 2BTQB 2P9GA 5F3DA 2AQIA 1SKQA 4NFHA 4DR5B 5B7GA 2I7DA 2PKQP 1T9ZA 3KCNA 1YZNA 4I6GA 2ANBA 1Z6ZA 2DWUA 2IOFK 2OOKA 2QSZA 3CR8A 2EKPA 4ZAXA 4RUKA 1DFIA 4R2LA 4N6NA 1SXJA 2C42A 2L82A 2W4IA 3FPSA 3KV1A 3LQKA 4FB4A 2WSLA 1L3IA 4TS9A 4HC4A 3LSTA 2RCNA 2CXOA 1WULS 1AF4A 3IP6A 5A7HA 5ALHA 2JCBA 1DKRA 4C6TA 2LXNA 1JXMA 1K5HA 3DLBA 1FMTA 1UC4B 1Z4QA 1XN4A 3CKKA 3KZVA 3ND9A 4LWQA 1KDVA 3AINA 1L5KA 5FTMA 1IBKB 3EDCA 3RIHA 3TBHA 4HNVA 2CV0A 3I53A 1TCBA 4I4TF 1ENOA 5BQ5A 2PD3A 3ZGVA 4EJFA 4ZI3A 4BIIA 1GITA 3IJRA 4EMTA 4NL4H 1PUJA 4OATA 3U0VA 2PSHA 1SBQA 3OI7A 2O0KA 3TX2A 1E92A 3FSRA 4EI9A 3ZV3A 2E48A 2IUEA 2PEZA 4MHSA 4ZPXA 3OM0A 4EBFA 1DRUA 2IUTA 1V8PA 2GVDC 2FPPA 3B2EA 3G5LA 3ZBQA 1V48A 4DEXA 1G20E 1L5HB 3IIJA 4LZLA 4K03A 4CL3A 3V1NA 1JH8A 1Y3CE 4LX0A 3NT5A 2H3HA 3WL8A 1CJBA 1HRKA 4YUVA 3QOFA 4LQ4A 2BMVA 1ZIYA 3N0RA 2JH8A 3L04A 3QRWA 4R9NA 1TU0A 1L5YA 3HG7A 1WPGA 1NE7A 3K9HA 4OHKA 4JSYA 4PNEA 4IDCA 2D0DA 2EX1A 3HSSA 4I08A 2AI3A 4PZPA 1DT3A 4HAYA 4EB3A 2PKWA 3DE4X 4QU9A 3PE4A 3T3GA 5H3CA 4UBLA 3WGGA 5L7YA 5EIXA 2CV1A 4CUZA 5A3RA 1WNFA 2IDMA 4ZEXA 3EG9A 4YRGA 2CHUA 1I4EB 4YAEA 1ADCA 1B0PA 1LBHA 5CDFA 2H0RA 1CB0A 1DLJA 2Z3WA 4HH3C 4S1TA 1HQDA 3VTAA 3HYLA 1IOVA 4YBZA 3VNBA 3EGIA 4Y7DA 1C81A 4DSAA 2CNNA 3MMXA 1OLSA 2B4KA 4ZFNA 1UAAA 1FW8A 2XXBA 4E14A 1ZJJA 4BHTA 2B4RO 1PVOA 1FRFS 1WVIA 4X64B 4DCUA 4CKZA 2ZJ1A 3ESCA 1M8PA 5JAIA 3CR7A 3EOZA 3JV7A 4DYDA 2UXBB 2ILTA 1I7PA 4LXQA 1PSZA 4US1R 1KMCA 1SUFA 2EFCB 2FQQA 4IJ6A 2OFPA 3ONNA 3LPLA 2Q6IA 1QLWA 1FFXB 1QFMA 1UINA 1CRLA 3IP5A 4FFPA 4GKVA 2XZOA 2Q8NA 5KQSA 1ZIPA 3CZQA 4LUCA 3L7DA 1P74A 1W4ZA 5M5BA 2IUYA 2OHOA 3YASA 2ZDHA 2Y1FA 3UMVA 4PG8A 2NYAA 2ZB4A 4WI1A 3NZEA 1S1MA 4LGMA 4OGLA 3PQ4A 5SYMA 5JDCA 3AW8A 1CWUA 5LNK1 1BMDA 3JYPA 1J90A 3JALA 5L45A 4NBVA 4YY3B 4IEIA 2OD7A 1YE5A 1U5BB 4P8RA 3DO5A 4OFBA 4X1IB 4DUPA 1GZ5A 5BT9A 1EX1A 3AF5A 3TQQA 1SU4A 1D0IA 3UWSA 2C7GA 2QAGB 2O2YA 2AE2A 1QHNA 1RAGA 5C3UA 2XA1A 2C4VA 2GEKA 4D99A 4GSKA 3P52A 4J16A 4UQLA 4PANA 5IYZF 1K8RA 5EHZA 1I6MA 2VDPB 3SYNA 3R7DA 3V34A 3MMZA 2PNFA 3FRHA 4M9XA 4E70A 4ETWA 3R5HA 2WNSA 2FZGA 2I3BA 5L7WA 2RE8A 4V0ME 4LISA 3K94A 3N2YA 1ZOPA 1X39A 2HQSA 1JQKA 1T4MA 1L4FA 2Q6KA 3LHIA 4CR8A 5F9FA 4RZIA 1MENA 4ALNA 2YJNA 3AUXA 3HDHA 3OEHD 2XWJI 4GDMA 2HSGA 4J7AA 2HO5A 3C7CB 4L85A 1QONA 4TTJA 4EW3A 2H1VA 5GY7A 1NBEA 1B2RA 1WCWA 2MYTA 2WNIA 2PUHA 3IKTA 2Y0DA 4E4TA 5JNVA 3BCUA 1H8EA 4XDHA 2AK3A 3NIWA 3CQ9A 4CCAA 4WERA 3A6KA 3BD7A 3U61B 1RBMA 5BVGA 2A9PA 4B87A 1TUGA 4QECA 3PTZA 1XJ0A 1A9QA 1YB1A 3DDNA 3OX4A 4WKBA 3UANA 5BNIA 3FI9A 1PS0A 1V11B 5IARA 1BXGB 4BNIA 1NMZA 5L8VA 2IPAB 4FEAA 5EXDA 1V1RB 4I4IA 2QLTA 1NFRA 4S0ZA 1K89A 1FS6A 2R1TA 2FPSA 1CK4A 1KJWA 3DOUA 3HJRA 2BFAA 1QMPA 4YVFA 5LPNA 2PE5A 1FNCA 2XNSA 1UP7A 3MTBA 4M1ZA 5EPEA 2HA2A 2H48A 1I24A 1SZPA 1TCCA 1X9IA 2EHJA 2H54A 2IYUA 2B8WA 4WPGA 5NULA 1NNEA 4JBWA 1WTAA 4PSDA 4RLFA 5AM4A 1U7TA 4M1QA 4E94A 1ODIA 2RCYA 3A9RA 2V9ZA 3VOAA 2GZSA 3PA8A 4M83A 1ENZA 1QQ7A 2IDJA 4BFUA 3ZTWA 1V3UA 1FFWA 3T4UA 5HCUA 1Y6RA 5AW0A 2Q1XA 1JHVA 3CKLA 4UVHA 4RVHA 3SZGA 1NXSA 4A10A 1N4AA 3FIUA 4UOEA 5IZCA 3AVWA 4K9LA 2VP2A 1M6VB 3K0SA 5D87A 3DE2X 4C7OB 1OH5A 4N01A 2Z9BA 5JNLA 1P5FA 4FONA 1DJNA 1N78A 1WKBA 2R44A 4O4IB 1Z15A 4I99A 4K9PA 4V2UA 3C5WP 4O3MA 4B6RA 3EBPA 1HDGO 5B7QA 4YAOA 1EFKA 3V4OA 1PJAA 3WGIA 2MR6A 2FH5B 1CRWG 5EP2A 1JU4A 4OV6B 1JLSA 1TT7A 2PO5A 5DK4A 4DDHA 2VF7A 3FNQA 5DMHA 4CKCB 4B74A 2BHLA 4QU8A 4QELA 821PA 3TW0A 2VF2A 1K6XA 1WXGA 3HCAA 1N0VC 3HN7A 2ZE8A 3K9WA 2HLDA 3NHUA 1AKUA 4G23A 1ADJA 4R8KA 5JC8A 5FOTA 1V5IA 1UFOA 2NSJA 3CM0A 5H82A 5IDVA 2C7BA 2KYRA 3I76A 4K6GA 4D26A 3UFBA 1ABFA 1TUIA 3BRWA 3VNAA 1IZ9A 2JFBA 3GIWA 4RHTA 2IEIA 3P96A 4I8DA 3T0IA 2BHSA 1NYRA 2YVQA 4FJ2A 2D2FA 1QTQA 3HJCA 4PHFA 2VYFA 1AA9A 2V9PA 3D8NA 3GCWA 2WWIA 2FWAA 4WBXC 4WSOA 5LU9A 3AM1A 4HH4A 1Y48E 2YX1A 2RGXA 5ISMA 5B1SA 3GNQA 3KSBC 3PRHA 4BFLA 1Z2NX 2ID8A 3PFFA 3RJZA 2RONA 2R4TA 4TL9A 5DRTA 1ZRHA 5B58C 1G6Q1 1OX6A 1WMAA 5CHEA 1ZVJA 2YJGA 4WOPA 2O2GA 4J0FA 4IILA 2WMOB 3S1AB 1JEEA 1U2TA 1ESNA 1E1DA 2P27A 3DO8A 1KR5A 2VPWA 5CPFA 1ND6A 1ZMRA 1A1SA 3FIJA 4G0ZA 5AK4A 1WL8A 2IDZA 1GRRA 1KQ3A 1NF2A 3EDMA 3KJHA 3JRXA 2VYCA 2XWSA 4MB6A 4EYEA 5EFZA 1W9HA 4PCAA 5HW0A 1GCGA 5JBIA 2HDOA 3C48A 5J2UF 1I30A 2CBGA 3H9QA 3RR2A 1P72A 5IJWA 2YUIA 1NR5A 4LMAA 4KPUA 4CR7A 4FHCA 1QF6A 4LWPA 4QOGA 4ZTZB 5MFPA 4EG0A 1HV8A 1IHPA 3OOYA 3I9V1 5COBA 4PPFA 1E2KA 1SVNA 2PWBA 1D03A 3I5AA 3V46A 5EXTA 4Q4JB 1CUIA 1O95D 2GEDA 1A4IA 4QDKA 3HFJA 1UM8A 4UTZA 5J4YA 2UYGA 4H08A 3CT6A 3MOGA 2VSQA 3GZJA 5F51A 3GWGA 5JECA 5KX5F 4YDRA 3IDSA 3RABA 2TRSB 2AJBA 5ALUA 2EP5A 4EB6A 3UJAA 4YCSA 3ED5A 1FYDA 2C2KA 1B8VA 1QTIA 2QMZA 4OJKA 1KFEB 5FTWA 2CEAA 3S6JA 2WHPB 4RF3A 2BFCB 2FW1A 3HK2A 3VNRA 4J4BA 4LJ4A 3OX2A 2QN7A 5AHOA 1FPMA 4JI8B 2XDAA 3H2BA 2Q49A 3E9RA 4K26A 4ER3A 5JBNA 1FSPA 2FQXA 4GGOA 1GN9A 1G7CA 3DEZA 4FSXA 5LMNB 5DBEX 3D6HA 5IAKA 2ZYDA 2XKAA 4TV8A 3IQIX 1RXIA 4P93A 4ER7A 4XIFA 5BSGA 2GK6A 3EXEB 1TQ8A 3P71T 4RABA 4BP8A 1PI3A 3FFWA 5AKHA 1BXKA 2WUEA 3P9RA 2R68A 1PWXA 3KQOA 4FKZA 1Z7YA 4PHHA 5DLPA 1L5RA 4MR7A 4YUXA 3TSYA 5EZSA 1GU1A 3NHZA 1B14A 1UEIA 2M9MA 3GD5A 3PYLA 3IV7A 3REQB 1O0SA 3F7OA 3U3JA 4ID9A 3HXPA 3HDGA 2KM1A 5KQPA 1I8TA 4TVOA 4EMBA 4WJLA 5FAXA 1FF9A 5LWQA 3L7OA 3GA5A 3WG9A 5DGDA 3MQ4A 3LPMA 1GPDG 5LBTA 3EWSA 4LMPA 2V65A 3OSUA 4DUZB 1F4VA 2HFJA 2Y8EA 4R16A 4LY6A 4LV6A 1N5OX 3H2IA 2GASA 3HLYA 3H1FA 3MOSA 1PR2A 3H8JA 4KE9A 4M22A 5K0NA 4CLXA 5IASA 4ZT5A 1RC8A 4QULA 4DDKA 4FGZA 2DPXA 3F8TA 3LT4A 1UJMA 3URKA 1GPBA 4XSVA 2A1UA 1UT6A 3NV7A 3ZDYB 4ZDJA 1JH9A 5C1PA 3GQBB 2JPDA 5DKFA 4DQXA 2FMIA 1LTQA 2FZLA 2CL7X 2PZ8A 5DEOA 4EL5A 1BU8A 1TZCA 5LD2B 2IOFA 2CLEB 3DAPA 3PT5A 4YACA 1HOTA 4P34A 4RA9B 5CA1F 3WX0A 3HUDA 1K7EB 3D2CA 3K6SA 1PKEA 1YK1A 3UTDA 3GGCA 4FP9A 2NU8B 2CD9A 2OCLA 4WN9B 2XQIA 3FNIA 5JANA 2BH2A 4MUXA 4YO8A 2V59A 1E5TA 1JN0A 1ZUHA 2EJBA 3LL4A 2JI6A 1VFPA 4YV1A 1GPJA 2BELA 4H2DA 1MB9A 4MMZB 4RANA 4CKWB 4HB0A