4YCBA

Structure of a single tryptophan mutant of acetobacter aceti pure
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
159
structure length
159
Chain Sequence
APVVGIIMGSQSDFETMRHADALLTELEIPHETLIVSAHRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETFRALQTASVPNSPIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a single tryptophan mutant of Acetobacter aceti PurE
rcsb
source organism Acetobacter aceti 1023
molecule tags Isomerase
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
total genus 53
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 2015-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 4ycbA00
2FWAA 2FWJA 4YCJA 4YCCA 2H31A 2NSHA 4ZJYA 3KUUA 2FW7A 4GRDA 2FW1A 5CLHA 2FW8A 2FWIA 3OOWA 5C5DA 5CLFA 1QCZA 1U11A 5CLIA 4YCDA 5CTJA 4Z7JA 3OPQA 4JA0A 5CLGA 3RGGA 5BOSB 1O4VA 3TRHA 2FWPA 2FW9A 3RG8A 5CVTA 4B4KA 2FW6A 2FWBA 4AY3A 5BORA 4YCBA 2NSLA 2YWXA 3LP6A 1D7AA 4ZK2A 1XMPA 3ORSA 2NSJA 5BOSA 4ZMBA 5CLJA 4ZC8A 2ATEA 4AY4A
chains in the Genus database with same CATH superfamily
5ALTA 1DCMA 5A9TA 1T8RA 4FCTA 4UTPA 4MUNA 1GTSA 1P2GA 1I9GA 2WKPA 4JC0A 3CUKA 2PGOA 5JXWA 1IY0A 4IHAA 4DB2A 1FQOA 5DM0A 2H92A 1Y1KE 4F3CA 2LTAA 5KWSA 1IQUA 2R7NA 1QX3A 4Q3DA 2JIZD 3THRA 3G8YA 1XNRB 1MQSA 2BELA 2B3DA 5F7OA 5LQKA 2PZEA 4Y2TA 2YXLA 1SQSA 2I1WA 5EJ2A 1CUCA 4PPQA 8ATCA 1RMYA 1NZJA 3NNSA 4Z4QA 2WUWE 1JILA 2ZSFA 3KU1A 4H1HA 2O7VA 1CUUA 3AFMA 5JJCA 1MC1A 3S5UA 3JARB 3LY7A 4UDOA 4J0QA 2SCUB 1AQNA 3BGWA 5DHSA 5JDCA 1YS7A 1AKQA 2ONJA 4PPGA 4CIXA 2B92A 2R8XA 4DWVA 3VR3D 3WKDA 1WNFA 2D0OB 1QHHA 5DT9A 2WFAA 3P52A 4R2WA 5CM2Z 4FGWA 3VNBA 2TS1A 1WVIA 4QLOA 4KV7A 3OD1A 2HF8A 4JGIA 1HLGA 3BQNB 4TXMA 1VRWA 2DTXA 2OY0A 4Q19A 5E2BA 3RT9A 1CUSA 3WP0A 4B48A 1GZ7A 3Q88A 5FWXA 4CKYA 1QPGA 2GFIA 2RBEA 2ZBFA 1B0AA 4DJDC 4E0BA 2XYPA 2JHCA 4FHFA 2RHJA 5JQGB 1L5NA 3OZFA 2DKNA 3VA7A 4P4TA 4BNTA 2G0NA 3EQ2A 3WYBA 3G8BA 3H2KA 4OXYA 2X4IA 4EUFA 1PWXA 2ZT8A 1CNFA 4L27A 4NVRA 1AB6A 1ZH6A 2MINA 2MSKA 3ZPXA 3IV6A 1ZNXA 3D4IA 1H4SA 4CLOA 2W2QA 3RARA 2HLHA 2BEWB 1H2YA 4MUBA 3SHOA 1TT5A 4JSTA 1GU7A 3WISA 3WYEA 2ZCJA 1ST2A 2BZSA 4JUDX 3RCBA 5C31A 3WZLA 4YP0A 3RYFB 5AQEA 1SUIA 3TINA 3AUFA 2IF2A 4MV0A 4C7MA 4IIEA 4C0SA 1KO4A 5HS4A 3DLBA 3U40A 4NTZA 3RHSA 5BV7A 3KQVA 2FPGA 2O8CA 2VDPB 4Y9RA 4E09A 2B61A 1ZJ4A 3AF3A 4K1XA 1IXYA 1YRQA 1CETA 3DYVA 1ISIA 2C82A 4BQOA 5LR6A 1AURA 1UZAA 1BX0A 2YWJA 4M98A 4XIJA 2D2IA 4ZJZA 4CL2A 1I13A 1K0FA 1RQPA 2G04A 2DFVA 2WU3A 3LYLA 4H15A 3V48A 3J81k 5BN1A 2ZSKA 2VJLA 3QF4B 3RRXA 5C3MA 3QFRA 1DTWA 2BFDB 4CEIB 2ZJ1A 1NUHA 4X8MA 3KYCA 1BJTA 4MRVA 3U1BA 4WNAB 5KNCD 2ZK7A 2QAGB 3IEIA 4HG2A 3MWJA 3QXGA 4RK6A 4YRJA 1IPEA 3WMGA 4DLXA 2PGXA 1NC3A 3WRYA 2RKOA 3IESA 5L4LA 3D02A 1OWNA 1C14A 4HZIA 4C08A 5HX7A 4B7UA 1NVXQ 3Q8XB 2FPOA 2BEVA 3QPUA 3A1EA 4QNMA 3WAGA 5IYZA 2ZRFA 3Q72A 2VBFA 5CD1A 1RCUA 3AFHA 3DKKA 5D3MB 2GF2A 4BRZA 1JLRA 4HVAA 1O95A 5IAEA 3WA6A 1ULUA 1E59A 4M0PA 4Q7JB 1AKRA 1COZA 1XDZA 2F59A 1ADYA 3M8KA 4MV5A 4QXRA 3TLBA 4N47A 2A33A 4A8PA 4CR8A 1DAOA 4QXAA 3ZWKA 3EODA 3CIOA 3R1IA 2WUFA 4BLPA 1L4EA 3T5CA 2DCMA 2QDXA 3B9RA 1WTCA 1QRAA 3IALA 4JU8A 2A78A 4XWGA 3WGHA 2V54A 3PYLA 4TS1A 5IWCA 2G71A 4DLKA 3CW2A 3FPHA 4MGIR 1KY5A 1DU4A 3SQNA 4O1HA 3WYAA 1YGYA 4CLRA 4DV5B 1LU9A 3PDIB 1SXQA 5DRTA 5FTNA 4EGJA 2GRJA 4RPLA 4J7CA 1KK1A 4ME6A 1P91A 2BMVA 1Z75A 5EJ5A 4DE5A 3PGLA 4I5DA 5JEEA 3UJNA 2J48A 2Y71A 4BKQA 5JNTA 1QHNA 3ABIA 1KDVA 1CQJA 3GRVA 1XDGA 3KPYA 2IXEA 2UVPA 2IYAA 1Y9ZA 3X1JA 5A06A 4IDGA 1T0JB 1J25A 3PT9A 1M2JA 1NXTA 3ZDQA 3E1GA 2PD3A 4HFMA 1T5LA 2AFHE 4IO0A 4AJ4A 4AYXA 1U65A 1QWOA 3KOZA 1YE8A 3WL5A 4BBJA 2FCRA 1RHQA 1ODJA 3DAFA 1G3QA 5JVDB 2D1YA 3O1IC 1M5TA 3OCUA 5CVEA 4JYZA 3RSQA 3W1VA 3FSEA 1B15A 3F74A 1PS8A 5C2JB 1WBDA 3Q9SA 2H54A 4Y1RB 1Z0ZA 1PS9A 1T0BA 1V9SA 3ZV4A 3EVEA 5F77A 1EIZA 5JPIA 2R96A 2YW2A 1UP4A 3I83A 4UQOA 2BZ0A 1SUDA 1V2HE 1MO4A 2CEKA 3N9IA 5UKDA 4Z3OA 4I0WB 2IS1A 4QYXA 3IERA 4L08A 3VC2A 2JHGA 3JQ7B 1M10A 2G63A 2XYHA 3GUUA 3JYPA 4LYJA 3VAYA 2IEDA 2A4MA 1QE0A 3HFRA 5A1TA 3D4PA 4UNSA 3VUFA 2R97A 4JA0A 1XPJA 4MAAA 1DV2A 4YXFA 2IYEA 3I12A 5K4GA 1N0VC 1UBNA 2OLJA 4JFAA 2FWBA 4TXHA 3S2YA 3TIFA 5BNZA 3RB8A 2P2NA 2NLOA 2HA7A 3ZKWA 5J4YA 1A88A 2AF4C 2QUAA 2VSOA 2BM9A 4CKEB 4MW4A 4BB9A 3UUWA 1ND6A 4HAWA 1IN4A 3FIJA 1M1XB 1PFWA 1MXFA 3VKGA 4MA5A 1T36A 4ZEVA 4L8VA 3U49A 4GQBA 1EGHA 4Z54A 5EWJA 3R3YA 3A6GA 1G7SA 1E8MA 2FUKA 3IOYA 3KO8A 5AJUA 3U61B 1PCXA 3ZGOA 1FSZA 1RBYA 2FEAA 2VNIA 4IMIB 5C5DA 4XYBA 1U98A 4XH9B 3HDVA 4B31A 2R8RA 2ZT7A 3TL3A 1R5JA 1J8DA 4CCSA 4BFTA 1KRHA 1ZJZA 3DZ8A 3K6KA 1I4TD 4U02A 5F5LA 5FRDA 1TUBB 3HFSA 5E1DA 1CRLA 4J7UA 4XI9A 1ULTA 4EA9A 2HQSA 3UKDA 1AC5A 3UUEA 1P1IA 4URHA 1NVVQ 1CUEA 4XJSA 1DRWA 1RWXA 2PLRA 1TMKA 1C30A 1JFLA 1PZGA 3I9NA 4QOIA 4EHFA 3B6ZA 4FOOA 3UMBA 5JZ9A 2WWFA 5H9WA 2PS3A 3I6QA 5T6BA 3GRFA 1XDWA 2GK3A 1A9OA 1A96A 4FN4A 4BNFA 4M7OA 3USCS 4V0RA 2FSHA 4OQ4A 4YQZA 1B6SA 1PAUA 2FU5C 2ZIEA 3AJ9A 3I0NA 3KVVA 3L7KA 4JWKA 1UP6A 1NGSA 2FW6A 4WZAA 5GJWC 4QZVA 5K5EA 4LRUA 2EJUA 4DIEA 3HKBB 1I4OA 3GJ5A 3K05A 1KOFA 2WYUA 2P9ZA 4NYJQ 3R40A 4IWXA 4PRZA 3MWKA 1JJAA 1E9VA 5ALXA 2AEJA 2XYVA 5AVZA 3BZBA 3QY9A 1FYEA 1USKA 2ZTVA 1LDEA 1NQWA 2BHTA 4QUKA 5DLEA 4CLOB 4YQFA 1THGA 1N2CB 2HCRA 2O7SA 5DHTA 2JRCA 2IP4A 3ZD6A 4CGZA 4OHCA 3AUKA 1QGDA 4G5OA 1P9WA 3RRBA 2HPVA 3Q7TA 1F6WA 2VLIA 3MMZA 3NONA 2NPFA 2OENG 3HCDA 3M4NA 2UKDA 1T1SA 2GEBA 5HOEA 4G07A 3PFKA 2HSGA 4EUNA 2P9QA 4RLSA 3N3BC 2FQYA 2RCNA 2AFIB 2CJWA 3TECE 4QDZA 3IOEA 1VHTA 1M2HA 2CB0A 5G0VA 4ZN6A 3IRVA 2O2CA 5CX1B 5JH7B 2PVCA 1YRHA 4NWIA 3RREA 1ULZA 1N2EA 3B1XA 4EHKA 1A4UA 1NMSA 2CGEA 2H1FA 2IP2A 5F23A 3X2SA 5IHXA 1NP6A 1M2FA 2JASA 4XD7D 3W7VA 5JNLA 1XCBA 2LD4A 3L8HA 4LYEA 4CFSA 4X9XA 2XXAA 3D8RA 3E35A 3LO8A 2OM6A 3FNBA 3GUYA 4D82A 2CL7X 1Z37A 1QK3A 3SFVA 2IZ5A 2JJQA 1LNQA 4KIUA 3JXEA 4KYVA 3SBDA 3L9WA 2NO9A 3FWYA 2QYTA 5HF6A 5KVQA 4PNZA 3MWDB 3VPDA 2VN8A 2JG3A 1AZWA 3H6GA 1QNFA 2HC9A 4RV4A 4B46A 2JLWA 3WZ2A 3HUDA 1MENA 1U0NA 1WSDA 2X3UA 3C2QA 2PR2A 3T41A 2ZUFA 3TG8A 4JI8B 1GPLA 4FE7A 2Z2ZA 2A5JA 3EG9A 4DVJA 2PUEA 4PSKA 5EE9A 2BDUA 4WK6A 2Q7OE 2REXB 2ZDQA 4IMRA 5IZCC 1T4DA 4TZTA 1Y37A 2RC5A 5LLSA 1NW6A 1P1JA 2VJPA 3QXJA 3NCTA 3UH0A 4LMAA 2BV3A 5MFPA 5BN5B 2GASA 2XQIA 1W2WB 4RD6A 5IJXA 1PNVA 1UKEA 2BM8A 3P97A 2KS6A 5KC8A 1KQPA 2XT0A 5LSAA 2ZRAA 4PX2A 4C22A 4O5OA 5A9SB 1ESCA 2IOHA 3TUZC 1UKCA 1ADGA 4ZU3A 2QAIA 4EGAA 1NMZA 1DIAA 3RGGA 1IDN1 2C61A 2X4GA 4CKEA 4KE6A 3C6QA 4P80A 5IARA 4WNCA 4MHTA 2WQ6A 2OCXA 4FTWA 4ZOLA 3L3BA 5TE9A 1VYHA 5CH8A 2PMEA 1N4DA 4OLHA 2XCUA 3GGPA 1OXBB 3FB4A 5FBKA 4E6EA 1YO6A 1G8HA 1U1FA 2ZAYA 5T6MA 1MT0A 2HMVA 1H66A 3CLVA 1RLJA 3PXBA 4LXIA 3D6FA 4BNYA 1NNUA 3IQZA 1YZTA 4LOIA 4RANA 4NU6A 2FEOA 3TLZA 4DPLA 4AROA 3S2GA 2VSNA 4BTVA 1CR6A 2EFEB 2FR1A 4W8OA 4S04A 4HFRA 4UUBA 5EAIA 5KYWB 5ELXA 2Q4RA 1XL1A 5I9BA 4P22A 3L6DA 3T1TA 1BGWA 1UFKA 1XLTC 5FBQB 5MGBA 1YACA 1JDTA 3SHWA 1E63A 3LO5A 2E4YA 3EARA 1GEGA 4B2LA 3EPRA 4RK0A 1AQIA 2R4UA 4GU5A 4YUAA 5HKKD 5K8UA 1DADA 3AG5A 4FP9A 5T4EA 3TMAA 2JLRA 3I5YA 4PYLA 1GPNA 4HBGA 2R87A 3WMFA 1GYPA 4JLVA 4BE4A 3VKVA 4WFIA 2EKPA 3ULKA 1A8UA 2AEEA 4CMKA 2CNBA 1N1EA 1Y1QA 4WKCA 1TZBA 1UAYA 3TLCA 2AOTA 1A8HA 4KNVA 5TS3A 3IDQA 4EI2A 1JXQA 2FSSA 3DOOA 1M6VB 4MW2A 4U3JA 3L0SA 4XCQA 4NEGA 1ABFA 1V35A 4EFMA 4R1PA 2UUBB 3FSGD 4ND6A 2X22A 2I9KA 4PGFA 3F47A 4C04A 3RM3A 2AG0A 1Y5LA 1XJWA 4KUEA 3TGWA 1N6RA 1P2FA 1VCHA 3TQCA 2O3QA 5CD9A 5JXHA 2RGUA 3GEMA 1D7OA 1JDZA 1P77A 1FVOA 1FX0B 1ONOA 2G77B 3DLCA 3NBZC 3C3CA 4LC1A 5T4HA 5ES4B 3ZR4B 5J2TA 1VPWA 2K2QB 2YKGA 4KWEA 2Z6UA 3CW9A 2B1RA 1PWYE 2ID4A 3K6RA 3RU2A 3NWJA 1AMOA 5LQUA 3ZCXA 4WXYB 4EKYA 2IHTA 2FMTA 2RGEA 4BQSA 4D7AA 3UA3A 1RCTE 3BS4A 4BCCA 1YZ3A 4L28A 3SDBA 1EGMB 1EMDA 4L5AA 4BQFA 4INZA 1Y6JA 4N82A 2BRUC 3GEEA 5KMGB 3TGPA 2BEUA 3BXXA 3QLUC 4M22A 4EG4A 3AI1A 3DCNA 2ADMA 4JCCA 4F5YA 5KVSA 2MOKA 4N7JA 2I2BA 4KQJA 1XRQA 5C35A 1XRLA 2HQOA 3NTXA 4R68A 4DJEC 2AB0A 2P5YA 5CA0F 1ADJA 5IJ0B 3PFHA 5JS6A 4BFZA 3DMTA 4BNKA 1XSEA 4LW8A 4CEIA 5HIAA 1JR3D 2J46A 2OZKA 3FWNA 4Q9KA 3IAS1 4EFDA 5ECDA 5J1TB 3ER8A 1UF9A 1KRWA 1V3TA 4JB2A 2WAYA 1S9DA 4U9HS 1EM8B 3A1TA 3KJXA 2A58A 5K8JB 3DE6X 4XCVA 2ID8A 4WCVA 4WUTA 2JVIA 4D3FA 2IX9A 3DLHA 1LPNA 1ZINA 4DA8A 4WESB 3UBMA 4RM2A 5EHNA 4EI9A 4EMTA 2J45A 3KNZA 4BX0A 1S5PA 1KKLA 5LYJB 2GN2A 1AS2A 1RYZA 4UKDA 2OHIA 5I7WA 5K1ZA 5F9FA 3MELA 1ZI9A 1QZTA 4Q01A 1JA1A 3V7NA 3BORA 3TSYA 1JB9A 2MSNA 4G8DA 4O4IF 4GD3Q 2A1TS 2VK8A 3OFJA 3L4KA 1OFUX 1JFVA 3H99A 4UVIA 1IBCA 2CHQA 4CN9A 3EPHA 1PDVA 3G1TA 3OQHA 2FNAA 5JNVA 4LBVA 3P4UA 1M2OA 4RHXA 4Q7EA 3GMSA 3N39C 4KH1A 4M6WB 5CB0A 4GGMX 2EKZA 4MVJG 3WLJA 2KW5A 4ND3A 4HS9A 5E95A 1GYQA 1VP3A 1FL9A 4J8PA 4EHJA 4KITB 5E9QA 5FYDA 3G7NA 4AMBA 1TGYA 4KYUA 1L5HA 1A04A 2VA9A 5ICCA 1Z83A 3A05A 4FFNA 5CX1A 4ZVRA 3CO0S 3F6RA 2KM1A 7AT1A 2NSLA 4H0CA 1W96A 3UXYA 5A04A 1PJ8A 4MJLA 4AKIA 2ONCA 4NCAA 1Y3BE 1CHNA 1GLGA 1GGNA 2XUAA 4W5WA 5CVUA 1T5TA 1SOWA 2QD2A 4I66A 4Z0HO 5E4FA 3KQNA 4X84A 3TRIA 1OIWA 4BX2A 3HCWA 5FTMA 3D0QA 4L7VA 5AJZA 1YQUA 1WUKS 3BL6A 5DTRA 5E0OA 2QPAA 1FDOA 3G2IA 4C88A 1SBZA 3TLXA 1C9NA 1KEUA 1DOZA 1U2QA 3IDSA 2Y1EA 2IZ7A 1RI3A 3NIBA 2BKUA 3GVPA 2XE4A 4QRHA 4W8HA 4JL5A 5ERYA 3SM9A 4R16A 1VMIA 2JIQA 5FWYB 5FOUA 3QWBA 2EZ8A 3TTWA 4GWKA 2O6LA 2AV6A 2K7FA 1P2DA 3AZOA 1TCCA 2VT3A 1NJ8A 2QMQA 3NCHA 2PO7A 4CE6A 2X5OA 4FFMA 4DG9A 3QVWA 2PKWA 2HA5A 2V97A 3VGJA 2QX8A 3HXLA 4ND8B 3B2EA 4ZT7A 3TZBA 3SG0A 1A2KC 1QYXA 5CJ2A 1USGA 3JZAA 1I6WA 2GBGA 3U6BA 2JGIA 2ZRCA 3ZD8A 4FN5A 1L4HA 2VZEA 3N1UA 4PO3X 3RJ5A 3WWPA 5H4GA 3F9IA 3HB4X 1C7JA 1K6IA 1RACA 1Y6RA 2ABWA 2DQYA 3BL8A 2NUPA 3OP4A 1XLVA 2GVNA 1CS0B 1QX4A 4JFRA 4MI6A 2BW0A 3I76A 1E58A 3CM0A 4P82A 2VWHA 4P08A 2UYQA 5KJ6A 1PL7A 2ZUTA 3K0FB 3K5WA 3BGIA 4RS4A 1BOOA 1E3WB 3VYTB 1M0WA 4JSYA 1DELA 2G1UA 4A5SA 1JX6A 1XELA 2GCEA 2IIQA 1E1CB 4L95C 4BMNA 3HBMA 3HL0A 3GAZA 5HUHA 1VJDA 3OEED 1SK8A 3ZHOA 4MARA 3VPFA 2HBQA 1NOJA 4U9IS 5DWDA 4FS3A 3PXEA 1TEHA 2X0NA 4QDKA 5H70A 1XAIA 4DNOA 7MHTA 1S2GA 2GF0A 4BFCA 3HO1A 1EU1A 4EHHA 5CT8A 3EZ9A 3W4JA 1F2DA 3IEUA 1C9YA 2Z5GA 2XHZA 3P32A 4RK1A 4EECA 2ZVDA 4PNPA 1Y8ZA 2WAAA 4I4TB 1EFCA 3MLBA 1N5DA 3D9QX 4I9GA 4OQXA 3KT0A 5H3CA 2C1ZA 1A9RA 1ZOPA 4C01A 5IAAA 1LBHA 3M4XA 5HDBB 5EQTA 4CEJB 3BDVA 3DHVA 3EIHA 1MO2A 4UMVA 3IS3A 4JLSA 1RAEA 3JY6A 5CVDA 4BJ1A 2W4QA 2G1KA 1TEVA 3EXHC 4R7TA 5EMLA 1I5EA 2BHLA 1CZKA 1OTHA 1YAJA 2OUIA 2QZPA 3IQDB 1XZNA 3NHAA 4P92A 5KINB 1AD2A 4BP1A 2WTEA 1GAQA 5KWEA 1LLCA 2RGAA 4FE4A 4IWNA 1BMTA 4NG5A 1OGIA 3AEZA 4YJ3B 2LIVA 2JVKA 3PEVA 3O4FA 3OE1A 4XFKA 2HXGA 3QUAA 4RZUA 4Z8XA 4AL4A 4D41A 7ADHA 4W99A 1TA4A 4FM9A 3G5MA 1J09A 4FDAA 2P67A 1BKDR 3K15A 1MVOA 1T4CA 3MJRA 3UANA 1KGDA 2V0GA 3ZCVA 4FGSA 1CHDA 3GGSA 4EUKA 1E3JA 1K5DA 5DTJA 4A27A 1QFXA 4LN1A 1ICEA 1ETHA 2NQ8A 3G1UA 3BWBA 1M7BA 1Z15A 2OCLA 1QFSA 1YZUA 4K9SA 3UHAA 1K08A 5FWDA 1V41E 3C5HA 4MQUA 4ND7A 1OX4A 2GCOB 3DVSX 3WBBA 2PH7A 2WQ7A 3WA7A 3IOMA 3S70A 1HRKA 4F4JA 2DPHA 1BCRA 1QCCA 2VPPA 3LMKA 4JLAA 5IXSA 1NDQA 1JQEA 1TPZA 3FUUA 4LDZA 3HBAA 5G4KA 4PNEA 4MUEA 4IV5A 3AFNA 1H05A 1PR4A 2ZYIA 1H23A 3CNHA 3EUEA 3I9KA 1NHGA 4ZCQA 1Z5UA 3O03A 1YB1A 2O20A 5JMPA 2V8OA 3PFBA 3NT4A 5TPWB 6ADHA 2JW5A 1RAFA 3VR5H 2IKQA 4I6GA 3UXMA 3WYFA 4H9GA 3K9GA 5CLFA 2UVQA 3D0RA 3DEZA 4LZJA 2PNJA 5HOQA 1ZMOA 5L53A 4RYDA 2GPTA 4C20A 4CLEA 2E1RA 5TMPA 2ISQA 2PL1A 1JHUA 4LE0A 2PSSA 4TKVB 4BWGA 2Q4TA 3CGWA 3R0JA 1KA9H 1U4OA 3HDYA 4K6CA 2BVNA 5A0TA 1AVTA 3FF1A 2BUBA 2J07A 1P3JA 4DBZA 4Q03A 5ALOA 3GZNB 4ZGGA 4P1ZA 2WIGA 2Z30A 3L8DA 4GUDA 5AIBA 2VJCA 3DT9A 2VUSA 3DOCA 2O3UA 5LUBA 4ED9A 1XXHB 3UK6A 1A1SA 4AS3A 4GAEA 4EOGA 1F0NA 3GUCA 2PQMA 3OO0A 1ESDA 4LV6A 4P3KA 4KGDA 4Z7NB 3QVVA 2PCJA 4DR3B 1YQQA 2BTQB 4FD2A 1R6BX 4FZRA 4IV0A 1HZZA 1DX4A 2J9YB 1YFLA 2WHPA 3RG8A 4R0MA 4GXRA 3HUUA 1IK6A 4GMDA 5A5DA 5CIYA 1XMSA 2JIBA 2W0MA 4P4GA 4OFZA 3V42A 4NF2A 2ZUVA 4N0DA 1BFKA 2NSJA 4COKA 1RI2A 3KYCB 2W2MA 2LKDA 1K7CA 1VZ2A 2XUHA 5FPTA 4LF5B 2CUNA 1E62A 1YR2A 2JEYA 2VQSA 3D6NB 1Q0UA 1P7PA 2M9MA 2JFHA 2NW6A 1H93A 2Z0MA 3JYHA 3KB1A 3QV1A 4RLHA 4JI1B 2OZLB 3H9BA 4IIVA 3V8EA 4ZTZB 3RAGA 2P77A 5HDQA 1RZRD 2Z8YM 3DDCA 1NW7A 1FVXA 4IXWA 1Y80A 2KI5A 4OHKA 1U0TA 1ODFA 3UAXA 3IJ5A 3CC8A 1GL9B 4REMA 2ORVA 2ZGVA 2I6UA 2J6BA 4U63A 1X1BA 2QTHA 2QVZX 2WV7A 4HDQB 3IL2A 4B3TB 4KQIA 1G20A 1UWVA 4Y9UA 4N4AA 5CT9A 5BSEA 4QXOA 3OO1A 4MDHA 2O57A 2V6BA 3CXUA 3PXUA 1WXFA 1J1UA 4ZVVA 3K0CC 4EY4A 5FBWB 3WLOA 1VKHA 2IYOA 1HNWB 4C7OB 3H5NA 3HN2A 4YJHA 4UOZA 4IUCS 1L9KA 2WTUA 4Q1FA 1O4WA 3OSZA 2B4RO 4PZUA 5DTEA 2UUOA 1YQGA 3RRJA 5C8YF 3JQ9C 1BVRA 1YMUA 3W79A 2PVSA 1WU8A 5KNBH 1UWLA 1B8PA 1LDGA 1TXGA 3U7EB 2A1UB 4MYTA 3A3KA 4KG7A 1V2GA 1TZJA 2LVBA 3FKQA 4MMXB 4Y1EA 4ZAWA 3OTOB 2XDQB 2ZE8A 4NK5A 4OB6A 1MD9A 1B6TA 3DTYA 3L02A 2OXEA 2O4CA 5EUCA 4MRRA 5BOSB 1A9YA 1E9BA 2XUJA 1H85A 4RMNA 4UDNA 1IK4A 3W8NA 3PQ6A 4BFYA 3MA0A 4HATA 3NXKA 3VJLA 4QODA 2QQ0A 1KZGB 1CZRA 3GJ6A 1PGQA 2IUFA 1PVVA 4FFBB 4ZODA 1SB9A 2WJ6A 1MDFA 2Q9BA 2WJWA 3L4SO 3LDFA 4AWAA 5IULC 3J7AC 1ESMA 1YKGA 1NJFA 4PBTA 4UXHA 2HFJA 1CXZA 5JISA 1OI4A 1VGRA 1WUJS 1Q22A 1W25A 4XGKA 4N5LA 4PM4A 5ALGA 4BAZA 4B3RB 1NNEA 1L5OA 2QUZA 2YWFA 1D2CA 4C78A 5DYYA 1WY7A 3U4QA 1QIFA 1GPAA 3KALA 2W48A 3KSUA 1RXUA 5CCBA 1SCBA 1RJ9B 3C8MA 4RO0A 1OH6A 2V4UA 3L7IA 1HEIA 5IJ9B 3PTZA 3T35A 4EPRA 2VIIA 4NCXA 4OYYA 3GVIA 1GNQA 1Y42X 4HX2A 3S4YA 5MDHA 3W5BA 1EK6A 3OQNA 4EMUA 1VKJA 3NWBA 3IUBA 1UPBA 1ZOSA 2RGXA 3FETA 3Q5EA 4OJQA 2C5SA 3BWCA 2R00A 3M9XA 4XQ9A 5J40A 3L8EA 5GM2A 1IMJA 1G4AE 3CNOA 1SUAA 1K8QA 1K6MA 2VQ6A 1LTKA 1L1QA 3JD3A 3M2PA 3LGSA 3PYXA 4M1WA 4I2VA 2A9RA 2YC2C 4MKGA 1OBVA 1BIFA 4R2LA 1P4AA 5F2OA 1YDEA 1KARA 1BYUA 3NVMB 5FAXA 5I7OA 2PUAA 3ENWA 1KMIY 4NHOA 3H0EA 4E07A 3I2IA 1DB3A 1KPIA 2UUCB 3D7NA 2N1BA 2XBMA 1J0EA 4QO8A 3PTLA 3ZV6A 5FPKA 2HH9A 2N9UA 3ILSA 5FHRA 1H9AA 1H2EA 4EL5A 2H18A 3QU4A 4IIHA 3KT6A 2ZE5A 1ZCBA 3NKVA 3QBEA 1JV2B 2Z95A 2PWBA 4F5WA 3GNQA 3F3SA 3JAKB 2J0VA 2EERA 2YHUA 3BREA 3K72B 2ZI9A 1SQ5A 1EJ0A 2C7QA 1AK9A 3NBUA 4MVJP 4FD3A 4NBVA 4CM5A 2BR5A 4HGQA 1TO6A 5CFOA 1UINA 3QUCA 4I55F 1ZR2A 1X2BA 3U0BA 1V37A 2A3NA 1AKWA 1DT5A 1IN7A 1AA6A 2GVZC 1MVNA 3P7MA 2ZWIA 3QFSA 3ZYCA 1U7XA 3AIIA 2XVZA 1DKOA 1D2AA 4NIMA 1E79D 1W94A 1WSBA 5LQNA 2XMQA 1UZUA 1KFBB 3JASB 1QP4A 2OSBA 4EIWA 3S55A 2WHEA 4IF4A 2YMPA 1G5TA 1V71A 4RAOA 1FCJA 3H5AA 1T9GS 5BSTA 5AM1A 2G9UA 2X0FA 4G89A 5AXDA 4BN5A 4XUEA 4O3FA 1HO3A 1SXJB 4PW0A 3A3PA 4CCYA 4DR4B 3QOWA 4DSAA 1I4LD 1QOPB 3E9NA 4E7OA 1A7AA 2VF4X 4LZNA 2FWAA 3DPSA 1ISPA 1G42A 1S2IA 2Y4NA 4P35A 4ZXFA 3KKMA 2F2TA 4INAA 2IH2A 2OHGA 3WTBA 4KMOA 5HPYB 3I30X 5AW5A 3TNYA 4ZO4A 2R84A 2F3UA 4PVCA 2Q28A 5BO5A 1DO8A 1KP3A 1RLTA 1MAUA 4C5AA 3C7TA 1NMQA 1FFHA 2C9CA 3J80A 1W5SA 1FRVA 4FQ8A 5CVTA 5DBEX 3OLXA 1D0SA 4RD3A 3DPUA 1J00A 5E1BA 2CXHA 3HYSA 1JQ3A 1WEHA 1Z5VA 3DDUA 4LNUB 3PL5A 1WMAA 3TRJA 5KNCH 3DDZX 2QZSA 5ITZB 4URUR 4WK2B 1UPAA 1ZXBA 2Q21A 1CD5A 2I4RA 3B52X 3LUJA 4J1NA 4B6OA 4WY5A 1O3YA 2AI1A 4ITVA 2OK7A 1H5QA 3C1UA 1RMQA 3FMFA 1TYBE 1V5GA 1ZIXA 2VDMB 2ZLBA 2QQFA 4MQEB 1HDYA 3Q3CA 4RVOA 3CTMA 2DM6A 1FMJA 2AXEA 2FFRA 2JGLA 3T5AA 1RHUA 4C0QC 1NN3A 1TYEB 1QPZA 3QU2A 1YZNA 4PFJA 4X8LA 1I14A 3EJWA 4BL5A 1G3UA 4WOPA 1RDFA 4G0WA 4MJ3A 3B85A 1YR9A 3MB5A 1KJIA 4RNCA 3FOCA 1X1AA 3E9YA 3EQ9A 3P9KA 3V8PA 5F73A 2CUKA 2BIFA 1WP9A 3WNDA 4QU0A 3HYTA 1UPUA 1XWIA 2V5VA 4XDHA 3DXZA 3OIDA 3TTSA 4LFBB 4GPZA 4WAUA 4ER7A 2OP0A 1DAMA 2OQVA 1BE0A 1KETA 1HQYE 3CEAA 4JEIA 1UDBA 4I3GA 1N9GA 1KFCB 3C5VA 1PLLA 3H1FA 1JSXA 4WLEA 4HDNB 2MMCA 1F8GA 2P2DA 4GECA 3SP1A 4GR4A 1QDUA 2E7ZA 2HADA 3REQA 4QJ3A 4EBBA 4YCSA 1ZN7A 4MV8A 2GB4A 1E2GA 2JLCA 4KGVA 4B76A 3CLUC 3DNPA 3JQ8B 2BFEB 1LTHR 3HZRA 3OJ0A 5A0FA 4C4SA 5E7JA 1VCNA 4QG3A 2F17A 4KMSA 3CZMA 4KLNA 4AMGA 1Z82A 2C7GA 2JATA 3SGLA 1YOBA 2B82A 4XA8A 1O03A 1VLVA 4EX7A 3FPBA 1DBQA 4GR5A 4RY0A 4U7HA 3DL2A 3HGQA 3SC4A 3UWOA 2AGVA 4BO9A 3EZGA 4A10A 2W6MA 4J3FA 3UM9A 5CB4B 2Q46A 4ZC8A 1W8DA 5I4BA 2RK6A 1BC5A 2PRJA 3E9EA 5AXAA 1HYBA 1QM5A 2PZJA 1S2NA 2V7TA 2D2XA 2XZTA 2YV1A 3HV2A 1OLUA 4URXR 2PUFA 4GYYA 2Z4SA 3HCBA 3QLVC 3QZUA 3G5LA 4O02B 4WWHA 5JG7A 1E69A 1KY4A 5LA6B 3UFXB 1NWHA 1VE3A 2FSIA 3BVPA 1G6HA 3HL4A 4FZ3A 4OFWA 4Y6SA 2QTWB 5L40A 4MA0A 1LI5A 3SBEA 4XM2A 3D1VA 3V4PB 4LBWA 1X77A 3J7TA 4YCNA 5KX5F 4A6DA 3N2ZB 5L45A 1Q5PA 1ZNWA 4GO1A 4EFKA 3FTFA 1GG2A 1PGOA 2ADOA 5JCJD 1QF6A 3AI3A 2GRAA 2ZRDA 2VRWA 3O91A 3ZIUA 2PFGA 3LW7A 1WXHA 2AZ4A 3ANSA 2Z1MA 3DEIA 4YFYA 1UANA 3IVRA 3T54A 1EQUA 4AF8A 3ZWAA 2WIAA 3QVSA 3R2JA 3T99A 4R2KA 1E66A 1ZI8A 1DIHA 3D59A 1L0BA 3QXXA 4B0OA 1ETUA 3THXB 3STWA 1A72A 1KH3A 4BPRA 2AK3A 2AI2A 3ORYA 3PJFA 2C57A 4PZLA 1P19A 3S68A 7REQB 3COZA 2Z2IA 2CDNA 4OB8A 1YI1A 1B0ZA 5FBZA 2FR8A 4QUJA 5LBIA 1E2DA 4AJLA 2QVXX 1IH8A 4BKOA 2W6JD 3RSZA 2O8DB 5AK5A 4B7XA 2C1EA 2IYUA 2O5VA 1DAEA 3FZGA 1NUQA 1P1HA 3ICVA 5F3RA 4PC7A 4RPKA 1ESEA 4LYYA 2HAEA 1WUYA 1YMQA 3DKVA 4PLZA 4Q4CA 1QYVA 3ZHQA 1CY2A 3GLFA 1DRKA 3DE0X 4OIMA 2FX5A 2YUIA 5TXGA 5EE0A 3UC9A 5BQOA 3FTEA 1GGJA 2P3LA 5C8ZA 821PA 1W47A 3H3XA 2AYYA 4B8ZA 1V1RB 1Z7EA 2QLLA 4WQMA 3DFFA 3TAUA 3TQSA 5JYDA 1R9GA 1LX6A 1HFJA 2GNOA 5CT5A 1GUYA 1TYZA 2ZUBA 2RHRA 3HCFA 3IIIA 4G1BA 4UHJA 4V02A 3RWBA 3VYWA 4J43A 1CK4A 2PQ6A 1YVPA 2A2ZA 4WXMA 2REBA 1QH1A 4FNAA 1E9AA 4ND2A 4QREA 5KIAA 1EA5A 5EHIA 5T5QA 5LZ9A 4IGFA 4Y2JA 1G2QA 1YB6A 3TRDA 2WLSA 5I51A 1NQOA 1A5TA 4G0UA 3C0KA 4WZAB 4BVJA 1EFKA 1H0RA 1UFVA 3AHDA 3L4BC 3BBLA 2O8BB 3EVDA 2CHUA 4B47A 3E58A 9ABPA 2X19A 3F71A 1RHKA 1EFPA 3RAPR 2CVZA 4MS3A 1CUZA 2VHXA 4IFIA 2CVOA 5BY2A 3Q3EA 2XKKA 1J2JA 5COQA 3DZJA 3R3SA 4M0DA 2QD3A 5LJLA 4NZPA 1Q6ZA 1SG6A 1EZ1A 3DO6A 2V7UA 2ECQA 3JZDA 3QKTA 4ARUA 5AUNB 2ZIXA 4PF1A 5A5EA 4MYDA 1S3GA 3KLPX 5EUBA 4HUQB 1V8ZA 3D3WB 2G28A 4EGQA 4IJWA 1NDUA 1PFVA 3U4HA 3A8TA 4QFDA 1GEEA 4QRIA 4RJTA 1X80B 4HH3C 1D4AA 4LDJA 5EJEA 1DIBA 1JHOA 1OOEA 3F98A 1BHSA 1KMHA 5KYGA 2OV2A 5CH5A 5SZKB 3UW1A 3KV3O 3TQHA 3ZBQA 5ECYA 3ZI4A 4ZTBA 2G67A 2AL7A 2XH8A 3KJFA 3LIPA 4IOMA 4LZZA 5G02A 5MF6A 1JJIA 1DEHA 1RPAA 2PDAA 1BHJA 2WG1A 2JBAA 4GSKA 5D1NA 3GU3A 4JN6B 4PWYA 5KJEA 3VVBA 4BEBA 2GN0A 2FB9A 3WNCA 4RJIA 3FFAA 4ZOBA 3FYUB 4GVPA 1G8JA 3AF1A 4FYXA 4K87A 3WGKA 1P1FA 5AKHA 5DOZA 4CI9A 2SHKA 4EGFA 4ZJUA 1ZR4A 1ZEMA 5H83A 1S1MA 2OCPA 2VLBA 4N7RA 2PRIA 3F6CA 1KYTA 3EMVA 3IP3A 3CR3C 2FSPA 2Y2UA 1EHCA 4AZ0B 3DL0A 3GZ4A 2GHIA 1IULA 4I4CA 2Z5FA 4X64B 5AQ1A 1X1SA 4ZZ0A 2DH5A 1KI2A 4D6PA 1CUGA 2NTJA 3OWOA 2UZAA 3HEBA 3QYJA 1X9IA 2GTIA 1G2IA 1QOZA 2H1IA 6YASA 1ZOOA 2HV8A 2MJLA 2CYCA 2ECOA 3GLGB 4K8OA 4XIGS 5L7WA 2H1WA 2RFLA 1W1WA 3W6NA 1ZUNB 1E89A 3R7AA 3RRYA 4BO7A 1D3AA 1D2MA 2XVAA 3LT5A 3RUHA 2WTNA 1Q0PA 5SY4A 5KNDH 3D64A 5EFOA 3D8SA 3DDOA 1UH5A 1R1DA 3WKCA 4FYVA 3TZHA 1XB2A 4IQFA 4YJFB 4C43A 4K9MA 4LDNA 5TDHA 2E89A 1I3KA 3HA5A 3HCAA 2X8BA 3HY3A 1A9TA 3WL4A 1G3RA 1RAHA 4YAGA 1YS4A 1PNRA 1OF1A 2RGRA 1O58A 3FHCB 2YRWA 1M74A 4DHEA 4HDKB 3QKIA 5F98A 4A0GA 1F8UA 2X4LA 3QP9A 2O23A 1JHXA 5AD1A 3UK7A 1R8YA 3GXOA 1YA6A 2PXXA 4JL6A 3AVTA 3FGNA 5U4XA 1INLA 3BWXA 3L8CA 3NG1A 5BNFA 5JYEA 3SSMA 3WYGA 3CNQS 4LSMA 1KOGA 3I2FA 2QMYA 2VUTA 4U7TB 4XTRA 1HMYA 2VPYA 2ZB2A 5IH3A 5K0SA 3SZRA 4DV4B 1BRMA 4P81A 4BNJA 3R0XA 4DNQA 2ZB4A 2ZTLA 3EXHA 4NLLA 4KXQA 4OKNA 4WASA 5BWLA 1BMFA 2EF0A 1O57A 3FZEA 1WETA 2JAWA 4UZEA 2DLNA 1ISJA 2HCJB 4EYEA 1Q0TA 3T3DA 1GVHA 5FL7D 4AICA 5INTA 1SXHA 3S2ZA 3W2FA 2V7QD 1Q3HA 4MO2A 3S8MA 3ROFA 1UQTA 2HHHB 1U8UA 3COJA 1C1DB 1KIAA 3LUPA 3QW2A 4HC4A 1SFRA 5I7HA 1Q1EA 4L57A 5D51S 3KU4A 1VC2A 1SKQA 1E2LA 1VJ1A 2PCLA 2YICA 3RWOA 4BWFB 4X95A 4G81A 4QWWA 5TQVA 1E6CA 1L5MA 5IP5A 2V3CC 1G21E 1B6GA 1SO8A 4RQAA 5KOIA 1XZGA 4PLWA 1OYOA 1NLFA 2YNMA 2FWNA 1PVDA 4DC0A 121PA 1BKYA 1HNZB 1IHOA 3CLSD 2GEFA 1V95A 2F3TA 5G40A 1Z4QA 1MGPA 4CL0A 5K0TA 3BIOA 2O5EA 1GGMA 1OZ0A 4IJMA 4OB7A 5TSDA 3W9UA 4FOTA 2ZJAA 4G0XA 1C0KA 3UICA 1HE4A 5FLYA 5IDXA 3T94A 2YHBA 1C3EA 1Q2UA 5G41A 3WLQA 4C5CA 3PD1A 1O94D 4RDIA 5HG0A 1W36D 1CTQA 4RW0A 4G4SO 1U2TA 4O6VA 1JHQA 4WXEA 4HBZA 3VO8A 1VQ1A 5BN5A 3SF8A 3PWKA 2A1TR 3QH4A 2PD4A 4J2TA 3OCXA 1LJUA 5BMOA 5A4DA 3DB1A 3WMRA 3HQ4O 1TU4A 3GYGA 1E99A 2PM8A 4AZ0A 5B3JA 4L0DA 3HU5A 3W3AD 1NPTO 2ZDHA 4AW9A 2C59A 3IAFA 5JMOA 1AZLA 1T0UA 4JBIA 4MPJA 4KSBA 2FQXA 4DBLE 2JGEA 1XX6A 3IKLA 2H5IA 3W5CA 2H17A 2PUHA 3CVVA 4W6QA 3OQOA 5IWAB 3D5TA 4GSYA 5DCLA 4EPVA 4REQB 2E6UX 1QIGA 2WNIA 1JAIA 3LOPA 4JZYA 3LRPA 4MP3A 5TPZD 1C3OA 1WDLA 3H13A 3CX8A 3FNEA 4EF5A 4RTJA 2QS9A 1ZD1A 4J29A 4PZZA 1F4VA 3W0LB 5J43A 1L7AA 2XF2A 1H2WA 2W6OA 2PFKA 2VP0A 3LQFA 4G25A 5IYZF 5EHXA 4R71A 3H1GA 2OORA 2I87A 1TZCA 3WLSA 2H7VA 1CJBA 1KI8A 2Z04A 3GPLA 1Q12A 3OBIA 3M4ZA 5JU6A 4JP2A 5JH7A 2Q3BA 3WIBA 1WHSA 3T4PA 2CWDA 3M89A 4UFPA 3LH5A 3IEPA 4N0QA 1Z25A 5IMBA 3ZW9A 4CM4A 1N2HA 4QUDA 3TSOA 1IBKB 2R8EA 1KI4A 4R7GA 4YRNA 5AVQA 1TLTA 4ER6A 4YDSA 2QY6A 5EJFA 2NP6A 3R8XA 1U0FA 1VMAA 4ZOCA 1FW6A 2RH5A 3GFBA 2Z56A 3H9CA 1OZHA 1GPDG 2HNKA 1QJ4A 4RZ2A 5GY7A 4NJEB 4HD8A 2QXYA 4UTRA 5JXIA 3K70C 4Q39A 3ZJYA 1FTNA 2UUPA 3VYUB 3U7IA 1OPXA 4R3UC 3EA5A 4F85A 5KTRA 3ZWPA 3CBQA 5CYPA 4X44A 1V48A 3FDXA 3G17A 2NU6A 4P3YA 4C4RA 3HNOA 4Y2YA 5K8VA 5TGZA 3ERCA 3AVYA 4E5DA 3MCAA 4LRSB 3PUYA 1R8SA 5ERGB 3DEFA 5LB2A 3O8OB 4E1VA 4YAOA 4UUQA 4M8SA 3SIWA 3PQEA 5HIIA 4DVGA 1I8TA 1TF5A 3GJ8A 2DCUA 4KUGA 3C3PA 1FP1D 2C4WA 3R9XB 2HU5A 4X6YA 3VR5D 1H1TA 1S8OA 1RR6A 1FRFS 1CG6A 1NXSA 1P4HA 2PANA 4XQCA 1XEXA 3X1YA 1OKKD 2CHGA 2FW0A 1ID1A 4Q37A 1C30B 1A9PA 4P7GA 2F1IA 2OC4A 3GIWA 4I1SA 2ZRIA 1MEJA 3HJCA 1CNMA 1YULA 4UQLA 4RBNA 3IHWA 1K27A 1L4UA 3SCZA 3RIGA 2IDKA 1V7CA 2FEKA 2GKOA 2XYQA 1JI0A 2EGHA 4LSWA 5CGQB 1NM5C 2GFHA 1KYYA 4Z4EA 4HZUA 3ZJ4A 2UZ3A 1N0IA 1WPQA 3ZDEA 3CQ9A 1IUKA 1SD1A 4LA4A 1OAKA 4IS2A 1DXYA 2JI4A 4MRMB 3WK4A 4BZZA 3IP9A 3E3AA 3OT1A 4A0HA 4WA8A 1L7NA 3ES9A 1C0EA 4NJMB 3I05A 1Y6QA 1NR5A 3FUWA 3W5JA 4P4LA 2CXXA 4K7JA 4R9VA 1ZUD1 1MO5A 5EWJB 4ZPJA 2IQIA 1GXSA 3SZ3A 3UAVA 4D9NA 5L3QB 2JK1A 3IR7A 4G37A 4I1VA 4C4OA 2IU4A 1XRMA 4LJYA 4ZDJA 3TR5A 4ZHQF 1JGTA 2Q99A 5TQ0B 2OSVA 3FJOA 4Q9AA 1F9EA 2GEJA 5E6SA 5BQPA 3T12A 2GLXA 5JCZA 4O2AF 2PGLA 4OHZA 4RVGA 4AM8A 4LHZA 4KSCA 1OASA 1A2QA 1IU9A 1JAXA 4LGYA 1UBEA 5DYWA 4ILEA 1P2BA 2B4YA 4IR7A 3DWFA 3RHFA 5KJCA 4W1QA 2PSDA 5EUMA 4EYSA 1P4JA 2X2PA 3UHFA 2XWQA 1ACJA 4D80A 3FCSB 2Y0PA 3FHOA 1TYDE 3DW3X 3GJSA 4UCWA 5FI0B 1SOAA 4E03A 2DX7A 1IUPA 1SBIA 2RGBA 4DBVO 1E8NA 4EVIA 2QTZA 2JAPA 3THYA 3L4EA 3PJEA 2ZANA 4RVDA 5BSFA 2HYDA 2FEXA 3TX2A 3UJ6A 2A67A 2CY0A 3LUHA 3B6JA 3VPBA 4IX9A 1GL3A 1JEYA 4JX8A 1A5AB 2QMOA 1HE2A 2XQKA 5CPFA 4LF6B 1WUTA 1YE3A 5GOZA 4C29A 3WSTA 2ZS8A 3BD8A 3GLFE 2XAAA 3A4LA 4Q02A 4NS4A 1V0JA 4PO8A 2BHRA 2DERA 3A2MA 3QNUA 4WFQA 1ZUWA 4UDYX 3HLKA 1ZA1A 4O4HB 5HKLA 5BP7A 4HDNA 4CIBA 1D2GA 2YZ7A 4BX9A 2GR9A 1GPBA 3M1YA 1P7CA 1G0OA 3GCXA 3GV0A 3IB6A 4ONEA 3ANXA 3F78A 2G70A 3LX8A 2ZRLA 1JJFA 3EVNA 4EY7A 2RJNA 4MINA 3JQCA 3VU1A 2HHAA 2WM3A 3LQ4A 3N7AA 3UKJA 1KEKA 1U94A 2D74A 4LUCA 3V1LA 3W5HA 1CZOA 2VYCA 4JKOA 4CF6A 4Q6BA 2HIHA 1OSNA 1J99A 1O95C 5DEIA 3AUJB 4L4XA 2RHGB 1N8TA 5TPZA 2YWXA 3M5CA 1Q0QA 1XTZA 4XR4A 4HNGA 2G83A 2A59A 3OCZA 4J07A 4MKXA 2YOHA 5K0JA 3L0DA 3FOFC 2HXYA 2VH5R 2VHQA 4LMPA 4PBSA 4N9QA 4WCFA 1G9XA 1TCUA 3MTEA 3MRVA 4Q7LA 2ZDGA 1KK3A 4PS1A 4UHDA 3B6MA 3HDQA 1E3LA 1PV1A 1I51A 1UZLA 2H7CA 3GY0A 3M6MD 1HE1C 4NENB 4Y0NA 2BFPA 3A1DA 3AR6A 4IEEA 1TK3A 4EMSA 2AYXA 3GJ4A 2OV4A 2F1JA 2XKAA 4JQZA 4MHOA 3HI6A 4D6YA 4ZI2A 3ILXA 2EFDB 2HA4A 2QTAA 3JQGA 2FHPA 4UMEA 4YCMA 2YVQA 1KMMA 1KDZA 1XNGA 1XKLA 4POAA 1HZJA 3RC3A 1NY5A 3VC3A 1W35A 3A36A 1RS0A 4HADA 2QTCA 4M0CA 3QEOA 4IG4A 1IB6A 2Q0QA 2HUNA 4YP9A 2PT5A 4Z4GA 1K3TA 1P74A 3EH1A 3F5DA 4R7ZA 5JD6A 1PKXA 2A5DA 1XN1A 3K5PA 1BXRA 4YUYA 2QE7D 4A6PA 3CA8A 4GMXA 5ALDA 1LC3A 2TECE 2VHCA 3LQ1A 2QRPA 2WKQA 1QYIA 3PICA 3IIKA 3LGAA 1PR2A 3MINA 4G63A 1I7QB 4BVEA 1C3XA 4RHUA 3JYOA 4WKNA 4EAQA 1ABBA 1PD1A 3E9CA 4DIDA 1WB4A 4LWOA 2DJIA 3JW8A 4HRVA 3VHQA 3JASA 1KR5A 3U4DA 1OB2A 1XI2A 2PRYA 2ASVA 3KC2A 1TGVA 3I45A 4RAQA 5EIBD 1M6WA 4HXFB 1WCWA 3KLNA 1FA9A 5BOVA 1Z8HA 5AW9A 4BWVA 1N4AA 1CEYA 3ONWA 3RU9A 2VPIA 1PFGA 4QQRA 3KZ1E 2ZS7A 1CS0A 4O2RA 1E1DA 1ODCA 1E94E 1P4GA 2F00A 4I5IA 3VYSB 4NNJA 3M6IA 4F12A 3AI7A 3R7WB 2FVXA 2E49A 2VSXA 2F8TA 2CMFA 2OWEA 3G1WA 4EYOA 2WKWA 3K8OE 1DQNA 4IQ8A 4MRSA 1TTPB 5BUQA 1QHSA 1B14A 3E5RA 4RHFA 3EQ7A 3C7DB 1NVUQ 3BCUA 1XEFA 4OXKA 5LBTA 3VBEA 2X2EA 3DULA 1I9CA 3QEMB 3OURA 4FC7A 4LF8B 1RADA 1JPJA 1GSAA 1JQ5A 2PKQO 4YC7A 3K92A 1NF2A 2MTBA 4BLWA 2AN4A 1TT5B 3DF7A 5F33A 3S1LA 4K40A 3SX0A 4RQBA 2HIAA 5T8KA 2HJGA 2X0KA 2GAJA 1U4SA 4RXMA 3CKMA 5IM4A 1DG3A 1RWBA 1MR3F 3M6FA 5FF9A 2X0IA 4J3NA 1RRVA 2WJJA 1C7ZA 1C1HA 5THKA 3PNKA 4DQUA 2DH6A 3GLQA 3SZOA 3VZDA 2V6GA 3SX4A 4XRGA 2OPBA 3QMVA 5GONA 3EIOA 1OYVA 2G76A 3TL2A 1GUFA 1UT5A 4Y6PA 2V7PA 1S2DA 1NRXA 5TQJA 3NB0A 3WP1B 1E2IA 5D3QA 5K3FA 3KHTA 1NF9A 4GKVA 2XODA 1U8AA 5ER6A 3SK0A 1L8OA 3OJCA 3TLYA 2D5LA 1FX1A 1QHIA 1AKUA 3GF4A 4HGNA 4A0FA 3RVPA 4GPBA 4ZZ2A 4BAGA 5FD8A 2WBLC 4X20A 4QT4A 3AVXA 5L51A 2DPMA 2AOUB 3GNSA 5CNJA 3GMDA 1GPUA 3QTLA 2PKXA 3AP3A 4NP6A 5LXTF 2R1VB 2ZTHA 2OAGA 1OV6A 1QS0A 4FBLA 2ISSD 3P0FA 2CLMB 2SCUA 4NARA 4JBXA 4CLHA 1TZKA 2WTBA 4QDTA 3RTCA 1UAGA 3VZQA 4DYVA 2GBPA 5DXFA 5B30A 2V59A 4F6RB 1DJNA 3EPLA 1Q3KA 1XQVA 1A27A 3NM6B 2IOFK 3GZTB 3WX0A 4X1KA 1TZMA 4MV4A 4YBZA 5I48A 1TVKA 2FP4A 2H9AA 5C4GB 4U2EA 4R5HA 4GLJA 4XGIA 4FWIB 4XQGA 2B1IA 2OYSA 2R8YA 3G0OA 2FPWA 3C1TA 3W9YA 5HRAA 3UN1A 2ANCA 4D8XA 1DBIA 4H3VA 1EK1A 4GPAA 2R7MA 3RV4A 4UNPA 1SY7A 3F6PA 4BX8A 4DWOA 4CGYA 4QGBA 3QX3A 3PLRA 4D4LA 3IPLA 5DHAA 3PCRB 4PLYA 4IQ4A 1Y63A 2VDUE 2C0CA 3L04A 1NI5A 4YJGA 3ABQB 3KB8A 3CVOA 1AT1A 1Z3IX 4JQYA 5A2GA 1QH8A 2HMYB 1CULC 2CBGA 3B6IA 1NUUA 3T0GA 2DMRA 4BVKA 4DAOA 3Q8MA 2WAXA 3ZTWA 2WVJA 1B74A 2FLKA 1GADO 2Q9CA 3ZVLA 4NG4A 3EMBA 3PXCX 2IZOA 1QHEA 3CFYA 1LVHA 4Y1FA 1O0BA 2WMYA 3GIDA 3KXPA 1UC5B 4RNDB 2MSLA 2ROQA 2FFHA 2X6QA 5G3YA 4GKJB 3NNDA 1MIOA 2PLAA 4AJKA 1E3MA 3DVRX 4HQKA 3UBTA 2FK8A 3IPRA 1ML3A 3JVDA 3AOEC 3PWSA 2IDMA 4V0MA 2JCSA 1MIHA 1NHWA 2EU8A 3HGTA 4PN3A 1JIJA 2BH2A 4IG9A 4BHTA 2O1EA 4MKZA 1G8AA 3QUSA 2YFKA 3OETA 2UYOA 1SZDA 4F3KA 2H07A 4Y30A 1WZ2A 4I3FA 3RLFA 3TN7A 3AUXA 2A5FA 4CMEC 4RD1A 3SBXA 5FUVA 3W3AH 3VI4B 2JF0A 4I50B 3QE4A 4XUDA 1XXHA 4X61A 3WO1A 5ADWA 4HFNA 5GV7A 2F8SA 1MNAA 3NHWA 4EBFA 3ZGVA 5K3CA 2O8EA 1I0IA 3AOGA 3L84A 3VV3A 1CP3A 3W8DA 2HBYA 3AYXB 3GL9A 3ZWYA 3PGA1 2O2HA 1X9GA 4HLCA 5BN4A 5KQLA 1G7CA 1FDTA 1P75A 4V38A 3UWSA 1GLNA 1ILWA 3G7UA 1S3IA 2WWVD 2XTJA 1KAMA 5IAJA 3UAYA 3WK6A 1QIJA 2EKBA 1P5ZB 2WC1A 4INPA 4YMSA 1HETA 5FI5A 3TRHA 2CJYA 8GPBA 4D0SA 2FFBA 1N25A 5EP3A 2C9MA 2O3TA 4CG2A 4F72A 4LYDA 4QU5A 1W9HA 4WEQA 1KWGA 3VR4D 3DMHA 4JUAA 1TUIA 4HI0E 5FXMA 3S8YA 2FZLA 5KYUB 4PZ0A 4CMHA 2Z3ZA 2F64A 1NVAA 2DU8A 3HLYA 4ALJA 1E92A 4IX1A 4BNLA 4YONB 3L1UA 1KO1A 1VPLA 2RAFA 3KKEA 4C6RA 1DINA 1C4WA 1IYZA 3HP4A 1U31A 1MAHA 4MVCA 2QD4A 4HB2A 2Q2WA 5CT4A 3OQVA 1AUQA 4MB0A 4PS0A 2HNBA 3R74A 4C1NA 3AJ8A 1T2CA 3P19A 1JBQA 2X5JO 1V1MB 1ORRA 2QUBA 4K6HA 2TYSB 3JQRA 2MYTA 3SAJA 3TYXA 1JZQA 2FW9A 3ZOKA 4GI2A 3QHQA 1KHHA 3DCYA 2VBGA 3LOQA 1R6AA 3WLLA 3QYFA 2ZW9A 3OCVA 5TMDA 2IKSA 3K2BA 1TTTA 2BEJA 5KTSA 2CLHB 4FI3C 4OL9A 721PA 1U9IA 3M5PA 2J31A 1TJ3A 4G0VA 1UWKA 2ZJ7A 1BMDA 1VJCA 4FMCF 4YI5A 2IY7A 1R9MA 3O3OB 2X5NA 3OE7D 3DO5A 1TE2A 3I5XA 2I2WA 3PX3A 3A28A 1C0IA 2DBZA 1MB2A 3F8WA 4LE1A 3EA0A 1OU4A 3TJMA 4BP3A 2HHLA 1AOXA 4D79A 1BDIA 2ZM5A 3A27A 1CBUA 4WCFC 4FOLA 5I8PA 1YQ9A 4L3VA 3RH0A 3ZLJA 3KAPA 4AZWA 1KQ3A 5CDSA 1I32A 4QLAA 4D26A 4R40A 2GN6A 2Q7XA 3A2NA 1YB5A 2VNAA 1CX9B 1XEWY 4OHOA 2QR3A 3EUWA 2BRUA 2OAEA 3VH1A 3PLAE 1SCUB 1QF7A 2WZQA 2X86A 5C1DA 4JC8A 5B6IA 3PNVA 1PTKA 2VDVE 4PYMA 1IY9A 1ZXLA 1GOTA 2BCJQ 3BDIA 1JVSA 2ZB8A 5H81A 3NHFA 4L9RA 3SX2A 3D4LA 3RRNA 4AZTA 4GL2A 2MSDB 4R2HA 5AVJA 2B37A 3RUIA 1Z88A 5K6TA 2GBCA 1MEEA 3IDAA 3TOXA 5FPHA 2WF7A 2R79A 3CRVA 3PI6A 1TJ5A 4ZCMA 1VL6A 2W43A 1JDVA 3ZE0B 3C5WP 1R27A 2A35A 3RS8A 3VR3A 1RZRA 4AY2A 4O2LA 2Q1WA 4P3NA 4RS3A 2H9IA 3OUZA 4MUGA 3AVPA 1Z5WA 2DUWA 1YHYA 3WGOA 2ENWA 4GZMA 4ARBA 5JOQA 3ZJUA 3P2KA 2PH1A 2Z2KA 5GV8A 1SM4A 3KVYA 2HF9A 2IV7A 4X90A 4S05A 1YGPA 1VZ3A 4FXPA 5AP9A 4E2YA 2WE7A 3KQTA 1B16A 1P5JA 2NXCA 3SKYA 1Q57A 2BSAA 3L7AA 3MSCA 3O26A 3TOCA 4DCGA 1DAGA 4NL4H 4XX0B 3WE7A 4JI4B 4M0KA 3A7EA 4ZI7B 5LIPA 2VDWB 3ASYA 2PFSA 3PD7A 5KSPA 4CBVA 3M4JA 4UEJA 2DWQA 3ND9A 3W7BA 1GRVA 2YWDA 5EP2A 3DEJA 1M2GA 4UPDA 3VHXB 1C1XA 3W2TA 5EA2A 3MS7A 2ZSIA 1KDOA 3DONA 1KJYA 1RXEA 3LLUA 5FPPA 5IVIA 3G5AA 3KWFA 1JECA 1EVIA 3WC4A 2Q07A 2XE6A 1GUAA 2C84A 2GCNA 2J87A 3DAYA 3EEYA 2PXCA 1A97A 4RIGA 5IF3A 4DC1A 5IEBA 4DS3A 1X19A 2HFKA 2VKQA 1VBFA 3M83A 3SKXA 1RRMA 1D2RA 1E2MA 1UKVY 1W76A 1G20E 2IYXA 3N6RA 4QWMA 4YRZA 3A6KA 1SQFA 2BKXA 2P2ZA 2XRYA 5HTKA 1LFDB 2HGSA 3FTQA 1QC5B 1X8JA 3HZZA 4K26A 5A6VA 5JASA 2CJFA 5E9AA 5LZ2A 3AM5A 4MUJA 3ESYA 3EXIB 3I6YA 3OU6A 4X71A 5CYOA 4BATA 2IYNA 1B23P 5EJ8A 3RVQA 5D6OA 3HN6A 4XWTA 3UMJA 2JCVA 2Y93A 2H1VA 4D25A 1IXSB 2G3YA 1GKUB 1Q0ZA 1XZEA 2GZAA 4KIJA 4NEQA 2RAPA 5B3LA 1EWYA 4C4AA 1ZITA 1IHPA 5FOSA 4IDNA 4WBXC 3DBIA 1S9HA 2ZREA 4LV5B 4DXHA 1S8NA 1KEPA 3L0ZA 3O7MA 5DN9A 3R8FA 1ACMA 3WWOA 2ERXA 1ZGAA 3UJ3X 3ETEA 1N5JA 5GONF 1FFXB 2I4OA 4KO3S 2PAFA 3JWIA 4HPXB 3NM4A 3HI4A 3P20A 5AW0A 4C7JA 1TD9A 4B32A 3FTNA 2O5CA 4D9JA 5HJ2A 3PENA 2P0EA 3R3HA 4B79A 4BFSA 3V6MA 3TFWA 2APJA 1FC0A 1GAXA 1HG1A 2VDLB 3EGXB 3IP1A 4CIAA 4DT1A 2PTGA 2XDAA 2YVKA 2Q2QA 3EFBA 4GI3A 4BQNA 2HA6A 2WW8A 4FHEA 4DOMA 3R3ZA 3TRFA 2FSFA 4YLGA 9GPBA 1NSYA 3FMIA 4M9SA 3OWHA 4TTTS 3Q40A 2Q0SA 2O0LA 2V8BA 2YCLA 1L7EA 2CFIA 1KVQA 2RB5A 4DR6B 4CQMA 2YWGA 3FCOA 2A5GA 2BUAA 4YR7A 2YN4A 3WK9A 4TL6A 2WIFA 2YJTD 3O93A 7GPBA 4O2BF 2Y4OA 4I19A 4DG8A 4V03A 5FWNA 1LC0A 3O90A 4UE2A 2I34A 1AZSC 1ZBQA 3FVVA 1MOQA 4L76A 4LNHA 5AKEA 4FKBA 4BVFA 5KNCA 2I6TA 1Z06A 2OMKA 1UFRA 2XB4A 3FUTA 2IBSA 1D4FA 1WHTB 4Q1EA 2VZ0A 3PR3A 3OM1A 2YV2A 4QQ8A 3ZBPA 4BCDA 3NDBB 4JDPA 5KZMB 1GA1A 2FMXA 1BS9A 1FU4A 1XAJA 4UCXA 1TADA 4B2YA 4EENA 4X3OA 3DFUA 4YGYA 1T3TA 2OGSA 3UAZA 2OKGA 1F8XA 2G9RA 1P3Y1 3PQ3A 4F8EA 3OZIA 4U7WA 3GA7A 3F0TA 1VYTA 1WXEA 1RRFA 2ORYA 3N74A 1OH5A 4GVXA 4DCUA 3KS9A 3OTGA 4ID9A 1N6PA 1KVUA 1ZA2A 5TV2A 2Q1TA 4OI1A 1H2BA 4BXOB 1H94A 2YY5A 1NJ6A 1GFWA 1Z4IA 3S40A 2W5UA 4CHTA 4DC9A 4FWTA 4OXRA 3T5TA 2NTVA 4RDHA 2O8EB 3QLVA 1Q77A 3D6VA 4EMBA 1UM9B 3QPVA 1L7MA 3BKWA 2O2ZA 3R0VA 5FWAA 4LG1A 5LOVF 3GNTA 3JD2A 2I55A 2QTTA 2JKZA 1JHVA 1YKFA 4X1OA 2GN9A 1BQEA 1YRAA 4MZDA 2OM2A 3EXG2 4J0EA 3L4JA 1XE3A 1ODTC 2O0JA 1M2EA 2EIHA 2VT7A 1WJGA 1QG6A 2Y1WA 2RJOA 2DFKB 1ZRHA 3BHNA 4N40A 4NYIR 3S81A 1TM4E 1YF3A 2N46A 4MDYA 3G2OA 3DGEC 1GPKA 4MIYA 5CLQA 4ITUA 2AQ8A 3IILA 3KYDA 4HGYA 1AKYA 4P38A 1X74A 1L8AA 1RKQA 2ZAGA 3R5HA 1MBZA 4LGMA 2VHTA 2XEXA 3X3HA 3B53X 5KTNA 3H5OA 3OX1A 1E32A 4NBNA 5DBGA 2VF8A 3ZY4A 3FNRA 3K5IA 1RLOA 4V0LA 4EO9A 1JPUA 2HU7A 5SYAA 4ZVNA 3I8OA 4KYIB 1R0BA 1SURA 3OAAD 4J3JA 4G8JA 4F4HA 3VVLA 1EQ2A 5CM9C 5JAOA 3MC1A 3OPYA 3NHYA 1ELOA 4TMFA 4CKWA 4EW6A 1TTQB 1PZMA 3EZLA 4DV6B 2NXJA 1FS5A 1MHPA 1G8YA 1GGHA 4FXOA 5K0CA 1P2UA 2QAGA 4YV2A 1M33A 1NVMB 4X92A 1JW9B 2XA2A 5JAZA 2JAQA 2HA3A 1ISRA 1FLVA 3QTBA 4LK3A 2XUKA 1O5TA 2B4AA 5AVRA 1KJWA 2BZGA 4XJTA 2GBLC 2BSQA 3PG5A 3HR4A 1QIEA 4YJKA 2XKJE 1YQDA 1YZQA 3OY7A 1DMRA 3Q0TA 2IELA 3G85A 4L8GA 1NAIA 1PFKA 2FLWA 1NOKA 3W9BA 4GDMA 2OXCA 3F97A 1W0KD 4TUYB 5PGMA 3I5UA 4KKXB 4DL9A 1Z0DA 4RMIA 4GNRA 2HLNA 2P9HA 2WYIA 2LKCA 2C4NA 2HJ9A 2W71A 1Z4LA 2ZP1A 1JA0A 3GPBA 3QFHA 3WSWA 3WGTA 1DBRA 1IN5A 2Z9BA 2CXOA 4UHFA 1UK7A 4RGBA 1R74A 2P8JA 1M2VA 3MTDA 4MVJI 4C21A 3ZNNA 1I2CA 1U7UA 2L17A 4MLCA 4PYOA 5FUBA 2KQUA 3KIPA 1W19A 2QZ4A 1PRYA 1YI8A 4MW7A 1DEOA 1SUWA 4IGKA 3R6TA 3D8BA 3EDRA 2EG5A 2GTHA 1IG0A 2X9VA 3CZ4A 2VJMA 1OW3B 1WUHS 1H5NA 3PCXA 3R5XA 3RTGA 4IRMA 4W63A 4W7SA 4CQLB 3I1YA 4NMWA 1PW5A 2HT1A 5JH7F 1C4KA 1EAMA 4TGLA 1Z4JA 5JQGA 3EEOA 1C80A 4IJ5A 5GPBA 4P0QB 2O7NA 5KDOA 1RYMA 4DLVA 2UVDA 3ZTYA 1QSGA 2ZWVA 1G60A 4ZHQA 4P5EA 4YYEA 1T9HA 2PTHA 1UMKA 4OFXA 2O0KA 2PLWA 2XDWA 3IBCA 1XRSB 3QA3E 2JKVA 4RZSA 1AM4D 2ONYA 1H2RS 3M3DA 1EE2A 3M6UA 5AM2A 4MV1A 4LGCA 1HFWA 1E60A 2WG0A 3OF3A 1JN0A 3EIWA 3OCWA 4FCVA 4JBGA 4R8VA 5CFZA 1I7SB 2DPXA 3ZH2A 1WA5A 1YDMA 3CX4A 1QU2A 5H82A 3QX9A 2SICE 1UKBA 4R31A 4YEDA 2EG9A 5KSYA 3LUGA 3QVTA 1Q21A 2VDQB 2FPPA 1X1TA 2PQ2A 3VPXA 4UNRA 1Z4MA 3PHIA 2YJNA 2H85A 5C81A 1T6BY 1ESZA 3OZEA 4IHJF 3DMGA 5BOSA 4RLFA 2C42A 4IDFA 4O63O 5EHQA 4F7WA 4HWSA 4Q4HA 2A0XA 4WX2B 4B17A 2QIOA 4E2XA 1O0CA 2FWJA 5LB4A 1NMEA 1PN3A 1PO7A 3E3MA 3KPVA 3OFNA 3LNTA 1IAQA 4PGHA 3IVCA 3LBHA 4J94A 3REOA 3WOVA 5DNEA 4V0OA 3I0ZA 4ZQCB 1MZPA 2BDTA 1BA3A 3WLEA 4JL8A 4QULA 2CXRA 1NZFA 4B6EA 1XYGA 4L9SA 4PHGA 5CDFA 3HVKA 4RELA 1JXOA 1NSTA 2GDJA 3OKFA 5FA5A 1X1RA 3V8RA 2OGTA 2EWMA 4G2TA 2AA3A 2CVHA 4Z1MA 2GHQA 5AVOA 3KLMX 4FKZA 1UUFA 4OLJA 3MINB 1XHLA 2Q8NA 4RA9A 2OMEA 2FJUA 5KUTA 3SS9X 3UHPA 1C50A 3QFCA 4B35A 2ODTX 3LOUA 4F3NA 1UOOA 3TPZA 2CDCA 1NP3A 2Q3LA 2VKTA 1M6YA 4QBFA 2A84A 1KAEA 2OBFA 4ZIRA 2H5JA 4H3HB 4HAZA 2CLSA 1Z6AA 1SBNE 4LHWA 1HSOA 4HQFA 5JQGF 1G16A 4DBLC 3HJBA 2WZBA 4KLCA 4M37A 4E4RA 3BD6A 3C7CB 2ZWMA 1WXXA 2IEIA 4PG6A 3L4BA 4RY9A 3VH4A 3HWRA 4PSVA 2BFOA 2W2VA 5DXAA 1NY6A 4R2IA 5HBGA 1SCQA 2EZTA 4GMKA 5HP4A 2AK2A 2C9DA 3LCJA 4DDMA 1P3DA 3C6KA 3HA2A 4RF3A 1GFSA 1CR1A 1I4DD 1Z8NA 2VQ3A 2W4IA 3CPSA 3K0AB 3QI7A 1HLFA 3RAJA 3AHGA 3VZPA 3G0IA 3TLKA 1XNQB 4UOEA 2W6IA 4IXNA 1P45A 1WSWA 4QC2A 1WW8A 5IMSA 1Z12A 1S4QA 4WCFB 4WKBA 3ZE2B 1HG0A 4WACA 2J5QA 3U3RA 2A7XA 2QMHA 5LM3A 1FFEA 5B36A 5KPDA 1R4NA 3C41J 1LVGA 4DPKA 4EB8A 1H69A 4ZWNA 5H3HA 2AXQA 3KQWA 3E27A 1XMIA 3A1WA 3CHYA 4BNXA 4QQKA 2YXBA 3JQPA 3IUSA 3U3XA 4NOMA 4MROA 1U5AA 1N0UA 1ZC3A 3PUJA 3WMXA 1ORHA 4P4SB 1W34A 4GOMD 3EXEA 1SULA 3TB6A 4ES6A 1MH1A 4WADA 2CT8A 3H8VA 4FYJA 2KMLA 1GZ6A 2DQKA 5HKOA 1P73A 2QL6A 4QTXA 1BFUA 1YJAA 3LX6A 4ADSG 5CFPA 2VG8A 4TSFD 2E1PA 4IHQA 2X1MA 2PGIA 5CW1A 5F3DA 1UMBB 4YT8A 3KJZA 3KWLA 4WV3A 2YMQA 5DTQA 3T52A 5DHQA 2WD7A 4Z51A 1AIPA 4JEHA 4ZAZA 4KVZA 5ALZA 3GAMA 1PV4A 2P79A 4ESOA 1U0BB 8MHTA 2KBEA 2DB3A 2FETA 5FHQA 1X7ZA 2QQ5A 4OGFA 4HDMA 4OU4A 1J6UA 5KNBD 3BC1A 2YFHA 3O3CA 1M1ZA 4AKTA 2NYUA 4XPZA 1MT3A 4RXTA 2A14A 3M6VA 5G0SA 4IIUA 4AF6A 3DBLB 3K8YA 3V8BA 4YR9A 1VI6A 3NT5A 4G5QA 3RVDA 3WLKX 5FV4A 5L8VA 4Z6KA 3IMGA 3WFIA 4DXDA 4C89A 4D02A 4MYRA 1UMDB 3P45A 3O74A 1DKUA 3UQZA 1K6XA 1OZGA 2XTNA 1LPOA 5ES3A 4MVJM 4M38A 4OHFA 3UJ8A 4C0KA 2FPSA 3DUWA 4G8BA 4WIAA 2J7KA 3O9MA 4MPDA 2FLVA 3TNFA 3PNBA 4GNKA 3KUDA 4DCVA 2J41A 3DTVA 4PIPA 1J23A 4ESEA 2IVZA 2NO0A 2OCAA 4RF2A 5TS2A 2R48A 1QCDA 2DPLA 2P4UA 2RAUA 2XGGA 3JYLA 1O97C 2YNMC 4AY4A 4NZZA 1VMEA 3IEKA 5DE3A 1YVDA 1E20A 2OK8A 1UIRA 4CMIB 4WBNF 3G0BA 4BO2A 2GERA 4O5AA 5AO9A 5IDQA 2XWPA 4QKQA 1RLUA 3ACBA 4GI1A 5L3VA 2GWRA 4X94A 1F0PA 5D6NA 2FWPA 1LK7A 4NK4A 5HE8A 5BMVA 1OFVA 4YYZA 5DCUA 2QX6A 4NFHA 3INGA 4JT4A 5K3AA 2F1KA 3P0RA 2HRQA 5T3UA 1D7AA 2HCTA 3EMDA 1PUXA 3RSFA 5CEEA 2XVYA 4KQXA 1R8XA 1T34A 2P41A 2IUEA 3MJTA 3UMCA 1X92A 1R0ZA 2OEPA 1A5SB 2AFIE 4XLLA 5JZVA 2QTBA 4YPVA 4QARA 4TMZA 3BX1A 2J3QA 1T3SA 4Q9HA 4MKIA 1J39A 2AX3A 5LUAA 4HB4A 4PAWA 3N07A 3UC5A 1JHDA 5B37A 3X1MA 4KE7A 5DNVA 5JWOA 1AKVA 3B3FA 4BYGA 3SR4A 3E53A 3NH6A 1K92A 2PX0A 5REQA 4B81A 4MZXA 3LF1A 3ET4A 4H31A 1NYQA 2QE6A 1Y1SA 1UKZA 1NE7A 1VL1A 2W8BA 3DKPA 3ELWA 3MCTA 4EF6A 1FFYA 1NVKA 1YJQA 2OCIA 3R7LA 2RKBA 4NNPA 4RVNA 4AUKA 4DREA 4YLEA 2VTKA 5DLPA 3T7SA 2Z4TA 1TFRA 4MR7A 3WFJA 4IQ0A 1G2PA 3LG2A 2MINB 2YC4C 1O8CA 2VC2B 2QMUA 1ZH2A 3PHCA 3QPCA 4UFNA 4Y9DA 3K0SA 2DVMA 1VL2A 3FG9A 3QBJA 2WU1A 1I3MA 1K8YB 3G82C 3U7RA 1DWUA 5CH3A 2O6HA 1FQKA 1QUFA 1VIVA 4YV1A 4NNOA 5LMCA 1AUOA 2OV6A 4DIOA 2IHVA 5IJAA 2BGRA 4L8YA 5DKFA 3NGXA 2J59A 4CN8A 2PKQP 5H02A 1P6XA 3LFHA 4CM4B 5E8RA 2WHYA 2R1ZA 3FNHA 4QL3A 3ISTA 4FDMA 3KZOA 1G6KA 1M1YB 1YQXA 4FB5A 1D04A 1GZUA 5H16A 5A4IS 4PZAA 1GAEO 1XMPA 1VE5A 2ZRPA 1EZ4A 4JOBA 3H1AA 3Q98A 3V5NA 5I45A 4WBNA 2I4TA 2AJ8A 4LXUA 3DH0A 4D4KA 4TS4A 3FLEA 3B51X 4ENSA 5LQAA 4MKHA 5TVKA 2R751 4DRXA 4PGAA 4QYWA 4UVDA 2EX1A 2WB2A 3TBFA 5G1NA 4MI3A 1PG2A 4DGQA 3PUVA 3I5MA 3NOOA 3PXDA 4RVFA 1GITA 1M2VB 3R0QA 4HNHA 4HNVA 1S0UA 2BGUA 4KO2S 3UJBA 4TV8A 3M4YA 3TZCA 4LY6A 1N2CE 1P7VA 1Z08A 2MWMA 3FZQA 3IGFA 2XRZA 2H3HA 1ZN9A 3NOQA 2IXBA 3LTEA 1KOLA 1FTWA 2D1FA 3WAJA 3DJYA 4A5OA 1P1KA 4MHSA 5JHHB 4B9AA 1Z34A 3NYQA 4MR8A 1E4EB 4B44A 4BEJA 4CPDA 3LPMA 1Z28A 3EAQA 3HUTA 1SRQA 1VHDA 5HW0A 4OEHA 1E2KA 3SR3A 2PUDA 5HF9A 3JVVA 1SRRA 4R3NA 2G1JA 3D4NA 4DR7B 2C00A 2JJ2D 3NOVA 3OI7A 1CR0A 5JS7A 3E15A 3NASA 1P81A 1QF9A 4RV5A 5JC1A 1ZM3A 1T9GR 4LE2A 4YWJA 4IV8A 1F38A 1U81A 3ITKA 4D8VA 2BFMA 1NW9B 2CNKA 1NX6A 3GLHB 4R01A 2P9GA 2XZLA 4K9DA 4P5DA 4V0ME 4BTEA 1R2QA 5T64A 1I1NA 4C7XA 3GO4A 1JDBC 3CWQA 2VYVA 2OCYC 2PU7A 3IIMA 3WRWA 2FPKA 4J1SA 4KN8A 4G5YA 1FYWA 1WULS 2WUVA 2AC2A 1Z6PA 2QLJA 2GKSA 2WSSA 3LLMA 3GLIE 3SR0A 4PTZA 4L6CA 3QVOA 4X6UA 3D54D 3C74A 5SZIA 5CGZA 3PSAA 4LQ4A 4U8GA 1Y7LA 1E6LA 2NO7A 2P0AA 2DQ4A 3FFWA 1JE0A 3NTVA 1QVWA 1E2BA 4B43A 3CLHA 4HMPA 3SM3A 4DY4A 4F86A 4OTZA 2BLNA 2D1TA 3C3DA 3STYA 3V9PA 5B57C 1QQ7A 3UYKA 5L3RA 4QECA 1W4ZA 2VPZA 3ENVA 3S1AB 1YRBA 3A7DA 5KQGA 4NI5A 3KYBA 2D1SA 1VECA 3RSGA 1NNI1 3SIXA 2J08A 2WR8A 2VWQA 3C1OA 4DLYA 3STXA 4F1JA 3C5CA 4YRIA 2NZWA 2BM1A 3ORSA 4C7VA 2KHZA 3EH2A 3PHLA 2VJQA 3KEOA 4H6XA 3F6BX 3SYLA 4JMPA 5ELLA 4LRWA 4UBNA 4OQNA 4F5ZA 2EC5A 4H7FA 3RU3A 2NQTA 4XQEA 3UT6A 1PL8A 4LDRA 3PKJA 2R5FA 5EG5A 5BVGA 5IXYA 2C99A 2QVLA 1X13A 1WCIA 1GRQA 3LVRE 4EO7A 3BEDA 3JTMA 4DKXA 5GJBA 4XUCA 3BTUA 5IJWA 3PSHA 1J8YF 2BBSA 2WT9A 3ZZUA 3OHPA 2QPLA 2XUOA 1BX3A 2AZXA 2I03A 4OU5A 4UCQA 2PBLA 5ARCA 3ZJ5A 3HJHA 1RJFA 1M8JA 4CM7A 1T3GA 1VIDA 4B3DA 2UZ1A 4KPFC 4BLOA 4D2IA 3SI7A 3P9QA 4Q4AB 1S96A 1NULA 2A9VA 5TPWA 3R9KA 3SJCA 4TWZA 5EYPA 1QTIA 1VIAA 4HDRA 3UTCA 5K45A 1XUOA 2DT8A 2LZ0A 3QGMA 4HN2A 4IJUA 3RC2A 4EEZA 2VJAA 5KWJA 2YJ5A 4P86A 1XNJA 1X7WB 2D4HA 2AQKA 3IHLA 1TMOA 2YV5A 3FOEC 4NAVA 3KR2A 5IAGA 3FSGA 4E12A 3GEGA 3V34A 1C9DB 3DWIA 3PNPA 1Q6YA 3OQPA 4R51A 8ADHA 1HKUA 3G5UA 2A4KA 4Q1DA 2G1AA 4IIBA 3IQHX 1DAIA 1Y0BA 2QLTA 3F6EX 4B34A 1JF8A 3KAQA 4HWTA 5JYBA 4O1MA 2PKCA 4JB0A 3GVXA 3W7AA 4HUTA 3GD7A 2DECA 1EUCB 1M0SA 3PV0A 2XVXA 1G41A 3P9ZA 2QGFA 3Q1LA 1P7YA 2OC9A 2WIJA 3V7YA 5ISMA 5CVVA 1Y7IA 1UBHS 5EQDA 1WKVA 2EYUA 5U1PA 3N7TA 3RF7A 1HFEL 2O59A 4RK7A 1NLZA 4BZQA 421PA 1XP8A 2D13A 5ANRB 3D8NA 3EC1A 2I8AA 3DZHA 4A4DA 3WB9A 2C4UA 1U11A 2P91A 5CDYA 1LX7A 2D1RA 1EEHA 1Q3TA 1U7ZA 2B7BA 2QW1A 1ZONA 4R05A 2EDAA 1SG9A 1SIOA 1QTNA 2JCYA 4QFMA 1DJPA 4LECA 4M3NA 3ZCTA 1E2HA 3WNVA 4ZU1X 3ZZ0A 3CZ5A 4OQMA 5C18A 3FM9A 1SHUX 2NXEA 2WSYB 2OBBA 5EVCA 2CW5A 3LC0A 2EHDA 3ZDDA 2REQA 3BSYA 2H2FA 1RPJA 2PXHA 3CPHA 3O8DA 1PR3A 4HRXA 6REQA 5FR2A 2A0YA 4J2HA 4QYIB 9ATCA 2NTEA 3L07A 5HZHA 1QLWA 3AWDA 3PVZA 2WSBA 4C9BA 3BAZA 3ELDA 3RC9A 1P31A 1EFTA 2ACKA 1NP7A 4XM0A 5FOQA 3H97A 3TXAA 3F3MA 1RLIA 2HUPA 3NUQA 4U2CA 3Q9LA 2FI1A 1W1UA 3UPDA 1G66A 2EJVA 1SG0A 4D81A 1RRKA 4CG3A 1X42A 2WZDA 3M82A 1XA4A 1CZHA 1X7XA 5FFNA 4CV0A 1DCTA 4Q7KA 1VA5A 4UU1A 1B8NA 1A1VA 1PU2A 3FDZA 4XKJA 4IJKA 3KOMA 2WJ4A 2B2XA 5DLDA 4ENQA 4TMTA 2WD9A 1VGQA 3IODA 3FR8A 3R9XA 1D0IA 1L7QA 4JS0A 4RKYA 1TAHA 4LXTA 5C5EA 1N2CA 1F60A 4PFSA 4D46A 3ADKA 4YA6A 1TIPA 4KN9S 4DIKA 2RD2A 4QLBA 4WXHA 3KSZO 1MN6A 1DS6A 1TQDA 2BSXA 1FUKA 2Z3WA 5JD4A 1WXWA 4JOCA 4TTPA 3MBOA 5DGDA 5EXDA 4HNAA 1YASA 2A9OA 4GLFA 4B83A 4L5CA 3IOCA 4CM9D 1KERA 2OTCA 4OQFA 3SFZA 4I5EA 4L3WA 5BYKA 1KZ4A 3HVJA 3EEFA 4DM3A 3EISA 3SQLA 1M72A 3ZG6A 2C4KA 2GMWA 3FJYA 4NU0A 2Q29A 3NBAA 4JJKA 1GSOA 4Q3CA 3K5HA 4Q9NA 1TW2A 4L07A 3OM8A 1SQ6A 1ZCAA 3JZFA 2ZRNA 3PA6A 3RBVA 2GN1A 1ITZA 3V2IA 1VLZA 2DLDA 3TNJA 4QD3A 3VYRB 2ZT6A 4A2QA 4JODA 2Y1XA 3ZQKA 4GEGA 2Y67A 3H1BA 2RB4A 4RTLA 5BUSA 3PFFA 4I08A 1TUBA 1ZJWA 4ZXPA 3L46A 1ZIDA 3RFUA 1DKMA 3OEWA 4ML3A 5TY0A 1V11A 2H8KA 1EQAA 5DHUA 2CYAA 3KOUA 1Q1BA 3GCDA 4RDXA 2WU4A 2GZ1A 2JGFA 1SUBA 4D9IA 1ZDMA 4H35A 2E37A 4HRYA 2WY2D 1AQLA 3QFFA 3JQAD 3CONA 1F17A 1PDOA 2DG2A 4NZYA 3K2EA 5B1DA 1X39A 1E9FA 1L5GB 4HWRA 4N0EA 1T36B 4NDZA 4UEWA 1WF3A 2OA0A 4FCWA 2ORWA 3IT1A 3TMKA 4JGBA 5ALIA 1ZD5A 1EDDA 1LS6A 1QYCA 2CK3A 1KY2A 2G07A 3IPYA 3GELA 3L18A 4HXGA 2QG9A 2WFLA 4G0NA 4K28A 4MKFA 2EFYA 1RC8A 5HM6A 4EQ6B 4G97A 3HNPA 3UNXA 3NHRA 3K1AA 1HC7A 1KBOA 2V7QA 2ZI6A 4W6ZA 4BKUA 4UNQA 5A6SB 5LPNA 5JIBA 4GXNA 2A9PA 2X0EA 1XBTA 4G1FA 2VOEA 1LRKA 1IM5A 2MU1A 3N5CA 2FUG1 4MV7A 3RG2A 1LBQA 2ZIFA 1US8B 4WK4B 3SNKA 1AQUA 3LF2A 5C8YA 3GQBA 3D43A 1RWMA 5K6RA 1WVGA 1KDYA 1BCSB 1TAQA 3AY7A 3H2SA 3KQKA 2RGNA 3OQIB 1XTPA 4P3PA 3HO8A 1U0GA 3SC3A 1FUUA 2WWXA 1SU4A 1R5BA 3A3OA 3TSZA 3BMQA 1N1MA 3RVOA 1MOZA 5D2CA 2GF9A 4U6QA 4PHTA 4WN3A 3GUZA 3D4BA 3IXQA 4UUAA 1LSUA 4CF7A 3FRJA