4YCBA

Structure of a single tryptophan mutant of acetobacter aceti pure
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
159
structure length
159
Chain Sequence
b'APVVGIIMGSQSDFETMRHADALLTELEIPHETLIVSAHRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETFRALQTASVPNSPIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
publication title Structure of a single tryptophan mutant of Acetobacter aceti PurE
rcsb
source organism Acetobacter aceti 1023
molecule tags Isomerase
total genus 53
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 2015-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 4ycbA00
5CLIA 4AY4A 2FWJA 2NSLA 4ZMBA 1O4VA 5BOSA 5CLJA 2H31A 2FW9A 2FWPA 5BOSB 5CLHA 3OOWA 3RGGA 5C5DA 2FW6A 5CVTA 3LP6A 1D7AA 3RG8A 2ATEA 3OPQA 5BORA 3TRHA 4JA0A 5CTJA 5CLFA 2FWAA 4Z7JA 4YCBA 3KUUA 4ZC8A 4ZK2A 4YCJA 2FW7A 2FW1A 2NSHA 4AY3A 2YWXA 2NSJA 5CLGA 1U11A 3ORSA 2FW8A 4YCDA 2FWBA 4B4KA 4YCCA 2FWIA 4GRDA 1XMPA 4ZJYA 1QCZA
chains in the Genus database with same CATH superfamily
2FFHA 1L4KA 2AE2A 5H1YA 1LK0A 2DJIA 2JHFA 1FFWA 5AESA 3K92A 4DQ0A 3ID6C 1R3DA 1VG0B 2PK3A 3ETEA 3ZCQA 2ILTA 4M0EA 3TZBA 2BGWA 3Q4GA 2YOFA 3OLZA 1NXSA 2E89A 1F3OA 1UFQA 1JG6A 1S6YA 2HNBA 2VQEB 5CLFA 4DCGA 3IDFA 5I8ZA 5DISB 5JMPA 3U44B 2H4FA 1TJPB 1HDZA 4PYMA 3EHEA 1YRBA 4V3CA 1E5VA 3OCXA 4YDSA 4MVXA 1QANA 3NHMA 5CBKA 3R3UA 1FU8A 4EAAA 2I3GA 3INGA 4JP1A 2VDMB 4ZQEA 1P9LA 3NHPA 1GGFA 2GPAA 2EBHX 4PHGA 3L1VA 1H22A 1NBOA 1SHJA 3OZRA 1OD6A 1Y7IA 3IE2A 1EWQA 4ZOEA 1SCQA 2Y1KA 1U4SA 1ZN7A 2Y0PA 4GLFA 1VMAA 2AWOA 2J3QA 3IQFA 4Q03A 4P7GA 5CEJA 4DLVA 1JDSA 2DUUA 1YZQA 2EEZA 2HMYB 1OLXA 1OBVA 2FN8A 2YTZA 1VJGA 3DTYA 3SJZA 1E32A 1VP3A 2XPCA 3IAUA 3NS7A 1J09A 5KYTA 1WEHA 2QA5A 3OLWA 3Q41A 3FCUB 3PDIB 4NMWA 4RXTA 2QBYB 1PS0A 1TTHA 4Q00A 3EOAI 1ESZA 3NGLA 1JBQA 3Q0IA 3A05A 1Y1LA 4GP7A 3UM9A 2J3DA 2VDOB 5AI4A 2Q1SA 2WVAA 4I66A 5IC6A 3V4ZA 1H4SA 2Z5FA 2I4RA 3OCUA 2JLWA 1RBYA 2ZR0A 3QNUA 4YGYA 3GUHA 7REQB 3KAJA 3PC6A 4IEFB 3BSWA 1Z15A 2RI1A 3UT6A 3QVJA 4OI1A 4BGEA 2BDUA 2DFTA 3O3OB 2JGMA 1U8ZA 3M49A 3IP6A 1DUIA 2OPHA 1VE1A 2WTXA 2IRWA 1AQJA 2CNNA 3T15A 2RG7A 4QG7A 3OEHA 3K2EA 3RTDA 3MSXA 2OK8A 4LFCB 3OPYA 2C2XA 1FSPA 1DV2A 3H1PA 3U2QA 3IBSA 1EFVA 4XW2A 3AR6A 2GPJA 2HLHA 2PFGA 2BRUA 2ZJYA 3GUZA 4MQ6A 2WJWA 4S2UA 2HOQA 3EISA 4I81A 4ZXPA 3IBTA 3IV7A 2HNAA 3VR0A 5E6SA 1ZOLA 3H04A 5KTNA 4LHZA 1BIFA 4PLYA 4D6XA 3QJGA 5BUZA 4POAA 2L69A 1EJ0A 3BXHA 1PWZA 5H16A 4C05A 4KI0A 4WXEA 2XB8A 4LGCA 3RJMA 3ZV3A 4PFKA 1XCGB 3TL3A 1TO6A 3T5PA 1BW9B 5CM8B 1VE3A 2H9AA 4XOIA 3MB5A 3UIEA 5ERYA 2VQ6A 2XKAA 1GPYA 3GI1A 3RAPR 5BR7A 4OEHA 4DMLA 1DAOA 1VFPA 2RJ3A 3QBDA 4MUGA 4AF7A 4NCAA 3KWJA 2O5CA 1OWMA 2PA0A 2ONJA 2WWWA 3ZCUA 2H11A 4FFDA 3C8HA 1ORVA 4X6LA 3D64A 1FTNA 1EGQA 1TZMA 2M1ZA 3FI0A 4HQLA 1V43A 4ZARA 2H92A 3X2EA 3PDJA 2HU5A 3FNGA 4TXMA 1KPIA 1L4LA 5KJ6A 3S40A 4JGIA 4X6YA 3UMYA 5TIIA 1T3ZA 1WXDA 3RVBA 1UM9B 2EX0A 1K97A 3HKEB 1QVAA 2VK2A 4H3VA 3EVDA 1EP9A 5ERGB 4ETIA 5HJ2A 1FUYB 1H85A 4C1NA 1E0AA 3U7QA 3H75A 3PWSA 4U8GA 1LB1B 3EPRA 2VAWA 2B34A 1WPQA 3KR0A 3MCZA 3T35A 2R65A 2P9TA 4A2PA 3VR5D 4F3TA 4OYHA 2HBRA 1HXHA 2YN0A 3R6WA 1JSRA 5EKTA 2PL5A 5THKA 5MDHA 3Q7IA 3TEFA 2FSGA 1GARA 4GOKA 4QJ5A 2VEOA 2QL5A 4KJXA 4QTYA 1S9HA 2P75A 1LC0A 1POXA 3CO5A 2HR1A 2A59A 1CLUA 4AO7A 2FFQA 2R8PA 1SKBA 3PXEA 2O4UX 2HRBA 4XYEA 2V4ZA 2Z1DA 4LK3A 3E3LA 4C4XA 1BCRA 1RYFA 3QOYA 3VU3A 4IDGA 2BM1A 2Q9AA 2VHUA 2C7PA 4K05A 4AF6A 5TB5A 1R5OA 1WBJB 1FNNA 1G5HA 2H3EA 3BSYA 3G13A 4OB6A 3KYJB 4PV7A 1QWOA 2DJ5A 5B1YA 2ZB7A 3A31A 5GM1A 2EATA 1TPZA 4MCAA 1J7JA 1SC9A 2QU8A 4P38A 3M9LA 2COEA 2M6SA 3T54A 4AJ4A 1E1NA 2F64A 5E1DA 5KYNA 1WKVA 3ZDEA 3E18A 1Z4MA 4OP1A 1DWOA 2V98A 5TS3A 3UY4A 1K7XB 1RJFA 2WYWA 3BWYA 4JBNA 1E3EA 3EQZA 3I5UA 1ZLXA 3S7TA 3NTUA 3QUAA 4FW9A 4G25A 2ZYTX 2JIQA 1JF8A 3E53A 3LF2A 1HT2E 1NFQA 3DL4A 4IPTA 1RAHA 3WZMA 4D9KA 4HNTA 4AI6A 1NL3A 3AEQB 4H17A 1T2AA 3E9RA 4BNYA 1DKPA 3AC0A 3ZE8A 4MLCA 5EZYB 1V96A 4TRNA 5TSDA 3RYTC 2V55B 5ENZA 3OCVA 3FZEA 2PX3A 1RXUA 2P2LA 1DO8A 2Z04A 3CEJA 3TTVA 1G38A 1C3OA 2RB5A 3DLIA 4EQ6A 4ZGGA 2OD2A 2UVPA 1XWWA 4NMLA 4J7AA 2BR5A 1WCYA 1VIAA 5HQ3B 1ZG3A 3TLXA 4ZDKA 3QTLA 4GQAA 3OIWA 3A1UA 8AT1A 1NQWA 4Z0TA 5GQSA 2BFDB 2IPXA 2DLCX 1S2NA 5MN4A 4FJ0A 3FAKA 3MPOA 1VTKA 4PG6A 2VYND 4FYKA 5TPZD 3GJ5A 3HNOA 5EIBC 4CR7A 4TLBA 4LWQA 5ALRA 5L3VA 3NI2A 4IIJF 3KOMA 3G68A 3QH4A 3MZ0A 1VKRA 2AT1A 4Q4HB 1PJ2A 1Z8DA 3UMVA 3VKVA 2L17A 4KFUA 1UOQA 2C2KA 3FWYA 3P1JA 5CDYA 4RGBA 1LSJA 2NU7B 1PV1A 4J1SA 5B12A 5KTMA 1FDTA 2CL5A 1UC8A 2ZRLA 3EVZA 4OLJA 2NVUB 2MT9A 2PLFA 2EZ8A 3C16C 3G5UA 4NZMA 3SQLA 1WA5A 2PMCA 3QLJA 4AX4A 3NIGB 1RC1A 2A9QA 4ZU3A 4ZGBA 1FZQA 1Z28A 1C4KA 5JIBA 2Z6UA 2V74B 1YDWA 4CM8A 1FE8A 2DFVA 1AOXA 2PD3A 3ISJA 4Q4DA 3LK6A 2Q6OA 5EERA 1XYYA 4DIBA 4BKQA 1QB7A 5JS1A 4FUQA 4UAGA 3VBEA 5J4HA 4M7PA 1KYTA 4WBNF 2A30A 4IIFA 2WJ3A 2E82A 5BV8A 3KXDA 4DIKA 3NVAA 2BTQB 4PO3X 3K5WA 5IBRA 2IZZA 4DQLA 4ADSG 2V3WA 4F4JA 4LZNA 4D9MA 2Y66A 1SM4A 3R3SA 1YZFA 3ROZA 4BLPA 3RU9A 2VPZA 2XWJI 2Z9BA 3FVVA 1P9OA 2Q49A 4U9HS 1XA3A 5ESWA 4DIUA 4C1BA 3A4LA 3L4BC 5KB3A 1QIDA 1CRQA 1Z6QA 1Y9DA 3PS9A 4EUNA 1PQWA 3R24A 3RROA 3O93A 3TKLA 1AE1A 2GO1A 4IM7A 3G2JA 4PHFA 1F5SA 2WI8A 3AONB 1X1DA 4BBAA 3EBPA 1C29B 2PS9A 1NBME 4HGRA 2QD1A 2BI7A 2VH1A 1OXMA 2CJFA 3W0LB 3HJGA 3NHLA 5DM70 1SK8A 2YIJA 2V3CC 4JKIA 1OASA 1P5HA 2ZTVA 1N9ZA 2ESRA 2VYVA 4GXQA 1H6CA 1ZONA 5JR3A 2G1PA 3U6BA 2D5IA 4ZU6X 3D8TA 4GSYA 4YTEA 3MCUA 2XRZA 3D8HA 1IVNA 3E8XA 3LECA 3CCBA 1GTL1 2HF7A 3F9CA 4OI2A 3HDTA 4Y6QA 5DBEX 4LQDA 4OHRA 4UARA 5DHRA 4DNOA 4EECA 4RTQA 1MJGA 4OFZA 1YACA 2BKUA 4M98A 3MM4A 4FKMA 3OESA 4UEJA 5AIBA 5M7EA 2V7GA 3OOEA 5F12A 4B44A 1CNFA 5SYMA 4L4XA 4RH1A 2BHSA 1UOOA 3NVKI 3OZFA 1ISPA 5E6UB 4GX5A 3PXBA 2B7LA 2J4CA 4MDHA 4MJ7A 2FR0A 4KXFB 4ZVTA 3ENQA 4BN0A 3CMMA 5IKPA 4YMHA 1YQDA 1ZUHA 1M67A 3GCXA 1NLFA 3EHDA 2FOIA 1TLLA 4UU0A 1N5KA 1VP9A 2CL6X 1AMUA 4DYHA 3RVPA 4ENUA 1W30A 1E79A 1QLHA 3EGOA 3K2IA 3QE3A 2OENG 3UK6A 1AIPA 2PUWA 3WGQA 1T2DA 3CRZA 2C2HA 2QTMA 1GIAA 3X1YA 2G4CA 4ITRC 5FT9A 4WASA 1NNUA 2DF8A 2X58A 3SJ7A 4AZ0B 2PMFA 3DR5A 2VTKA 5FA8A 4E5SA 3MTEA 4GRIA 4XCQA 4A10A 2JIZD 1FLNA 1PGPA 3C3WA 4H6PA 2HYDA 2BH9A 2H54A 3KLNA 3PYLA 4Q34A 1PI3A 3U0BA 2CCKA 1DT5A 4BP3A 3TG2A 2Q2WA 3CEMA 3EGDB 1OI3A 2QMEA 3N0WA 4XPIA 4DMGA 2AEJA 2Q2QA 1QO0A 2BUAA 2H5EA 4RF4A 1J49A 3D59A 4RPJA 5IYZF 1MBZA 3DKVA 4I1YA 1OU4A 4L0QA 1DXYA 1J70A 3CZ5A 4OOEA 4WNIA 4ZEOA 3WL5A 3FYCA 2P9HA 1DXHA 4Z2AA 1APBA 3B53X 4OIFA 2R4UA 2YJGA 4Q9KA 3P9CA 3A04A 2IH2A 4P3NA 3V1LA 5B3LA 3N0RA 5DI3B 3V8MA 1B1AA 1G17A 4RL4A 4E5DA 3AF4A 2X6TA 3FPBA 1GLNA 4GE3A 4YQYA 2DQKA 2C94A 2JHGA 1CJVC 1RCUA 1IQ0A 3C3JA 4BUJA 2AFHE 1AM4D 1VL2A 2QMOA 4OJQA 3ZHOA 3HL4A 1UDXA 3DF7A 2FOXA 3FNRA 5MGNA 2RGYA 1KJIA 1XZBA 1M8FA 1Q44A 2VT6A 1RRGA 1Y8QA 4RD1A 1EA7A 3NXSA 1KIFA 3AETA 4D0LB 2J3KA 3M6AA 4IIGA 2CLEB 4N6NA 1HYGA 1U63A 3L3BA 5K3CA 3WE7A 4TZ6A 1L8QA 2CHQA 1GU1A 2SCUA 5KSOA 2QHXA 3R1IA 4NE9A 1QIHA 1S4QA 2WFZA 2NV6A 2ZWIA 5DM1A 4YAUA 4TN5A 1HURA 1H2WA 4JEHA 4X5OA 4CDRA 1HNXB 1RRMA 1GPJA 5KYKA 3FFAA 1ZA2A 3DJFA 5EWMA 4TS1A 5J5AA 3FB4A 1A04A 3RASA 3EPKA 3GVPA 1VCHA 4JLUA 3D6VA 4YUXA 3JALB 5CBPA 1H65A 1MGPA 4UNSA 4NP6A 4QZVA 2PUHA 3WBKA 2F1HA 1V8BA 3G2LA 1MH9A 4BX2A 1D4OA 4Y1RB 1BYIA 4TMTA 3VRHA 3RRFA 5D86A 5IDQA 1EHIA 3OY7A 3JU3A 4PF1A 5JJ5A 5DBIA 1M0TA 4M1YA 3KM0A 1K2VN 4R1QA 4WFKA 1Y5LA 1WLSA 2W2KA 4KRYA 4L4UA 521PA 2ATCA 1WVIA 2ZBVA 2ZIZA 4IDBA 4DW8A 4IHKA 1RYZA 2OILA 3AXTA 4YFVA 4WLVA 3RT9A 1KZ7B 2L0XA 3FOCA 1XKQA 4WCFA 2DT5A 4E07A 4JI0B 4B83A 1ND5A 3OZAA 4QEZA 4NZYA 4C6SA 3MB8A 1ZXBA 4J0CA 4L78A 1IDN1 2W4IA 3BMCA 1SHUX 1Z35A 3EIOA 5JMWA 4FYXA 3M1YA 5DIFA 1X7WA 2VP5A 3KJHA 4X92A 4CLHA 4ZALA 1A9XB 4TSRA 1EVJA 1XT6A 3ZUPA 1MAVA 1PBNA 3GIWA 3NBQA 2ZAGA 4L0MA 1AKVA 3BFXA 4IJWA 3ZXSA 4C43A 1JNYA 2HRQA 1IDOA 1S4MA 2AXNA 2GETA 2PZAA 3R5TA 5EZQA 4CI0B 1K3TA 4YLYA 5KPDA 4HN9A 3U61B 4L57A 3COSA 4DCOA 1VI2A 1YRLA 2ZRKA 1E2UA 4MEAA 3HR4A 5JEEA 5JH7A 4K2HA 5JSKA 4F9TA 4BQQA 4Y1FA 5AOVA 4C78A 3DEKA 1ZPDA 2QMHA 5JCOC 2ZUEA 2CBZA 4GBMA 2Q2VA 5FYQA 1VGVA 3IAHA 1E2NA 2VWHA 4G0QA 1OYOA 5T4EA 1PLKA 2KBEA 3TXYA 4BMYA 5EJ4A 1L8LA 3WBFA 1HETA 1VIYA 2XUOA 5TQ2B 1IPFA 2PSJA 2WU3A 3FGOA 4YJ3A 2AMFA 3IIMA 1KMQA 1Y6GA 1ZHOA 3EDCA 5P8WA 1XTZA 2FPKA 3F1KA 4M54A 4WN9B 2JKZA 3GXBA 5C8XA 1HGXA 2V5AA 4PN3A 1QK3A 5CA1B 2IZ0A 2RHGB 2HT6A 3VM6A 3TB6A 1NBMD 4CV1A 3O84A 4ZI7F 2VAXA 3BZUA 2WIJA 4BLVA 5ICGA 1RFGE 3AUAA 5CD1A 2B8JA 1TQ6A 4Y9SA 4TUYB 3X1WA 4NJEA 3R3XA 4W8HA 4RXMA 1E3WA 2R86A 1B43A 3P19A 4NYIR 5ICFA 3P4YA 3H83A 2EWVA 3PCXA 3QSYA 3ZJTA 3TRKA 3OM9A 2VP4A 3PJEA 5GTDA 3LLVA 1DAHA 3UTCA 1G2QA 1C3JA 2QR5A 1U0NA 3EFHA 5FPYA 2PEZA 4OFWA 4IV5A 4MOWA 4WLUA 5G1NA 1QGZA 2VXYA 4NYMR 3ZTYA 1H1LB 4FDMA 4YUZA 1N3LA 1HG1A 3OU7A 1QP4A 4HQFA 4KDCA 3O92A 2FFBA 1RAEA 3QPDA 1QORA 1AS3A 2XCIA 4MVJI 1YS4A 5KOHA 3WKAA 4QPCA 3P9PA 4XLZA 4RHFA 4FFBB 1OH7A 1U9YA 3A3PA 4DMCA 5LU8A 1TFUA 3BWBA 3HNPA 3GLRA 4CDNA 1MV5A 1P4AA 1SRQA 4OYRA 4U2GA 1MVOA 5HE9A 1IBLB 3K9GA 2RGWA 2XQVA 1CZHA 1Y80A 2OQIA 5DM4A 4Y2QA 1K5PA 4G07A 4C20A 1OI2A 3G89A 3NHKA 3RU7A 3ORQA 5KPJA 3FWNA 4GM0A 1L4NA 1TZ2A 3Q87B 4LZWA 4RE5A 4U3JB 4R0MA 1VE6A 5I7WA 5J2TA 1BDHA 9MHTA 4MKZA 4HP8A 5JAZA 3L0ZA 2B8WA 2Q3FA 5EAIA 3RUPA 3O0DA 1D2MA 5KYXA 1QV6A 1X0XA 4B43A 1XRQA 6GPBA 3ES9A 2VRWA 2VXOA 3MJ4A 3NKVA 3SSOA 3UOWA 3ENNA 5EUCA 2W98A 5A6SA 3LA8A 4FINA 1B7GO 1U9ZA 3K0HA 5DB4A 3H9EO 4YMUA 3LH5A 5B4VA 1T6ZA 3BH6A 4V0RA 2XAAA 2ATXA 2PVPA 1T5DX 4DB2A 1XL1A 2V7BA 1JJFA 4PAWA 2DUMA 3GRPA 3OMWA 5AVTA 4DIEA 2CYAA 1QDLB 3WIUA 2VDNB 3THRA 5I9NA 4FR2A 4JB3A 2IFTA 4JU8A 3HKCB 4ZVUA 3U6KA 1R0LA 2JKVA 4UHHA 2HX1A 1G20E 4FE7A 4LQCA 2R68A 4BJ3A 3BL5A 1NT4A 3R40A 5A03A 5EG5A 4H6XA 2Y3IA 2EFCB 3I01A 1P9NA 4I9GA 2A7QA 4W5RA 3D7LA 4TL8A 5FBLB 1MQAA 3CRRA 5DNDA 3WK6A 5AJZA 3I92A 5IDWA 3VPBA 4BZPA 5CDHA 1T9GS 2QG4A 1ZNQO 1VYUA 4R2LA 1JIIA 1Z2DA 2DPHA 1MB4A 1Y7LA 1YOVB 3HN6A 4FHDA 4CTNA 5FWYA 4D5GA 1KTVA 1F0YA 1BFUA 3VHQA 2QGNA 3ZZNA 1ZNWA 1VPLA 4FFLA 3ICOA 2ZR7A 1V41E 1II9A 1YOBA 4E0BA 1GAWA 2FPLA 3QJYA 5BVHB 4ZREA 2FWRA 3HCCA 3MMNA 1NC1A 4BVEA 5C8DA 1GNQA 2JDIA 3WHLA 2A88A 3JQGA 5D3QA 1YFZA 5U1PA 1L5HA 5LM3A 1NQVA 1ESMA 3AW8A 5JT1A 2JGFA 3EMBA 1ZMOA 2Q3JA 4GMGA 2XMPA 1U2ZA 1JHYA 4KMRA 4US1R 5JHHB 4CT4B 4RH3A 2V4MA 4PM4A 1VZ2A 2PX4A 4P82A 1E5DA 3IURA 3C87A 2C07A 4A23A 3GLHE 5LU9A 3FMIA 3C6BA 3IVMA 1KFKB 3IOMA 4OUDA 4J2OA 4R2IA 4MV0A 5I8WA 4LJ4A 5HK9A 2XCRB 5EI5A 4X7RA 2JGDA 2LBPA 3O7MA 3V42A 3RJ9A 3WIVA 5IX8A 4NMXB 3MAGA 4GLLA 4IY1A 1J56A 1HA3A 3R3YA 3DVRX 2ZSBA 4RKEA 2VUIB 2WDZA 1UCFA 3IKMB 4JSTA 1PWEA 5IM5A 3TTTA 2GGSA 4IWYA 4XIIA 5A9SA 4ZMSA 4GVLA 4YBZA 1BEUB 3K05A 3FAZA 2GCNA 5KNLA 2HLNA 3SU8A 1SEVA 1U6KA 5CNIA 3VR6A 5AW4A 1PL8A 2DE0X 3T3PB 3JYOA 3VI3B 4ESEA 4P98A 1NI3A 4MKHA 2SICE 4OHBA 4D41A 4ZCMA 4CIXA 1NSTA 2GHQA 3CN7A 3QU7A 4IR7A 1YHZA 3H3XA 4NRDA 3UAOA 5JD5A 1JWBB 1SC6A 1WZNA 1G9XA 1KQ3A 2XTAA 3ANNA 4KQHA 1ZMXA 1Z82A 5FBKA 4FBGA 4E15A 4PPFA 2ZREA 2YXPX 3NAQA 1KYQA 2XAUA 2G82A 4CQJA 1QAQA 4LISA 5SYNA 2O7VA 4JLAA 1XXHB 2JD0A 1T0PA 2OGTA 4FFPA 4RVSA 5CPFA 1AHHA 5CEFA 3DOOA 2ZYWX 1MXHA 2CD7A 4PLPA 3EXFA 5HUJA 4PC7A 4IDPA 4F6CA 3MVEA 4WVFA 1E9RA 2ZULA 4RK5A 1YE8A 1XEWX 4HB4A 1IY1A 4UEKA 1DRVA 3DOIA 4ZC1A 4BO0A 2IP1A 2AQHA 1J8FA 1AB5A 4O2RA 1M2HA 1U5CA 5M29A 4B8WA 2A9PA 2I54A 1E6WA 2IZOA 4FEEA 4P6VF 1IIBA 3S2EA 2KS6A 5EIAA 5KC9A 1LLFA 4O4JF 2AI3A 4GG1A 1CJSA 4I50F 3IE1A 3ANTA 3BIJA 1JB9A 4G8BA 2GKGA 1QP0A 1JQBA 3RVDA 3E9ZA 4CT0A 3D3WB 5EHZA 2AI2A 3VNAA 2WW8A 2ZGVA 1NVVQ 2QN8A 3B3QA 3NVDA 1QM5A 1RWBA 1HLFA 2H5LA 3AF3A 1FVFA 3PFFA 3IXQA 3KTFA 3CNLA 3WRXC 1S8OA 1YC5A 4QDJA 1M1XB 1AY0A 1HI9A 3KQOA 1GV1A 1SPXA 1Y8RA 2IXGA 3R3HA 2VYVD 1EPUA 4EJ6A 3S1AA 1FC0A 2HBZA 3Q7PA 4G85A 4CKWA 1XF9A 2KLBA 1X87A 1KAOA 1GLGA 4MYRA 1RQLA 3GFGA 4HZUA 4OO3A 2QRZA 1PK8A 2F9MA 4RZ2A 4KXYA 4XDHA 3A6ZA 2JG3A 2NUTB 3H1FA 2YOGA 3DDZX 4XJXA 3HB7A 4W1QA 2HQBA 1NI4A 2PKEA 4P7JA 3BE5A 3ZEAA 1T35A 3CUVA 4Y6LA 3K0KA 4WMLA 2HSJA 2WM8A 5K03A 4IQ8A 3RYHB 1OQAA 1Q0QA 1H9CA 1MO2A 3HVIA 4I8IA 2V0NA 1PFGA 2DMRA 2HCBA 4EY4A 1ZD8A 3PFGA 4GBGA 3SQOA 4DLAA 2LR0A 1BHJA 2J9GA 1S2MA 3E3OA 2CUNA 3THYB 2REQA 3QU2A 2R62A 2ZXEA 1E79D 3L7YA 1JEAA 4RKRA 3HJCA 1RJDA 3EPHA 1W85B 3GT7A 2GZ2A 1FOEB 1ZIYA 3CO0S 3KLMX 1XQVA 2DB3A 3LSYA 4G1UC 2B92A 3LYLA 1WJGA 1D2RA 2ZVPX 2GBPA 4JSRA 3A6HA 2WIGA 1UMKA 2GEFA 3DLPX 1OXSC 2ZFUA 1ZXXA 3GNQA 3VI4B 2IPAB 1NI5A 4PYLA 2XUHA 3UZUA 2XCUA 4EYOA 1Z2OX 3A9TA 5JANA 2CUTA 2QX7A 3NRCA 1SUSA 3HKBB 1JHQA 2Z8XA 3HFRA 4FGSA 2X6RA 1WP4A 3RJ5A 1YBHA 4LMBA 1QO0D 2FZEA 3CT4A 3WDMA 3ZCXA 5AVOA 1CUEA 3K16A 1N1GA 2I80A 2PT5A 2VPTA 1RQ2A 1VA5A 3K1AB 1DBWA 3F74A 3PQ5A 8ATCA 2ODWA 1GZHB 3PQ8A 1V47A 1JJAA 1ZM3A 4XB1A 4I3GA 5LQRA 5EP2A 5FTLA 3IKLA 3E2IA 1A9RA 3UUFA 3DT6A 4U39A 2G9RA 4RBNA 3SLRA 4DJJA 2PUDA 3HGMA 3EZ2A 2C4NA 3WGIA 4XSGA 4YPVA 2GVDC 1J00A 3OFJA 4GR4A 3HVJA 4ND8A 4R9NA 1LUAA 3H5VA 1SB9A 4OGLA 3WY9A 1YSCA 3GPBA 4W9NC 4EGAA 4DLKA 4O4LF 3P9QA 3G2OA 4NX2A 4DLRA 4FMDB 5L3RA 2Z08A 3UJNA 2AOVA 1H6BA 5LZ8A 5FWXA 4DCCA 2L82A 3UB4A 2PGLA 5F23A 1CS0B 3ZWAA 2I6XA 5KTYA 2YMQA 1RXCA 3ZN2A 5K8TA 2JI9A 4PNPA 3KQYA 2FPXA 1UBLS 2C4VA 1E7RA 1PJQA 5FD8A 4LNUB 4JLSA 5E7IA 4ZZ0A 3NDRA 4KAXA 4WY2A 3GLGB 2H0AA 4TMXA 4M8SA 3VH4A 1ZU4A 1V11B 1SQ5A 1YZUA 1JT2A 4JODA 2YWHA 2N46A 4YJGA 5PNTA 3D0QA 3FPAA 3TINA 2GXUA 5B57C 2AK3A 3U5ZB 2QRVA 4J0DA 2P2DA 4LRXA 3AEUB 1Y37A 3KB8A 3PX2A 5CVUA 3UG7A 3WB9A 1YIAA 3LSTA 1MHPA 4GEKA 3WL8A 5E2AA 5TMDA 4RTSA 2IYOA 3HMQA 2VBCA 3GF4A 2P90A 3W77A 2NTNA 2WPDA 4RH0A 4Z0PA 2O8EB 6ABPA 4GI2A 4RGVA 2W4QA 5EP4A 4OX9Y 1SH7A 4P4LA 1CULC 2ZCUA 5CHEA 4ZVRA 5MN5A 2AHRA 3A3YA 4W99A 4C7JA 2JZNA 3O1IC 5FI0B 4JP3A 2JCVA 4M83A 3VUFA 3I34X 3D5TA 1ZGZA 2UZAA 2GYVA 2ZSJA 3G7SA 3KS9A 2GO7A 1PNOA 2Q6VA 3I2GA 3ZGOA 1Z4LA 1VGQA 1DFHA 1QHXA 3G2NA 2JFYA 3QFSA 3CX6A 2ONCA 3Q1KA 3Q0TA 3KAQA 4AN1A 2PLWA 1FYXA 3U3OA 1UBFA 1AQ6A 1E3JA 1PBTA 1GTJ1 4N0DA 1U0HC 4E03A 5KNBH 3AZQA 1V45E 2Q5EA 2JEZA 1N2CB 2X23A 4IG9A 1JDNA 1X7HA 2O48X 1DJQA 3H2SA 2DPYA 2FZGA 3JQPA 3A4IA 3PQCA 3EXEB 1Y0BA 3SMVA 1FTSA 4AY2A 3JQ8A 2SNIE 3TOZA 3KUDA 1GZUA 1T5LA 2RHCA 4DDHA 4ZI5A 4HYQA 2BJHA 2ZG6A 3R7BA 1BE0A 1NXPA 3H8SA 4KIWA 2PSHA 4RAQA 3D6HA 4URXR 2WB2A 5DH9A 2MSNA 4F1JA 1JKFA 4WACA 5C3UA 1DV1A 2VRNA 5KYUB 1O08A 2CSXA 3MILA 1KI7A 3KR9A 4KKVA 4MIOA 4IOKA 2NZVG 5C9ZA 1LS1A 4FFNA 4NYJQ 5DP2A 1E9CA 4AWAA 2FDCA 2R7KA 3W2FA 5TXGA 3SC4A 1HMYA 2P4UA 2XV1A 2ECFA 2HA4A 4WNAA 1YQWA 2DKNA 1K4MA 1J0EA 3AL2A 3FTCA 3H1TA 4M55A 1CE8B 4PS0A 2COUA 3PNPA 1ULBA 3F6CA 4LBZA 3T6KA 3ZR4B 2PPVA 1PFQA 3IPYA 4AJJA 4D96A 1T5OA 1N7HA 2I8LA 2VJBA 4CLRB 1GKKA 3L4BA 4EW1A 4F71A 5KNCA 1PNQA 1ZI6A 1WVMA 5JAHA 3MF4A 3O2NA 1KEEB 2H4HA 3JWHA 4KXUA 4EYGA 4YT2A 1VE9A 2GM5A 1THMA 2X6QA 3DE4X 3VHXB 1JQLB 3UEOA 3RK0A 1WU8A 1FDSA 5LMNB 4BYMA 4AJ1A 5A7FA 1QHHB 5HJEA 2FXIA 1N0UA 2MINB 2PUBA 3VKGA 1FRQA 2IEZA 4ZI2A 4GRAA 4CR6A 1ZNXA 2H1HA 2R44A 1EVLA 1L5LA 2XRFA 4AJOA 5C53B 7GPBA 1TVKB 1A7KA 1IHDA 3BN3A 3SZOA 1Q12A 1PU2A 1P1BA 3OAAA 4ZEXA 3ETHA 3LWZA 3ND5A 5KJEA 2GAFA 3ZHQA 4D98A 1T36B 1VJTA 3VU0A 2DBYA 3FTNA 3STTA 4UMEA 2IK8A 3A6JA 2QRUA 3DZGA 4HQRA 4LE1A 2XA1A 3OQPA 4GT1A 1HE4A 1KRWA 5TQ0A 5B2FA 5KMGB 1CUUA 3GDOA 3ZQ6A 1HOTA 3P5SA 3SYTA 1KEPA 4M9ZA 3VYVA 4IQ0A 1FUKA 2CKMA 1B2LA 5CXXA 2JLXA 4NDNE 2C4UA 3V7UA 1XPOA 4HZGA 3MUEA 2D7CA 3CF4A 2VK8A 4HDRA 4NATA 3TIIA 2QPTA 4UZSA 4MP6A 3JATA 2AF3C 1B6GA 2ZDQA 3L8ZA 4PQFA 4D7AA 3L1IA 3CEPB 4PRYA 1L6RA 2WYHA 3DYVA 1M1YA 2WD7B 2KBFA 3GUCA 4FCCA 5FPQA 4DM3A 3SHQA 1EDOA 2C2BA 3GCGA 3KC2A 1Z0AA 4NMHA 1GNRA 4PLFA 3LLSA 2IIPA 3EEYA 4ZCLA 5MGBA 2ZUSA 4TRMA 4TZ0A 4TXJA 4UHDA 2D3WA 5D8DA 4JITA 5LOVA 2ZSDA 4K9QA 5IWCA 5JCJA 1IZ0A 2OAGA 4M9UA 4WL0A 2NTVA 3J7AC 4UOEA 1U2GC 2H2GA 2O0LA 5CG1A 3ENKA 2PQ2A 1OVGA 1TYAE 3PGLA 1GRVA 4XX0B 3VPDA 1OLSA 4R05A 3WWOA 1F9EA 5D7BA 5DYGA 4EVSA 4MUNA 5A4DA 1ISFA 3O8RA 1R74A 5LZ4A 1E18A 3DZDA 3U4GA 1JH9A 2AMVA 4B3JA 1LJLA 1TI7A 1BQ3A 4KLAA 3RHSA 3T06B 4YRCA 3K5IA 4D92A 2IITA 1LNZA 4UBKA 3CIFA 3MLEA 1PV2A 3LVQE 4O4IF 2H00A 3QJ5A 2QMYA 4IRXA 1M1ZA 1BS1A 1R6VA 3Q0EA 2BFBB 4NICA 5A62A 5DEOA 5BQFA 3VTFA 3DE3X 1YBVA 1LV8A 2JDID 3HI6A 4TQGA 3WHIA 4R7ZA 3WBJA 2P65A 1MRNA 5A3RA 2DWCA 1XZJA 3JWGA 3KPJA 4YP5A 4MS1A 5KX5B 3IA2A 3MPUA 1JZQA 4WHMA 5FORA 2Q1TA 4E7PA 3UA3A 1ZNYA 3Q3GE 1MZPA 3TAUA 3NKLA 2FQQA 2XQIA 1QP8A 4HUQA 4LE0A 4Y0NA 4ENWA 4IQFA 3OZEA 1QBGA 2QORA 5TLSA 3AERB 1MIHA 1TEVA 4R7TA 5FL7D 1N92A 1P2GA 1SBNE 1DJPA 4W7IA 4NLLA 4UXJA 2GA8A 1AHNA 1SHTX 1O87A 1R8SA 3SR0A 1P3JA 2UYYA 2IHUA 4CKCA 3LBFA 3LHKA 1V1RA 4BMNA 1DPFA 3KPYA 4Q3LA 3ZGVA 4AY6A 3R75A 3EPLA 3D7MA 1U4OA 1P29A 1V9SA 5C18A 4A15A 1HC7A 2EKBA 2PSEA 3ML1A 1ZM7A 1FDOA 5G4KA 1VSQA 2IPNA 1JB1A 3E9CA 4FR5A 3VR6D 2E87A 4ME6A 1GAQA 3LLUA 4NS4A 5EJ6A 3PLRA 3CNHA 3ANMA 3GP5A 4WTOA 1XZGA 3IILA 1HPLA 1JUDA 1W76A 2G1AA 3FPKA 1T2VA 4ND5A 4EX6A 4PGFA 3DAPA 1LNSA 1AQYA 3VX3A 3BMQB 4OREX 1MLDA 2Z83A 3E05A 4RCYA 3USES 1ENYA 4EG5A 2NZWA 1AQUA 1JA0A 1RHKA 3ASVA 3C43A 3TQIA 3UTDA 4D26A 3NT5A 5GMOA 3V80A 1IE3A 2QJFA 1E2DA 1O6BA 5AK3A 1QGOA 4DBZA 1M6WA 2SKDA 1JXMA 3RTCA 2CJPA 3FVQA 2D2XA 3WNVA 4ER6A 2JANA 2JJ2D 3VNQA 4U63A 5T3YA 4TLMB 1US8A 2VQDA 3GJ7A 3RFUA 1ZM9A 4EH1A 1AXGA 5JYDA 2F48A 5JXWA 2PUGA 3MUFA 1ID1A 1X7ZA 5KSPA 3WLJA 5JCOA 1EBUA 1BD4A 1SC4A 1TXGA 5AJYA 5DM0A 2UZ4A 4O3FA 4DJEC 3TYXA 3NANA 4OB8A 3EUAA 3EQ7A 4HDSB 2C2YA 4QJ4A 2WFLB 1VYTA 2FMXA 3AP3A 4HDCA 1RTKA 2GN1A 2VI5A 4YRRA 4C2AA 4LX8A 4R8VA 3IS3A 2FE1A 2HCFA 2VZLA 1GFIA 4L15A 3JAMA 1VG8A 2Z2XA 1LDEA 1DLJA 1KFJB 4MGZR 3RJZA 5AJUA 2QJRA 4AMZA 3OTHA 1PFYA 4LZZA 2R79A 2ZUUA 4KAFA 3AYZB 4D1YA 2WG2A 1IY2A 1HE8B 1K7EB 1G42A 1OA1A 1R0XA 1ISHA 4MA5A 5CDFE 1GR0A 1XJ5A 1D4ZA 2FP4B 1V35A 3BE4A 3D2AA 3F4KA 4MVJH 4GSLA 4RVCA 2YXDA 4AU1A 1GTVA 3OE7A 3CZAA 3BHJA 2ZB8A 1WZ2A 3DMPA 4WZAE 4CMBA 4DFDA 1ZI8A 2EDCA 1F2VA 1PZFA 2Q28A 3PHJA 4ZCSA 4RPKA 5KTKA 5FOVA 1E4EB 2P40A 3TWOA 1UQTA 3RSOA 3SK0A 1M2OB 1YJ8A 4B45A 1YZKA 3BE6A 3D3QA 2RHTA 2FSIA 2PKRA 4JHLA 5DM2A 5EZSA 1CUIA 1U2PA 3OO0A 4Q7KA 1V1MB 1NJ8A 4FIZA 4K9RA 4NI5A 2D74A 1K8RA 3ETJA 2C3UA 4HH3C 4UM9B 2K2QB 1QYCA 1QZTA 2RKOA 2D7DA 2ECQA 2O7RA 4MPRA 4NBSA 3QUSA 3AFOA 5C7OO 1NY6A 3PJGA 1H4VB 4IX9A 1RXIA 1Z5OA 3QPVA 5T4HA 1NVKA 2WY2D 1PT5A 4IOMA 2JK0A 1OI7A 2RHBA 3VSAA 2W11A 4P93A 3ZK7A 4P58A 4F4IA 3G0CA 3SM3A 3HADA 1ESNA 4DOMA 1NUPA 3A37A 4JBYA 4G9EA 4QL3A 3HU1A 5K8CA 2HCJB 3U40A 1CY8A 1GLVA 5KYVA 3W1WA 4YRPA 4YYZA 2YMMA 1AGXA 1PT9A 4L4ZA 2IBSA 2IYYA 2AOTA 3FSEA 5LA6A 3BJMA 5J4YA 3HJBA 1GR1A 4D9CA 4I36A 4OGGA 2IEDA 3KX2A 4IYRA 5EIFA 2YVUA 5GGYA 5KYGA 3WG9A 2FFJA 2HJHA 5IRCD 4RYDA 1T4DA 1SY7A 2Q4DA 3I3OA 3OBIA 3PV0A 3WJ1A 4EY8A 1LA2A 1NPDA 1XPRA 3QVKA 1TUEA 4BJ5A 2W8BA 3GFVA 5CXQA 3JYPA 5FOSA 3PEWA 3ROQA 1J1IA 3LK7A 1KDRA 3CZCA 1U7PA 1FP2A 2JH8A 3F0TA 3CEHA 4FQ8A 4YONB 5C51B 2LE0A 4L2IA 3TSYA 1GYQA 2CNBA 3EGIA 3PJDA 3VMFA 4ZK2A 1E1LA 2GJ8A 3JVDA 5CIWA 2B3TA 2NAPA 4LTNA 3RARA 2GR9A 4ZVOA 3IIJA 4QLBA 1A1VA 4DRXA 3V4PB 3S55A 5DGXA 2P27A 5HFAA 4RVGA 2OHHA 4JBIA 4L16A 3JQEA 4CTJA 3P2OA 4REOA 3A1VA 4CZ2A 2OV4A 4QOHA 1XK7A 1E1YA 2ZRQA 3HM2A 2ZRHA 4LY3A 3SC2B 1V5EA 4D8WA 1HTTA 4EYQA 3EMKA 5FUXA 3IBFA 2BEKA 4DCMA 4U0JA 1JQEA 3EIWA 4PZDA 4ONEA 3TVDA 5E3HA 4C6TB 5KCZA 1FQKA 1IBRA 2ZSHA 4HGNA 2ADOA 2PSFA 3LVRE 3O8QB 5EE3A 2I22A 1BHO1 2H0RA 3CCFA 3CUSA 3EZ7A 3NBMA 4W6ZA 5TX7A 2RI0A 4O02B 4DR3B 3K9QO 5FAXA 3K4HA 4UUMA 4S1OA 1BG6A 2VJPA 3BCRA 4BFZA 1EWRA 1ZCBA 5AVYA 3A0RB 1CRLA 2Y0CA 3T5BA 2HGSA 5B64A 2YZMA 1U5BA 3W6NA 1RAFA 3ELUA 1ODKA 1I6MA 1P7ZA 4WW0A 4YS6A 5I51A 2WPDD 1QFMA 4OXIA 3WYGA 1JFVA 2BMEA 2CVQA 4GP6A 1AU9A 3LD9A 5EHNA 5I4CA 4QNNA 2A3RA 2QRHA 3Q3IA 4XE5A 1PTJA 2PKCA 2Q9UA 4DA6A 2YWRA 1GL7A 3KT0A 4IMRA 1TQHA 1U3TA 121PA 2SECE 4ZOLF 1NVWQ 4ZAGA 5IF9A 2AUNA 3NCTA 4NCBA 2IEAA 1Y5NA 3D02A 2FZKA 3SSNA 2I4LA 4RACA 2QM7A 2E1RA 4RIHA 3ZJ4A 4BS9A 3VZDA 1GUFA 1ZHHA 3RNLA 3QIVA 3SC3A 2Z9CA 3WYEA 4AMVA 3PQFA 1JI0A 5I5EA 2QZPA 3UH1A 2G6BA 2EBFX 4GR5A 3V7NA 1W52X 2BGNA 3QEOA 3LS2A 2MSCB 3DPUA 3NIWA 5C8YB 2BKXA 3GBVA 3HCNA 4X94A 3ROFA 4CGZA 3SHTA 1PL7A 4P22A 3AHHA 1JIKA 2NU9A 3DAGA 1PT7A 4HRXA 5AOCA 1BH2A 2YMPA 4WXRA 5KTSA 5E7MA 2CDBA 3HCEA 3D3JA 2QUKA 3IMKA 5FI3A 4AG5A 4JYZA 1Y3FE 3AHCA 2BYTA 4NABA 3KJFA 2X1MA 3KUUA 3MGCA 2ERXA 4GGPA 2PRIA 4PINA 4UTNA 4B4OA 4QJIA 1LKZA 2AC4A 4P3KA 3AHEA 1C1YA 2FR8C 2GDZA 4O29A 3LOQA 4Z4QA 4EKYA 1SC1A 1MQSA 1G8GA 3B3GA 3BSSA 4IIEA 5CJJA 5F77A 3U1TA 2AOWA 1G7RA 1CXZA 2YHIB 5BUQA 1A76A 5DXJA 1XDWA 1XTIA 4M1KA 3O83A 4EA7A 1KKLA 1WUIS 3LTNC 3E1GA 4K28A 2R1VA 3NATA 5AXAA 2OCIA 6Q21A 2P6UA 4DIMA 1G291 3SFZA 1I36A 1RRFA 2GN9A 1TYEB 3P4UA 4FOSA 4G89A 3DBLA 2WJZB 3T5MA 1X1SA 1J7KA 5KNCD 3GCZA 1DRWA 1FFSA 4WI1A 2J0SA 4B1FA 4MH0R 5JARA 1JTFA 1E69A 2B82A 3CA8A 4K5QA 1FLVA 5IJ9B 4OHZA 1Z88A 1AF7A 2Z98A 4YI5A 1LDYA 1XEAA 4ZYYA 3K94A 3WRXA 3RJTA 2C2GA 2OYCA 1KORA 1ZD1A 1A98A 4LOKA 1D2CA 4EB8A 1F6BA 4FGWA 2DBRA 4G65A 1Y3BE 3MW8A 3T7CA 5K5EA 1CEXA 3IB3A 1XEXB 4CN9A 3OIFA 3IAFA 1WXIA 3OAAD 4O33A 5KO2A 3CW9A 2E5LB 1Y5MA 1B8PA 2DWUA 2YFQA 3MT7A 3O4RA 2VTBB 2R6HA 1J0AA 1CRWG 1QZ3A 1YJXA 2XNKA 1NJ5A 3A1TA 4NENB 3SYNA 5LP6A 3O74A 2QS9A 5F2OA 3U1VA 1Q2UA 3R76A 2XXAA 1UP7A 1XZNA 3P9IA 5ADWA 1K0FA 3L1JA 1AVTA 2FF5A 3K9LA 4HRVA 3K0FB 1KYWA 2ZYVX 1M8PA 3RYCB 3I2JA 2WYVA 3C4JA 4WOJA 3OLYA 4QNRA 1BU5A 3BKWA 4C4ZA 3ISTA 5FEMA 1T2CA 3EW7A 2Z3VA 2IYWA 5D84A 4LI3X 2QLNA 4O2BA 1RKBA 4MGHA 2GEUA 3AVPA 4MKRA 3WLIA 3LUHA 2AC2A 2OV1A 1FMCA 1Y48E 2AOUB 2HBQA 4K40A 4TX1A 5K99A 2ECOA 2EG9A 3BRSA 4IH1A 1DGQA 1T0IA 3HZZA 3HSSA 1AGYA 3RIMA 1ULAA 1E2IA 2MSDB 1QQBA 1NNSA 3GK3A 1GP2A 2QRJA 2VJNA 4CUKA 1NSFA 5JCJD 4YV1A 3MT0A 3GLKA 4OA8A 3B60A 1V4VA 3JW8A 3IEVA 1JEQA 1WTCA 4DA8A 4CMIA 4L5AA 4Z9BA 3ULKA 1MABB 4M0DA 4N4AA 4NBUA 4OH1A 1G3IA 2P0YA 4KQXA 1VL8A 1SVMA 3ROPA 4Y6PA 1N36B 1GQ2A 3QU4A 3H5IA 5FWAA 1N6IA 5IXSA 5KTPA 2YDXA 4DVJA 2QV0A 3C0KA 3PEFA 4V39A 4X20A 4ZVNA 3IP9A 4IKEA 3EGXB 4CM4A 1JE1A 5HZHA 5JZ9A 3HUDA 4TS9A 4HD8A 5EJAA 3G8YA 2AV6A 5C5IA 4OA5A 3P2MA 3FETA 3IPCA 2FX5A 1AUXA 4RZQA 2ZYSA 5CVVA 1O0BA 3NTVA 1MPXA 2NACA 5EY5B 3OZXA 3QOFA 2XJ4A 4N47A 1M83A 4DBLC 3HXLA 3JAWB 2JLRA 4JJAA 1BVUA 2GHRA 3X1KA 4RJ2A 1TMGE 4XRGA 1EIWA 4W9NA 2FN9A 3P32A 1GU7A 3WL6A 5FUQA 3EOZA 1AKQA 5CB4F 1Z33A 3C5HA 1OXUA 1U9JA 3CF0A 1IZ8A 3NHJA 4CLOB 3G8CA 3RIYA 1V3UA 1Y3DE 3I04M 1Z0SA 3NHFA 4D0NA 4IDFA 5DKFA 4BL5A 3OSZA 1KNXA 3H2IA 1GTMA 2BE9A 2GAOA 3F7NA 4GMXA 3PDHA 3LX6A 4XCXA 5B2EA 4CFYA 4J0KA 5CW2A 5C46F 4BWFB 2GA9A 4HQ0A 3QMPA 3WGUA 3B6IA 4ESHA 5LQUA 3LKVA 1I7SB 4KI7A 3HJFA 3AL0C 3NWEA 4OY3A 4RSRA 1PT6A 2W00A 1N2BA 3OX1A 1RI5A 2NU8A 2J59A 1Y9ZA 3VHRA 3PKIA 1DIRA 5JQGA 2YBEA 2Q5LA 4PGGA 1ZBDA 1Q3TA 3IRVA 2VDWA 2B5OA 3DNFA 3EY9A 3GCWA 5CK4A 5DYWA 2QLTA 3UAZA 3O6VA 2WK1A 1RLMA 1IY9A 1EJ2A 3C97A 3GQBB 3VU9A 4CG1A 2BL4A 2Z1MA 4PPQA 4L51A 1XNGA 1LTKA 1JAXA 5FO0A 1WUKS 4IVPA 2A67A 5SICE 1FX0A 3D3KA 3Q2OA 2EKLA 2BCEA 3EY4A 1YTUA 2KPOA 3E5NA 3MUOA 2GXAA 2IOHA 2PPLA 2HWUA 3KBOA 2JBAB 2V7TA 2YYAA 2HXYA 2ZUBA 1Z8NA 2GBFA 2O4CA 9LDBA 8LDHA 1VCMA 2ZKIA 1BVRA 1H3FA 4W4TA 2D2EA 1R9MA 3E0XA 4YMIA 2FTKE 3LRXA 4MDFA 2X9NA 4N7RA 3WXBA 3FZQA 5I47A 3NPAA 1ZMRA 4JI4B 2IZ6A 1KBZA 2XEDA 4ER3A 4O4HA 2Y1XA 2C1EA 4D3FA 1GZ5A 3LC2O 3QU9A 3OFKA 2W6JA 3UOGA 1D04A 3DOHA 3NGXA 1SD5A 2JEYA 4XDGA 1NVMB 1QS0A 4A73A 3LPDA 4AM8A 3QGMA 3H8WA 4WK2B 4X7BA 3RTEA 2BE7A 1V1JA 1XSEA 3BFJA 1KZYC 4LY9A 3QKSA 1RI2A 5ALSA 5KQLA 1EB9A 1C80A 3LT0A 4JQCA 2C77A 3UXYA 3PD1A 1ZWLA 4LYAA 4P35A 4I55A 4DAOA 1O0CA 4HH4A 2CFCA 5HM6A 1FUEA 2HK6A 1Q22A 3R6DA 4YASA 2XECA 2IYFA 2R1TB 5F2KA 5HZMA 5IAJA 2F1JA 3DMRA 1KDPA 2O2IA 1YZHA 4KQ1A 4X1KB 4IJ6A 2FG6C 4F3KA 5J2UA 3F6RA 1HYQA 3KSAC 5EMHA 3ZJVA 3W34A 1A9SA 1RIIA 1UBEA 2VBFA 4RY2A 5FFMA 3QYPA 2BMWA 2GTHA 5FLYA 5TEVA 2P6PA 4F06A 5JVDA 3CZ9A 3OC0A 3ADPA 3FA2A 4BBZA 3FDJA 4IKPA 1PR2A 2OM2A 3GDHA 1BA3A 3MS2A 3OTIA 4CL3A 1CRZA 1CR6A 1UZAA 1NJ6A 3OE7D 3SXJA 1OF1A 4F3RA 1TF5A 1CYEA 3DD5A 2NYRA 3FUWA 1CJUC 3QM1A 1DSSG 2CDAA 3NZEA 2XWPA 3OQ1A 3QEKA 1FRNA 5LIPA 3AVXA 3TX2A 3NETA 1LPSA 4PPGA 1L5GB 2BDTA 1A9OA 1MB9A 3DBVO 4L9WA 4N65A 4OYLA 4XIYA 2Q6TA 2H63A 2P5SA 4B85A 1KOGA 2Z09A 4D9JA 4KR0A 3R0IA 1W59A 2ZBFA 1O6FA 4KAAA 1RS0A 4BU1A 3TLGB 5IJZA 3GVIA 3BHMA 5I7VA 5E3JA 3IVGA 1ZMTA 4Y18A 3H05A 5DXAA 3ZE9A 2JLCA 1M2GA 5J40A 3AKEA 1PX2A 1S9DA 2H16A 2YUTA 3B78A 3M6FA 4GKVA 4ALJA 5TMPA 3IAM6 1N5OX 4LAFA 1TCAA 2Q9BA 1Y7HA 3PQ2A 5EGSA 1JFFB 1M6HA 3GZNA 2RDMA 1DAMA 2P9JA 4P0TA 1NVUQ 3INYA 4PTZA 3AU8A 2FA9A 4G6ZA 5A4IS 2UZ1A 4H9GA 2IS6A 3P4XA 3IO3A 4YY3B 2ZAIA 3BTVA 2J7KA 3HBMA 4FZJA 1HORA 2QSUA 2J9ZB 1P0MA 1R5BA 4GBED 3WTCA 1TO2E 3CVUA 7YASA 3Q1LA 3HA2A 1KEZA 1W19A 3BQ9A 2R6AA 3QX8A 4YO7A 5C81A 3KQLA 1G16A 1LZLA 2GN8A 1UKAA 4A8JB 4M1MA 4ZDIA 3PF9A 3DQQA 2AKEA 2LP4Y 3CURA 4RMNA 5HKBA 5JSZB 1ZJ4A 2BY4A 2O2XA 3LCCA 4YHHB 1PF7E 3GGJA 3KPWA 2I76A 3CVWA 1Y9JA 1N32B 2CLFB 3ZWDA 1TTQB 1JPVA 5L95A 1YONA 1W36D 1YCFA 1B8VA 5K3SA 5B55A 2FKAA 4W1PA 3F8SA 1T0BA 1JZTA 3N39C 4YJ3F 3WYDA 3TR5A 1U2GA 4H7PA 5KSZA 1IHXA 1W4CA 1KEWA 1LBTA 4AKSA 3TLMA 4WJLA 4IDAA 2JHCA 3THWA 1I14A 1N9KA 1TUGA 3QPWA 4FONA 4KE9A 2XCOA 1OJ7A 3NBXX 1NDQA 3HHEA 4R2WA 4ACAA 1JPJA 3DFIA 1J9EA 2ZBPA 4TTRA 2CNOA 3BFKA 4Y9TA 5I7SA 1W46A 3HO6A 3T5CA 2O8FB 1CIJA 2P3SA 2NT3A 1KK3A 1G59A 3OO1A 3MUNA 4MHTA 3MQFA 2DERA 2X86A 1Z7EA 1OYWA 2UKDA 3G79A 2WWXA 3FIJA 4GUDA 4RL6A 2FLVA 4EF6A 4BVFA 3N86A 3PEYA 3ZDQA 1U1CA 3NFYA 1VHDA 1HMPA 3CRW1 5DX1A 1UQUA 3UWKA 2WLSA 2RB4A 5DLYA 1GQYA 1K3UB 1XGKA 3H97A 2FPGA 3TSCA 3OZWA 4E31A 4OHXA 1USVA 4RPCA 3QEJA 3VC2A 2AG5A 3COPA 1NJSA 4O2AA 2R0QC 1YMQA 2WD8A 2GM4A 1QH8B 1I3NA 3F3SA 5CX1B 4AROA 2VF4X 2H1SA 5AKEA 4NFYA 1GRRA 2J5KA 1X1TA 5FIUA 3TN7A 2IDZA 3T7JA 5I48A 3MS4A 1IATA 4UFNA 3FR8A 4BV2A 5B7QA 3J80A 2Z2ZA 5BV0A 2ZPAA 2ISQA 4FZ5A 2DFLA 3F5SA 4JJKA 4LNHA 1RYNA 4OP2A 5FBRB 1TM3E 1UJ2A 1IYZA 1YASA 2BGMA 2TMDA 5KTRA 2AFHB 2O3SA 3VISA 5CDSA 3QEAZ 1T4CA 3IKJA 1JRLA 1PS9A 1LS6A 2Z3ZA 3D5EA 3QMVA 4RJIA 5AOBA 2W6ID 4CWAA 4DJ5X 1WV1A 3RT7A 4YROA 4NH0A 2OOSA 3NBKA 1QYDA 4PFSA 4XD7A 1AA9A 3W4JA 5L40A 1XDUA 3IYLW 4ZMBA 4WX2B 4ERNA 2GM9A 5EXSA 1UBMS 1KNQA 2F2TA 3P0FA 4B82A 3ERCA 3PBKA 2V7WA 2PX0A 3U3DA 3NDJA 4HQKA 4XQGA 2EHDA 1XPJA 2EJCA 2XQJA 2XGJA 1DTSA 5LYJA 4LXIA 1WE2A 1CY7A 221PA 2YDYA 3DEJA 2GAJA 4REQA 4RA6B 2OA0A 4B3MB 3F49S 3KSUA 1LSSA 3IQIX 1KI2A 3MCAA 3VDMA 3FMGA 3CF2A 4M9QA 1F1BA 2JAPA 1ZOIA 4L5IA 1UBNA 4ENQA 1A2OA 3DC7A 2JJYA 3MTQA 1Z8HA 1U7WA 2REOA 3K0CC 4PR0A 1CS4C 4D74A 1I94B 3BMOA 4S04A 1IRXA 1EZZA 4TOIA 2PMEA 2G4LA 3ZZ0A 2D6FA 3HDHA 4FHCA 1PO7A 4J1NA 5HQTA 1Z5WA 2OGUA 5CFZA 5IVKA 3LE8A 4QVKA 3B1WA 3FSGA 2GCOA 2BMJA 3P9SA 3CQ9A 3VSBA 4F45A 1GGNA 4AL4A 3CNQS 1C1XB 1D4AA 3R7WB 2P41A 5EE5B 2D62A 5YASA 3A2NA 4LTDA 4P53A 2IWRA 2VYCA 3OUUA 2AN3A 3DWIA 2YWXA 3NW9A 5B6IA 3HEAA 4GQIA 4R83A 2WHRA 3GPDG 2O2JA 3AV0B 2YHSA 1F8GA 3BDIA 1XZLA 2B99A 1OYYA 2PZ8A 2VH5R 1R0BA 2QJWA 5AI8A 2W2LA 4BLRA 3PWTA 1LF0A 3FTEA 4S24A 4LJ6A 1NUTA 4A6DA 1ZJ6A 4GS5A 4D43A 1VBFA 4DABA 1PZHA 4JHXA 1ZO8A 2G36A 2IGBA 4QYXA 1U8AA 4Z4FA 4G24A 3PA6A 2B7CA 1ADCA 2JCGA 4A5SA 1JZSA 1RAIA 1X13A 4PYRA 1UM8A 3VNSA 3B6ZA 4RKFA 2B94A 4PYIA 3VZRA 4BFUA 1BH6A 1I7PA 1M6VA 3SMQA 1C3VA 1CK4A 5MN6A 4C3ZA 3K8ZA 3CVJA 3D2CA 1AX9A 3KOXA 2PZJA 1C7IA 3LQFA 4TMKA 5EKDA 1NQTA 4ZPJA 1SJ9A 3IR5A 2F67A 4I4TB 3OT1B 1CV2A 3AVUA 3K4PA 4NU0A 4JJZA 4WN3A 4RHUA 1NJ2A 2A86A 1KVRA 1SBCA 1NAHA 1UF9A 2YW2A 3D8BA 1A72A 1ONNA 3O5AA 4P83A 3DH0A 3WDLA 1MDFA 1KMIY 4P8RA 5HUHA 3GELA 1V6CA 2X7JA 1HBJA 2NPFA 4C6RA 4B3HA 1SRRA 4YECA 4DCTA 4MO9A 2OHOA 2YC2C 2NP7A 1EUQA 5LLSA 1JFLA 1CUDA 2BFPA 4LXUA 1TIKA 1NV9A 1R4MB 1YF3A 2ZYGA 3DOUA 4CL0A 4RMHA 2QY6A 5J43A 2C7RA 1NW6A 2K87A 5HZGA 2XCTB 1XO1A 5JAMA 4WZZA 3K1YA 3O3MB 4XB6B 2FWBA 4KV9A 5H68A 4EO4A 4HGYA 4NBKA 4X65B 1DRKA 2FNAA 5K8UA 3M6IA 5AKJA 3X0DA 3L7KA 5JSQA 1W48A 1E1CB 1PG5A 4DDVA 4LOJA 4M53A 4TQAA 1D2GA 3HU2A 3DW1X 1XTQA 2B83A 5FLEX 4KJZA 1GUAA 1OT5A 2DLDA 2HJRA 2I3ZA 4BVJA 4ZCIA 4ROSA 2YQZA 4G84A 1J2EA 1G6Q1 1FFGA 3UC9A 5FLXA 3ZDBA 2FRXA 2H5JA 3MBOA 4KYVA 3P9YA 3MWYW 4FNAA 2BLLA 4ZVVA 1BWPA 3VDXA 3ROTA 2F4NA 4F5DA 3U44A 4UDYX 1WDLA 1JHDA 4JP2A 3RUIA 3ECCA 1HSZA 1YS6A 2CVHA 2LV8A 2EKDA 2FMFA 2OSVA 5J5CA 5C0OE 4DARA 4ZJUA 4HGZA 4BZQA 2HM7A 3U9TA 2XB6A 2G63A 4DY4A 4V24A 5GJWC 1J07A 3ILVA 4LVUA 1EH5A 4BKRA 4ZYWA 4L8GA 3DNPA 2QW0X 3ZTWA 1LBQA 4PX5A 2A92A 4EHFA 1SXJE 2H31A 4L0CA 1A9TA 4KE8A 4C0BA 1X94A 4R51A 4QBFA 4P2GA 1FBTA 4QOGA 1RXSA 5JADA 1F2UB 4GNRA 5DM60 2Q1YA 3HO8A 3TQRA 2A5YB 2DTXA 1FU7A 1YHYA 1CZUA 1PSZA 3KV1A 3L2OB 3LCUA 3OH8A 5FQOA 3T9AA 3RLFA 4AWXA 1FIUA 1P4HA 4C7OB 2QBYA 4B6FA 3CISA 3QLTA 4AS2A 1Z4QA 1YDFA 2I78A 3RQSA 5I4IA 3KQUA 1L8AA 2P78A 1DE0A 4ZJPA 1WCXA 2MYTA 1O2DA 1TT7A 4I99A 3D7SA 2DGDA 1G20B 1QCZA 2PL1A 3IV9A 3VDRA 2CF5A 3EMVA 3GNTA 4S0ZA 4M49A 3TXAA 1OXBB 4UNNA 2Z4SA 3AG6A 2P7IA 3G9TA 1G5QA 4K3UA 4MS3B 3HA3A 4HWRA 4XYGA 4ZO9A 1T9GR 2WDPA 3LUDA 3N3AC 3KYCB 5FAKA 1NWCA 1P2DA 1UXIA 4D99A 5LQAA 4A82A 4MJXA 1CQXA 5ALYA 3JD2A 3Q7QA 4HB0A 3WOHA 3DE6X 2OCXA 1PEYA 1CB0A 1YJCA 4LXGA 4HN4B 3ECAA 2EWMA 4TVOA 3QG1A 1IQPA 2ZIXB 3B48A 4B7AA 2NSJA 5C5CA 1JEOA 2JFVA 1GVHA 1WXEA 3TOXA 2C9BA 1E62A 4LDAA 4DLTA 2YRXA 4KPGA 1COWA 5KHLB 1OH5A 4RWEA 1EUCB 2QPOA 2J9FB 3HKDB 1GL3A 5JC1A 1GG2A 1ML3A 1EFCA 1GADO 2I2CA 2P8SA 4U7FA 1KC1A 3D4OA 2WIFA 5CLJA 1R0CA 3LO5A 4NG4A 2EKPA 1QQ7A 5DTMA 1K6MA 2W43A 4X1IB 4HNAB 1FNMA 4CMHA 1B41A 3DOFA 3KETA 4YRFA 2D3TA 4RQTA 3RIGA 1RWOA 3O8OB 4QYTA 3VXKA 1DKRA 5J1SB 3QFFA 3L6DA 3IDOA 4ZCRA 1IEWA 2B4YA 3EXIA 4HPJB 3KU4A 3QY9A 2BCJQ 4HL6A 5CVJA 1O58A 3KWLA 4PVCA 3UFBA 1M75A 1POWA 1QTNA 2W6OA 5FADA 3IUBA 3GOQA 4E7OA 3T1NA 1UWLA 3II6X 3T4XA 4N39A 5HKLA 2DBVO 3AUXA 3EVTA 1C1DB 1JJVA 3KAKA 3GGOA 3NIFB 4U2FA 4BNHA 5EJ8A 1YU9A 3IT2A 4OF4A 4UNRA 2FR8A 1G5RA 1IM5A 4YJFB 1Q1EA 4F7DA 1ZK0A 3ZV4A 1NATA 1RJ9B 1SA0A 4ON9A 4AZ3B 2EJBA 4DV4B 5DHTA 2VDQB 3HK2A 1BEEA 1TA4A 3FB1A 3B1JA 2WJPA 3QUQA 1DFGA 1QPGA 4UDXX 1A1SA 3L4EA 5HCUA 3M6VA 1XP5A 1OAOC 3LLCA 3VYUB 4CCWA 2XZDA 5CM9C 2GN0A 1JQJC 3I42A 3KIPA 3QU5A 5AJVB 5TPWB 1KI6B 2CYCA 2QVXX 3SYMA 2PBLA 1EAMA 1T9KA 2G40A 4FYWA 3R7SA 3SKXA 3TI9A 5D2CA 5H02A 3WIDA 3BRQA 3DDCA 2DPLA 5BT8A 1MO6A 4AFNA 3TD2A 4TZTA 4F85A 5LSAA 1XNJA 4H0CA 5SZHB 2NO5A 2HWXA 4WFJA 2XLCA 4C3VA 4DWJA 3N0TA 4GOOD 1KWKA 1RZRD 1T6NA 1PFWA 2PIDA 5T5QA 1OZ0A 1HDYA 3MWDB 3ZZTA 3KJXA 3N2GB 2PT7A 5DT9A 1QRTA 4NV3A 2FPPB 4KMOA 5AVJA 2JAXA 2DWPA 4Y2VA 3L5KA 1BDBA 2PBZA 2BKVA 2G67A 2VVTA 3F8WA 1E2MA 3MYYA 4WLOA 4UUPA 1M10A 2D1QA 3I28A 3U4IA 2V6FA 1Z6TA 1XPUA 1D9ZA 4JNCA 4PHTA 1KYYA 2K2WA 2V8OA 5CIYA 2CHUA 4QU5A 4E11A 4ZEVA 4DIOA 3GWGA 3HUTA 1QTIA 1OFTA 1IWOA 1XCMA 2B21A 1U80A 4CQMA 2WOJA 2CVZA 3AEQA 3NTOA 2CFIA 3BWEA 3T8YA 5AJWA 4RPGA 1RJGA 5DTQA 5FFNA 3SF8A 5EZYA 3BSFA 4ERXA 7MHTA 2O2CA 1NONA 2DLNA 3EBLA 4ZD6A 4LGYA 2VAPA 3FWHA 4GEGA 4TTSA 2GEBA 4P4GA 3AM5A 1XKXA 4ARSA 3LY9A 5B1SA 3LZCA 1MX5A 4MV6A 1VJRA 3VPXA 2AEMA 3H65A 3W9SA 3WP0A 3K70B 5KAPA 2GK3A 2AD1A 2NXJA 4QUDA 3ORHA 2RGCA 4JI8B 2RC6A 4TSFA 3KK0A 2C0PA 2R97A 2Y9MB 2BUCA 4MHOA 1J1UA 4QDTA 3OQJA 5K3BA 1H6DA 3NEYA 2Y1DA 1GGKA 2PUCA 5JZBA 1SWVA 2H2IA 5HK8A 3KHSA 1KZ6A 1WPGA 2NSLA 4Q4HA 1ANKA 1LU9A 1RLJA 3INTA 3FHOA 2QLMA 2FX3A 3DHEA 1SHKA 1X1CA 2GDJA 2JFPA 2JS7A 3KZOA 2X8JB 4BDTA 1NQUA 1QMGA 3ETLA 4EZIA 5DNWA 1YGYA 2NVUA 2PX8A 1MX9A 4X8HA 3RUAA 1RAGA 2Q3BA 2X8WA 4A8TA 3AB7A 1P73A 4FBMA 1G66A 2VXBA 4A6PA 1TW3A 4QSMA 2LZ0A 1UBCA 3WSTA 3QHQA 5JAUA 1TLFA 4QAJA 2HT1A 4D3ZA 3G8BA 2OO3A 2J32A 4H59A 3ST7A 4JMPA 3TW6A 1N5RA 2CC2A 4PNZA 3OHSX 3VZQA 2XDQA 2PWYA 4Y2RA 4D79A 1B74A 1DCKA 1G6HA 3JYQA 1USIA 3FD8A 3JCZA 3MBKA 4J6EA 3AFIA 1SVNA 5IXJA 1QC5B 3RS9A 2VDKB 1H8HD 2BTQA 4MWBA 1BQ4A 3Q3HA 4MR7A 3U3JA 1ZZGA 3G0OA 3MYRA 2QB5A 2WHQA 4KWHA 4X95A 1EXVA 2A4KA 1HDRA 3UJ8A 5B58C 4IS3A 2IXAA 4PCAA 4C2TA 2BIFA 4RAOA 3SI7A 4YGXB 4O8ZA 3WGJA 4BGIA 4Q4CA 5DNCA 5A6VA 3F4LA 3F9RA 4JLVA 2AFIA 4TMWA 5JJBA 5ALPA 4CLDA 1PVOA 3C74A 4YB8A 3HN2A 1UMBB 3RSQA 3FHJA 1Q92A 3KDPA 3DKRA 2HSZA 4EDHA 5E2BA 1Z29A 3LOPA 1IRIA 3DCYA 5FB3A 4DLYA 1FX1A 2CFOA 2NTYC 2ACWA 5JY1A 2G1UA 4PG5A 4KVZA 1TYBE 3LHDA 7AT1A 3C98A 821PA 3PR1A 3IP5A 4JC8A 4GPZA 1H6AA 1KKUA 2C5SA 1ZXLA 1NVTA 3GT3A 3JQ6A 3OWOA 1Q0SA 4JCOA 4RGQA 1XD2B 2QZZA 3G5MA 1P1HA 3IRUA 3HSKA 4P5EA 4Z49A 4HWKA 4ASUA 3IR6A 4EELA 2LIVA 4R69A 4M8IA 1M2VB 4FE4A 1VXOA 3T4EA 4N5IX 2GHTA 4BEVA 1QF6A 1JHOA 3FNBA 1ARZA 5K1ZA 4TWRA 5BORA 4L0DA 3N2LA 4RCZA 1QIEA 1GPUA 3NEAA 1ZVMA 5E6UA 1QVWA 3F5DA 3IDQA 4Q4LA 1A5SB 2NYAA 2VKTA 3UC5A 3IO5A 3ZX5A 1S2DA 1J5PA 2CNKA 2GLUA 1L8XA 1OAKA 1XNHA 2WF6A 3D7KA 3THSA 3S99A 3RO7A 2PANA 4DDMA 5BMVA 5IT4A 1JLLB 1TMYA 1WCV1 2R6DA 2KX7A 1IOZA 5E8JA 4ZDJA 3VO1A 4F5YA 4HFMA 4DCJA 2QYSA 3E9NA 5BSTA 5A7GA 4EA6A 2JRLA 5I7RA 4GX1A 4DR7B 2BR3A 4D3SA 1Z63A 4UPVA 3LNCA 2FI1A 4AZ0A 3U7FB 4OAOA 3SJBA 3H1BA 5FFFA 5H4HA 3HFJA 1G3MA 2FZCA 3SSMA 3K6KA 2JIBA 3FUTA 5JD3A 4DV0B 4KQKA 2Z58A 3OE1A 5AR1A 2HHJA 3FSGD 3GRKA 1QPZA 2BH2A 3E1KA 1DDGA 2CWDA 4A0GA 2ZYIA 2RH5A 4P0QB 1Z0ZA 3DP9A 2FETA 2VHVA 4CM9D 2NMVA 4BZWA 3IIKA 3QEMB 1DX4A 2WIDA 5F5LA 3T3MB 3L18A 1LZKA 4JQSA 2Y6VA 2OFOA 1GN9A 3ZHYA 4LF9B 2W2LD 2F17A 1QOQB 4FWIB 1G9SA 1R8QA 2BM0A 2GZMA 4LC0A 2CHFA 5DSTA 1JJ7A 1T2NA 3M2PA 4HLUC 1X42A 2JGEA 3O95A 1J9ZA 2XADA 2ODPA 2B8NA 5DTEA 1SQFA 4IV0A 1Z4NA 1RRKA 2PNFA 3DHNA 4E2FA 5ICEA 3MERA 3EGCA 5JW6A 1CJTC 2NXNA 3ZVRA 1VQ1A 1XEWY 2A14A 4CTKA 2G5TA 5EXEA 3F6EX 3OCWA 1UMCB 2W2PA 2RK4A 3OM8A 1SUWA 2QK4A 1KHHA 4NKRA 1GTG1 4DGQA 3REQA 3FYTA 4IVQA 2X1LA 2P1DA 5LNK1 3AIOA 4IHAA 5B58T 1X70A 3DO8A 3LT5A 3PXUA 2HHCA 5F7ZA 4R6WA 4B2LA 1I80A 2PE5A 1H0HA 2CBXA 4BE9A 3IUYA 4P0PB 1X80B 1KGDA 1XF1A 1GSIA 2ZTLA 1AS0A 5I9MA 1L3CA 1W6RA 1V2GA 1XXLA 3ZE7A 5FPKA 2YZ7A 3G17A 1SIUA 1RM0A 1Z07A 2BDEA 4B6QA 3MOIA 4R5HA 4JUFA 2NUAA 1VKNA 3W2IA 4GKBA 3OA0A 2R5NA 1PJ3A 3JALA 4FYJA 1ISIA 1JVNA 4B0PA 4BVAA 2YHBA 1OTXA 2ZJ7A 4OSPA 3PGJA 1TIPA 3GROA 1CZKA 5A4MS 4TV8B 3GFRA 1F7UA 2OZKA 3F5MA 1IY0A 5EYPB 4TVSA 1ZRMA 4HSEA 4ZZIA 4NOMA 3D4BA 1A4UA 3A3NA 2NM0A 3H11B 3E3NA 1L7NA 2B2NA 4UAVA 3UWDA 2CJXA 1C0LA 2EYQA 3D6FA 1PR1A 3FYSA 1KP9A 3R2JA 1BKDR 4MWCA 4LFAB 1BNCA 3HWWA 2OWEA 2JJ1A 1ZD9A 1TKAA 2DHEA 1KGSA 1BHSA 2NZXA 4H6WA 2CZCA 4JS0A 4QU0A 4XUDA 4BLUA 2N1MA 3O21A 4MLPA 4H7IA 4A2CA 1R0WA 2PR2A 5EPEA 3ZYZA 1BDIA 2OZPA 4Q47A 2ZXUA 1KIAA 2YY5A 4KIUA 3ZKWA 4FC7A 4I4IA 5MF6A 2Y6UA 2QTVA 1FFXB 2QRQA 4NNJA 2X0JA 3EB9A 3NAMA 1GUYA 1ZSVA 2ZBUA 4JJFA 4JIMA 4IBOA 2V9PA 2O0KA 2XMSA 3GDGA 3LC0A 3UO8B 3PPIA 1ODIA 5KKCA 2QWXA 5HE8A 2IYZA 2AMLA 2J5BA 2ANCA 4G5RA 3UMGA 2ZZNA 4LXQA 1IBCA 1NPYA 4PZLA 3U4DA 4A1OA 1E59A 4PIPA 2WT4A 4UKDA 5DN6A 4ENRA 2PUTA 3HYSA 4PYOA 4Q1DA 1PJ8A 1GL6A 2JVKA 2R11A 5FBQB 4EP1A 3EVGA 5FBVB 2XKBA 3GFOA 4G1FA 1Q3HA 3CJRA 3KQKA 3HEMA 1YUNA 4D4JA 5HF5A 2IL1A 3K0AB 3L6UA 1R8JA 1SQ6A 4JC4A 3OQBA 4MB0A 3I04A 1FVHA 1CT9A 5DI9A 1Z16A 2B25A 2PMBA 2A9VA 5FUVA 1W7AA 2QTAA 4Z51A 5LQDA 3TMAA 2RBGA 3WFIA 2B6HA 1SVKA 3ANXA 1E20A 5NLLA 5TQ2A 2UXDB 2IBTA 1K3FA 2KJQA 2MJLA 4ZV4A 4KXNA 2EOAA 3BXPA 4A2QA 1PZEA 1U3CA 3ZGXA 4AECA 3EEQA 1ZOOA 3KKPA 3IEMA 4NIMA 4RK1A 4TN1A 3L7NA 3G8AA 4WN9A 4C0WA 4F3CA 2AVDA 1V8PA 1BDJA 3E70C 3ITDA 1RLUA 3H86A 4MI3A 4QD3A 3LX4A 4WZBE 5F9MA 3BKXA 4ZEWA 3VPAA 1VM6A 4ETWA 3GD7A 1IXKA 3ZHRA 4YLEA 1OFHA 3IUJA 3NV7A 2HMSA 1B73A 5JD4A 3TD6A 4TUYA 2WSBA 3OOYA 4NDAA 6CHYA 5IM4F 1H4QA 3ICEA 4RD0A 4OGKA 1SKUA 4LC1A 1FUIA 1N78A 4MQEA 1BE8A 1Q5PA 2G76A 3NXKA 3PPWA 2HH9A 3SHVA 1YAJA 2P9CA 1W0CA 4K2AA 1U7UA 3A1EA 4U6QA 1PWYE 4BKOA 3OJOA 5GADl 5LDDC 2VTDA 3C5VA 4MPDA 5KWSA 4GOJA 1S7GA 3ILHA 1K92A 3BGVA 5REQB 1H1LA 1OTYA 5JJLA 1W2WB 2Q99A 4GXNA 2PH3A 4EY3A 3JD4A 2R6CA 4LQ4A 1M8GA 4YA6A 3WQQA 3LIPA 1RI4A 3SDBA 4MGIR 1R0SA 1RKVA 2Q50A 3FMVA 4I46A 1Q7RA 3PC3A 2FB9A 3KEMA 1ODCA 1T8WA 5FO1A 3FTQA 3WQSB 4DMRA 2DPXA 5B7PA 4P3PA 3FDZB 3KQWA 4FFBA 3FG9A 4F38A 3NEJA 1ISGA 4G5QA 4DUGA 2FQWA 2M1XA 1IB6A 1X6VA 1TGVA 5FTMA 2YJNA 5CFOA 2IU0A 2RAFA 1ULSA 4WKPA 3VH3A 2JLUA 1PUJA 1ZIXA 5BSUA 3TF5A 4PAOA 2C9DA 1JKJB 2NADA 2JATA 3CX3A 2V9CA 3EIQA 1F06A 4MS4A 4U3JA 5DWDA 2UYHA 4LPKA 2CLCX 2QX4A 4TKMA 1NMSA 1Z0IA 2OD9A 5FNVB 3B89A 4C14A 4KWEA 4GMHA 4HDKB 3NV9A 2CBGA 5BR4A 4LV8B 1Y1KE 5FPSA 1H66A 3IHKA 3KO8A 3UAXA 2C5FA 4Q5IA 3DNMA 1Y82A 4L5JA 4IUCS 3MD0A 3ZWVA 4LVOA 4TRRA 5IMSA 3U56A 2UAGA 1QJ4A 1MAHA 3DBIA 3K0CA 3QE2A 3QUCA 2Q3MA 3WKDA 1UKEA 3C1TA 1G7CA 2QAGB 1Q91A 4TKZA 3I6QA 3JVEA 2VUSA 3DXZA 1ZZEA 1GEGA 4OVKA 1THGA 2ZRAA 1X7YB 2VHZA 1F0KA 4L9AA 3HKCA 3HB9A 3L7OA 4UREA 3CWZA 2FW8A 1V9LA 2QEQA 3ZLTA 4KPUB 3DDUA 4OHOA 5ICSA 4AWBA 4LJ5A 5BV2P 1AQIA 1IC6A 2G06A 2XMRA 4I5DA 4FGJA 1QYRA 5J58A 3S1AB 2AN1A 2GH1A 4WDRA 4C7KA 5EJ9A 1ZESA 2OO5C 3V3TA 3AF5A 3Q12A 1XUOA 2OQ2A 2Q7OE 2OCBA 3W2HA 2C1XA 4BLQA 3EIFA 1EVQA 2ZE6A 4CJXA 4ZHSA 3GJYA 1OROA 1YOVA 4LW8A 3ZU4A 2HNKA 4RDIA 5JSYA 5AKGA 3GDWA 3SOZA 4DY6A 5JPCA 5CIQA 3MJTA 4HXEB 4MW2A 5EXDA 4JVOA 5LPNA 3GG9A 1ZJ5A 2OECA 2PS3A 1E5LA 2PT6A 1QGUB 3AG5A 3QKRB 4KQFA 5BVHA 2FJ0A 3USCS 2ZIUB 3CUTA 2CNLA 1N33B 3OQIB 2Z3WA 2QX8A 1N5IA 4JVSB 4BNXA 4HK4A 1TADA 2CXOA 2I87A 3DMNA 1NLZA 3EZGA 4Q39A 2XXBA 2YZNA 3JV7A 1KSHA 4U2BA 4L95C 2DU8A 3NNNA 2ORED 5JHGB 2AGVA 2PGXA 3B1KA 3W4KA 2BKAA 2JFXA 3UHJA 4IIJA 3FCXA 3IPXA 1LJ8A 3CRMA 4MVJE 3DBRB 5FHQA 3U4QA 3TCXB 4UCXA 1ECCA 4Q3KA 1CCWA 4BFWA 1Y6ZA 1LTHR 3I6ZA 3Q5DA 1CY2A 3RCBA 5JZMA 1OX5A 4O08A 4TROA 4CMCA 1XNRB 2HBYA 4NPAA 3RE1A 3EVNA 1QJCA 2B1QA 4HMPA 1UL1X 4X93A 1JG3A 1JH8A 3G49A 4IP0A 1SXHA 1N2SA 3RTGA 1FEZA 3I2YX 5B2ZA 1O9GA 1T8TA 3ETCA 4N5MA 2PV7A 1TLTA 1V3TA 2HI0A 2DG2A 3M3DA 4QODA 1TQ4A 4RK4A 3EIXA 1CUCA 5AM4A 5KSYA 3ND6A 4PHCA 2BHNA 2QDKA 2WA2A 1I4WA 1MRSA 2YY7A 4MV4A 4PR3A 4TSFD 5EUMA 3O4VA 4YRJA 4JYCA 1C1HA 4ZZ2A 3T1VA 1P5RA 4CM6A 4CW7A 1XD9A 2X9VA 3QV2A 4WZAB 3UV7A 4DCVA 1ECLA 3EMDA 3F47A 4HAYA 3ZE2B 2E55A 3TCKA 1OX6A 2RARA 4LWOA 4WVLA 3DB1A 3BILA 2M6LA 1J1ZA 1IBKB 3AVYA 3W5IA 1P6XA 3JARB 3MQ4A 3OF5A 3C6XA 1NN0A 4XIJA 5JALA 1PDWA 1C8KA 2YQ5A 3O4IA 4GW3A 5TQJA 1VLMA 1LQ2A 1P31A 2OZLB 3D8NA 3C6QA 1CVLA 4HX5A 5NULA 4X24A 3RSGA 3HBAA 1CJCA 5C7YA 1XIVA 3GH3A 1N8NA 3ASYA 2AN5A 2RCNA 3HLYA 1TEZA 2A5FA 4B31A 3AJ9A 3NR2A 4MPTA 2BEUA 2C5AA 3I2FA 5T6BA 1ZINA 2M98A 5T64A 5I5GA 4C0HA 1DDOA 2IYSA 4LJ8A 5LQSA 4D9HA 1V39A 1EFRA 5FJJA 3E48A 2I33A 1QIFA 4KPFC 3ED5A 4EFNA 4D25A 4Y30A 4L7VA 4MCIA 4ARCA 3EIHA 4IS2A 4MJLA 1AKMA 5LLDA 1R8YA 3KDSE 4LJKA 4MRVA 3D0OA 1N3IA 4K9DA 1ZK2A 4UTXA 2HIAA 4BNIA 3E58A 1IOVA 4DMUB 4RIIA 1XQ9A 4X1YB 1H42A 4XLLA 5ECGC 1NG9A 1II8B 2AZTA 1U8EA 3D3WA 4UNPA 4WAUA 4HQNA 1KE2A 3VOAA 3WYBA 1CDOA 1Y1TA 2EFYA 2W90A 2WU8A 1E0DA 3RYFB 4A0HA 1Y8AA 1XLTC 2Y0EA 1B42A 1Z6GA 2FEMA 1QTRA 1RRVA 1UBTS 4KRGA 2VHXA 5E0OA 1G8SA 2M6RA 1EX1A 2FJPA 3IVCA 3AI1A 3G0BA 4F4FA 3KQQA 2DQZA 4B87A 1HH4A 2O6HA 4ASUD 2ZK7A 2FZ5A 3ICQB 3HCDA 2X19A 2XUPA 2D2IA 3GLSA 1T6BY 4PLCA 4B6GA 5EVJA 3PC8C 4TLCA 5D3MB 5HKOA 3QWIA 5CUQA 3UPDA 3JTEA 3NGMA 4RHCA 5A06A 3PNSA 4P1ZA 4DJDC 4NU8X 4OHCA 4RTLA 3LI2A 4B7ZA 2CMFA 4Z53A 1XTRA 1OOEA 1XTTA 3BA1A 2F55A 1WW3A 1F48A 1OIWA 1SCAA 3GJSA 2C7VA 4LHXA 2CJWA 2I7TA 4G0UA 1F20A 4IHJF 5FTKA 4PYNA 1E66A 1E77A 2WU0A 1KFBB 4BKUA 2VF7A 3THYA 1P77A 1QQ6A 3WRYC 4QBTA 2H65A 4BTVA 3OZ7A 1T15A 1ONBA 3FTDA 3Q3CA 4XYBA 4EY7A 2ROQA 1SWWA 2CVPA 1TAQA 2A5LA 2ZUVA 3DM5A 3R9KA 2Z6AA 3I05A 5F51A 3Q3JB 4P7FA 3ZLBA 3GJ8A 4E5PA 4JQZA 1RP1A 2F7SA 2J41A 3OM0A 3IVRA 3TE7A 2B4RO 4LZJA 3NWPA 1KZGB 1V37A 2JGKA 3HDQA 4PPNA 4PWYA 1H9BA 3OEED 3KSBC 4G4JA 3S27A 3EJ6A 2RJOA 3CUEF 3DV0B 4CRWB 1T5HX 4KNYA 5M34A 1VRCA 1FYWA 1I7QB 2H59A 3L8FA 3RVNA 4X0EA 3ZZMA 3OBBA 2O3JA 2PZFA 2XD9A 4GMDA 5B1DA 1U0GA 1B0ZA 2BP7B 1I3KA 1H5NA 4QWWA 5IEBA 3WWZA 2Z95A 3A2KA 1WY7A 2XCQA 4WQMA 5ESXA 4BO4A 2XZPA 3HU3A 3IAS1 4R1PA 4L02A 4ZCTA 4NZZA 1E3SA 4DGSA 1XRJA 4DHWA 5JU6A 3C2QA 1OAOA 4H1WA 4HUJA 1CW2B 3PNMA 1YZTA 1S8FA 3FPGA 3TFOA 4JLPA 2QXTA 1NUAA 3L06A 1C7QA 1RLIA 3COYA 4O1HA 1VSVA 3LYAA 4FS8A 4L74A 5KU7A 3IHLA 1A9YA 4GC9A 3A9CA 4IVNA 1OHHD 1PJBA 1QKIA 3JASB 5AI6A 5ADHA 1L3BA 3GZTB 2P6OA 3GNLA 4EW6A 1CS0A 4Y2TA 4A27A 3DXXA 1R37A 5KI6A 3OZUA 4V0OA 2XE6A 3E9EA 4LRWA 4D42A 5JQGF 4KXMA 2B5WA 1IUKA 4M0MA 1IULA 4QUGA 2F1RA 2FWMX 1GXSA 3D4LA 3KYDB 2JIRA 3PC2A 3AF6A 4KW7A 2PWAA 3FYDA 4MGYR 1V11A 4B5LA 5CAEA 3H4VA 1Y8CA 1SG0A 3GAAA 3KZMA 4I1SA 4U2DA 3S2YA 3WFJA 1MN6A 3TE6A 3PXCX 2H8KA 1NTOA 5IZ4A 3P20A 4YK7A 1YJBA 2FSPA 2C59A 3U7JA 2Y67A 4HT3B 3LYHA 1NUHA 1XCPA 3K6SB 2EV9A 3ZWBA 1RVV1 1I2CA 3FUCA 1R4NB 1RWKA 1PNTA 2WSSA 1JKXA 1W93A 2JJ1D 5AOAA 4GVPA 1LFAA 1G21E 2AL7A 4R84A 3DZFA 4O4HF 3QE4A 1NP3A 1U8XX 4FOLA 4U5QA 4P80A 1EWKA 1CZRA 2BGIA 4WK4B 3D4IA 3SIXA 1P5JA 3N0XA 3K5HA 4JR2A 1W4LA 4FZRA 3IDAA 3FNFA 4AKEA 1BRTA 2PCJA 4EFKA 2PMDA 1HE1C 3B52X 2IHZA