4YCBA

Structure of a single tryptophan mutant of acetobacter aceti pure
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
159
structure length
159
Chain Sequence
APVVGIIMGSQSDFETMRHADALLTELEIPHETLIVSAHRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETFRALQTASVPNSPIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
publication title Structure of a single tryptophan mutant of Acetobacter aceti PurE
rcsb
source organism Acetobacter aceti 1023
total genus 53
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 2015-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 4ycbA00
4ZC8A 4ZMBA 4AY3A 5BOSA 4ZJYA 2FW1A 2NSLA 4Z7JA 5BOSB 4YCJA 4YCDA 2H31A 5CLIA 1U11A 2FWAA 1XMPA 3RGGA 3KUUA 2FWBA 4B4KA 4JA0A 3RG8A 3LP6A 1O4VA 1QCZA 2FWIA 2FW7A 4YCCA 4YCBA 1D7AA 5CLHA 3TRHA 5BORA 5CVTA 4GRDA 5CLJA 2FWPA 4AY4A 2FWJA 3OPQA 5CLGA 2FW8A 5CLFA 2NSJA 2FW9A 3OOWA 2ATEA 5CTJA 2NSHA 3ORSA 5C5DA 2FW6A 2YWXA 4ZK2A
chains in the Genus database with same CATH superfamily
3VYUB 2FPGB 2ZZNA 3ILVA 3QKTA 5BN3B 1MAVA 3LRXA 1S4QA 4KJZA 1WVMA 2PLWA 3EAGA 3HHEA 1GAJA 5DNWA 5JAHA 2WMOB 3LQ1A 3HJUA 4QWMA 4LZAA 1KTVA 1RT9A 1V8OA 3B13B 3O4RA 2XDYA 1BN6A 2FWNA 4K6KA 4M1MA 3QLVC 1HZZC 3GD7A 1SPXA 4QUHA 4ZCSA 3RV3A 4CF5A 4PWYA 3ZV5A 3WA7A 3LTNC 5LXTA 3A7DA 1RQXA 1E7MA 4NWIA 4DJJA 2V5UA 2X7XA 4WY2A 3K9GA 2VLIA 1HURA 2PH1A 5GV8A 3V3KA 3MTQA 3QKWA 4EG4A 4YMUA 1ZAYA 4HPJB 2PYZA 2WOJA 5BNFA 2G9ZA 4DDTA 2OECA 4UE6A 2BSQA 1XP8A 3T99A 4PLPA 5F4ZA 5K0ZA 2EBWA 3UAZA 3R7DA 2WYOA 2IYWA 2WNIA 4F8JA 4ER7A 1C30A 3VSDA 2ZTLA 1EWYA 4ME6A 1GG9A 1LK7A 3LVFO 4AQDA 2FUG6 3PE3A 1RHMA 4R9SA 5DFAA 1G6KA 4HSGA 4JH0A 5FBRB 4FI3F 1PT6A 2A9OA 4WBSA 4ZAXA 3WGZA 4EJMA 1NJ8A 1KQPA 1T9CA 4WESB 1P33A 3N8NA 5K0CA 5HFJA 2YBEA 1JHZA 2D59A 2NPOA 2WU1A 3C1TA 3THXB 1N75A 3S3TA 4NULA 4FR5A 1AMNA 2E4AA 3OQIA 1AH2A 2Z95A 1UBCA 3KPJA 4R8LA 4E1AA 3NUQA 3SJCA 1BHJA 5ALRA 2F1OA 4UNIA 4CYMA 3BWDD 1D1QA 4F72A 1P9NA 2YW9A 3BHMA 1X7XA 2H18A 3AKCA 4DLWA 2F4VB 5LDDC 3U1BA 2A6PA 2O06A 3QU5A 4DCPA 1R5JA 4B4WA 2J85A 1DJPA 2EFDB 4P2BA 4EA8A 3OURA 1WETA 1XAGA 3DDHA 4S24A 5JWOA 2F67A 3EFBA 4HGYA 1CE8A 1USVA 4NENB 3ULKA 5CYOA 2VDKB 2AYYA 2E5FA 2IXBA 3DBLA 2HIHA 3HGQA 2H59A 4L4ZA 4EIWA 4FFDA 4S0ZA 1TAQA 4AZ3A 3EIEA 4FNGA 2PXCA 3IHLA 5AHOA 4S1NA 4ZHQF 2R5FA 1WZNA 4Y9SA 3DZ8A 3LX8A 1BC5A 4L73A 3P9CA 4BNKA 2Q41A 3CJQA 3ROTA 3OLYA 2OVFA 3U9SA 6REQA 1W0KD 4BUCA 4FHDA 3FE2A 4OI1A 3WL8A 2AGVA 1VMKA 4BVEA 3GWGA 3U4AA 2OV6A 3CNLA 4BNXA 1OXSC 2EU8A 4QUAA 1CU1A 3A4YA 2LRHA 4FFVA 5JU6A 1I2MA 1QGED 2BP7B 4N4AA 1LV8A 2M6KA 3TZCA 1H8EA 2AKAB 1ZICA 2YY6A 4DV7B 4LXHA 5E7QA 3RJTA 3I4CA 3UFBA 1U3VA 2VR1A 1RM5A 4N65A 2XLCA 3ITDA 4N1AA 1D1PA 1FTQA 3BWBA 5CBKA 1IM8A 1U6KA 3AM1A 1OLXB 2AOTA 2Q2QA 2QTMA 2V7QD 1L5LA 4EHAA 2G40A 4GPAA 2MTBA 5KPDA 2COUA 4Q01A 1VIMA 2DG2A 3U62A 1N9KA 5HKOA 1SWWA 1T4CA 2HM7A 3V55A 4CMGA 5AW6A 5TC4A 1JVNA 2L82A 1NFRA 4CM3A 2ZM5A 4MR8A 3NEAA 1QRRA 3HKCB 1TCBA 3GLHA 1KI6B 4AL4A 3SZGA 3P4XA 3HJCA 3IQHX 4PICA 4B1FA 3ZCTA 3IOEA 2E55A 2JJQA 2WTUA 3LCCA 3B3AA 1IZ0A 5CVTA 3TRHA 3U3OA 2ZRJA 3HDVA 3GJQA 3G13A 1G5FA 2EYQA 1T8PA 2R8BA 3C7TA 1NJ1A 4A5OA 4URVR 3PLNA 2I4NA 3Q7PA 4MW7A 4JKYA 3AW9A 4PWZA 3RBXA 4QUBA 4S2UA 3GVHA 2QTCA 2OHIA 2QJTA 2PXXA 1UM8A 1Y6FA 3HCEA 1OIXA 3KKKA 4E5YA 2UZ4A 1VQ1A 2IOHA 2PPLA 4O63O 3LUBA 4BMVA 3RODA 1YL6A 4DV1B 5TGZA 1RI4A 1Y7PA 2ZIUB 5HFAA 5KKNB 3LDUA 3ESQA 5L4NA 4PLWA 3GG2A 1ORDA 1TM7E 4D8WA 3C1OA 4JKOA 5BYJA 1AK2A 2VHTA 3ICEA 2EZUA 2GUGA 2Y92A 1FMCA 5DNDA 1I0IA 1QHHA 2FW7A 3SS8A 3RSLA 3JR7A 1VXOA 3ONDA 1VLVA 2OE2A 2Q9CA 2CV1A 3JVVA 1RWBA 3MWEA 4DC0A 4N7RA 2QE7A 1LLFA 1V1RB 4YRNA 4AMUA 1I7LA 1J0EA 1YCFA 3MWGA 2FSFA 5L3ZA 5HIIA 3IAUA 4H27A 1PJ2A 1WE2A 3BHJA 3QUCA 1RC8A 4AJ9A 4TKUB 1LA2A 1PIWA 3EVDA 1A97A 2FPLA 3BMXA 1E5QA 5G02A 4KNWA 3LD9A 5D84A 4M83A 3FSGA 1DXHA 221PA 2Q0SA 5BOSB 3EIHA 1SUDA 1YE8A 3CF2A 4NFLA 4O8CA 2JKYA 5AXAA 1EZZA 1ADJA 4AN4A 4UXIA 2DKFA 5JCZA 3U7QB 4ZCPA 2YHAA 4Z86A 2GPBA 2RE8A 2DBZA 1DC8A 1EQ2A 1M76A 3GRYA 3RYFB 3K35A 3I09A 1XTSA 3ZI4A 1O5TA 1L8OA 3VSAA 1DIHA 1OH5A 1G8KA 1PJ3A 2O1SA 1PBTA 2VDWB 2WMNB 2ZWIA 5IDQA 2WWWA 3IAS6 4NNOA 4BP1A 3RASA 3S8EA 1CLEA 4KMSA 3F7OA 4H59A 2F8MA 3EWNA 2ACEA 4IBOA 3OEHD 3WZMA 4UVIA 5KDOA 4EG8A 1KYWA 4QRIA 5BMVA 1M6VA 2VIIA 3CC8A 3CXRA 5E7JA 1L4GA 2E37A 3L40A 4HDAA 1EZ1A 4LYYA 4JT2A 3NFRA 1CUXA 3P52A 1ONPA 2F00A 2VPQA 1RFLA 4AJEA 3FJYA 1QF9A 2AX3A 3MTGA 3E70C 3U4HA 1TTQB 1A72A 2PBZA 4ALMA 4DTCA 4LK3A 2E18A 3GJZA 4U3JB 4TSRA 2VHJA 2VRNA 1SVIA 4NDAA 4TRNA 1O94D 1Z8DA 3GA7A 1OPRA 1VG9B 1A5SB 3R3UA 3ON5A 4FLFA 2REQA 4AKEA 3N5KA 4M1QA 3ZD7A 4NVRA 4TWBA 4KJXA 4IP0A 3B1XA 5ITWA 1I6LA 4IDFA 1Q3KA 2XBUA 1ZG3A 4MV1A 3OZCA 1KI4A 2D2XA 5TQVA 3BREA 4G23A 3RSQA 4G4GA 1KAHA 2A1IA 4OB8A 1G2PA 5T67A 3TCXB 5EPUA 4KR3A 1FUUA 3SZ3A 3X43A 5KWSA 3PF9A 4BASA 1VE6A 4N9WA 4IXTA 4DNXA 3BDAA 1JHPA 5C9ZA 3HVJA 4RWZA 5IT0A 3WLPA 2QRKA 4URWR 2EX4A 3T7SA 4YJGA 5CH3A 1KGDA 1VP3A 3OQBA 3OTHA 4A0SA 4ZDJA 1FJXA 1TLLA 1VJRA 2PJRA 3ZKAA 5AK0A 5ALMA 5AVSA 3VO8A 5DBOA 1E1NA 1N32B 2IF0A 5BT9A 3RRZA 1QP4A 5CA1F 1GU0A 4OHZA 1FMTA 4MJ3A 5J2UA 5LN1A 1D03A 2JD1A 2V4ZA 3AYXB 4RE6A 1EU1A 2FQYA 3BFVA 4BNHA 1F6DA 1WUKS 3C6QA 1MJHA 2R6AA 4HEQA 2ASVA 1NPDA 2WZDA 3JRXA 4IOKA 4XDGA 5HJ2A 5KSYA 4FZ3A 5EWJB 1CUFA 5B64A 3U7JA 3W90A 5DN6D 1V1MB 2MDTA 2WYUA 3GN1A 3WIEA 2FKAA 4R7TA 2GERA 3V1YA 1NN3A 2P0EA 1G5HA 3ND5A 5JW6A 1BKDR 4MVJD 4DB4A 3K1ZA 1DCFA 4J4BA 4Q4JB 4Y1RA 1L5OA 2P8JA 3TXXA 5BR8B 1RXWA 1C1XB 1OR8A 4FSXA 2DE0X 4ZGWA 2ZAYA 3CKLA 3P45A 2VZ8A 4OA8A 3Q2IA 3AM4A 5JD4A 2NADA 1YS9A 5FYDA 1Z25A 1IPHA 4GKJB 5REQA 1KARA 4PN7A 1V8ZA 3F8WA 5H83A 3PC4A 2GBFA 1FA9A 3HDHA 4MVYA 1FJHA 1K2VN 1T9GR 2Z04A 4IXWA 1TQ6A 4OB7A 4KO8A 4OUDA 5DHQA 3UFXB 2HTFA 4F5EA 4EUKA 4XIFA 2VPPA 3GJYA 3AXTA 5FHQA 3TD6A 5L3SA 1E5LA 2P6MA 2PT5A 3C3AA 5C51B 5FL7A 1SKQA 2QZJA 4D8VA 5H80A 1XJCA 4HL6A 5BV1A 2GM4A 3X1YA 5FL7D 4BZZA 4F5DA 5CEEA 3AR7A 2OM2A 3LUGA 4UJ5A 1YRQA 3AHIA 4HJXA 5FOWA 3OC0A 1HEYA 3G8DA 3IVAA 4P4SA 1ISPA 1Z6PA 3WFIA 1WDWB 4OYRA 2PK3A 3IAXA 2F9LA 1PQPA 3IMKA 5TEVA 4ES6A 2K7FA 3CHYA 3IIJA 2Y0DA 4RKQA 3F97A 3NJ8A 1ZK3A 3QU7A 3GQBB 4XUEA 2O8CA 4BV8A 1DC4A 3WSWA 2HHHB 2XOKD 4OQLA 3SP1A 1A4IA 2YOGA 5IVKA 1O6CA 4RHXA 5F3DA 4Z0HO 3Q6MA 2P27A 4BMPB 4PYJA 2YQ5A 1OXTA 3ZX5A 5LWHA 3I2FA 3VDXA 2H3HA 3BXOA 1NBME 1TYEB 2BTQA 2Y71A 2GD1O 2G71A 1P0MA 4CM7A 5K8TA 1TT7A 4A8JB 4G8DA 4O8ZA 1VIYA 4GMFA 5KTNA 4MRVA 2RGNA 4ZPJA 4IHJB 4EZBA 1FB5A 1JHVA 1T43A 4DR3B 3AJDA 3B1KA 3FZGA 1M0EA 3A4MA 3UHOA 1P9WA 3P2EA 4EPVA 2IRWA 5BV7A 4R81A 3MJ4A 2PUCA 2ZYGA 3JYQA 2XUJA 1BWSA 4D4HA 2YWRA 1M1YB 2WWIA 5AOVA 4LAFA 4LV5B 3ZWPA 3GBVA 3G2NA 5DU2A 2WWHA 3I9NA 4CFYA 1QANA 4KXFB 2V65A 2AOUA 4CM9A 5JO9A 2VPIA 2XEXA 3D5QA 4UEJA 2ZUUA 1H3FA 1VBKA 3FGNA 3SR3A 1UAYA 4Q1DA 3T0IA 1ZM9A 2OFOA 3T5GA 1ZKMA 2D0PB 4C4ZA 4DIUA 2VAWA 4OREX 4RW0A 1E6LA 1IY1A 3OUUA 2Z2KA 1D2NA 1P2SA 3EULA 3RVJA 1M74A 1HMYA 2DLCX 2M9MA 2Y1XA 1WRBA 4UHEA 5IXYA 1EB9A 1Q84A 2I7CA 3CF4A 5D6OA 1LFAA 2D7DA 1A82A 3NEPX 4PG5A 4ZCTA 2EC5A 3N8DA 4OGFA 5LYJB 1EVJA 5MDHA 4BFZA 2P7HA 4RF4A 3ILXA 4B47A 2QRQA 4RYLA 2FMFA 2WILA 1D6JA 1XIVA 4YR7A 1XXHB 1GPBA 1AB6A 3CG4A 5F3RA 1K27A 1M34E 1U7HA 3AFOA 3V33A 1NR7A 4XYGA 5CM9C 4CTNA 1FFAA 2FZVA 1Y3CE 4LMBA 4M1OA 2FPMA 4G8CA 3HVRA 2Y0CA 4BGDA 4LJ7A 4MMZB 2GESA 4MI1A 3M6AA 2V96A 4ZKEA 3R3ZA 1EGQA 5C3UA 5JASA 3Q9SA 2HTEA 3MWJA 1Z0ZA 1O95D 2HNKA 5DSZA 2PLNA 5E1MA 4C0SA 3VPFA 1GPAA 4YK7A 3GLRA 3IFSA 3O4FA 3QUQA 4K26A 4K5QA 3SEAA 3KOXA 1R0RE 2B1GA 3FHTA 3WGUA 1GAQA 4D3YA 4YUAA 5C8YF 4I36A 2XUHA 4CKBB 4YDQA 1QRSA 1IOZA 1CG6A 4BBAA 1ARZA 3NC4A 2VH2A 2XTJA 1MTOA 4M36A 2P1ZA 4MW5A 5BSTA 2QMOA 1FNDA 2V8OA 3LPCA 1Y5IA 5EPOA 5JCXA 4G0VA 3L0PA 3T4EA 4LF5B 2UV8A 2G70A 1HE5A 2FRXA 3K31A 3MXTA 3QF4B 1FDTA 4NZYA 3STVA 1A5BB 1H8HA 5K3BA 5JIBA 4ZOLF 3OWHA 2JA2A 4ACBA 1TZMA 5D51S 4BOYA 1KP2A 1N1GA 4U2BA 4QOIA 5B30A 3C8HA 1UKBA 3NTLA 1B2RA 1UFVA 3NIGB 3BXXA 1TIPA 3R23A 4PY2A 1QHSA 3PCXA 1GA4A 2G25A 1E6EA 2MSEB 4LZPA 4MW2A 4QFCA 2Q49A 5LBIA 4BTLA 5C32A 2MSLA 4IW3B 3UUGA 4JBGA 4U0JA 1LF5A 4PYLA 2O1EA 5DTEA 5EIBC 3UJHA 5CXUA 1YBHA 2LXNA 1AA6A 3TW0A 1QJ4A 3KTDA 4JYCA 4BJHB 2YFYA 1C5KA 3LKBA 1B16A 4R4JA 2FMUA 1B43A 2HA3A 3IQEA 5DX8A 5F1KA 3IXMA 1NFQA 4J0FA 3H3JA 3DMYA 5KZMB 4CDNA 4J43A 2JLCA 4E32A 4KWTA 1UPTA 1M6EX 5EWMB 4MROA 1H2ZA 1ZQ1A 3CZ9A 4I3FA 1SEPA 1C3OB 3B6MA 1O5OA 2CXSA 3QV1A 4MCJA 5F2OA 3TBKA 3TVDA 3PEWA 4K0KB 1X7ZB 1H0HA 4GM1A 4D8TA 2V0GA 4Q6BA 3R3XA 4I55F 2A14A 2INGX 1F2UB 2V5AA 4FYWA 1BGWA 1U2DC 4V0MA 3KKQA 2OZKA 3SG0A 2Z98A 3WE7A 1N5LA 1UPBA 3WV4A 3GLGA 3GCXA 2H4FA 1PD0A 5ER9A 4FDVA 4BY9E 3TB4A 3D02A 1CY0A 3BCUA 3TPZA 5AVZA 5IU6A 4CUJA 3CB4A 2Q4TA 1UP6A 3DP7A 3NTRA 4HYYA 3EWAA 4K2HA 4MW1A 3K0AA 5IN5A 4LYAA 3KUKA 3DBHB 1R27A 4BLPA 2QZ4A 4K2AA 3P97A 2FP4B 3IEKA 4GMDA 4MV5A 1H69A 4JUDX 5GONF 1P7ZA 2FPIB 2ISQA 4QPDA 1FU4A 1RBYA 4N5DA 2J3EA 2NN3C 2RKBA 3RT7A 1I7QB 4C7OA 3MCTA 3EVTA 4HGNA 4OATA 2QRZA 3E22B 1MBZA 3WIOA 2HSWA 1ODCA 4GBMA 5PGMA 4L8VA 2W58A 3OTGA 4C4TA 3K0EA 2IYUA 1AZLA 3ABZA 4HYEA 4N7JA 3V34A 3NM5A 3AY0A 3T35A 3THYB 2QBYA 5IC4A 4ZJUA 3AIKA 1JYSA 1N6KA 1II0A 2YJ3A 3AR9A 4JGIA 5ESDA 3UC9A 2A0FA 1V16A 1VPVA 2A8YA 2GJ8A 1PTJC 2ZT7A 3KOUA 1DAOA 3D7RA 4HDSA 4P4NA 4ZU1X 1HDRA 4I3GA 3S1AB 3THRA 4C0AC 3HB9A 1IK6A 4ODIA 4OYLA 2ZJ8A 1NJ2A 4NY1A 4C4SA 1EYZA 1R9NA 3FYUC 3K1YA 4K9OA 4M99A 4CG2A 2CUNA 2JGDA 4KNVA 4OBEA 3GZNA 3CNHA 4Q0MA 4I81A 3EXEA 1E66A 1PG2A 1G63A 1TFUA 2PR7A 4OJMX 4AX4A 5BWNA 3GCGA 4FE7A 3R5KA 4JVMA 1SBYA 4LGMA 4PCUA 4TTIA 3JWPA 4TT8A 3RFXA 2N3ZA 2NWQA 2AEJA 1LZKA 4HVAA 4ZEOA 2WHYA 4LGCA 4Y7CA 1PVVA 5FQNA 3HLKA 3EBPA 2E2WA 1A77A 3SYLA 3SN6A 2GZAA 2PZAA 3OUTA 1PQWA 4QXQA 3ZZ0A 1D4FA 1R8QA 4FOLA 1U1DA 3W06A 1KYVA 3VPXA 1ZW1A 3OFSA 4L4RA 3PIDA 3ENWA 4QM6A 5T3YA 1IXZA 4TYPA 4DJEC 4EUHA 1Q7TA 4X63A 2BFFB 1XD2B 2IZ0A 4OKNA 5CFLA 3RUDA 1O4WA 4CL8A 1A9ZA 4QYXA 3E7XA 1GEGA 2VFAA 3FPJA 1JSRA 2D4HA 3IMCA 3IT3A 3OLQA 3PFIA 4H3VA 1U9IC 4C21A 5IJ9B 5E6RB 2B21A 4QXPA 1M5TA 1DSSG 4JJ8A 3LO8A 1WIWA 1LVGA 1UJ5A 4MJXA 1XKTA 4DADA 3NDBB 4L78A 1CQZA 3GUVA 1N8KA 4XWGA 1NA5A 5TF0A 2CVPA 3ZI0A 2CBGA 3E8XA 4K9DA 4C4OA 1J99A 3UXYA 2O1WA 5AFSA 4KGDA 4M6WB 3KVYA 1NL3A 4MPTA 3V2GA 3LUPA 3MWLA 1IEQA 2YZNA 4L7VA 1QKKA 3JSXA 4TVSA 4GMGA 4OQEA 4RKYA 5D3MB 2OD2A 5T3UA 4DA7A 3ZDEA 4KH0A 3GCZA 4MYSA 5HMMA 4CEJA 2HWXA 3HR4A 2C7BA 3KKOA 3IOCA 3ZXUB 2P5TB 3F2IA 4R9UC 2DR0A 2GPYA 2HRBA 1N0IA 1HE2A 2PFKA 2GJ4A 1RLUA 4KYUA 4RFSA 5AK5A 4A5SA 4CFSA 4IOJA 2P90A 3AERA 3QOWA 2VP6A 3A2NA 3NWEA 4GXRA 3WMFA 1U8ZA 3OESA 4G07A 2H1OA 1EQAA 1OUMA 2VF8A 821PA 3HB1A 4KN9S 3BD9A 4BUZA 4C0WA 2P9TA 4O1MA 1LNQA 2J5RA 2YC2C 3KU1A 3OWXA 1WR8A 3OF5A 4KQ2A 2JB9A 3FWZA 3H5LA 4UAJA 1OZHA 2O4CA 1D04A 3HMKA 1VI2A 3FLMA 3UMSA 4AZWA 4BVKA 3EODA 3ZY3A 4ARBA 2XMSA 1OYVA 1PSWA 3OFKA 2NACA 3ADDA 3CJRA 1G1MA 3CH4B 1EDZA 3JYOA 1Z4PX 2XOEA 1R0XA 3NUGA 3ENNA 2NU9B 2D00A 1WS6A 3HRHA 1L2TA 5IVPA 3BCRA 4ECEA 1A88A 1DFHA 2DH6A 2OUKA 4FE4A 2FLVA 1YS7A 3EGXA 3LCRA 2JIBA 3TR5A 2B4RO 2WQ6A 3U7GA 1QDEA 4RK0A 1LC3A 5HM8A 2CK3D 2EV9A 1V2HE 2OV8A 4NICA 5EXXA 4RTNA 5HEKA 4UOQA 1G42A 1L8AA 1PQ4A 3I1JA 1PJQA 1EFDN 1NLUA 2WKPA 3KAKA 3H04A 3KB1A 3SF8B 3KQMA 2H8KA 1ZC4A 5HIKA 2C2HA 2G9VA 4EHLA 2PQ2A 1CNMA 1TNDA 2C59A 2ETXA 5BQXA 1TAHA 3LVBA 1GDDA 4HQOA 2VJAA 5FI1B 1H9AA 2RMKA 3UXMA 4DNOA 3VSEA 3ETLA 2Q8PA 3CUYA 3KPUA 5CTAA 3O6VA 4Y3UA 4ZVLA 7ABPA 1QP7A 2JD2A 4FFWA 4EP1A 5A62A 1U80A 2QLJA 2JFZA 2XVAA 3AUTA 4E5SA 2C5BA 4DY6A 4ZZ0A 1S8AA 3Q6IA 4ABTA 1KI8A 1T1GA 4PV7A 5JMPA 1X13A 2ARKA 2PZBA 3ZZMA 5AXCA 1XTUA 4TMXA 4W9MC 3ZDRA 1STOA 4RZXA 4C1NA 3QWHA 1UEXC 2RHLA 1N5DA 3KETA 2UXCB 1DUIA 2V3WA 3MBKA 3PQDA 3ZIAA 3M2TA 721PA 3SHWA 2CJYA 3LVQE 4H1UA 1ZK2A 2VL7A 1PE0A 4O33A 4ZCLA 1AG9A 1L5NA 4C9BA 2PWPA 3P71T 3V4RA 2BFEB 3A36A 2VHWA 4DSAA 4JI3B 5E9AA 1PYGA 1RMTA 3PC8A 1FFWA 1E79D 1GRVA 2CNNA 5CA0B 1NVEA 3THWA 3F6SA 2QX9A 2QHXA 4X5OA 1T13A 3FFXA 3QQPA 3HCBA 1HY3A 2G28A 2PX4A 2X4LA 2ILVA 3QKRB 4RVNA 1OXUA 1ZZGA 4WLOA 4ER0A 1C7RA 2IEDA 2NP6A 5FH9A 1QQAA 3EEIA 1PFKA 1KQOA 1QFYA 4TMZA 2CNLA 3VI3B 3K6SA 1QF6A 3E2MA 1Z26A 4BJ5A 5A5GA 2OCGA 3F4LA 3L1KA 1RD4A 4OM7A 3MT8A 5AJUA 2FPKA 3DOCA 1TCVA 3I30X 3QI2A 1U0BB 1QTRA 4D99A 4GWGA 5FJIA 3FIUA 3K15A 5KOJB 1CTQA 1C7EA 2H1RA 4S05A 2EERA 2NAPA 1UKZA 4DIEA 4OJQA 2Q0HA 2C9DA 3WGLA 5HW0A 1ECBA 2JS7A 1E2DA 1P29A 1V7QA 1X86B 1EG7A 1W35A 2W00A 1NNI1 2ZJYA 3B6IA 3NC1C 3PNYA 4IDGA 5EJEA 2QAGB 2AX4A 1Z5UA 1G5QA 1XAHA 4JOSA 4FMDF 4GSKA 4X0EA 2PX6A 1T9BA 3I45A 5FBHA 3TZQA 3WYAA 4H4EA 4TGLA 4KITB 3TEJA 1MN6A 4B84A 5A3RA 3K8OE 3WRWA 2Z5GA 3CEJA 5ENDA 4JNCA 4KE8A 3X3HA 5H3LA 3RH0A 3BH6A 1MABB 2FR8A 2J67A 1ZK0A 3LL7A 3ZLBA 3KJIA 3AVXA 1Y7TA 4PVDA 3Q3IA 5BSMA 1E1LA 1UIMA 1ZGBA 2CGEA 3DTNA 1JFVA 2WJJA 3HM9A 1SPBS 3A9SA 1J56A 2E89A 2DCMA 3O21A 4OHCA 5DJ5A 4DHEA 1GUDA 1U1GA 4E5UA 4ZCIA 1JLRA 2J33A 1T3ZA 3AWIA 5AM3A 3MJVA 2W83A 4NS1A 5BN5B 4EFLA 1WA5A 1XK6A 3H13A 3OOWA 3UJ8A 3N2EA 3V1KA 1REQA 1ZGJA 3P0EA 3BRSA 1K4YA 3FTPA 2DPLA 2CN1A 3IDAA 3PYMA 5FQOA 4M9CA 4C3VA 1ZA2A 2PUGA 2FNAA 5DNYB 4F6LA 2GA9A 4J2TA 2J9FA 5TPZD 3ED5A 1ZN7A 1GDHA 3WBJA 1YOVA 1YFLA 1UBUS 3OZWA 4JXKA 3TJRA 1M1ZA 3ZH9B 3E48A 4LXIA 4ZALA 2J3MA 4QE3A 3IPLA 4FJ2A 1UBGA 4HXYA 4O4LB 2YINC 1T5OA 4H9GA 3TMYA 3QW4B 5GVRA 4MHOA 2VJCA 1ORVA 3JZIA 5JH7A 2C2OA 3NTXA 3PITA 4M76B 1PQYA 3PNMA 4G0NA 2J31A 5JG7A 3P9PA 4G1MB 4RJLA 5ILGA 5J4LA 2JGMA 2MINB 1GLGA 3HXPA 3JATA 5KC9A 2WMDA 1SG0A 1GARA 3TR0A 4IIFA 3B1JA 3U81A 5HUQA 1PL7A 1PNQA 2H4WA 1L5WA 3FMOB 4INOA 1UKAA 4HDNB 1ATIA 5ANRB 3BB3A 4DPMA 1PZMA 1S96A 2FGJA 3DL4A 4G9BA 3GQVA 1YGPA 3S1LA 4G36A 1MT0A 1SCNE 4DARA 4WX2B 3DLHA 2FUCA 1GZ5A 4JIGA 3N8HA 2Z8ZA 3VR1A 1WXDA 2EFJA 2Q5FA 3NMUF 1IVNA 1XCPA 1CJTC 2F3PA 5K0JA 4JX9A 3FAKA 1YB4A 3K9QO 4G89A 3DO5A 3MTBA 4EVSA 1DADA 1UBNA 4LZZA 5JRJA 2Q6IA 2VUIB 4W1PA 4A82A 1U7WA 1Q74A 2Q4EA 3TIIA 5GV7A 3TNLA 3I5XA 5I45A 5LWQA 1GV0A 1X9GA 4W82A 3V4VB 5CDFE 2WIKA 1TKCA 2FUEA 4KUGA 1LLUA 1ZRHA 2CXQA 1Q1QA 2GTIA 4CIXA 5EE0A 5DGDA 1XZCA 1JW9B 3PWTA 4WN9A 1S9DA 5C5CA 2R4TA 2ZYSA 2XAUA 5B1HA 3VUFA 1UWCA 2B0JA 2ZPAA 3GEMA 4GP6A 4PZCA 2EG5A 1IQUA 1JHDA 1SXJE 2FFRA 1N8NA 1TTPB 2HWUA 2O2DA 2XYGA 3IUPA 4QQNA 5EXSA 3HFRA 1XAIA 3UANA 2UUCB 3IQIX 1RI1A 2WB4A 3T0GA 3DOFA 4XQ9A 1MXFA 3EEQA 3R3VA 5ESXA 1ZIDA 2YMQA 5LQAA 4WJZA 1KMQA 3HNOA 1ZHHA 2O2XA 3GZTB 3SKVA 3U31A 3UWPA 1V35A 2NO6A 1GCUA 2V7PA 1QPGA 2Q3JA 5FT9A 3EVBA 2GN4A 5K45A 3JPWA 1L4NA 4RX1A 1DARA 1S3IA 2E0IA 2HIMA 4NQRA 4RYDA 1UC5B 5BN1A 3ISVA 1ABFA 2R1TA 3AYZB 4CEIA 1L7PA 1PWZA 2W6MA 4EQ6A 1P4AA 1YUNA 4Q3DA 3WQRA 1R74A 4TSFA 2E4VA 4CG0A 3CR3C 2I22A 1G66A 2R66A 2V7XA 1GZUA 5JO0A 2W8BB 3LJKA 2ZBUA 1E96A 1VKRA 2OBLA 1IIRA 2XQKA 2Y93A 3CNNA 3E2IA 3E5HA 5AM0A 3S4YA 1Z62A 2W6ID 4Z9FA 5I6DA 2HMSA 3OX2A 3QFFA 4RK7A 2VHZA 3PJGA 4B3HA 1UFRA 5DM1A 1U7PA 1WDLA 1PFGA 2SKEA 4E2FA 3ZXXA 4Y1GA 1W94A 3KYCB 5JVDF 2HUNA 5DI3A 5DHTA 1O9HA 2PJUA 1T24A 3NW9A 3R7FA 2FCRA 2FB9A 4PYMA 4E4YA 5IF3A 4R71A 3WVNA 5JNLA 2IK8A 1JQDA 4XVHA 2FG6C 3E9RA 4XZ3A 3MTAA 4ZAGA 4F9GA 1O8CA 2HK6A 2SCUB 3IVCA 5CFMA 1XL0A 4UBLA 3UM9A 1XLUA 1AURA 3F3KA 2TYSB 2KJQA 2G9RA 2LD4A 2J1LA 1ULHA 3AFNA 4DR6B 4MV3A 4YUYA 2OAP1 1MMFB 2PL5A 2SHKA 4M0MA 1N2BA 1DTWA 1CUBA 2YHUA 1KI1A 3D81A 2V7GA 2IITA 4HKTA 4BAUA 3HE3A 4JB3A 2CLIB 1G3IA 1YS6A 2YX1A 3KDAA 1MW9X 3M6XA 3VSBA 2QTVA 3FHOA 1XZKA 3DWFA 1T5TA 3H2BA 4Q7EA 2UVPB 4E5DA 1KI3A 2YVUA 1BMDA 1MQAA 1TZJA 3KXIA 1TMYA 4R1PA 2Z1NA 4YV1A 2I29A 4S12A 4TL7A 4ZRMA 2X1VA 3EMDA 4YS6A 1U3CA 3PXDA 2WKWA 4AM8A 1VJ5A 2ZE5A 4TLLB 4XOUA 3DJFA 3WG9A 4E5PA 2NYUA 2Q1XA 4RZHA 2WTNA 4KXUA 4YASA 5TPWB 2EX0A 1XKXA 1P0QA 2YRWA 1KS2A 3CNEA 2GA8A 1KZ7B 3DLCA 5JHGB 1UANA 1O1YA 3D8BA 3JZDA 3D7KA 3HBFA 1DXYA 3PNLA 1NOKA 1C14A 1ZVQA 3CX6A 1IQPA 3PRYA 4U6NA 4A1FA 3UOAB 4C76A 1R9JA 3L6BA 4BFUA 1ONSA 3D4IA 1C1DA 3HH8A 1JN0A 5FDFA 3NAMA 3TNYA 2RHDA 2J5KA 2ZJ7A 1P17A 4FC6A 4NJMB 2BFBA 4V0QA 4BRUA 4BWGA 1W76A 3LPDA 5E8JA 5ICMA 3IT1A 1YS4A 2VNKA 3X44A 2HK9A 4GGOA 5TRTA 3AR4A 2ZB8A 2D5IA 2IGBA 4WACA 3BMOB 3QWFA 1T2AA 1UOQA 4HC4A 3AETB 2HSDA 1U2SA 3VZCA 2VT2A 5EEGA 5A9SA 1JDVA 6CHYA 1F2DA 1OMOA 1YIDA 2XEDA 5HILA 3TQOA 4DG9A 5JQGB 1DQPA 2VQ6A 1H2AS 4MR7B 5AI9A 4FW8A 5JJKA 4R9NA 4DMKA 4K9MA 3W6NA 1QGAA 4AWAA 2RONA 2R5WA 1U8AA 1V6CA 1O77A 4DLKA 1NDUA 4Q3NA 1I4DD 5L51A 4DM4A 2CF5A 4NPHA 3ZWWA 4B9EA 4NKRA 4EHBA 4UCWA 3W8RA 2HT1A 1RAFA 3WB0A 1L0BA 3W5SA 4FD2A 4F9TA 1YQ9A 2OHHA 1XZAA 1TLFA 3ZXYA 3JQFA 1W36B 1EP3B 4H3HB 5IANA 4LSGA 2J3HA 4QDXA 1BQ3A 3LT0A 1T3LA 3IIMA 4XGNA 3MAAC 3C5HA 5D01A 4RVUA 3CZQA 3HSKA 4ZVMA 2QUKA 1PG0A 1GU1A 3A6JA 3H18A 4IKOA 4KQGA 1T15A 3BFJA 3EGDB 2G7MC 1RYFA 1GPJA 2ZWOA 3NU1A 3W8DA 1TM5E 1YGYA 1ZH4A 2EW2A 2CBZA 2XKAA 3ANMA 1KH1A 4M9QA 4ZZ2A 5IVIA 3GT4A 3NGMA 2DULA 3IGFA 3M3DA 5COAA 4QSHA 2P77A 1IOVA 1SKBA 1L5HA 4NBTA 2V74B 4ITRC 2M32A 3MERA 2P7IA 4N6GA 2OBXA 2FWPA 1MB4A 2IPXA 3W77A 1FFYA 4DKXA 1NVVR 3PCTA 4ZT6A 4YRAA 3ILHA 3PA8A 3H86A 3VPHA 4CQMD 3VR2A 4CM5A 1TEZA 1UCFA 4Q3EA 4C6TB 2WV9A 4OOEA 1Q57A 4CL0A 3LCVB 1E2UA 5IVDA 5CVUA 3G0IA 2Z30A 4MCAA 2Y4OA 4E46A 5KTKA 3L4EA 4LY3A 4ZO6A 1UXHA 1H1TA 1RKUA 2COEA 3ELBA 4NECA 3WRXC 2JK0A 4MR9A 3EPJA 4OJYA 2XWBF 4QBGB 2GJSA 1A9TA 4HWKA 4HZUA 4CR7A 4IUYA 4RZUA 1M2VB 5DV9A 2BFAA 3N2KA 4GGMX 5KYUB 2DLNA 1ZH0A 1JB9A 4QEKA 3CRZA 4D0LB 4MS1A 3LGXA 3SJAA 1SC9A 4UASA 4F38A 1QAMA 3TZ6A 4PFJA 2Z2JA 1JHOA 1SVMA 1ZISA 2IYXA 5AKLA 3DC2A 2FDCA 4PX3A 1Y4SA 1KJJA 1C3JA 1JDBB 4N9QA 3WGJA 1KO1A 3K9FC 1QV7A 1T5LA 2I99A 1JR4A 2H2AA 2YN2A 2YXEA 3QVLA 4YEDA 5EZYF 4XVCA 1ZGHA 4I3HA 4KRFA 1GAXA 2GK4A 1H6CA 1YUMA 1HETA 1I7PA 2WUWE 1M7HA 4DLSA 4EYKA 1ADCA 2G8NA 4BYMA 1GFSA 1DJLA 1Q92A 2PM8A 5CK4A 5F1YA 3W7BA 2Q07A 3T9DA 3JARA 4E5MA 1I2ZA 3GAFA 2I03A 4LMPA 3JWEA 2JVIA 3D6AA 1JKIA 1G6HA 2EZ8A 4TXJA 2C83A 1AUQA 1Q0QA 2G9QA 3M1YA 5IT4A 4AIIA 1JALA 1ZMTA 2VDJA 3NTOA 5HOQA 2ZJBA 4MQMA 3ENQA 1E61A 4IDDA 1VHJA 2FPRA 4M8IA 4NBWA 1PFYA 1VYVA 5F78A 4BNYA 4L8FA 4YXFA 4IGIA 5KNDH 5FPSA 1HM5A 4M22A 4EYGA 2PRZA 4GECA 4R8VA 2GPSA 4G9EA 2IZ5A 3WB9A 2BGGA 3OX3A 4F91B 4Y30A 4RJ2A 2JCYA 4KSBA 2ATCA 4JQCA 3OLZA 2GAAA 2OLEA 2BKEA 2OQIA 2B8TA 5TLSA 2C61A 3QXXA 4PGAA 3WXMA 2G5CA 3O93A 4JYAB 1MJ5A 4G6ZA 2BDEA 3A25A 1NXSA 4BMNA 2GCIA 4YA6A 3U80A 4HXFB 2JFWA 5HYVA 2SICE 1XV5A 5J2TF 1B14A 4DCCA 2UZ3A 3VKHA 2XB6A 2Z43A 4IO1A 3Q7QA 4MUGA 1N2OA 2FZCA 4M0PA 2O20A 3L8FA 2EFCB 5CB6A 1U3TA 2ID8A 2QRVB 4IHAA 5TQ2B 1NW5A 1OOEA 3RS9A 1KS9A 1MFPA 3L77A 1G55A 1Z3CA 4MZDA 4C89A 5C31A 5BR1A 3BTSA 4BB5A 3KLOA 3FZYA 4YRFA 2WHEA 3T5MA 4AO6A 3UT0A 4PSKA 1GUYA 2CHUA 2OFWA 4G4IA 3UT5B 1VMIA 4B0OA 2FQ1A 3RS7A 2FEPA 1RPJA 4BNUA 2OHFA 3BSSA 2RHWA 1KIAA 1TDJA 9MHTA 4PN3A 3ORRA 4CM4B 2FPWA 5KQRA 5KTSA 2CB9A 3UK0A 4YLYA 5IEJA 3RAGA 4EHNA 1M7BA 2GZRA 4Y8VA 3CE9A 4AIRA 4DRXA 3E9NA 3OD5A 2DR2A 2ZI3A 3PA6A 4YAOA 4ZMSA 2QU7A 4C2AA 4MX8A 5FV7A 1K3FA 3FCXA 4HPXB 3OT1A 1TO6A 2HV9A 5DH9A 5A6SB 1S8NA 4EJSB 2WU4A 2Y0BA 5BT8A 4V1CA 1U9JA 1NLFA 2FSVA 4L3VA 2BW0A 5CEJA 3OJEA 3IEUA 1VFPA 4YJDA 1O94C 1X8LA 2BWJA 2OBMA 1Y42X 3WK7A 4QUKA 4RJIA 4EMSA 1VPWA 5J47A 4QT0A 2VKTA 1GNSA 1Q0LA 5IJXA 2WQ7A 2XA9A 2YXLA 2ZYRA 2H52A 1M2OA 1PFQA 1X15A 3FH0A 3GU3A 5AVXA 5AW9A 1GFWA 3IO3A 4YIHA 3TLGB 3D2CA 1INLA 3CRRA 4CZ2A 4GMXA 4WKGA 5F4BA 4U9UA 5CIWA 1Y1QA 3DKVA 2CC2A 2LVBA 2XUAA 3F6CA 2ZBPA 5SY6A 1JFSA 3LK6A 4LRXA 4LJAA 3L02A 4NL4H 3H9JA 1KMIY 3KQTA 3U39A 2J0EA 4WXYB 3VDMA 3R0VA 5C1DA 4LTDA 1PLLA 4UHHA 3GEEA 5M5BA 3OZ7A 4YAIA 1W2GA 1M2NA 2YIDA 2V59A 2QTZA 1YF3A 4FFRA 1I4EB 3K6KA 2WF8A 5CIQA 1N2XA 1I30A 3G8AA 3EZFA 3ZVMA 1Z6GA 2EQAA 3UTDA 4W8OA 3DLIA 1ZN8A 4L4XA 3G9XA 3OZFA 1NXVA 3S2EA 2ZIFA 3AWDA 3K0KA 3QFSA 2MJLA 4O0MA 5IXSA 1AF4A 1BS2A 2XV1A 3DKIA 3LDGA 4M38A 5CNKA 3VUEA 5FUWA 2QT9A 1TYZA 2VSXA 5AHRA 2R8EA 3WIVA 1TZCA 4IUDS 3RS2A 3DXXA 4L28A 4YJ2A 4PX9A 1KETA 1R4AA 3U7EB 5KSZA 3RBZA 4M60A 3C6MA 1ECPA 3R8CA 4RDXA 5AVTA 4QLBA 4OYYA 1SBIA 1EK2A 4WQMA 2O8DB 2AW5A 3OZVA 2DFNA 1BKSB 1DTSA 1FFHA 2AL7A 2CLMB 2B8JA 2V6BA 3ASYA 3FHJA 3GT7A 3N0VA 2QPOA 4TS4A 521PA 1U3GA 4JDPA 5B4VA 3WQHA 1UAGA 1XCJA 2VVTA 3KFLA 4FU0A 4D42A 4MVJI 1CRLA 3V8PA 1FP4B 3A4VA 4FCCA 1KZ4A 4XYMA 4XB6B 4B4OA 2R3SA 2WE7A 3T3IA 5CT9A 1Z4QA 5FV4A 3HUFA 2FRDA 2GQ0A 2L2QA 1N2CE 3K2QA 4UU8A 3IB3A 1G7SA 3NG1A 1KU0A 4LE2A 2QQ5A 2PSEA 5EE1A 4BLQA 3HP4A 1FFXB 4QYSA 1QBGA 3UQYS 4X1YB 4Z0TA 5C3MA 1ADYA 3UTCA 4LYHA 1Y6RA 2B30A 1P2UA 2HCRA 2VSYA 2QQFA 1V26A 2AJ8A 2NW6A 2YZMA 1O57A 4UVEA 2ZPTX 3GDWA 5EIFA 3DONA 4Q7LA 3TSAA 3MCVA 3MJRA 1F5SA 2C20A 1RWMA 2QL6A 3GJ6A 3LSTA 3OQHA 5JZMA 1ZIPA 3AH8A 4OVKA 5AR1A 4NX2A 2JATA 1RPAA 1L4EA 2VS1A 1BXRB 1BCSA 3AQIA 3GN2A 2XXBA 4JB2A 1G41A 3H05A 3M8KA 3O03A 2RBKA 5HM6A 1M1UA 2Y6UA 3MLAA 3QVJA 5DLQC 2RHMA 1JU3A 1U8UA 1W5EA 4PGMA 1KEKA 1U0FA 3R6DA 4JN6B 4BNIA 1CUDA 1CIVA 3QLUC 3IR5A 2P9HA 2BELA 5CYPA 4A10A 5CRIA 3D3NA 3K0CA 3KOOA 3ANSA 1T0BA 4H7DA 3T1NA 3RWBA 1AS3A 3W2HA 4DA4A 1C8VB 5CNMA 3O3NB 2PX5A 4IX9A 3SMVA 4B5LA 4DEYA 5KOHA 3SK0A 2RGNC 4J0IA 3ZK9A 5KMGB 1J0AA 1XDUA 4ARSA 2VT3A 4H1VA 2I7XA 2P3LA 2V4UA 3KEQA 4G5SA 3S2SA 1XA0A 2Q5HA 2PY6A 3WLAA 4CMIA 4TKZA 3OE5A 4ZFNA 1AUVA 4DKJA 4KDEA 3BWYA 1B4DA 1YMVA 4XR4A 4ZI7F 2JA1A 2J5XA 4B3SB 1H6DA 1WY5A 4LFAB 3EXHB 4LHYA 2BGJA 1ZUD1 3R7NA 4HBZA 1OFUA 3DC7A 4FGSA 1T36A 4D4MA 4CKWA 3NJ4A 1YQDA 2MMGA 3AKEA 1KOFA 1XC7A 4HGRA 2WP0A 4QT4A 3TK1A 4C22A 3NHMA 4Q7KA 3KPVA 2YV4A 4R5MA 5K0FA 3H5WA 3OE7D 4N5NA 2M6SA 4KQ1A 3ZYCA 1RRKA 2OO3A 1VPLA 4L8LA 5AKYA 5LZ4A 1MW8X 4ESHA 2GAOA 4GZ6A 1Q95A 2HGSA 2DHCA 4E11A 1FP1D 1SIWA 2ZQ5A 1LSOA 3G1WA 1DKUA 1PGNA 4L08A 3VR0A 3JQ7B 4RACA 4A8PA 1JE0A 4LF9B 1E69A 2H16A 1MB2A 1WX1A 3UWOA 2WZQA 4ARCA 4DGSA 4EY7A 4F6RA 3U4QA 3K9CA 3CLSD 3RUIA 2NTNA 2NUAA 5IS2A 5K0TA 2B98A 2H11A 1LGYA 1QYDA 3UA4A 5H1YA 4KVGA 1JEQA 1CY1A 2PTGA 4JJFA 4DSZA 5AICA 5AJYA 2QG6A 3KKEA 5CCBA 3WMXA 4KH1A 1K6JA 2B5OA 5EMLA 4HLUA 4CQMB 5CB4F 2BMVA 2TMYA 1HOXA 3R5TA 4GI5A 3ZNNA 3ZH2A 1E2EA 4IIYA 4QNMA 1JR3D 2GMWA 4MGIR 4WSOA 3MUEA 2JLBA 3KALA 1X42A 3LP8A 2ANCA 1F3OA 5TY0A 1D0VA 2FRVA 3BRCA 5ARDA 5GP1A 1X7HA 5COBA 1BN7A 3NT5A 4KV7A 1ONBA 4U2DA 1Z4JA 2IVFA 2FXVA 1OZ0A 4C3OB 3OMWA 3RUHA 4YRMA 1NBMA 2JI9A 2W2LD 1QTIA 4C7MA 1X38A 1YZUA 2ZZMA 2AG0A 4HDKB 5ELMA 2ZXFA 1LS1A 1PVDA 4YPVA 1AF7A 1NBIA 2JLAA 3UAGA 2O0LA 4P0TA 3U2QA 4DIOA 1C1HA 2P9CA 2JLWA 1A8HA 1ORHA 1TX4B 1RRMA 3QVKA 4FX2A 2IOFK 4P98A 3KHKA 4BKUA 3MSCA 4Y2GA 4UOZA 3OEYA 2JZOA 4F8EA 4ZVPA 1UC4B 4QNRA 2WZCA 1TEVA 4A0RA 3GNQA 3UGTA 3U7HB 4L5BA 1SNYA 1C3LA 3LHFA 3JVDA 1KOLA 4JVSB 4KYIB 2XNDD 2VRCA 5HMLA 2RAFA 4ZT2A 5K1ZA 3L43A 3VAYA 4QQ8A 3WKEA 2YJNA 1QZTA 4E13A 3O3OB 3S99A 4XE5A 3UPTA 3PNVA 2FAXA 4POAA 1G3QA 4PW0A 3RW9A 4IY1A 3K1AB 1BSVA 1U2EA 4C0LA 2PAAA 1CJKC 5K8UA 3S5UA 4OFXA 1ENZA 5CJJA 3CQ9A 4GMKA 3WLJA 4JOBA 1UMBB 2WJIA 1HT1E 2RHTA 2CLDX 3U7RA 4NYJR 4TVOA 4O5OA 4QTTB 3ZU5A 3W2IA 5K0BA 2PZEA 5F3WB 2ZVQX 1ESNA 2XNSA 4GEGA 5HK8A 5DYYA 4HQ6A 2MSWA 5FOQA 2VA9A 1E2KA 1KSFX 1W0JD 3E03A 4I50A 3OCYA 3T06B 1HEUA 5JTTA 2WD7B 3HUTA 1NUHA 3RNOA 3CVUA 2PPVA 2QDXA 5LQMA 3ZW7A 2H1IA 3L4KA 3OZTA 1D4ZA 3UWMA 3DCYA 4XLLA 1SCIA 3UG6A 1KQGA 2CCJA 3S70A 4BZXA 4QJIA 3UXEA 1BS9A 1RKBA 2XBMA 3A9UA 5IWAB 3U5ZB 1M72A 1E2BA 1IE3A 2JZCA 2AFHB 5CCEA 3DLTA 1U7TA 3MINA 1M1NB 2Q5CA 3OTIA 4BE7B 3H99A 1M34A 3QYFA 4RVGA 4RXMA 2GJ9A 4DLPA 2BJWA 2DGDA 3ITNA 3QUSA 2F17A 4J6EA 4C29A 4C4YA 3FOWA 4GSLA 1N8TA 3P94A 3VR6D 3BAZA 4AJHA 3DBOB 4B17A 2QL9A 2IEYA 3H2KA 2ZBRA 3NHSA 1TOAA 3FVQA 2OENG 1XELA 2I33A 4AC9A 3HCNA 2XMDA 2IQ5A 5K05A 5LD2C 4N8EA 2J0SA 1BCRB 3CPHA 1HSOA 3DUFA 4JC4A 3A1FA 1O08A 5BSHA 1MX5A 4IVQA 2BBSA 2WTBA 3HYNA 5KVVA 2NSHA 2QU8A 4R0MA 2XCRB 2WD8A 5JE8A 4JI1B 1E0JA 3IO5A 1JBQA 3BJZA 3JU3A 2YXDA 2IGTA 4XQEA 4NBUA 3ER9A 2A30A 2QLTA 1YE5A 3CW2A 5B36A 5E0KB 1GPMA 1KRHA 1UBTS 2HBQA 2R62A 5DULA 1NPTO 2ZAMA 3B38A 3OKCA 4ANFA 3RSSA 5LMZA 1AXEA 1E2QA 2IEGA 1KAOA 4LOJA 5ALJA 3LECA 3R9KA 3SYTA 3VU9B 2DWUA 1CSEE 4D4JA 1IXYA 4CV2A 1KI7A 1PKXA 2RH4A 1DAFA 4MHSA 4L6IA 3GIWA 1VRCA 3A3KA 4KFSA 1T5SA 2KPOA 4FYHA 3RTAA 1IJKA 2C0PA 5D5HA 1X1SA 3D4NA 5BW5A 3WBKA 1N25A 1ZFNA 3OPYI 4M9XA 1A9XB 3WB1A 4XW2A 4TV9B 3UCXA 1MB0A 4Z0PA 4ZA2A 3T4UA 2I7DA 5AUQA 2FUG1 5HRUA 3AONB 3CU5A 2IYLD 5SZJA 2I6SA 3K8QA 1RYDA 2AD5A 2JHCA 3WMRA 4JXZA 1FXUA 2QSUA 4K9QA 2C4WA 2G08A 2NUTB 3DW3X 4WK2B 2BEUA 1KKLA 1SZPA 3VQTA 2I0FA 3G5UA 1XN4A 4PZAA 2GJAA 4XFJA 5C2JB 4M1ZA 3TYXA 3FBWA 1PZHA 2AYXA 3LY9A 3R6GA 3AFGA 3EDMA 3WSVA 1GQOA 3RHTA 2QGFA 2Z8YM 5KAPA 5J1SB 4WXPA 5DBGA 3EGVA 1WLYA 5JZSA 4ENPA 4G5FA 2A5YB 3GRRA 3OLWA 1A98A 4HAZA 1OLSB 3BEOA 3GGPA 2SBTA 2VEDA 4M86A 3TRFA 3ZPXA 3TUZC 2PT7A 2REOA 1E7WA 1OH6A 2GZ2A 2DSTA 1T6ZA 1KFJB 3I6QA 3ONFA 1VKNA 3WWZA 5CX4A 3H5RA 1YTLA 5PNTA 3Q7EA 2WF7A 2QXYA 4PHTA 4P3NA 4X97A 3QI7A 1FP2A 2XPCA 4FHZA 3AJEA 1U8CB 1Y9AA 3HG7A 4G0UA 1OD6A 1RWXA 4XWAA 1CUIA 5JR3A 4DXAA 2ZI7A 1JQ5A 1P45A 1SUWA 2BKVA 3HXKA 3INTA 4RTPA 4GE0A 5I4IA 2V97A 1FTWA 1TQDA 3EYAA 3CCFA 3LL4A 3OJOA 2VDLB 3UMJA 1Q14A 3N58A 2XQGA 5K6AA 2F8LA 2D4AA 3M6IA 3QEMA 2QG4A 2PUDA 3DKRA 4ESVA 4RJKA 3QPAA 1K7EB 2ATVA 2HADA 2R65A 3I05A 1Y80A 5JJCA 1I0LA 1JFTA 5KX5B 2F1KA 2QX8A 5FBLB 1G9XA 1P4JA 4L5AA 2F4NA 4FHFA 4R2WA 2AN9A 3EVZA 3QG1A 1JI3A 1I1QB 1YU9A 2GEFA 2XF2A 3UNXA 1PT7A 4BTEA 4DB2A 4CCAA 2VLBA 3D3WB 2CZCA 4YI5A 4G09A 3D31A 3I5AA 3B7PA 2W98A 4KX3A 1FXWF 4X66B 1LRJA 3OAAA 1CB7A 4JBXA 2VH5R 2HMVA 1ML4A 2C82A 4MEJA 2HGZA 2VTDA 3IIEA 3OAAD 4GRAA 3T9BA 5ARCA 5BW8A 4RVCA 3JQGB 1U6JA 1WB5A 2W43A 2YN0A 4HAWA 3W9SA 5B7GA 1OROA 4B7ZA 1XZNA 2BLLA 1V37A 3HUDA 2QORA 3K5HA 3QVOA 3QSYA 1JDUA 3G02A 1DV1A 4PQEA 3AHDA 2AOWA 2D0DA 4JBLA 3Q1LA 4GOXA 1P60A 4BZWA 2OESA 3MCWA 4GRIA 3L79A 4U2EA 3LDHA 1FBNA 3AEKA 1JUDA 2J48A 1HDIA 2QMUA 4PX5A 5KDDA 2VBCA 3TLJA 3SSMA 4BAZA 1VCNA 4MWZA 2P9EA 1CUWA 1VLLA 5ECYA 4BRWA 2P91A 4UQOA 4ALJA 4OQYA 2IHJA 3N2ZB 3LRPA 4ZQCB 4FDUA 5SYAA 1H4TA 3C45A 4O2BA 3RVPA 5ETJA 1DEHA 3HU1A 4GRDA 2K4MA 1MEEA 4FNMA 4DM3A 4UW9A 2PU7A 3LNTA 2NLOA 3NQ41 5LZ2A 3ICWA 4P4TA 3AFMA 3VPGA 5BVGA 4M3NA 2Q4OA 5I7VA 3PVZA 5LXTB 4YP6A 2DB3A 2IIVA 1A7KA 3NTVA 4LQCA 1U0EA 4U4AA 5LZ9A 5F7OA 3K4QA 3GLUA 3THXA 2BFWA 4DWWA 3EFHA 3DOEA 4B5KA 1MX9A 4X8LA 4B2YA 4CUZA 2J3JA 3OKPA 4YONB 5AI4A 4D3XA 4FFLA 1S3FA 3C3YA 3EVCA 3F5FA 4RHYA 3UJPA 4A26A 3HA3A 2I91A 2W2MA 1C3EA 4BEBA 3ASUA 4LHZA 2P2YA 2VHYA 4D26A 3O3MB 1C30B 2HLDD 3P4UA 1EM6A 2GK7A 4KAFA 5CFZA 1BYIA 2JLVA 5FORA 4LJYA 3QE0A 4ONEA 2WPDA 4B73A 3WWYA 4QLAA 3V2IA 4B80A 4B3IA 4EF5A 1F4LA 1WSBA 1EX9A 1OILA 4HAOA 4MITA 1TQ4A 2FK7A 3E2PA 4JENA 1ICIA 2Y8EA 4RMHA 4X7PA 5LLDA 5K2MA 4DLNA 3T8YA 3MPUA 2QSJA 3TMAA 1N0VC 1KA9H 1CF2O 4PBTA 4DWOA 4YPOA 4DV3B 5JLJA 2GPWA 3M7IA 4QRHA 1K7SN 4WKCA 3EZ7A 3HM2A 4JX8A 2OXTA 2F1HA 3VPDA 4Q9NA 4NOKA 4E30A 3C7AA 3IAS1 5CDTA 3MWFA 3U0BA 4B3DA 5TS2A 3H3XA 3R6LA 3F7NA 4XQ0A 3TR6A 1X7XB 1JFLA 1Z0KA 2H7YA 3PC8C 4IV0A 2GRUA 3GZJA 2FN4A 5GPBA 1VI5A 1VL5A 3D59A 1JIQA 1KTIA 3OQ6A 3NB0A 3IDOA 4N48A 2BV3A 1QQTA 2DOKA 3WJ1A 1VSQA 1YO6A 1UPFA 3GUYA 3DBLB 3Q3JB 3R3SA 1TM2A 2CVZA 3L7BA 2C8JA 1T9ZA 4R1SA 2XD9A 5DDIP 3NCTA 3RYHA 4OI0A 5CXSA 4AZ3B 3JPYA 4EKEA 2GKGA 3IDQA 3FWPA 4ALIA 2IZZA 2HO5A 3JQ9A 2JIQA 1SM4A 4GQIA 2IYNA 3D8HA 3WDSA 2VUHB 6REQB 1KF0A 4L6CA 4DXDA 3HLTA 3HXLA 3L0ZA 1F8FA 3F3YA 5ILOA 1Y4DE 1KBQA 1M3SA 4FQ5A 5I9IA 2BRUA 4UM9B 1DHTA 2IHZA 1ZOLA 1NW7A 2LDBA 3F4KA 5CAEA 1JU4A 2A5JA 1Q19A 4NZOA 3H83A 1ITZA 1BJTA 3X1ZA 1OGIA 3V4SA 3AF5A 3GDGA 1YZHA 3DLBA 1XT6A 4JMPA 5A3VA 4DFDA 3BF7A 2HCJB 1R0BA 3L1UA 4LCBA 1C9KA 1JNXX 1FP6A 3T94A 2GT1A 4OV6B 1NVGA 1X2BA 2NVWA 3FB4A 1L1QA 1IZ7A 3KT8A 1TF2A 4LF7B 2I6XA 3KJEA 1GUAA 1T4CB 1Z35A 3L8YA 4X8HA 1YJ8A 1E9FA 1BQEA 4MR8B 3WNCA 4IUCS 1GKLA 4BNLA 3GLHB 3CUVA 4PC7A 3TUJC 5I7SA 3S1SA 2IW3A 2OGZA 4AZSA 2E82A 4QU8A 2GPJA 2QN3A 3BTVA 4KR6A 2FMIA 2RK6A 1GRCA 4DC9A 3PPXA 2HMAA 3DVQX 3RADC 4HUJA 4QOEA 3HZZA 4POOA 1DRUA 3DQPA 2F3RA 4QO8A 1IZ9A 1L8QA 1RSZA 1ZH6A 2HWWA 5DGXA 1YCGA 3RSGA 4Z2YA 3R4VA 1GFZA 4HNVA 2FN7A 1RLIA 3CBQA 4C0XA 4DDVA 1ZMXA 1EUDA 3EC1A 3FNEA 4OP1A 4Q9KA 2I2DA 3G0GA 1USWA 4NV3A 2WU0A 2DTXA 1JSZA 3WO0A 4RA6A 3TTVA 3PDIB 4YAUA 4QASA 2PGOA 2VCEA 1DIBA 2IZOA 3R09A 5KWIA 2ZUCA 4B0PA 3CZCA 1QHHB 4HLDA 2FF5A 4W1SA 3AW8A 1H2FA 3T1HB 4DLZA 4W4TA 4L3OA 3QM1A 2ZJ4A 3MWEB 1VHDA 2JFFA 2P3OA 3TOCA 1RAIA 4MUAA 5CR9A 1QR6A 3TTYA 4Y2TA 3RJ9A 2DY0A 3T3MB 1NURA 4C7XA 4XYLA 3AP2A 1DC6A 1S8OA 1NIJA 1W2HA 2NVUA 1DBPA 2PZJA 5A1TA 2XGSA 5IW8A 2AIRA 1R64A 1ZEJA 4GYYA 4P5PA 2Q5IA 3O75A 1I7SB 4YQYA 1NI3A 1WPGA 2C0QA 1Y5NA 1H2BA 1B73A 4PIMA 3FPBA 4IMJB 1P5HA 1LJLA 5CB0A 3FRIA 1YRBA 2REXB 3G6KA 3U0VA 3VNRA 3IBYA 2CE2X 1FW6A 4M0LA 5FI5A 1D09A 4JEHA 4MUBA 1C50A 4PS0A 1MRSA 1QOPB 3LLVA 1EGHA 2LKDA 2P35A 1I3MA 2RG7A 3QE2A 1JFFA 4YJ3F 1J7JA 2HU5A 2IHUA 3BXHA 3ZU2A 4CEHA 5EJ2A 1OC2A 4RZ3A 1K4MA 2LGJA 4ENWA 1VP9A 3HU3A 3T1VA 4MJLA 3LUAA 4OHFA 1GFIA 3BE4A 3RBAA 5TJ9A 2WAAA 2QROA 4UUOA 2AG6A 2WVHA 5EGNA 2IYSA 4IIGA 1Q11A 3DDZX 4X24A 4C7BA 5BMVB 1LNZA 1VLJA 2ROQA 1GCAA 1M6VB 2BMDA 2Z3WA 3SIWA 4U2CA 6GPBA 4RWEA 3ZCPA 2A67A 3AI2A 3FNHA 1XEWY 1P1FA 1ZI8A 1UKCA 4OSEA 4IIBA 4YRRA 2D1QA 3WY9A 1C3XA 1XXLA 2X3YA 1PZXA 3I2JA 3TI7A 3OKAA 5B2FA 4MUNA 4M9UA 1P2VA 5LQCA 2ORIA 1EE2A 2DBYA 2GAIA 5CLGA 4MPDA 4YRJA 2HEGA 5E4YA 2PH7A 1OTHA 2B2NA 4L85A 3EZYA 4W7SA 2X86A 4KLNA 2PKQO 2REQB 3IVMA 3ADKA 1IXRC 4IG9A 3E4CA 3R44A 3A1UA 1SHUX 3COYA 3K73O 2ACWA 4UUPA 1XLWA 1U1CA 3TQCA 4RM3A 2XODA 1UZUA 2I2BA 2R60A 4BDSA 1E64A 3AOEC 3STXA 4D9NA 1YQWA 4J75A 2W6NA 1DINA 1AHPA 1DX9A 1TC1A 3BQMB 4RCVA 4XQCA 4YDHB 3ZGVA 2XDQA 4D79A 1Z38A 2ZJ5A 1CERA 4HR7A 1G2IA 4J1NA 4NMHA 1JRLA 1NLZA 4AJKA 3INNA 2YV5A 4I7EA 4M1YA 4DLTA 5IAEA 1E59A 2CFIA 4YJGB 3GVIA 4W5TA 3IP3A 1O96A 2ENUA 3FVRA 3IV9A 5EFZA 2GS9A 4P7GA 1B0UA 1FQJA 3VYTB 4AMVA 2ZWAA 4MVJF 4A23A 3HRKA 3FTFA 4YB8A 3VU8A 2DUWA 5JRZA 4IIVA 2LPMA 1YDWA 3HO6A 2VJDA 3UEOA 2HPZA 4JLDA 5EYPA 3IALA 2O57A 3KB2A 5DHFA 3BUSA 2W42A 2DPYA 5KYYB 3FA2A 2Q0QA 5FHRA 1N33B 4QTYA 1EFRD 4KDFA 1J90A 1JX6A 2GI4A 1E9DA 2C2WA 4UHKA 3WGOA 4D3ZA 4TV8F 1J23A 2WF6A 3H8SA 4GBED 1ZI6A 4M9ZA 5G2OA 4BO8A 1CT9A 4OJNA 5T57A 3EVEA 2IE0A 2J7PD 4FYVA 4WVFA 5LLSA 4I9HA 4P7KA 3A8TA 3C5VA 1HFWA 1V1JA 2RKOA 3KBOA 5AHXA 1AGNA 2VDOB 2NMVA 3ZE0B 4OB6A 3R9IA 4ETIA 2Y1OA 1XLVA 1D1SA 3DB2A 2PXAA 3B36A 4R3WA 3B20A 3M9WA 2I6GA 4G4SO 5REQB 1KAMA 1PUJA 2O7NA 5AI0A 5CA1A 3L92A 1QG6A 1NJFA 2BEWA 3E3AA 4GVLA 3BICA 3NYQA 3U4CA 4OUDB 2Y76A 3JALA 4DLLA 1GUFA 3CGWA 2GF9A 3D8RA 3OZIA 4CRWB 1FPQA 1KORA 3KQPA 1N6HA 5L3SB 2JFGA 2FEAA 3G2JA 3ICVA 4G1CA 3PVSA 2XB8A 3AI3A 1RTTA 3DGFC 4KKVA 4LXTA 1P44A 4MV9A 2IC5A 1F8GA 4LOLA 1T25A 2D3WA 4ZAWA 4OMUA 5IJAA 5JYCA 4QM7A 3PEFA 1PFUA 3N8IA 4TTQA 4LNUA 3ER8A 1TO1E 3HKEA 1E99A 4M8LA 4TRMA 1LVHA 1LKZA 4BNJA 2XQJA 1CEQA 1J97A 3NR2A 3J81k 2BTEA 1R37A 3SJUA 5JECA 4P4SB 1BHQ1 1H22A 2PD3A 3O84A 3BGIA 4XB2A 5EVCA 1SBCA 2IHTA 6NULA 1M2EA 5C1OA 3KJNA 1PEDA 1KK3A 1WNTA 4Y2QA 1NXWA 3WMGA 2YICA 4ZTBA 3SYMA 2ORYA 4Y1EA 1J8QA 3CIOA 1JJBA 2UZAA 5CITA 2A86A 4BVHA 1ZKDA 3QXCA 2A1TR 3I9JA 4UUBA 4DZZA 1ILEA 1U2TA 1P7WA 1BE8A 5F5XA 1XA3A 5FWXA 4MUHA 3ZK7A 3GCWA 1FRVA 4E94A 1P7CA 5K9ZA 4AP9A 2DF8A 4BLRA 2BTQB 1XO1A 3RS3A 3JZMA 4MLDA 1ULTA 4KXMA 1SUAA 3ISJA 4FONA 4UMVA 2PSFA 3WKCA 2Q62A 3TLCA 1W1IA 3NKLA 3S81A 1PNRA 3IKJA 1B7GO 4CV3A 4NCAA 1NRXA 1E6WA 1GA6A 2PZFA 2CMGA 3ESDA 1AZSC 4Q18A 1WVIA 1UXOA 3AZPA 3LQKA 1Q12A 1MJNA 3CKKA 4DLYA 3F7TA 4MS4A 3BGOS 3GMSA 3NI2A 5CNJA 3L1HA 5FAXA 1XPJA 4YX9A 1Z5NA 1Y7IA 3CEHA 3CNQS 3CMCO 4NG4A 5AOAA 1RHJA 2AOXA 2B7LA 4LTMA 3ADBA 2A5GA 2ONYA 2V6FA 3PE4A 1ZQ9A 2AOUB 1T8RA 4HAIA 4JJIA 2OUIA 1KVTA 1NW9B 1UDCA 1ZN9A 2C78A 3ML1A 4OI2A 3JQAA 1NAHA 3E7FA 3JQFC 1PJBA 1EMDA 1L7MA 1SOMA 1TGYA 2CEKA 3WAGA 4M8NE 1K1EA 2DRIA 3H1TA 1K06A 1RBZA 2UYHA 3AC0A 4F3TA 2O7QA 1G9SA 2FW9A 1EINA 2BUAA 3D6UA 3GGSA 1I6KA 3JQAD 1JEEA 1ORWA 1QHGA 3KELA 3B82A 3L7NA 4NE7A 3FRHA 3GLFA 4PZ9A 4F4CA 3KOYA 3BSYA 1VMDA 3JV7A 3L1VA 4WT7A 1EK1A 2C5HA 1R8XA 3LCUA 4BEWA 4YCSA 3KPYA 1RS0A 1ZK1A 4AAYA 3WBBA 1VGRA 4DLRA 1KPHA 3EG5A 4MWCA 3VC2A 1UM9A 5F1OA 4EFNA 2ZANA 1KYZA 3U3MA 3A1WA 5F33A 5KCZA 2PQ0A 1EGMB 2GAFA 3PRHA 2N1BA 5EA2A 3ZY2A 3L4BC 1YVPA 4EA9A 4XVUA 2NZYA 1XX6A 1BIFA 3K09A 4P86A 4LHWA 2IEIA 1ENOA 1FX1A 1EP9A 1ND5A 4XUGB 4X7BA 1W85A 2X6QA 1WXFA 2D6FA 5MGBA 2AEEA 2ZKLA 1IPFA 4HNSA 1I4LD 1OZAA 3LWBA 1E5DA 2WT4A 3F7MA 2PYIA 1JMKC 2OO7A 3JTMA 4ZREA 4IDQA 5BV2P 3WFZA 2I5PO 4OGKA 1AQNA 2ZULA 5DVZA 4JC0A 4TLDA 4DSNA 1WP9A 5FCDA 2X6RA 1JEYA 2NOAA 1V6SA 2JRLA 4MXDA 2GM5A 4G37A 5K7SA 4AD8A 2VNHA 1YR1A 1Z18A 3KR0A 3PDCA 1RVV1 3DZKA 4GWKA 4DBLC 2HCBA 3HXOA 5LMNB 5AMXA 1M0TA 3PEVA 4INJA 3PPWA 1J8YF 1XQXA 2VPTA 3W3AD 2JG3A 1VGQA 3GJ7A 2CEAA 4GVXA 3UWDA 4EKIA 3IL2A 5D7BA 1VSUA 5ADVA 2VHXA 4EAAA 4DUZB 3HN7A 2GEBA 4AQYB 3PGKA 3RYIA 4MUEA 5A0TA 2GN0A 1DBVO 1JWAB 1KR5A 3F5QA 1XYYA 2R9VA 3PC7A 3QOXA 5EXEA 4DQ0A 2ZT6A 1D6MA 1NJSA 1UJNA 1WDKA 3ID6C 2DQSA 1HT3A 3KO8A 3ONWA 4WFQA 3DE4X 4OEHA 1ZCJA 4O4LF 3S2GA 4XI9A 3D5TA 4FMCF 4PG4A 4RMGA 3KB8A 1U0JA 2AQ8A 4TXHA 3GUUA 4HQNA 3VC7A 1H2RS 5B2EA 5TMPA 2F55A 2I66A 1QTNA 4AU1A 2E7ZA 3L6UA 3LXXA 4XSGA 1V41E 4M87A 1OBVA 5AW2A 2OTCA 2JAWA 1T8UA 2V9ZA 2VQSA 3FOBA 5DZSA 1ST2A 3W6PA 4KQ9A 5C8YA 3I6ZA 2CMKA 3COWA 1R8YA 5JXWA 2LNDA 4QYWA 3ZGXA 3M5CA 3DLPX 3LO5A 3AP3A 3DLAA 1SOAA 4KC0A 4PAQA 5GJCA 3TLMA 1YK1A 1JJ7A 2XZPA 4MGKR 4WL0A 3GA0A 4FZRA 4DQDA 5FEUA 3L07A 3L04A 2FDXA 3NXSA 3O91A 4I9FA 4GOJA 2VK4A 4RIHA 4OQXA 5J40A 4DSOA 3CLHA 4ILKA 3TZEA 5I7UA 5KYNA 2B4QA 4ZOLA 5MFZA 1QF7A 3UIEA 4AKHA 2QP4A 1IU9A 1SFRA 1JTVA 2P6UA 4TQ9A 3FYCA 4D9FA 1T8WA 3E1GA 1GR0A 5EMNA 3R5HA 3V8QA 4HQRA 4YI3A 4FT4A 3ORQA 4PO3X 3BQ9A 5LP6C 4DMRA 4ZOQI 4RTQA 1YA4A 3HCRA 1QVWA 5BURA 1NZDA 1UODA 1X14A 2X77A 3GLGB 2PUBA 2X5KO 2QMQA 1QG0A 3J80A 5F73A 4DJFC 4MTCA 4OHYA 2JFPA 2VPWA 3EMBA 2C4KA 1AGXA 2CDBA 3O9VA 4Z9XA 2M98A 5JJBA 4TWRA 5LD2B 1XB2A 4KWCA 2NV0A 4URYR 1CS4C 4J8PA 1W5BA 1R5OA 2ZSKA 3FIJA 3RYTC 4GO1A 4E14A 1Y5MA 3AUXA 3EF1A 1FMLA 4N41A 3K0AB 4KGVA 1VG8A 2H29A 4CQJA 3ZE6A 3VNQA 2ZSUA 2Q8QA 5LU9A 1JT2A 4RTMA 3H19A 1HMPA 3HJGA 3QA9A 3RIHA 4BMCA 1H2XA 5DP2A 3N8KA 3T38A 2N0SA 2HYIC 3KV3O 1X7DA 4BQSA 3UAYA 4YO7A 1NZFA 3UENA 3SSOA 5IF9A 4EK9A 1F48A 2PDAA 4M1EA 4X44A 3GFGA 2GYWA 3U9TA 1AKWA 1SRRA 2ZB3A 1CQJA 3HCCA 1EWKA 3CVJA 3LNCA 4I55A 4Q21A 1ZHFA 4JGBA 2CMFA 1XVVA 3EZNA 3GGOA 5FF9A 2PH5A 2QTTA 1AIPA 2FPXA 4YR9A 2QBYB 3A3OA 3AJRA 1IEXA 4PC2A 2X1MA 2WA2A 4X20A 4PONA 3A6KA 1V16B 2W2QA 3D4BA 2GFQA 4HDSB 2H4JA 4FS8A 3DL0A 3PC3A 4FWBA 1HBJA 1MP0A 1MB3A 1BW9B 1NW3A 1UDBA 2JGDB 2PRKA 3GZNB 3HY6A 4PE5B 3PHHA 4DREA 1QVVA 1XVTA 3EXEB 2XZOA 1V39A 4UE3S 1WSAA 1HUQA 3B2EA 4NBSA 2UAGA 5GONA 1WHSA 3UYKA 3VR3D 4KLZA 3AY7A 1DEXA 1TADA 3M1AA 3HVIA 4FJ0A 3D3JA 4YP0A 1GSOA 3CMMA 2QRJA 3DG9A 3MZ0A 4ECAA 5LP6F 1WXWA 4FCVA 1IUKA 2ZI4A 3N07A 1XMVA 2R25B 3TO5A 4EJ0A 3CVWA 2YY7A 2V4MA 4CLDA 3ZIUA 1H2YA 1JSLA 4HWTA 3ZU3A 1AV6A 2JVKA 3FMPB 1E2JA 3FCYA 2KW5A 5DM60 1IUPA 3TE6A 4EI2A 1NQVA 2Y2VA 1ILWA 3MQ2A 1RPTA 4AF6A 1DDOA 1ZJJA 3JYNA 1ZGCA 1YDMA 3RKRA 2AZDA 1I1OA 1YS1X 4A0FA 2JJ8A 1DJQA 2NTYC 4R3UC 2V1XA 3ZNOA 2PRIA 1CY2A 1FPMA 4M8SA 2FSHA 2AJTA 3DXYA 4DEXA 2OK7A 2QVCA 1S0UA 3QU4A 4GX1A 4P6VF 3R41A 1LQTA 1P8JA 2Q9BA 4DAOA 3W5DA 1XDDA 3VVBA 3FFBA 4P4GA 1YJBA 3UC5A 1C1YA 1R6VA 1SUBA 1BMFD 3O2QB 4FMBB 4Q9LA 5ALVA 2V7WA 1F1BA 3IIIA 1ACMA 1QOZA 3TCNA 2DPXA 2YBDA 3IB6A 4P31A 3UF0A 3SIRA 4YRSA 1WW3A 5CXXA 4HB3A 3P9ZA 2HSEA 4PHFA 4TWIA 3WICA 2QDKA 2H2FA 2IPNA 3DWEX 4GC5A 5LZ5A 3G85A 2VDVE 4YRIA 2B7BA 1RW4A 2VC2B 2DBQA 2H92A 4HB4A 4I8DA 2BL4A 5JXGA 4FPXA 3VTZA 5B4TA 1ZUHA 4HADA 3OZRA 4HQKA 4RLQA 1FUKA 3S2UA 3RWOA 1UZLA 3VYRB 5DPMA 2GKSA 4ER6A 2E5LB 3SX0A 2QXTA 2QVGA 3OCVA 1O0BA 2CL0X 3TIXB 4AYWA 4R0VA 3OIUA 3MIZA 2I80A 4Z8XA 4E07A 1R50A 4CEJB 4D9JA 5CT5A 5IHXA 3TVYA 4MTLA 1DQYA 3ANTA 1U8EA 3N74A 5EKSA 1Y1LA 2YJ6A 1Y34E 3R40A 4HF7A 1K3UB 2X5NA 4NU0A 2HIGA 4PLCA 3P1JA 2ES4A 4RFSB 4TX1A 1EA7A 5J2UB 2LP4Y 4KUHA 3AF6A 3K9HA 1DWUA 3OJ0A 3AERB 1G21E 2QMEA 3QTLA 1Z15A 5GMOA 2XGGA 5JDCA 5LPNA 2JLUA 3EPKA 2WICA 5ICFA 2AJCA 2GNPA 4MA4A 1UBEA 2PUFA 4JBIA 5CYFA 4HWRA 1UJMA 5IYZF 4C5AA 1AO3A 4LWOA 3IEIA 3D54D 3B9RA 3UOWA 4O2LA 2WJWA 2AFIA 4K05A 4UAGA 4X90A 3TBFA 2WIGA 2OGSA 3E1SA 3HWX1 4FGLA 4LG1A 4MW4A 3VKGA 1XBTA 4ND8A 3SNHA 2WR8A 1TECE 2EWWA 5HF8A 1US8A 2HF2A 2NVBA 4IIEA 5L9AA 1C0IA 2J9YB 4X64B 4BCDA 1UJ2A 4JLNA 2A57A 1JECA 5JQGF 3L93A 2O8VA 3W8EA 4KHPB 1NMZA 3N1UA 4G1BA 1W0CA 5KREA 3MTEA 6PFKA 2FZ4A 2DSNA 2OBYA 4E2XA 2J3DA 3K0CC 2IS4A 3IERA 4JDUA 5K20A 3C3BA 3FNBA 3EGXB 3ROFA 4HAXA 2OCIA 4FHEA 1IH8A 4PLHA 3QTBA 5I7RA 2O3SA 1QFXA 2GXSA 2GXAA 1AKRA 4M88A 5C53B 2ZEJA 2CFSA 5FP0A 5J4KA 1WSDA 4G2TA 4LTNA 4EGAA 5HXAA 1G7TA 5C8VA 1J2EA 2EG9A 1YRWA 4F97A 3BEDA 1E1DA 3DDCA 3CO5A 1HZZA 3QLVA 1T6BY 5IKEA 1MVOA 2BFNA 5IMSA 3AF3A 3NLLA 1U0OC 3PFGA 1B6GA 1C29B 4IFIA 3BBPA 3D7NA 4MQEB 4KN8A 1ECFA 2LKCA 3QENA 2C8VA 2JIZA 3OPMA 3PR1A 1Z9BA 5AVQA 1N9GA 1SG6A 2VP4A 1K8ZB 4Z7QB 1P61B 4AJLA 1XMQB 4AY6A 2JIZD 4B4KA 3KOWA 2D5CA 1A2OA 2RAPA 4BPBA 5G1PA 2BKLA 1ES9A 1N2CA 3HA7A 4EG5A 1ST3A 2F62A 4C20A 1DO8A 4UVHA 1JAYA 5HGJA 3SSAA 1MHTA 2XIJA 1Q1BA 4HYTA 4LXYA 2VJNA 2Z56A 4GNRA 5ILQA 1L6IA 4MMYB 2VK2A 4LRYA 4H0FA 5JLAA 3UMYA 2WKSA 1EWRA 4LI0A 1WMSA 1B00A 2ZTUA 3OICA 4P7FA 5IH3A 2GEVA 2OLKA 3C16C 3GHYA 4JP5A 16PKA 3Q85A 1EESA 3LUCA 2GO7A 2FZLA 4AJ4A 3QX9A 3IUJA 4V0RA 3N75A 3KYJB 4IIXA 5AOCA 1SCJA 2R2GA 1I6MA 3TLKA 1KC1A 2W2TA 3SJ7A 1IPEA 4NBVA 2B6HA 3K6SB 3E9QA 1VHQA 1XMPA 4IDAA 2Q3DA 4WFJA 1SCUA 3ZVRA 2DYKA 4P53A 1Y9JA 4C1BA 1KL7A 3NOQA 4F3CA 1J2YA 2QLBA 2AV6A 2HU8A 2MYNA 3D3KA 2X7JA 3G0OA 3WOHA 1WUHS 3BIOA 4MA5A 4BJ1A 1RADA 2JF0A 4UDYX 3T52A 3EQ2A 3SQLA 3NYIA 3W4IA 4DVGA 1J2RA 1PO7A 1APBA 3SHTA 5EXDA 3SVLA 1MG0A 4EYSA 1Z63A 2J45A 3DFIA 2C9OA 4A92A 5IBRA 2EL7A 2IFTA 2QTRA 2Z5LA 4AS2A 5CH5A 4MQ5A 1A04A 5CTJA 3M33A 2EVWX 3LBAA 3GPIA 1LW6E 2V54A 4I1VA 5HVNA 4F2WA 2I3BA 2NG1A 1EPUA 2VBGA 4B74A 1CC1S 5C5EA 1QMPA 3ZDXB 5GGXA 1Y3HA 3ZJUA 4UFPA 4WRRA 3UA3A 5TE9A 5JSZA 3TCKA 2GZHA 2J5BA 2BOVA 1K6IA 1NG1A 2R84A 3OOJA 2OG2A 1W8DA 1BS1A 3FJ1A 1DOZA 4NOMA 1HYEA 2P2CA 4Z9YA 1SXQA 2PA3A 3I1FA 2HREA 3CWCA 4AMGA 1A8SA 1M6YA 1OWNA 2GJKA 2P4HX 4Z99A 1RZRA 2FX3A 3L7OA 4IH1A 1DKMA 1SBNE 1FYWA 4HDOB 4PG6A 2Q3LA 4Q7JB 4WAUA 2PZ8A 2AXPA 2ZUSA 2V7TA 3HFSA 1RZRD 5A5EA 3IJEB 3SZLA 4MP3A 1T5IA 1MKYA 1REQB 1E4EB 3GMTA 3JQPA 3WWCA 3EZLA 4OJKA 5CVVA 3CNBA 4WCFC 1R10A 5TQ0B 4NXMB 3RSHA 4GP9A 2L19A 5KWJA 4B6EA 5DTMA 5FBWB 2J9FB 3IQFA 1RLOA 1YOVB 121PA 3RCBA 5K51A 3IESA 3C6KA 2CLSA 3EOAI 1N7HA 4OLJA 2WSIA 4LDQA 1SVWA 5IARA 1JPJA 1E60A 3QBVA 3BULA 3KZXA 4ZIRA 2Y1CA 5JNSA 4C6HA 6AT1A 3GROA 1JQJC 1NVBA 3MGBA 2PMBA 3KL4A 2Z9DA 1QOQB 2C31A 4TS1A 5DE3A 3I9MA 3OSZA 1XVIA 1GGHA 5JH7B 3BDIA 4MEBA 4AS1A 4GEKA 3N70A 1SH7A 3F71A 1VA5A 3PG5A 2C0CA 2OG1A 3K20A 4ZK2A 1O58A 1ZOPA 1G0NA 1DG9A 3JATB 1QYXA 2P1RA 1AV7A 1ECJA 2KSQA 2RIPA 3NDPA 5HZKA 3U09A 2G8LA 2GK6A 4XPZA 3REGA 5BW4A 3K5WA 1ISJA 1LWNA 1J0DA 1Z5ZA 4BX2A 1Q22A 4IV5A 2B9VA 5AJWA 3ETGA 4GYKA 2DHRA 4S1VA 1J21A 4OH1A 3W1EA 4C43A 2VZ0A 1XI2A 2A5LA 3FBTA 1EGAA 3UKOA 4ESEA 2IXGA 1R0CA 3PI6A 3X2SA 1T3GA 2J07A 1AKEA 2QVBA 3RHFA 4EECA 3NX4A 2O3UA 1MOPA 1PJRA 2WHPA 2GX6A 4I4NA 4Z3DA 5JC1A 4HS4A 1C8KA 4MRPA 3SMQA 1X0XA 4TYMA 4UEKA 3QX3A 3YASA 1FJGB 5F9HA 4KQKA 4KSYA 3WP0A 3MT9A 1MO4A 3DHVA 2H17A 4FN4A 4AZ0A 2Z3ZA 1ZUWA 1PT9A 1RQPA 3CX7A 2QNRA 4ZYXA 3L8DA 3T1YB 4UM5A 2HBYA 4NH4A 4XSVA 5TB5A 4B6JA 1SVKA 1CF4A 4GZMA 1YR9A 3A1DA 1YWGO 2Z4RA 3FSJX 1DG3A 1W5AA 2CXXA 3LP6A 4HDCA 1GIAA 4LYFA 3ZWKA 1EXNA 4FKZA 5EQDA 5DM0A 1ZOOA 3EDCA 2PUJA 3O4HA 2GCNA 3FTEA 1ZD1A 3IDFA 1W4BA 2PD6A 4RKWA 2CSXA 2YIMA 1I01A 2RK3A 2V7UA 3DT8A 4DUGA 2QJRA 3VMFA 1YACA 1KHHA 3IXQA 4WN9B 2MR5A 5E3IA 1NUPA 4BFXA 5H8WA 5BQOA 4EGQA 3NONA 4OP3A 4KPFC 3HXMA 1NYRA 1CWUA 1M9NA 1ZUIA 2CFCA 5FOSA 3VR5A 1VLQA 3U19A 1UWVA 1NY5A 3AKZA 1V5EA 2XMPA 3P9IA 3TFOA 2P9BA 1YR2A 5F9FA 3JVIA 3RSZA 1LQUA 2M1XA 3FCEA 4X3PA 5LM3A 1Z4OA 4BCBA 4DCOA 3QUAA 5HZGA 4BQIA 3EC2A 3QVSA 4B4VA 4R69A 3ZCXA 2GDZA 1NVTA 1EDOA 1J8VA 5ECDA 4BFVA 3P2JA 4AG6A 1R16A 3G0CA 3HYTA 2C3MA 2VH1A 3RFUA 1A5AB 3JYHA 4KPUA 1VCHA 3H6GA 4XTCS 3H65A 4H2DA 4KX5A 3WK4A 3FTQA 3LXRA 3QWBA 1ZM4A 5U4QA 3F3SA 2R1TB 3ZWQA 5B6JA 1RTKA 4CEIB 4KIWA 1GVNB 4EQ6B 3OIDA 1Z83A 3OM1A 3QU2A 5LQUA 4MV4A 1SHJA 1OA1A 3LOQA 4RZIA 2CXHA 4TROA 3CIFA 1CZNA 1D2EA 3KP1A 5FNVF 1DZIA 4I5DA 2VQ3A 1W47A 1B74A 2Y0PA 5E6UA 4BGUA 2HK8A 4ZQFA 4Z51A 2O5CA 1OAOA 5KVSA 1G8HA 1HYGA 3Q9LA 3LLCA 4EYOA 1OIWA 1NLYA 4KYTA 3CPJB 3EEFA 1EJ0A 3P27A 1PNVA 3AVOA 4BAGA 3FPEA 3L0SA 4FEYA 4MPRA 4MB0A 1ZESA 4GU5A 5DI3B 2XMRA 2YYAA 3EW7A 3IH5A 4ZEMA 2WC1A 2FW8A 5HDQA 1IOWA 1AK9A 1BXGA 1O7JA 1E1CA 4R0NA 3SICE 3HO1A 2UZ0A 2BUCA 5JOQA 2G0NA 3FKSA 4L0MA 3ZBQA 2WWXA 2PKEA 3RFCA 5B57C