3P45A

Crystal structure of apo-caspase-6 at physiological ph
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
133
structure length
133
Chain Sequence
b'FDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords caspase-6
publication title Crystal structures of active and inhibitor-bound human Casp6
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 48
structure length 133
sequence length 133
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2010-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3p45A00
1CP3A 4I1RA 5LU8A 1IBCA 3R7SA 2FP3A 5IAJA 4N7MA 3DEIA 4DCOA 3R5KA 3GJTA 3H13A 5IARA 3V55A 4IYRA 3RJMA 2H4YA 2CNOA 4AWAA 4EHHA 2C2OA 1NMQA 4JB8A 4ZVOA 3R7BA 2DKOA 1NMEA 2J30A 4ZVPA 3UO8B 4D3XA 4EHFA 3EDRA 3IBFA 4EHDA 4AWBA 2QL5A 1RHUA 5IAEA 1SC1A 5H0IA 2XYGA 4QUHA 1SC3A 2C2KA 1RE1A 5I9BA 1NW9B 2QL9A 1SHJA 4D3YA 4I1PA 4PRYA 1RWVA 3PD1A 2H5IA 2QL7A 3H1PA 2Y0BA 1RHJA 2P2CA 2XYPA 3NS7A 1K88A 5IAGA 5LU9A 2C2MA 2XZTA 4QUGA 1I4EB 2QLJA 2J33A 1RWNA 2HBQA 4FDLA 5IBPA 5IBCA 4N7JA 1I4OA 1RWXA 4LSZA 2HBYA 4QU0A 1JXQA 1RHRA 1RWPA 3H11B 1GQFA 4ZVQA 4ZVSA 3GJSA 3DEJA 4QUJA 4HVAA 3KJNA 2H54A 4FGUA 1RWWA 3H0EA 2CDRA 5IAKA 3GJQA 4JQYA 2XZDA 4QU5A 3NKFA 5LUBA 1BMQA 3E4CA 2FQQA 3S70A 2FUNB 4HQ0A 4NOMA 2CJYA 1K86A 1ICEA 1QDUA 3D6FA 2H4WA 2H5JA 2HBZA 5IBRA 3V4LA 1RWOA 4EHLA 4PS1A 4QUDA 3UOAB 2XYHA 4QULA 5K20A 5IABA 3NR2A 3DEHA 3R7NA 4EHKA 2C2ZA 4JR1A 1PAUA 5IANA 3BIJA 4QUBA 2H65A 4JQZA 4JJ8A 1F9EA 1M72A 3EDQA 4JR0A 1QX3A 3V6MA 2WDPA 2HBRA 3SIRA 1KMCA 3ITNA 3GJRA 3S8EA 4EHNA 1RHKA 5JFTA 1SC4A 1F1JA 2H48A 4QTYA 3DEKA 1RHMA 4NBNA 2J32A 4NBLA 1RHQA 2AR9A 2H51A 1CVRA 2NN3C 3PD0A 4QU9A 1NMSA 3P45A 3QNWA 4DCPA 3R6GA 5I9TA 1QTNA 5LUAA 1RWMA 3K7EA 3SIPA 2CNKA 4JJEA 4M9RA 4N6GA 4QUEA 5IC4A 4N6OA 2CNNA 4JJ7A 2CNLA 3H11A 3V6LA 5IC6A 3D6HA 5IASA 3D6MA 3P4UA 4FXOA 1GFWA 4NOKA 1SHLA 4QU8A 1PYOA 4QUIA 4DCJA 2CJXA 3PCXA 4ZVRA 2C1EA 4JR2A 2QLFA 4FEAA 3OD5A 3R6LA 4NOJA 4NOLA 4QTXA 4EHAA 1RWKA 4EJFA 4ZVTA 3KJFA 4HQRA 2Y1LA 1I51A 4IEFB 4AW9A 4QUAA 4D3ZA 4PS0A 2QLBA 4N5DA 3KJQA 3IBCA 4ZVUA 2J31A 3V3KA 3V4OA 4PRZA 4NBKA 1I3OA 4N6NA 3R5JA 2K7ZA
chains in the Genus database with same CATH superfamily
1FUUA 1W4AA 5BT8A 1G8FA 1UZUA 2WJ4A 3L3BA 1VIVA 5IAJA 2GPWA 1PEKE 2PEYA 2GFIA 3GLUA 3LLUA 4B8WA 1H2ZA 2I7CA 2XUQA 3AHFA 3COYA 3WLLA 4WA7A 2OORC 2PUJA 3OZBA 1RC1A 3CX8A 5EN4A 3GDWA 3FLAA 3SOPA 1IG0A 2YFHA 1JH9A 1TVCA 4EHDA 3LA6A 4IL5A 4W5WA 3TF5A 5C4IA 4S24A 2KB0A 2GZ2A 2IS4A 2WF7A 2QYOA 3HDTA 2DFLA 1A9RA 3E3OA 521PA 5PGMA 4YONB 1XFDA 1QO7A 3FGOA 1DKOA 1QAMA 4G9BA 5D5HA 3UCXA 2LDBA 4YRZA 4FS3A 4PFKA 3RYFB 3WTCA 2AOVA 4JUBA 1YC2A 3KQYA 1JHDA 1YCHA 1A7UA 2O2DA 2X7HA 3ED5A 5J59A 1ACJA 1NA5A 1LJ8A 1LRJA 1P6XA 1Y6ZA 1TQ4A 3IPCA 1NV9A 1QZUA 3UJ6A 3RAEC 1O94C 4FB5A 3VDQA 2XTMA 3AUSA 5TRTA 4XFKA 4WZ6A 1JLSA 4UDYX 3LRXA 4JU8A 1HUQA 1TM2A 4MTCA 5TGDA 2X76A 3WY9A 4DN6A 2Y92A 4E2ZA 3E4CA 4ERNA 2FUNB 1N1GA 1ST2A 2G6BA 4N41A 1C9JA 2J0SA 2ERYA 4KJZA 3ZWOA 4F92B 1PKEA 1EGHA 3KEOA 4LGYA 4MW9A 3D8UA 3KQPA 1OWMA 2JJ1D 3C0KA 1JILA 3K0FB 3NTUA 3ZVNA 3P20A 1H66A 2WVHA 3U39A 1FB5A 1WRBA 1ZIXA 1RYHA 2CVHA 4OPMA 4S12A 1O57A 4WNAB 5ICFA 4P38A 4FYKA 5JZBA 2PLNA 3IGFA 1N1MA 2TMDA 1F0YA 1T4GA 4HP8A 3FCUB 4BGEA 4H7KA 1NMYA 5A7HA 1W9MA 1HE8B 4U7PB 2P91A 4EI8A 5B53A 4WXHA 1EQ2A 4TYYA 4TVSA 2MDTA 4D0RA 1GQOA 4MXDA 4P3PA 1VPTA 2AJLI 2XRMA 4Y1EA 4Z4FA 4OLJA 1PF7E 4Z4HA 1NMSA 3H1GA 4U39A 3V00A 1X94A 3WAGA 1NNSA 3RFXA 1OREA 4GMFA 4HMOA 3VPBA 2H17A 1T8RA 2X41A 2DY1A 4TSFA 1FNMA 4COKA 4I9HA 1Z4NA 3UUGA 4HFNA 4V0OA 1J90A 3TD6A 3ZNOA 2PKQO 2OV4A 3LHFA 4DHEA 3S2ZA 1J0CA 2VHUA 4N6OA 3ABIA 4IXTA 2NADA 1RXCA 1SQSA 4TKVB 2H1FA 2QAIA 1LKZA 3CT4A 3I3SR 2EC5A 3SMQA 1GTZA 1ZCAA 1U65A 2Z5LA 2DF8A 4NFSA 3RUIA 3VJKA 1MRZA 5BSGA 2F59A 3B3GA 2XT9A 4OQLA 1NVKA 1TLLA 3AERB 1BN7A 1F2UA 1HQCA 3NAZA 1QBGA 4K87A 3S2YA 3SHTA 3SLRA 4C7OB 1PFVA 1YAJA 5HVNA 4DRZA 2FOIA 1BHSA 2F3RA 1YMVA 1S8AA 3PHJA 4AF6A 4K9OA 4M0LA 2WPNA 4RMHA 4V0NA 3ZZTA 4OAPA 1OTYA 5JEDA 1C9MA 1FSSA 1G6Q1 1KMMA 1L4FA 2J1LA 2Z3VA 3QVGA 2AUMA 4QG7A 4TLDA 3WGIA 1GWNA 1UZNA 1OBOA 1HLGA 1SCBA 1XVIA 2PEZA 2WYWA 3BXGA 1OT3A 1W88A 1QRRA 5KTPA 5WRFA 4B84A 2AKEA 4UBMA 4E13A 1J1UA 3O4VA 4UASA 5HA5A 3B9PA 2QN2A 4FSHA 4ARZB 1GZDA 5HCIA 1GL9B 4DPLA 2JFQA 2WICA 3X1DA 2QTWB 3GX1A 2MINA 1HDRA 1A5AB 4DSUA 4DB4A 3I2JA 2YIDA 4PEVA 1P81A 4RNCA 3F8TA 2QUJA 2W6PA 4EI9A 1YO6A 4LF6B 1DKQA 1E4EA 4OXYA 3W7BA 3ROPA 4G37A 1N8SA 4TRRA 3TAHA 4CCSA 1L5YA 4NMWA 3VR4A 2E4AA 2J67A 2FEKA 3L0IB 5KQGA 3R0QA 4FE4A 4FOSA 4J0KA 1Y8QB 5JNUA 3ABZA 2GZSA 3F49S 3R6TA 1S3SA 1P18A 1ZGBA 1SVSA 3DB1A 1RYZA 4A4DA 3L7MA 2CL6X 1IH8A 3MLBA 2G1KA 2JNWA 1NN0A 4L8VA 5C3MA 1N7GA 2O2EA 4HX9A 4TMTA 5JAUA 2O2CA 1FVHA 5EXSA 4EITA 1EWTA 4LZOA 3FIUA 1GOTA 1ADJA 3P9YA 3NAMA 4HDAA 1AC5A 1FDIA 1G19A 3AILA 1RI2A 1ZVQA 4P3XA 3WI7A 1NRWA 4OHFA 3AFMA 4NAVA 1RQ7A 3LQ2A 4QBKA 1X8LA 1S01A 4AMGA 5EHNA 1OLUA 1OFUA 3IEMA 2BR5A 1FFEA 1TL7C 3KOWA 5LQRA 2ZIEA 4L22A 1FVFA 2CJYA 2BONA 4TUYF 3WR5A 2O8CB 3JCZA 1VMDA 3DBIA 3QKRA 4WJZA 4Y6LA 1GGHA 4BNDB 3U7GA 4ID9A 1FTSA 2ECOA 2Q3HA 4MUYA 4IZOA 5T4FA 3OLVA 3T4EA 2A0UA 3HCRA 3D3JA 4J29A 3HGTA 4YDHB 2GWHA 3FYUA 5BQOA 1WKCA 3A11A 3EVAA 5BQFA 5FOSA 2RKOA 1T8YA 5ITVA 1WXWA 1U8ZA 3C45A 4MV4A 4NDZA 4UUAA 2VJNA 3OIVA 3WZMA 5IXJA 4MW2A 1THZA 5KQRA 3CY6A 1G8MA 3MC1A 4IDGA 5BUSA 3R7WA 5AVVA 1Y0BA 1MOPA 3H4IA 3IOYA 4G4GA 4OL0A 4LJKA 3F3SA 5IHXA 3LKZA 1OX6A 1X8XA 2SCUB 1N3BA 3H2KA 2C29D 2BEWA 2IVZA 1J2EA 1Q14A 1N6KA 2AI1A 3HNPA 1WZUA 3RU9A 4US2R 2DWPA 3BL8A 2DUWA 3MINA 1EX9A 5ALFA 2R2AA 3I9V6 1XV5A 3R0ZA 2ID8A 2ZBFA 3KT8A 4WZBA 4RMIA 1CR2A 5FOWA 4LGCA 1SVKA 2P6MA 3ONDA 5J2UF 2YVKA 2E4WA 2CLHB 5ED4A 1FQKA 1EFHA 1HETA 2IF0A 4M1KA 4X20A 1PNQA 1IXSB 2QNBA 3LLSA 3KJGA 4FN4A 4TMKA 1E92A 5AM5A 4YP6A 3QFSA 4DSOA 5B4TA 5JH7A 4RTSA 2C7OA 4F3NA 1FFSA 1X1QA 3HL0A 4NE9A 3WS7A 4RORA 1YR6A 4TV8F 3NUQA 1E6WA 1EEXB 3PPVA 4NNJA 3FTCA 5TB5A 5J5VA 4ETNA 3C7AA 1GT91 3H2BA 3INNA 4OB6A 3KJQA 3OCWA 3BDVA 3O7MA 1M1NB 3ITDA 5CLQA 3RIGA 2FFHA 2Y2VA 3MYRA 4GAEA 1PK8A 3E84A 3G8AA 1SNYA 2I6SA 3EISA 3Q5EA 1TIBA 3UK0A 2GZAA 3BH7A 3Q1LA 5DULA 3B1WA 3IDQA 2XMGA 1OGIA 1QG0A 2A7QA 5HF5A 3F2VA 3OZAA 5DI3B 4Z0TA 2IEAA 1WQ1R 1SCIA 4MR8B 5B12A 3LDUA 2J45A 3DPSA 4X3PA 3SFTA 2WNSA 3I37X 3BYZA 3VR6H 2MR5A 3E3LA 3V42A 4HDKB 1IZ9A 1VBKA 4PFSA 1O0BA 2JDIA 2VJKA 5HRUA 2BTEA 4GI2A 3AEQA 4HQOA 2W42A 4DM3A 1SC3A 2GN0A 4FYIA 3S28A 4ZHQB 1A9TA 3QVKA 1SIWA 1O87A 2AJTA 2ERXA 1B8VA 1X14A 2GNPA 2WD8A 3AFHA 4LE2A 3EVFA 3Q41A 3ZLBA 3AJ9A 4QXAA 5F33A 4BN0A 1YDGA 3COWA 3EAFA 3QFTA 2EV9A 3NFRA 4JC0A 4MCIA 3RSCA 1RWNA 5EIXA 1II0A 1JU3A 1V48A 3E1KA 4LQDA 4LSGA 4URHA 3O74A 2LKDA 4P4NA 4XQCA 5AJHA 4GYYA 1DJNA 5EUMA 4F4JA 5C7YA 1G7TA 4LX0A 2JF0A 4OIFA 5KJEA 1ZZGA 4OUKX 1WM1A 1CUEA 3T3GA 5JTUA 1XMVA 2OZKA 3B1KA 5CVJA 3T0FA 1OW3B 2C9YA 4P7GA 3TTXA 3ZJYA 1G21B 1KOJA 2HU2A 3QV1A 1MJHA 3O3CA 1SN7A 4NOMA 2AFRA 3CEPB 3OHPA 5T3UA 1KPHA 3TZ6A 5ALLA 2PPLA 1BX0A 3I52A 1HC7A 2FSVA 3HYTA 5E3HA 1QQ6A 1R3DA 1JG6A 3QOXA 4AYTA 4AP9A 3F1LA 2DAPA 2CLDX 4OYLA 4GT1A 5BWCA 4YCNA 4ZZIA 1MF7A 1XVLA 3I04A 4EW1A 3VO2A 4ARBA 5AI0A 3NVMB 4B6EA 4DC1A 3HM9A 5DRYA 1SVLA 1GXSB 3TG2A 1UBCA 2I3ZA 4NAUA 1CJCA 2H48A 1L2TA 3KQTA 4YMLA 4J07A 1EQAA 2N3ZA 2V7QD 3MUOA 4F60A 1XMJA 3PUHA 4FP9A 5K8IA 1W7AA 1RXEA 4NBTA 2YINC 3DE2X 2V03A 1Z26A 2C4MA 1VMAA 2P9CA 3G2PA 3RK1A 4HQ6A 4KDRA 2K4MA 3GRRA 3VPAA 4U2DA 1FFBA 1MFPA 3R7AA 3RJ9A 3FUXA 2XE4A 4EB0A 2JAUA 1QH8B 1S4QA 1V47A 4JJ7A 4RD2A 2NM0A 1Q21A 2I29A 2PO7A 4B17A 3QPWA 3ERCA 5AJWA 2GXQA 1GKUB 1O5TA 4PBRA 3W5SA 2OAQ1 3DAGA 4QUIA 2Q21A 4RHCA 3L8DA 5GZ1A 1ODTC 2J08A 4HMQA 4D41A 1FZQA 3WGZA 1U3TA 2Y1EA 1SVWA 5BYKA 4K2HA 2B1JA 4FOLA 4N12A 3KP1A 2VUTA 1QGUB 2WAAA 1Z28A 4PIVA 3V1TC 2JLVA 3EFEA 4Q1BA 2I6FA 5ENDA 1P9LA 3KZMA 4MKXA 1BCRA 5HTKA 3TTVA 5BVHB 1CUHA 1JKMA 1Z7GA 3IMCA 5J4HA 3WK5A 1NR1A 4C22A 1S8OA 3CCCA 4OMDA 2BDTA 3R3SA 4OJTA 5E8JA 3AI3A 1XWWA 2GPNA 3DOCA 3F0TA 2RGBA 2BEJA 1T9AA 2QW0X 4D3SA 3A1CA 2AFIB 2JHFA 4F86A 2OESA 5JZ9A 4MH0R 4UZFA 3G6WA 4KE7A 5FBZA 1FF9A 1DX4A 1U0EA 3DE5X 4II2A 2PU5A 5FTJA 3REGA 1J5EB 3IAFA 4F85A 5GOTA 2XWBF 5IPFA 3ZHXA 4OHRA 4N47A 4DMFA 3UK7A 1A2OA 3DOIA 5KVAA 1IJBA 2G88A 3CNLA 3L8GA 4X54A 1KR5A 5HS4A 4GRAA 4DIUA 2W2QA 5A03A 4P1ZA 2OGTA 4GMKA 3RS4A 1DKPA 1ZCBA 4IVRA 3WP1B 3DXYA 1NLFA 1XDGA 4JEUA 1RAAA 1RYYA 4MVJH 4UBOA 3E9ZA 1LBQA 4B8YA 4AIRA 4Q5IA 4BNMA 3PL1A 4BC1A 4EL0A 1EFVA 3CWZA 4TTTS 2NVBA 2PH1A 3TX6A 2NMVA 4IY1A 2CBXA 3U7QA 4S2UA 3DQZA 3M81A 4B3HA 2I0FA 1RWPA 1SZJG 2HF2A 1IB6A 3L4KA 2ODWA 3S6JA 1K8RA 3FNRA 2JFFA 2YJNA 4GZLA 4G24A 3C85A 3DAYA 1RLJA 5BOVA 1UBMS 1KEVA 2F43A 4M0DA 3H9JA 4RFSB 5EY5B 2J07A 4RTQA 2WSIA 2PMEA 4HQ0A 4F5EA 3GJYA 4UHCA 4UFPA 3NMUF 1Z34A 2FPIA 1WL8A 2R84A 4PM4A 5EVCA 3H4VA 4L4RA 4YXWA 1FZTA 1OTXA 1VYUA 2WIFA 4IHJF 4L8GA 4R4JA 1NUPA 2H9YA 4XSVA 2NO7A 3I6MA 5REQB 4XX1A 3SJZA 1MC1A 3L18A 1WSBA 4CLEA 4PHGA 1F0PA 2WJJA 3IR7A 3IDOA 2O0KA 1IRIA 4AMYA 5BNIA 2H65A 5B1YA 2QRMA 3TFQA 1IK6A 4NYMQ 3IP7A 3OQ1A 2YZKA 5KX5B 2QRPA 3S8EA 1AY0A 1UAGA 4OCZA 3KT3A 1ENYA 1KYZA 1F1JA 2PMCA 3DO6A 3OKCA 1CQIB 1A4XA 4OI4A 2FJUA 1ZVKA 2QTTA 2X0KA 2POCA 1D04A 2QAJA 4JHLA 4UDXX 4A6XA 2QM8A 4WMLA 2RHJA 1VPWA 2A9KA 3R5SA 3K1ZA 2EU8A 2G82A 3T41A 3WOVA 1WF3A 3BWXA 1B8NA 1O95D 2ODEA 3QEJA 4M0PA 2K7FA 1G9SA 3UF0A 1TM1E 3LLMA 1OB2A 1ABFA 3M4XA 3OF3A 4DA4A 1DRJA 1Q17A 4HC4A 1NKSA 2GK3A 2OFPA 4QEDA 3WGHA 1RXSA 3KQNA 4I8DA 3PXCX 4CNQA 1JR3E 3TQIA 4P0PB 3C3WA 4MYCA 5DBGA 5AD1A 5IZ4A 4B4KA 4F1JA 3NVKI 5BMOA 5KQPA 3CRMA 4DJEC 1GFIA 2VUSA 3GVHA 5DNVA 2GO7A 4M0EA 3CUKA 4DMGA 2D62A 2WNIA 4GGOA 1Q1ZA 3ZY5A 3FTQA 1G38A 4H35A 2H0AA 1TC1A 3IEXA 2FMHA 4RHXA 2O8BA 3NONA 4KR0A 5F77A 3RU2A 4C6SA 2JLXA 2N1BA 2HF9A 3PF9A 4G2TA 4HXYA 3MUNA 2J31A 2J6IA 3MWEB 4PNEA 5C31A 3WLEA 1GPDG 3BA1A 3IPAA 4B32A 4DRXB 4RPIA 5LCXA 1CEXA 2BZSA 4XCVA 4P0TA 3MJDA 4G23A 3FDJA 4ZU3A 1KI6A 3TQHA 2FPRA 3M4ZA 2F90A 4L5JA 1N75A 3UWSA 4DMCA 2R8ZA 3DS8A 5B3AA 4CFSA 4GE3A 4RZIA 3CG0A 1MVNA 1NG1A 1PWHA 4Q4LA 4HB3A 3RFCA 1FP4B 5EIEA 2IW1A 2AEFA 3KC2A 1XPJA 4QDXA 1KZYC 4N0EA 4DF3A 3I28A 1EAYA 4MUIA 1Q57A 1W19A 3D0KA 4JWTA 2Y67A 1A2BA 2ZROA 3V8EA 1PS0A 5HZHA 1P6QA 4EVIA 1Q22A 5JRJA 1JEYB 1R4MB 4RL4A 3OQBA 3FHLA 3EZNA 1LRKA 4V03A 1FK8A 4AF8A 1FVXA 1QG6A 2QLJA 4I1SA 3C97A 4DAEA 1KMHB 3JWIA 4OU4A 4Y2RA 1KO4A 1BOFA 2GBGA 2B1GA 1QCCA 1QYXA 2B4TO 2FW7A 5I7AA 1FX0A 4M53A 3RWBA 1XC7A 3HP7A 4M9XA 4EG8A 1NDHA 2XMPA 1XEAA 2VIIA 1GRNA 1Y8RA 3PDUA 4LK2A 1ZGZA 2P6UA 2DB3A 3KQOA 2EL9A 2IUSA 1DEOA 1DIBA 2EKLA 3LP5A 3P2JA 4IV0A 1HYGA 2V9PA 4M99A 1W0JA 2DH5A 2Q27A 1U2DA 2H7YA 3KAQA 3KHTA 2Z1MA 3KR0A 1ECFA 3OQVA 4TWRA 4BX2A 3G9TA 1QJCA 3QTBA 2NX2A 4JIMA 4CCYA 3JTMA 3OTIA 3OPXA 3CX4A 3EG9B 4YLEA 3OSZA 3WL4A 1LBEA 3RSSA 2VJYA 3ZHQA 2ACEA 4MGKR 5ADUS 1H2RS 3V46A 2HJ9A 1PO7A 3FPSA 4JGGA 4UAGA 5JW6A 5AICA 1UUFA 4L1KA 5EZ5A 3K0EA 5I7OA 1RXVA 5HEKA 5CJJA 4FMDF 5TE9A 4YX9A 2EW2A 3P2KA 4R6WA 3JSXA 2NPOA 3NWOA 4YFYA 2GDJA 4M86A 2H9AA 4R01A 1A95A 2QJRA 3VMFA 5BOSA 2UYHA 9GPBA 3W8RA 5JLJA 4NENA 3T0IA 1ES9A 2BFDB 2HKIA 3ELYA 4KK3A 5EC8A 3VNSA 3V4FA 3KQLA 2I03A 1O94D 3P2MA 3HEMA 4MNTA 3QEOA 2BFCB 2ZULA 4YTEA 5CB6A 3MTEA 2HCTA 3WMWA 3GT3A 1XBTA 3F67A 3OEED 4KPYA 5FEMA 2KMLA 4AO8A 2FZKA 1WZCA 1FFWA 5TS3A 2M2IA 2NUPA 1KJYA 3CVYA 5JQGB 1I6LA 2JIRA 3VHRA 1F2TA 5C7IO 2ZRNA 3GGOA 4S1PA 4DL9A 4KREA 4Y2GA 3KPWA 1AKMA 3AR4A 4FZJA 4N65A 5EQFA 3IODA 2NV6A 2P8SA 1Y48E 3F97A 1XCGB 2EVWX 5LLSA 1VI5A 1YB2A 2YYAA 3H9EO 4LY9A 4U5QA 1GU0A 2ORVA 1TGVA 3HQ4O 1LPMA 2GZRA 3EX7C 4N03A 4ARVA 1Q12A 5JFOA 3G2KA 3I5MA 4P22A 3HB0A 1UBSB 1VE1A 4NI5A 4QUAA 2IOFA 3SC2A 1JEAA 2VA9A 2AMVA 2OXFA 1BOOA 1UFRA 2HN9A 2HZBA 4YHBA 3UMYA 2HDNB 1V6CA 8GPBA 4CM3A 4FGLA 5L4SA 2HJGA 2ZE5A 2QN8A 3DV2A 5JNVA 4AQDA 5ALNA 4OP1A 1YL5A 2O7RA 5LQDA 5EZSA 5KHLB 1E0AA 4QGGA 3MJRA 3MCAA 3MEQA 2AW3A 2YMPA 3FHOA 4DLKA 3GGSA 2O2IA 3PQDA 4M55A 5JO9A 2J7PA 2Z4SA 3VOBA 4GXQA 2O8DB 4QFDA 3THWA 1LWNA 2BZ0A 4EF6A 1RKVA 1CRLA 4B4DA 5ECWA 5IM5A 4HUQA 2K2QB 3TUZC 1NVWQ 1YVEI 1FX1A 1WUIS 3CNOA 1O0CA 3QA9A 5DTRA 3CUYA 1Y9DA 1HLPA 3IHTA 1UPXA 3MNFA 1VSVA 1L5FA 3QY9A 5GMOA 2OCIA 2P2CA 3ZV3A 3AHHA 5SY6A 3CKLA 4NECA 3N6XA 2HK7A 2X13A 2XVXA 1H8HD 3K73O 4HO1X 4LOAA 4PG4A 3WO1A 3SAJA 3WQQA 4ZQBA 4BX8A 2LE0A 2H18A 3NBQA 4UCWA 1NF8A 2DGDA 2GHQA 2JFOA 3PR1A 3RFFA 2IL1A 4A0FA 4Z2YA 5JBQA 4TV8A 4DV5B 5ALRA 2I34A 4V02A 2FPUA 5FCDA 5JISA 3TDMA 1EGQA 3AI7A 4Q05A 3A9WA 4KOAA 3MTGA 1FDVA 4N9WA 4X1IA 4EMBA 4Q7KA 1GUFA 4OL9A 2BP7B 3PNVA 4KO8A 4OSEA 4AC9A 4DZRA 4F4FA 4Q3NA 5KTTA 2W6OA 5T3YA 2F9LA 3HSYA 4O4HA 4E2FA 2ZUUA 3FTEA 1K86A 1ICEA 1ST3A 2Q9CA 2ZU6A 4IIDA 4YDSA 3SVTA 1G9TA 2KX7A 3UWMA 2Q1SA 3EZ9A 4Q18A 4CCWA 3K53A 1SVNA 2XQIA 3DEHA 1IXZA 1G8AA 1WU7A 3LRPA 3NR2A 3OHSX 2IYAA 3PQ2A 3OPYA 4P4UA 1PD0A 3QELB 4COOA 1HL7A 1ZJ4A 4NYJR 4XD7D 1OC2A 4GECA 2XE7A 4WK2B 3HZHA 3TO5A 3ZVLA 1R0WA 4TXLA 1EUYA 3GVCA 1QKJA 3SJBA 3KLMX 4WIAA 4OX9B 2WF5A 1J20A 1ZGJA 4QQ8A 5DHPA 5LKRA 3UA4A 1AF4A 4K03A 3BMXA 3G3EA 5HYVA 2AE2A 1Z0IA 1NW3A 3DBLB 3GD5A 1PG5A 4IJQA 3ROQA 2VL7A 1N36B 1F51E 4RF5A 1EUDB 2JIDA 2ZW9A 4G81A 2NN3C 2R8EA 1EE9A 2PGXA 1T2EA 3KWJA 3U6KA 1K3TA 5T6BA 5ILOA 1M67A 5I9TA 3C41J 3BF8A 5C5IA 3EOBI 1J9EA 1O58A 3NHRA 3NEJA 3AMVA 1I7LA 2JHAA 2NZYA 2FR1A 3DZFA 4JU9A 1OH5A 1LDMA 2EGHA 1NUAA 1WVGA 4FD2A 4QD3A 2CXQA 5HE8A 2WQ7A 2HSWA 4AN1A 5DBFA 4HH0A 5ALHA 3LQFA 4CKCB 3WLRA 2F55A 1HE3A 4YAJA 3FZEA 3PUZA 1WHTA 1AQNA 2Q7XA 2OC9A 3ORSA 1SHLA 3K9BA 1XD2B 2E5FA 3Q3HA 4YJHA 1AGRA 3PEUA 4MV3A 5T5QA 4MMXB 1KZHA 4OF4A 1E7MA 1BKSB 2YFQA 4E2YA 4HT3B 3IB3A 4KWIA 5TJHA 2IYXA 2Q5JA 5I7WA 4MOWA 5MN4A 1OZAA 4BXOA 2XXAA 2RARA 2IHZA 3S2GA 4PN7A 3RBZA 5J63A 1YBFA 2IYUA 2B99A 1TUIA 2JH8A 4MULA 5DGIA 3RV4A 2YDYA 4C89A 4UOZA 4FTWA 1SWVA 2VP0A 5CP8A 2I6TA 2B92A 5D84A 5H82A 5FL7D 4MINA 1PSWA 2H9IA 1CG6A 2ZIXB 4LCBA 4PANA 2JIPA 1KSFX 1XRSB 2QMOA 2G9UA 2X15A 2ZKLA 2Q8PA 3IT1A 1HQDA 4K1XA 4A5OA 4CV0A 2PUTA 1XTRA 2YRFA 4Q37A 3TVDA 1E6EA 1XNGA 3OTOB 1XQYA 2P3OA 4AXBA 2F8SA 3OZRA 3DKPA 4QDZA 3RYCB 2BFPA 2Y1GA 4PNHA 3J80A 5F3RA 4ZIRB 4TM7A 3TZHA 2BH9A 2HK6A 2VQSA 5IFKA 5JECA 1Q1NA 3G85A 1W36C 4URWR 3NM5A 4FUQA 1QG4A 4WXPA 4ZCPA 1VC2A 5MGNA 3AR5A 6Q21A 1I9CA 3HB4X 1OBVA 4Z4QA 3GL9A 2XODA 3IBFA 4U7JA 3DEAA 4AUKA 4NMXB 2HHJA 3L9XA 3SS7X 1X74A 2UYQA 3LBFA 4PLTA 2XYGA 2CXTA 2JGNA 1Y9JA 4QUHA 4ZC8A 2UXDB 2XGMA 4W1QA 1BHJA 5KYTA 5JI2E 1M8KA 4YP5A 1KC3A 5ECYA 5KOYA 2P6OA 4ZO9A 1ID8A 5EP1A 4OJMX 3TFWA 3IEUA 4F7DA 3CLHA 1T34A 4WKNA 1DXOA 3K9HA 3NPAA 5H59A 2Q7OE 3U6BA 3UJNA 4C4OA 1KDRA 4L7VA 3DD1A 1J21A 1WCYA 3U40A 3VVBA 1TAHA 2AI2A 4WK4B 4YUVA 3PTLA 2B2XA 2BPOA 4PZ9A 2H1IA 2HO4A 4YB8A 2N1MA 1K27A 1W0CA 3ZLTA 3F9RA 4Q21A 5CB4B 3X2SA 5BNFA 3VHXB 1R0YA 2XTNA 3R3VA 2JCVA 1SEVA 2VDRB 4FUTA 3G89A 4HEQA 4J1NA 4B75A 4MVJD 1DOAA 3UGTA 5HK9A 1V8FA 2GT1A 2BHNA 3EW9A 3LOPA 3O3OB 2I7XA 4XYGA 1SH7A 2HSEA 2IEIA 4MWCA 4RE6A 2L19A 2ASVA 2NYAA 3LGAA 1J33A 2FW6A 4FBLA 4M9SA 4DNOA 3GQVA 5KNCA 3BQMB 2GJ9A 4JI6B 3RSQA 4NXMB 1T0BA 1YHNA 2OPHA 1I6MA 1WZEA 2H1LA 3FRIA 2FGKA 4GL4A 5DM70 4GNRA 5EIHA 4ALJA 4HLDA 1I7DA 1FU4A 2WFAA 2F8MA 1TGYA 1FUYB 5B1SA 5H4GA 1NV8A 3VR4H 5G4LA 2QN7A 1KEKA 4DSTA 2XCOA 4E09A 5CDFE 3U0VA 3UAOA 3SZGA 4US0R 2XB8A 4RC9A 2IYNA 5C37A 1NYQA 2REQB 5FR1A 1VJ1A 4NZ9A 4AYXA 4HUTA 1DWUA 3FROA 5IUKC 4DCPA 5JXHA 3THWB 3H2ZA 2X5NA 5L3VA 3BKWA 2D59A 5K8LA 2ZR0A 2OGSA 1ARZA 4CL0A 4YCLA 5D1HA 1MA3A 2YV4A 1GZVA 2FSVC 3CLTC 7YASA 5L9AA 3VYVA 2EGGA 3EODA 4M1WA 2ZRFA 1M6YA 1OIVA 2I4LA 3NV9A 4XEUA 4C6RA 2IHYA 3RRFA 1QZ3A 2D1FA 4DRYA 1YS2X 1F7VA 2HWUA 2I4RA 4FE7A 4KFRA 4MRAA 1M75A 3IIEA 3K9WA 3Q72A 1BH2A 3MELA 5TLSA 5CBPB 4G5XA 3QF7A 4CF6A 2Y99A 3DMGA 2VKQA 4IHJA 5TQ0A 2VF5X 1CZLA 4LYGA 1M6VB 4OD0A 1LZLA 4JUCA 2NU7A 2WG1A 3LC7O 3PC8C 3NIDB 3TW6A 2X3YA 3VUFA 1P80A 2ALJA 1IVNA 4MDYA 3K0CA 1Z7WA 3EQZA 1DTWA 1H1TA 2XI4A 3NLLA 3P9IA 2WJVA 4UHJA 4WN9B 2D0IA 3SEZA 3BFPA 3T7KA 2PRKA 5KSPA 2CFIA 2PX8A 1N4DA 3PQ3A 2ZFUA 3ESDA 3IIJA 4R9UC 4ZO4A 2QVLA 4TLCA 2I7TA 2WE8A 4HDRB 1EDBA 1R8SA 2A35A 1XRRA 3T7TA 3U3MA 5IM4F 1X19A 3FYCA 3ZV4A 5I7UA 3GFSA 4YRTA 2JAOA 2VKTA 2WF6A 1L0BA 2Q3MA 2J6HA 2Z2KA 3N74A 2W71A 5CM9C 1S9HA 3AM5A 3DC7A 1HZZA 1U3GA 3OFVA 4MVJP 4C4AA 2B9EA 4U2CA 1EVZA 3EIFA 3KLBA 3PLNA 5FPSA 3SE0A 1DI0A 2WHPA 2Q3LA 3OETA 1EVEA 1DOHA 4U2FA 2OHIA 1X9IA 4AZSA 3TDKA 4G0NA 4M38A 2DULA 4V1CA 5KTSA 3RADC 3WLHA 1UMCA 1H05A 2OZLA 3FPCA 1V4BA 1PHRA 3ILVA 4PLFA 1QVWA 5IT4A 4AULA 2GBCA 2R62A 1USKA 3AL0C 2EJWA 4F72A 1FRQA 1E8NA 2P4UA 3MM4A 1X2EA 1PL0A 1NC3A 4MIKA 3A1FA 1PZNA 3OAAA 1Y6JA 5EKXA 4QPNA 3UAWA 3M3PA 3OCYA 4EHJA 4RJIA 3ZDBA 3A26A 4MPRA 4Y0AA 3ABRB 1NY5A 2IPNA 3D8HA 3EMDA 3Q7RA 3KKEA 3DM5A 3ETNA 3RF7A 3TJRA 5K51A 3RANA 4DADA 1ZI8A 3HVIA 4RKRA 4BLVA 1X87A 3EWSA 4FNAA 4J0JA 1HO3A 4OKIA 3A1TA 4B80A 1C1DA 1QDUA 4KGVA 2QAGA 4DR5B 1A9QA 1Z5GA 1UT6A 3E8XA 1FJGB 3BAFA 4O25A 2AEEA 1E3WA 3S40A 1RNLA 1BVRA 1BWPA 1F7UA 1YHZA 4DQVA 3GN1A 2YVLA 1CP2A 2ECFA 2XYQA 5E2BA 3EGDB 4OXRA 2GFHA 4EUNA 1SG9A 4RLFA 3NRBA 4OHVA 3GK3A 4LOLA 4Z9FA 1ZITA 2C3OA 4KRFA 1KMCA 3NHJA 3ZIUA 3CQ9A 2EX0A 2PSJA 4FK8A 4BHTA 4CQLB 4EY3A 4FSXA 4IUDS 5HZGA 1V1MB 3INGA 5ERGB 4FHGA 2NO4A 2ZJ2A 2DBQA 1IUNA 4LSMA 4UE2A 4C2UA 4HLQB 3BXOA 3IV6A 3DAHA 3GLKA 4RJLA 5B5SA 3AG6A 3O8DA 4HLUC 1P3Y1 3GY0A 3R3WA 4ZI7B 1OBCA 1C30B 3EJWA 4YRPA 2AMLA 3OCVA 1E1CA 1HKUA 2Y71A 2GBFA 4FHCA 1M6HA 3W8DA 1W73A 1X7WA 4DLSA 2G08A 2GRAA 3E4DA 5EAIA 2PD3A 3CF4G 4L9RA 3RRMA 4D8TA 4ZHQF 5KQSA 4EX6A 1LPAB 5TIIA 2L2QA 3GI1A 5B7GA 1AGYA 3NIGB 2XBUA 3K05A 1FLVA 2Z5VA 1MTOA 3N2KB 3SX2A 4B3FX 1Z5ZA 2YC4C 4QJ4A 1T35A 1KRWA 4GD3Q 2RGYA 3UW3A 3JATB 2UU9B 4WLFA 2FN9A 2BFFA 2QYHA 3QKWA 3AEYA 5F2NA 2BEKA 3H5IA 4GOND 2FDRA 3GNTA 4KQGA 2AX3A 3VH2A 3O84A 1XMSA 3DBHB 3O4IA 4LJRA 2P3LA 3K1YA 2GUWA 4IH9A 1YFKA 1KGSA 2QMQA 5AESA 5HIKA 1J2YA 4LNHA 3CRZA 3TOXA 4OY3A 1YRBA 3JVDA 4X3CA 4A16A 5IS2A 5KDOA 5AUPB 5GJCA 4RIEA 3ACCA 1Z2AA 1OFVA 1CUZA 1Y9AA 1V95A 2HEIA 2G25A 3PCRB 1HDOA 5KTOA 3OP1A 4QQRA 5JPDA 2DEUA 4MWOA 2BT4A 1KJ9A 1XTZA 4LRSB 1KXZA 4RD0A 2YWHA 3FD8A 4OHOA 4Z7JA 2C4TA 1CIJA 3HB5X 3K3PA 2GF0A 2QOEA 1GTL1 2UZAA 4FQ7A 4P33A 3AHCA 1DXHA 4PG6A 3WK9A 1UJMA 2Y27A 2JLSA 1AURA 1PQUA 3MTQA 1LNZA 1TF2A 1XA4A 2WWHA 3BWCA 2CHQA 3KJEA 3OBIA 4HTFA 3THRA 4H3SA 1UANA 1B7GO 1IWPB 4S1OA 5B37A 3LXXA 3CLKA 3NKLA 1MGOA 1W2GA 1GPAA 1XXHB 3EWNA 3JRWA 4KE8A 4RVUA 5T8KA 2IV3A 1QTIA 4KYTA 4WW0A 3HA5A 1U0JA 4FCTA 4O2AF 1ORVA 1QANA 1RAHA 2BFEA 5LA6F 2M6KA 2VOEA 3TQSA 1ONSA 4RL6A 4EI2A 1E0KA 5CVCA 5IH3A 1SXGA 2PSEA 2R86A 1KJWA 1BDMA 1JAXA 4XQ0A 1UQRA 4BKUA 4WTOA 1WY7A 2OO7A 4YR7A 2QU7A 2ZYGA 4LDNA 2O06A 3NASA 1JKJB 5ELMA 4UW9A 3ZE6A 1RYFA 1YXMA 1QIEA 2A14A 1JWAB 1WJGA 3NATA 4BEJA 1UBRS 2HB6A 3F8WA 2CNBA 4ZMRA 2ZCUA 4RPCA 5AHKA 5HBRA 3SYNA 4EUFA 4UHDA 3JSAA 3AB7A 1Q0HA 2IYEA 2JAQA 4ZK2A 3U9LA 3D3KA 3HXKA 4RA9A 2ORYA 2C3YA 4HAXA 5H3CA 4RKEA 4U2EA 5G02A 4EGFA 1IOVA 1WOMA 5L95A 1T3GA 1NJ5A 3IUNA 1FRVA 4YEDA 1K7SN 3MTIA 2WBLC 5AJZA 1K92A 2D5LA 2HK8A 2QZSA 5K5EA 4QOFA 5E95A 5K0SA 4O4IB 1TCVA 4A0HA 3CVWA 1OHHA 2UZ1A 4OQ4A 4RXTA 1EK1A 4WY8A 1JKFA 6GPBA 1HH4A 2DFDA 4BFXA 2W8ZA 4OQEA 4PHTA 1QLHA 5EKTA 2EARA 4M9QA 4ZDWA 3PRYA 5JVDB 5CFRA 3OD1A 2HRDA 3EYAA 4RTMA 1QIGA 3JQBA 3T3MB 1FCJA 2P4HX 4CGYA 1K6EA 1VL8A 4JD5A 2ORWA 2GNOA 4C76A 2HHLA 2Y4NA 5T57A 4CRWB 1XAIA 1ZR2A 3K20A 3RUHA 5D3QA 3ZDCA 3V33A 3TPCA 1KU6A 1G6HA 4JLMA 3CISA 4IIFA 4L16A 5E1OA 1SVIA 3P0RA 4F46A 3WMEA 4OAOA 1PGOA 5BSWA 2QIOA 5SY4A 3MPOA 2XUZA 3PNOA 1JLLA 4RTJA 1RQNA 1F9AA 4L9SA 3EDYA 4ABTA 3U60B 4H15A 3UB2A 1TCAA 4H6XA 4FKZA 4I8XA 1OV6A 3ZY4A 7GPBA 5AW6A 1P60A 3S8YA 1U9JA 1I0LA 2I33A 3DBRA 3U81A 2NUAA 2O8CA 3MW8A 1MUUA 4OQMA 2DTEA 2ZSHA 1IY1A 2BY4A 1T1IA 3RM3A 2HIGA 1G66A 4KIJA 3H8JA 5E38A 1YA8A 5EHZA 1W4CA 2PXCA 1ACMA 3E9NA 4UTOA 3VOSA 1E2JA 4M8SA 1I8TA 3PK0A 4L27A 1DTSA 2IYFA 2PJRA 4BB6A 3VH4A 4OK3A 4GI5A 4QDKA 2FEAA 4IMIB 4EG4A 4N5MA 4QPDA 2HM7A 3ROGA 5C8DA 3JASA 4MI3A 4CLOA 3T54A 2PX3A 3KU1A 5HR5A 1GPUA 3GF4A 1X15A 5G0TA 2WWIA 1Q92A 4ATNA 3KDPA 4FOOA 4TS4A 3WRYC 4PRYA 4ITVA 2GBLC 3EVBA 3PZRA 1BS2A 1E18A 3PRKE 3GHYA 3LX4A 3BL6A 5LIRA 3TEFA 1Q11A 3HDYA 3QE0A 4MUEA 5K6TA 2I8LA 2PA0A 2XHEA 1E1CB 1AKTA 3L05A 3ZOKA 5KREA 2HRCA 4MR9B 4NJEB 5M34A 4R2XA 1FRZA 2HMUA 3M6WA 3T7EA 1RRCA 1EHCA 4FGJA 1CUVA 5G4KA 2FN8A 5AOBA 5F9FA 1MC4A 4M6WB 1E32A 2C7GA 3FIJA 1Y4ZA 5K3DA 4Z6KA 4KPEC 2O5EA 2MT9A 5DWDA 5DP2A 4NKRA 1EP9A 2DJ5A 5FBVB 4Y1GA 2JCSA 1JEDA 4MKGA 2E4UA 4WZAE 4CG1A 3W2TA 2ZR8A 2KQUA 1ZR4A 1XAJA 3ZIAD 1QCZA 4LJ7A 4EATA 5K20A 2FKAA 1GAWA 1SCQA 1CJKC 2NQ2C 5HQ3A 4EFDA 1QH1A 2GHRA 2NIPA 4ZTUB 3DZIA 5BUZA 4LFBB 4O3MA 4GSYA 3LYUA 2WMOB 1P44A 2D8AA 3CJQA 1M1UA 1LS1A 3N1UA 4ZZ3A 2Z2ZA 1AQUA 4PAMA 1VJCA 4LOKA 3SHVA 3W5DA 1JJAA 2Y9PB 3BMCA 3CFYA 3BE8A 2ZANA 2V55B 2AB0A 3O2QB 1HEUA 5K2OA 1ZH6A 3MJEA 4HGNA 3T7IA 2BTQA 1GILA 1ULAA 3F78A 4KQ2A 1QGYA 3NOVA 3G02A 1J4AA 3Q1KA 3T9EA 4E5PA 5ITWA 3OX4A 2HCJB 1O6CA 3D4IA 4G65A 3E18A 1VRWA 3K96A 3I2HA 3VKWA 1EGAA 3QFFA 4HWSA 3ZEAA 4BVLA 1JB9A 1MABA 2NT3A 3OA2A 1NBIA 4RDHA 4HTFB 3VR4D 2CJWA 1SXIA 1WBJB 2FNAA 1YFJA 1IBLB 2IH2A 2CCGA 1J56A 1DQNA 1DMRA 5EIBD 2LCQA 2PN1A 4P3KA 3AVTA 5AM0A 5K0FA 4D57A 1HG1A 4NR0A 3UHJA 4FB4A 1DBWA 5BW6B 3IVCA 1TFUA 5L45A 3P9PA 5TXGA 2YOHA 2NSJA 3OT5A 5FHQA 1JDPA 1RQ2A 5HGJA 4ZOCA 3CE9A 3MCUA 3NFYA 3LECA 4CMBA 1MB3A 2ACWA 4L4UA 5B7PA 5BR7A 1IHPA 1D2NA 1B0AA 2FUEA 1IZZA 4GLJA 4X66B 1X42A 3MG9A 2ZBRA 3VO8A 1Z36A 4I5FA 1ZNZA 1ZJZA 3U16A 3MRSA 1QV9A 2OKGA 3BEDA 1W581 1V35A 4EAAA 1NC1A 2VEDA 2PUGA 4MA5A 3HLTA 2HPZA 3B1YA 1Y98A 1PK9A 1ZLYA 1Y6FA 4JI2B 2ZI9A 2I55A 5D3MA 1RRVA 1KFBB 2YJZA 5LQCA 2R4QA 4DXHA 3O8RA 1LK7A 4LC1A 4W5OA 4EFNA 3BRSA 2VAXA 3OZEA 3FUCA 2PY6A 3BQ9A 3E9CA 1IY9A 3ORYA 1BEUB 1TCCA 4AWBA 1K7FB 2QUAA 3OM8A 2D0PB 2J6CA 2UAGA 5I9BA 4C4RA 2VYCA 3A1WA 3GG9A 1L5KA 1UBJS 3TQCA 4AUMA 2FUG6 1QMPA 3VO1A 1LSUA 2JFBA 4WDQA 1TU3A 3QJYA 3Q7TA 4O2BB 4R2LA 4MGHA 3L9WA 1WCXA 4UJ3A 2D74A 5CXSA 5SYNA 4WZBE 1Z0ZA 4LFAB 4B09A 3JYHA 4UNRA 1XJ5A 3ETCA 4RTNA 1NIJA 1ZKDA 3JZMA 3T3HA 4ALLA 2ETVA 5JQGF 4KAAA 1E96A 3O8OB 4HDNB 3PKJA 3E9DA 3C43A 5A4FS 5JSFA 4AY3A 2E48A 3I09A 4RXMA 1BXZA 1OBHA 2XYVA 4IQGA 4OGKA 1F0KA 1SVMA 4CM4B 2JD0A 1KY2A 5GONA 3RH0A 2E1RA 3U3JA 5IAKA 4BNKA 2IUEA 3K71B 1XDBA 1W36D 1THGA 4B1FA 5BSUA 3NWJA 5LP6C 4P5EA 3WC4A 1E3EA 2QTHA 4AM8A 4IIEA 2WD7B 5JY6A 4PG8A 3UBTA 4KXFB 5BPHA 1G5RA 3KPYA 3N87A 1GGEA 1ATIA 2VJMA 5EQDA 3IKTA 4DV2B 4EGSA 4KIFA 3EK2A 1A7AA 3T5PA 3E7XA 4KQIA 2ZP1A 4R5MA 2ZUCA 3AJAA 3OTHA 4R1QA 3GFPA 2VK8A 3KQWA 4DV6B 4FYXA 3IP8A 3S1AA 4YO7A 3T5BA 5AM1A 1YVPA 1CD5A 2I7VA 5BUCA 5HP4A 1K5GA 4YMSA 5A5DA 1CS0A 1STOA 3BMNB 5JALA 2E4YA 2Q8QA 2XDQA 4LW8A 4Q47A 1DPGA 4Y9RA 1YBAA 4OB7A 3JASB 3HKCA 1SRQA 4H59A 3GZJA 1EE2A 5JXJA 2JDID 3ZWBA 1NJ8A 4ND2A 3FVVA 2PAAA 1S7GA 4EUHA 1KERA 1X7GA 2HGZA 3UCFA 1Q7CA 4MYRA 5C8ZA 3CJRA 3DDSA 3N2NA 5KYGA 4ZVOA 1DFHA 1NPYA 1AE1A 4HBZA 3UNXA 3ILXA 3QHQA 3EPJA 3L8EA 1TT5A 1JIVA 4LJ4A 4MV1A 3JZAA 4UNPA 5ALQA 2X4IA 2ZOSA 1ULZA 2QTGA 1MHPA 2IYVA 3H1FA 3O9MA 4DJJA 4KQXA 3H6KA 3UJHA 3VZDA 1NIPA 2PGJA 4MRPA 2PYDA 4GLBA 4RFLA 3U7HB 3QXSA 5JJLA 3QLVC 1ZD8A 4DCMA 1FA9A 4A2QA 5IEBA 5G2OA 1PFYA 4PAOA 2R6R1 1CQWA 2J9FA 5HJ7A 1OJ7A 3PC7A 1NG9A 4XA8A 1QC5B 2WHRA 1V1JA 2FP3A 2YV1A 4LS3A 4LXXA 3IURA 4Q9IA 2YXEA 3WDSA 1ZJYA 3CLTD 1SVOA 1WQ3A 1HDZA 3R5KA 1VHJA 3DCNA 4V3CA 3WGJA 5MN5A 5IKMA 4GUDA 5CLFA 1USGA 4KFSA 2VP6A 4MR7B 2VAPA 2X0JA 3SSOA 3KHSA 4IDAA 3VYWA 5CM8B 1U7WA 1Z6AA 2GI4A 3CW9A 3OT1A 4HADA 4LV6A 5EQJB 4F56A 2WQ6A 1HT0A 3OO1A 3REQB 2I8AA 3F5FA 2C4HA 4ON9A 4MW0A 5EPOA 3SQLA 4AKGA 3PZBA 2OYRA 4ZCQA 4Y6SA 1VIMA 1TPYA 2PD6A 3VPCA 4UTRA 3M1IA 3MA0A 3FHCB 1KMIY 2O52A 5F98A 3WGNA 1XTKA 2Y9MB 3GJ5A 3PNYA 4FU0A 4DNXA 1XRMA 2QSZA 4IVPA 4BFVA 5F9HA 3F6RA 2FQYA 1FL9A 1U2QA 2VC2B 4R6XA 3L6EA 3QXCA 4GM4A 2DYKA 4I55B 3U1TA 2G5PA 1JPVA 4MO9A 1SUBA 3QUBA 4OQQA 1RKUA 3ZWNA 2ZRMA 3HA2A 3UWDA 3CVVA 3PSHA 3FPJA 1HXHA 4QBGB 4ZAXA 1P61B 5FUXA 3BC1A 4TKMA 3VC3A 3I2KA 5A4AA 3R75A 1RLOA 2FGJA 3E5NA 3MERA 5JRDS 3AVUA 2NZWA 3W5UA 3UENA 4MV6A 1KQNA 1FQJA 3EXEB 4X63A 2V6IA 4MDFA 3BREA 2QV0A 4ZP1A 3U61B 1DFGA 3Q98A 2OV8A 1M9NA 1YBVA 3DOJA 3K9FC 3PE6A 6REQA 4OB8A 4KLCA 4LWQA 2AXEA 3VV3A 4F11A 2PZ8A 2MWMA 1W94A 5CB0A 3OFJA 5G0SA 3I2YX 2LUOA 1OU0A 2L69A 3AW9A 4O6VA 4OHUA 2DCMA 3RR2A 4IICA 1CUGA 4HWTA 2EFHB 3ECCA 3ZI7A 4B3DA 2BL4A 4ED9A 3I5YA 1MDBA 1IN4A 2J59A 3BXXA 1WBDA 3PJRA 1WDMA 4LHWA 2PXHA 5LBUA 4DR2B 1Y3BE 4G2NA 2XMCA 4R51A 5EJFA 3JQ7B 2FPGB 2ZSJA 3H86A 2WABA 5EP4A 1M1YA 3PNSA 3VYRB 2QJWA 3STUA 2DTXA 4AMUA 4TV9B 5JNWA 4EBBA 3CWQA 3ZV7A 2XXJA 2V6JA 1FDUA 3IAM6 4NABA 1FYXA 4M1TA 3V8PA 2Q2QA 2WWWA 3I6YA 2OP1A 2WM9B 4O2AA 5CEFA 5LA6A 5AHXA 1T6ZA 4PO9A 3AR9A 2QAGC 3R0JA 3NU1A 3PT5A 4DLPA 3JAKB 1MX9A 3A9VA 1GYPA 3EVDA 5DN6D 2BEUA 3KVNA 3HZRA 4QPPA 1QB7A 1XMPA 5COBA 1EFPA 2P35A 2ZS7A 3LTNC 1AKQA 4ZANA 3X1ZA 5AWFC 1RXYA 3CMMA 2OK8A 1ZJJA 1FLAA 1G3IA 3GPIA 3L49A 3NG1A 3GYGA 3ICCA 5H3LA 4ENPA 5KTRA 2H7CA 1BXKA 2BM1A 1T10A 2XB2A 3JD4A 2ZT8A 3KAKA 2C1EA 1CSEE 4BP1A 4QAQA 1DJMA 2QP3A 3D4OA 4I6GA 3C5CA 2B69A 4P84A 3LUGA 3IP3A 5JS1A 4IEFB 1LX6A 2SKDA 5KNCH 2Q1TA 1NJ1A 3OBBA 3OJLA 2CJPA 2VK1A 2YJGA 5EKDA 1G4HA 2PO5A 4PHFA 4F5YA 3UXMA 3X3HA 2WP8J 4QQFA 2PVSA 3MWDB 5JCXA 1OI4A 1CR1A 2AYYA 3GA0A 1Z2CA 1JSLA 2GAJA 2IUFA 3VU9B 1CRZA 4G84A 3TAUA 3EUFA 4YXWD 4LF5B 4BFZA 2IP2A 3PGLA 3VZRA 4DCOA 1JJ7A 3QKIA 4II7A 2BKVA 5JI3E 3DO5A 1E3QA 3BGVA 2VJOA 4DIDA 2CLMB 2GPBA 1CJBA 2X6TA 2C5AA 1BEZA 2YV5A 3SF8A 5U4QA 2WB4A 2WZBA 3SZRA 1RU3A 2IEZA 4J0DA 1SC6A 3K4PA 1WPGA 4EO9A 1DT3A 3VFDA 1R74A 5AW0A 3TGLA 3L1UA 4R7GA 3SQOA 2PE5A 3AUXA 5D6OA 1RKXA 5DHUA 4RPJA 1GNTA 4D1YA 2BISA 5AW4A 2ENUA 2AZTA 1HDIA 2HPAA 4AZ3A 4ZQHA 2A5JA 1D4AA 1X7XB 3HPQA 2HR1A 1K88A 3HKCB 4GGMX 4KVAA 5AVKA 4CM7A 3TJMA 5IVKA 4C0XA 1FSPA 1N6RA 4C0AC 3F6CA 2RG7A 2AJ8A 4PLZA 1MAHA 2C07A 5IBCA 4CKEB 1BJRE 3IP9A 3NHBA 8ABPA 1FC0A 4IHKA 1IHYA 4YPFA 4KR9A 3RSLA 4EENA 2YZ7A 1ZNQO 3A4IA 1GN8A 3PWTA 4MVJM 5E7QA 2O3TA 1SXJA 1I6WA 4KVGA 3SHWA 2X6QA 3SX4A 4I4NA 2XIJA 2WQZA 1C81A 2HU7A 2AF4C 2MSKA 3PUWA 4H08A 4OREX 3PFKA 2G6TA 3OY2A 4LWZA 3SVLA 5DIZA 2J3DA 2ZWAA 1RCTE 1Q0ZA 4I2NA 3UGKA 4H77A 3JARA 1Z88A 3ENKA 5T8KC 3RSHA 3TVYA 2BIFA 3E53A 3JAWA 3IUEA 3WSTA 3FPEA 1UWVA 2ZB8A 2QR5A 3HR8A 3W9UA 3IX7A 3ROXA 3WB0A 2C7QA 1MAVA 2IYTA 5HZKA 2J9FB 3M3DA 4HQNA 1C0LA 4MPTA 3LOUA 3C5VA 2YWXA 2IRWA 1G55A 2BVNA 4HAUA 3IXQA 2J32A 1UKAA 2DP4E 1WKVA 3FVQA 4Y67A 5C53B 2G4CA 3IEIA 4C7KA 3OKPA 1E3IA 4YAWA 5KYNA 4W5JA 3OKFA 3B52X 3U26A 1XDSA 1ZVJA 2GLXA 1VJ5A 4CMGA 3EDCA 1MV8A 1S3FA 1B15A 1NF9A 4U7DA 1Y1PA 3DL0A 4DR1B 2ZUTA 4DA7A 3M6VA 3K16A 3RVNA 3PB3A 4OVKA 2CNNA 1O5OA 2PX4A 1DIOB 3HKEA 1GPH1 3N53A 1XKXA 1I5RA 4C4SA 2X8JB 1YB1A 3AONB 1LK0A 2B4YA 2C2XA 1SBTA 2MR6A 2XTJA 2ZJOA 4BCBA 1BMFD 4DHWA 1CC1S 1G1AA 3N2GB 5GADl 1DCMA 3RE1A 2ZEJA 5TQJA 1V1RB 5DNCA 1KP2A 3LHSA 1PV4A 2YWFA 2G9ZA 2QX7A 2XNCA 4DCSA 1KU0A 3CKKA 1K3UB 4ANFA 2PFGA 3LPMA 3GPDG 2FR8A 1KH1A 4EWLA 5LVAA 1YDEA 3O8QB 4HQKA 3VR3D 2EXXA 1YNOA 2JFWA 4G8DA 4ME6A 4C78A 1CW2B 4DNFA 2XDWA 3A37A 2C2HA 1TMKA 1GEEA 1W1UA 3GG2A 5B1DA 3UJAA 1NXWA 4PRLA 3BE6A 3N0XA 2FP4B 3AYZB 1CY2A 1O54A 1T4BA 3PFGA 4Q4JA 3ICEA 1Q2XA 2FYTA 4MV9A 1QHEA 2ZRQA 3BIWA 4LY3A 4N8EA 4XFDA 4AL4A 4AX8A 3IUYA 4D3DA 2GM5A 2VUUA 3DEIA 3UG6A 4QM6A 9LDBA 1IN8A 2GD2A 2YVAA 3ZQ6A 1XUOA 3N8GA 4ZKDA 1SBZA 3DWGA 1CY7A 1H3FA 3MILA 4LNAA 3V4SA 3THXB 2VWQA 4CL3A 1XL0A 4P83A 4UE3S 3D1VA 5ECGC 5H4HA 1VZ3A 1P4SA 1C4WA 3SNHA 1XMQB 3NB0A 5A2QA 4YJ2F 2OUIA 1T0UA 3F7NA 1KFJB 5H0IA 4WFIA 1R64A 4KXLA 3L4SO 4C1NA 4D3YA 5CAEA 4F12A 4BV8A 4XQEA 1T9ZA 5K6AA 4O63O 5ADHA 2HIAA 2NUTA 3WIVA 3KZOA 5BYAA 3G2NA 2WI8A 2QRVB 3FJOA 3QKSB 1NTRA 1FOEB 4AP6A 3ZHVA 3TKLA 4AJ4A 1C3XA 1WMBA 1X9GA 3RAFC 1BO6A 2RBGA 1WXXA 3OLWA 1YS6A 1EFLA 2QN9A 4B4WA 3QVMA 2V7BA 2V7PA 4WLOA 4LBVA 1UWCA 5CT9A 2FX2A 5TPWB 1TM4E 4EJ6A 1QVVA 2ODAA 3ZKAA 1E6LA 5C35A 3SR4A 2P9EA 2JLYA 1N33B 4W7SA 1PT5A 4RTRA 1OI3A 1QFYA 2CMHA 2HV8A 4KO1S 4QOSA 1WO8A 2ACKA 3JQGB 3GW8A 1Y3FE 4GF5A 3FSEA 4JODA 3UOAB 4BMXA 3QKTA 2LTAA 4BGUA 2FH5B 3ZTYA 2YKGA 4QDUA 4LMBA 4NCHA 3GJ8A 1LLCA 1NUHA 3TX2A 1R4AA 4J4BA 1SJ9A 3DNFA 4Y1FA 2VHJA 3HHPA 4M7OA 4F45A 4Y6OA 2AD1A 1ILEA 5E6SA 4FJ2A 3BHIA 2Q62A 3T5CA 4CMHA 1NQTA 2R6CA 3WMFA 5FD8A 5K0GA 5FYDA 4G67A 1ZO8A 1IRXA 4HTAA 4E2WA 2BSQA 5CW2A 3SJCA 4U6NA 2I6XA 2OCAA 1C2YA 1SOVA 3MIIA 4FBMA 4LF9B 1MJFA 1IEWA 4IHQA 2D3TA 3HP4A 2VDMB 2HD4A 3MBKA 4J76A 1Y4AE 2JFGA 4YQYA 3QMWA 1QTQA 1P77A 1D2MA 1PR9A 3HBAA 3IERA 1N9GB 3R23A 4J1QA 4ZYYA 1DFIA 3E48A 2BYTA 1KNQA 1U2SA 4QXQA 4ARIA 1E6UA 1KSJA 1RM5A 2X1MA 3L07A 1DT5A 3HVJA 1ZM2A 2XUJA 4L0QA 4QEKA 1ZX1A 3LHKA 4L6IA 4LYEA 4ND6A 3P9CA 3A36A 3UPDA 5SYAA 1XK6A 2P4QA 5CXXA 5TARA 1E1LA 3UHAA 5IJ0B 1TC2A 4NPHA 1P72A 1RAEA 3VKVA 4C43A 2C57A 1V0JA 3EC2A 4DC0A 3TGWA 3EARA 1NVVR 1ULTA 4I4CA 4QBHA 4YRFA 2TMGA 1CYDA 2ZWMA 2WVAA 1QFZA 2I9PA 1F14A 1T3SA 2O5VA 2ZRDA 4Q12A 4BRWA 5IHPA 4HYYA 4A6PA 1OCEA 4KQ9A 5ILQA 5JRZA 3E9MA 4MLCA 1VG9B 2WIJA 4JJGA 3UAVA 4CV3A 4QTTB 4CTNA 1EFAA 5HHTA 2HA4A 1U5AA 1RDFA 3NEYA 4NBKA 4HVLA 1U8XX 1RJ9B 4TN5A 3FZGA 3EZFA 1Z2EA 5JJBA 1SD5A 1CFJA 4KXMA 3C98A 2VPIA 1IYZA 2IUUA 2QD3A 4FNGA 4HFMA 2GMWA 5L3QB 2W2KA 2PBRA 2KHZA 5D5PA 3OPNA 1U7ZA 4RZ3A 3LPLA 3OI7A 2LGJA 2AG5A 3W5JA 1GPLA 3LVQE 3QVXA 3O21A 4XRGA 3EZ6A 5A3VA 1AKUA 3IUPA 3Q6IA 5IDQA 3GB9A 1M8GA 2C20A 4FMPA 2P9JA 5B57C 2ZBVA 3I9V1 1ZFNA 1QFXA 1L5GB 2XKBA 4OHYA 1RYMA 5KC9A 4Z9XA 3I92A 2Z9DA 5BXYA 1NWHA 1C0KA 1H42A 2AWOA 1JIQA 1GNLA 2VPQA 6ADHA 2V7GA 2Q3JA 4OA5A 1WSDA 1V71A 4GPIB 5LU9A 4CLRA 4DARA 3CW2A 2IXEA 3Q6NA 4UHFA 5IBPA 1VB3A 3KKKA 1V3VA 2QYSA 3NTLA 3OC6A 3MT8A 4IIBA 3H17A 3O4JA 1J1IA 1W49A 3ZE7A 3GJSA 1XWFA 4IIVA 5FBRB 2H4HA 2UZ3A 2IKSA 2W98A 4Z99A 2GPSA 2GD1O 1GU1A 3HSSA 3I5XA 3Q8XB 3G5UA 1A04A 1JIIA 1E69A 2Z6VA 4MW4A 3WQSB 2BC9A 4QC2A 4CM1A 2EKBA 1HTBA 3HBMA 4O2LA 3HCPA 1KR2A 5TPZD 3OQOA 4R2IA 1JXMA 3EAGA 3DJYA 4TT3A 3EQ8A 4I9FA 1J23A 3SZMA 2W2XA 4Q4DA 2BGJA 5SY9A 4F6RB 4ZOAA 3LF2A 5E0KB 3L92A 5IFLA 2YFKA 3A28A 3DC2A 3KALA 4HEJA 5GV8A 3QVLA 1F12A 4YT2A 2CVQA 3IKVA 5BMVF 1CJSA 2V58A 1C4OA 1PEYA 2PAFA 1OZ0A 1TMOA 5E2AA 5BR4A 2XNJA 4KXYA 4AS2A 4B44A 2VP2A 4L2IB 2Q3CA 3A6HA 4LA4A 4RDIA 4C20A 3PR2B 1UBKS 1U6IA 2JCXA 4X1YA 4G5FA 1R8QA 3GNLA 5EVJA 4OJNA 5JDCC 1WXIA 2H1CA 3U5TA 3WE7A 1Z35A 1JAYA 3JQAA 1ZWKA 4TTRA 4WUVA 1WCWA 1IM5A 2I5PO 4GRDA 5AVSA 4UAVA 3PX7A 1PS8A 3GJXC 3KOOA 4EGQA 5IXSA 3AU9A 3AR6A 2IEYA 2REXB 2ZI6A 3BM5A 4P35A 4Q00A 2ILVA 4D9CA 2PJUA 1M8FA 5JWOA 3M5CA 2D1YA 3OECA 4ODIA 4BKOA 1CNMA 3CXUA 3H99A 1T2FA 1VG1A 2ID9A 3EA0A 1LTQA 2JJYA 5A0VA 1UP4A 2PANA 1YZTA 1QRTA 4PWYA 1NZJA 2Z1DA 3DNPA 4L4YA 5DLQC 5B58T 2Q45A 4MPJA 2G7MC 1TTTA 4CTKA 2BGIA 2P0EA 3VXKA 3EVEA 4ZT3A 1JQLB 1EFCA 4Q39A 3W2IA 3WGYA 4K9SA 2HQBA 4UEKA 5A05A 1K0UA 5CX4A 2EAUA 3E2MA 1WETA 1F3OA 1PT6A 1JAIA 2VHEA 1ZK3A 1RC0A 1Q7RA 1C3OA 1XQXA 2JCYA 3K4QA 4M8NE 2NU8B 1T24A 4IYJA 1JTVA 2GCGA 5LQJA 3AHEA 1FFYA 1O1YA 1P2VA 5C2JB 5FDFA 1F38A 4ZALA 2ZTSA 4KFUA 3RHTA 5JS7A 3TM4A 1N5DA 5I7EA 4YVFA 2VYNA 3CN9A 2EWVA 1T6XA 3AIMA 4S35A 3SN6A 5BXQC 3IOBA 3Q8KA 1C29B 2HSJA 3PXBA 5CMLA 1WXDA 5AUQA 3S5JA 1XZEA 4YHHB 3HFSA 5EMKA 1PTKA 4XGKA 4EHFA 1E2HA 3LBIA 5I8ZA 4M89A 3OLCX 3M5WA 1GCGA 5KYWA 2VO1A 1W96A 1AD2A 4MWGA 2R8BA 4O0LA 2QUZA 4CIXA 1XF9A 4JL8A 5D7NA 4RDXA 3KLPX 4D8WA 1WUHS 5AKJA 4KRGA 4YCMA 1WG8A 3IQWA 4D6PA 4CIVA 3HYRA 5A6SB 1VHWA 1GZ3A 3ABSB 1AZTA 3MTBA 3AEZA 4HVCA 2ZYDA 5BQPA 4RANA 1N2CA 1I1QB 2FK7A 2WIBA 3C1UA 3KYJB 4G9GA 4LRXA 1TJ5A 1W9HA 1JT9A 4HQFA 5DM60 3KR1A 1XNRB 4NBSA 4FGUA 1ANKA 2H3HA 2GEFA 2II6A 1SHKA 4QKQA 4FDAA 3TN7A 1JIKA 4Q82A 2C92A 2PWPA 1BEEA 2EJUA 2H5JA 5BPFA 4PPYA 2RC6A 2ISSD 2GYVA 2W2LA 1CZUA 4NPAA 4M21A 1K5HA 3AVVA 2FX3A 2HIMA 2ET6A 3PJFA 4N39A 5CGQB 3SEFA 4DBLC 2ZETA 1QRSA 3DR3A 2WV7A 3R0XA 5LZ8A 3RLIA 2LCFA 1H6DA 1FQWA 2ATCA 4UXHA 3N2YA 4WESB 3KSAC 4NCJA 2QX6A 4DE5A 1P5RA 1T0IA 1NN3A 3QWIA 3U4QA 5ED0A 1XJWA 5I7HA 1E79A 1GZ7A 1I3LA 2W6QA 3K30A 3ODGA 4P5PA 3TL3A 3ZQ4A 3ABOB 1W5TA 3CRRA 4C5CA 4QTYA 5LFAA 3KXPA 1EP1B 2W2KB 1FDOA 1TQ8A 3PQ6A 1U9IA 4ZZ2A 3PD0A 2GZHA 4DM4A 1F17A 1E1KA 1UH5A 1JFFA 4RVDA 4AJKA 3QI2A 4ESEA 3EXHA 4TKUA 5HFAA 4CEJB 4PLCA 1M2OA 3GUUA 3KXLA 1TXGA 4JJ4A 2ZZMA 4XLTA 2IDZA 2ZUDA 2EBFX 5HDQA 3W6NA 3IVRA 2PKCA 1D2RA 2YQ4A 2DHEA 2FRDC 4W82A 1B73A 5CH5A 1LBTA 1I1HA 4LZLA 1X39A 1QVZA 2HMYB 5AI5A 5I9LA 1QHHA 4PINA 4QU8A 4Q9LA 3I23A 4X44A 3PCXA 2HCBA 2H31A 1NGSA 3OAAD 3HJAA 5K3FA 4AJJA 5JLAA 4QYTA 3OU2A 2I2DA 1P4JA 4FYPA 3UGQA 2ZBGA 4AQYB 3I05A 1A27A 3KCQA 3O4HA 3WZ2A 1OIXA 3O31A 4BLPA 4H1WA 1JFSA 3LDAA 4B6JA 3I34X 3UK2A 2WC1A 2XT0A 3N58A 5F52A 4DQKA 4O29A 4CE6A 3RC7A 3C7TA 1XZMA 1PJ3A 3R4CA 4MKRA 2P2NA 2XIQA 4RZSA 1O0SA 3LK6A 4QDTA 2A4MA 1P1HA 3WFJA 2IV2X 5AUNB 1FUKA 1ZVMA 3SWWA 5H1YA 2FZEA 3AY7A 4HD8A 1RQLA 3DAFA 3MOSA 1CEYA 1Z2NX 3PX2A 3ZD8A 1SBQA 3WYBA 4CZ2A 2VQEB 5I7SA 3E2PA 1A9YA 1WW8A 2X42A 4GSKA 3C6YA 4GHWA 4OM7A 4YACA 4BKMA 4DDMA 4D9FA 2ONYA 3T99A 4QWMA 3IMKA 2F8TA 2F3PA 1C7ZA 2WZDA 4XYEA 3VR0A 4CF4A 2P4EA 2WJYA 3WLPA 4PIPA 1IIRA 3W06A 2DHCA 1YJ8A 2FETA 3JQ9A 3OX1A 4ZCIA 2C2KA 3MXTA 3OFNA 1UT5A 3B60A 4IEEA 1B00A 4AY5A 2MYPA 2FSFA 1GYQA 3GIWA 3KAPA 3GCZA 1UDXA 4YRGA 4BYGA 3N75A 4ML3A 4HAOA 5IP5A 3RVQA 2C2YA 4CQJA 3DSRA 3A3PA 4PZCA 4RIGA 2OEPA 4X24A 2B98A 4DWJA 4W5NA 1XEWY 2FRVA 3UKJA 3OZDA 4B82A 3M6IA 5LLTA 2WWYA 3W3AA 2ZJ0A 4WOJA 3JYPA 3MOIA 3NYWA 1IHUA 1W5FA 1Z47A 1YJXA 3O1HB 1HNXB 4CPDA 4PV7A 1EJBA 3DTYA 2VBIA 2OCXA 1PJ2A 2A3RA 1MNAA 2NO5A 3JYQA 3MTAA 1X7ZB 4FSDA 1FMCA 4U2GA 4YMWA 4DDTA 1KAQA 2Q5LA 3QPBA 4LJ9A 4PX9A 3TLCA 1I14A 3GT4A 4HATA 1N6HA 1GUBA 2RHDA 1RRMA 3DD5A 2WWTA 3A4NA 3A7DA 2R1VB 2GN6A 2L82A 4ZT7A 3RBAA 4B3BA 1C3OB 1FSGA 3KYDA 3OM1A 1JALA 4BPRA 3X1KA 4YJ2A 5K01A 5L6LB 3A0RB 3ZWPA 1YACA 2QP4A 1KK0A 1FDRA 1FU8A 2JGFA 2JIZA 2Q5OA 3PI7A 5KU7A 4O4LB 1Y9ZA 4TXJA 4XB1A 1PE0A 3B3JA 2OL4A 1KVSA 1M83A 1UP7A 1JVBA 1UPAA 4JJZA 4DV1B 1VYHA 4Q7EA 3ZWDA 3GLFB 4OYRA 3TK1A 1TU4A 3VAZA 2BFBA 2OKCA 4IDPA 1NNLA 2BGUA 3R5TA 4PGAA 4DPKA 5ITZB 2VZ8A 1L4HA 4GXRA 1WABA 2O50A 1WVMA 2B35A 2UUBB 3VKUA 2CHVA 4HN4B 2CNLA 2L0XA 1XA3A 2RHGB 3CU5A 1KFCB 2EFGA 4QTZA 5CVEA 3FRHA 1YONA 1U4NA 2VCHA 4JOQA 3L7OA 5F1OA 1MG0A 4I55F 4UM9B 1JI0A 2E0IA 3RW9A 1NOKA 1WX1A 3KYBA 1ULBA 5TDHA 3U4AA 2QUHA 4BOYA 5KVSA 5KKAA 5FADA 4BIMA 2Y1LA 5JV5A 2EATA 4CDNA 4GG1A 2OHHA 2PMBA 2QD5A 1CUUA 5HDBB 5E9AA 2XKKA 1E3DA 4F4IA 5DHFA 3LGSA 3QEMA 3O8BA 4UHBA 5H02A 2E4ZA 3IBYA 2PT7A 1F06A 1I3OA 2AHOA 4UZSA 2RHMA 4DCGA 3UATA 4PY2A 1AMNA 3GPLA 1Z45A 3I9KA 4IXMA 1KA9H 3L0CA 3GYBA 2YWEA 4JDPA 4P6VF 1GGFA 5F64A 5DHSA 1XRNA 5DRTA 6CHYA 2DERA 4MA0A 4TYMA 1ZN2A 3A9SA 1L9XA 3PPIA 3RSOA 5BURA 5JSZA 3I04M 1C7QA 4JBGA 1XTIA 3ROZA 3TUJC 5FTKA 3PFHA 4G25A 2PV7A 4D9GA 2QM7A 1B6RA 1LD3A 2ZSDA 2XZLA 4R41A 3RT9A 4LVNA 5CA1B 1OHHD 3L0DA 4IM7A 4TMXA 1J2JA 2FR8C 5CBKA 3I5AA 4LYAA 4TV9F 3KHUA 4XIYA 3ECAA 1RMTA 1M2GA 5KJ6A 2ECPA 1JEQB 2EYQA 1X80A 4YUZA 3G5TA 4YDRA 2JCGA 3WICA 2WU4A 3TIFA 3TZEA 3ZWCA 2AL7A 1U3WA 2KW5A 3ITEA 4CI9A 4PTLA 3IL2A 2J4CA 1G3UA 4ZDIA 1BXGB 3I72A 1DLJA 4CKWA 3WLKX 1PNOA 1XSEA 2G9VA 2E6UX 4WVLA 4ZOQI 1ULUA 4QLAA 2BHTA 1PBNA 3H3FA 4WJLA 1ZUD1 1UJNA 1FFXA 3G5MA 1FFGA 1PW7A 1T4MA 4I50B 4MKIA 5F7JA 1GPJA 5LWHA 4NC9A 4P08A 5B58C 4TRJA 5L3SB 4BRUA 3DFUA 2QUBA 2HEGA 4WEOA 1O6FA 3KL4A 5F3DA 3TQOA 3BL5A 5CHEA 2JJMA 2YS6A 3T0GA 4DDHA 1E2DA 4NEGA 2ZDQA 4ND8A 3GH1A 1ZH8A 1AK9A 2DBRA 4GLOA 2C2GA 1QOZA 2R85A 1XALA 4YMVA 2AJDA 4CM9A 1LNSA 1YQXA 2BUBA 4TTJA 3VU1A 1GV0A 3AKDA 5DKFA 3OQNA 3SLGA 4X94A 3PUKA 3C6KA 3T1NA 4EHKA 4B6RA 1DBIA 1GJRA 5EWLA 3D4NA 1UF9A 1VRCA 3GJ0A 4I5EA 4PG5A 2XVYA 1USUA 2NU9A 4ISBA 4H31A 3L2OB 4BRZA 4F4CA 1ORRA 1YZFA 2GXSA 1W35A 4MUNA 2XZOA 1G8JA 2H4ZA 3BWMA 4CMJA 1ML3A 1MX3A 4CL8A 3FOFC 3HCNA 3SHQA 2WTMA 5DLYA 2XGOA 1LF0A 3K5IA 5EE1A 1THTA 1GGKA 2B94A 4ARUA 1SA0B 3QNWA 4OH7A 5DE3A 1I5OA 3RNLA 4OSPA 3BBPA 3B8EA 1NX9A 1OFGA 4NS4A 4X6XA 1JPJA 1TVKB 3GGCA 3O93A 3HCDA 1SEPA 1MT0A 4HWOA 3R40A 2V9ZA 3ULKA 1PZGA 3ZWQA 1VJ0A 4P54A 3C5WP 5I51A 1PFKA 2W00A 3VJMA 4BO9A 2C4UA 3PTAA 3ZCXA 4LMAA 1YJCA 2ZJZA 3KTOA 3ND9A 2CMKA 1NN1A 4EFMA 3L0OA 1KMNA 2PRIA 1C9DB 4DQXA 2V98A 2VFAA 2WJZB 4NFHA 4DA6A 1W6RA 3P94A 3R9XA 3THYB 2I1VB 4KR3A 1SZCA 5DGDA 3V4VB 1XP5A 2G4LA 1RAGA 3HCAA 3QPVA 6YASA 3RJ5A 3BGIA 3GLGB 1B3BA 3ENZA 3KOMA 2W48A 2NV0A 1ZUNB 2IBMA 3CPSA 5B3LA 1JVNA 4IOLA 1W4ZA 1KI8A 5BV8A 1IEQA 5BMVA 1RFGE 1QR6A 3IE2A 1AZLA 3EGXB 1BQEA 2PGOA 3PYMA 2QX8A 4WBNF 4Z51A 2WWFA 2GPAA 2XEXA 4L85A 1VIAA 5EZYB 4ZYVA 2I1WA 3OZSA 4HY3A 2ZIGA 3N86A 1L4LA 4QQKA 5I3ZA 3DW3X 2R2GA 1ODKA 3WHPA 2PBLA 1DLIA 1LK5A 3U7EB 3IVAA 2DY0A 3DOUA 3HDQA 3W2EA 4ZO7A 3FUWA 3ROEA 1HYBA 4DLYA 1LX7A 3EXAA 2I99A 4D25A 3E3AA 2DPLA 5A3JA 1SBHA 2NVUA 2AMYA 4M8KA 1DIAA 3EEIA 1AKVA 2LIPA 5FUMA 3QI7A 1S2LA 1KVUA 4RSRA 4GGPA 4UUBA 1FYDA 1SUIA 1UKVY 1Q7BA 1W5BA 3CUSA 3M0EA 2ZE6A 1F60A 1XO1A 2YWCA 3U09A 4BVEA 3DLBA 5DN9A 2HFJA 2QYTA 2JGMA 3WX0A 4U02A 1JTEA 4W63A 3SJAA 2FDCA 4HWPA 3U7FB 5FL3A 1Z0FA 2HH9A 1OAAA 1E1DA 4A1FA 3QOFA 1NNEA 1UM9B 1A4IA 1T0HB 3OZUA 3OEWA 4A1OA 5LMUB 1P7CA 2QMZA 1QGDA 3A70A 3EF0A 1PWZA 2OB2A 4AO7A 2P5UA 1V16B 5HIIA 3U1BA 5LM3A 3HBFA 1PR0A 4BLRA 1F5SA 4JJIA 2F3TA 3SYTA 1Q50A 4CEIA 4A8JB 4CN9A 4L6AA 3HJBA 3I12A 4MQEB 1SG6A 2D5BA 1L4UA 3AYXB 4QYIB 4GIBA 3SE7A 3TINA 1WXQA 3AEUA 3MTJA 1MENA 5B2EA 2YASA 3GZNB 5CVVA 4DMMA 4KVZA 1M8JA 2XYRA 4ITUA 2WA1A 3HO1A 3BMOA 3HEAA 3LVFO 3N2ZB 4MS4B 1U9YA 1JE0A 4CGZA 1TZMA 1OFHA 4L3WA 4UD6A 3L0PA 1BA2A 5AW1A 4S1TA 1QZZA 3RVJA 2VVTA 2E5LB 1M6EX 1O4VA 4KWEA 3S2EA 3ZBQA 4R2JA 3LKBA 5B4UA 1EDOA 4JEMA 1IXYA 2QN3A 1EU1A 4L78A 4ESHA 3U3RA 2CVFA 3WBFA 1NONA 4QLOA 1Z18A 3EBLA 7AT1A 1F0NA 2V4MA 3W6PA 5FLXA 4TZKA 1PJRA 2G1PA 1VLJA 2ZAMA 1ZG3A 3QXGA 3QX3A 4M9RA 4C07A 3GCDA 2P3SA 3AF5A 1L5VA 2R5WA 2X4GA 3DNMA 3FI0A 3GCGA 1MFZA 2FLVA 2WJHA 3JQPA 4YT8A 1GFWA 4AY6A 2O59A 3KZNA 3OEHA 3GJZA 4FEEA 4KYUA 4UNSA 2PYZA 2VEOA 4J7CA 1DARA 5EGNA 1YZUA 3K2IA 4GRIA 4I5DA 1HLDA 1WR8A 4FFDA 2IUTA 3RSZA 2ZWPA 5CVTA 1LA2A 1Q19A 2WKPA 4RZXA 4ZMSA 1LBSA 4G5GA 1XJCA 3OY7A 4N40A 5IBQA 4CM5A 3ASYA 2PMDA 3D7MA 3E22B 3PYXA 1UKYA 4N5DA 5F4BA 5HIJA 4B3IA 4CF5A 4BNVA 2OO3A 4CV2A 1H0KA 3EHEA 3CNQS 1QDEA 2PIDA 2AW5A 4EM6A 1PZFA 4E5NA 1ZRNA 2DT8A 4HBGA 4EQZA 3IB6A 4W99A 2IF2A 1T8UA 3NQ41 3GFFA 4KO2S 3THSA 4J3NA 1R00A 5K0ZA 3LLVA 2RJNA 3HSKA 2YHIB 4Q1DA 1SXHA 3A1VA 2PD4A 1NMQA 1AUOA 1J9ZA 1LTKA 3C6ZA 1O08A 3Q2IA 3RG8A 1UMKA 2JCBA 2OV3A 1DCKA 1GKYA 3HCOA 4KMSA 4C4ZA 5C8YB 3G9XA 1YZNA 3I0MA 2ZYTX 1QPBA 3G0IA 1KI2A 3EQ2A 4RJJA 2CEKA 2AOTB 4I1PA 2WWXA 4HS9A 4KNYA 5JY1A 1QAOA 2PMKA 4OI2A 5HFNA 3FUTA 4L76A 2QTVA 4UU0A 2O0JA 2FR0A 1IG3A 3L5OA 3QBEA 4JC8A 2REBA 4BNYA 5IZCA 3NS7A 4F06A 2E2WA 2QRJA 2FW0A 4RW0A 5TF4A 2C96A 3MCZA 1YRYE 1ZHOA 1D9ZA 2J9XB 1QQTA 4QNMA 1T5IA 1RYNA 5DGCA 4ND3A 5BSHA 1M6NA 2A3NA 1DIGA 4NBRA 1YS9A 2WPDD 4NG4A 5CTJA 4PC3A 5J5AA 1F8YA 1GVHA 1A76A 2B21A 3C3KA 4E5DA 3H5TA 3OMLA 1VCMA 1N2JA 1HK7A 1VXOA 4U3JA 5LB4A 3X2EA 5JAOA 3QBTA 4TMFA 4BNTA 1P6UA 1LPOA 3D7LA 4R8KA 3D3WB 3IE1A 4PXYA 2FW9A 1CULC 2ADOA 5DBEX 4ZVKA 1GL3A 1OBFO 4KMMA 1JGTA 2PCLA 1M74A 3C4QA 3ED1A 4JA2A 4CNBA 3C2QA 1CX9B 2V65A 3PKZA 2CT8A 3A3OA 3AKEA 3VDRA 2JI4A 5GTDA 4LHZA 3DVAB 4FW9A 4BNLA 3GEBA 5IANA 4PZAA 4D6XA 4L4ZA 4YQZA 1GAEO 4ARCA 3TKAA 1KWKA 4G86A 3DJFA 3QVUA 3RNOA 2WDPA 3U13A 1NE2A 1YVDA 1XMXA 2EQBA 1UPTA 2BJVA 2H8KA 3DEKA 4HJXA 3DKVA 4KXQA 7REQA 2ZUEA 2XRFA 2NW6A 1QOQB 5G40A 1ECCA 1QWSA 3GH3A 1SB9A 2W6ZA 1JDUA 2DUMA 4NTZA 4RVOA 3LJKA 2XT6A 5FP0A 2ANCA 3Q6MA 4JCCA 3PA8A 4GKBA 5TMBA 1RXUA 5EE3A 1XVVA 3C3DA 3CVJA 5T6MA 4M60A 3ZGYA 4J03A 3DT8A 5KINB 3V3TA 3AO0B 2HW8A 1QE3A 3P7MA 4D4IA 3UUFA 1ZC4A 2JFPA 4L6CA 2RH5A 4G6ZA 3IQFA 4P3YA 4U2BA 3H7IA 5EG5A 5L4NA 1SXQA 2AK2A 2GCOA 2PGIA 3DMHA 5KSYA 5ELXA 2RGNA 4PCVA 4MV5A 5FNVB 1Z3CA 1R0BA 4Q0MA 1Z5UA 2P68A 3LQRA 5JJ5A 1UBTS 4TXHA 3L1HA 3KJXA 4R05A 4ZVUA 3WKBA 1QYCA 2OTCA 2XNKA 5H7XA 4OH1A 3WHIA 3VKGA 3HDHA 4OHXA 3VNAA 1VSUA 1JFVA 3HE3A 5C5EA 1U3UA 4O1IA 2RBKA 5HRAA 4V2IA 2C9CA 2OCDA 3OTWA 3PVSA 3QENA 3Q7IA 2Q4OA 2GM9A 2QBYB 3ZWAA 4Q7QA 3H2GA 4C2TA 3V2IA 1KZ9A 2CYBA 3RK4A 3ADBA 3AP2A 3EASA 1XZ8A 2HXSA 1UM8A 3PNPA 1PNRA 1P1JA 4NMMA 3JWJA 5I5EA 2PL1A 2CMDA 2ZSEA 4I4TB 1XLUA 2R48A 4NHEA 3DP7A 5AVWA 1GLGA 3ZYCA 4FMBB 4S1NA 1GHTA 3AW8A 1OLXA 4ZQFA 3DMTC 1VLVA 1Z7YA 1DAGA 3B7PA 1M2VA 3OZTA 1IWOA 4F3CA 2XYPA 2Z5GA 5AVOA 5EIFA 2DFPA 1N4AA 3IOMA 3CR8A 2EKQA 3H16A 1US8A 4WE3A 5EUBA 1G4UR 2CLIB 2W8BA 5LB2A 4S1VA 1CQPA 1VE5A 2O23A 2JFVA 1N92A 4WV3A 4HDSA 3V2GA 1T5DX 2OP0A 2C58A 2EW8A 4WGGA 4GX0A 4QU0A 1P33A 4F2GA 1GQFA 1P4HA 2OUKA 3P96A 1ADYA 4GW3A 3SZUA 2JK0A 3LP8A 4JYCA 4NYIR 4RQB