3P45A

Crystal structure of apo-caspase-6 at physiological ph
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
133
structure length
133
Chain Sequence
FDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of active and inhibitor-bound human Casp6
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords caspase-6
total genus 48
structure length 133
sequence length 133
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2010-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3p45A00
5IABA 5IAJA 2C2KA 2CNKA 4JR1A 1QDUA 2HBQA 5IAGA 2WDPA 4QU9A 1QX3A 4N6GA 2H51A 4IEFB 3UO8B 4FXOA 2CNOA 3DEKA 3PD1A 1SHJA 5H0IA 5IARA 4D3ZA 2QL7A 4IYRA 3DEIA 2H5IA 1RHQA 1NMEA 1RWMA 2J33A 3NKFA 1GQFA 3GJSA 3GJRA 5IC6A 2K7ZA 3H0EA 3IBFA 3P45A 5IANA 4HQ0A 4PRZA 4EHFA 3V3KA 2CJXA 3DEJA 4EHKA 4EHHA 5I9BA 2J32A 1JXQA 2Y1LA 4M9RA 2HBZA 4AWAA 4EHLA 4QUAA 1RHKA 5IASA 4JJEA 3KJFA 4NOJA 1RWXA 3NR2A 2H48A 1I3OA 2XZDA 5LUAA 4N7MA 4PRYA 1RWNA 1SHLA 3PCXA 4ZVPA 4AW9A 1I4EB 5I9TA 1GFWA 4ZVRA 4PS1A 1ICEA 4FEAA 4QUEA 5LU9A 3RJMA 1CP3A 2XYPA 1F9EA 1PAUA 4JQZA 5JFTA 1RHRA 2QLJA 3V6MA 1K88A 4NBLA 1I4OA 3H11A 1RHMA 3D6FA 3H1PA 3IBCA 4LSZA 2H4YA 5LUBA 2NN3C 4HQRA 4FDLA 4PS0A 5IBRA 2QL5A 4ZVTA 3P4UA 2HBYA 4QUIA 4N6NA 2C1EA 4FGUA 2QLFA 1NMQA 4N5DA 5IBCA 1RWOA 2HBRA 3SIPA 4ZVUA 3V55A 1PYOA 4D3XA 4NOLA 4QU0A 3ITNA 5LU8A 3R6GA 1RE1A 2CNLA 2FP3A 4JR0A 1IBCA 2H54A 5IAKA 3R5KA 4JB8A 1NW9B 3V6LA 4DCJA 3S8EA 3R5JA 4N7JA 4ZVQA 4EJFA 2J30A 4NBKA 3UOAB 3KJNA 4EHDA 2FUNB 4HVAA 3R7NA 5IC4A 3QNWA 4AWBA 2CNNA 2P2CA 2C2OA 4QUGA 2C2ZA 1K86A 1RWPA 4JQYA 4NOMA 4DCOA 4I1RA 1RWWA 3DEHA 3R7BA 1SC4A 2XZTA 4ZVSA 3NS7A 4QTXA 1RWKA 2J31A 3H13A 3GJQA 4JJ8A 4N6OA 4D3YA 4EHNA 2H65A 5IAEA 1RHUA 1RHJA 2CJYA 2C2MA 4QUJA 3R7SA 4QULA 1SC3A 4I1PA 3OD5A 3EDQA 4QU8A 2QLBA 5K20A 3BIJA 4JR2A 3PD0A 4QTYA 1QTNA 2DKOA 1RWVA 3GJTA 2AR9A 4QU5A 3S70A 1CVRA 4NOKA 4QUDA 1M72A 3R6LA 1SC1A 1BMQA 3SIRA 4QUHA 5IBPA 2H5JA 4ZVOA 3H11B 4DCPA 1I51A 2XYHA 4NBNA 4QUBA 2H4WA 3E4CA 2XYGA 1F1JA 3D6HA 3D6MA 4JJ7A 2FQQA 2QL9A 3KJQA 3EDRA 2CDRA 2Y0BA 1NMSA 3K7EA 4EHAA 3V4LA 3V4OA 1KMCA
chains in the Genus database with same CATH superfamily
2A9RA 5CA0B 1P44A 1H2WA 1RCUA 2DGDA 3IJRA 3S28A 2ZSDA 2O5CA 1JEAA 3AWIA 4Q39A 3TVYA 1B6TA 4XWOA 2E3JA 4RK1A 4D3DA 1P80A 4C1BA 1CF2O 4MWSA 1WOMA 2NYUA 3U3KA 5KTYA 3F9IA 4MJ7A 2LIVA 3G49A 5FUMA 4D6PA 1GUYA 2XE4A 5DFAA 3AJEA 5J9FA 4DXAA 1H9CA 2ID8A 4W1PA 4JBWA 1QPGA 3GLRA 4IFIA 4EG8A 3DUWA 2CVZA 3EGOA 3S81A 1AS2A 2XNKA 4RMJA 4BMVA 3A9CA 4GRDA 4WKPA 1PJSA 1WDTA 2R97A 5LCXA 4D46A 2DTXA 4MK4A 2Y68A 1MENA 1V3UA 1FJGB 1R37A 1Z33A 4XGNA 4ZJPA 4HUQB 1XTPA 4NYIR 3W5BA 1M2VB 2X0JA 2ZRGA 5JROA 3W6ZA 1IQUA 3M4ZA 2Q49A 4DWJA 3NGMA 4OXYA 1K4KA 3DLPX 3T5MA 1Z0UA 5ALNA 5AFSA 4HN9A 2YOFA 4IIXA 2FFRA 4H7PA 3GQBA 4Q7LA 1JMKC 4NDNE 3TM5A 4QPPA 1M2EA 4E5SA 1F2UB 4HAXA 2Q9UA 5FL7D 3NHUA 1FNMA 2AIRA 4BEBA 3OY2A 4DQUA 5L3SA 4TYYA 1VRVA 4X66B 1J0XO 3RC3A 2HRCA 2ZULA 3ENVA 4R2IA 4B8ZA 3PLRA 4H3VA 5A4KA 5KJ1A 4L8VA 3HY3A 3SBDA 2WILA 2YCBA 4FGJA 2JFZA 2FZVA 4K9PA 4KYVA 1KDRA 5DHAA 3F6SA 4EMUA 3ETLA 1V9LA 4NMWA 5CGQB 2R62A 5DYWA 4PPFA 5KTKA 4U9IS 4UUMA 4YMIA 3FCOA 2FWJA 3PFKA 5FOVA 3U40A 1A77A 4LQCA 1QHYA 3OIWA 4YAIA 4YRAA 4K9MA 3X1ZA 1GTSA 3SQWA 3Q7PA 1F3LA 2IDJA 2QTHA 3GFQA 3PJDA 3PFNA 3G2HA 4ZXPA 2BEWA 2R1TA 2LE0A 2R7AA 3AHIA 1P5ZB 4IF6A 4S04A 4O4JA 4Q5IA 4FHCA 4Q37A 4ZT5A 3WYAA 1E1RD 3QX7A 1QAQA 1Z4LA 1CZOA 2X0IA 1E98A 3BA1A 1SVKA 4PZEA 4RPCA 4NXNB 4QT0A 4K03A 4OSPA 3ZJUA 4UZFA 2PKQP 3S6JA 4RHXA 1T8PA 5EWLA 1OA0A 1Z45A 4DYDA 3L2OB 3VVLA 2C97A 2RJ3A 2XAAA 1HFWA 5T4FA 4EUSA 3C6XA 4IOLA 1DJLA 4PWYA 4J7UA 2HJWA 4BP9A 2PU5A 2OVBA 5K51A 4WA7A 2DQZA 2W48A 5FXMA 5EIBC 2YJ4A 4IJVA 3SSAA 4DA6A 1JLRA 3SICE 4RVHA 4TROA 4G8BA 4CIDA 3HJRA 2GSDA 4AN4A 4UTRA 1Z6AA 3OJWA 2IU0A 3QEBZ 3NUQA 4TZ0A 2ZRAA 3KJQA 4QASA 3CZPA 2NM0A 2OG2A 4IIJB 1U0NA 1U5BB 3R76A 3NGLA 1TLLA 3WJ2A 3BICA 3VC3A 1FTGA 2CNKA 1ISFA 3GGOA 3LDFA 3VR5H 4RVOA 1U3GA 5B2FA 2ZI4A 5HFJA 4LYJA 4RK4A 5CHYA 2Q41A 3HP4A 2WAOA 1KE2A 3QV2A 5EXTA 4ARZB 2RGCA 1OT3A 2FPMA 1KFBB 1RP7A 1BX3A 3O7MA 2PEYA 1MG5A 4ZQHA 3FGOA 3P9KA 2BGKA 4IOJA 5DHSA 5KTMA 2ZAOA 3OJ0A 4YXFA 1IB6A 4OM8A 3RAFC 1PVOA 4Y7CA 2JJ2D 2JGMA 3IR6A 4XCXA 2D00A 1JILA 2HHJA 2JVKA 4F2GA 1KEPA 3JARB 3I2HA 1W96A 4RJTA 2B7CA 3QPCA 3HK2A 1DAEA 1RYEA 2W9XA 4OCZA 4EY8A 4RTJA 4OJNA 1JFRA 2B1RA 2G4VA 5K8TA 4JYBA 4M8LA 4MS4A 2BPOA 4MP3A 3WGLA 1DIAA 3KEOA 1XX6A 3JW8A 4IIFA 5REQB 5IN4A 1Z0ZA 3PT5A 5DULA 2MMCA 2JLYA 3ESRA 2IH4A 5AW6A 2JGAA 4KQJA 1CZLA 4KV7A 4Q66C 4G26A 4TT8A 5ALFA 3RS7A 4Z7OB 4YAFA 3BOSA 4EG1A 1MABA 1TK3A 2JRCA 3U7RA 4B3IA 2H7CA 3MWLA 3L1KA 5KKNB 3H11A 1DAIA 4EFMA 4QOFA 3P52A 1KI6B 3WJ1A 1K6XA 1RJWA 3DE5X 4MLPA 3ZIUA 4FBLA 4DCNA 3HU2A 4F3KA 3I72A 3AGQA 4I0WB 2YJNA 3JZMA 4ES6A 3VOBA 5AI9A 4AWXA 4MEBA 2BSQA 4KZKA 1CETA 3CLSD 1VL8A 3GVHA 3OIFA 1QVRA 3AKEA 1FSPA 1C8LA 1MXHA 2QTCA 5ALTA 4MCJA 1PS9A 5E8JA 4AX4A 4E5YA 1NW5A 1L4EA 3B78A 2PNFA 3CHYA 2QVXX 3C16C 1UC5B 2ERXA 1BMTA 3BK1A 3QI7A 3S8EA 3AERB 3C7CB 1K7XB 4A92A 4JHLA 3RSLA 1F6WA 4U7JA 5ILOA 5JISA 5EZYA 1HWYA 3HYTA 4MMYB 4UAJA 4A7PA 1JPUA 2JFGA 3R4VA 3DMNA 5IFKA 4BV9A 2PUEA 3WB0A 5KX5F 1J20A 3A3PA 3CO0S 1BHJA 2V3CC 3AF5A 3BWEA 3RBVA 1AX9A 2J6IA 3HBAA 4UVIA 1M34A 2VF8A 5KQSA 1SQGA 2FPKA 5MDHA 4OLBA 3E84A 4AY3A 5C5IA 4L73A 2P4EA 2RHOA 5L4LA 4WXEA 3ZZNA 3LGXA 5DHRA 3E03A 2XRMA 2PQ0A 2E87A 1RXYA 1Z0IA 1N2XA 4RZHA 2H2AA 5EFOA 3KKKA 5JZOA 2VSQA 4WPGA 5K3BA 4ARCA 1ESMA 5DWDA 2YVAA 3VR0A 1H8EA 3UT5A 1EUDB 4JBYA 1RPNA 3IS3A 3H9JA 5HIIA 2Q5JA 3FYCA 3HVUA 4MR8A 4PGAA 3OG9A 4YIHA 1VG0B 4RK5A 2IHVA 5DHTA 4MI9A 3JS5A 2DSTA 1EFTA 3HVHA 4GUDA 4L4RA 2P27A 1KZGB 1NUPA 2HK9A 4LV8B 3SEAA 3ZHUA 2X7XA 3EDCA 5BQOA 5JQGB 3CNQS 1DJOA 1FFWA 1TZJA 3TBHA 4DLWA 2HBQA 3KUKA 3LUGA 5F1YA 2CE2X 4LVCA 3A2MA 2IH5A 4H1HA 2GEUA 3IUYA 1V8OA 1YASA 2YX1A 4I4CA 4F4IA 3C3JA 3I01M 2I22A 5FCDA 2WFLB 3K0AB 3DEIA 5LQAA 2QRVB 3HCWA 3LRPA 4D4GA 3A6KA 4NBSA 1MQAA 3BJEA 1UH5A 1F20A 3ELUA 4H7FA 5C53B 3R3ZA 2H1LA 4J8PA 1Q0PA 4W5TA 1XZPA 2PH5A 2PJDA 4G8CA 1YI0A 4U6NA 3ROZA 2PO5A 4FD2A 2WWFA 1ZGCA 1G4AE 4JEUA 5F12A 1ZBDA 1YD7A 2XQFA 1J5PA 4UU0A 1Q6ZA 1BXRB 3FYUB 3QU2A 4RH3A 2MINA 3UMFA 1CBUA 2GK6A 2W8BA 3L7MA 2XEDA 4MSUA 1EWTA 4EKEA 5BN5B 4HSEA 1Y34E 5B1YA 2H2GA 1XDUA 3OTWA 4URYR 1N6KA 3UZUA 4LTDA 3H4MA 4QOSA 3RASA 4X9XA 1FX1A 3WKDA 2P9JA 5L8VA 3SJUA 3H1FA 3UT0A 5AUOB 4KWTA 2DKNA 2DUMA 5CCEA 3SN6A 3HXOA 1TQ6A 3ANNA 3D0QA 1C9YA 1Z5ZA 2C8JA 3IMCA 1R5BA 3MT7A 3B3GA 3BYZA 2ATXA 4JKIA 1K88A 2CCGA 2AF4C 3BE5A 3FPBA 2J85A 2XYQA 4NRDA 1M6HA 2LIPA 1HOTA 4LC0A 5CJ2A 5JPIA 3U37A 4M1EA 3QM1A 4ETNA 5I45A 5EHQA 4NBUA 2K4MA 2GPBA 1LBEA 3L8GA 5B5SA 3LAWA 2HJ9A 3L6OO 4H6VA 1O97C 4LDPA 4QBIA 1WDLA 1X9HA 1WXHA 2IVZA 4R7TA 4PSKA 2CL6X 2V6IA 3LSTA 1L1RA 3NTLA 3DNPA 3QE2A 4QPCA 4U2BA 1XAJA 4CVNA 4NK4A 3X43A 1U3WA 821PA 2QYHA 3IAAA 5A4AA 3HP7A 3K5IA 4MWEA 4FNAA 4QDZA 4IJUA 1F4LA 4XASA 5A4JA 2VCYA 3HGQA 1SD1A 2XXJA 4XJTA 3V2HA 3WLSA 1KYXA 1KMQA 5JBQA 4ZVQA 2BM1A 4KIWA 3MILA 4PG4A 2X8AA 4M55A 3P94A 4NEQA 3G1UA 1OA1A 4EYSA 1J07A 2V65A 3AOGA 3B6MA 1FU7A 2NO1A 3NRBA 3PGA1 4X0EA 2FEKA 1MRZA 4L15A 1A4RA 3KFXA 5KOHB 1XK7A 1WHTB 1X86B 3PC3A 3WGGA 2UXBB 4Q9KA 4L5AA 2X6RA 3BB4A 4QELA 3OZ7A 1E7WA 2CLKB 1ZGJA 2DC1A 2NYVA 2VYND 3QEMA 5ER9A 3SKXA 4K9OA 1E2IA 1NNSA 4ZGBA 2ODTX 2VZ8A 3M82A 2WIBA 1E4EA 3K32A 5TJ9A 1VP9A 2CD9A 3LDGA 1C3LA 1V0JA 1W85A 5BURA 4GSLA 3RYTC 4HZUA 1R8YA 1UDCA 3MUEA 1JSXA 1XU4A 1XZQA 2OQVA 1IHPA 1QTNA 2CFRA 1L1QA 4WOBA 5TSDA 1BTOA 4QSMA 1M1NA 4B0PA 1OLOA 4C08A 5B3LA 4OBXA 4JJFA 3KG2A 4PCLA 1T15A 3S29A 3SP1A 2QNRA 4FFNA 2XUJA 1K8YB 1UPCA 2WM3A 3GGCA 3HN7A 1C30B 3TR6A 3E4CA 1THGA 5KCZA 1D2CA 1RYFA 3GLKA 2IKQA 3ILHA 3QLVA 1ZJYA 2CXOA 4COOA 3NTVA 3WZMA 3LY5A 1M1NB 2HXYA 1ZR2A 3IB6A 2BKLA 4W99A 3KDAA 4MQEA 3C0KA 4AZ3B 3MWDA 5DKFA 3A6GA 1S7CA 3L7OA 1P4JA 1SCKA 5IH7A 2L19A 4REOA 4J1TA 1HDEA 5D84A 3VH2A 5CCXA 4GS5A 4BLRA 1J7JA 3W7VA 1Q74A 3ODGA 4E5UA 4AY6A 2Q50A 3A9TA 2WIJA 1CJSA 3TNDA 3ER9A 5JALA 2PFKA 2QT9A 1NONA 2I4TA 8MHTA 1AT1A 1F2TB 1WHSB 2OYSA 1P5JA 1ZNWA 2I1QA 2YXBA 5EXDA 4IQ0A 5DM70 4GOLD 1JG3A 1EVLA 3DVSX 3PNKA 3QA9A 3W3AH 2DFVA 1XQ9A 4HN2A 4KQKA 4OATA 2Y76A 1Y9DA 2FEMA 2QUAA 3C1AA 3LK7A 1QH8B 4JC4A 4MPTA 1L7NA 1PJTA 1N2JA 3NEAA 2UZIR 5JJKA 3IO3A 4BFUA 4P38A 3V80A 3AVWA 2ZAMA 1G2OA 4BJHB 1H94A 3F7NA 3GRVA 1IK4A 5E0KB 1B93A 1E1QA 5KVSA 4CEIB 5JJIA 1EP9A 4KB5A 2I6QA 4LK2A 3PPYA 3UJ8A 3CEJA 4JXJA 5GONF 1R4AA 3WK4A 3FE2A 3P9QA 4CR6A 4N76A 5EUCA 2I8LA 1TL7C 2JFHA 1RHRA 3IAEA 3Q41A 3U7IA 1TRHA 2BFCB 1P77A 3GL9A 3O91A 4NKRA 3REOA 2JIPA 2P2GA 2I2BA 5LUBA 3VSDA 1K5HA 1WDKA 1ZP6A 4QODA 1NXWA 4TLAA 1KDVA 1I1QB 5HP4A 1GPYA 1LC0A 2EZ8A 1NMQA 4CLRB 2CC2A 3P7MA 1DO8A 4FB5A 4NZPA 1TYDE 5FV7A 5U4XA 3U2QA 2WJZB 4NFLA 2A35A 3WGMA 1NBMA 4UTPA 3OPXA 4I50B 4BRUA 2EW8A 4MHSA 2ZI5A 4UUQA 1P31A 2ZUEA 4F5DA 3VDNB 3WK9A 1E9DA 1MQ9A 3LY9A 3HL4A 3IKTA 3DT6A 3TRHA 3R3JA 4MJ3A 1P1JA 4OB8A 1BDBA 4ITUA 4BNYA 4FEYA 1F12A 3AJRA 2Y67A 4RVCA 1O7JA 1DWPA 2JVJA 4J9UE 4Q7KA 1GVNB 2CXSA 2QUBA 4B46A 1LQUA 1RQLA 3AUUA 4QUGA 3LWDA 3UH1A 2WHYA 3FWZA 4URFA 3THOA 1BFKA 3CKKA 2P2YA 2BE7A 5DW3A 1OSNA 4CKBB 1ZD8A 2CEKA 2PSHA 3AY7A 5KS2A 1PJZA 5C46F 3WA7A 3WO0A 3FPLA 1GTRA 4RXMA 4JDPA 3NVMB 1U3TA 2LKCA 1PTJA 1UAAA 4YMWA 1OTHA 3EMKA 1QB7A 4IZOA 4EWLA 4RL4A 1QP0A 2G5GX 1MNAA 1Y3DE 3DPUA 4KNVA 1QP4A 4IDCA 2D4AA 5KYNA 4PLHA 3PGKA 3S70A 1H3EA 3GRZA 3A11A 1OLUA 1GNPA 1UKVY 4S2EA 3KR0A 1NSFA 2R6R1 5LA6B 3IP8A 1VJDA 1X7GA 1QUFA 3RF7A 1RQPA 2XYHA 2AW3A 3CX3A 2ODEA 2ZRFA 3AG6A 2J4FA 4ME6A 3SSNA 4Z4IA 1IVNA 1HUQA 3DEAA 3EGWA 1I7PA 5F1OA 3UT5B 2EJUA 4NHOA 4Q9IA 2AZXA 1P4RA 2FRDC 2PCJA 2A1UB 1CQIA 2IYUA 3PTZA 5FBQB 4Q05A 4TXNA 3BMNB 2OCIA 5J2TA 1VQ1A 4CBVA 3DBRB 4D25A 2VEOA 4M3NA 2XUQA 3U16A 2I33A 2VDJA 1U81A 4LRQA 4TUYA 4NMLA 1U1IA 5JS7A 4NONA 3ZWMA 3CZCA 4ZC1A 2OO5C 2VHVA 3RREA 3QENA 3E8MA 3T9CA 1E92A 1H2YA 1UJ4A 4GPEA 1B0ZA 5FKJA 3H7IA 5TMEA 3RRBA 4D81A 2NU8A 1KNQA 3FROA 2JJQA 1U0BB 1I24A 3KQMA 4ODIA 4AO7A 2YV3A 3WLIA 4F4CA 5IYZA 1TU3A 3AKYA 3ZGYA 4FX5A 5L95A 2B3TA 1F3OA 3NNSA 3UOWA 3GRKA 2H4HA 2NUPA 2WKPA 3O31A 2D5CA 3WKBA 4WOKA 3TJZA 4F2HA 2LR0A 3BXXA 3GUYA 4YJDA 4YV1A 5L7TA 4AZVA 3VYWA 2O0MA 1XZDA 2V9CA 3AETA 3MCUA 3VZRA 1R0SA 1GTL1 3LFHA 3CWQA 1R4MB 3O4IA 1ZVMA 3OPVA 4D6YA 1Y7HA 2PRYA 3NW9A 4Q4JB 2ABWA 1FTWA 5BMVF 1H2FA 4IUYA 1LFDB 1EFHA 4RNDB 5AHKA 5AR1A 5BWCA 5DNAA 5TQ2A 5I48A 2R8ZA 5JO9A 4UNRA 3GN1A 5E6UA 3AYXB 1S96A 1QG0A 5CFPA 4KDRA 1DUVG 1KEEB 2P4HX 1BA3A 4LHEA 4PX9A 4ON9A 3RE1A 3P0FA 4B43A 2PYZA 4J6FA 4EI8A 3P27A 4P33A 5IHXA 3TH5A 1BEZA 1YQTA 1GZ5A 4NWIA 4Y2TA 4DTIA 5A03A 1CJVC 5J58A 2GOYA 2H9IA 4F2WA 3DV9A 3PUKA 3LQQA 2J6HA 1SK8A 2IXDA 1U8EA 2WJ6A 3LOUA 2JJ2A 3A2KA 3NWOA 5AP9A 3CVOA 3UWOA 2PS9A 3OTQA 1IXYA 3NOVA 4YJHB 4JB8A 2B4TO 1OLSA 1WBJB 4LECA 1PR4A 2OT3B 2BW0A 4W82A 5FPYA 3VUEA 4FVTA 2OGSA 2W6ZA 2XX3A 3F6YA 4DDHA 1VGQA 3WK7A 1HYEA 1BOOA 2C4TA 1IHOA 3KIPA 4ER3A 1Q7TA 3TQTA 1FFHA 3GF4A 3C43A 5EE9A 3LT5A 1GADO 5I4KA 2GFHA 2HMUA 3DF7A 3WNDA 4MVJP 3RHZA 1E8DA 2JC3A 4US2R 5GOTA 3QBJA 3SU8A 3GFBA 3JQCA 4K3VA 5D3QA 4JU8A 4BKPA 1JHZA 1NRIA 1Q44A 1YB5A 2FR1A 3OJLA 2AG5A 3G8YA 4QGHA 2G77B 3G9QA 1D1TA 3OT4A 3ZWWA 4AUNA 3OQ1A 3OURA 4US0R 2AZ4A 5DU2A 3ASVA 3C1OA 3CTPA 3D8HA 4JJAA 4LXYA 2GGSA 1O9HA 5FWYB 1ZISA 2ERYA 1OIVA 2P91A 3VSCA 2BFBB 5IUNC 4GO1A 3GP8A 1VMDA 1W8IA 2VHWA 2CT8A 3G1TA 3QJYA 4XJSA 5KQMA 4KR2A 4D5GA 1KIAA 1LTHR 2BMJA 2BGRA 1GN8A 2H57A 3UF0A 5A0VA 4AICA 1TOAA 3R6LA 3ZV7A 4F3CA 2CJWA 2ST1A 2ZBGA 3FVTA 4M9CA 1JDBB 1UPTA 2GO7A 3TQOA 4WFJA 5JY6A 4NJMB 2QUHA 1M8FA 5AK0A 1U7PA 3ZZUA 4D9NA 2PWBA 2MR5A 4A1FA 4LXQA 4QGSA 2SHKA 3V1TC 4TMWA 2QL9A 2XB4A 5EQFA 4PGHA 4CNBA 2Y0BA 1VIDA 2NTYC 3K7EA 4P3OA 4QPNA 1C3VA 3B1XA 3R3YA 3DYBA 3QXXA 4V02A 5F7XA 2Z57A 4PXAA 5BN1A 3B8HA 4Y6PA 4C7OB 1R3UA 2GN2A 4PLGA 3KK0A 3TLKA 1H23A 4ABTA 1PDVA 1Z75A 1V5GA 3DYVA 3PX3A 2N1MA 2WK1A 5CM9C 3WWOA 2QJFA 3EEFA 1L2TA 4X7MA 2WYWA 1D2AA 1DFIA 4ALMA 1XTKA 3CVXA 1AV6A 2WAXA 4OU5A 5U4QA 5IANA 4BQEA 2QUJA 4C4PA 3BXHA 4YRCA 2ZZKA 3I92A 1OU0A 1RAAA 4DRXA 3NJRA 4Q4HB 1P7ZA 4DMLA 3LBFA 2C8VA 2Y1LA 1XNJA 3AV3A 4NYJQ 2GYYA 4URWR 3V7YA 5I9LA 5JH7F 3AFOA 3WLHA 1YHZA 4G4SP 4GRIA 4GKJB 2BJWA 3GLFA 4P6VF 4F5EA 5LL6P 3HO1A 3DFZA 4HXFB 1OFTA 1JJBA 1X7XB 2G63A 3FD8A 4O5AA 5FL7A 3CB2A 1UZUA 2PM8A 4U5XA 3I4LA 2OCAA 1CB0A 2RGEA 4RYDA 2HIHA 4MGHA 2DX7A 2RGYA 2RBGA 5EIOA 2PZ8A 1UOPA 4GP7A 2BZSA 4TXJA 1O0SA 3WI7A 3QF4B 3WK6A 1NN5A 3TEJA 1K4YA 2QJOA 4ARIA 4PSUA 1HPLA 1RI4A 3CLSC 2PUFA 1KZ4A 1NPYA 1O5IA 2B34A 4WZBA 3GUZA 2ZW9A 2QJTA 5HZMA 5JS8A 3T0GA 5EERA 1JEOA 3AZOA 3AUSA 3HEAA 5TR9A 2ZR8A 4ITVA 3KUXA 3ZYZA 4HNHA 4XVUA 1ZD3A 3N0RA 3THRA 3NXSA 2HT1A 4XVHA 1CY2A 4BZPA 3F47A 1IBCA 3FCUB 1DRKA 4NCBA 1X6VA 3ZNOA 3WRWA 3QUTA 4HN4B 5FP0A 3PX2A 3RS9A 3ZW9A 2VRCD 2IHTA 4XM2A 2GN8A 2W98A 4YROA 4YCSA 3E8XA 2PH7A 2V7BA 5IXJA 3W5AA 3ROTA 4MW0A 3AHDA 3VDMA 3URKA 4Y9TA 2QE6A 2ETVA 3JAKB 1QH9A 3MWEA 2IYXA 3NUZA 1EBBA 5LZ7A 3DE0X 2JI6A 3MCTA 2BKVA 4ACBA 4G0WA 4PAWA 4WESA 4DUGA 2ZWVA 1CS0B 4Z4QA 1Z38A 1MVOA 1YZLA 3PL1A 4YJGB 2Z5GA 1S01A 1BYUA 1TIBA 2GESA 5DYIA 4ZVVA 7MHTA 5C31A 1FS4A 3QBEA 3PDJA 4EA9A 1DV2A 1NHGA 1PTJC 3B2QA 5T41A 1X3LA 4K9RA 1SWWA 3OWOA 1V4VA 3M6UA 5JMPA 4CW7A 3KAQA 3V8RA 2E21A 4U39A 1XDBA 1VFPA 1DNPA 4MUGA 1KYYA 1OZ0A 5JCJA 3VC1A 2WP8J 1T1SA 4JI0B 4NIMA 3R74A 1R0WA 3UC5A 5BR4A 5F98A 5IJWA 1ZEMA 4A1OA 1RKVA 3FTCA 4R1SA 4EHAA 1NRWA 4KX5A 1H2AS 2I1WA 2OCPA 4RQBA 2C2KA 5EJEA 3NHMA 1V1JA 2JAHA 2ZWOA 5INTA 4CFSA 4KPEC 3IAXA 1G66A 3DDCA 1NLYA 2E0IA 1KU6A 3INTA 3CJTA 5DM2A 1B8OA 4ZEVA 3QVGB 4OHBA 3L4EA 2H1WA 4FGZA 4R41A 5ALDA 3SM3A 3PJFA 2OVFA 2C59A 3M5DA 2YHAA 4HFJA 4ZDWA 5B2ZA 3K71B 4DLXA 1JQJC 5JLAA 1QSGA 3DAHA 4KAXA 1FDRA 1N8TA 2Q1SA 1GUAA 4NF2A 5A62A 1EGQA 5EN4A 1G7CA 2WAMA 1T9HA 4EHJA 3K30A 1KY3A 3O2QB 3DV2A 1LLFA 4KQCA 1Z12A 2Q46A 1TAUA 5HF6A 2PUHA 4B5LA 5FUBA 1ST2A 2QAGA 4F3RA 4OHFA 2XCRB 2IX9A 3EUWA 4M1TA 1YBVA 2P5TB 2P2ZA 4IRXA 3ZE7A 2L17A 4TKMA 1RLIA 1FLDA 2V45A 5ARCA 1JU4A 1V5EA 1QOZA 1JFSA 1XVIA 2VOEA 2X8LA 1T0PA 3V8VA 5U1PA 1ADYA 3LQ2A 1JSRA 2Z2KA 3LXUX 1Z28A 4EKNB 1Z5PA 5DISB 2OENG 2I54A 2IEBA 1SVNA 2J7PA 1IPFA 4W5NA 4X1YB 3NTRA 4F6LA 1PKEA 3W7AA 4EPTA 3OE7D 1W93A 2VZEA 1CEYA 3K0SA 3IA7A 1W0KD 4OUDA 1XRNA 4CUJA 3U4HA 1D2GA 2BFNA 4NK5A 2AXEA 2OB2A 3KU1A 1Y8RB 3A9SA 2C2HA 3DTVA 1E9VA 2B61A 4MX8A 4BO8A 2NAFA 5D6OA 4ENSA 3K53A 4YP6A 5T8KC 1Y82A 1UCFA 3CNNA 2WIDA 3QSGA 3E82A 2Z5VA 3AZQA 5EZYF 3RAGA 4KR6A 4KMRA 2CHUA 2C92A 3C3BA 2NXCA 5BPHA 5JXGA 2I55A 2ES4A 3HPRA 1WOYA 3FTNA 3LO8A 2Z6AA 4NICA 5K5EA 3C3EA 2VAXA 1AKUA 1D09A 4KOAA 4RZ2A 1MR3F 1JDPA 2FOXA 4HMOA 2MDTA 1C7ZA 4K87A 5CK5A 4UVGA 1P19A 1CPYA 3L93A 3DAPA 2Z8YA 4RV5A 2Z8ZA 3MJSA 4CV2A 5F77A 1H22A 3H13A 1AS3A 3OZUA 1KFKB 4B4UA 2UU9B 1X0XA 3AEKA 1NKTA 1A9SA 3DZFA 5BUQA 2JGFA 2GQ0A 3DXXA 1VLJA 1B8PA 1JIQA 1FW8A 2FN9A 1YI1A 2QM7A 4IP0A 4KUEA 5IJAA 3I6YA 3VZQA 4YRBA 3JD3A 3TZKA 4UULA 5KYXB 2B5OA 2C4UA 3OH8A 4IKPA 3RVDA 3T7JA 2C77A 2GM5A 4K9QA 5K2OA 3AI3A 1O6FA 1TC1A 1NVFA 3KQPA 5EKXA 5LJIA 4H9GA 5T3UA 3M4NA 5BV8A 4HH4A 1CUFA 1ZMOA 2RG7A 2FEOA 1NASA 2P9HA 1Y89A 3BMNA 3N2EA 3O21A 5J2TB 2FPWA 3PRHA 4FLEA 4OLAA 4FCTA 4DG8A 4KXQA 2ZSIA 4C1NA 2FPGA 2JIZD 3VKVA 4A82A 1HEUA 1PJQA 3A1TA 2GKOA 2PGNA 3G2JA 3LG2A 4K6GA 5EJFA 5FNVF 1X80B 1ZRNA 3GMTA 4G9BA 2JAOA 3GN2A 2RHDA 2R1UA 4QNRA 4Z1MA 1DBWA 2R5NA 4YR9A 1D6JA 5EXXA 4BFCA 1KSFX 3Q2IA 4IJ6A 1C9KA 1JA1A 2WOJA 1C5KA 3EXEB 1Z8FA 4AZ0B 4D4IA 3RVQA 5AW1A 2R7NA 3AUKA 5JAZA 5JYBA 3UPUA 1RZ3A 1QF6A 4ER6A 3IBFA 5DTRA 1LS6A 4V0OA 1T8WA 1L4MA 4WKOA 3EQ7A 2EARA 2R7LA 3JALA 1QQ5A 3O75A 4MW1A 2WJHA 1EZ4A 1ODJA 4TMYA 1BFDA 1XJCA 4EHHA 3TYXA 4PNEA 4DG9A 1P45A 3MRSA 1ZRHA 5CIYA 3CISA 2OORC 2SNIE 3LVRE 4G6ZA 2NG1A 3ETHA 2KBFA 4KUHA 4BEJA 3ESDA 5AVTA 5A02A 3HXQA 4OIMA 4ZGGA 4EP1A 1H8HA 3COWA 3C7TA 1FVXA 4H4EA 3NVKI 5TF4A 3D5TA 5ADVA 2H8KA 1I7SB 2O3UA 2BE9A 2EJWA 4P35A 2HIGA 2WSSD 1Z9BA 1LWNA 1I0LA 2WLTA 4F9GA 3KQVA 2D2IA 3GNQA 1HEIA 2ICAA 4JVOA 2BT4A 4CHTA 3I9KA 3NETA 1X7YB 4CR8A 5B3AA 3NEYA 3AFMA 5EHXA 1J8QA 2RAVA 4MWOA 1K8QA 4HNSA 1W36B 2QPLA 1KJYA 3DB2A 2GN6A 4MUYA 1G17A 5ALYA 1MX5A 1DCTA 1AN9A 1J2JA 2ZAYA 1Z2NX 2RG1A 3L7KA 4TLBA 1EM6A 2R11A 2E4VA 1JMYA 2B8NA 2A84A 2OXFA 3H9EO 1PRYA 1Z3CA 3TR5A 3ZHVA 4JEMA 4F11A 3BGWA 4F3YA 3HJFA 2XR1A 2R44A 4AJJA 4NY1A 2R6CA 3IP9A 4NDZA 3V3TA 1W36D 1TM2A 3SYMA 2YOHA 3C8HA 3FG9A 3L8MA 3RS0A 1G8KA 4XFDA 1FRFS 3G8BA 3U4IA 3RDPA 4I4TB 2QNIA 4UNIA 3SGLA 1CNMA 3AY3A 2HJVA 3CX7A 5DNEA 2QPOA 3C48A 4KWEA 4YAEA 5G3YA 4D9IA 3TRJA 5F64A 4YT5A 1FJHA 1B23P 2M6RA 4Y98A 4PO3X 1ZUWA 5ALQA 5CG1A 5LZ9A 3VU1A 4ZYWA 2I7VA 1JDZA 3ANMA 2XCTB 5HSGA 4B81A 2NGRA 2XZTA 2KSQA 4JUIA 4JBGA 1I0ZA 1XQXA 2P9ZA 4ZP1A 1P17A 1XEAA 3VKHA 4TYMA 3RU9A 3USZA 4Q16A 4MKXA 4YWJA 2C54A 2CJYA 5F7JA 1GUBA 1M5TA 4C06A 3QBVA 3UTDA 1G3QA 4CCYA 3MWGA 5AMXA 1F2TA 1RABA 1WHSA 5KOJB 1RZRA 3LTEA 2O3SA 3LKBA 3OZBA 2QNBA 1B43A 1RAFA 1SKYB 1W88A 3C3YA 3OZSA 3PPWA 3PVZA 1NJ1A 5JMWA 3CGGA 3OEYA 2PZFA 3UK6A 3C8MA 5J40A 4EAQA 4B7AA 1FTYA 1RVDA 5AJHA 5HYVA 1JQ5A 2VHTA 1JJVA 3TQFA 4AS3A 3EW7A 4RKRA 5D5QA 1A5AB 2PJZA 5KPJA 3K9HA 1L5KA 2D13A 1GIAA 1O4WA 1Z5WA 3GFRA 4DLUA 4MARA 3ZLBA 3ZWKA 4DWVA 4CCSA 4TSFD 3JR3A 3V8BA 2JGNA 2EX0A 3M2PA 3PS9A 3V4LA 1HA3A 2X8JB 1FOEB 5BOVA 1ZAYA 1WZNA 4IKEA 1BXGB 1ZM7A 3WYCA 1M2HA 2PS1A 2A3NA 2GXUA 4RTMA 2Q4RA 4QDJA 2REQB 4KRGA 4CG3A 1ZC4A 1Q1ZA 4G97A 4O4HA 4OGKA 1NIPA 1I0IA 2QIPA 5LDGA 2Z5LA 4LFAB 3QFCA 4OQLA 3FBWA 2PMWB 4R2MA 3N8HA 1GZ7A 1SQ5A 3GFTA 5C8YB 3CNEA 1DJNA 1YK0A 2FMKA 1GP2A 3IODA 3LYUA 3EPJA 2R8PA 2A58A 4ID9A 4ZODA 1Q77A 4TWIA 1G20A 2X4LA 4MA0A 1LNZA 3OZGA 4DA8A 4EPWA 2VCHA 2J3KA 2R6JA 5E2BA 3C7KA 3V4SA 2PYIA 1GGVA 1M1UA 1C7EA 2G1KA 2ZBVA 4RFLA 4FQ5A 4HJXA 2J3EA 1O03A 4ZT7A 2XZDA 1FZTA 3K4QA 5AICA 4XLTA 1KXZA 5IWAB 1O97D 3HJBA 2WLSA 3D7KA 3I6IA 3L79A 4E6PA 4IO1A 5LU9A 2XGOA 3THWB 1ID1A 4FCCA 4PZYA 3ZBQA 4QO7A 4YO7A 2X8BA 3CKLA 3RRYA 3CPSA 4UQOA 1FP1D 1NTOA 1EMDA 5CDTA 2ADFA 3EXHA 1J8FA 5JBNA 3R7WA 1VE5A 2AR7A 4A8PA 3HUUA 3PC6A 5KOYA 3L1VA 2YWFA 2ZYWX 4B80A 3D6FA 3I58A 4LRYA 3NHZA 1CXZA 5IBCA 3RROA 2YDYA 2I66A 1SXQA 3S2SA 4IJWA 3NDBB 1R74A 4R9VA 5LPNA 3ITNA 4RKQA 1T10A 1ESCA 2BFMA 2PQ2A 2VP2A 3KTFA 3ZW7A 4UBOA 4R8RA 1KFEB 2H54A 4JJGA 1M6NA 1T3ZA 2P62A 1GA6A 1IN4A 1ZJ5A 3ZHTA 6PFKA 4YUZA 1F8GA 3QPWA 4OHKA 3U62A 4FJ1A 2GCOA 3R7NA 5AM3A 2VWHA 1C3EA 4U2EA 4DV0B 2I8AA 2B3DA 2IF2A 1ZOIA 4BKUA 1CZKA 3GGPA 4EI2A 2XADA 4HGOA 1MC4A 1WF6A 5D85A 2BHLA 5AW5A 1KMHA 1WP9A 3IE2A 4AYWA 4LX8A 3U1TA 4M37A 1LW7A 2UXDB 1DVRA 3MLAA 4NJEA 3U5ZB 1QP8A 2O2GA 2ZIXB 5DYGA 4ECEA 2X7HA 3I73A 5DBFA 4J0GA 5DTJA 3PUIA 1SC3A 1FFBA 3NWBA 4MNTA 4YIKA 1CFJA 1FA9A 3ETJA 3LQ1A 1DDIA 1CULC 4M4SA 3VHXA 4D45A 5JC1A 1SBHA 3LMKA 2J1LA 5EPOA 1RWVA 4C0JA 1J2UA 3ZHXA 1EUYA 4CTOA 3UBTA 3BERA 4UFOA 5CFQA 1ISSA 4G8DA 1EI9A 2DJIA 3CB4A 2BMDA 4PZZA 1CVIA 4RD0A 2FQYA 2P9TA 4TLLB 5LBTA 2LPMA 2RGNC 3E61A 1ZZGA 1A88A 3ENWA 1VKNA 3BKXA 3TD2A 2YICA 4ZYVA 2B5VA 1JDUA 2V4ZA 3LL7A 2C07A 4L0MA 4Z3DA 3WGOA 1UT6A 2ZTMA 4B44A 4CODB 2IBTA 2QN3A 2XNDA 3LDAA 1YS1X 4IIJF 1E20A 1SKYE 1Y5LA 3UAYA 5CLGA 1OUMA 4A10A 1O8BA 2YHIA 5F3DA 1L5YA 3C2QA 4FYIA 3VPDA 4Z99A 1RM0A 5ALUA 5HVNA 5EKTA 4LJ9A 3ZDFA 1Q11A 2YMPA 5EOVA 2EBFX 2JBWA 3CG4A 4ZOBA 1CUZA 5GQSA 3UCFA 2ZRIA 3AIMA 5I7UA 1YF3A 1KVRA 3KXDA 3GZNA 4G37A 4R3NA 2ZQYA 3TIXB 2ZUSA 3DNMA 1EJBA 1BEEA 1IBRA 4XTRA 1GZSA 3SJCA 2VC2B 2VDNB 4XX0A 4FMPA 4G9EA 5CLIA 1FZQA 3ZUPA 4DCVA 5IF3A 2D3TA 4YAUA 3GPBA 4E88A 4Y6LA 1ODCA 2VZ9A 1UIRA 2DWCA 4RZSA 2AOXA 2WABA 2VP9A 3CJRA 2QZZA 2M6LA 5SYNA 4C2BA 4CGZA 5GJWC 4XARA 1D5CA 3DD5A 4WBNB 3AERA 2HWKA 1X1EA 1YDHA 2QMZA 4HH0A 4PG5A 3BFVA 5KVVA 2NU9B 5AKGA 4J91A 1T2EA 4BQIA 5LA6A 2DE0X 1JF8A 3B7GA 1YOVB 1VGRA 1P2FA 1B0PA 1W2HA 5JWOA 1VL6A 2PLAA 5C5DA 4X64B 4A4DA 1C0IA 1GT6A 3N3BC 3R20A 1NBWB 1JNYA 1CR2A 1YBMA 4JC5A 2CXUA 4AN1A 5KNBD 3G1WA 4HXEB 2XNJA 4XZ3A 3ZI4A 3RS4A 5ECDA 2ZE6A 4QWWA 3GJ5A 4IMJB 1YRWA 4RF3A 1NLUA 2XUIA 2Y4OA 3DHWC 3VH3A 4P4SB 3U9SA 1EX7A 3OKFA 5FBVB 4QTTB 1PEAA 4WEQA 5K4AA 3T7KA 2UYYA 1KBQA 3A36A 3JPYA 1GSOA 4E21A 1E66A 1UPBA 2F64A 1JDVA 3C14C 4LBZA 4OUDB 4G25A 3ZDRA 2QEQA 3IPAA 1JTVA 5J5CA 2EL9A 3ZHBA 4BNXA 1ZK2A 3AJ8A 1CTQA 5IKXA 3DBHA 4NCXA 2BGGA 4BATA 3WY9A 2PZGA 3IX7A 1FVFA 4FFSA 4V0QA 3IOMA 1PUXA 3OCCA 4WH0A 3H2JA 1DQZA 3NP7A 1QM5A 1RM5A 5AUPB 3H5NA 3HV2A 1DARA 1TKAA 2OHGA 3Q88A 3N8GA 1BVYF 3PP8A 3TQIA 1RWKA 2W4QA 3HNOA 2P0AA 2DQ4A 4YLEA 4EB3A 1DEXA 2ZYGA 3KKLA 1FPMA 1Y3FE 5IVIA 4PCAA 1KJZA 4MOWA 2V0NA 1AQ6A 1ACMA 2XBLA 1MRNA 3ZY5A 1YCFA 5FTLA 4W8GA 4HXYA 1ENPA 3WDMA 5AW8A 1XG5A 4JWTA 1LRJA 4JFRA 4QOEA 1CDOA 2P6NA 3RU3A 5DT2A 4WGFA 3MGKA 3TW8B 3HRIA 2JJ1D 1AUVA 2QT0A 4NENA 3X2FA 4F3NA 1TKRA 4U0JA 3IVGA 5ILQA 4QLAA 1H6CA 1NSTA 4TVSA 2GWRA 4F9FA 1U8ZA 4DVGA 2G07A 2IYRA 4S0ZA 3B9RA 3TLBA 1N5IA 1H0RA 4YP0A 1KOFA 4Q3BA 4YYEA 4D5EA 5HTKA 3GVPA 3CNLA 3ZCRA 2JKVA 4C7JA 2WD8A 4NPHA 2QXYA 1C4XA 3BF7A 3K15A 3OA0A 3G0IA 4IW3B 5D86A 3TLMA 4NE2A 2Q1TA 2VDWA 3QVGA 2FSIA 5ALSA 1SY7A 3NDRA 2FE4A 5FPSA 5JUWA 1V1RA 1YB1A 4L22A 1V37A 3E5NA 4EVIA 3CMCO 1V5IA 3RHTA 4D0GA 3LUDA 5E4FA 3LUKA 2AOTB 1MIOA 4X54A 5BV1A 1E1CB 1TJ4A 2Z08A 4OI2A 1WX1A 2ZBDA 4EFDA 1MC5A 2HB6A 3S1AB 5BSMA 1HZZA 3P19A 4XQ9A 3G85A 1GILA 3ZDDA 2Z6UA 3IBYA 2OZPA 4M53A 5AOAA 1I1OA 2O8VA 5F73A 1F51E 4P82A 4DPMA 4OSEA 1L5OA 2FOIA 2NTVA 3AUYA 4HQ0A 3O8QA 4OG2A 3AESA 3GJ6A 1OIWA 5LSAA 2XNHA 2A86A 3V8NA 3LHKA 1NM5C 1UPXA 2J32A 3GV0A 3TKAA 1V16B 4IIEA 4KJZA 4DNOA 1CS4C 3VR4A 1T1RA 3R0IA 2KJQA 4Y18A 4HTFB 1NUHA 2Q3DA 5LDDC 3PHJA 2VF7A 3VR2D 5K4HA 3EHEA 1EJ0A 1VPLA 5AVKA 4PV7A 3IEMA 3OT1B 2XUKA 4RJKA 1F9EA 5G0TA 2WP0A 3UJ6A 1B6RA 5FWAA 5CURA 3RR2A 4YCMA 5AW3A 5DJ5A 1HNNA 1HDRA 3F9RA 4N5IX 2LWIA 4QRDA 4DR4B 2A9FA 3ZHQA 1A27A 1RAIA 3RFXA 1QV9A 3KLPX 1DQNA 2LRHA 1N2IA 3MINA 2GK4A 2WD7A 4IIDA 2CJWB 1UKBA 3KOYA 3TW0A 2Q1XA 1ZHHA 1N1GA 1UDWA 3FZYA 3UQZA 2C00A 3GEDA 2O54A 4KQMA 1JNXX 3WWDA 1VZ3A 2HN9A 1OI7A 3E58A 4QGAA 5HKAA 5HZHA 4JI1B 3TQRA 1OE0A 1T2FA 5COBA 4DR3B 4N5MA 2IYAA 3W2HA 4CM4B 5A9SA 3SF0A 2R8OA 1LBTA 2CBXA 2GBFA 5I9MA 5KNDD 2VFAA 2IPNA 2Y6VA 5KAMA 4I9NA 1JPVA 2Q2QA 1QFZA 3QF7A 4JA0A 3H8SA 1CQZA 4ZAZA 4G1EB 2AYYA 4ISCA 3T5PA 4ER5A 1I5RA 1R66A 2GYUA 4B3BA 4RKEA 1XPJA 4WCVA 1QR2A 1EYZA 1T9AA 4BX9A 3K70C 4MDHA 1XDGA 4L3VA 3MUNA 5D00A 5EJ9A 1LBHA 2OAQ1 3GWGA 1OXSC 5K0EA 1ZJZA 1FYVA 2CMFA 4RJ2A 4CTKA 3PITA 4HAUA 3ZV4A 3K8OE 5C1IA 2QX6A 1XCJA 2JFOA 4O4JF 4DR5B 1UBLS 1WZUA 3H3XA 5A6SA 4KPYA 2Q0XA 1CDEA 2ZYIA 2FEPA 1X7XA 4UCFA 4TLCA 3ZLJA 1NJSA 3C70A 1XJQA 1T0BA 3KEMA 2PV7A 2GB4A 3ZKAA 1YU6A 4QECA 2ZZMA 2PKXA 2B78A 1I10A 3GYBA 3D4IA 5EKSA 4ZQBA 1Z22A 1PZHA 4WDRA 3BJIC 2F8LA 2R8YA 2AMLA 4CF5A 4CM9D 1K97A 2ZUUA 3JQ8B 2EKQA 4U2KA 8ATCA 2IUFA 5KMGA 2PCLA 3OE5A 4JT2A 4HNGA 3BWYA 2FTKE 1GUDA 1VPVA 4TV8B 1N0UA 5H7XA 3I8SA 5TMPA 3RRFA 1VL1A 2E48A 3N58A 3NTXA 4MVJD 3GAAA 3WYGA 1PV4A 1BXZA 1T9GS 2WB2A 5BN5A 4P7GA 5IAGA 4BBAA 2MIIA 2PZJA 1ADFA 3GEGA 4CIXA 3KYIB 5F4ZA 1GM5A 2YQ4A 3VU0A 4OQQA 4GW3A 4K9SA 3O0TA 4XGKA 3TMYA 3EB9A 1A9TA 1XDWA 4ZJUA 2WVHA 1WCWA 4EYOA 3K5WA 2EERA 1ABEA 2A33A 2ANBA 3PVCA 1QIEA 1NLMA 1QYVA 1GN9A 1T35A 3N8IA 2A4MA 3UAZA 3T1YB 4CKCA 1QQ7A 1XZFA 2IPXA 1A9XA 3A1EA 2JZCA 3Q7IA 1YQWA 3H1BA 3C8ZA 3OLWA 4FYPA 4IDBA 4HQNA 1MNQA 5DCWA 4AKTA 1ECGA 4G0ZA 3QE4A 5DN6A 1KDYA 3ROXA 4ZCMA 3EARA 5BNTA 1RBMA 3GOHA 1SOMA 1PK8A 1N75A 2M32A 2PJUA 1ENOA 1QIDA 2JCSA 3CLUC 1YZYA 3JAWB 4MYCA 4ZT2A 3OMWA 3OQPA 5AVQA 1BQ4A 2ACEA 1UXGA 3A14A 1MW9X 3A1SA 3IEIA 4Q01A 3QFHA 9ABPA 2O8FA 3KAKA 2P9EA 3E3LA 1TDJA 4IG4A 5KWVA 1ZD2P 1TYCA 1UOQA 4QJ4A 1ZYUA 5AT1A 3AP2A 4B3XA 1CRPA 3JSAA 3BHNA 2WQ7A 4DIBA 1OGIA 3GLHA 2ZLBA 2ZJ1A 3H1GA 4Q4DA 3QITA 2JDID 1X1BA 4CEJA 2I2XB 1YTUA 3U61B 4P36A 2FMUA 2QD1A 2CNBA 1J33A 3I2IA 4BECA 1IBMB 1LQ2A 3NALA 3GR6A 2AHOA 3CUWA 1N4AA 4CF4A 3RAJA 3KSRA 1FBTA 2OV1A 3I42A 4OKNA 5B55A 2PRJA 3PHGA 3UVEA 3CWZA 3HGMA 5KCMA 221PA 4G2TA 1AIPA 4DDKA 1GD1O 1F8YA 1L8LA 1QXSA 2WKSA 3A1UA 3OLXA 2ZFUA 4ZVUA 1O95A 1ZGGA 3G9ZA 4OMCA 3STHA 1Q6YA 5BR1A 2E82A 5BVGA 1P0MA 4RY8A 1T5LA 3ETDA 1RPTA 5JZSA 4NVRA 2VPTA 3UH0A 5LP1A 1E5TA 4RD4A 1PUJA 2RB5A 2Z98A 2AG0A 1QH0A 1X8KA 4IV0A 1DTWB 4V2IA 3ZN2A 2VAWA 2VK8A 4TQUS 2W7TA 1E0DA 3DA8A 5CRIA 3KOZA 1QE0A 5A0FA 3KWJA 4QXOA 2GASA 4D0LB 1T8UA 4DZRA 5I7VA 5IXYA 4MO9A 2IUTA 2H5EA 4UCQA 4D92A 2J0QA 1JZQA 3GCDA 1DKQA 4KAAA 1XLTA 5BWNA 3NIDB 3ZIAD 4KXFB 5CB0A 3Q9NA 4OKSA 5BMOA 2WHPA 4GLBA 4M36A 5CXSA 1DJPA 1AXRA 3JV7A 3KFVA 4U2FA 2BDEA 4RACA 3L46A 4ZRDA 5KJEA 5IKMA 3KHUA 3K3PA 4XEUA 2B1JA 1L5QA 2GEDA 1UMBB 4ENTA 5E4JA 2V6JA 3IUPA 3OD5A 4IJKA 5F2KA 3T6KA 4B3JA 3TWOA 2YJZA 5BRAA 3MJ4A 3EC7A 4ZOLA 1JYFA 2H1HA 3JQ8A 2Y1XA 4D9CA 3J81k 2PKQO 1JWLA 1T1IA 2ATEA 4IEEA 5E8RA 1FRVA 4ARUA 1V2GA 4HAIA 1SNYA 4KODA 4QUBA 4Y2JA 4BMSA 1GL9B 1XRPA 2BFCA 1BQEA 5EJGA 1SHTX 2CVFA 3TM4A 3PIIA 5FLYA 1PSZA 1PI3A 3BK2A 6REQA 1B74A 1AZWA 2QG6A 2HM7A 4WESB 3NV9A 1OFIA 5TMDA 2F1JA 2HAEA 3HYSA 3ZD8A 3IDFA 2OCXA 4Z49A 2C2BA 3O8DA 3OLYA 16PKA 4EB0A 3P4YA 4JCCA 3HXTA 2BTOA 3DEKA 3H1EA 1CY8A 1O54A 2H5LA 1U1GA 2H2DA 2VDUE 1QO7A 4LGYA 1KO4A 3TXAA 4EQ6B 1RXVA 3AX6A 2ZZNA 1A9OA 4F04A 3E3NA 4TX1A 4N0EA 2AOVA 3S2IA 4IWXA 5KWSA 1PKXA 3QLJA 1TF5A 1XMXA 5CYFA 4EKIA 1B1CA 3R0QA 3EUEA 4M98A 3LUAA 3F97A 4KGZA 4RU1A 3UFXB 4YRKA 2FW0A 3BDAA 1AD2A 4PYIA 4KTTE 4F1KA 1Y3CE 2GPSA 4MIKA 3ZJ4A 2XZLA 2G4LA 1O94C 1UQTA 2B5WA 4UHJA 4MULA 5ES3A 5AXDA 4BBJA 1MZPA 2B2NA 1U2QA 2WQZA 3B70A 2WB4A 5FJIA 4B4WA 1Y9ZA 5GIOE 2V6GA 4DABA 1XWFA 4YHBA 3ZE6A 1J0BA 3MUFA 4CMHA 2TECE 1QIIA 2ZB7A 3RT1A 4DIKA 5FRDA 2HSJA 3THYB 4HY3A 1D6NA 1L4HA 4YTEA 3USCS 2QTTA 4QQFA 1KXJA 3K35A 4EYGA 4X6YA 4DDVA 1A7UA 2EGGA 2D5AA 1YZNA 1GEEA 1XHFA 1TW3A 2CXXA 4P34A 1BXGA 3HJGA 1RJFA 3P4UA 3WLOA 3E9MA 3MERA 2WTMA 3FF1A 4A8HA 1N2BA 4R69A 5CEFA 1RWOA 1Q16A 3MRTA 1MW8X 2CJPA 2NQ8A 3C8DA 4C0QC 1IJEA 3G0BA 4N0PA 3RF6A 3GDHA 4MVYA 1M2OB 1U7TA 1A9PA 2ZJ2A 3BWDD 3QPBA 4MVXA 5H16A 3NAZA 4MW7A 1JU9A 5ALHA 1U0TA 5EVCA 1ONPA 3KYJB 4F4UA 1OQAA 1KO8A 2G9QA 2Z9BA 3N76A 4KBGA 1ENYA 3EEIA 1JMVA 2G25A 5JFTA 2GAOA 4EGAA 1KJ8A 1T0UA 2WUEA 3K1YA 2VT2A 3AF1A 5CW1A 4NBVA 4FN5A 5AJWA 4XFKA 1H1LA 1A9QA 3L6CA 4CTMA 5FV4A 3BQMB 3OM0A 1EB8A 3IR5A 3B6ZA 3NT5A 4XPZA 1ACJA 4OH1A 3UGTA 4MYSA 1E9CA 1VP3A 4LZAA 5EY5B 1N5KA 2LW7A 4LXTA 4ND8A 4POAA 4ZOQI 1X13A 5J4LA 4DMGA 1AMNA 4OA8A 3TLCA 1OX4B 2ZUDA 3JVIA 2XDQB 4TKZA 3PSAA 4GEGA 4REQB 1HLPA 5F2NA 4GNKA 3V1NA 2QDXA 4OP1A 4R2LA 1TAGA 1DBRA 1TVKA 5BYBA 1F5NA 3WIBA 3ZW8A 2QTBA 4O4IA 4D42A 1XN1A 3P9CA 2Q4DA 5A2QA 4QDKA 5ISMA 3BZBA 3QE0A 3T9AA 4ZMSA 1JA0A 1L5VA 3KPJA 1AHNA 1YVUA 2Q4EA 3KPYA 1M72A 3DC7A 3LOQA 3MTAA 3OHMA 5EINA 3HLKA 3O8OB 4MRMB 3WISA 1MOQA 3WGYA 1XXHA 1JFFA 2B6HA 2HL6A 1ZCZA 4WNCA 5KWIA 1ZBQA 2W70A 3AU8A 5SZKB 2FSHA 3CUSA 3DMGA 3R8XA 3LBNA 5LR6A 4Q82A 4JUAA 2OCDA 3A0RB 2IP4A 3TTUA 2WM2A 2HLPA 3FTDA 4FDUA 4RC9A 2C4HA 2W00A 4UUNA 3ZCPA 4BVAA 5FEUA 2JG3A 1KMCA 2QVZX 3OQOA 2IPOA 4L4ZA 4N18A 1KKMA 1Q22A 4FFBB 4J7AA 2V0GA 1DRUA 2YY7A 1CB7A 1LRLA 1M2FA 1SVWA 2RGDA 3QQ5A 3C4QA 4JODA 1NMXA 2PZEA 2ZRPA 2NO4A 3RLFA 4ESOA 1TCBA 4E15A 3MTIA 3ZWQA 4IR7A 1QFYA 3H2YA 3IMEA 3JRWA 4EJSC 1IMJA 5DNVA 1NYRA 3ENNA 4C30A 3E7DA 2FZKA 1AQNA 4H16A 3FI0A 3S7ZA 1A7JA 5BW8A 1VHJA 4G85A 4B2IA 1I13A 5IDVA 1DBQA 3HJUA 3OVMA 2FFBA 4Y67A 2C5HA 1BU5A 4O33A 1G0OA 3IELA 1KDOA 1G1MA 4ZK2A 1DT5A 1VLQA 3CLKA 1Y1RA 3L9XA 4YQFA 1VI6A 4P4GA 1FXWA 4UEWA 1R9MA 3MAAC 3K0BA 2DWPA 2W43A 1BE6A 1HMYA 1C4KA 2Q8NA 1X2EA 2CXNA 4HO1X 1E3MA 3CUVA 1SJ9A 2QVLA 1GPAA 3UAVA 4IUCS 2Q2VA 1MJNA 1TZBA 3PDUA 3E4DA 1WSBA 2MYNA 1TB4A 1T3HA 3FI9A 2X77A 1KO7A 3I9V1 5LC1A 8OHMA 4XSGA 4ZEXA 3T7RA 1IOWA 1UBHS 1DO2A 1M67A 2Z04A 1NHWA 1MO4A 2C61A 3CRQA 2ID9A 4Z54A 1W1UA 4UTOA 3EIQA 3ES9A 3JRNA 5E3JA 4FD3A 1WXIA 4DAOA 2DBRA 4I1SA 3W77A 2GD2A 1M1ZA 2C9ZA 1R6UA 3KC2A 3L77A 3NHLA 3QW2A 5D3MB 5FTJA 2FJ0A 4ZZIA 1P1KA 2WJGA 4BLSA 3UC9A 2OHJA 2QY9A 5F33A 1OKKA 4ZQFA 1VCHA 3RG8A 2XWQA 5COQA 1GCAA 3AQ4A 4EELA 1Z39A 4S1PA 5A5VA 2RAPA 3T5GA 5CFZA 1RJGA 3G89A 3HHEA 4WNAA 1X1SA 2J30A 2EEPA 5A5GA 2PXAA 3A10A 4OU4A 3GZNB 4HVCA 2OXEA 1J8VA 3IP5A 1ORVA 2HA2A 2UVDA 5CR9A 5ERGB 5JASA 5FO1A 2XB2A 3RRJA 1GLVA 2FDRA 2VXCA 3W6NA 2VJPA 2LVBA 3DZGA 2ZVDA 4DN6A 1LSOA 4JI7B 3AB3A 2PSFA 4M0CA 1XNQB 1WNTA 2I03A 4FZJA 3URMA 2XKKA 3E5RA 4HB0A 1GPNA 3S0JA 2BSXA 4X00A 1MJFA 4HS4A 1DBIA 3U56A 2J59A 2XUFA 5C52B 4WMLA 1MN6A 2RCNA 4EA6A 2GDJA 4OGWA 1GXSA 4HVLA 1Z8NA 3FFWA 3O4FA 1OFHA 4PVCA 3STXA 4A8JB 1JDNA 4DJ5X 4EF6A 3OAAD 3PEVA 1OHHA 1NE2A 1S8OA 1VLMA 2JA2A 4S1OA 3VSEA 3R77A 2A14A 5CHEA 3DLAA 1S8NA 1S1MA 4YP9A 3LD9A 3ZV5A 1LPMA 1V7ZA 2YJ6A 2IS1A 1BRTA 1YVEI 3EZYA 4HRVA 4FW9A 4MV7A 1SUPA 4LYEA 3L0ZA 5G4KA 1DIOB 1MP0A 1VHQA 3M9LA 3SDSA 3WWEA 5B6IA 1KVUA 3U3RA 2BZ1A 5BXQC 1F60A 1T24A 4L72A 4C01A 1E9AA 5BYAA 5JRZA 1N2OA 1VMIA 2AJTA 2EP8A 3WKEA 2CNOA 4CLEA 4K26A 3THSA 2C3YA 5HFNA 3GDFA 1X7WB 3OJEA 4EIWA 4M2LA 3ZU3A 2EZUA 2ALJA 4PHGA 3ELYA 4UD6A 2VHUA 2SKDA 5TX7A 1ZZEA 5TPWA 2A9JA 3QTTA 4OX9Y 4FBGA 2E5FA 3L7NA 3H9CA 5B3KA 5HKKA 1W19A 2PWAA 3L07A 1E3WB 2JLQA 3GUCA 4RETA 1UBMS 1V11A 3K0FA 2HSGA 3TDMA 4NPCA 3AHHA 2HSEA 2JCGA 2VF2A 3KTAB 4H2DA 4X8OA 2DQKA 4ZCPA 1BFUA 3KVRA 5FTWA 5H5JA 2I78A 1D6MA 3E7FA 3HWWA 2XSZD 1NVXQ 3FMFA 4TKUA 4AMGA 2RHLA 4ZIRB 4ZVPA 5CX1B 2TMYA 3MD9A 2HWXA 1YHYA 5DWQA 1ICEA 2QTWB 3TW4A 5EKUA 3SVTA 5E7QA 3SC6A 1ONBA 5DGIA 3WBJA 5IJ9B 1KP3A 1LUAA 1FFYA 3PENA 1JYEA 4YV0A 3U49A 2BBOA 3ONWA 1ZH0A 1U5CA 3ZIDA 4HWPA 1AUOA 3EPPA 3N53A 3GIDA 1BCSA 1EP2B 1Y42X 3N6RA 3OP4A 3PPXA 5CP8A 1A95A 3NANA 5FBHA 3IIMA 3WOHA 4AXBA 4KP7A 2C7VA 2B1IA 2YYYA 3L06A 3JQAA 2A1UA 1B0AA 1Z88A 1OXVA 1SCDA 4W1SA 4K6MA 2Q62A 3UHFA 3U3XA 1X1CA 1ZLXA 2JB9A 2XDAA 3O84A 3AR4A 1X7ZB 1J49A 2DEUA 3G9UA 3HYCA 4Z9XA 1QV7A 2NXWA 5ADHA 3JQDA 3MXOA 1WVMA 4OJYA 3DOOA 1BHQ1 4ZPXA 2AEFA 2FWIA 1MJGM 2VH5R 3NV7A 3MRXA 3PXBA 4WW0A 4CCAA 1I32A 1LPOA 2FN3A 3AK4A 3EGIA 4JT4A 4LZOA 5ALJA 3SK0A 3E7WA 4TTSA 1K5GA 3LW8A 2ZYRA 5F5NA 3SM9A 3ZX5A 4D8XA 5FAKA 2XA9A 1Y5NA 4KVGA 4WLVA 3TLXA 1JHMA 3RLIA 1TEVA 3PJEA 4DV5B 5EQJB 4F3TA 1XMPA 3M83A 1SVUA 2IGBA 4IZHA 3WYNA 5JW6A 4AKHA 1V7PC 4HDRA 1EFPA 2OXRA 3RT9A 4DIDA 1GTG1 1DAMA 2R96A 3L7CA 5CEEA 2QLNA 4N8DA 4Y2HA 3UXHA 3B89A 5I3CA 2I9PA 2H4XA 1BDMA 1L7BA 1K98A 1UMDA 3PWSA 1KK3A 1B73A 4B17A 5B58T 3C3KA 2BRUA 1Q7BA 2WRZA 2OXIA 5D2CA 5K20A 3BIJA 1QQTA 4OXIA 4WLFA 2GAFA 4BGIA 3ONFA 1DEAA 2VQ3A 4BNMA 1USIA 4Q18A 4Q3LA 3O92A 4TLDA 1LVGA 5HUQA 1TUEA 4IQGA 5BPFA 5JH7B 4GQIA 2I1VB 5H70A 1L7MA 4CQMD 1VJ5A 2WOOA 3KB6A 4CLRA 2MJLA 5DSZA 1PZEA 1W1IA 3R3UA 4N12A 2VDRB 5JSYA 1Z7EA 3NPAA 3RPEA 4BOYA 4YC7A 2CDRA 2COUA 1Q5PA 4QGGA 4I55B 4B34A 3FTFA 2RBKA 5EWMA 2PGXA 1U7HA 4G3XA 4RV9A 4C4ZA 3ZHZA 1IH8A 3D8TA 2ZTHA 4GDFA 3PWZA 4MV4A 3DCYA 5FUWA 3HSKA 1ZD9A 2JLWA 4H7HA 1EIWA 4W9RA 4IZ6A 5JSHA 1PLKA 4KHPB 3ZKWA 3BM5A 3FA2A 5ED4A 2APJA 2O8NA 4FQ8A 4GSKA 3S44A 4WFKA 4KQ9A 1XWIA 1H05A 3IAS6 2CK3A 5PNTA 2G9NA 3QI2A 3TB6A 1E7SA 2BI4A 2BM0A 4EHLA 1CVLA 4BMZA 1SCAA 1RHKA 3IQXA 3TECE 3W3AA 2CWDA 4BX2A 3TQQA 1C7QA 2G76A 1CIJA 4RTQA 5CMLA 1XRJA 1WULS 4OLFA 4PFJA 3UJ9A 3CVYA 1Z73A 1Y1KE 3O1JC 3G2KA 3KZMA 4QLBA 2P5UA 3M1YA 3RK0A 3EDOA 1QIFA 5BW4A 2UUOA 1PQYA 5EIEA 3KR1A 1CY7A 4UBKA 5JXWA 3QUSA 5DM1A 5ECGC 1RNLA 1SG6A 3KO8A 1NI4A 3KSZO 3KT3A 3D3QA 4ND2A 3U9TA 1Q91A 4B32A 1LZKA 1KWGA 1EXNA 2V8OA 4B84A 1ZSNA 3V6MA 4F56A 4YCCA 1FYXA 5LOVA 3H86A 2DRIA 2IYVA 2WJIA 4HNQA 5IXSA 3U1BA 1OXUA 2O2JA 1NT4A 4XUGB 3E6AA 1XNRB 1N2SA 2ONZA 4JOQA 1MOSA 2NXEA 2DFTA 2IYTA 5CB4F 3FCEA 3VSAA 2HPVA 1FP6A 4B83A 3FPEA 5K3EA 1EFCA 2HRDA 2QKYA 2SBTA 2HK8A 1L4LA 2GPWA 1YNOA 4RTNA 2WINI 2EDCA 2WYUA 1RE1A 3NX4A 1E5QA 2YFYA 3RSCA 2XV1A 3OBIA 3PWKA 1NRXA 1IHDA 4J1SA 3SPXA 1YCHA 5JU6A 2DQYA 2BKEA 4OXQA 3B2NA 3DE3X 1SXJC 2PUWA 2GWHA 5BY2A 1Q1BA 3QIVA 1Y5IA 4LQ4A 4JLJA 3T9FA 1OCEA 2AWOA 5A3QA 1GOTA 1GQSA 1P4AA 2ROQA 3LQ4A 2Q4OA 4R3UC 4BVKA 1CIVA 1SZDA 4QXPA 3GJZA 2ZANA 3DR3A 4XYMA 3PK0A 5TPWB 2EP5A 1B8NA 3EAQA 4YRTA 5J5AA 3FSGD 1SMKA 2R4UA 2VJOA 1VSVA 5DB4A 3I01A 1QC5A 3RFFA 4ZDJA 5AVYA 5TT1A 3H5OA 3WTBA 2VJCA 3FB1A 4HAYA 5E9JA 10MHA 3E1SA 4PXSA 2XUPA 1F8UA 2A30A 2OK7A 3ORFA 3OX4A 4RLHA 3MMPA 3N5CA 3WXMA 3SFVA 2NWQA 2YXDA 3FY4A 4QREA 1Q0TA 2UZ1A 2WWGA 3ZCXA 4UEKA 4N0DA 1UXIA 1E3DA 5ICGA 1GQ2A 3UWDA 2GLUA 4YJHA 2IW1A 1IIRA 2J5BA 1UBOS 2OHOA 5JDCC 4ZHSA 2I3AA 3AVPA 5CB4B 2C7BA 1NAIA 4UDOA 4PZAA 3V1KA 4PBTA 1U0OC 1LGYA 4P3PA 1JH9A 2IXEA 2XF2A 2YRWA 4YONB 2PZLA 1Z29A 2JLRA 2P67A 1WCXA 3DB1A 3L01A 4FS8A 4HTAA 4A8JA 4K0RA 4B48A 2YQZA 4EZIA 1TD9A 3F4LA 1QZ3A 1ZXLA 4WN3A 1UJCA 5TS2A 2COEA 4DSZA 1OZHA 1EWVA 3DBOB 4UUBA 3TG2A 2WT4A 3PC2A 4XD2A 2QTRA 4HATA 1V8BA 1RACA 3I8XA 5ARBA 2IGTA 5E3IA 2GHRA 1P61B 1PGJA 2R7KA 1BDHA 3WHKA 4JOBA 3I4FA 1NI3A 3OQVA 4KU4A 5ALOA 4CN9A 2QVBA 3F5SA 3OEHD 3M1AA 4HDQB 4KXWA 5KNCD 2O2IA 5CCBA 3E0QA 2AXQA 3C5CA 5D5PA 4BZXA 2PNJA 1BXRA 1QGZA 2QD2A 3QWIA 2YZ2A 3QLTA 3AJDA 4QFDA 4ZKEA 2ODPA 3DQQA 1K2WA 4OQEA 1VL5A 2FNAA 2VNHA 3QWBA 4JJEA 5FOXA 3SEFA 3LXRA 3L0BA 4YJ3B 3I2GA 3NHKA 5AOVA 1HBJA 4ZAXA 2WF7A 4XJVA 1TAHA 2QHXA 2YHUA 2NU6A 4E07A 1A7AA 2XB9A 4MIEA 2O8CB 4L9SA 1I4EB 1HLFA 3WG9A 4MVCA 1F0KA 4MUKA 4P3NA 3VNSA 1CP3A 1FFCA 1P81A 1ZA2A 4UTVA 1KQOA 3DGEC 4FOTA 1U5AA 4LRXA 4Y1RB 5JAMA 2OV4A 3A4NA 1GL3A 2YWGA 3M6WA 1KU0A 1U9JA 1G3UA 1BKYA 1N8NA 2YYZA 2I80A 4PLCA 1Y8AA 3CX4A 4MRRA 2RC6A 3WWZA 4CKWB 3V97A 3SYNA 4BY9E 2FEAA 4XDZA 1YCGA 4REMA 3TZEA 2ZBRA 4FNMA 2WZQA 1KAMA 2GBCA 3K6RA 3Q3EA 1XQWA 2Q3EA 1ZONA 1HDXA 5IKOA 4LDZA 3CT4A 1R8XA 3NCTA 4N54A 4CCYB 5C1OA 3IP7A 3AR3A 4INZA 1H9BA 4OIFA 2QRLA 3FR7A 3T3OA 1BWSA 4IL5A 5JDIC 4OJMX 4PX5A 3EISA 3ICWA 1EGVB 1L5HB 4LE0A 5EE1A 3LM8A 5KHOC 3DL0A 3UAOA 1MBZA 2FXVA 5A6VA 1R9NA 2WU4A 1E1LA 1VYTA 2B8TA 2G36A 2WSYB 3QVSA 4O4HF 5IDWA 2E1PA 2VSOA 4K6OA 3A25A 3W78A 2NVUB 2ZKIA 4ZU3A 4ZTUB 3SOPA 3KBOA 2X86A 2MSKA 1G5QA 3AYZB 4MI6A 4E12A 5JDIA 4URHA 3FUXA 4DR1B 4DEVA 2CLDX 5LLDA 1SU6A 1SKQA 1KBZA 2FPPB 4BTEA 2VPPA 4YT4A 1BKSB 1OBVA 1NLFA 2ONYA 3ROQA 1ZVKA 4WCFA 5L53A 5B6JA 1YS2X 2ZEJA 2E49A 1QLJA 4FSXA 2J5XA 2EKBA 3II6X 1I1HA 4GGPA 3UHPA 5K0NA 3X2SA 2W22A 1P1CA 1FU4A 2PD3A 3EDQA 3G8AA 3DTTA 2R84A 2HLDD 2IDMA 3D02A 2JIMA 3VMMA 1IXRC 2YCLA 1W4CA 3P2JA 1E5VA 2ZBUA 2BLNA 2GI4A 2NAPA 3IUEA 1NX9A 4OA5A 4HHEA 4ENUA 4DZTA 1FXUA 1GZ3A 1NXVA 3GU3A 5DBEX 5MHTA 4YCBA 4ZI7A 4QZVA 1NOKA 1U6KA 1U9YA 3VO1A 4JN6B 2OD2A 1E2FA 1H5QA 3AHFA 3UA4A 3PNMA 4YRPA 4EJSB 2O8BB 2YV1A 4E2XA 2XDYA 1HGXA 2GZ1A 5F7ZA 3HXLA 3EZ2A 3LUJA 3STWA 3BN3A 1IUNA 1T13A 2Q6TA 1IEQA 1FFGA 2V03A 2VPZA 3D6NB 4FR5A 4QKQA 1IEWA 1XVVA 1LK7A 3DTVB 5D5HA 3TCNA 4G4IA 5TLSA 2Q3BA 2YINC 4KLZA 3ZWXA 1GTZA 4LX0A 3ZD9A 1FDWA 2EFHB 3RIMA 1NNEA 5A5FA 4RDIA 5FNVA 3C45A 2ZKLA 4Q3AA 4XB2A 2NADA 2PIAA 3P5BA 1FSSA 2GCNA 4IYRA 4DTCA 5EMKA 5HS6A 4ZI2A 1G3IA 2WG0A 1ZR4A 5ITZB 3J7TA 1IG0A 3WLFA 5COAA 1V95A 4RA6B 2QY6A 3O0DA 1WO8A 2CJXA 1LPPA 2C96A 2GK3A 3KLOA 3B82A 3KZCA 1EK1A 3GGGA 2KW5A 2OBLA 4HH3C 3ZU6A 4ENPA 1Z56C 2AN1A 2C3MA 4AVYA 2FG7C 4XDYA 1J8DA 5JNRA 5B36A 1S2DA 5HILA 3T9EA 2O0KA 2ATVA 3RT7A 3H19A 4U7FA 2XD4A 5ICCA 3KOXA 1KKUA 621PA 4J4HA 1ACLA 1V35A 2ZIZA 5DM4A 1E2GA 1JR3A 2Q5QA 3WIEA 3AC0A 1VE3A 5JDCA 3GA5A 4BO3A 2O2SA 2IS2A 2GN4A 2BTEA 2X23A 3FPGA 3UJDA 4JT9A 4DXDA 4CKEA 4MRSA 1ZU4A 4LVOA 3PEWA 2Y93A 4NU6A 4DDWA 3QEAZ 2V58A 4LYGA 2WU0A 3R3WA 2YUIA 4H18A 4N48A 2V8BA 3OKCA 2XCLA 1YONA 3MLEA 4HEA6 4NBTA 3FYHA 2WF6A 2F3UA 3CLRC 3OPQA 2Y1FA 1OFGA 3DE4X 1XRRA 3EHDA 3A1CA 3LRXA 4FYVA 4BKMA 4G86A 1GZ4A 1RRCA 2HR1A 2P2LA 4I50F 4GI2A 1GGKA 1NW4A 1M0WA 1BEUB 2Z56A 2QAIA 3OOYA 4CL0A 1YOBA 2ZRNA 3HB0A 1HO3A 2JH9A 2PT9A 2W6CX 3FDXA 4AWBA 1VIYA 1WR8A 1DDOA 3FFAA 3MBIA 4JELA 4DNPA 1Y6FA 2RK4A 4UBIA 4N0QA 4EYEA 1T4CA 5F2OA 5BMVB 1E2HA 1EVZA 4W7IA 1L6RA 2IVFA 2PS0A 1H1DA 2QR2A 4FILA 3ZDBA 3ICCA 3SZRA 1QGED 2QRUA 1G16A 2GF2A 2EX1A 4I3FA 5JZBA 5K8JB 1G3RA 1K89A 4IUBS 1P7CA 2CYCA 3JRXA 1BGVA 2JHAA 3PZBA 5EP4A 2XMCA 1CNFA 2NUTA 3ZWDA 3TQSA 3BFJA 2FN4A 2Y92A 2HHLA 1W94A 4RA9B 3G2QA 3IHKA 4HJRA 1AKVA 1EE1A 4RIIA 5JHGB 4I5GA 4WFQA 3WMXA 3QV1A 3E15A 4HG2A 1CRZA 1T8SA 2LCFA 4RA9A 1D07A 2D2VA 1VPDA 3LT4A 2ORED 4S1TA 2NLOA 4RM2A 2PMFA 1EDDA 1JKJB 2D59A 1JEQA 2NUTB 3FBGA 4PPQA 1EX1A 3FHJA 3HVIA 3IP1A 2Y1OA 1IOVA 1HZZC 2VPIA 3C3MA 3VGJA 5CLFA 1RC1A 2Q1YA 2ZB3A 4WXMA 5TIIA 5AKEA 1NMSA 5IRCD 5AW9A 1DIHA 3A3OA 4HLCA 2QG9A 4L6AA 1J99A 1NC1A 4UBJA 1SCJA 4UHEA 4YDRA 2Z2ZA 4JR1A 2VH2A 3QHPA 2O0LA 2UVQA 2PR7A 4KDFA 3BWVA 4L9WA 1KMNA 4AJLA 2IHBA 3DFMA 3IMKA 2QTLA 2LXNA 1LPNA 1C8VB 4AY2A 4ROSA 4FBMA 3A05A 1YZTA 4N01A 2H17A 1TK2A 3SQOA 1N2CA 1SAYA 3A6DA 2XH8A 3M4XA 4I99A 4Q7JB 1BA2A 5BSRA 3QOFA 2X9GA 2PWZA 3N70A 4AQDA 4B3TB 3DOHA 4MIOA 4CEHA 4CF7A 1JBEA 2V7WA 5DO9A 1AKYA 4IILA 1DTEA 4ZVKA 4KN6A 4RKFA 3FYSA 4MTCA 2C9YA 1OV6A 4MYHA 4MP6A 1ORDA 5FPQA 3AILA 3KHSA 4PZCA 4RY0A 1O57A 5H4HA 3WGUA 4E5KA 4RXTA 2EX4A 1MGOA 1APBA 1U1CA 1R0KA 1LY1A 5EG5A 1TCVA 4C4RA 1C1XB 4II3A 4MR9A 4AJNA 3F46A 3AJ9A 2IOYA 4FB4A 1CQPA 1EFDN 3G8CA 2RSLA 1EK0A 3B60A 5CITA 1O2DA 5JSKA 2DHQA 2WHXA 3FDFA 3LP8A 3LA6A 3MB8A 4M21A 3UB4A 4HWKA 1PS8A 4YCDA 1N9ZA 5IMSA 4CHGA 1G21B 3LLSA 1I01A 1SBQA 1C1YA 2DTDA 3COVA 2VYVA 4ROTA 5CVDA 4C0SA 1GEGA 4PLYA 2DF8A 3PUXA 3AL3A 2JHCA 3GT4A 1YR2A 3TIFA 1Q0RA 1MTOA 3BSFA 2C83A 5CDSA 4W5JA 1KI9A 1YULA 3CINA 3UKOA 1LI5A 2GNAA 3GEPA 1T1JA 1CFZA 2EZ4A 3R6GA 1YB6A 5LP6C 3QY9A 3O3NB 4Z3KA 3IALA 4PG8A 4IMIB 4IVQA 4E30A 3Q40A 5EPEA 3EVAA 4OYYA 2Z3WA 3B36A 3ZDYB 1JLSA 1BQ3A 1UJ6A 1Z7YA 2AF3C 5ALKA 4BKQA 3ZDQA 4YMVA 3T3NA 1RSZA 3UJBA 4AF8A 5CBPB 4Y1RA 5JXJA 3IE0A 3WNQA 4RLFA 2FK8A 2IEIA 5EEHA 1W9HA 1I9CA 2W2LD 5DTMA 4C6SA 2QGZA 1II9A 3THXA 4TS4A 2D2FA 4MVWA 5F5XA 2EU8A 5A3VA 3RRXA 1XPUA 4NU8X 2B8EA 1MHTA 1SC4A 3QXHA 2CWWA 3LY7A 4Y2RA 1W44A 4ZOLB 4OQXA 3AW8A 1EQUA 1DXQA 4L7QA 1SXJA 5GONA 3FHOA 3SX4A 3ONVA 5EI5A 4QUJA 3AEUA 3VM6A 2BGUA 4K8OA 1BOFA 5LLSA 5EP3A 1NWHA 1JQLB 1MAVA 1DAFA 2H0AA 2WIKA 3OESA 4ZI5A 3W5UA 3OEEA 1ZSYA 3B2EA 1FUIA 1GGHA 3GJTA 2FVXA 2WHPB 3OFVA 3DBLA 4C3UA 4OH7A 3HKEA 4NOJA 2A7QA 2YS7A 4D41A 1IZYA 4KKVA 3TX6A 1J0DA 2WWRA 4S0XA 2NVBA 4LNUB 3FBTA 3VBEA 4KQWA 1P1BA 3FSJX 2UDPA 3MMSA 1GAQA 2PSEA 3ZK7A 4BFLA 5JCOA 1VMKA 1KK1A 2R68A 3IUSA 5K3SA 3TNLA 3UICA 4GZLA 4A9AA 2Y1GA 3ND9A 1JVBA 3SZ3A 4BWFB 5H3LA 1X38A 2IPLA 4QRHA 4E4RA 4LF6B 3A4VA 4IZIA 1VIVA 1Y33E 2FGKA 1C1XA 3Q0TA 1VHTA 3CE9A 3W8NA 2X2FA 2ZWAA 2QRPA 1NKSA 1QCZA 4ZD6A 4AY4A 2C2WA 4NV3A 3RTGA 5A6SB 2QTVB 1XNHA 1PDOA 2Y8EA 4GZ5A 2ANCA 2V6BA 4OBEA 3GDWA 5TT0A 4DA7A 1AGPA 3L5KA 4ZYZA 4BYMA 2C7QA 1R4ZA 1TKBA 1ZN7A 3OZXA 3P45A 5CFLA 3UATA 1PFKA 2H92A 1F8FA 3QZUA 1OXMA 4KACA 4XPIB 4H4DA 2F9MA 1VB5A 4O1IA 5HQ3A 2DR0A 1K75A 1H2ZA 1M2WA 3LFUA 1ULZA 1NX6A 3DM5A 4QG7A 4WXHA 3SQMA 4V0LA 3X0DA 5MF6A 2XVZA 4W9NC 1V3TA 2EKZA 5AESA 1XCPA 3E3MA 3N7TA 3U4MA 2ZS8A 3FR8A 3KKQA 5HCNA 2CXHA 3OQBA 4AW9A 1UODA 2C7PA 2ZVJA 4BDTA 4DDTA 1LC3A 2AYXA 3B3AA 2YNMD 3KQYA 1PTKA 2JL1A 3FFBA 1W48A 1MFZA 1Y1LA 2UZ4A 2AQ8A 2IXAA 3QQPA 2J3QA 1U7DA 2XECA 1E1NA 3BBLA 2WC1A 3OCWA 4GPIB 3DVQX 3OIUA 4E0BA 1U4OA 3N2IA 3THXB 1XYVA 4Y1GA 1YDWA 2JGRA 4JIMA 3M6AA 3PXXA 2PUCA 2XZPA 3K5HA 2WZDA 4NCAA 4RSHA 2WF5A 4QQNA 3ZXYA 4HEHA 2O48X 1TMYA 3NIFB 3F1KA 3GLQA 3EZLA 1SM4A 2CFCA 3K9NA 5BSUA 3VTZA 1ULHA 3R5HA 4QJ5A 4AP6A 1F4VA 3I53A 1GAEO 1YL7A 2Y4NA 3ZI7A 2W5UA 3C5VA 2VXYA 4HNUA 4RTRA 3UJNA 3EIHA 3EULA 4Y1FA 1NQXA 1GCIA 2C57A 2KX7A 2OHVA 4NBWA 2H4JA 3VX4A 1DX9A 1M10A 3EJWA 3KS9A 3ROFA 1F7VA 4HWRA 1OWOA 5H02A 3ERCA 3OLCX 2RGWA 1T26A 1RRGA 4W8OA 3V9PA 2C99A 1ZHFA 2ZCJA 1LX6A 2PQ6A 1XTRA 1NI4B 1NMZA 4L0DA 1O5TA 4JB3A 5ETJA 2XYRA 2DBYA 2EJBA 2JCXA 3HWX1 2WSBA 4O3MA 1PS0A 3RYIB 1E96A 1DE0A 1NWCA 2GD6A 3NAMA 1TYBE 2Q7DA 3CZ5A 5C32A 1IJKA 2ZIVB 4DFDA 1TUIA 1BW9A 2GT1A 2UYGA 1RXIA 3OZAA 3SLGA 2E6KA 4ZO7A 4G8JA 1MEEA 1EGAA 3COSA 3W9UA 1GO2A 4TKVA 4MGEA 3T1QA 1E7RA 3KVOA 4BX8A 1ORHA 4JVSB 5CT5A 3C3WA 4HF7A 4OHXA 2CLMB 3ASYA 2I29A 3ZKWB 1NYQA 4H7KA 1KWKA 3BQNB 3G6KA 3O4JA 1UPAA 3C6BA 1I5OA 4OAQA 3CKYA 1CUSA 5B1IA 4L4YA 3B5EA 5A7HA 5HBGA 3S2UA 3SS9X 5JJBA 2RIPA 2XRZA 2WTBA 3W05A 1AKTA 1EJ2A 5THKA 5TRTA 4DCPA 3OIDA 1HSOA 2X0KA 4UM9B 1TXGA 2A88A 4JJ7A 5A71A 1T9KA 2WA2A 1T6NA 1UBKS 3V7FA 4CM8A 3GLGA 4P7JA 4BO6A 2D1QA 3ADOA 2R8RA 3WMRA 2F4NA 1EG7A 1I2ZA 5SZJA 4UASA 2ZPAA 1XZJA 1XAHA 1ZM9A 5A9TA 1OB5A 5IABA 3DKIA 1QFXA 4I50A 5DX1A 4FR2A 2BFDA 4B7ZA 4DWWA 1EUCA 5KSOA 2AQIA 1E0KA 1FVOA 1QS0A 2RHHA 2XUZA 5DSXA 5K09A 3FNFA 5CU7A 3SD7A 1RYZA 3P1JA 1K8XB 4MUBA 5EMJA 1SO8A 3B13B 2X58A 4F60A 5A3RA 1W5BA 3B53X 3HB1A 4WA8A 5I7WA 4J75A 2QGNA 1ZAKA 1Z6QA 3BRCA 3ETGA 3GEEA 3BIXA 3R9XB 4DUYB 5FORA 3OZFA 4G5QA 3RTDA 4WOPA 5AXBA 2WAYA