1JJVA

Dephospho-coa kinase in complex with atp
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
205
structure length
194
Chain Sequence
MTYIVGLTGGIGSGKTTIANLFTDLGVPLVDADVVAREVVAKDSPLLSKIVEHFGAQILNRAALRERVFNHDEDKLWLNNLLHPAIRERMKQKLAEQTAPYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARSANFEQIQRIMNSQVSQQERLKWADDVINNDAELAQNLPHLQQKVLELHQFYLQQAENKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of dephospho-coenzyme A kinase from Haemophilus influenzae.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transferase
molecule keywords DEPHOSPHO-COA KINASE
total genus 72
structure length 194
sequence length 205
ec nomenclature ec 2.7.1.24: Dephospho-CoA kinase.
pdb deposition date 2001-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01121 CoaE Dephospho-CoA kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1jjvA00
1E2FA 1DAIA 1Q57A 4PC6A 1F3OA 2V54A 3RS5A 5KSZA 1IY2A 5DI9A 4HB2A 3X2SA 3N2EA 2TMKA 3C14C 3QKSA 2GTPA 1OIVA 3GLFA 1CU1A 5JEEA 2JCSA 1IN4A 4G5GA 1BIFA 3K0AB 2XZPA 5FOWA 2VH5R 3L8YA 1G6OA 1I2DA 3CRMA 1G3RA 4D0GA 2X2FA 1OXTA 2BBSA 2QSZA 4PAQA 5EP2A 4B44A 2IYQA 1A2KC 2WM9B 3EA0A 5SZJA 1EWRA 4HB4A 1ZNXA 3GLGA 2G77B 5FPTA 1JI0A 1MOZA 2XNDD 1GFIA 2IWRA 4LPKA 2ZE6A 4QBHA 821PA 4KFSA 1IN8A 2QMEA 3DEFA 4KFRA 1OH6A 4NPHA 1N6RA 2V3CC 3TSWA 2CE7A 2IC5A 4BFWA 3K09A 2P2LA 4LY6A 1P6XA 1LS6A 4PSKA 1G3UA 1AIPA 1NMZA 2DWPA 2VP2A 4BASA 3QXJA 4EPTA 5EP3A 2V9PA 4ARZA 1M34E 1IJFA 3SR0A 221PA 2YINC 5FPSA 3K70B 1KTVA 3KQHA 1SHZA 2XEXA 3K9HA 5EZ6B 3LVRE 5F2EA 2FG5A 2R9VA 3MUFA 4TZ0A 5CYOA 1N6PA 1RW4A 4ZCLA 4DCUA 4QRHA 4RD2A 4MRNA 4A4DA 1L7VC 3LH5A 1TF5A 4Q9LA 1VCIA 1BH2A 4EIWA 3RRZA 1EXMA 4ZIRA 1GILA 3PUZA 4MRSA 4PC7A 1LFDB 5CLLA 2CMKA 5LB4A 3QPWA 1G64A 1FW6A 4AKEA 1XTIA 1M2OB 1E2PA 2WKQA 3ZH9B 1KMHA 2WJYA 1ZIOA 1R5NA 3GMTA 4RD3A 3T1VA 1DAFA 4DIEA 3QXHA 2ZTSA 4HZIA 3IUYA 4JVNA 2H8KA 4XSGA 3ZDQA 1X8JA 2WSSD 3RSLA 3V00A 4C0LA 3C5CA 3NHAA 2VO1A 1RKBA 2N1BA 2A5GA 1Q21A 2VHJA 5GJVC 3OF5A 4HB3A 1U9IC 3EX7C 2EYUA 1U0LA 2QEQA 3SDZA 1CR4A 3FPAA 3P20A 4L15A 3THXB 5M04A 1N25A 4BGDA 1GNQA 4TMWA 2X2EA 3RC8A 4OQMA 2A3RA 3SOPA 1KKMA 4K46A 2YWEA 2IYRA 4YMTA 1EFRD 2QM8A 4B75A 2OE2A 2HJVA 3KTAA 1HTWA 3IQWA 3PVSA 2PMKA 4NYIR 5AUQA 2IUTA 1KMQA 1KZ7B 3E2IA 5H68A 2ZR9A 3IQXA 3A8TA 3FOZA 4FMDB 4AKGA 1F2TB 3JZMA 4HAXA 1HEIA 4B32A 1G4UR 2ECKA 2OAQ1 1IN5A 1YRBA 4GOJA 4LHYA 3B1WA 2FSIA 2NTYC 1BYIA 5CYPA 3U5ZB 5B58C 2WBLC 4RZUA 3GLFB 2FWRA 1M6NA 1E32A 2MSDB 3HWSA 4DCTA 2P5TB 2WVJA 4OI0A 3KB1A 4QG7A 2CL7X 4Q47A 3SHWA 3TAHA 4GI7A 1E9DA 2ZI4A 4EAQA 1IAQA 2JIZA 1AA9A 1TPZA 3W34A 2R6AA 3B1VA 1Z0DA 4I99A 2XXAB 1MKYA 3H2YA 4HSEA 5E4FA 4OK5A 3W3AA 5D3MA 3I8XA 3LW7A 4OKSA 3GLGB 421PA 1NLFA 1RFLA 1V5WA 1SVSA 1U8YA 1VECA 1XCPA 2FMXA 3LLUA 2NO0A 2W6IA 4IRUB 4HUTA 4DT1A 1AS0A 1EX7A 3ZQ6A 3R8CA 2HYDA 2C04A 3AVPA 1Q20A 4UQOA 1RRGA 2A7QA 1G9XA 2GRJA 4MRVA 4KCGA 1QHIA 4PR0A 3U61B 4AC9A 4NHOA 1NG1A 1DAGA 1NJGA 3A58B 1ELOA 2VSXA 4LJ6A 4A9AA 2JLYA 1NLZA 1WE2A 4LGMA 4NU0A 1TQ2A 2FSHA 5HE9A 4QHYA 1Q3HA 3MJRA 2XZOA 2WAYA 3Q5EA 1NIPA 4XSHA 4DB4A 1OPXA 3KUDA 5CIQA 1DG3A 1HV8A 4ERNA 1A5TA 3TSZA 3FTQA 4AWXA 4I81A 1IXRC 4I4LA 1ZD9A 3ONWA 4LYHA 4JBWA 2VLIA 5K8IA 4IVRA 1RC8A 4CYMA 4PO8A 4LWZA 1Z6YA 2JLRA 2ZEJA 1NBME 2B21A 2O5VA 4TL9A 5G40A 3AVUA 2J5XA 3BIFA 4KO8A 2ZRFA 5ANRB 3SFZA 1T0JB 3VR4A 4RD6A 2OBNA 1SKYB 2FDCA 2A9KA 1NN1A 1WF3A 2ZETA 3CW2A 4RFVA 1SHKA 5G3YA 3WYAA 5HCNA 4A0HA 2CLSA 4CT4B 2J7PD 2ZR0A 1FL9A 1TUIA 4AD8A 2WWFA 3WP1B 1O87A 2ZS7A 3JVUA 4BQSA 1VG1A 5IK2A 3RS0A 1QVAA 2EW1A 3QBVA 3RRNA 2DHRA 3PENA 1GIAA 2H16A 1E9AA 4C0KA 2H5EA 3CWQA 1PV4A 1IN6A 2FN4A 3BS4A 2IT1A 1JJVA 3LVQE 4FXPA 2EFEB 3SNHA 1BKDR 4D25A 4O25A 1R6BX 1N0UA 3W90A 2BMDA 2ZI7A 1KK1A 3Q8XB 4IDOA 1SVMA 3I61A 3LX8A 5CDFA 4DDWA 3KTAB 3TRFA 3T15A 3KJEA 2MMCA 4K81B 5KU1A 3IDQA 2IF2A 1SXJE 2JATA 1Z29A 3OEED 4D2IA 4CEHB 1AGPA 1FQKA 1F2TA 3SS8A 1K8RA 3W8NA 4C7OB 1SXJB 2XB4A 4IJMA 1X8LA 1T5LA 1BS1A 1NY5A 3K8YA 3HP1A 3JZAA 5CB8A 3PEWA 5L3SB 3EZFA 1AKYA 1UBEA 4A8JA 3HR8A 2PBRA 1YVDA 1CJVC 4FWIB 1E1RA 4IXMA 4B3FX 4BFTA 4P32A 4PHHA 2ANCA 2WZQA 1HA3A 1YZNA 1YRAA 3QF4A 4DDVA 3U7HB 2BEJA 4KV9A 1ZUNB 3MD0A 4L16A 2ZI3A 5J47A 4Q66C 4EPXA 3MFYA 1Y63A 3NVAA 1CTQA 4TQAA 4H1UA 3SFVA 3C16C 3AVWA 3MJHA 2IXFA 4POAA 3OZXA 5D3MB 1CR0A 4PSVA 1E79A 4KITB 2OBMA 1M7HA 3VQTA 3KFVA 3QF7A 1WQ1R 1B0UA 2GJ8A 1UFQA 3ZLJA 2AWOA 4NYMQ 3GEEA 3BFKA 4ON9A 4N0DA 1FX0B 2F1RA 1G8YA 1XEFA 3OIWA 4Q1EA 4FCWA 4JL8A 4ACAA 4FMDF 4TT3D 1KI4A 3GJ6A 4GBMA 1S9HA 2ZJBA 3N5CA 4QL3A 2V6IA 3BWDD 2W2XA 2EYQA 1XTKA 3PEVA 4AIIA 5L3RA 1JR3A 1FFHA 4JYCA 4HEJA 4JLKA 5G53C 3VR1A 1ESMA 1TQ4A 2KWIA 2YOGA 1YZQA 1JR3E 3PFIA 1WMSA 4TLCA 4F91B 1WA5A 3EZ6A 1KK2A 1P2SA 4WA7A 3QPUA 4RSGA 5EJEA 4KFTA 2BBTA 2WSMA 3H84A 1E6CA 2KB0A 4I1UA 4OHWA 4J0QA 4OHYA 2XSZD 1N6IA 1P72A 2V7QD 4UXHA 1XPOA 2YOFA 2QN6A 4MYHA 4HB0A 2AK2A 4QGGA 3UMRA 5FTLA 3DKPA 4EQ6A 4OK6A 5FPHA 3OFNA 3U7EB 5DGXA 3EIQA 2OFOA 1GL7A 1P2VA 4MKHA 3Q7QA 3UANA 4OQLA 3A4MA 4TWZA 1AGRA 3TGPA 1H8EA 2ATVA 3DOFA 4IDQA 1Q3TA 5LBIA 1SKYE 2ZJZA 3EASA 2ZJ5A 4EDHA 2E87A 1WBDA 1XJ0A 3CM0A 4B34A 2B7CA 4LJ5A 2DY1A 3FE2A 5L8VA 3CONA 4JBXA 5EXXA 4M2LA 2GZHA 1PJRA 1OFTA 2QPAA 1ZM4A 4V0OA 1HUQA 5EP1A 3ZVNA 2BCGY 2J7KA 3UATA 1IY0A 3REGA 1FMLA 3ZVRA 3RYTC 3B9PA 1XF9A 5LPNA 4QBIA 5K8TA 3FMOB 4OQFA 1C9KA 1LV7A 2IWHA 1Z5ZA 2B7BA 4IHQA 4OHZA 4BFUA 1TF2A 2W2TA 1A1VA 2QP3A 2GXUA 2C98A 5IDVA 3QOFA 4OBEA 1DG1G 3OE7D 1UJ2A 5GJBA 1U81A 1CIPA 3TQCA 4C7OA 1SXJA 3AM1A 2GF9A 3EZ2A 2OSBA 3A1UA 2HCBA 4HAZA 4BFXA 1FMJA 5KPJA 3FHTA 4NDZA 1Q1BA 4GP7A 2JLXA 3SN6A 2FNAA 5JBQA 2ODEA 1XXHB 3U3RA 1J8MF 4LJ4A 4AYTA 5EP4A 1VIAA 3MAAC 1M7BA 3I62A 3KJHA 3OEEA 5DSZA 1CKEA 5EE1A 1W4AA 4OYHA 5FR1A 3BRWD 3F5FA 4F92B 4PPGA 3DM9B 3CWZA 5FTMA 5HR5A 1TU4A 4GPTA 2ZXUA 4C0HA 2DB3A 5CLQA 2Z5FA 2OESA 2ZRKA 5G41A 2UKDA 5AUNB 1NN0A 2ZAMA 3DHWC 4M9QA 1PLKA 2L0XA 2YYZA 5HE8A 4UNNA 5C46F 2BCJQ 2ZSFA 4ZDIA 3I72A 2REOA 3KUCA 4HLDA 1KI8A 2OLKA 1ZM3A 4Y0VA 3NDBB 5EE3A 4UNQA 5HTKA 2ZM5A 2F1JA 5DN6A 4D4KA 1F6BA 2ZREA 3IIKA 4RZ2A 3PR1A 5JWRA 4ZKEA 5SZHB 1MR3F 4DEYA 1J90A 5JWHA 1S4QA 1W47A 2WWGA 2OILA 4HZUB 4KODA 2FEOA 2ONKA 5E7IA 1IBRA 2ZRCA 3P4YA 4RD0A 3SI7A 1WP9A 2NZJA 4PSAA 5IT5A 3L0OA 3RRYA 5K8LA 2R62A 2ATXA 3LX5A 2G6BA 3IHWA 1JALA 2OEPA 3HPRA 2AL7A 4BUJA 4LBVA 2Y8EA 1N5IA 4Z8YA 4FCTA 4A6XA 2NOAA 2WWYA 1R5OA 2AKAB 2ZROA 4DSOA 1G7SA 1U99A 1AQYA 2IYVA 4LOAA 1KI7A 2IS2A 3K9LA 4BLTA 1AK2A 2WTUA 3WNDA 3ZZTA 5JS7A 2ZVPX 3WHLA 1RRFA 2IS1A 5DE3A 2PLRA 2Z43A 2GXAA 4LC1A 4EFMA 4M9SA 1YR9A 2EQBA 2F1IA 3K1JA 2BIFA 3QKRB 4DSTA 3DOEA 4B35A 4LUCA 3AEZA 4LYFA 3FKQA 2HCJB 2GHIA 3G5UA 5F9FA 1F48A 3VKHA 1VG8A 1GTVA 1VHTA 2K5UA 2C03A 3N70A 2AN9A 2QT0A 2Q0HA 1T8UA 2HLDD 3QG1A 4A0RA 2H57A 4TN1A 4QM7A 1PVOA 4DLUA 4O2LA 1JBKA 2ZUCA 1T8TA 3OHMA 4BEBA 3U6BA 2PEYA 1H8ED 1SVLA 2G88A 3B13B 4B71A 1I2MA 4P0TA 2FPKA 4S35A 4TYWA 1NVXQ 1MT0A 4PPNA 2G9NA 1R0YA 3KKMA 3PUVA 2QL6A 2AKYA 4M22A 4B74A 3UMSA 3R7WB 1DAKA 2FJUA 3WBJA 1KKLA 4A8JC 1VHLA 1W4RA 3GCGA 3SEAA 1TADA 2CE2X 1KY2A 1II8B 3I92A 3IBYA 1UPTA 5H8WA 1KO8A 2V1UA 1NY6A 1U94A 1ZUHA 2IBMA 2C5LA 3NC0C 4LJYA 1JEEA 1R0WA 2ZS8A 2ERXA 2QAGA 3GFPA 4MQBA 2FV8A 3IHLA 3O47A 4RFSA 2VHQA 2ZSBA 2G0NA 5TMPA 2UZIR 1ZNWA 1BO6A 5EUMA 1R4AA 1OLOA 2XOKD 5JJKA 1E2QA 4KVAA 2IYWA 3CPEA 3C5HA 2QNRA 5LD2B 1IXZA 1RVDA 3EA5A 4M9ZA 4RCZA 2O8EA 3RANA 4YMVA 2QBYA 4R7ZA 1NI3A 4W9MC 1Z6TA 4QBGB 4FWTA 1Q1EA 2V8OA 2GJSA 4TSFA 1W2HA 1N6KA 1E2MA 2A5FA 4MDFA 1E1RD 3NKVA 1JJ7A 1B23P 1HYQA 1EGAA 2HV8A 3KJIA 4CVNA 1M8PA 2CK3D 4GOKA 4HDCA 4HZUA 4XTCS 4MRRA 4QNRA 2NIPA 3HYTA 1C1YA 3AF3A 3U3OA 5A5GA 4B2IA 1FP6A 4KBGA 4ZCMA 3L43A 3IKJA 3NH9A 3QVVA 4M1MA 5AJWA 4BFZA 2A2ZA 5KYKA 3B9QA 3QJYA 4KHZA 4AURA 5AJZA 1E79D 1N2CE 1MO4A 5TVKA 1M7GA 1LS1A 1MH1A 1JPNA 1ZCAA 3BH7A 1W7AA 1SVOA 3PUXA 2R6DA 3CF6R 2H7VA 1N3BA 2GESA 5KPDA 4PX9A 2XJ4A 5SZKB 4LI0A 1XCGB 1CXZA 1EFHA 1NVWQ 3H4MA 4E5UA 1EG7A 3FKSD 1U8ZA 3BH0A 3A37A 1WRBA 2QTVB 2HF8A 2ZUDA 4JS0A 5TB5A 1I4LD 3QKSB 3PCRB 2IEYA 2J0QA 1RJ9A 1I4DD 1KO4A 5EE9A 1T3LA 2VHCA 4C0AC 1GUAA 2VP6A 4PANA 3L0SA 3RDPA 3I1FA 4PFSA 4TMXA 3CH4B 4Q7LA 3VU9A 1ZC4A 1DBSA 1GZSA 4AYXA 3WNCA 5KUTA 2WOOA 2YC4C 4IFBA 4MDEA 4AY2A 2D3WA 1DOAA 1W36D 4CF7A 1ZP6A 2GVDC 1LW7A 4WXRA 4Q1FA 2VSFA 5KHOC 1G18A 4G5OA 4NCNA 3GFOA 1P7CA 2VQSA 2O8FB 1KGDA 1ZM7A 1FQJA 3K09C 1JB1A 2BMJA 2F3RA 2BBWA 1XEXB 2ZJ8A 3RABA 4FW9A 1CJUC 2BV3A 3B7GA 3CRVA 1XMIA 2D7CA 3EWSA 1LTQA 2FSGA 4TMKA 2JLVA 2NG1A 1UAAA 5JSZB 4ARZB 3OIYA 1VDZA 4JKIA 2VP5A 2JASA 5DIFA 5C4MA 2JLWA 3E1SA 3TR0A 1CLUA 3QY0A 4Q9KA 1H65A 1GM5A 1W48A 1PLJA 1IXSB 1NMXA 1E0SA 2AWNA 2RGGA 4O3MA 3NEJA 3A36A 4GMDA 2DFNA 2QAGB 2VA8A 3FKSA 1Z2AA 1TMKA 4RFSB 4D81A 2ZPTX 1SZPA 2QENA 2WHXA 3EIEA 1YJ5A 4B2PA 4BZXA 3GLIE 2FA9A 1F2UB 1E9CA 3SZRA 4MKIA 2J0SA 2Q6TA 3KB2A 2IYUA 1FNNA 1G1MA 4KLZA 4WW0A 1AZTA 4DWJA 5C2JB 2ZSAA 2GKSA 1LF0A 2X19A 3RLFA 1JPJA 1OXUA 2GZAA 1U98A 2J87A 1KMHB 2YVUA 4TYNA 3KQUA 4DKXA 4LX0A 2RHMA 1OJLA 1GVNB 2EVWX 4M53A 1YZGA 3UWOA 1ZU4A 1DARA 3QKTA 2CDNA 2E9SA 4JJZA 5D3QA 4GZMA 5AUPB 2GCNA 4QM6A 4M8NE 1CRQA 3CX8A 4AG5A 4IXNA 3K0FB 5JCPA 2JJ8A 3QVUA 1XMJA 4M21A 1G7CA 1EESA 2LCFA 2F43A 4BRWA 2BJVA 2G3YA 2BJWA 1KAGA 4QHSA 3CB4A 4MGIR 2XGJA 1K5GA 3PEYA 4HDOB 5EQTA 2C78A 1TAGA 3D7MA 1ZIPA 1NP6A 2RGBA 3ZZ0A 2G1JA 2QTHA 3QQ5A 5AUOB 1DAMA 4GZLA 3JVVA 3LRPA 1KJYA 4MH0R 2FSFA 1K5DA 1L4UA 5JS8A 3F0TA 1OW3B 5JLJA 2CK3A 2YKGA 1QHYA 1A82A 3W5IA 1IY1A 4YXWD 1G19A 1HE1C 5K8UA 3ZIAA 1U8AA 3Q72A 4R2HA 3I5YA 1RRPA 1W36C 1NL3A 4CEJB 3NBYC 3KXKA 5KSPA 4YONB 2WSSA 2N46A 4RD1A 1ZJ6A 2IXGA 4WAUA 2OXRA 1VMAA 1KI1A 4PC2A 2XB2A 1E9FA 5BN3A 2EWWA 3QG5A 3L8ZA 1E9EA 2AFHE 4LYAA 5JJLA 1EFTA 4P3YA 2JJ1A 1FNMA 1XEWY 1Q12A 3CF2A 4V0KA 5HPYB 2XXAA 4TTQA 5EUQB 5FI1B 1KDTA 2GBLA 3S1AB 4DLTA 3KL4A 4FN5A 1VTKA 2C2HA 2LWIA 4DT1B 2BBOA 3BXZA 1XX6A 2O8FA 3A4LA 3LFUA 5BN5A 5H1YA 5B64A 4BFVA 4E07A 1CRPA 3VX3A 1T91A 2OCAA 3TK1A 3SC3A 5JSZA 3QPVA 2OZEA 3U60B 1VCOA 1MV5A 3OIVA 1G5RA 2WJGA 2OCPA 1OKKD 1OV4A 3OIUA 3B6EA 3LV8A 3U44A 1J2JA 2O0HA 2ODBA 3T5DA 2HLDA 4DUGA 3P26A 1CEEA 2OO7A 4GNKA 4MYCA 1XNJA 2NO9A 3ETLA 3ADCA 1W2GA 2QUZA 2BEKA 2HT6A 2ZRDA 2A78A 3T1OA 3B8HA 1E2GA 3AVYA 1F2UA 2FGJA 1YQTA 4ABYA 3T1QA 1DEKA 4RKEA 1W49A 3O8RA 4NCKA 3PITA 1CBUA 5A4JA 1ZRHA 1NSTA 1XTQA 3O8DA 2IYLD 4M1WA 1DE0A 4F38A 2FZLA 2ONJA 5JJIA 2O52A 3CPHA 2ZVQX 3E5HA 3T35A 2ZE8A 4IEEA 4RVCA 5JCZA 4LSGA 1Q1QA 1XTJA 2GAAA 3EARA 3U3JA 3LO5A 2E1RA 2ZYWX 4OI2A 1QHNA 4V0ME 1FZQA 4Q03A 1Z47A 4JMPA 2NMVA 5FL7A 4DSUA 4RJLA 2F43B 3Q9LA 1Z22A 1E3MA 3PXGA 3CPJB 4M1KA 1TX4B 1P60A 4RZXA 4DBLC 3G82C 3LBHA 4Q48A 1RPZA 1Z0KA 3EZ9A 1COWA 3X1WA 3LDAA 4JLPA 3ZVLA 5DISB 1RZ3A 5TARA 3RVBA 2FH5B 3E70C 2PCJA 4LRWA 4OL0A 4DUGD 1PLLA 4U7DA 5EE5B 2WWHA 3CR8A 5FBVB 3AF0A 4US0R 4B2LA 4PZYA 2G1KA 5IRCD 1D9XA 3AQ4A 1S1MA 1W5SA 2OXCA 3TVTA 3A6PC 3PUWA 4PQRA 3CR7A 4ESHA 1KI2A 3CZQA 3LY5A 2AXNA 2CLDX 4TQ9A 4DLRA 4C0BA 3Q5DA 5FPYA 3UMFA 2GJKA 2O0JA 4HAYA 3OEHD 2IXEA 5B57C 1JQLB 1E2LA 1D2EA 1F5NA 3U3MA 3SJCA 5J5CA 3VAAA 3BC1A 3ZIAD 721PA 2ZE7A 4ZI2A 1L2TA 1XDBA 2W83A 2P67A 4BLRA 2D4HA 2C77A 1W4CA 4JL5A 1VG9B 3C8UA 1FUUA 2KBFA 1H8HA 3S1AA 1MO3A 3BB3A 2J1LA 1TTTA 2O0KA 4Q21A 5FL7D 4H1VA 3THOA 1P3JA 2QT1A 1E2DA 1DO2A 1KDOA 4FD2A 4M1YA 5FUYA 3W9YA 4DCVA 4Q7JB 3SJAA 3P4XA 1G20E 1UEJA 2J46A 3CH5A 3N2IA 2F1HA 2KE5A 2ZSDA 2V1XA 2J0UA 5BYJA 2EFDB 1COWD 2NPFA 2JAQA 3CO5A 4QGFA 3SE0A 5FUXA 4DLWA 2F7SA 1EFCA 5CIWA 3AKEA 4YDSA 3HR7A 3ZVMA 5F98A 3D8BA 4NCIA 3U4QA 4FMCF 2W00A 3MGCA 2JGNA 3LW8A 3Q3JB 2ODNA 1KNQA 2ORVA 2BHRA 3IILA 3B1YA 3K0EA 1XRJA 3WRXC 4PHFA 1KO1A 2FPMA 5JRZA 4XH9B 2ZRNA 1N6HA 3W6NA 2QGZA 3QEOA 2WJVA 2FE4A 1OHHA 3AGQA 3A1TA 2IYXA 3KQKA 4C0QC 1YKSA 3M6AA 2HEIA 5L3QA 2O8DA 1O3YA 4OJQA 3IIMA 4EQ6B 4DLYA 2ZU6A 2QE7D 2J0VA 1E9BA 1KDRA 1TEVA 3TUJC 2F9MA 3U7GA 2QTFA 1YZLA 4GRAA 4Q4JB 3T06B 1KI9A 2R6GA 4Q4LA 5F3WB 4Q1CA 1XTSA 4MGKR 2PX0A 5KTYA 2WKRA 1UADA 2ZRPA 4NKRA 1MO6A 3IBGA 2AXPA 1XWIA 2BWJA 2DWOA 1Q22A 1XMSA 4E03A 3U6KA 1T6NA 5FBRB 5C18A 4QJ5A 3CX6A 5FR2A 1VCMA 3CUEF 2GEUA 4P33A 1YR6A 1Z0JA 2YZ2A 1G3MA 2WJHA 3WYFA 3VNVA 1EFUA 3WYGA 1YR7A 1U90A 1NVVQ 1Z28A 1XD9A 3NTUA 4TL7A 4WZAE 4XVUA 2AD5A 4XWAA 4ZDKA 1G5PA 1DAHA 4N3NA 2QI9C 4L5BA 4IDNA 3AF4A 2C99A 4PAMA 1P61B 2FOLA 4D82A 1E9SA 4B3GA 1AQUA 3MWJA 4M1SA 3O8CA 3VMFA 2Z4RA 1NNEA 4URZR 2C9YA 2QQ0A 1HT1E 5FTKA 4UJ5A 4URUR 2VPPA 1CF4A 4NMMA 2OV2A 2XAUA 1FOEB 4NL4H 3KKQA 1UBCA 2G0TA 2YOHA 3AUXA 5EXPA 1N5KA 1HURA 1P75A 4MUBA 4UNSA 5J4KA 5FOTA 2AK3A 4WVFA 2JIZD 4LJAA 3TSOA 3J81k 4YLGA 2ORIA 4US1R 1E94E 1M74A 1FP7A 2V4ZA 4Q9HA 4AKIA 1ZUIA 4EPWA 3NBFA 3X1DA 1KSHA 1XXHE 2W6ID 3UXMA 2GCPA 3MCAA 4JLNA 1N5LA 4YXWA 5L3VA 1YZTA 2IHBA 1G6HA 2GK6A 3RWOA 3B78A 5GJWC 4MGZR 4Q7MB 1US8A 3IO3A 3KFXA 3TUIC 2J0UB 3ADKA 3H0KA 3Q7PA 4OJKA 2GILA 4TL8A 4LJ7A 3I4LA 4UJ3A 4HUQA 5GJCA 4O2RA 3WMGA 5DNYB 2W0MA 1F60A 2ZRJA 4HAVA 4KSBA 1KDPA 2DBYA 4JT2A 3RS7A 5CM8B 4YQFA 1N6LA 4F4CA 3VTKA 1QF9A 1XEWX 5BXQC 3C4JA 4JLAA 3T5GA 2ZJAA 4LBZA 3I73A 2QRNA 2JJ1D 4GSYA 3KZ1E 3I5XA 1OFIA 2LKCA 4UKDA 3GJ8A 1GRRA 4QC2A 4Q4AA 4QJ3A 4ACBA 1XCMA 2GVZC 1DELA 3DVLA 4LPSA 2FPLA 2XNDA 3QEJA 5FOUA 2FFBA 2I1QA 1Z0AA 2QORA 5FBWB 3THWA 4GFDA 1U0HC 4XOIA 1J70A 4NONA 3HU1A 5L3QB 2JA1A 2O8DB 3A1SA 3W6PA 4AI6A 3P32A 4ASUA 2NGRA 3RRMA 3CRW1 1RIFA 4IVPA 4QXAA 1HH4A 4LHXA 1G17A 4A2WA 2DPXA 4Q19A 3LBIA 2FZ4A 3VR5A 4BLQA 2X1VA 5DYIA 2ZYUX 2OFXA 2VYFA 1G3IA 2ZU0C 3B5JA 3EXAA 5EZ5A 1NF3A 1KI3A 3PG5A 3QKRA 1TU3A 2WMOB 1Q44A 4PC1A 5DN6D 5IHPA 1L8QA 5IK2D 3W3ZB 1YZUA 4KFUA 1EX6A 4DLXA 4CGZA 3KXLA 1MRSA 4UNPA 2QRZA 4C4PA 1G41A 4WZBE 1Z0IA 4IKEA 4PO9A 3ZS8A 3TW4A 2MMGA 4B47A 1AN0A 4B76A 4YC7A 2ANBA 3VHXA 3LAWA 2ZRIA 2YNMA 1GNPA 3QSYA 121PA 5C4GB 2DFKB 4JLJA 4KLNA 1VIYA 2R8RA 1YU9A 4TLAA 2GA8A 1QHXA 2WIAA 4D4LA 4DXAA 4MKFA 4C9BA 4OI1A 3LLMA 2SHKA 3IEUA 1SVKA 3ND8A 2AD1A 3BBPA 5JHGB 5DLQC 2WV9A 2HF9A 2VF8A 4L9SA 4DSNA 3FFBA 3MRSA 3R7WA 1KOFA 3FMIA 5AWFC 4XWKA 3C7KA 1ZD8A 1ZCBA 2EU8A 2D7DA 3WRYC 4Q4HB 1KAOA 1R8QA 4EKDA 4LZZA 1DTSA 4F4IA 1Q0UA 1II8A 2XSZA 3QXCA 2Q9CA 1IM2A 2HYIC 2QP9X 3AKDA 1SVWA 2PJZA 2AHOA 2YWFA 3BORA 2CBZA 5TXGA 4G5RA 3TE6A 3V4RA 3VNUA 4C30A 4PHGA 1C4OA 4MITA 3OESA 2BM0A 2CJWB 2H18A 2IF0A 3GLHA 4BEJA 1XZQA 2PLFA 1FPMA 1P4SA 2EFCB 3PJRA 1AZSC 1E96A 3GJXC 3PV0A 3MWYW 4U02A 4XWOA 3ADDA 2GEVA 2WJJA 2YV5A 3EPKA 2REXB 5DHFA 4R98A 3AUYA 4ASUD 2OG2A 4UXJA 1U9IA 1NIJA 1GKYA 3R9XA 4D0LB 2QSYA 1BMFA 1S2MA 6Q21A 1W5TA 2RHDA 1US8B 4LV8B 2WIBA 4OQXA 5FL3A 3AVOA 4MRPA 1L4YA 3WBKA 2BMEA 2R6FA 1KSGA 4TT3A 4RCYA 2XJ9A 5KNBA 4JVSB 3SHFA 5FBLB 5AJXA 4A82A 2FFQA 4KI0A 4QOSA 3CNOA 3THYB 2QAJA 4M9XA 1KNXA 4X8HA 1Z6GA 2LKDA 1OXSC 4IOLA 4AG6A 4D0NA 1OXVA 3NBZC 3ADBA 2QA5A 2WJIA 4R71A 3L0PA 2NZ8A 3LXRA 4ITRC 3TMKA 4XVRA 1H8HD 5GADl 4C0SA 1UKZA 3EG5A 1YE8A 5KDDA 3K70D 2WAXA 2A30A 4E09A 4TYYA 1DS6A 1OF1A 3UK6A 1OH8A 2VL7A 1J7KA 5TV2A 2NPIA 3UIEA 3U7FB 2RAPA 1AJEA 3EWAA 1P2UA 1AS3A 4Z8XA 3Q85A 2FFAA 4CEIA 2BC9A 2G83A 4QFMA 4PQYA 4CT5A 5KDLA 1GKUB 1NKSA 1ZW6A 1QHSA 3AP3A 3OFND 3T61A 4DCNA 3MG9A 1OYYA 4TSFD 1W44A 1PZNA 1ZYUA 4ILEA 1LNZA 1QZXA 2N42A 1EFRA 2GWHA 2ZRBA 1RJ9B 3H1TA 2Q9AA 1FTNA 4NE2A 4JZKA 1ZVQA 5TDHA 4G1UC 2PX3A 1CR1A 2B8WA 1QRAA 2QU8A 2O8CA 4K8OA 2Q3HA 5LB2A 2BMFA 2KI5A 2X77A 1MABB 2ZRLA 3F3YA 3VU9B 2WICA 2YHSA 4WIAA 4D4MA 2VHTA 1JR6A 3BE4A 4TTRA 2OHFA 1A7JA 3LA6A 3CF0A 3KQLA 3EPJA 1OIXA 2QQEA 4BPBA 4Q5IA 2CHGA 5GVSA 3K70C 5DH9A 4QNMA 1E0KA 4RKFA 3U2QA 3AP2A 1XEXA 2J7PA 2XTMA 4EJSC 5H70A 3AF2A 1R2QA 4ZO4A 1G8PA 4C3ZA 1UF9A 4JL6A 4JBYA 4V03A 1QBKC 4Q4HA 4HYYA 1S0UA 2OM2A 2Z83A 4LJ8A 5FUVA 3LWNA 3M0EA 4LC0A 1IOZA 5DHAA 2GJ9A 1JXOA 4DVGA 4EFNA 3X1XA 1ESNA 3WY9A 5BW8A 1E99A 3CIOA 4XJXA 4EJSA 1OYWA 4LHVA 4LBYA 2CJWA 4M1OA 4URYR 3AP1A 621PA 1D6JA 3HDTA 1JXMA 2BVNA 4ESVA 4B3BA 2QZ4A 2CCGA 2GF0A 3LNCA 2HXYA 1NN5A 3SU8A 4G01B 4DCSA 5CJ2A 3IO5A 4TYQA 5DI3A 1Z8FA 2FFHA 3UPUA 3AH8A 2VIIA 1DO0A 4FINA 5BYKA 2CLCX 3KKPA 1CR2A 5AK0A 2DFLA 3HJNA 4F7WA 5JI2E 1VYUA 1XD2A 2HUPA 3MLEA 4RZ3A 3VR6A 2PEZA 2J41A 1A4RA 1KSFX 4MA4A 4OQNA 4ZV4A 1DVRA 4EPRA 2R65A 1GG2A 3IIJA 1XTRA 2J45A 1OIWA 4V02A 1Q1ZA 3K0AA 2AR7A 4MYUA 1KYIA 3K0FA 2CVFA 2JLUA 5F9HA 3THYA 4CIDA 4KJZA 2JLQA 1NVVR 1R8SA 1OE0A 3LD9A 1BMFD 2I1VB 1GSIA 4II7A 3RAPR 3SJZA 5J4VA 5J4YA 4O0MA 1WBBA 2JLSA 4N0EA 3ZGXA 5AJVB 1CULC 3UG7A 2CNWA 3KXIA 2P65A 1KY3A 2QG6A 1D5CA 2V6JA 2GAOA 3TW8B 2F6RA 2ZE5A 2ZQ5A 1OFUX 2IYYA 2PMDA 2WKPA 3QENA 4CEIB 2BKUA 4TL6A 3VKGA 1HE8B 2CL6X 4WBSA 1WCV1 4I1VA 5TY0A 4BE7B 1JNYA 2PZFA 5KO2A 2F9LA 2RB4A 1DPFA 1QHGA 2XITA 2IUUA 2JJ2D 2WPDA 3QI2A 4CEJA 2I4IA 3RWMB 4WZ6A 1IN7A 1ZD1A 3WP0A 3ND9A 4B73A 4V0LA 2ZIAA 1T4GA 3P27A 1ODFA 3RS3A 4DDUA 3CNNA 2P6RA 2RH5A 4JIMA 3FHOA 3K0CC 1T3HA 1ZINA 3GEHA 3GJ5A 2XX3A 4UXIA 2ZANA 4TLEA 1NBMD 3AF1A 3SBDA 3TJZA 1XBTA 3F8TA 3IPXA 4ZI3A 1VYTA 4DZZA 4HLUC 1ZNZA 2ZI9A 3D3QA 5CM9C 1LB1B 3IEVA 4B48A 1AM4D 2R44A 1U0JA 4BLOA 5LDDC 2RGNA 2ZI5A 3FWYA 3B82A 1KO7A 2QM7A 3KDSE 4MGYR 4Q9IA 3ICEA 2CCJA 3B1XA 4CW7A 2HDNB 1LY1A 4Q1BA 5GVRA 1U2RA 5FI0B 5JMTA 1UKVY 1D8TA 1OSNA 1P73A 1BYUA 4KXFB 2CHQA 4M0LA 5EXSA 3FMFA 3QKUA 4V0NA 1JAIA 4IVQA 3GJ4A 1XU4A 4L4UA 2QPTA 4IOMA 1IONA 3U44B 1JECA 1VPLA 1CP2A 4M1TA 4BWYA 3DZ8A 4IFEA 3LBNA 4EJSB 3SBEA 3FDIA 3KX2A 4BLPA 2CCKA 4Z54A 4JYBA 1TQDA 1TQ6A 1NG9A 5FTNA 1UEIA 1J8YF 1MRNA 2CNWD 2ZRMA 4KVGA 4TQUS 3EC2A 1E2KA 2I3BA 2VP4A 4FCVA 2RGEA 4GP6A 2DYKA 1N0VC 5DI3B 5G3ZA 3MWLA 1GP2A 1ANKA 3AVQA 1W0KD 1KI6B 1NMYA 2YWHA 4B3DA 4TMTA 4GOXA 1G291 1JR3D 3OE7A 4BFYA 3SYNA 1XD2B 3NXSA 4PHTA 3T1TA 1IHUA 2C9CA 2RMKA 4I1OA 4YMWA 4ZDWA 4E22A 1GWNA 5HKKD 5E3HA 1KJZA 3DPUA 3I8SA 2JJ2A 2WPDD 4DLVA 4TZ6A 4PPFA 2IK8A 5JI3E 3CBQA 1Z63A 3SQXA 4KYIB 1IQPA 1OH5A 4NTZA 2XZLA 2W6JD 3TIFA 1OKKA 2DR3A 3FB4A 4TLBA 1JQJC 3RNLA 4HLCA 1HQCA 3SQWA 3VHLB 4IW3B 2QMUA 4AYWA 4A2QA 1E2NA 4KAXA 4KU4A 1P9NA 3WMFA 1E4YA 1LF5A 3EZ7A 4YMSA 2ZRGA 3DZDA 1W46A 1E2EA 3TQFA 2C8VA 4AKHA 4LV6A 3V4FA 1P62B 1XP8A 4LHZA 1X8KA 2PT5A 3BB4A 5JZVA 2VP9A 2CL0X 2X8AA 1V43A 1R10A 2ZJOA 4DB2A 5CITA 5FH9A 4FI3C 4W5JA 3WMEA 4KSCA 1P9RA 2DWQA 2IUSA 4JVLA 2GXQA 2J59A 2GZDA 1TNDA 1GNRA 4IOKA 4GL2A 2KBEA 2IS4A 1X86B 3K53A 4IOJA 4PAOA 4LK2A 4N1AA 4LBWA 5B2ZA 1GRNA 1XJCA 3A1WA 3ZJYA 1VYVA 4XD7D 2OLJA 5J4HA 1KZGB 2VHUA 4URXR 2OBLA 3TVDA 4Q9JA 1E2HA 2Q3MA 4W5WA 2RCNA 5FOVA 3EC1A 3NG1A 3DDCA 1RYHA 5FOSA 4GDFA 4Q02A 4OI4A 3R9IA 3NH6A 5BWMA 1P2TA 1KK0A 4MKGA 4C0JA 5ELXA 1HT2E 3AVVA 2UVQA 3RS2A 4TMVA 4PXAA 4PZZA 5A0FA 2OT3B 5HKKA 3BAFA 5AJYA 1M1YE 1YZKA 4ZPXA 2B6HA 1KSJA 1N0WA 3OAAD 3TAUA 4JLDA 1JEDA 3GFTA 3WNBA 3AGPA 4IEIA 4QHTA 4NYMR 4DDTA 4X8LA 5P21A 1NJFA 2MSEB 2W6JA 3C41J 2RGXA 4RD4A 3U3KA 2J9RA 4JLMA 4B33A 1NSFA 3U4QB 4W7SA 3ZD6A 1UBFA 3L2OB 2ZITA 5CB6A 4D26A 1X1RA 2YC2C 3BD9A 4JJKA 3KQNA 2AX4A 1ETUA 2H92A 2J3EA 1W36B 3PUYA 2WMNB 3RS4A 2QMHA 3EW9A 3AKYA 2ZS9A 2B8TA 4DLZA 3ZS9A 4URVR 1QHHB 2WOJA 1Z08A 4NZYA 5FUWA 4S2EA 1KI6A 4YMUA 4CEHA 1X1SA 2WWWA 1ZM9A 3VFDA 1WXQA 2Z4SA 4HATA 2OCBA 4Z51A 3H86A 1A2BA 2NO1A 4U00A 2P5SA 1II9A 1Z2CA 3ASYA 1II0A 1W4BA 4G0NA 1UM8A 2WWXA 3P1JA 5L3SA 5KSYA 4Q4JA 4A8JB 2OFWA 3REFA 5FTJA 5JRJA 3RSOA 3GQBA 2O8BA 3QBTA 3QF4B 2QY9A 4IDPA 3BFVA 4XD7A 5FPKA 1W0KA 1GL6A 3FYHA 2JLZA 2CHVA 2GNOA 1RYFA 1ZMXA 2BDTA 1ZC3A 2W58A 1J99A 3CKLA 3GLHE 4EFLA 3GP8A 4YDHB 4PC3A 2D62A 1E69A 4A15A 1XB2A 1W1WA 1D2MA 1UKYA 5DYGA 2VF7A 2XOKA 1Z83A 1HQYE 4DEXA 2ZYVX 3ZZUA 2GCOB 2V7QA 3ECCA 1YR8A 1RRCA 2IW3A 2GETA 3NC1C 4QGHA 4A0FA 2CEAA 4OK3A 1OHHD 2D06A 2RGCA 1XZPA 4ZKDA 3K0SA 3B2EA 1X6VA 2RKOA 5E7MA 2ERYA 1FX0A 2QAGC 4LV5B 1VKJA 3OAAA 4PZLA 3HYRA 5CK4A 1R7RA 2OUKA 2C96A 1Y3AA 1G8FA 1AKEA 2FEMA 3QUSA 1UDXA 3PQCA 2H17A 3CRRA 3CNLA 1IJEA 5CDFE 3KJGA 3EPHA 521PA 1VCNA 2EWVA 3X1ZA 4Y0AA 3ICQB 2H1LA 2D74A 3WXMA 4ZCIA 2UZ3A 2REBA 4A36A 1R0ZA 1HY3A 2JEOA 2W0SA 2VTKA 3QNUA 4HLUA 4PTLA 3RC3A 2V55B 1QG4A 3TUZC 3BGWA 3TR5A 4EPVA 1BOFA 1CJKC 4A92A 5KSOA 2YJTD 4G5SA 2QP4A 3ASZA 2ORWA 4NCJA 4P4TA 4B3XA 4P31A 4BFSA 4EPYA 3TH5A 3M4YA 3GPLA 4JVMA 3TNFA 1SXJD 2ZRHA 2PT7A 4DRZA 2FX3A 5JHHB 1OXXK 4R9UC 4A1FA 2XTNA 2YWGA 4W5HA 2KSQA 3K9GA 2ZSEA 1XJQA 4KYUA 2D2EA 1R0XA 3LQRA 4HUQB 3A4NA 4P4UA 3X1YA 4FMCB 1OB2A 1I4TD 4HLQB 1G21E 2EFHB 4BZQA 2PH1A 4JT4A 2Z6VA 3FHCB 4NH0A 1GKIA 1KO5A 3AVTA 2Q3FA 1G7RA 3HU2A 5FFMA 1NBMA 3W6OA 1N6OA 3L82B 3GJ3A 2R2AA 4URWR 1R5BA 2A5DA 1K6MA 1WDTA 4Q4AB 1KJWA 1NN3A 4DHEA 2ODWA 3EPLA 2R6CA 3GJ0A 2GEDA 2PL3A 1OB5A 4WXPA 3GLFE 1FTSA 1VG0B 3KKNA 3NEYA 3DMNA 1QHHA 4XVQA 1G8HA 4CDGA 3THWB 5HZKA 4DIDA 4RY2A 4OHVA 3IGFA 4NBSA 4HDQB 8OHMA 3G0HA 2PZEA 2NQ2C 3UWKA 2VRWA 3NWJA 4D6PA 4C2UA 1JAHA 1XPUA 2IHYA 1E0JA 1S8FA 1ZBDA 2A5JA 1SXJC 4KBFA 1X3SA 5B30A 1D9ZA 2ZJYA 4PQFA 3W8RA 1G7TA 1P9WA 1Z06A 2XTZA 2ZRAA 3BK7A 3LQQA 4G3XA 4LJ9A 1Z07A 4HI0E 1XXHA 2OAP1 1GRQA 1QVRA 3HPQA 1T9HA 4IDHA 4XIGS 1CS4C 3TKLA 3GD7A 1XD8A 2FF7A 3DL0A 2O8BB 2QGNA 4NYIQ 3VX4A 3BH6A 1G5TA 1SKQA 2FGKA 4Q7KA 4B3CA 1EWQA 2D2FA 4HAWA 3EIHA 2PJRA 3K0CA 4OHXA 2QMOA 4TMZA 1OT3A 3CZPA 1CJTC 2DFTA 3DO6A 1XPRA 4M4SA 4V0MA 2IYTA 1KK3A 3DM5A 1EK0A 1Z6XA 2GCOA 5E95A 3W5JA 1S96A 4PO1A 5HCIA 5J4LA 4MYTA 3MSXA 2EFGA 4XTRA 3VKWA 4Z1MD 4DC9A 2XNSA 1TL7C 3M1IA 3O8BA 2RGNC 4JSYA 3BERA 5J40A 5EE0A 5KOYA 3FMPB 5FBQB 4AK9A 4WOPA 3D31A 3DMDA 4F93B 2W2VA 5BN4A 2RGDA 1SQ5A 4LDJA 1GAJA 4Q1AA 3SJBA 4CZ2A 5IF9A 4MUAA 1SGWA 1ONBA 2P6NA 2ASEA 4TLDA 2GBLC 3AV0B 5UKDA 2ZJ2A 2VEDA 4QKQA 3GLIB 3EAQA 4QGAA 4B6EA 1W0JA 1SULA 2NO6A 3WHKA 2IYZA 2ZI6A 3OEHA 4JKYA 3NIBA 2BKEA 2QE7A 3VR2A 2QPOA 4X8OA 1DADA 3GLHB 3QE0A 4H9GA 4I1SA 4F4JA 4P4SB 5AR1A 1XFAA 1E1QA 1D2NA 1TUEA 3CRQA 3FVQA 1ZM2A 4US2R 4LHWA 4Q00A 3QXSA 3VR3A 3DKVA 4TTPA 1Z6AA 1LVGA 5HZHA 1S3SA 3B85A 3FFAA 4CRWB 2MSCB 4NCHA 3HU3A 5KNDA 3A1VA 2IEZA 2RGAA 4NP6A 3I3SR 1OH7A 4D80A 1GOTA 4U5XA 2IS6A 2ZYTX 4QJ4A 3SYLA 1GDDA 1N6NA 1MO5A 4B43A 1E2JA 1NLYA 4TYPA 4A2PA 1S9DA 3NDPA 3PEUA 1AS2A 2HT1A 4X8MA 3K9NA 5CJPA 1SVIA 3T34A 2JDID 2AFIE 4B6FA 4BRUA 2P6UA 4L9WA 4Q18A 4GT1A 1E2IA 3R20A 3AKCA 3FGNA 1OFHA 1TEXA 2WWIA 1P5ZB 5FOXA 2NO7A 1G8GA 3RHFA 4JLBA 2B92A 4D4JA 1G4AE 3TBKA 4ZDJA 1E9RA 5JWOA 3CLVA 2PCLA 1W0JD 2PZGA 4Z1MA 4FIDA 1UDWA 3BFXA 1YHNA 1QG2A 4A0GA 3R9WA 1NVUQ 2F55A 4FMBB 1RE0A 2FU5C 3QIAA 4BECA 4C2TA 5E7JA 2QROA 3CX7A 2IA5A 2ZAOA 5JFGA 3I32A 1E1QD 3C15C 1NRJB 3NBXX 4BLSA 1UBGA 1FUKA 3PIRA 3R8FA 3LXXA 2CVHA 2VSOA 3V9PA 5BQ5A 3T12A 4BZPA 2DCUA 3SYKA 1G3QA 2P0EA 1WB9A 1CJMA 2GXSA 5EXTA 3ZQJA 5LD2C 2IX3A 2ZUBA 3MMPA 4PPQA 3GLGE 1ZAKA 2O8CB 4DLSA 1GL9B 1NKTA 1MABA 3BB1A 5KDOA 2HJGA 2Z0MA 1S3GA 3MWKA 3GEIA 5JECA 4NYJR 4DJTA 1PUJA 1G16A 1N5JA 3NHBA 2A5YB 5SZIA 4L8GA 2GK7A 4ZIRB 3B1ZA 5CK5A 1DAEA 3D6TB 4QBFA 1ZNYA 1T0HB 4R2IA 3IPYA 2O8EB 3AB3A 2IL1A 1T5IA 5JEDA 2QBYB 1S1CA 4JLOA 1Z3IX 2HXSA 4HAUA 2VP0A 2KJQA 2P3SA 2GJAA 4GMXA 5DO9A 4A6PA 1E0AA 1KHTA 4JSTA 1E98A 4LYJA 2VBCA 2BM1A 3ZYCA 2F3TA 1ZU5A 1XMVA 2Q9BA 3B60A 4Q01A 4EUNA 2C95A 3KKOA 1E4VA 1TF7A 3GLIA 2GDJA 3ZD7A 4LCBA 3UG6A 2JDIA 2ZR7A 3QXXA 3THXA 3BOSA 3BJIC 3AVXA 1Z0FA 1KIMA 1UKEA 2C9OA 4NYJQ 4P4SA 3GJ7A 5C1BA 2CXXA 1T3SA 3L0IB 1PUIA 1QDEA 3UKDA 4JLVA 5KNCA 4Q1DA 3TLXA 2OCYC 4G5QA 2IYSA 2BOVA 2Q21A 4UNRA 1GITA
chains in the Genus database with same CATH superfamily
3ORQA 1E2FA 1H93A 2XH8A 3QU9A 4Y6SA 4ONEA 5SY4A 2P2GA 4ZHQB 4NZMA 3T7DA 3CUTA 1IDN1 1OX4B 2DJ5A 4L50A 4OUKX 2Y9PB 3GJSA 3I64A 1P1CA 3NBAA 4I1YA 5TS3A 2PO7A 2ZYIA 4RETA 4ETWA 1VSVA 4IIFA 4G0ZA 3W78A 3F96A 3SF8B 2GTPA 3KXPA 1OIVA 3HCPA 3AHFA 3GLFA 4HO1X 3FFWA 4G5GA 3VTAA 2XZPA 5FWYA 3MJSA 3RUEA 1PDWA 1G6OA 1SPBS 2OZKA 3HN7A 4FFOA 1E5TA 1G3RA 2HWUA 2ZT6A 3D3WA 1ZEMA 1CSEE 1NATA 4MIYA 2XKKA 2X2FA 1OXTA 5KQGA 1Z5OA 2BBSA 2QSZA 3OZDA 5EP2A 3WL7A 3DBHB 2VXOA 1LRLA 1NFQA 3SNKA 1PEAA 5CCXA 4DQDA 2ZATA 3EA0A 5FA6A 3ANMA 1FUEA 1NRXA 4D4GA 1ZNXA 2C83A 3UXYA 3ZUPA 2G77B 5JNUA 1MOZA 1GFIA 3ETHA 4FYYA 1QE5A 2RIRA 1J22A 2I71A 2IU0A 1QLWA 821PA 3QA3E 1Y6FA 2IC5A 3MTJA 4LQDA 3TW8A 4I1IA 3VZBA 4W5TA 1M1YB 2AH5A 1LS6A 5DBEX 4E14A 2DWPA 3GDOA 1JIKA 1JZTA 2VP2A 3OPNA 2W6QA 3TOXA 1TO1E 3AERB 3PKIA 1KEZA 4W8OA 3TAXA 1LPAB 4BVHA 5AVQA 4P92A 2H2GA 2BJHA 1R8XA 2QW1A 1M34E 5KU7A 1JWLA 4RVUA 2BE7A 5F51A 2Z6UA 3G17A 3K70B 4HQFA 3UMBA 3K9HA 5EZ6B 4HYQA 2R9VA 4C6SA 3MUFA 4F1WA 3N0XA 1RW4A 4JHLA 2Q8NA 4MW4A 4V0SA 3FIUA 3GMSA 4WKGA 1TF5A 1C50A 2IGTA 1RTKA 2Q8PA 3N2GB 4OXYA 3IT3A 1HR0B 1W9HA 4UTVA 3DBRB 1EXMA 4JOBA 1GILA 4JC4A 4MRSA 5A5VA 3A1CA 4IUCS 5ALWA 3G9TA 4BQQA 5DM70 4YJFB 2JPDA 3HY3A 3ZUGA 5LB4A 1Y9EA 3T3PB 4M1ZA 4BO6A 5BVHB 1NQOA 1A95A 4L1KA 4BJ6A 5BW5A 3U09A 2WKQA 1KMHA 5FR1A 4AFNA 3GMTA 3IT0A 3TLKA 2WWVD 4FNGA 4Q9AA 3QXHA 4O1IA 4JVNA 5T57A 3IUYA 4MVJG 4DBLE 2JB9A 4XR4A 5DM60 2WM3A 4JI4B 4OP3A 4U2GA 4XSGA 1K0FA 2W22A 3KSMA 5T7BA 1L4EA 3CPSA 1X8JA 1L9KA 1NBWB 4Q3OA 3MRXA 3RSLA 4FCCA 1R64A 2VO1A 1ESZA 4HN2A 3VVCA 4D9GA 1YQ9A 1QTRA 4J4HA 5HA5A 4DFDA 1U9IC 3EX7C 3FZEA 5C1DA 1YDEA 2D00A 2AFRA 1N2CB 3WFZA 1RXUA 1DXQA 3KAKA 3JWJA 4MICA 4NJEA 3TF5A 1MBZA 4FYVA 1K9VF 2EBUA 3KT6A 4FGUA 4TMWA 3PNQA 1D1QA 4BDSA 4BRSA 5CEJA 2A3RA 5DGHA 5J2TA 2W2LD 3RCBA 4OQ4A 4HPXB 3T7JA 3MTGA 3TFWA 3UBMA 3GNTA 1LRJA 1CUSA 2HTFA 2QM8A 4B75A 5FTWA 2OE2A 2EJTA 3IQWA 1TVKB 2XRZA 3JSAA 2PRSA 3FPBA 3OUZA 2QRVA 1APBA 1EDZA 5HNKA 3BGVA 1IIRA 4FMDB 3WGNA 2C00A 4HAXA 1E58A 4K28A 4B32A 2OAQ1 1UP7A 1XR3A 3L04A 1IN5A 1BX3A 1WMEA 4GOJA 3L8GA 1QDUA 3B1WA 4LHYA 4B0PA 4BMZA 4CM8A 4EL5A 3U5ZB 3I1YA 4QFBA 5T3UA 1NP3A 3SF8A 4Z86A 3C6BA 1PRYA 2C2KA 4RZUA 5BSMA 2YR0A 3S1LA 1M6NA 2MSDB 3GLFB 3BCSA 4FC7A 5FWYB 3VR4D 1SWVA 4NICA 1L5SA 3STXA 3TAHA 4GI7A 2ZI4A 1OWNA 3A4IA 4CIWA 1IAQA 1N7IA 2GNPA 2VHWA 3DBHA 3SXPA 2R6AA 1Z0DA 3AW9A 1N4AA 2DE0X 5FV4A 3GEGA 5CX1B 3W3AA 3GWGA 3I8XA 1N8NA 5JG7A 4F06A 4OKSA 2NZXA 4RMNA 1RFLA 3PE4A 1XCPA 1U8YA 3LLUA 5JQGA 1EI9A 1KRHA 4GKBA 4BEWA 1H2XA 3MCWA 3HSSA 1KY4A 1QB8A 3HBNA 2PYDA 3DYIA 4X60A 2C04A 4MPRA 4QUBA 3BTUA 1Q20A 4KR7A 1MC8A 1M1YA 3DV9A 5D6OA 4YCJA 4KCGA 4PR0A 1UAYA 4LECA 4QDOA 3DE5X 4AC9A 2V45A 3WLKX 1MOSA 4UBIA 2DQKA 2QN8A 3A58B 4XX1A 1L7OA 5BVGA 2JLYA 1CHDA 3RYIA 4NDAA 1EHCA 2IHKA 2NSLA 3ELBA 4QHYA 1HORA 4UZEA 2PDAA 2XZOA 1FTYA 4UU1A 5DWDA 2XRFA 1OPXA 4BQIA 2BRUC 1ZG3A 5DTEA 1L7NA 4TV8A 3ZK7A 1SUFA 4I81A 2CUTA 2F1OA 2H07A 1R0CA 1SO8A 1XCJA 1JIXA 2VLIA 3UK2A 1RC8A 1ADJA 3TLCA 3N2GA 2QYTA 1W25A 2BSAA 2JLRA 4NENB 3PNOA 5CLJA 5G40A 3RAFC 5A05A 6REQA 4HT3B 4KO8A 4CKEA 2X9GA 1T0JB 3HEBA 3VR4A 2HPHA 2G5GX 2W6OA 1C3EA 2OBNA 1EX1A 5EEGA 5H4GA 1HGXA 4YP6A 3VYRB 3AY0A 1NN1A 4YAIA 3I6BA 4BO2A 1OI3A 5G3YA 3WYAA 1B6SA 3CBGA 4BNXA 3EISA 1VZ2A 3O8QB 3UAZA 4CKYA 2JFPA 4M0PA 2WWFA 2P9BA 3QE4A 3QFSA 2VWQA 3RVOA 5GONB 3WNVA 2BGKA 1V5GA 1B3BA 3ITNA 4MV4A 3U49A 4LRUA 2ADOA 3TM5A 4E0BA 4BGIA 4TS1A 1SQGA 1T0PA 3QBVA 4QECA 5BMOA 4C0KA 2EW8A 3CWQA 2QD4A 4IIDA 4PZDA 2WG1A 4HJRA 4HK4A 1IN6A 1JG4A 3RYCA 1N2CA 1H85A 3T3IA 2QN1A 2RC6A 2XD4A 4FXPA 2TECE 1SXQA 1GNLA 4B45A 2GCEA 2HSGA 3NW9A 3ENWA 4FE3A 1KVQA 4JP2A 5ETJA 3ZK9A 4EMTA 2BMDA 3WWDA 1IUPA 1O6FA 3AK4A 1SIUA 2FHSA 3LFTA 1FFDA 4GU5A 4DIMA 5J2TB 1NVEA 1CDDA 1RNLA 2ZBQA 2EL7A 4YRPA 1HFJA 1NQ5A 1W35A 4L75A 5HYVA 4Y6PA 3T15A 3TRFA 1TVKA 1YOBA 1U7XA 2AQIA 4XDZA 2BLLA 2C7BA 2QRVB 1JJAA 3GY0A 3PEFA 3IDQA 5BRNA 5KU1A 1WV0A 3AF5A 4KIUA 1Z29A 4W8HA 2BUBA 2ZUWA 4NOJA 1GUDA 4Q39A 3KALA 4MVYA 3ZW8A 4YJDA 1B6GA 3IVGA 4OREX 5H81A 5JYDA 1ID1A 1K8RA 3SQLA 5JS2A 5H9WA 2WU3A 4C7OB 3SR3A 1FVXA 2I22A 2ZZKA 1L8OA 4CR8A 3EZFA 1V5FA 1AKYA 3UTDA 1ORIA 1UBEA 4HX2A 2O7NA 1PT5A 2VK8A 4G4IA 5KYWB 1AF4A 1ZXBA 4IXMA 4B3FX 2XCRB 4HNTA 1YVEI 1E6WA 4C4RA 4LF5B 1E5QA 1XZMA 7AT1A 1Q6ZA 2XYQA 4BNVA 4ENTA 2XNKA 5IJ9B 3JVEA 2JK1A 5J47A 5H4HA 5IK2D 4LF9B 3NTLA 5K8CA 4GMKA 2AN4A 2XPCA 5MF6A 5A3SA 2C7OA 1GZUA 3ZV3A 3PTAA 4NBWA 3EG9A 1O6BA 4FYWA 1H6DA 2Z98A 3BFPA 3FPFA 4PSVA 2X4DA 1KQFA 1DEHA 4HMQA 1YZFA 4H6VA 2UUAB 2ZVDA 2JCXA 3VQTA 3W0LB 2J3LA 4HGPA 4B7UA 5JQGB 4GYJA 1RQXA 4CHTA 1SELA 2OCLA 4ZI7F 1SIWA 3FZYA 1B0UA 3LKDA 3C7CB 1L4LA 1FDSA 3TB6A 3KE9A 4F6CA 3ZLJA 4RY8A 3RTEA 5GMOA 1IB0A 3C8ZA 1FX0B 3FGPA 3MF4A 3UJ6A 4ALIA 3DXZA 4FCWA 1Y9AA 4F21A 3RAGA 1JVNA 4FMDF 1ZGHA 2V74B 1W85A 3GJ6A 2FSSA 3N8GA 3BL6A 4REOA 1DUVG 1S9HA 3VH4A 2I4TA 4OIMA 2ONCA 1RWMA 2J3JA 4HWTA 4WD3A 4AJOA 4QL3A 4LQ4A 4C2AA 1NUUA 1KHHA 1TCVA 4GBED 5L3RA 1NJ8A 2C82A 4JYCA 5JUWA 3T9EA 3D6HA 1C0LA 3KVNA 1ESMA 1TQ4A 4QSMA 3CGGA 1SRQA 5L45A 1LTHR 4HNGA 4TLMB 4F91B 1H4TA 1B8OA 3NNDA 4Z0HO 4NENA 5EJEA 4KFTA 3TRKA 4FX5A 2WB2A 1G5QA 6REQB 3EVTA 4I1UA 2CXSA 4J0QA 4UXHA 1P72A 4DUPA 1CCWA 2DLNA 2YOFA 3LDGA 3GMIA 3KDAA 2QN6A 1GUBA 3QU5A 3BGSA 4QREA 3LT1A 2AK2A 4WDRA 3UMRA 1E2BA 3WISA 4Z1OA 2ZJ7A 3W3AH 3KHTA 5KX5A 2WZCA 3U7QA 3OFNA 1A5ZA 5DGXA 1M1NB 1LBEA 1PE0A 1NXXA 3PGKA 4OQLA 3OG9A 2YXNA 3KT3A 4C4ZA 2ATVA 2DVMA 2V7UA 3DOFA 3RC9A 4FFVA 2PFSA 5LBIA 3T34A 2GB4A 5DBFA 3T99A 4NI5A 1RWNA 3PFWO 3UICA 2XUIA 3HI6A 3X43A 4DYVA 5L6MB 2E87A 5DNCA 2CNKA 1E6KA 2F3PA 2DY1A 2M32A 4AO8A 4F9EA 2O2GA 5L8VA 2HLHA 1QPZA 4M2LA 4KPYA 3HZZA 1OFTA 4PNZA 4V0OA 4ZRNA 1W0CA 4YO8A 4BNGA 3RGGA 2BCGY 1KJIA 1SKBA 3R3JA 2J7KA 4Y30A 3UATA 3JVDA 1GEEA 5TEWA 2CLEB 1C9KA 1LV7A 1Z5ZA 4IHQA 3G9ZA 3EBPA 4PRLA 4OHZA 4CNQA 1TF2A 2MHCA 2W2TA 4FYPA 3NI2A 3TQRA 5BSKA 2G17A 3URMA 2XHZA 3HB4X 4OBEA 3WSWA 3UA3A 2ACEA 3HB9A 1UQRA 1KYQA 4RSHA 5E9QA 4NXNB 4YBZA 1CIPA 3TQCA 4C7OA 2HJ9A 2Q3DA 3PE3A 5JV5A 3A1UA 1DSSG 2HCBA 4HAZA 3FHTA 1KVRA 4GWLA 1QM5A 3K2EA 3GBPA 1M6WA 2CVOA 3CLRC 1C9DB 3M83A 3SN6A 5CDSA 3ERCA 1J07A 4FSXA 1TYZA 2LCQA 1XXHB 4EVIA 5MN5A 2E4UA 2WU8A 3C98A 4AYTA 5ECDA 3P9QA 3QE9Y 3MAAC 3RVPA 1J1ZA 1XJ5A 3A0RB 1JEOA 3A2LA 1A0OA 1ZR2A 4U6QA 1E7YA 3OEEA 4GLBA 2I8LA 3PU6A 4GG1A 1EJ0A 1B0AA 3A11A 4YRBA 1QTQA 1AUVA 3EG9B 1U1EA 3TLGB 3DV0A 1Y8RA 5BV2P 2V7GA 1A9RA 3H9JA 2JAPA 2Z5FA 2OESA 4FHGA 5CLQA 1NN0A 3QVLA 4K0RA 1PV2A 5DBOA 4ZALA 5ITWA 3T5TA 3EBOA 3C6YA 2GAFA 4XR9A 3HCNA 1NNSA 1XMQB 2BHLA 4UNNA 5FA8A 2A86A 2BCJQ 2ZSFA 3ETNA 1RLOA 5H02A 3MGKA 1R4NB 3NDBB 2E7ZA 5GINE 3E9QA 2P9GA 2UXBB 4UNQA 1YC5A 1JIIA 3N2ZB 3ZWXA 2W2KB 3KC2A 2YV2A 1EG2A 4HL6A 4PG5A 4XYGA 5JWRA 5A0TA 1MR3F 1KS2A 2ZQYA 2PKQO 4PZUA 5JWHA 4BYMA 4E5VA 4BKPA 1GR0A 5E7IA 4KODA 1T1EA 5EIFA 3UUFA 1KEUA 3P4YA 3R41A 5G0WA 2NZJA 4PSAA 1QR6A 3MCTA 1JDVA 3CNEA 4NZ9A 4UU0A 3RRYA 4R84A 1A8SA 3LX5A 5HF6A 3VDXA 2P7IA 1T9AA 3C74A 3PHJA 2G8NA 5J5AA 2I34A 4I46A 5DYNA 1HNXB 4GPAA 3AM4A 4X90A 2GFHA 1K8YB 3GNLA 5AH0A 5G4KB 3WWOA 4PG6A 5EFOA 2E21A 2ZIVB 4MS4A 4C22A 1JDTA 1F0YA 3ILXA 1YRWA 4YUAA 5I6DA 4LDNA 4I3GA 1VP3A 3AEXA 1VQ1A 1G7SA 4HVTA 1U99A 1LH0A 3E7FA 1JKJA 4LOAA 3TLAA 4FSDA 3MAGA 1PFWA 3GU3A 4DWOA 2GBGA 3JQBA 3U7QB 3ZHRA 4EK9A 3ZZTA 3WHLA 2BEWB 2IS1A 1RLMA 2WFLB 2YWJA 4YB8A 4LF8B 1IYZA 1SUSA 2D3TA 1IHPA 1H4QA 5LSAA 5DT2A 5TX7A 1DINA 4N4AA 4JP5A 3FN4A 2HCJB 2A14A 3OCXA 3FBWA 4URHA 1M0TA 5EJ5A 1GTVA 1VHTA 5CVUA 2Z2XA 4K6FA 3N70A 1AO3A 2AN9A 3KHKA 4JB2A 2QT0A 2Q0HA 1T8UA 2HLDD 3BAZA 3Q12A 4A0RA 3PYLA 3ZDCA 2JGDB 4TN1A 4QM7A 2GPYA 3OIDA 2E4YA 2H4YA 2HNKA 5K7SA 3RADC 2BZGA 4JUFA 2G7ZA 4FZ5A 4GOLD 4EKGA 3PHCA 1JR2A 4MUJA 3UK7A 1P5JA 1SCDA 3JARB 3ROGA 1QIDA 1NC3A 2G9ZA 1Y3FE 4NNJA 1H8ED 4ETIA 1RZVA 2G88A 3B13B 4EUKA 5IDWA 4PEVA 1GZDA 4K2AA 4QZVA 1UZNA 1MT0A 2H7CA 1R0YA 4ETMA 3I34X 2QL6A 4B74A 2Z8ZA 1GVHA 3UMSA 1DAKA 3CSSA 5FLEX 3UW3A 2UZ1B 1YNSA 2FJUA 2RH9B 2X13A 3LJKA 3QTBA 3ZDYB 1XQ6A 3WBJA 4FX2A 2C5AA 1T2CA 3DEIA 3DMHA 1KU0A 2X14A 4KKXB 3ABQB 1A4IA 3ED5A 3LZCA 1GQQA 3TQQA 1W4RA 3SEAA 4JBLA 4BWFB 1GTJ1 3QBJA 3DBOB 2VPQA 3W2IA 4YT2A 4IILA 3WGKA 3KOUA 3D7NA 3B52X 4ERXA 5EZYA 2CZQA 3PR2B 2ABWA 3EFOB 5IUKC 5J2UA 2A84A 3F7MA 3NC4A 4LJYA 2FEPA 2VK4A 4MWZA 4OQEA 1ONSA 1R0WA 2CWDA 2NQTA 4FGWA 5F5NA 2V5AA 4ZT7A 5JMPA 1GAXA 1NWCA 1C3JA 1VJRA 1H0RA 1X92A 3O47A 4RFSA 2ZSBA 7ABPA 4HY3A 2R6R1 2Y0PA 1HRKA 2UZIR 3LXUX 1UT8A 5ALJA 1BGVA 3RSHA 3E18A 1Y8RB 3JYQA 1YASA 5D5PA 3I5MA 1YDMA 2XOKD 1NDUA 2JLBA 3Q2OA 1EVJA 2UZAA 2BZ1A 4FBGA 4ICIA 4KVAA 5KTKA 4D8XA 2PM8A 2ATEA 3MTIA 2WK1A 1NFRA 2GBFA 4M9ZA 2Y1KA 2NAPA 2FW6A 3H5NA 3E23A 1U2GA 2JGFA 3FYUC 5ERXA 2BFFB 2VQ6A 3MS4A 1YD7A 3R3SA 4FWTA 1VE9A 1PNVA 2FWJA 2GJSA 2PUJA 5AW1A 4FYMA 1E2MA 2IZZA 2YZMA 3DTYA 5E4YA 4MDFA 3H1BA 1E1RD 4MUHA 3NKVA 1JJ7A 2WHYA 3RJMA 4JJEA 4ZEXA 3BICA 3G8AA 2GOYA 4GM1A 2E55A 3NGXA 2NVUB 3A4VA 2IKQA 3GRZA 5FYQA 1M8PA 2CK3D 4YASA 2D1QA 2YIVX 4H7EA 4GYYA 1C1YA 1U2ZA 2JI6A 2V3WA 3OZFA 3U3OA 1LPBB 3V32A 1E3DA 4IIJB 4B2IA 1GGEA 3AFGA 3NH9A 3QVVA 4M1MA 5AJWA 4MV1A 3ZBUA 2QTBA 5LVAA 2A2ZA 3B9QA 5KYTA 3QJYA 1V39A 2B78A 1SKAA 1DRVA 3QE2A 3AU8A 2YJNA 2ZJFA 3AFMA 3PTLA 4K88A 5AJZA 3EFHA 4MS4B 5G4KA 1T26A 7GPBA 4FDAA 4G89A 1SQ6A 3OTWA 5K20A 4ZZIA 5B53A 1SVOA 4HXFB 4N47A 2R7MA 4R8LA 7MDHA 5AOAA 3QEBZ 2CV0A 3GVIA 2VZEA 2WNSA 3NBKA 3ZXXA 4HG2A 3CCBA 4KQCA 2GESA 1E66A 1R8YA 3C7TA 3GNSA 1UBMS 3E15A 4TS4A 5E6RB 3SF0A 1EFHA 1NVWQ 3MINB 3SSNA 1KTIA 4ENUA 2R86A 3KAQA 1EG7A 5FT9A 2BEWA 1M75A 3L9WA 4LI3X 3B1KA 2WFLA 3I52A 3ZGOA 2HSEA 3OVMA 3NHKA 4GDMA 4KE7A 4AO7A 1YULA 1GLVA 2IEYA 4V24A 3X3HA 1G2IA 3PJFA 4YH1A 1X7DA 3PPVA 1OGIA 3UAVA 3ZDFA 1U8EA 2HX1A 2ZIUB 5EE9A 4D6YA 4J16A 2WILA 1SOUA 2DHCA 3R3XA 1HDEA 3A6EA 3R0ZA 3OMLA 2R60A 1JH8A 3LUCA 4G81A 4MR7B 4BATA 1WDWB 3I1FA 4KXNA 5FF9A 2GM5A 4DR2B 3LIPA 1ZC4A 2J48A 1OUMA 4ZCPA 2FW7A 5KNBH 2F00A 2YMPA 3P2MA 3T3GA 4G1CA 5KUTA 1RPNA 4GC9A 3WLOA 3CVYA 2YC4C 2RGWA 1L5KA 4AY2A 1MIOA 3FYTA 1ID8A 1DOAA 3TZHA 2IHVA 1USGA 1W36D 3I30X 2GVDC 3JY6A 4WOJA 5KHOC 2FZKA 3NNSA 4PQEA 4NCNA 4YAEA 1MQ8B 3TRIA 3PFKA 1TQHA 3FPSA 2CLOB 4UVDA 2ZSHA 5LNK1 1JB1A 2BMJA 2IHUA 2BBWA 3D6MA 4FFNA 4IQ0A 3T3DA 4KPGA 2RFLA 5E6SB 1EP1B 4FW9A 1PDVA 2UZ1A 3ZNQA 1LTQA 3TNJA 4C3OB 2JLVA 1Z4MA 4AWAA 3OIYA 2HH9A 5JSZB 1VDZA 1Y7LA 4JKIA 5DIFA 4HHEA 2JLWA 4ZCSA 5JYEA 3TR0A 3QY0A 4Q9KA 5CXQA 1L5OA 5EZYB 5AJTA 1NHWA 3EFOA 5HF8A 4RTLA 5SYAA 4J49A 1NMXA 4KGDA 2AWNA 3ZTYA 3NEJA 3HY4A 3MIIA 4GMDA 2GHQA 3LE8A 3WXBA 4EHLA 3E9RA 4RFSB 5EQDA 5JIBA 1U0BB 2G5CA 1SZPA 4NV0A 4YPFA 5HUQA 1UJ5A 1DQZA 1GPUA 3IE2A 2CBXA 3WGVA 2O23A 4RA6B 3GLIE 1BAPA 4PW0A 3D1JA 3SZRA 4IXTA 4MKIA 2E48A 4EZEA 1W87A 3O1JC 2UVPB 4RPIA 4KLZA 1KC1A 3H5TA 1N9GB 2X19A 4B6PA 4LRTB 3QPBA 1T5BA 1JPJA 3OP1A 2GZAA 3NYIA 5EJIA 1U98A 2J87A 2YVUA 1I3OA 5JCOA 1SUDA 3BHNA 2BFFA 1VE5A 2FPPA 1TC2A 4LX0A 2RHMA 4MMYB 1OJLA 1UC4B 3O2QB 2EVWX 2YFKA 4FE7A 4O0LA 1GCAA 1JU4A 1NW7A 2Q21A 3PA8A 1K4MA 5AKJA 4DANA 4DQKA 2AMVA 3UWOA 6GPBA 1AHPA 3FOFC 3SIXA 4O4IB 3LQKA 3MTQA 1EBBA 2XUFA 3TM4A 4JJZA 4L22A 4EY3A 1CUYA 1PT6A 2PWPA 4FVTA 2AG0A 4M8NE 3CX8A 4BGEA 3ORHA 3K0FB 4IXNA 2DCMA 3SIPA 3QVUA 1NW5A 3GYBA 4Y8VA 4GPZA 1PS9A 1SC6A 4OHCA 4XZ3A 1N5MA 3ZWKA 2F59A 3TZKA 2WIGA 4GE0A 4YAOA 5K0LA 3BMCA 1JMKC 2XGJA 3I9JA 2I67A 3PEYA 1ZMBA 4UUNA 4PFKA 5EQTA 2I7TA 1E8DA 3NTOA 2V59A 2OD9A 1TYBE 2PNJA 3R23A 5BMVF 3I53A 3LS2A 4KYVA 3WMXA 2A0FA 2G1JA 2H7XA 2Z4TA 1NKVA 2QTHA 2GJ4A 1DAMA 1EVKA 4A0QA 4ND3A 1CUWA 3JVVA 5AUOB 3O4FA 4A8PA 1AUOA 1K5DA 1L4UA 2E2WA 1RYEA 3KJZA 1C1HA 3L8HA 3R3VA 4LZAA 2YKGA 3Q8KA 3W5IA 2F90A 1V0JA 2GLXA 1XK7A 1G19A 2INGX 3PX3A 3MINA 5K8UA 2IGBA 5AKZA 4RTQA 2NTJA 2RJ3A 3I5YA 3N7TA 1UINA 1DKOA 3PD0A 3BXHA 3I04A 2R1TA 5F1KA 1L4BA 1YGYA 3KXKA 3A3NA 3NBYC 5KSPA 5JXWA 3WS7A 1GA4A 2VJLA 1T1SA 4ARBA 4YPOA 2WHPB 1U2EA 1KI1A 1YJAA 3F49S 4HGRA 4WZAB 3GRPA 4D8TA 2PGLA 2A58A 4BMXA 1U3VA 4G63A 3DE4X 5JZOA 2QIPA 3QG5A 4PN3A 5D8DA 4QO7A 3IP8A 5JXJA 1QGAA 4LYAA 1DCFA 4D97A 2A35A 3PGJA 1JLHA 3O21A 1QHFA 2X4IA 4IQ4A 5K0CA 1EPUA 1A9ZA 1I4OA 2XXAA 5DYTA 1P2BA 1VLQA 5C8DA 5KWSA 1MIOB 2VNKA 1TGVA 4BMOB 3OZVA 3BIOA 1GFZA 3S1AB 1SC9A 4DLTA 1LTKA 2XUHA 3NUZA 4ATNA 2LWIA 2XZTA 5B4UA 1N33B 3QJ5A 4D3FA 1JMYA 1AV7A 1XX6A 3QV2A 4D1YA 2IQ5A 4PRYA 1YB7A 1WDKA 2IJGX 1NJ1A 2PPVA 3PDHA 1UBSB 1HT0A 3GGSA 4BFVA 4NMWA 4BHTA 1UC9A 1QH1B 2QRQA 2VNIA 3I28A 5D5HA 3VX3A 1ZHOA 2JA2A 3QBDA 1C1DB 3NIFB 3WX0A 3FY4A 3HCFA 3RBZA 1Z15A 3ZWNA 4W8GA 3SC3A 5JR3A 5JSZA 1ZMRA 2G70A 1BMDA 4QPJC 3OIVA 1GL3A 5HJ2A 3PUKA 2Q1XA 2WJGA 1P77A 1OKKD 1A98A 5BNZA 3BGDA 5DYWA 1X1BA 3WOVA 3NQ41 3TOVA 1RXIA 2O0HA 2Z6AA 4K9PA 2OO7A 4B7AA 4DN6A 2OORA 5I7OA 1XNJA 2Z1NA 3ETLA 3HB1A 3SICE 2IELA 1J4AA 4BO8A 1P80A 2P9HA 3T1OA 1YS1X 1M6VA 2XW6A 4CQMB 1V8FA 1VSUA 1OBCA 1NYQA 2EP8A 1E2GA 1A8IA 5JAZA 4GX0A 4RA6A 3D54D 1RAEA 1V3QE 2QRHA 2JAWA 1QJ4A 1K3FA 1Q77A 3HJCA 1NW6A 1XRRA 1CY6A 4ABYA 2NVOA 1X3LA 5C1PA 5MDHA 2VBIA 4NVRA 2CDBA 3ZZ0A 2COEA 3IURA 2C9BA 2PK3A 1YIAA 1HT3A 3OCZA 4Q6WA 1CZNA 4UCWA 1QMGA 5BUSA 5E7QA 2BY4A 1OASA 2DQ4A 2VYNA 1XZGA 5K8VA 2FPPB 3NDJA 4AUEA 3HA3A 3RS9A 5JJIA 3CPHA 2ZVQX 3DLPX 2IQIA 1UMCB 3ONEA 5DASA 2P78A 3MRTA 3T35A 4JJIA 5EWLA 3C97A 2HOQA 2EHJA 3IX7A 3TIXB 2JH8A 4QD3A 1HF3A 4OI2A 1P1FA 1O6CA 5KJCA 4BX3A 1NQVA 2YFQA 4P93A 1QYXA 1BVUA 1ONOA 4JMPA 4L72A 3KIPA 3II6X 5HDQA 2NMVA 2PUCA 3CJRA 4GIBA 4C5CA 4Q3LA 3ZX4A 1JPUA 2FUG1 4G85A 1E3MA 3CPJB 1PYGA 1TX4B 2CNDA 4I3HA 1T9KA 4RZXA 3KM0A 4KC0A 4CTJA 1KFJB 3QLVA 5JO0A 4ZO9A 3RREA 2RI1A 4Q48A 3FTEA 2XXJA 3DXYA 3RYHA 4Z9XA 1COWA 3X1WA 1EEXB 4PZEA 3O31A 2NP6A 5TARA 5IAAA 3RVBA 1XHEA 2Q6LA 5JAIA 5TE9A 4YP9A 4OL0A 1QORA 5FDFA 2QRKA 4ER0A 5EE5B 2OQ2A 4LS3A 2H4ZA 2P69A 5CCDA 1HETA 3NV7A 5AIAA 3QH4A 4I6GA 2H1VA 4X44A 3OCJA 4BVLA 1I94B 2QTTA 5LYJF 2I3ZA 5DBIA 3MRVA 2X6QA 4IIHA 5B7GA 1DDIA 4KWCA 4F7DA 2OXCA 3S7TA 2H0AA 5CAEB 2VHEA 4RPJA 4ESHA 4BYGA 3D7SA 3H65A 4I0WB 4MZXA 3Q5DA 4JI3B 1KVSA 4WZAA 1NVKA 3KHUA 4WKPA 4X7RA 5FPYA 4F9FA 5BV7A 2CV2A 1XNRB 2JHPA 5IC4A 4O4IF 1DZIA 1XZDA 2EP7A 2RJNA 3P0JA 4Q12A 2BFOA 3HEMA 1VIMA 3MSCA 3NPMA 3E05A 2QXUA 3JPYA 5D3KA 4Y2GA 4DR6B 1C8LA 2YV4A 2ZE7A 5AW7A 2EQAA 3U4AA 1VI2A 4EJFA 4BLRA 1E89A 3C8UA 4MVJA 1H8HA 3S1AA 2HF7A 4JV5B 5ALOA 3STWA 3YASA 5L40A 5LU8A 2JEYA 1UANA 1TTTA 1FJGB 1UBLS 1PF7E 3D3JA 3THOA 3DAOA 3A3KA 1E2DA 1QRRA 1AN9A 4M1YA 5FUYA 3W9YA 5ADUS 1EFPA 4JEUA 2VYVD 3P4XA 1U2GC 2D5IA 4X92A 5EKDA 3SJAA 2XCSB 1UEJA 2ZBPA 3N2IA 2D6FA 5DV9A 3ZIDA 5HKAA 4Z0TA 1A97A 3U62A 3BA1A 3UGJA 4IINA 3P0EA 1COWD 2JAQA 1NUQA 3CO5A 2BDUA 1SC1A 2V3VA 4M6WB 2HQBA 5FUXA 1EVYA 2F7SA 1EFCA 4WNIA 4EI8A 3DZBA 3AKEA 1YB4A 5F98A 1Y6JA 3D8BA 4WBNA 1YU6A 2FP3A 1V8ZA 2NYRA 1OAOA 3LLCA 2NYVA 4ZGBA 2JGNA 3PX7A 1NOJA 1AHHA 3LW8A 1KJNA 3Q3JB 5J63A 2ORVA 1VC2A 2C2MA 2BHRA 3NKLA 3V5NA 3K0EA 5IM5A 4WN9B 4PHFA 3H1AA 3SC2B 4CQMA 4FN4A 4Q1VA 2VR1A 4JGIA 2ZRNA 3UOWA 2Y6UA 3EWIA 3LHIA 1V5EA 1IEQA 1P81A 4UC0A 1RJWA 1F9EA 3W6NA 1IJBA 1ZPDA 1OHHA 4Z49A 3AGQA 1YDHA 4RQTA 2ZM6B 1MJFA 4GW3A 5JH7A 5K9ZA 3O74A 4Z6KA 2PUAA 4OJQA 1NYTA 4QUIA 3BMNB 2Y76A 2BGJA 1T4BA 2GN2A 2J0VA 1E9BA 2X6TA 1TEVA 4C6TB 1FJXA 1UMCA 5IEJA 1SIOA 3IUQA 5EIOA 2BHSA 3MFQA 4Q4JB 2G40A 4AVYA 3WIOA 4Q4LA 4UFNA 5F52A 1VE7A 5FWXA 5CLGA 3QLEA 1KETA 3IBGA 2NZVG 2BWJA 2AXPA 5E8RA 4ZWNA 1TCUA 2HIHA 5FBRB 2V7BA 4MIKA 4P98A 5EIHA 1GPYA 3PPIA 1KRXA 4RYLA 2XKAA 4P33A 1YR6A 1Z0JA 1W8DA 2A8YA 1NNLA 3VNVA 3RYHB 1N1EA 1C3XA 1U90A 2EKPA 3H5AA 3RTCA 3DJFA 4R2JA 4K05A 5C0OE 4P54A 5HOEA 2QD3A 3AL0C 1XD9A 4TYMA 4AY3A 1UWCA 5FV7A 2QJOA 1OPRA 3N58A 3TD6A 4ZDKA 5EVJA 1DAHA 4LRXA 1UXIA 2NXCA 4IDNA 4MV9A 1XNHA 1CZUA 2C99A 3EVAA 2O2HA 2FOLA 3BMOA 3WGMA 4TUYF 4B3GA 1DBWA 3ZBPA 2HSZA 4INJA 3Q10A 4QGSA 3AOGA 1AQJA 1Q95A 1NNEA 5CAEA 3BIWA 3FKJA 1K4YA 3RK0A 3VO2A 2FPSA 4DM3A 2QQ0A 4EYOA 2XIJA 3FNIA 2WSIA 2VPPA 1M2VA 3LCMA 1CJSA 2K2WA 2Z8XA 4NL4H 1ZA2A 2ZXEA 2YOHA 4PS0A 4MS1B 1N5KA 1V71A 1E7WA 3JQFC 1RQNA 1GFWA 2BEUB 4UNSA 3LO8A 4RDHA 4Z9BA 3URKA 4M0CA 3PNVA 1SU8A 2M9MA 2XA2A 2XWPA 4F4HA 3FH0A 2V4ZA 3FDJA 4Q9HA 4E6PA 4AKIA 1XYVA 2GBPA 2UDPA 3DSRA 4FTWA 2KW5A 3A31A 1FNCA 4JEHA 4U7FA 4EPWA 1Y4ZA 1XA0A 2W48A 3C24A 2CN1A 4YK7A 5TMBA 3SCZA 3ON5A 3TL6A 2GCPA 3MCAA 3IDZA 4LGCA 3U4GA 7REQA 4WK6A 1YZTA 5T4BA 2VJPA 3H4TA 1Z2OX 2GK6A 3PFHA 5DBHX 2P8SA 3B78A 3REOA 4JBHA 5GJWC 4WFQA 5IKEA 5M5BA 3PFBA 3NJ8A 2ZCUA 4M9UA 3RI3A 2V0GA 4L6IA 1T5SA 3OA0A 3DLHA 4TL8A 2H5JA 4LJ7A 4M6WA 4UJ3A 1NUPA 4BE4A 1HWYA 4BFLA 3KWFA 4HAVA 1FCJA 2H51A 1KDPA 5FUBA 5B12A 3RS7A 1FDRA 1ORVA 1XLTA 1VA4A 2I03A 3ZCUA 1ONPA 4WBNB 4YQFA 1QF9A 4F4CA 2CNBA 2XCIA 3S2FA 1XAGA 3F98A 2QRNA 4B7XA 2JJ1D 1JWBB 2IPNA 5DLEA 4GSYA 5M29A 1OLSB 4MV3A 4AJNA 1QSGA 2FHPA 2IPXA 3ZGZA 3DDWA 2FUKA 5DBGA 4J8PA 4N48A 1ADBA 4ACBA 4QJ3A 4GKVA 1P91A 3D43A 1BEZA 2WP0A 4LXYA 2TRSB 3GFQA 3QWIA 4NBVA 4EG0A 3SC4A 1BG6A 4Y2YA 2O14A 4BB6A 2Z3VA 2QVCA 1RAAA 2VRBA 1DT5A 1U0HC 2I1WA 2KPOA 2DF8A 2PWAA 1XPJA 2VF5X 2Z30A 3H7AA 4EY4A 2A4KA 3BFJA 5T4FA 1KDYA 5K0JA 3AT1A 4CCSA 3M6FA 3ZLVA 4ZCTA 3DE1X 1Y6ZA 1HH4A 3AUKA 1G17A 4LHXA 5AD1A 2DPXA 1E3LA 3Q3HA 3LBIA 2X7HA 2AB0A 2R7AA 4GC5A 5H82A 5BMVB 1G3IA 1J0CA 2C59A 2FQ1A 2WHQA 3B5JA 4W9NA 2QNBA 5EZ5A 4Y1RB 3QKRA 5IHPA 5DLYA 1Q44A 2IU3A 5EQFA 2VCEA 3SBXA 4LHEA 4ZARA 3W3ZB 3DD5A 1J0EA 3PC4A 3GHYA 1H42A 7MHTA 4KFUA 1ISMA 1YSCA 5IM4F 2YJ3A 1GCGA 1DJPA 3KXLA 3EDOA 4BNWA 3DFZA 3ZBQA 4C4PA 4CGZA 5JCJA 3DDNA 2O1XA 2R96A 4LISA 2VAMA 4IKEA 1KQPA 3KXDA 3U16A 2IH2A 2NX2A 3TW4A 1AN0A 4EGCB 3ANYB 3TKYA 2AC7A 2M2IA 4DIFA 1JR4A 3CRZA 2GYWA 2ZRIA 5FOQA 2AT1A 1D0SA 4AECA 4JLJA 3O2JA 1QKIA 2ZXFA 3K8OE 4OVKA 4XXHA 1K8ZB 5D86A 3UYKA 4MKFA 4C9BA 1MXHA 3RSSA 3ND8A 1OCEA 2Q29A 3LKBA 1JDBB 3K96A