1JJVA

Dephospho-coa kinase in complex with atp
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
205
structure length
194
Chain Sequence
b'MTYIVGLTGGIGSGKTTIANLFTDLGVPLVDADVVAREVVAKDSPLLSKIVEHFGAQILNRAALRERVFNHDEDKLWLNNLLHPAIRERMKQKLAEQTAPYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARSANFEQIQRIMNSQVSQQERLKWADDVINNDAELAQNLPHLQQKVLELHQFYLQQAENKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEPHOSPHO-COA KINASE
publication title Crystal structure of dephospho-coenzyme A kinase from Haemophilus influenzae.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transferase
total genus 72
structure length 194
sequence length 205
ec nomenclature ec 2.7.1.24: Dephospho-CoA kinase.
pdb deposition date 2001-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01121 CoaE Dephospho-CoA kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1jjvA00
2EYUA 4QBGB 3VHXA 3R9WA 3EC1A 3CO5A 4LC1A 4PQYA 4UJ5A 1U98A 4EQ6B 1FNMA 2QT0A 3LDAA 3TMKA 1WXQA 1HEIA 4B73A 4ZPXA 1H8HD 2GJ8A 4DDTA 1T5LA 4HB0A 1VDZA 3IILA 3RWMB 2ZSDA 2BJWA 5JRJA 1JQJC 4AURA 3GPLA 1KAOA 3Q72A 1V5WA 4GP6A 1DAEA 1N5JA 5EP3A 2W6ID 2CHQA 3L2OB 1PJRA 3NTUA 1DAIA 1ZBDA 1E3MA 3GLIA 4LYHA 3FKSD 1DG3A 3PJRA 1KK2A 3TQFA 1T0HB 3KKQA 4EFNA 3AVYA 4HEJA 2XGJA 4PX9A 1IQPA 2FE4A 4NYJR 2REOA 3HWSA 1ZIPA 1US8A 2C95A 4HDCA 3U6BA 2F1JA 4OI0A 3NXSA 2DCUA 4ESVA 5BN3A 3DL0A 3KJHA 2IWRA 4AG6A 2IYRA 1SVKA 3QEJA 4NE2A 2N42A 1MO3A 5CIWA 1NN1A 3TUJC 1W0KD 2D2EA 4C2TA 3QI2A 1NP6A 3U7EB 4WA7A 1VHLA 1Z5ZA 2MMCA 1JEEA 2XJ4A 2OFOA 3C5HA 1MO4A 3L0OA 4XTRA 5FR2A 3T12A 3T1QA 2IWHA 5JJLA 3A1SA 1ZINA 2HLDA 2IYLD 3KQKA 3U60B 3U7FB 4II7A 4ZCIA 1KIMA 4UKDA 5J5CA 3R7WA 2WWIA 2JJ2D 1N3BA 3PEWA 1RKBA 3CB4A 3EPLA 1TL7C 4F92B 2FFHA 3DKPA 3P32A 3U44A 1GVNB 2ZUBA 4CT4B 2FSHA 2WJYA 1GG2A 4NP6A 4C0JA 4CEHB 1YE8A 2CBZA 4NH0A 4R2IA 4AYTA 1FZQA 4AD8A 5CJ2A 3U4QB 2C5LA 3CF6R 3I8SA 1WE2A 1KDOA 3P26A 4PHHA 2ZS8A 3LX8A 1DBSA 1GKUB 1LNZA 2RAPA 4LI0A 1E9RA 4A0FA 2Y8EA 3KQLA 1G3QA 2I1VB 1PLLA 4ITRC 4LJ4A 2H57A 1I4TD 4Q4JB 4V0LA 1AS0A 1MABA 1WDTA 1UFQA 5B58C 3MFYA 3RS0A 1S3GA 2GCPA 4QGAA 5J4LA 3T15A 4Q1BA 4MDFA 2WSSA 2GXUA 4PHTA 1KNXA 2JLVA 2VQSA 2ZETA 4Y0AA 4QFMA 3T06B 5TMPA 3L0PA 1TEXA 2R44A 1XTIA 2ORIA 1KDPA 2AL7A 3PCRB 1SZPA 2QPTA 3VX3A 1KI6A 2O8CB 1XJQA 3FVQA 4L8GA 1NBME 4C0SA 5FTLA 4M22A 4F93B 3JVVA 5J40A 1FP6A 1NIJA 2HT6A 1M7HA 2JASA 2DWOA 3NG1A 3WMEA 1IN6A 3SE0A 2ONKA 1MO5A 621PA 1T8TA 4D80A 3AUYA 2NO7A 1XEXA 3K8YA 3TW4A 2O8BB 1WRBA 3B1WA 1IN4A 1UBFA 4RD2A 5AUNB 3ETLA 4LUCA 4Q4HB 1D2EA 1M6NA 3I92A 1QRAA 4ZI2A 1XD9A 3EARA 1WB9A 1S9DA 1XCGB 3A58B 1Z0JA 4NCKA 4P4SA 4NDZA 2QUZA 4JLVA 4NCNA 4MH0R 2ZRGA 4DZZA 2C9YA 2CL0X 2ZE8A 1N0UA 4DLZA 2VTKA 4A0GA 1XXHB 4QGGA 3IEUA 2WPDD 4PZLA 2YC4C 4A2QA 3AKEA 3AVOA 1P9WA 4BLPA 5A5GA 1LS6A 4JLAA 3O8BA 2G88A 1UEIA 5DN6A 5IHPA 2YKGA 4PTLA 1AA9A 4OHWA 1KYIA 4RFVA 5CB8A 4BPBA 4ARZA 1SGWA 2QP3A 5BN4A 4G5QA 3SYNA 3L0IB 2C8VA 4Q00A 4JS0A 1RYFA 2ZVQX 2ZYVX 4DCVA 3AVPA 2IF0A 3QBTA 4I1VA 1SHZA 4OKSA 2FPLA 1HT1E 2JJ1A 1E9FA 5FPTA 4TTQA 4DT1B 1Q20A 1G3IA 2NQ2C 3TIFA 4G5RA 3ONWA 3U2QA 3OAAA 3FKQA 1GFIA 1VTKA 4KFUA 3GJ8A 4NKRA 3K0AA 4E09A 5J4KA 2P6RA 2IS1A 2YOGA 2W2XA 4LHYA 2OILA 2H17A 2J0SA 3H84A 1W2HA 4PANA 2DB3A 4Q4LA 5FTNA 4BASA 3F3YA 3AF1A 2AFIE 2D7CA 1QHIA 3O47A 5JEEA 1G21E 1N6RA 5DHAA 1XD2A 2A5JA 3LBIA 4FMDF 3C5CA 2RGDA 2G1KA 3ZS9A 1YR8A 5EUQB 3A1TA 1UKZA 2QM7A 3TRFA 4K46A 4LYJA 3B1XA 4BE7B 1R8QA 5JJKA 1W5SA 4Q9KA 1GITA 1S8FA 4IOMA 2O0KA 3WP1B 2ZXUA 4FCVA 1GOTA 5A0FA 4UXHA 4X8OA 4A2WA 1JJVA 1H8EA 2ZS9A 3MSXA 4M8NE 2FSGA 3DMNA 1A7JA 5JWOA 3ADBA 4W5HA 2XXAB 4PAOA 3LXXA 4BQSA 2G77B 2PX3A 3C41J 4HDQB 3BJIC 5FFMA 2KBEA 2QG6A 2GF0A 5KO2A 2Q9CA 2WM9B 3L82B 2CNWA 2VP5A 4WW0A 2ASEA 2YYZA 3OEHD 3B9QA 2C99A 4P4TA 3BD9A 4TMVA 2ANBA 3EW9A 2DFLA 2BOVA 1SKYE 2ZU0C 1IXSB 1SVIA 1UBCA 2ZRCA 2AN9A 1TQ4A 4A4DA 3ZIAD 4ACAA 2O8FA 1CR2A 2GAOA 4PO8A 1W36C 2FFBA 5FOTA 2ZU6A 3TKLA 4O0MA 4C0AC 1P6XA 4DB2A 3Q3JB 1ZC3A 1RFLA 3BB4A 1Q22A 3NC0C 3TR5A 4IVRA 4DLRA 2YWEA 1BO6A 2OLJA 2ZAMA 3BH0A 4MYUA 1RZ3A 1XMSA 2Z6VA 4LOAA 3EWAA 2ZRKA 1FUUA 3B7GA 2P67A 1W1WA 2J7PD 2HJVA 1OIVA 2HUPA 3FFAA 2QBYB 1E2QA 1OXXK 1E4YA 1AS2A 5B30A 3VKHA 5P21A 4OI2A 2IF2A 4IRUB 4ASUD 3DOFA 5E7IA 2OZEA 4JLJA 1GAJA 2VLIA 1AM4D 2FX3A 3KJGA 1KO4A 1VHTA 1N6NA 3A8TA 2J87A 2WJVA 3EC2A 1AK2A 3KKOA 3GLHB 2C78A 2GCNA 4JLKA 4D81A 3A37A 1FPMA 5EE5B 2A3RA 4MGKR 4TL7A 5FBVB 3PEVA 1OJLA 1A1VA 2H16A 4PPFA 1NKSA 3WNDA 2P6NA 4MYTA 1E2NA 1KK3A 2FN4A 4JMPA 5EXXA 4GRAA 4HLDA 3WHKA 1ODFA 3DEFA 3SBDA 1NN0A 3I1FA 4HLCA 1GZSA 4R7ZA 1WP9A 4TQUS 2IUSA 5EQTA 4JLBA 2OBLA 2PT5A 3NWJA 5BN5A 1Z2AA 4D25A 1AZSC 2G6BA 2YOHA 5IRCD 3R8FA 5H8WA 2QAGA 4B74A 3OFNA 1TTTA 2ZI5A 1CR4A 4NL4H 4KITB 2R6CA 1LS1A 4RSGA 4B3FX 1ZUHA 2DHRA 4XD7D 1NMYA 3QKSA 1P61B 4TL9A 4B3XA 4LZZA 2QU8A 4YDSA 1ZMXA 2R6FA 1U0LA 4BFWA 2R9VA 4A6PA 5DNYB 4A0HA 2XOKD 2AKYA 2QTFA 4DB4A 3RS2A 5JS8A 4W5WA 5DIFA 3CZQA 1JPNA 4PFSA 1S9HA 1E2JA 1FTSA 4IFBA 2Q9AA 3KTAB 3OESA 3QNUA 4D0GA 4DUGA 4F4IA 4URXR 3BWDD 5J4YA 3MG9A 1AKYA 1JR3E 1BYIA 5BYKA 1RJ9A 4C4PA 4B3GA 3KKNA 4DLVA 1PLKA 3TUZC 4DJTA 1KZGB 1OLOA 1X8LA 2YNMA 3DZDA 4WXRA 2VP9A 2XX3A 2WWHA 3GLGA 2WJJA 2ZI7A 3AEZA 3K9GA 1KGDA 1E1QA 1XEWY 5CYOA 1E0SA 3FMIA 2NOAA 1LTQA 2UVQA 3AF4A 4ZDKA 1C1YA 3LLUA 4JLMA 1ZVQA 3BB3A 2RMKA 4U5XA 5AJXA 1YZGA 2ZJ2A 4YMSA 1Z22A 4UNNA 1DO0A 3U3OA 3W6PA 1CULC 3KUDA 4M1MA 1QVRA 2IT1A 3Q85A 3GJ5A 1AQYA 4P3YA 2BJVA 4E22A 3BXZA 2OT3B 1AZTA 2HF9A 2OSBA 2JLSA 1M8PA 2D74A 1T8UA 4Z8YA 4BECA 5EXTA 3QPWA 4JZKA 1FX0B 1P7CA 1ZM7A 1ZAKA 3AF3A 4RKEA 4E03A 4M9ZA 5DLQC 4RD3A 1CU1A 2C04A 3HDTA 3ICQB 3CM0A 2WVJA 2J3EA 1DS6A 1YZTA 2JLRA 3HU3A 4JVSB 2LKDA 4FCTA 4BWYA 2HXSA 1YZNA 1LVGA 1E2FA 2O52A 5LB2A 4PXAA 4KFSA 3PEUA 5KSPA 4Z51A 2WWGA 3FOZA 4BUJA 4BFXA 3RS4A 2IS6A 4LBWA 1GKYA 1TF5A 2YINC 1Z6XA 4DCSA 1QHSA 2JLQA 3CBQA 5D3MA 4Q1CA 4XVRA 1HUQA 4OQFA 8OHMA 4MYCA 3AVVA 1Z6TA 2V54A 1SVOA 5HE9A 4E07A 4BLRA 1B23P 2VPPA 1VECA 1W4RA 4AYXA 2QMUA 2XTNA 1Z8FA 1XRJA 3SQXA 4NCIA 1CJVC 1A82A 1IXRC 3AP3A 3KQNA 4CRWB 3M6AA 1F60A 4PC1A 4I1SA 4LHVA 1RVDA 5CM9C 4V0ME 4HB3A 3CR7A 4G1UC 2JJ8A 3QF4B 4ZCLA 1IM2A 2F6RA 2B21A 4RZ2A 2FFAA 1EX7A 1G4AE 2XJ9A 3WBJA 3QENA 4LRWA 1P75A 3REFA 4QJ5A 4V0NA 4L5BA 1LF5A 2AK3A 2QTHA 1G7TA 1JXMA 3EA5A 3BFKA 3T5DA 4TYQA 4ZCMA 4KBGA 2VP2A 3AV0B 2V4ZA 3GJ6A 4URWR 2GHIA 1VG9B 3LH5A 3LQQA 3TSOA 1Z0FA 3T5GA 1IONA 2JLWA 1OYWA 5FUVA 2F3RA 4ABYA 2PJZA 5DO9A 5EE3A 3BFXA 1MRNA 1G20E 3H0KA 3NBYC 1UEJA 3HP1A 4Q5IA 1P4SA 4TYYA 3B1ZA 4MKIA 4C2UA 4DDWA 1W49A 2HXYA 3BC1A 2UZIR 4JT4A 2ODNA 4RVCA 2OM2A 3U3MA 4CEJB 3MJRA 5KDDA 1E1RD 2REBA 3FYHA 4M4SA 5BWMA 5J4HA 1OFIA 1T3SA 1TF7A 1VIAA 3TK1A 2C98A 1NIPA 1P60A 2EQBA 4HUQB 4R2HA 2FV8A 3AKCA 2VIIA 4LJ8A 4G5GA 2ZI4A 2NZJA 3TR0A 5C1BA 3I5XA 4TMTA 3SBEA 4G3XA 1E98A 4ZIRB 2JIZD 1W0JD 2IYSA 2IXEA 2DY1A 2IBMA 5E7MA 3TLXA 4EPYA 5L3QB 4KODA 3CPJB 5AJZA 3IHWA 1OF1A 3GLFB 2OBMA 4QHSA 3KXKA 2C9OA 3N2IA 1R0XA 4YMTA 2PL3A 3TNFA 3LBHA 2J5XA 3KX2A 4TLDA 3K9HA 1HH4A 2FSFA 4W9MC 1CJTC 3LVQE 4I1UA 4RCYA 3HPQA 2KI5A 2VHCA 4HYYA 1ZNWA 2GZHA 5AWFC 1G1MA 1X8JA 5HTKA 2BM0A 2F1RA 3I61A 2ZREA 3RANA 4TT3A 2DPXA 1EWQA 5DYGA 4HAWA 4PSVA 4US1R 1VPLA 1GWNA 4HLUC 3VR4A 1ETUA 2QORA 4QM7A 5F3WB 3CF2A 2AX4A 2PZEA 2DBYA 4JVNA 4ZKDA 2P3SA 3PVSA 4IVPA 1QG2A 1U8ZA 4WZBE 4Q1DA 4ZKEA 2CDNA 2P2LA 5FH9A 1YVDA 1ESMA 1KKLA 1DEKA 3D31A 3LVRE 4MYHA 2J0UA 2ZRIA 4TTPA 1II8B 3H86A 4N0EA 2EFCB 1FOEB 2HCJB 3CRMA 3TVTA 2ZI6A 2WKQA 4DVGA 2W83A 2MSDB 1OSNA 2FSIA 1R6BX 1PLJA 4GZLA 3H1TA 3ZZTA 1W4CA 4K8OA 1N6HA 3AP2A 1N0WA 1ZM4A 1BH2A 4B71A 3PV0A 2ZR0A 4F38A 3QXXA 1NSFA 1MRSA 1WF3A 1OIWA 3F0TA 1RRPA 2NG1A 1Z0KA 1R5NA 1FNNA 1COWD 1CS4C 2HYDA 3U3RA 2WIBA 2P0EA 3PEYA 1T91A 5AR1A 3TAUA 4QBHA 4NYIQ 4LCBA 4DXAA 1TADA 4A82A 5G3YA 3I72A 1Q21A 1EK0A 3EZFA 3Q5EA 5FR1A 1VCIA 3MWLA 3BFVA 1ZJ6A 2BWJA 1KSGA 1ZD8A 3AGQA 1UBGA 1VYVA 1N6KA 3U7GA 1XU4A 1T9HA 4X8HA 1E9DA 4C7OA 3AKYA 3K0CC 4A2PA 4LBYA 4B2IA 3EIHA 1SVSA 2AWOA 3W3AA 3BK7A 3LLMA 4HZUB 4AI6A 5HZKA 2CE2X 3IIMA 5FPHA 3UPUA 1RRCA 4OQNA 1IOZA 1KMHA 2B7BA 4QBFA 1FUKA 2ZS7A 3CX8A 1T3LA 3GD7A 2R8RA 1ZM3A 1KI8A 3LBNA 2V7QD 3EIEA 1C9KA 1P2VA 3FHOA 5CK5A 5FPSA 1HT2E 4QGFA 1YHNA 2YWHA 3THWA 1Q57A 1OHHD 1EFHA 2IYXA 4R98A 4D4JA 4A92A 4FI3C 4WZ6A 5HPYB 2IC5A 3IDQA 1OV4A 3OE7A 1II9A 2HDNB 4NYIR 4HB2A 2VYFA 2QSYA 3SOPA 2QENA 3FFBA 1KK0A 1M34E 4JL8A 5TVKA 4URZR 1SXJD 5JSZA 2XNDD 1XPUA 4QGHA 1R5BA 2HEIA 2YC2C 4Y0VA 1JR3D 2W2VA 4IEIA 5EP2A 4H9GA 2OEPA 3BB1A 3ZVRA 4LSGA 1KSFX 3IO3A 5FUWA 3MWJA 1E96A 1G8PA 3OHMA 4LHWA 1FQKA 1EFUA 2DYKA 1E9AA 2OXCA 1D6JA 2F55A 3R8CA 2ZM5A 2VL7A 1YQTA 3S1AA 3KQUA 1W4AA 4B3CA 2FPKA 3K70B 2VHTA 3FHCB 4JT2A 4UXIA 4LBVA 1U0JA 2RGGA 2JEOA 2JDID 3P1JA 1SXJB 4TLEA 3THYA 5AJVB 4ZO4A 1N5IA 4B3DA 5EP4A 4PPGA 3O8DA 2WOJA 4P31A 3THOA 1KO5A 1I2DA 2VBCA 3GFPA 5IF9A 4DLXA 2ZR7A 3WRYC 3QEOA 5AUQA 3SYLA 4EJSB 3KDSE 4D0NA 2I4IA 3QF7A 1HTWA 1U2RA 1IXZA 1X1RA 1W44A 2XAUA 2F1IA 2B7CA 4ZI3A 2D62A 1AJEA 1P3JA 3JVUA 1G3RA 1IN5A 4Q19A 3UANA 5KUTA 2CJWB 4QOSA 3FWYA 4YLGA 1AN0A 2QM8A 4TMKA 2YZ2A 1GILA 2WMOB 2ZROA 2ZEJA 2VP6A 2F43B 4IDPA 1PUIA 2IA5A 1G8YA 2P5TB 5ELXA 4TYPA 2F1HA 1KHTA 1ZNYA 4NONA 3CF0A 3T1OA 4EKDA 4LGMA 1VG1A 3DDCA 4RD0A 4IOJA 3P4XA 2J45A 1G5RA 3ND9A 5CYPA 3RSLA 3MD0A 3IGFA 4DWJA 2SHKA 1KOFA 1E79A 3C16C 2BBTA 1E2GA 1NBMA 4LV5B 1GKIA 2P5SA 2F9LA 1JXOA 3I32A 4DLTA 2W58A 4OK3A 3CNNA 2ZYWX 3UWOA 3NH6A 1QVAA 4PZZA 2QN6A 3SNHA 4C0LA 2LKCA 4DSUA 1IJFA 4HAVA 1KAGA 4YMWA 3RS5A 3AM1A 1RYHA 4AKHA 4TL6A 2VH5R 3BGWA 3TBKA 2IYZA 5FOXA 5BXQC 3TVDA 4JLOA 4PQFA 1IAQA 3WNCA 3VR5A 4A8JA 2KWIA 1F2TB 4MQBA 3J81k 3RC8A 2R62A 2AHOA 4EAQA 5LBIA 4FD2A 1VG8A 1E2MA 1O3YA 2AK2A 1G7RA 1G4UR 1QHHA 2WZQA 4OJQA 2IYUA 3VU9B 4A6XA 2VF8A 3W6OA 4AKEA 1J2JA 2QPOA 4KVAA 3N2EA 1D9ZA 3THXA 3ZYCA 1IN8A 1YZLA 2L0XA 3OIUA 3ZVMA 1BYUA 1CF4A 2V3CC 2ZE7A 1EFRD 2JATA 2ZRPA 4M0LA 4TQAA 4DEXA 1GNPA 3QKUA 2GZDA 4LC0A 1W2GA 4QNRA 1HA3A 3MJHA 3NDBB 4O25A 4ZDIA 2QT1A 4B34A 1JAIA 1IY1A 4DLWA 5IK2A 4HI0E 2HF8A 2VHQA 4M1KA 4TSFD 4KI0A 5FL7D 4PC2A 3KKMA 2BCGY 2Q21A 4MKGA 2OV2A 3KQHA 4JLDA 1E0AA 2WMNB 2RGEA 5CDFA 2JLYA 1Y3AA 1P5ZB 2GCOB 4F4JA 1CTQA 1OKKD 4URVR 2P6UA 4FCWA 1GL6A 2CVHA 4WOPA 5HKKA 5KYKA 4KO8A 5B2ZA 4QHYA 4JSTA 1YZQA 3G82C 4MGYR 3VMFA 1CR0A 2ATVA 5FI0B 1OFTA 1HV8A 2CL7X 2GJAA 2QL6A 3K9NA 5FBWB 3TUIC 1F2UA 2ZR9A 1RRGA 4ZV4A 1J8MF 5GJVC 3ICEA 4MDEA 3B1YA 2NO9A 3ZS8A 1E9EA 1BKDR 3KJEA 2J0QA 1U8YA 1TEVA 3NVAA 4NYMR 5DI3A 1SHKA 3FPAA 3CWQA 1N6PA 5KNCA 2KE5A 3DVLA 2DR3A 1JQLB 3GLFE 2EWVA 4IW3B 1E2PA 4Q9JA 3A1UA 1XWIA 4PSKA 1NJFA 1E32A 1CLUA 2W2TA 3BH7A 1IJEA 2UKDA 1ZU5A 4MUAA 4TLCA 1W0JA 4KYUA 3V00A 4BLOA 1TNDA 3RVBA 2BCJQ 5EE9A 4NHOA 5FI1B 5BYJA 3MAAC 4OYHA 1KJYA 1NF3A 1DAGA 2IYTA 1G5TA 1XJ0A 2KBFA 2RH5A 4TN1A 4RFSB 3SZRA 4DBLC 4R71A 2N1BA 2WKPA 2B92A 2GXAA 2EFDB 5KPDA 3G5UA 1Z63A 3WXMA 2BKUA 4CF7A 3E70C 4WXPA 4LJYA 2IX3A 3DPUA 3QKRA 1NRJB 2FEMA 4FINA 4Z1MD 4IDNA 3AKDA 3TSWA 4OHZA 4OQLA 4GMXA 2O8DA 3BBPA 2I1QA 3M1IA 2REXB 5FTJA 2J59A 2CK3A 3ND8A 5TXGA 3HR8A 4TMWA 1G5PA 4GOJA 2BEKA 2ORWA 1CRQA 2D3WA 2RGCA 4ILEA 1L7VC 4PQRA 2BMDA 3K0FA 2WWFA 3QQ5A 2Q3MA 1VKJA 3AQ4A 3CRVA 4L4UA 4DLUA 3T1VA 1BMFA 3UG6A 1Z07A 1X86B 4WBSA 3VHLB 4A8JC 2JA1A 1E0KA 2RGNA 4UNSA 3UG7A 4BFVA 4BEBA 5KDLA 5KSZA 1UM8A 3IKJA 2QSZA 1XB2A 4KXFB 4YMUA 1UBEA 2O8EA 2QNRA 4XH9B 4DCTA 5KNDA 4DSTA 1Q3TA 5JI2E 4PHGA 3LAWA 4DDUA 4Q4AA 1NVVQ 4MUBA 4CEIB 4M1SA 1BOFA 1P73A 2QE7D 3LWNA 4DSOA 3LY5A 3NHBA 3KFVA 3W8NA 1FMJA 4S2EA 4TYWA 4EQ6A 1JI0A 4BEJA 4PZYA 1G291 4ZDWA 3SDZA 3VKWA 4JKYA 3K0EA 2W6JA 3PQCA 3I62A 2J7KA 2ZJ8A 1PUJA 1Z0AA 2CCJA 1JPJA 3A36A 3AUXA 3NBZC 3W90A 4BZQA 4LYFA 3L8ZA 2ZSEA 2CVFA 2GBLA 5HZHA 2KB0A 5AUPB 2BMJA 6Q21A 4H1UA 2ZPTX 2XSZA 3LO5A 2F7SA 2AD5A 1EX6A 2V7QA 4L9WA 4C0KA 3MLEA 4D82A 4MGIR 1I4DD 1VYTA 2C77A 1UAAA 3SU8A 1N6IA 1H8HA 1KJZA 4IJMA 3EPKA 2ZSFA 1OHHA 1X6VA 3C7KA 2GVZC 2KSQA 1NVVR 2X77A 4Q9IA 2V6IA 2WWXA 3ADCA 5JWRA 2OCBA 3W9YA 3TSZA 4MKFA 1G3UA 2PMKA 2ZAOA 1MKYA 3CH4B 2W6IA 4KFRA 4JLNA 2ZTSA 4D4KA 1L4UA 2Z43A 3CNOA 2ZE5A 2DFKB 2YOFA 3FKSA 2W00A 4Z8XA 3IIKA 4XOIA 4GL2A 3DM5A 3KUCA 1NI3A 2ZITA 5CIQA 4BFZA 1SXJE 1TQ6A 1DE0A 3PIRA 1CKEA 5FBRB 1OB2A 3ZQ6A 3F5FA 2Z4RA 5EP1A 3H2YA 4NTZA 4RZXA 1AIPA 2VHUA 1T4GA 4EFMA 3GLIB 4URUR 2ZI3A 2ZRBA 3GJXC 2EYQA 5GVRA 2FGJA 5LD2C 2ECKA 2GRJA 4D4LA 4CEHA 4DIEA 2HLDD 2O5VA 2PLFA 3EZ6A 2GEVA 4GT1A 1W0KA 1D2NA 1NMZA 3U4QA 2GK6A 1US8B 5EXSA 4BLTA 2BM1A 4QL3A 2OBNA 2BMEA 5TB5A 4Q9LA 4ACBA 1VG0B 4NBSA 2ZRHA 3HR7A 4HDOB 3PXGA 3FE2A 4XWAA 1ZP6A 1IBRA 2JJ2A 4Q4JA 2ZI9A 3ZGXA 1J90A 1UKVY 4F7WA 3Q9LA 4NCHA 3ADDA 4W7SA 1Z6YA 3TE6A 4ERNA 1KSJA 3LNCA 3U6KA 4CW7A 2CHVA 3BIFA 5UKDA 3CX6A 4HLUA 5M04A 2MSEB 4AIIA 1XZPA 4OK6A 2A5FA 4PR0A 4DEYA 1NY5A 3B2EA 3R7WB 3GLGE 2YWFA 1RIFA 3CONA 5KSOA 1OH6A 3DZ8A 2A5DA 2O8CA 3U44B 2CHGA 2WSSD 1TUIA 1QHGA 1UDXA 1UJ2A 2DWQA 3QIAA 4HAZA 4YDHB 3T1TA 1QDEA 5F98A 4AY2A 3PR1A 1U99A 1XD8A 2RGNC 3B5JA 1VCNA 3DKVA 2QP4A 2GAAA 2R6GA 1SVMA 4FMBB 2IS4A 1JAHA 3ZVLA 1J7KA 2F3TA 1NLZA 3OEED 5KHOC 2O8BA 4MRVA 1XP8A 1E2KA 4AKIA 4GOXA 2J1LA 4Q4HA 4Q47A 2XTZA 1ELOA 1MABB 2FNAA 3MGCA 5TV2A 1Q1EA 2XB2A 4KSCA 4O2RA 2EU8A 4Q7LA 4U7DA 1DARA 1KSHA 1TPZA 4V0MA 2EVWX 3UWKA 2FPMA 2X1VA 4BGDA 5EZ5A 1XXHA 4HSEA 5CLQA 2ZRMA 2OFWA 1E2HA 1G8FA 1NVXQ 1OXVA 2FZ4A 3UIEA 1HYQA 1KI6B 2FZLA 4KSBA 1W36B 2IS2A 2FGKA 4EFLA 3PUXA 4NZYA 2IK8A 3VFDA 1MOZA 3QPUA 5KOYA 4TLAA 1Q1QA 4L16A 3CLVA 3K0CA 3TW8B 2GBLC 5GJWC 3QG1A 4GNKA 1YR9A 1E2LA 3DHWC 2CE7A 1KMQA 2W0MA 3Q5DA 4TWZA 1XEXB 4LK2A 2OXRA 4IKEA 3LD9A 1LFDB 5DN6D 5FPYA 3T61A 1G7SA 1DPFA 1M7GA 3K1JA 1UF9A 2WPDA 1FTNA 5FOWA 5HCIA 3D7MA 2DFNA 2QP9X 5AK0A 1E9SA 4WVFA 2ZJ5A 3C15C 4DT1A 2IYYA 4P4SB 3CZPA 1R4AA 2BBSA 1U94A 1U8AA 4CZ2A 4DCNA 1GL7A 1WMSA 5EE1A 2JLXA 3IIJA 2WIAA 2FFQA 4AK9A 2CCGA 1YJ5A 1VCMA 5E95A 2JJ1D 3AVUA 4EIWA 3B60A 4Q7MB 4MITA 2GILA 5JEDA 2DWPA 2WICA 4GMDA 4BRUA 1XFAA 2AXPA 3UMRA 1DTSA 1T6NA 3KB2A 2ZSAA 3RS7A 4IOKA 2LCFA 4ARZB 5LDDC 4MGZR 4OI1A 1ZW6A 1R0YA 2A78A 3I3SR 3P4YA 3SYKA 1G8GA 4GPTA 2FG5A 3ASZA 3ZZUA 1CEEA 1O87A 4MRSA 3ADKA 4YC7A 4B32A 4XVUA 1Z6AA 4B6FA 3RABA 1UKEA 1X8KA 2WKRA 4QNMA 3SN6A 2OHFA 2WV9A 1FMLA 5H68A 4P0TA 2D06A 1KY3A 2PX0A 4L15A 3OIYA 3CKLA 3VNUA 4EDHA 1Q0UA 2XXAA 3I4LA 1PVOA 3BAFA 1G18A 1ZD1A 2RGXA 4KYIB 3K0AB 3TQCA 3NEYA 2CCKA 2ZUCA 1ZC4A 5JMTA 4M53A 1TUEA 1H8ED 3OZXA 1XMJA 3LQRA 3FDIA 3SS8A 2GDJA 2NO0A 2G83A 4HUTA 4LYAA 3U3JA 1KZ7B 4TLBA 3CR8A 3HYRA 4QC2A 2QI9C 1D5CA 1S4QA 1U9IA 3IQWA 2PZGA 1G8HA 4X8LA 1XD2B 1M74A 5B57C 2CNWD 2FWRA 4GSYA 1XTJA 4LJ5A 2WJHA 5DYIA 1KI4A 1ZD9A 2VRWA 5GVSA 5FBQB 1SVLA 5FOVA 3MUFA 4TMXA 1G9XA 4V0OA 3U5ZB 1XJCA 1B0UA 3LV8A 1C4OA 1TU3A 1R0ZA 4XVQA 4B33A 2ZUDA 2RGBA 3OEHA 4Z1MA 1YU9A 2H8KA 1NG9A 5BW8A 2HJGA 3ZJYA 1VCOA 5CITA 1GUAA 2C9CA 2Q0HA 1XNJA 3ZLJA 3U3KA 5AJYA 2YV5A 2XZOA 2E87A 2OG2A 2QA5A 5D3QA 1J8YF 4AYWA 3IO5A 3ZIAA 2QBYA 5JCZA 1GNRA 2VSFA 4Q1FA 4LV6A 3U61B 4PAQA 4POAA 2CXXA 3AVTA 2IYVA 2NTYC 2J46A 5C4MA 1Z6GA 5L3SA 4U02A 2C96A 1NG1A 2V8OA 4KAXA 2O8FB 4PC7A 1SULA 1G19A 1A2BA 4OQMA 3H4MA 1QHNA 1R5OA 4IVQA 1Z28A 4JBYA 4D0LB 3GLHA 3FHTA 5HCNA 1E9CA 1LV7A 2NPIA 2J7PA 3VNVA 2HV8A 2WBLC 3AH8A 1LW7A 4I99A 2GKSA 1QHYA 1T0JB 1KO7A 4UNRA 1KO8A 1CJKC 1EESA 1KK1A 4HZIA 2XTMA 4WIAA 4ON9A 5DISB 1JBKA 4M2LA 4ASUA 3D6TB 4XWOA 4TZ0A 4BRWA 2AXNA 2PH1A 4OK5A 4HAYA 5DHFA 4RD6A 3O8CA 1D8TA 3FB4A 4JSYA 2QE7A 1P2TA 4IHQA 2ATXA 2PBRA 3W34A 4QKQA 4AKGA 1BS1A 3HYTA 3QXSA 2IUTA 1GSIA 5E7JA 3L43A 5KU1A 1NVUQ 721PA 2WHXA 1NMXA 3GJ7A 2BBOA 1M2OB 3K70D 3ZQJA 3PITA 3PUYA 4FMCB 2GA8A 3GFTA 1IHUA 2A30A 3WYAA 1CP2A 4C0BA 3SFZA 2YWGA 3OFND 4A0RA 4PC3A 4KJZA 1HQYE 2QGNA 1ZM9A 2FDCA 2G0NA 1KI1A 3KFXA 3D8BA 2IHYA 5EXPA 2GEDA 2OCYC 1TX4B 4JJZA 3RDPA 1QZXA 3T35A 4B75A 1YRBA 2CLCX 4BZPA 1CIPA 5CB6A 2FF7A 2PEZA 1I4LD 1E6CA 2GJSA 2ORVA 1NN5A 3FTQA 1N6LA 2OCPA 3KTAA 3X2SA 5K8IA 3X1DA 2YJTD 1EG7A 2Z5FA 4XD7A 2QTVB 2GJKA 4GDFA 3P27A 3K9LA 1Z3IX 2ZJAA 2O0HA 4IDOA 2OESA 2H92A 2QAGB 2RGAA 3NEJA 4DUGD 2QGZA 1G17A 1OXSC 3GLIE 4LJAA 2XOKA 1OFHA 1EXMA 3R9XA 2I3BA 1S96A 1ONBA 3QSYA 3ASYA 3QKSB 1WBBA 4D26A 3DMDA 4TL8A 3FMOB 3VR6A 1TF2A 2PLRA 5EZ6B 4DKXA 2JLUA 1XTQA 2NIPA 4B3BA 2ERYA 3VTKA 3OIVA 2KJQA 3GMTA 4LBZA 1LB1B 1QG4A 221PA 3VKGA 1E1QD 1U9IC 1EWRA 5H70A 4A1FA 1Z0IA 4OHYA 4M1YA 2HT1A 1K5GA 4M9XA 3REGA 1CJMA 5JHHB 2GWHA 5C18A 4CVNA 3ECCA 3WHLA 2VA8A 3EZ2A 4LHZA 3C4JA 2ZYTX 4QG7A 2OLKA 1FX0A 4O3MA 4JL6A 1RJ9B 1S1MA 4DC9A 1N5KA 4YXWD 3KB1A 3PUVA 4A15A 1YZKA 1XTRA 2WSMA 3RWOA 3AF0A 1DELA 3GLGB 1G41A 1FW6A 4WZAE 5CJPA 2PT7A 2ZYUX 2GXSA 5JJIA 2CLSA 1N2CE 2QEQA 2QROA 3PUZA 2QQEA 4CIDA 4P4UA 4QM6A 2ZJZA 5JECA 2ZRAA 1G7CA 2QY9A 2GESA 3BORA 4BFUA 3KJIA 4BLSA 2ONJA 3VQTA 3W3ZB 1R8SA 4B6EA 2AD1A 1N6OA 4Z54A 1CXZA 3WMGA 5EJEA 2FOLA 1NJGA 2GJ9A 2QPAA 1K6MA 3HPRA 2NGRA 1QBKC 3WP0A 2V1UA 5SZJA 3IBYA 4EPVA 1ZNZA 2R65A 3A4MA 1P2UA 4I4LA 2VHJA 1OB5A 4F4CA 1A5TA 2EFGA 3QF4A 3OEEA 1HE1C 1XZQA 5DI9A 3SHFA 2OE2A 5IT5A 1QF9A 2CL6X 2H7VA 1R7RA 3NBXX 5GADl 2BVNA 2G3YA 5FOSA 2B8WA 5C2JB 4JBWA 4B35A 4B44A 4QBIA 1KDTA 2QMHA 3MRSA 4NYMQ 1TQDA 4B76A 3V4FA 2R6DA 3WYFA 1X3SA 1WA5A 1XMVA 4Q48A 2OCAA 2ZJOA 3B78A 3GJ4A 5D3MB 5DSZA 3A4NA 1Z2CA 1E9BA 2VO1A 3NC1C 3GP8A 2X2EA 2VSOA 5SZHB 5AJWA 4UQOA 1AGPA 5KNBA 2IXGA 3SC3A 2QRZA 4LJ9A 4KBFA 3ZZ0A 3SFVA 3CPEA 1UDWA 1ZU4A 4CEJA 1S3SA 3MWKA 1W47A 1YZUA 3R9IA 5K8UA 5TARA 2ZQ5A 4X8MA 1W48A 1KDRA 1EFCA 2Q3FA 4US2R 1N5LA 1IN7A 5G40A 1KNQA 3K09A 4HUQA 1DAFA 4M1WA 821PA 2IW3A 4JVMA 4PAMA 5FUYA 4G01B 3W5JA 3SQWA 4XTCS 2ZRJA 4B2PA 3GJ3A 3CUEF 4MRRA 4KU4A 4JIMA 5FUXA 2B8TA 4FW9A 1SVWA 4RKFA 4C30A 1GP2A 4ZIRA 2E9SA 4FWIB 4P33A 5JHGB 5L3QA 4Q18A 4BFTA 1DAMA 3BOSA 4MRNA 2J0VA 3GLFA 3X1XA 5KTYA 3HU1A 3EZ9A 4JBXA 2ZE6A 5EUMA 1WBDA 3W6NA 4ESHA 3I8XA 2R6AA 4LHXA 1HURA 4V03A 1E1RA 1BIFA 2GXQA 1GTVA 2ZSBA 3GCGA 5TDHA 5CDFE 1XCMA 5LB4A 1RE0A 3B9PA 4N1AA 1YRAA 1G6HA 3PFIA 3UXMA 5DGXA 1Q3HA 1CJUC 3PG5A 5B64A 4PC6A 3ZDQA 3L8YA 2UZ3A 4TMZA 3LW8A 5EE0A 2AKAB 2JIZA 3KXLA 4LJ6A 4EPRA 3Q7QA 5K8LA 1W7AA 2MMGA 3HJNA 1ANKA 4D4MA 4DDVA 2CMKA 5JCPA 2PEYA 4WAUA 1M7BA 1NKTA 1D9XA 2WAXA 2P65A 4P32A 1F5NA 1FL9A 3N70A 2YVUA 3QOFA 4G0NA 4KCGA 5H1YA 4O2LA 1GRRA 4RZ3A 1NNEA 4TT3D 5JZVA 4QJ4A 1AKEA 4DSNA 1U90A 1VYUA 4PO1A 5IDVA 1II8A 1OE0A 4N0DA 3R20A 2D7DA 3EG5A 2CLDX 4A36A 4I1OA 3SJAA 5GJBA 2PMDA 1NLFA 2Z0MA 3RRYA 2Q9BA 3EA0A 3BERA 521PA 2ZRNA 4B48A 1GNQA 4OHVA 5SZKB 5F2EA 3UATA 1ZUIA 1PV4A 3WY9A 1RPZA 2C03A 2F9MA 5FBLB 3KZ1E 1ESNA 1JNYA 4HB4A 4EPXA 1Z47A 2JGNA 4HATA 1OH7A 1N0VC 3M4YA 4LPKA 2IEYA 4HAXA 3RLFA 3B13B 3RS3A 5BQ5A 3T34A 4LV8B 4DIDA 1P72A 4DHEA 2A5GA 3UKDA 1D2MA 3SR0A 4NCJA 2TMKA 3IUYA 4EUNA 1W46A 5JFGA 5SZIA 3V9PA 5FOUA 1E2IA 3IEVA 4FXPA 1I2MA 2J0UB 3LX5A 3EX7C 3SJBA 5K8TA 1Q1BA 4DCUA 5J47A 2ZRLA 3PUWA 3GJ0A 2Q6TA 4HZUA 1L8QA 5JRZA 2A7QA 3RSOA 2JCSA 2V55B 4MRPA 3RNLA 3Q8XB 1XBTA 3RC3A 1COWA 1MO6A 4IXMA 1OH8A 2B6HA 1ZNXA 2D4HA 1G16A 1KI9A 4Q66C 4Q1EA 4L9SA 4G5SA 4BLQA 2GVDC 3NBFA 1ZYUA 3CRW1 5KPJA 4TQ9A 2A9KA 4NMMA 2FH5B 4UXJA 3QE0A 1A4RA 5C4GB 5CM8B 1E69A 4AC9A 5C46F 5KSYA 1DAKA 1DVRA 2FEOA 1V43A 2IEZA 1R0WA 4KHZA 4Q1AA 5L3SB 3CH5A 1E99A 4QXAA 3AP1A 3A1WA 4I81A 2GEUA 2AR7A 3KXIA 3NHAA 2XEXA 5F9HA 4XJXA 3K09C 1G3MA 2WOOA 2BIFA 1UPTA 1XMIA 4C7OB 4KLZA 5F9FA 4CYMA 3OE7D 1AS3A 4Q01A 3WMFA 4C9BA 2Z83A 2ODEA 4D6PA 1A2KC 2NZ8A 1T3HA 3IPYA 1KMHB 2BEJA 3IPXA 1Q1ZA 5G53C 4Q7JB 1NY6A 4FMDB 4V0KA 1G64A 3QXJA 3DOEA 4LX0A 3FMFA 2H1LA 1MT0A 4UNQA 1DADA 1W5TA 4QJ3A 3GEHA 3EPJA 1P9RA 1OPXA 1SXJA 3THWB 1XTSA 2XNDA 4LY6A 1OYYA 4OJKA 5KDOA 1XDBA 1JR3A 4JYBA 4JKIA 2ZRFA 1AGRA 2IXFA 2GTPA 3RYTC 3PENA 2G0TA 3D3QA 4JJKA 4NU0A 4BFYA 3EPHA 3KL4A 2JAQA 1RC8A 4EJSA 3JZMA 3GEIA 2OUKA 3OF5A 5JSZB 4JL5A 1L2TA 3V4RA 2RCNA 1JR6A 1FP7A 5TY0A 3QBVA 3ZD7A 1XEWX 4U00A 3BH6A 2CJWA 2JDIA 3KKPA 4XSGA 4OBEA 2OAP1 4IDHA 2AFHE 3B6EA 3TAHA 1PZNA 3ZVNA 2HCBA 4Q9HA 4FIDA 2F43A 4B43A 2IL1A 4D2IA 4Q02A 3TH5A 4URYR 4F91B 1OIXA 1F48A 1OW3B 2IYWA 4GFDA 1FFHA 2C2HA 2FMXA 3K0SA 2AWNA 2A5YB 3S1AB 1DO2A 4J0QA 3X1YA 3G0HA 3B85A 4LPSA 2J41A 2PZFA 2QZ4A 5DE3A 3THYB 3SHWA 3B8HA 4YMVA 4OI4A 4CT5A 3QVVA 3RRNA 1T5IA 3CRQA 1NSTA 4YQFA 2QMOA 2VP0A 3EASA 1JJ7A 2H5EA 2LWIA 4JVLA 2EWWA 3DO6A 2FU5C 2IHBA 3EXAA 3C8UA 3AVWA 2GETA 1JECA 4B2LA 2ODBA 4M9QA 4Q03A 1CRPA 2QRNA 1E94E 1TU4A 4EPTA 3AGPA 4IFEA 4NPHA 3RAPR 1E79D 2RB4A 3CNLA 4YXWA 1XCPA 5HR5A 1NBMD 4XWKA 5JBQA 5CK4A 4UNPA 5FTMA 4Q21A 4B47A 2X8AA 3CRRA 1RW4A 4TTRA 1W36D 2NMVA 1CBUA 2GF9A 4A9AA 2FA9A 3A4LA 1F2TA 3E1SA 1NLYA 1GM5A 4DLSA 4TYNA 3NIBA 2XZLA 2BHRA 2V9PA 3SJZA 4W5JA 3VU9A 3FGNA 4IXNA 3IHLA 2IUUA 1U0HC 1LF0A 2ZVPX 5JLJA 2EFEB 4XSHA 3QG5A 3LRPA 4GI7A 1K5DA 1XEFA 3NKVA 2DFTA 4BZXA 3JZAA 4R9UC 4PO9A 3OIWA 1TMKA 3K53A 1LY1A 4E5UA 3A1VA 3SI7A 5A4JA 5J4VA 4IDQA 3QKTA 1M1YE 2MSCB 5JI3E 2ZJBA 4RJLA 2K5UA 2PCLA 2ZANA 2QMEA 3TGPA 2QQ0A 3UMFA 2H18A 3GQBA 1ZCBA 2RKOA 3QPVA 4OHXA 4K81B 1GDDA 1H65A 2VP4A 2G9NA 1DAHA 1KJWA 2ANCA 3F8TA 4RY2A 3U7HB 4KLNA 3AF2A 4A8JB 421PA 3SJCA 4AWXA 5IK2D 1JALA 1K8RA 1YR6A 1Z0DA 1EFRA 3HU2A 2D2FA 2GCOA 2EW1A 3L0SA 1E0JA 3P20A 5DH9A 3SEAA 2GNOA 2O0JA 4MKHA 1XXHE 3ZH9B 3VX4A 1QHHB 1X1SA 2XITA 1KKMA 1W4BA 4S35A 3THXB 3K70C 2WWYA 5L8VA 4TSFA 5FL7A 3WRXC 4AG5A 2YHSA 2GZAA 1SXJC 2W0SA 5HKKD 2RHMA 2EFHB 2QAGC 2Z4SA 3FMPB 2ZRDA 5G3ZA 3GEEA 3QJYA 3NDPA 1KY2A 1KTVA 1R10A 4RD4A 1P62B 1VMAA 4M21A 1XPRA 4CGZA 4GZMA 2BKEA 3EWSA 5G41A 3OAAD 3QUSA 3O8RA 1YR7A 3LXRA 4YONB 1FQJA 4TZ6A 1MH1A 3BE4A 1OKKA 2X2FA 4PHFA 4EJSC 1N25A 2N46A 1UKYA 3IQXA 2JLZA 5CLLA 1XTKA 1SQ5A 1TAGA 1KI2A 2CEAA 3UMSA 3X1ZA 3QY0A 3BRWD 1AQUA 2FJUA 4LWZA 5JS7A 1ZCAA 4CDGA 3N5CA 2BV3A 1R2QA 3VR3A 4Q7KA 3GFOA 3X1WA 4HLQB 4PSAA 4RD1A 3TJZA 3WYGA 1JB1A 1XPOA 3CIOA 4QRHA 4OL0A 3MCAA 4RFSA 1ZUNB 2A2ZA 3M0EA 4FMCF 4M9SA 3MWYW 1GIAA 5FPKA 1DOAA 1P9NA 1Z29A 4M1OA 1F2UB 4M1TA 3ZD6A 2ERXA 3CW2A 1ZM2A 4C0QC 5AUOB 4OQXA 5LPNA 3UK6A 4GP7A 2ODWA 4N3NA 5HE8A 1RRFA 1P2SA 2BMFA 1NN3A 4IEEA 4BFSA 1ZIOA 5DI3B 4JYCA 4XIGS 4FN5A 1XF9A 2NO6A 4IOLA 3W5IA 3QXCA 3I5YA 3RRZA 5L3VA 5L3RA 2GK7A 3MMPA 3WBKA 2HYIC 3NH9A 2X19A 2R2AA 1OXUA 3E2IA 1KI3A 1CR1A 2V1XA 3CWZA 1WQ1R 4JLPA 4EPWA 3RHFA 2XNSA 1MR3F 1YKSA 1EGAA 3AB3A 2VEDA 1S2MA 3E5HA 4C3ZA 2XZPA 1F3OA 2ZJYA 4LJ7A 4KV9A 4KFTA 5LD2B 1NVWQ 1HE8B 4US0R 2OO7A 2CK3D 1UADA 121PA 1VIYA 1JEDA 1QHXA 1OFUX 2QAJA 1DG1G 1IY0A 2WTUA 4LDJA 3EAQA 2VSXA 2XB4A 1SKYB 3QKRB 4HAUA 4ZDJA 1OH5A 5FL3A 4H1VA 1BMFD 3VR1A 1L4YA 4QHTA 1KO1A 2Q3HA 4C0HA 3LFUA 5E3HA 3B1VA 2ZIAA 4DLYA 3QVUA 4CEIA 2E1RA 3EIQA 2O8DB 1WCV1 1E2EA 1Z83A 3W8RA 3LW7A 3A6PC 4FWTA 3QXHA 1U81A 4G5OA 1HQCA 3AVXA 2BBWA 1Q12A 2WJGA 2OFXA 2G1JA 3VR2A 1F6BA 1J99A 1Z06A 3LA6A 3VAAA 1GL9B 3DM9B 1Z08A 1GRQA 1NL3A 1J70A 1TQ2A 1XX6A 3CPHA 3I73A 3CX7A 3K0FB 4V02A 2OAQ1 3WNBA 2PCJA 2RHDA 4DRZA 1II0A 4GBMA 4PPNA 3RRMA 2NO1A 3IBGA 4RCZA 3Q7PA 1S1CA 1OT3A 4PPQA 1Y63A 1G6OA 5GJCA 1SKQA 2W6JD 2WWWA 4GOKA 2O8EB 1E4VA 2J9RA 2IYQA 4NYJQ 2PJRA 3AVQA 3EZ7A 1OXTA 2V6JA 4MA4A 2WAYA 3B82A 1EFTA 1GRNA 2WJIA 4UJ3A 1HY3A 1S0UA 1E2DA 2BC9A 1IY2A 3BS4A 3C14C 3GLHE 1Q44A 5FTKA 4Q4AB 4RZUA 5JWHA 1KI7A 1ZRHA 2BDTA 5ANRB 4KVGA 2XSZD 5E4FA 2NPFA 1MV5A 2VF7A
chains in the Genus database with same CATH superfamily
1WUJS 4M9RA 4QBGB 4R9VA 4XJSA 3W0LB 3WKAA 4AY5A 1DEXA 1Q0QA 1Y6JA 1LXCA 3CO5A 5IUKC 1F9AA 3T7TA 4EQ6B 3UVEA 4QYSA 3TMKA 1AHPA 3A3PA 3OMXA 1DMSA 4ZJYA 1H8HD 3ILYA 8ATCA 4M0DA 3C7CB 3EIWA 2WP8J 4HB0A 3RWMB 3G6WA 4DXHA 3RIEA 1H23A 5CVDA 4Q7EA 1O95D 1Z82A 2IZOA 2RGRA 3UYLA 1Y7PA 3OU2A 4I5FA 4GP6A 2XOXA 4M54A 1ENOA 3F6EX 4X91A 4GICA 4LDRA 1SBQA 1DAIA 2HA4A 4WUVA 3WOHA 3F6BX 1E3MA 1FSSA 1EM8A 3FKSD 1DG3A 2PL9A 3BEDA 1PV2A 3HCNA 4R8KA 3TQFA 3P2IA 3WGZA 5K20A 1PEDA 3A9VA 1T0HB 4WXEA 3AVYA 3AEQA 1UXKA 5JFOA 4NYJR 2PMEA 3I2JA 1L4GA 4QELA 3HWSA 3IP7A 4DWVA 2H2IA 1US8A 1Y9JA 1U2TA 1MVOA 4PG7A 4PONA 1P19A 1DQPA 4KN5A 4RYLA 1HYBA 4GPD1 4MEJA 3ICWA 1LNSA 4MMZB 1SVKA 1OLSA 3QEJA 3U1VA 3V2IA 1TZMA 4O02B 1WSWA 1MO3A 3FBTA 2OWEA 1W0KD 2FW1A 4FGSA 4NE9A 4QTZA 4WY8A 5E9AA 3UOGA 3VBCA 3WDKA 1NP6A 3GWGA 1T1SA 1EHIA 4ICIA 4DMUB 3BSFA 5EJ5A 4AX8A 2XJ4A 2FYTA 4AUKA 4C08A 5EJGA 3T1QA 5E4TA 3DLIA 3U09A 4JITA 3U60B 1LDGA 5CLGA 1WXDA 1PR0A 5IC5A 2P1DA 4ZC8A 4H1TA 4CLXA 3DZBA 1JBEA 2ESRA 2C88A 1H5UA 2FLVA 3G2QA 2J9XB 4OJMX 4ZGWA 1P7PA 2NSHA 2X9VA 4CL8A 1TL7C 2QRMA 4MMXB 4OMFG 3OEWA 2Q6KA 3LCUA 4KX3A 4RA6A 3VPAA 2IU0A 4CEHB 4LXUA 2Y6UA 1V5FA 3RJMA 4AYTA 1K4MA 1SXPA 3PE3A 3QOWA 2HMAA 5AI0A 5BSMA 3U4QB 3K1ZA 2H1IA 4JK3A 1O97C 4L08A 2YRXA 1YA8A 5KX5F 1JN0A 4YRFA 2CNBA 1RQPA 4PHHA 3LX8A 4IR7A 2WDPA 5AVJA 4D9CA 2NW6A 2XNCA 2J85A 2JL1A 1DX6A 3C74A 1PJSA 3ESDA 3G9TA 3PPVA 3KQLA 3H0CA 2O3SA 3DE1X 1PLLA 2HNAA 4OHRA 4Q4JB 3GRAA 4JJEA 3WICA 4TKVA 4V0LA 2X6TA 1I7PA 2GSDA 3RS0A 1UK7A 1VP3A 3KCQA 4QGAA 1NLUA 1WMEA 5CH5A 1E2UA 4Q1BA 4MDFA 1GQQA 1M6VA 2GXUA 1UKCA 4PHTA 1TC2A 1KNXA 1RHKA 1NUUA 1XKLA 3N7AA 4QFMA 2BM9A 1ESDA 2AI1A 1CVRA 2R44A 1JIIA 4WLOA 3I2GA 2FHPA 2AL7A 3PCRB 1FNCA 4GMFA 4HDNB 3LGXA 2A92A 2XQGA 4UFPA 4C0SA 2PVSA 1NBME 5FTLA 2VDMB 1E64A 3KHUA 1Y7LA 1AHHA 5J40A 1RYZA 3T9AA 3TW8A 1SB8A 2HSDA 1EWKA 2BFDA 2VR1A 1W88B 4FIZA 4JX8A 5J1SB 3L7OA 1KAHA 3WMEA 1WB5A 4LDPA 5AOCA 3OT5A 3DAHA 2ONKA 3AJ9A 4LDQA 4ARBA 621PA 1V8FA 3AUYA 4KL8S 5CP8A 3TW4A 4AXBA 1TU0A 3CW8X 3MERA 3P19A 3QV2A 3B1WA 1SBYA 1U1CA 4D96A 2J3IA 1S6YA 4YAKA 1GTSA 2PV0A 4S0XA 4XDZA 5AW2A 4LUCA 3TQHA 3OWHA 1T2NA 3MINA 4TSKA 4ZI2A 3EFEA 5EWMB 4Z4QA 2I4RA 2IEBA 4JJAA 1EP1B 3D2AA 1XCGB 3UKOA 1KJNA 4NCKA 2ZUFA 2OP0A 2RG7A 3A7EA 1S02A 2G9RA 1Q84A 1G9SA 2QUZA 4JLVA 1VSBA 5HX7A 1D4FA 3DLPX 4MH0R 5CW2A 1GCUA 5LYJA 2ZE8A 4WASA 1QIHA 2DPGA 3WO1A 3DE2X 1XYYA 4A0GA 1PFYA 2GKOA 3IEUA 2WPDD 4GQBA 4PZLA 2SKEA 3E2MA 1ZH0A 3P5SA 3VJLA 1P0CA 1P9WA 5A5GA 5DLDA 2BDUA 4KLRA 3R9KA 4G1FA 3O8BA 1CZLA 4Y8VA 3IE1A 2HDWA 1EDEA 2WMDA 1JVSA 3GO4A 1SBNE 2H7XA 2YKGA 2QTCA 1JFLA 4XDGA 5F1OA 3VZRA 1J49A 4XZ3A 4ARZA 4BJ6A 3JQ6A 1E0DA 1ZD2P 3HV0A 1T8YA 4Q00A 1HDZA 1XAIA 2HJRA 5JJ5A 1JR4A 4U2KA 1NNI1 4HH0A 1BTOA 1T34A 2ZVQX 3DKRA 4IG9A 4NV1A 4E46A 4S04A 2J5KA 3AVPA 4I1VA 4OKSA 5DM1A 2FPLA 5CMLA 4MV1A 1PNVA 1SCUB 1HDGO 2F00A 2IY9A 3PC3A 4R1LA 1DIOB 4TTQA 3RQSA 3DA8A 2VJCA 3S2ZA 3CUWA 5JW6A 5BMVA 2QS9A 2KLBA 3IAFA 1CCWA 3LTEA 4QQ8A 4X7PA 2O4UX 3GJ8A 4BUCA 2JANA 4CT0A 2P6RA 2IS1A 4TROA 1JA0A 3AFHA 5TQ0A 1XZJA 4ETNA 4F85A 3F74A 5CG2A 1C0IA 2H17A 3IE0A 1ML4A 4FSHA 3H84A 1W2HA 3K7EA 3E9EA 3EH2A 3JD3A 1N2BA 3QE2A 4Q4LA 5FTNA 5CCBA 1TGVA 4BASA 5AW3A 4YP6A 1UBHS 1XA0A 3TTUA 3NTLA 2AFIE 2D7CA 1QHIA 3O47A 4H6VA 1XD2A 4ALLA 1YOBA 1OZHA 4DV7B 3ZS9A 4WESB 4ZT3A 1B42A 3A1TA 3GJRA 4N5IX 3COVA 5D5QA 3PEEA 4YRPA 1OZAA 2VNIA 1R8QA 4U7TB 3T1HB 2I7CA 2K6GA 2LGJA 3IR5A 3IPLA 3DSRA 4N6GA 2JJQA 4J1NA 1V16A 3VHRA 4ZU6X 1JJVA 2XGSA 2ZS9A 3O3NB 3CJTA 4RMGA 3L0ZA 1QYDA 2PYDA 1MQSA 2GX6A 3M82A 4GVXA 4PGFA 4RY0A 1A7JA 1BWQA 3OTIA 3ZQ4A 3TIGA 2JNWA 5HWSA 2R4UA 3AUUA 1ZQ9A 2JK0A 1G1AA 1D4AA 3EVAA 4ALMA 3OPYA 4BKOA 1UT6A 4BQSA 4C6HA 1QYCA 4ITVA 3H5NA 3VDXA 3BJIC 1VYHA 1KAQA 3O21A 2Y1WA 2GF0A 3EXIA 3PFFA 1CVIA 1IRXA 1Z4QA 1NQTA 2CNWA 2G63A 2IDJA 2Q9CA 3EMBA 2M1ZA 4R69A 1VLZA 4W1QA 3FFXA 4KWTA 2YYZA 4WW0A 5HBGA 4BO0A 2HBYA 4R68A 4MV5A 1VPWA 2HJWA 2BOVA 1SKYE 4MR9A 3F97A 1DTWB 2YMPA 1NV8A 1XAHA 4JY7A 5K0LA 5GQSA 1AN9A 2GAOA 3DW3X 3AEYA 1QWOA 5FOTA 2XTAA 4E2XA 3FGPA 4D97A 1H22A 2A4KA 5EEGA 3ZV6A 4DB2A 1UJMA 1ZD4A 3SIWA 1BJKA 3IPAA 4YWHA 1G8JA 1V5GA 2FP3A 3ZJVA 4GD3Q 2ZIXA 1W6RA 1CB7A 3AHHA 3HNPA 5AVRA 1JH9A 1E3TA 2ZIFA 4YCLA 2YWEA 3KLMX 3I01M 1TCUA 2EBUA 1XMSA 1ZK0A 2W6QA 1JHOA 2I2CA 4ARSA 1DMRA 1D7AA 3W2GA 2I6QA 2ZYSA 2P67A 2NU6A 1RBYA 2QUAA 3ND5A 4MUGA 3VI3B 4WNAA 4C4ZA 1CY2A 2HUPA 2CUTA 1NXOA 1OX4A 4OCZA 2FQ1A 1Y37A 4ZVMA 5ITSA 1OR8A 2IF2A 4R7GA 5B55A 2OZEA 4JLJA 3KYBA 1H0SA 2C8JA 2AOUB 4D43A 2W5UA 2P75A 2VLIA 1H2XA 1PSWA 3K6RA 5ALHA 4XR9A 3AJRA 3QBJA 1M2OA 1KO4A 4OB6A 5LR6A 3C3MA 2XKBA 4YFVA 1PJ2A 4TN5A 1U3CA 2YWRA 1SBHA 2J87A 1Y8QA 4REQA 1D2HA 3BXHA 3ZY5A 2V3VA 3T5TA 4B4UA 2X0JA 1JKXA 5AW9A 1WO8A 3N07A 3GRPA 3SBOA 1IZ8A 3KSMA 1ZI9A 2BGNA 3PEVA 1M5RA 5G0TA 4I2VA 1NKSA 2OCKA 1X1AA 2SBTA 2WZCA 4ENUA 4GRAA 1IE3A 3KP1A 4HLDA 1A95A 3DEFA 1JHZA 1F8UA 2FB9A 1CIVA 3SZLA 4BVEA 4BX2A 2W2OA 5IT4A 1DZ3A 3FRJA 1HBJA 2OCLA 2QTVA 4X00A 1O6FA 3I1FA 2DC1A 5CNIA 1EB8A 1PVVA 3DTVB 4DDMA 2A4MA 1E2BA 2FVYA 3L4EA 4BZZA 1VE9A 2X0NA 4LXXA 3V1TC 1LD3A 1MNQA 1AZSC 2AXQA 3O38A 3PNYA 4NBUA 3RSZA 4B74A 2FWAA 3I45A 3NWEA 1JKJA 4NENA 2G4VA 1TTTA 1CR4A 2AMVA 4FOSA 5LWQA 1ZGAA 1LS1A 2HNKA 4XQ9A 3S28A 3Q7RA 1FU7A 3H1AA 1P61B 4XWWA 4JB0A 5K8CA 4P0QB 4MVJG 4QDKA 1RPNA 4QUAA 4B3XA 4P5EA 2OXTA 2B0CA 1CSEE 3AF5A 1OX5A 2QU8A 1V1MA 5FWXA 3VYSB 2R6FA 3AKZA 1SHUX 2R9VA 5ICEA 5JTTA 3ASUA 3PC2A 2FOXA 4A0HA 2WLSA 2IXDA 3DB1A 1IU9A 3EJWA 2QTFA 4J0HA 4DTCA 4LQDA 3CZQA 1CX9B 3VR6D 2AFVA 3Q88A 1FTSA 2QRLA 2RJOA 2Q9AA 1L7XA 1O9GA 3KTAB 4JI5B 2PWPA 4EY7A 4URXR 4REOA 2I91A 2OGZA 2OYRA 3E22B 5ENZA 3P2JA 1JIUA 1BYIA 3AWDA 3KU4A 5BYKA 1R6DA 4CFZA 4P81A 1OLOA 1X8LA 2VDWB 3DZDA 2FEPA 2ZLBA 4MI6A 4WXRA 1JZSA 2WJJA 4JI7B 2ZT8A 1YWGO 3TOVA 4KQ9A 5A06A 3AEZA 3KTOA 4W6QA 5J23A 2QWXA 3K9GA 1XEWY 1NUQA 4UC0A 3HLYA 2HHHB 3JQGB 3H2BA 3LJKA 4ZDKA 1C1YA 4CWAA 1G2IA 4JLMA 4UOQA 2RMKA 3QLUA 5AJXA 2VF2A 4J6EA 3DZIA 5GMOA 4UNNA 1FMCA 4HC4A 4ZN6A 1LU9A 4QGSA 1LGYA 1L5LA 2ZWPA 4M1MA 1GPWB 4B0OA 3Q85A 4G24A 1AQYA 5K6TA 2Q6VA 4F9GA 3Q6MA 3GNSA 1UAGA 1M8FA 3TDKA 1FYEA 2JLSA 4R1OA 1G2QA 1L7OA 5WRFA 2R4TA 3P71T 3V7YA 2IX9A 4IDCA 4Z8YA 4BECA 3QX3A 5K45A 1LDMA 2J6BA 3A26A 3LUKA 3OX4A 3LZ6A 3R0XA 1P7CA 3KUUA 5TQ2B 1TQHA 2E85A 2FCRA 1BCRA 5IUNC 2OFFA 4F84A 3WISA 1CY8A 1PI3A 3TF5A 4UVEA 1CU1A 4ZVLA 3ICQB 1JRLA 1UXHA 3CM0A 5KI6A 3MOGA 2H3EA 2NYVA 3NIFB 3AW9A 1XNGA 2V74B 3PNSA 2JLRA 4I0WB 4RIGA 1I2CA 2HXSA 1QP8A 3BTSA 3S0JA 3NJRA 4PXAA 4WFJA 4AZ3A 4JP2A 1KHHA 2CY0A 2JD2A 3F4KA 1IEXA 3RS4A 5B2FA 4NBWA 5E1OA 1M3SA 3NC4A 1LX7A 4MI9A 3HCEA 1N5RA 5DU2A 2JGDA 4QPCA 3NLLA 4G8JA 2XWJI 4KDFA 1I36A 4DCSA 2JLQA 5EFOA 1HUQA 5J2UA 2VS1A 5KINB 2V54A 1SVOA 1P1HA 3QM1A 4NH4A 5EJIA 4ALNA 1KYTA 3BQMB 3E8MA 3P94A 4AYXA 4BWVA 2NVUA 3R5JA 4MQ5A 4EHLA 1Z8FA 3SQXA 1ISFA 3IT1A 3KQNA 4HEA1 1IXRC 3AP3A 3UJ3X 2NUTA 3THSA 3R7BA 1L7AA 1GNLA 2G70A 3BCRA 3H6GA 3PBKA 4I1SA 4LHVA 3QW4B 3FDZB 4TKLA 5DYTA 1FU8A 4C5BA 4EX7A 3QF4B 4XIIA 1JP7A 4KQMA 2VTEA 4ZCLA 2JLBA 2QR3A 3HDQA 3NGMA 4KXLA 1SG6A 1G4AE 4OXIA 4RKQA 4KPUA 4RZ2A 4TS9A 3KQVA 4UAJA 4DC1A 1V3QE 1RT9A 1BRMA 3HVKA 3REFA 3JAMA 4AJNA 2VC2B 2C7PA 1R12A 4V0NA 2VAPA 4H0NA 1T35A 3T9DA 2AG5A 2O8NA 4W5TA 4IJWA 5JATA 4M55A 3T5DA 4AJJA 4AM8A 4PYMA 1YUMA 1NMQA 1WTAA 2JCXA 3ZGLA 1VJ1A 5LOVB 1VG9B 5JAMA 1Z0FA 4WCFA 3MTIA 1NQUA 3NT4A 5BSVA 1ODTC 1USIA 4XYGA 2ACWA 5DO9A 2D0DA 4K3UA 2EOAA 3MGAA 4QIHA 5EE3A 2VJAA 5EN4A 3RUHA 4BLVA 2Y3IA 4XR4A 1MRNA 4D3SA 1Y8RB 3ABQB 4HNTA 3BJEA 1JHMA 3FVVA 4JNKA 4N8SA 4NULA 2V58A 5FNVA 3DNPA 4Q5IA 3ZHTA 2I4NA 4U7FA 4RQTA 2BZ1A 1UAYA 1W49A 2HXYA 3BC1A 4JT4A 2RHOA 2A9VA 4C03A 1TA0A 5BWNA 4F12A 3MJRA 4G56A 5BQ3A 1E1RD 3FYHA 1MC4A 4M4SA 3VC3A 2O2ZA 2HBZA 2Z8YM 4A8JC 1TM4E 3VR4H 4UOZA 1UBTS 1P60A 4HUQB 4C4OA 1QGUA 1E60A 3I9V6 3X1KA 1WETA 3PRYA 2ONYA 2VIIA 4BMPB 4G5GA 2Y67A 2NZJA 4KK4A 4A7PA 4I5IA 2RHBA 2WI8A 3C5VA 4TMTA 1KE1A 3FBGA 4NOKA 4G3XA 3V34A 1W0JD 3EQ6A 2IBMA 1HR0B 2Q07A 1A3CA 5FBHA 3TLXA 4BB0A 1LTKA 1HXHA 3FTPA 5HK8A 1QYIA 4TXMA 1XZIA 4QHSA 3KDPA 2OZKA 4BBAA 1GY8A 1WWKA 3LBHA 1O54A 1LBHA 3MELA 4K9OA 1Q16A 2J5XA 3KX2A 4QFBA 3KYCB 3FSGD 3K9HA 2O3JA 1HH4A 3PNPA 3TEFA 2H54A 3PUKA 1KWGA 3LVQE 4I1UA 5MF6A 1ISSA 2H5JA 4QJBA 2P77A 4RCYA 3ZBQA 4HYYA 3KR9A 1CRWG 3CUVA 3UFXB 1I7NA 3Q0EA 2D5LA 5AWFC 2HD4A 4H1HA 1POWA 1X8JA 1UCFA 2ZCJA 3T54A 4IIXA 2ZREA 2HZBA 3NNNA 4TT3A 3ZDZB 5DYGA 4BNNA 2BSQA 4DA7A 4US1R 4HNUA 4GGPA 5ELMA 1G98A 1EVKA 3KE8A 3M5DA 3C7AA 4HLUC 1ETUA 4QM7A 5F3WB 1PZMA 3KKLA 2RH8A 3KLOA 4NE7A 4ZKDA 3PQ7A 4JI4B 2P3SA 4JFAA 4LTMA 5CA1A 2RHGB 5CVCA 5E1DA 3TRJA 2P2LA 4XQEA 5LXTA 2Q8QA 1YVDA 1ESMA 1KKLA 2F67A 2P4HX 2ZZKA 5DRYA 1L5ZA 2G8LA 4ZRMA 2HQOA 2ZRIA 2QE6A 3U4IA 2DJIA 1R6VA 3HCWA 4RA9A 2EFCB 2PL5A 1V37A 4YGYA 4WKCA 4CKXA 2MSDB 4RJ2A 3RSQA 2DBZA 4MCAA 4BMZA 2QD1A 4IZ6A 1VGQA 1I7SB 4GZLA 1U0SY 4UUPA 2C61A 1ZM4A 4JP8A 1Y34E 4KXMA 1LZKA 2NQTA 3G13A 5FIUA 3KLPX 4OA8A 2NV2B 2VYCA 3UCEA 5M34A 1WF3A 2O2HA 4QTUB 1HYGA 1YQXA 4W1RA 1IN1A 2X86A 3VSEA 2PDAA 2NG1A 1KVQA 1R5NA 3GT7A 2WIBA 1FP4A 3FA2A 2UUBB 3IQIX 4JUFA 2P40A 2VEOA 4KAJA 3TAUA 3NATA 2Q3BA 1KEUA 2O9JA 1XRQA 3K35A 3LYUA 1YA4A 2Y27A 4DXAA 5IM4F 1OGJA 1FXWA 3I72A 1EK0A 1T3TA 2E1PA 4I4NA 2RD2A 3MWLA 1F8YA 4RABA 3IVGA 3OQIA 4CPDA 1KSGA 1VYVA 3AQIA 4RANA 1T9HA 1GPH1 3NDJA 4X8HA 2Z6AA 4I9HA 1ZH8A 3GGPA 2YWBA 3AKYA 4JUAA 1B16A 1AT1A 5JH7A 3K0CC 2Q4EA 4HWSA 4ND7A 1TFRA 1SVSA 4J1TC 4B6QA 1RZRA 1P3DA 4I9FA 4YCDA 5BMOA 2YWDA 1UC9A 4DLAA 1J6UA 1FFSA 2CE2X 4LMRA 4WBXC 4TZTA 4ZHQB 5TQJA 3K8ZA 3LRXA 5LJLA 1RRCA 2B7BA 2ET6A 3CX8A 3DFKA 1CYEA 3FWHA 4QE3A 3QGMA 1FXSA 1ZM3A 2QI9F 3ER9A 2V7QD 3ESBA 2B78A 2A0UA 2VK1A 3DZFA 1A7AA 4J2TA 5HOQA 1YHNA 2VI5A 3FMGA 2W2NA 1V48A 3THWA 3W8FA 5AFSA 1EFHA 5ERGB 4HX2A 1WPXA 2VPQA 2MR5A 5I5EA 4EUEA 3CBGA 4WZ6A 1GGFA 1OBVA 2AW5A 3OE7A 3WG9A 4X5OA 2OHGA 5CXQA 2IRWA 3RU9A 2QTLA 2QENA 1M34E 1JV2B 2C94A 4B82A 2E5WA 3O8OB 3LNTA 3FPKA 4Y0VA 4XDYA 3LVFO 5AESA 2VF5X 5CT4A 2IBTA 3HKCA 3L8GA 1BMDA 2HHLA 3MBIA 4OBWA 4PGHA 1Z5UA 1F0PA 1QFMA 1U7DA 3RSFA 1ZQ1A 3IO3A 2ODQA 1Z56C 3BTVA 3RTEA 1K5PA 1G8PA 2JHPA 3O8QA 1TO6A 4LHWA 4FYKA 2VG8A 2DYKA 3LE8A 3JWPA 1E9AA 3ULKA 2WAAA 1OAAA 1CY6A 3AEKB 3R8CA 4MROA 3WJ1A 1YQTA 2WG1A 1VJ0A 3DXZA 4HYTA 5DGTA 3N2LA 4JT2A 3S1AA 3K70B 4LBVA 2ZATA 2RGGA 3P1JA 1DQSA 4EHFA 3CURA 2ID8A 3FZGA 3IQEA 2P9TA 4KE7A 4UEJA 2AZXA 4HTFB 4JA0A 4N8EA 5AJVB 4ZO4A 2HA5A 1Z7WA 4E15A 1QONA 2JFWA 1MF7A 3AYXB 1DAPA 3GRZA 3QBEA 3QEKA 3T7JA 1G8AA 3ENWA 4BWGA 1W34A 5DV9A 4HL6A 4BDSA 3GFPA 1P6QA 5AW6A 5KYNA 4JUIA 5ALFA 4IX1A 3QEOA 3PXEA 4AO6A 3CF4G 1K6EA 3QF7A 5IEJA 2YZNA 3IKLA 1X1RA 1N57A 4R7TA 1W44A 2AOTA 1XU7A 2HK6A 3FLMA 1B93A 1P3JA 2BP7B 2JFQA 5KUTA 3GCDA 4QYIA 3QU4A 1NVMB 3HO8A 4KLCA 4FILA 1RAFA 3BRSA 5B3LA 2HSEA 2YZ2A 1WEHA 4C6TA 1TM2A 3I9MA 3OC6A 3OURA 2HL6A 4EB6B 4FI3F 3D1LA 1PUIA 2IA5A 4MV6A 4YJGA 4TYPA 1RMQA 3O74A 3A3KA 4DF3A 1OQAA 1QXSA 2ONZA 4NONA 4M87A 3V9AA 3AUAA 3B3FA 1GCIA 1LTHR 3IAAA 1CG6A 4TXJA 2H9IA 4LGMA 3DDCA 4NFSA 3AY3A 3H5VA 4BV9A 3QRWA 3P4XA 1Y5RA 2J45A 3WK9A 3CUKA 5LDGA 4A27A 1GG8A 5CYPA 4UPVA 1ZCZA 4K1LA 1E6KA 4E31A 3FCCA 1VDMA 4NBTA 1E2GA 1RJWA 1USVA 4AF7A 4LV5B 4DXDA 5GAJA 1NXWA 4CTNA 1GKIA 1CT9A 2POCA 2BHLA 1OWPA 2QTZA 4C01A 4R31A 5JT1A 3GDFA 1R50A 5JYEA 1NP7A 2EP5A 3NH6A 3P0EA 3PQ5A 5JMWA 4M1QA 1DFIA 4BNLA 4C0LA 1R8XA 4ATNA 2YWCA 3ITDA 1GUBA 3AM1A 3MGKA 5AM0A 3DMTC 5TPWA 4RMHA 3TBKA 2ZUVA 5IDYA 4FYVA 3K5HA 1GQSA 1Z4NA 5BXQC 4JLOA 4PQFA 4EO9A 2MT9A 3HN6A 2JIMA 3VYWA 3NVMB 5A5DA 4LECA 1F2TB 5H9VA 3OE5A 3VI4B 4H6XA 3R74A 3UK2A 3COJA 3V3TA 4RO0A 5LBIA 1EMDA 1V9LA 1VG8A 4RAOA 2OHJA 4XJTA 1D03A 2AK2A 4Z9AA 2UYHA 2PQ2A 4KR7A 3QVJA 1G4UR 5DEIA 3VU9B 4FFDA 3HG7A 2CNLA 4AW9A 4HVCA 3RREA 4Y1EA 2K87A 2O50A 4A6XA 1JJAA 4PLTA 5AH0A 4KVAA 4EW3A 4KAAA 5LWHA 1I7DA 3THXA 2GBCA 1IN8A 2HMWA 2L0XA 2OHIA 3I39X 1BYUA 3OIUA 4PYKA 5HRCA 3PI6A 2PS3A 2WD7A 2JATA 2BKLA 2ZRPA 3H8JA 4M0LA 4NMXB 1THZA 1Z7GA 2GZDA 2OO5A 1UQUA 3BGDA 2H1CA 3SOZA 4D74A 1PW7A 2OSVA 3LCRA 1EP2B 4O25A 5EQFA 5BOVA 4ZDIA 2ZK7A 2O19A 1IY1A 3IULA 4ZO6A 4O2AB 2RFLA 5DSXA 1T6YA 3SQDA 2VHQA 1I6LA 2WIJA 4GKVA 1W25A 2R8XA 3B12A 4S3MA 3W77A 2OCDA 4A91A 5DBOA 1M66A 2IPOA 3LQKA 2F48A 1PNRA 2I1LA 4MCJA 3D4BA 1IB6A 4ER0A 2DU8A 2Q0SA 1CZOA 3DP7A 2Q1XA 4CKZA 1A2OA 2HF2A 1FNSA 3SVLA 3D59A 5LKRA 2BI7A 1OAKA 1MX9A 1T25A 1Y3AA 2V5UA 4K2HA 4PBRA 4TXNA 1CQPA 4NLLA 3ZKWA 2P6UA 3ZWYA 2CVHA 1LPNA 4L0MA 2E4ZA 1TRHA 5B2ZA 3OC0A 5T7BA 4JSTA 1YZQA 4PLFA 3L6BA 5FA8A 1ZIYA 3SWWA 3K6JA 4JWTA 5CB4B 3PQ4A 2QL6A 3T0IA 3PGJA 4M0PA 5HS6A 3K9NA 4EG4A 3TUIC 3MJ4A 3GPBA 5A1JA 4I08A 2GQ0A 1J8MF 1T0PA 3ICEA 3A4IA 2W8BB 2V03A 3B1YA 1YD7A 2H08A 3I6QA 4W9NC 4WKNA 3UJDA 4DYVA 1ORRA 1TEVA 4G4IA 1A76A 1BJRE 2YIJA 1SHKA 2YN2A 4C7JA 5A1TA 1MW8X 3I5AA 4L2IA 5ED0A 2BGMA 5DCYA 2R6R1 2V9ZA 4IW3B 4LRUA 1SUBA 3PHLA 4S1PA 3SS9X 2B5OA 2GFQA 2XGGA 3R6LA 2JFBA 5FPQA 2XCIA 3H65A 4YP1A 3RJ9A 3M8KA 1IOVA 3D2LA 1N2JA 1XCOA 1IJEA 2DERA 2UKDA 4MUAA 1MG0A 1W0JA 1QP7A 4KYUA 4BLOA 1TNDA 2HIAA 1ZICA 2XUHA 3TL2A 5THKA 1GV0A 2BCJQ 3ZBUA 1YQWA 3HA5A 5FI1B 3QNMA 3K15A 1KJYA 1NF3A 5DGDA 2RH5A 3SZRA 3JATA 4DBLC 4L3OA 2N1BA 3M6LA 2DMRA 3A32A 3G5UA 1GA4A 3JQ7B 1DKLA 2QK4A 3NV7A 4LJYA 3TOZA 4EVIA 1ZW1A 1TCBA 3M6VA 2IX3A 1ORDA 4G2NA 3E3OA 1MFZA 1JSRA 4GKBA 3RASA 1R9NA 3DD1A 1RADA 4OSPA 2QVGA 1P6UA 3BCHA 4OQLA 3UV3A 5JZMA 3HWX1 3JARA 1BFKA 1GQOA 3WIUA 4MZDA 1T6XA 4LC9A 3VJMA 4AJKA 2H1HA 1M2FA 1NATA 1WR8A 1U4OA 3CVXA 1VKNA 3ZDDA 5JD6A 5BUQA 1CERA 4BY9E 4CKYA 3CY6A 4XGRA 1G5PA 3BSWA 5ALOA 1BU8A 4ZYYA 3WAJA 2J30A 4W5NA 3CEMA 4QOHA 1U7UA 2BEKA 1R9MA 2D3WA 2RGCA 1BDIA 2W6MA 1M2KA 4JJ8A 5EJ6A 1CPYA 2AF3C 2BMDA 1N7JA 4B6RA 3RYIA 4TS3A 3PLNA 2GN0A 1K7FB 4Q9DA 2Q3MA 3AQ4A 3T1VA 1ZVJA 3VHLB 3GUVA 1Z07A 3DV9A 3LCVB 3BMOB 2PX6A 1JKMA 1QLJA 1SBTA 3EF1A 3HZHA 3PGVA 4OP2A 5DXAA 1JU9A 4UNSA 1SCIA 3TFQA 4BEBA 1JHYA 4MV0A 3ZI4A 1NI4B 3IAS6 5KDLA 5BUZA 5JY6A 3IKJA 1PGPA 2HQRA 4R3WA 5CT8A 3V2HA 1Z6QA 1XB2A 5J5VA 2PZMA 2NLOA 2O2EA 4MKRA 4ZJUA 4N6OA 1Q3TA 4EUFA 2LBPA 2ZBPA 5LUAA 4KIFA 5CIYA 1ST2A 1GCGA 5E6UA 1YK1A 1NVVQ 1YB7A 4FFNA 4Q4AA 3UHPA 1UC5B 4M1SA 2QE7D 2WTEA 5C4IA 2QLBA 2QZ9A 3UJPA 1ZWLA 2BKXA 1S01A 3CG4A 3GVIA 1VIVA 3SF8A 1CUAA 1FMJA 1BE0A 2M32A 3E1KA 4I50F 1P0PA 3DONA 1ZUD1 1DU4A 2ZRQA 3KS9A 4BEJA 1G291 4L8VA 3I6YA 1EQ2A 3GG2A 1X7WB 4JKYA 1SA0B 1T5SA 1GZ3A 4TVSA 2MU1A 2DE0X 1TRKA 2J7KA 2JGKA 1X7GA 2L19A 2HCRA 1O6BA 1DG9A 4WHMA 5K2MA 4HBZA 2Q2NA 1XO1A 3BXEA 4GZ6A 2ZSEA 2RHRA 1RQGA 5K3FB 5AUPB 1I6MA 1O89A 6Q21A 3FRHA 4AS2A 4PYJA 3Q8WA 1F7UA 3DMFA 5D1HA 2YZKA 1MJHA 2AD5A 2YH2A 1Z8HA 3FKJA 4DCPA 4AKTA 2V7QA 3BL5A 3LMKA 4Y2QA 4E5MA 4OH7A 4NNPA 5T41A 5LYYA 5CDUA 1VYTA 2D5AA 2H06A 5IAEA 3FLEA 2O0LA 1JAZA 4IJMA 4BVAA 3TM4A 3OFKA 3G0DA 1N9GA 1AV7A 5A5FA 2ZKIA 1HT3A 3CVOA 1NVVR 4IQFA 3D0QA 2BTQA 1RWXA 1G6KA 4I1RA 4KMRA 4HXEB 3UM9A 4RXUA 3ECAA 3A0UA 3P2YA 4KKVA 4MKFA 2VWGA 1MKYA 4FR0A 2JGLA 3FPCA 3I9NA 1I3NA 3K2IA 1L4UA 4H7JA 3CNOA 5SY9A 3A4TA 2ZE5A 3T7RA 3ZDFA 3KNZA 5EHGA 4UE3S 4L74A 4O6VA 5DX0A 4JOSA 4GL2A 4ZOQI 2ZITA 3DHEA 5CIQA 2QUBA 1F38A 4MQMA 4CF4A 4RTRA 4FHGA 3KDAA 3CUSA 4NAHA 4K0RA 2Q4DA 2M98A 1OB2A 4C3UA 4OM8A 1C9EA 1LRLA 4LXHA 1KYQA 1N8SA 4RZXA 4IGFA 2VHUA 5DLEA 1UFOA 3MB8A 2FGJA 1VKHA 2VH1A 5IAKA 2ECKA 4QDZA 1T0IA 4ARCA 1MAVA 2PLFA 3AEQB 1WUHS 5KQRA 1L1QA 3H16A 1D2NA 2IYNA 4RPKA 3RTAA 1US8B 5SYNA 2EGHA 4CMEA 1LJ8A 1G55A 5A71A 3ZE2B 1PGQA 5ALGA 2ACKA 2OBNA 1ZSVA 4IV0A 4PBSA 5TB5A 3ETHA 3UMCA 4YRDA 1OLSB 2PO7A 3SX2A 1CS0A 1CUHA 1ZP6A 2HWXA 2JJ2A 4ND5A 1I0IA 5B4TA 4X65B 4NZ9A 3ZXXA 3MT8A 4II3A 4TXHA 1XQVA 1Z6YA 1FLNA 4W7SA 4ERNA 1PJCA 4YP7A 4IP0A 1LZLA 4BNJA 3PXUA 4C21A 1ZN2A 3N2KB 5KJEA 4ZEMA 2CHVA 3NUQA 2P2ZA 3L7NA 4QREA 1YIAA 4PAWA 1EFKA 1Z2PX 1T5BA 3PB3A 3NTQA 5UKDA 3ZWQA 1H2ZA 4ALKA 4BGEA 1GEEA 4K9NA 1IJBA 2YS7A 4PR0A 3WL5A 3O31A 3OFSA 3GLGE 2YWFA 1RIFA 2JI8A 1KMNA 3CONA 4NWIA 3B20A 2CLOB 3UKJA 4ZMBA 5MDHA 1HL3A 3UAZA 3VVBA 5L40A 3W5CA 1NXXA 1O94A 1ZOLA 3DD5A 4WXYB 1JQDA 3UXHA 3LPAA 1C4WA 3LQ2A 2WSSD 3L3BA 4RA6B 1D0VA 1UJ2A 3QIAA 2PRIA 1OZ0A 1E3WA 3G1TA 3F5MA 4AMYA 4CBVA 5BSWA 1XD8A 3T1TA 4D9GA 1VCNA 1Z0SA 3AZQA 1EWVA 1YS9A 2R6GA 4AMUA 3A6DA 2ZBFA 2WKSA 1JDBC 1J7KA 1NLZA 5EAIA 5B3JA 3CCBA 3TL6A 1XP8A 4R1PA 1XZBA 2OK8A 1LWOA 1NMEA 2FN9A 1RYEA 3LX6A 2H4XA 2R2GA 3AG6A 1FVHA 2OOSA 2VYND 3QYFA 5J2UF 4L8YA 5JZBA 1EAYA 3L7KA 2XTZA 4TKVB 5AKKA 3FTNA 2EKDA 4Y9RA 4F8JA 4Q7LA 1M6VB 1V1JA 4OOFA 2EVWX 3FCUB 1DC7A 4BGUA 1KE2A 4Q39A 2FPMA 5LQRA 1SM4A 5F3RA 3ONVA 3FNBA 1GSHA 4P3XA 4HSEA 5JNLA 2QQGA 3W8DA 1PW5A 1KPHA 1TQ8A 5H9WA 1OJ7A 3UIEA 3MJDA 3VU0A 4KSBA 2QJFA 2FGKA 4EFLA 3PUXA 4GXQA 1XKXA 1MOZA 3QPUA 3QUCA 3C3XA 1X42A 4JSRA 4L16A 5DGHA 3LQ4A 2PQ6A 2VQFB 3TW8B 3U16A 2I1WA 2GBLC 3V8MA 3NYQA 2MSNA 2BFBA 5COQA 2VJLA 2XE7A 3D4LA 1IULA 4RWEA 5TEWA 1KMQA 3M9LA 4MHSA 2W0MA 4CQMD 4B3SB 3F71A 3B3AA 5ALQA 4AF6A 3G5MA 3S1LA 2O2GA 4IKEA 2VPYA 4LGVA 3LD9A 4RIFA 2GBFA 3G9UA 1LFDB 3ID6C 1G20A 1VSQA 4I5EA 4MWEA 1SPXA 2O23A 1YDMA 1DPFA 3K1JA 4FR2A 1UF9A 2DUMA 1FTNA 4G1EB 4XUGB 4ZEVA 3MINB 5HM8A 2BEVA 2DFNA 2PUJA 4IIGA 4RESA 2ZJ5A 5ARBA 3RAJA 4ZYXA 3C15C 2IYYA 2Y92A 1C7FA 1R4AA 2BBSA 2QMZA 4NQRA 1U94A 4XVHA 3WK4A 5EJFA 1SAYA 5HGXA 5LYJB 5KAPA 3UAYA 2GS9A 1YGYA 2FRVA 5HZGA 3MEQA 1VCMA 5AM1A 3K2BA 2JJ1D 4JXXA 1SD2A 1ONNA 3AVUA 4PS1A 4UCFA 3HB7A 2WJAA 1YMUA 1BWSA 2YY6A 2GILA 2ZB2A 3TTTA 1ISGA 5ADUS 1YBAA 5JEDA 2DWPA 4QUBA 1JL3A 2B7LA 3ROTA 1XFAA 1ND5A 4BYGA 2AXPA 2AJDA 2X1LA 3ZUGA 4CMHA 3CU5A 3K5PA 3KB2A 2FX5A 1BS9A 1MC5A 2HH9A 4WCDA 2XCSB 3BBLA 3RS7A 4ARZB 2LCFA 4RW0A 1BG6A 1JZQA 2IU3A 3L5KA 1KFBB 4DIKA 4CLOA 1ZW6A 2A78A 3SYKA 4N40A 4F9FA 1NASA 1VMEA 2V7VA 4GPTA 5KJCA 5K3OA 3UUFA 3RIYA 3ZZUA 2EF1A