1JJVA

Dephospho-coa kinase in complex with atp
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
205
structure length
194
Chain Sequence
b'MTYIVGLTGGIGSGKTTIANLFTDLGVPLVDADVVAREVVAKDSPLLSKIVEHFGAQILNRAALRERVFNHDEDKLWLNNLLHPAIRERMKQKLAEQTAPYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARSANFEQIQRIMNSQVSQQERLKWADDVINNDAELAQNLPHLQQKVLELHQFYLQQAENKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEPHOSPHO-COA KINASE
publication title Crystal structure of dephospho-coenzyme A kinase from Haemophilus influenzae.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transferase
total genus 72
structure length 194
sequence length 205
ec nomenclature ec 2.7.1.24: Dephospho-CoA kinase.
pdb deposition date 2001-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01121 CoaE Dephospho-CoA kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1jjvA00
1FTSA 3AH8A 3T5GA 1WBDA 1X86B 2O5VA 1E6CA 2EYUA 4H9GA 4DDTA 3VHLB 2GEDA 2CL7X 4WAUA 5BXQC 5BQ5A 4D4LA 3I62A 4JSTA 3AB3A 3PUZA 2J3EA 4ZKEA 2V3CC 1SVSA 1HE8B 3EG5A 1VG9B 4PSVA 3IUYA 3RDPA 3SJZA 3AV0B 1MO5A 3CB4A 1GFIA 3EZ9A 4OQLA 4PHHA 4RD1A 3WYFA 2QBYB 3I8XA 2XNDD 4AYWA 4M1MA 4JMPA 5AJWA 4A6PA 3O8BA 2LWIA 2W00A 4TLDA 4HAUA 4PQRA 3DEFA 4B3DA 3HR7A 4GZMA 4QC2A 1GP2A 3FE2A 5IF9A 1XXHA 4JLNA 4A15A 3U2QA 8OHMA 2CHVA 5DH9A 2ZYTX 1U9IA 5EP2A 1YQTA 3LXRA 4H1UA 1P2TA 3CR8A 3UK6A 5AUNB 3ZZ0A 1N5IA 5C18A 1N5JA 4W5WA 3P4XA 3SQWA 2WIBA 4JLJA 3PR1A 1KDOA 3W6OA 3I5XA 4IOMA 2BMDA 4BFUA 5FPHA 4PC3A 2G0NA 3QKSA 1KZ7B 1DO2A 3T61A 4BGDA 2KB0A 4KFSA 1TQ2A 4TN1A 1UM8A 5B64A 2GWHA 2XNSA 5CIQA 4BLPA 1U9IC 2HXYA 4BUJA 2OCBA 2F1RA 3KZ1E 2VHQA 5FUXA 3EC1A 2RAPA 1NIJA 4ITRC 4AKEA 1SGWA 2ZE6A 2IYZA 3AKDA 2V7QD 3ASYA 2PT7A 5IT5A 2WPDD 5CM9C 1I4LD 2OFWA 5H70A 1ZJ6A 4Q4AB 3WHLA 1W0JA 3Q5DA 1H8HA 1OLOA 1U98A 3C7KA 1P73A 4PZLA 1G5RA 3MWYW 3VMFA 4B33A 2ZI9A 3F8TA 3H84A 4Q9HA 4BRWA 1H8ED 1G6HA 4EPVA 3FFBA 2QMEA 1NN5A 4DC9A 5KTYA 3S1AB 4K8OA 1G3UA 1IN6A 1EFCA 1P5ZB 4QL3A 4JLBA 1OB5A 3VU9A 2BMFA 3SHWA 4NH0A 4O2LA 4EAQA 1Z6XA 2HT1A 1D2EA 4MH0R 1NN3A 3OIVA 4HLQB 4GOXA 3KJHA 4NCIA 1I2DA 3CPJB 1Z0JA 2V8OA 1D9ZA 4M1SA 4WZ6A 4B3XA 1XTQA 3IKJA 1XU4A 1M7HA 2PMKA 3N2IA 2OZEA 5CLQA 4MYHA 3V4FA 3I5YA 4BPBA 2ZRGA 3NKVA 1G17A 1QRAA 3ETLA 3S1AA 1JQLB 1WMSA 1HY3A 4YXWA 3NC0C 4A2PA 1T8UA 2F6RA 3RSOA 1LF5A 1Z6AA 4XIGS 2EU8A 5A0FA 5IRCD 3A1VA 2FMXA 2IYXA 4KSCA 1UEIA 2BC9A 4BQSA 3JVUA 1GRQA 3HYRA 4C9BA 4UXIA 4KCGA 4CEIA 3THYB 1DEKA 2G1JA 4EJSA 2BMJA 2Q6TA 3G5UA 2J0VA 1N25A 1JR6A 4TYWA 2O0KA 4EPXA 4E5UA 2X8AA 4OHYA 4A1FA 3QEOA 2IYTA 3D8BA 3FKQA 2QGZA 1JB1A 2QPTA 4M9XA 4NBSA 2ERXA 2OCPA 1AK2A 1G7CA 2JEOA 4C0BA 3GLGA 4QHTA 3VR1A 3SR0A 3PXGA 3U7HB 1VHLA 1II8B 2BM0A 2RGNA 1H65A 2X19A 1E0AA 1SKYB 4MQBA 2W2XA 3AGPA 4EJSC 1S0UA 2HYIC 1EWRA 4KFRA 2C04A 4F4JA 3J81k 3IHLA 2VP0A 1BYIA 5GJWC 1G19A 3VNUA 1K5GA 4WOPA 2FZ4A 3TJZA 1IN4A 4A4DA 5EZ6B 2VO1A 1Z8FA 1ZC3A 2QP9X 3UMRA 1U2RA 4N3NA 2OUKA 4TSFA 4WIAA 5FPTA 2QE7D 3CNLA 1F5NA 2IYWA 2RGNC 1EFTA 4NYJR 2DPXA 3AUXA 4FN5A 1AGRA 3B1XA 2RCNA 1II8A 4M22A 3VR4A 2PL3A 4XJXA 3CLVA 2IL1A 3RLFA 1TEVA 5J5CA 1T9HA 4CYMA 3QJYA 2D7DA 3GLFE 2QAGB 4U7DA 4O3MA 1E4YA 2FEOA 2VSFA 5EE0A 4ASUA 5C4MA 2J0UB 2J87A 2ZRFA 1DTSA 3DKPA 1G7TA 3FFAA 3FMOB 2FE4A 4IJMA 4B47A 5G40A 1J90A 4QXAA 4MYTA 4IFBA 1DPFA 3L2OB 3QPUA 4HSEA 1XNJA 1CJUC 1OFTA 4OQXA 3THWB 1PLJA 2WAYA 1F2UB 4KODA 3EIEA 2XTZA 1Z6GA 3CO5A 4LV6A 4DDVA 2GZDA 1UKYA 4RD0A 4BEBA 1JPNA 3AGQA 1UBCA 2ZIAA 4I1SA 4TMVA 1OE0A 1X6VA 3SJCA 2L0XA 4FCWA 2ZI4A 1Q22A 2J0UA 4IDPA 4BFTA 3U4QA 1G3RA 2NIPA 4DHEA 1N6LA 3KFXA 3WNCA 2C98A 3AF1A 1MV5A 2IHYA 3ND8A 3NXSA 5EXXA 2P6RA 3OF5A 2DFTA 3HDTA 1AN0A 1G4UR 1M34E 2ATVA 1RPZA 4LJAA 2J0SA 2FU5C 4TLAA 3R20A 4KVGA 3FB4A 1E2DA 3AF0A 5DHAA 1CF4A 3OFNA 5JECA 1W36B 1SHKA 4LJ5A 3UWKA 2CLSA 2N42A 3A58B 1NRJB 3MG9A 5DSZA 2QSZA 4EFLA 1P2VA 2GXUA 1IN5A 2C9OA 4QBIA 2I1QA 2W58A 3KKNA 4MKIA 4HZUA 4DT1A 4M4SA 4YMTA 5A5GA 4DLVA 4XVQA 1U99A 2WKPA 5SZKB 4EQ6A 2IBMA 4EPRA 1ZC4A 3HU3A 1E32A 1GNQA 1XZPA 3B8HA 3WBJA 3RS3A 4BECA 3TGPA 3MJRA 4TTQA 1IOZA 3SYKA 4XD7A 1OXUA 5F9FA 2EFDB 4UJ5A 4Q1FA 3ZJYA 2A3RA 4FCTA 3OIYA 2YOFA 5B57C 1MKYA 2VEDA 4IEEA 4DDWA 3HJNA 4LYHA 3QOFA 2R6AA 3SQXA 1MABA 2Z4SA 4ZDWA 2QU8A 2RHMA 2NZJA 1W1WA 2WZQA 1SZPA 1NF3A 4HDCA 3B78A 1F3OA 3TQFA 3PEUA 3KXLA 1PV4A 4MRNA 2FGKA 2JIZD 2GCOA 4FXPA 2AD5A 1N6NA 1ZM7A 4JYBA 3L8YA 3A1WA 3EIQA 2J46A 1T5IA 4NZYA 3C14C 3K0FA 4CEJA 2WOJA 4KI0A 4KBGA 2F9LA 1GWNA 1KI2A 1RYFA 2BJVA 5H68A 3O47A 4E07A 4KYIB 4D0GA 2ZEJA 2F1IA 3G82C 2GVZC 3DM5A 1G3QA 4OHVA 4W5HA 4D0NA 4YONB 3TW8B 3TK1A 1KI3A 2ZROA 4KBFA 1E99A 2VHCA 5GJCA 1VYVA 3BK7A 3WNBA 4DBLC 1IXSB 4QNRA 4ZV4A 2DWOA 3KTAA 1RIFA 1ZM4A 4XSGA 2FEMA 2H57A 2PX0A 1E2QA 2SHKA 1FUKA 1Q21A 2ODWA 3BRWD 4DCTA 4NONA 5A4JA 2QROA 2PEYA 4NCKA 2MSDB 3CF2A 1R0ZA 4P3YA 4C0KA 4RJLA 3DZDA 1RYHA 2REOA 2XZOA 3T34A 1KK2A 4KLZA 1FPMA 2ZREA 4P4SB 1E9EA 1NI3A 4QFMA 4TMXA 2C8VA 5G3ZA 1GNPA 2Z6VA 1GL6A 3CF6R 4OYHA 2IK8A 5FL7A 2BBTA 4CEHB 2A2ZA 2F9MA 2AK3A 2ODNA 3GJ6A 3QPWA 3QXXA 3FWYA 4JT4A 4OKSA 1DARA 1BS1A 3LY5A 3CZPA 1GL7A 2F1HA 2CXXA 2BDTA 1CXZA 2JLRA 4XWOA 1FNMA 3BH6A 1G8FA 4DLTA 2AKAB 4BZXA 3DOFA 1KOFA 4HI0E 3E70C 2WTUA 3ADCA 3GFPA 2QQEA 1T5LA 1DAFA 3PV0A 2O8FB 1UAAA 3KKQA 4QHSA 2DBYA 3IIMA 3MGCA 2ZRIA 3GEEA 2PZFA 3Q3JB 4ZCMA 3VR3A 3ICQB 4IDOA 3RS7A 2KBFA 2QTHA 2ZE5A 4FINA 4K81B 1CR0A 1KK3A 4HB0A 4I1UA 5E3HA 1Z3IX 2DB3A 3THXB 4TSFD 5FI1B 1BOFA 2ZRMA 4BRUA 4M1WA 4B32A 3K70C 4JBYA 1NKSA 4Q1DA 3OEED 5FOUA 3NBYC 2O8DA 3PUVA 4ZCLA 5EJEA 1KO7A 1YJ5A 4S35A 3K0SA 4ASUD 1ELOA 3TAUA 3B1YA 4HB3A 5FPKA 4ILEA 4KU4A 4EPWA 3VTKA 1X3SA 3GLFA 5JFGA 1NY6A 3QBTA 4Q9KA 4MKFA 4UNSA 4I99A 1OB2A 4TMKA 4M2LA 1JPJA 4G0NA 2BBWA 1LS1A 2P2LA 1TF2A 3L0PA 3T06B 5BN5A 1QG2A 1QHIA 3O8DA 3TE6A 2IF2A 3VFDA 1UFQA 1NSFA 2VLIA 2ZJZA 2ZITA 4JL6A 3VX3A 4NL4H 1KI7A 1OH5A 1HTWA 4V02A 4X8HA 1XPRA 4D0LB 4A2QA 1TADA 1E9DA 2FPMA 5SZHB 1XTRA 3LBNA 1G3IA 2ONKA 1CBUA 2OFXA 4FD2A 4D82A 1O3YA 1W2HA 2P0EA 4D4JA 2CLCX 1PUIA 2GESA 3EC2A 3ADKA 3B82A 1KSGA 4D6PA 1S9HA 1XD9A 1XD2A 2Q3HA 4JT2A 4DSUA 5JBQA 3RAPR 1C9KA 2A78A 3NC1C 3KUDA 1NLFA 4YLGA 1GTVA 2BWJA 1SVLA 3CR7A 1J2JA 4US0R 1E2IA 4OI1A 2P5SA 1SQ5A 3AF3A 3DMNA 3UIEA 3QY0A 4DEYA 4AURA 3RRNA 4UNPA 2BHRA 4JBXA 1CJVC 5CM8B 4QM6A 2NMVA 3OFND 1NJFA 2A5FA 1P62B 2YC4C 1G7RA 1AJEA 4B3GA 2FGJA 3EWAA 2NGRA 3LWNA 3I92A 3Q7PA 2RB4A 4LJYA 3UANA 4TL9A 1N6PA 2VP4A 5HE8A 3RVBA 1OJLA 3TVTA 1QHNA 1CTQA 2EYQA 5EP1A 1Q12A 5H8WA 4MKGA 4CF7A 1R5BA 4XD7D 4PAMA 5EE5B 3W5IA 4O0MA 4M21A 4OJKA 3SJBA 2P5TB 4TYYA 2GBLA 4BE7B 3R9IA 3L8ZA 3BAFA 2J59A 2GXAA 3QPVA 1KDTA 1DADA 2NPIA 1R0XA 3B5JA 3W3ZB 2WWXA 3REFA 1UF9A 1E4VA 5B58C 1PVOA 2WJYA 3GJXC 2HEIA 4JJKA 1N6HA 4FI3C 3NWJA 2GBLC 4IEIA 4BASA 4OBEA 3IO3A 4IVQA 4LDJA 2VP2A 4KXFB 4Q9LA 3U61B 2FH5B 4MRRA 3VR2A 3D3QA 2JCSA 2ZR0A 1W46A 3AEZA 2A5DA 4AIIA 3UXMA 3K0AA 1W0KA 1YZQA 2VA8A 2ANCA 4TYQA 3NBZC 2FSIA 2PJZA 5KNCA 3BBPA 1GIAA 1LNZA 3CRW1 4M53A 3V4RA 1B23P 1H8EA 4URZR 1FZQA 2AR7A 1MH1A 3V9PA 1Y63A 4AG6A 5KO2A 3X1ZA 1ZNYA 2G1KA 3BB4A 1ZD1A 4GT1A 2JJ2D 2WWWA 1N0WA 2GNOA 5F9HA 5KPJA 3GLIA 3CPHA 3PCRB 1ZD9A 2DR3A 3I32A 2QAJA 4DSNA 1FL9A 1RE0A 3AP1A 4URUR 3NH6A 4PC1A 1SHZA 4G5GA 1KI6A 1G64A 1JR3A 2JLYA 2ZRDA 4MUBA 1VTKA 1PZNA 3BC1A 1COWD 1UDXA 3F3YA 4FIDA 2GXSA 3NBXX 4P31A 3KJIA 1US8B 5EUQB 4HAVA 2YC2C 5DO9A 5FPYA 2PCJA 3FMPB 3O8RA 1KZGB 3I61A 4B2LA 5CITA 1S2MA 4PHTA 4WXRA 221PA 3ND9A 5FL7D 1FOEB 1ESNA 3K9GA 4DDUA 5HKKA 5KHOC 1AA9A 1L4YA 1Z6TA 3GJ8A 1MT0A 3N2EA 2FPLA 4AK9A 4D81A 4DWJA 4UKDA 3K70D 2R6DA 1Q1BA 4PZYA 3TUIC 1RVDA 2IC5A 3W8RA 721PA 4A0HA 5F2EA 5K8TA 2CCGA 2GK6A 2ZJOA 2WWIA 2OG2A 3CX6A 3IIJA 2ZI3A 4QJ3A 3KJGA 2C5LA 4TZ6A 1HT1E 2JJ1A 4TMTA 1E9BA 1IN8A 1RW4A 2ZSBA 1AS3A 2ASEA 3Q8XB 3QE0A 2QQ0A 3GJ0A 3CKLA 2GZHA 2P65A 1A1VA 4R98A 2PCLA 5KYKA 4U5XA 3RS2A 3SBDA 3IO5A 4F92B 1VG1A 4GSYA 4H1VA 1G41A 4DSTA 5JEDA 4IDNA 1G9XA 3ADDA 2O8BB 3PJRA 3TLXA 4HLUA 2Z4RA 1TQ6A 5JSZB 5HZHA 1Z08A 3AKEA 5J4YA 4RZ2A 2AHOA 1A5TA 2ATXA 3I8SA 1VYUA 3CRVA 2QE7A 1SKYE 4HB2A 4LZZA 1JECA 1R8QA 5E7JA 1KAOA 3B9QA 3BORA 5M04A 1YR7A 1IONA 1IY0A 1W49A 4M8NE 1KI8A 1W7AA 3SI7A 1WA5A 2RMKA 1NVVR 1G5PA 3GLHB 1N0UA 1ZRHA 2V6IA 1XRJA 2QI9C 2VBCA 4HLUC 4LBZA 4B73A 2O8BA 5L3SA 1XJQA 2WM9B 1EFUA 1S1CA 1K8RA 4RD6A 4A92A 5BYKA 5JSZA 4P4TA 5FBRB 4KHZA 2A5GA 4DLZA 3DHWC 3SYNA 4OI2A 3R9WA 2LCFA 4YMWA 5LD2B 4MGIR 1W48A 3NVAA 4LYFA 4RSGA 2R2AA 2HT6A 3UG6A 2ZPTX 1U0LA 3EASA 2IS6A 2IYQA 2IUTA 5FOWA 4B2PA 2IHBA 5FUYA 4C0SA 1K5DA 5E7MA 2RGXA 4DCVA 3AF2A 1YE8A 4ZCIA 2O8EA 1YR6A 2B92A 3HU2A 1KYIA 4DLRA 2R9VA 4ZI3A 3HU1A 2NO9A 1DAHA 2TMKA 4LSGA 3QIAA 1WQ1R 3DO6A 2ZS7A 2F55A 3VR6A 5AUPB 2J0QA 1ZUIA 2BKEA 1NY5A 1TU3A 3IPYA 4HLCA 2VF8A 3SNHA 2MSCB 4A36A 2RKOA 2ZE7A 3CH4B 4JLOA 2ODEA 1KHTA 2QBYA 3NHBA 1VKJA 4OI0A 2ERYA 3IQXA 3C16C 2UKDA 1X8KA 1T3HA 2VP5A 2ZVQX 1ZIOA 4NDZA 2N1BA 1E94E 5LD2C 2DWPA 1KDPA 1FNNA 2A5YB 3BH0A 5HPYB 3CUEF 5J40A 1RJ9B 1RKBA 2E1RA 4N0DA 4C7OB 1XCGB 2MSEB 4NKRA 3AVVA 3RANA 1E0SA 2PH1A 4Q18A 5CB8A 1OIWA 1EFHA 2OT3B 3QXCA 4RZ3A 4Z1MA 1XP8A 2OLKA 1QZXA 3HYTA 1EWQA 4EPTA 2QPAA 3U7FB 5TVKA 1Q3TA 2ZRPA 1I4DD 4NP6A 2QTVB 1OKKA 1YZLA 3D31A 1W0KD 1XCPA 2B8WA 5KU1A 3AVXA 1IN7A 1E1RD 2JLQA 2JIZA 4IW3B 4C7OA 1U8ZA 1JXMA 2NO6A 2ZRKA 1R4AA 5B30A 4YMSA 2Q9CA 2YJTD 4JJZA 4JZKA 3U44B 5DI3B 2PT5A 2WVJA 4TQ9A 4B44A 3WNDA 1ZMXA 4FWTA 4QHYA 3B9PA 4W5JA 4Q4AA 4LYJA 5B2ZA 2I1VB 3CW2A 1G20E 1ZU4A 4PSAA 4DLXA 3IPXA 1G1MA 4RCYA 3R7WB 1E2PA 3ECCA 3LO5A 5KNDA 4A0RA 1P72A 4L8GA 4EFMA 1JR3D 4YDSA 1G18A 5J47A 2DHRA 2C95A 5JJIA 4TQAA 5E7IA 4OI4A 4E09A 2FFHA 1U8YA 1P9WA 3UMSA 5C1BA 2NQ2C 3B7GA 4NYIR 2EFCB 2J41A 2CL0X 1WBBA 1N2CE 3W9YA 2J9RA 3UMFA 2GXQA 4EIWA 4Q02A 5CYPA 3ZD7A 1KO4A 5HKKD 2ZUBA 4URVR 2FG5A 3FDIA 2FA9A 5TY0A 2CE7A 2ZTSA 3FPAA 1TPZA 3T1TA 3IHWA 3RRYA 1LFDB 4EDHA 1Z0DA 4EUNA 1XD8A 2CLDX 3AVPA 2ANBA 4QM7A 2HF8A 5ELXA 2Q3FA 2WWFA 1HT2E 3AVOA 2GCPA 4Q4JB 1NMYA 2G6BA 2OSBA 2B8TA 1ZBDA 5AJXA 2WKRA 1T0JB 3OIWA 3RS0A 3ZVLA 4K46A 3A37A 3TR5A 2JJ1D 5C4GB 2H7VA 3QF4B 3BS4A 2VYFA 2NOAA 4PR0A 5DYIA 2R6GA 2G9NA 3RABA 1J8MF 3THYA 3NEYA 3I4LA 2IS4A 3QF7A 2BKUA 3PEYA 1N3BA 1S9DA 3FHTA 1ZUNB 4Q4JA 2GCNA 3T15A 2H1LA 3RNLA 2H8KA 2P6UA 4DIDA 3GJ3A 2RGAA 4Q01A 1SULA 1P4SA 2Q3MA 4DLSA 3H0KA 2X77A 1LF0A 4BFZA 2LKCA 2RGEA 2NPFA 3OEEA 2P3SA 2BBSA 5GVSA 1G21E 3AP2A 1T3SA 1YR9A 3B2EA 4MRVA 1Z83A 4BFYA 4OK5A 2WMOB 2EFGA 3GJ5A 4MUAA 3SS8A 3H4MA 2AL7A 1MO3A 2FPKA 5TB5A 4JKIA 4N0EA 3ZQ6A 2ZI5A 1E0KA 2ZI6A 1P3JA 2JA1A 4JL5A 5EXPA 5FTLA 3LXXA 3MD0A 5CJ2A 3RWMB 4B3BA 3WYGA 2W2TA 3A4LA 2D7CA 1GVNB 4Q03A 2ZQ5A 1FUUA 1J99A 4BLTA 2DFNA 3FHCB 1FMLA 5FOTA 4A0GA 1FQKA 4G01B 4G3XA 1W4RA 1AQYA 3EWSA 5LB4A 3GJ4A 5KNBA 2NG1A 4CIDA 2XGJA 2FFQA 2Y8EA 4IRUB 4Q1CA 4AKGA 1U8AA 1AS0A 121PA 3OESA 3IQWA 3WP0A 4A6XA 2XOKA 3TBKA 1N5LA 2QA5A 2D74A 2C9CA 2IYRA 2QAGA 3LAWA 1CS4C 2QORA 1JALA 2VHTA 1KO5A 1WDTA 4XH9B 5FBWB 2V55B 3MFYA 3BB3A 1E2HA 3LX8A 621PA 2KI5A 5UKDA 3EPLA 4MYCA 2FNAA 1CR2A 2ORWA 2ZJ5A 1L2TA 3THWA 3VX4A 1F2UA 1Z22A 1MR3F 4BFVA 5EP3A 2QAGC 1D5CA 1ZNWA 3RC3A 5KSPA 2QENA 1XPOA 1E2EA 4AKHA 3IBGA 5HCNA 1TUIA 5D3QA 2ZSEA 1P7CA 1JEEA 3KFVA 4Q00A 1Z28A 4D4MA 4TQUS 4AG5A 1ZCAA 4DEXA 2ZAMA 1BKDR 2WOOA 3LV8A 3FMFA 4FMBB 3IGFA 4TL7A 4UXJA 5J4KA 1GL9B 1V5WA 4XSHA 4TLCA 2IX3A 1EG7A 3I3SR 5AR1A 5KDLA 4ZIRB 2J1LA 2YKGA 4DUGD 3CM0A 2QL6A 3A1UA 1S1MA 4B3CA 1MOZA 4NMMA 3CRMA 4LI0A 4IDHA 3GEHA 2GK7A 1OXTA 4V0ME 1IXRC 4QOSA 1QBKC 1XEFA 4D2IA 4PQYA 4Z1MD 1VG8A 3AVQA 1OIXA 3B1WA 1OH7A 1XCMA 4S2EA 4C2UA 5AJVB 1ZYUA 4BEJA 3SDZA 4DLYA 4X8MA 1OKKD 3U6BA 3KQHA 1Z29A 4B43A 5DNYB 5FOVA 2IUUA 3L43A 1JAIA 4QGGA 1Z2AA 4IOJA 1IXZA 2ZANA 3RS4A 1W36C 1B0UA 3AVWA 4C0HA 3FOZA 1WB9A 2JLSA 4CGZA 1XTIA 1RFLA 4TLEA 5ANRB 5G3YA 2FV8A 3W3AA 4A9AA 4PANA 3CIOA 3OIUA 1GZSA 4JLPA 1RRFA 1UKVY 2ZRAA 1A82A 1KMHB 5DGXA 1VCNA 2OBLA 5FR1A 5EUMA 3M6AA 1JJVA 2QY9A 2B7CA 4DCSA 3CNNA 2Q9AA 3L0OA 2WSSA 1SVKA 4WXPA 4GRAA 2FOLA 1GKIA 2GDJA 1XTSA 2KE5A 1HEIA 1GG2A 4B3FX 4HB4A 3GLIE 2ZS9A 2WBLC 1DAKA 4LGMA 2JJ2A 1YVDA 2V4ZA 1R6BX 3BB1A 2HV8A 2IYLD 4DB4A 1AZTA 1JR3E 1QVAA 2W2VA 3ZIAA 1IBRA 1UBEA 1Z06A 1Z0IA 2GA8A 3L82B 4JSYA 1W2GA 1FP7A 1XEXB 3U6KA 4HATA 1KIMA 3KJEA 2WJVA 1XJCA 4HLDA 1E2FA 1COWA 2NZ8A 1X1RA 5FBLB 3GEIA 2XZPA 4NYMR 3T5DA 3TSZA 4NTZA 4ZI2A 2EWVA 3TW4A 2XSZD 3BFXA 4V0KA 4QNMA 4ARZB 3NDPA 4L9SA 4LPKA 4OQNA 1ZVQA 1PLLA 1ZUHA 4HAXA 4Q48A 4ZKDA 1XPUA 1BMFA 2IYVA 5JWOA 4TZ0A 1TUEA 4R71A 1I4TD 4RY2A 4DVGA 2GKSA 4ZDJA 4OK3A 4Y0VA 2W6JA 3FKSA 3LQRA 2ZSAA 1Z07A 5KSYA 1HUQA 1DELA 1XEWX 3IEVA 2GEUA 1ZP6A 2W83A 4B74A 2EQBA 3LRPA 1L7VC 4II7A 4P4SA 1OXXK 3SJAA 1M7BA 2RGBA 3I73A 2GJ9A 2FSHA 2YOHA 3HPRA 1OHHA 5LBIA 4CEHA 1E2KA 1TL7C 2BJWA 5FUVA 4HUQB 2ZJ8A 3DDCA 4LRWA 4TL8A 2AWNA 5JWRA 2HYDA 3DMDA 1CULC 2V54A 3PUWA 4FMDB 4LC1A 3U3KA 4NHOA 4PZZA 4HEJA 1U81A 5DLQC 4WBSA 3MWJA 4LJ8A 4KSBA 2IS2A 1NLZA 4B75A 1FMJA 2IW3A 3REGA 3KKPA 3TIFA 2ORVA 2O8FA 2XX3A 4NU0A 5TXGA 4J0QA 5TV2A 4D26A 2X2EA 1E9CA 3A8TA 3MWLA 3ZDQA 3ZYCA 5JI2E 4JVNA 4GFDA 2XJ4A 2C96A 4R2IA 1L8QA 1YZNA 3CX7A 3QBVA 3THXA 2OCAA 4WZBE 4F4IA 1U90A 5JWHA 4NYJQ 4C3ZA 1MRSA 2YWEA 4Q7MB 4E03A 4XTRA 1MO4A 1KY3A 4PC6A 2XOKD 4QJ4A 2YNMA 3ZH9B 3LNCA 1E2NA 2QN6A 1GKUB 3DKVA 3T1VA 1AGPA 4DCUA 1FW6A 2Q9BA 3B1ZA 3NHAA 3B85A 4M1TA 1TEXA 1V43A 2IT1A 2I4IA 1IAQA 2CMKA 2F43B 4BWYA 4XWKA 2ODBA 1XZQA 2ZRBA 3GLHE 3C15C 4TL6A 2FX3A 1KKLA 4I1VA 1E0JA 2QG6A 1XMSA 1TTTA 2WAXA 3PFIA 1YKSA 2GILA 3PUYA 3CONA 1XX6A 3HP1A 4LCBA 4B34A 4OK6A 1W44A 5K8IA 1OFIA 1ZM3A 3K0EA 3LW7A 1Z0FA 3U3RA 2PJRA 3MJHA 4JIMA 1QHXA 4UNNA 2QMOA 1E79A 5FOXA 1ZINA 5HCIA 4BFSA 4EKDA 4XVUA 1J8YF 4YDHB 3W34A 1DAGA 1WRBA 2JLVA 2EW1A 5BN4A 4UJ3A 1SXJB 1YZTA 4C4PA 3ZZTA 4D25A 1N6RA 2F7SA 2G3YA 2IXFA 3PVSA 4HDQB 1VECA 4LHVA 3QEJA 2X1VA 5SZJA 3CZQA 5FH9A 1GKYA 3P26A 1E9FA 3IIKA 1UJ2A 3V00A 1P2UA 1S96A 3TUZC 1W36D 3EA0A 1D2MA 4V03A 3IEUA 1LY1A 2KWIA 3QVVA 2OO7A 3SZRA 2VRWA 4V0MA 3DZ8A 1HE1C 4UNRA 5DIFA 3WHKA 5GJVC 4PQFA 4MGKR 2H17A 2ZE8A 5FUWA 3EX7C 2G77B 4FMCB 4HAYA 2ZSDA 4KAXA 1OFUX 2D2EA 2WJJA 2B21A 3NBFA 1VYTA 2GF9A 1JXOA 3LLUA 3PITA 5AUOB 2VF7A 3BFKA 4Y0AA 4TMZA 4OL0A 1NVUQ 4A8JB 2P67A 1QHGA 4DB2A 5JHHB 1NSTA 1HYQA 2F3RA 3NH9A 3ZVMA 1KK1A 4WVFA 1GNRA 1SXJC 4JBWA 1QHHB 1F2TB 1E1RA 2AKYA 1EGAA 2WSSD 5HTKA 3ZGXA 1VIAA 2O0HA 4Z51A 2BOVA 3A1TA 4L15A 4Q1BA 5DHFA 5L3QB 5KOYA 3E1SA 4MDFA 4F91B 3P1JA 3T12A 1R8SA 4AYTA 1YZKA 1P2SA 3TVDA 4UNQA 3EPHA 1R5NA 2GJAA 4NPHA 1WCV1 2IA5A 3AQ4A 4QBFA 2B7BA 2OV2A 2ORIA 2JJ8A 4NCNA 1GOTA 1YU9A 4PC7A 4GOJA 3EIHA 4M1OA 5TARA 3TH5A 3ZIAD 3VNVA 2BEJA 4GNKA 1Q20A 1IM2A 5L3RA 1JQJC 2YV5A 3SC3A 4OHWA 4CZ2A 4HDOB 1QHHA 4JLMA 2DFLA 2ZRCA 4GP7A 2QM8A 3GMTA 5FL3A 1LB1B 1E1QD 2CEAA 1AKEA 2UZIR 4M1KA 1G8HA 4P32A 3MLEA 1KDRA 2ZRJA 3ZD6A 1X1SA 2YOGA 1G8PA 2V1XA 4GOKA 4V0OA 5HR5A 2QPOA 2MMCA 5CJPA 4DIEA 3PEWA 1KAGA 4Z8XA 1FP6A 4QBHA 1BMFD 2QRZA 3KKOA 3ZS8A 2YYZA 1NN1A 2ZYUX 4GI7A 4RD2A 1DAIA 3W90A 2C03A 2W6JD 4URYR 2IEZA 3FKSD 1QHSA 3X1DA 1IY1A 3UKDA 4LK2A 2PZEA 1OT3A 5EXTA 4DSOA 4TTRA 1US8A 4DLUA 4V0LA 3WRYC 4G5QA 5C2JB 5L3VA 4O2RA 4NE2A 3AUYA 1CIPA 1OHHD 3Q9LA 1KSFX 2ONJA 1CU1A 2FFAA 2B6HA 2AFHE 2PMDA 3U7EB 4A2WA 5JJKA 3LFUA 4B48A 3N5CA 2CVFA 3P27A 5D3MB 5JRJA 1FTNA 3IILA 4LBWA 1CP2A 3CWZA 3WXMA 1DO0A 4LYAA 1W4CA 2FF7A 3P20A 4LJ6A 2KBEA 1Z6YA 2W0MA 5CDFA 3NG1A 3HWSA 2IXEA 4JKYA 5KSZA 3EZFA 3O8CA 2ZXUA 3U7GA 3L0SA 2O52A 4FCVA 3U3OA 4AKIA 3TUJC 4JVLA 3H2YA 1UPTA 1L4UA 3P32A 4U00A 1XMJA 2ZYVX 2XXAB 1LV7A 1O87A 4OQMA 2HF9A 1SVMA 3CPEA 2GTPA 2VHJA 4JS0A 2OEPA 4MITA 2DCUA 3SBEA 3H1TA 1HV8A 1DE0A 1T91A 3WRXC 2G83A 5DI9A 2OCYC 4LJ7A 4R2HA 5CK4A 1SKQA 2IEYA 4TT3A 1NVWQ 1NBME 2OHFA 2OLJA 5K8LA 3EPJA 4CT4B 1QF9A 4KFUA 3QENA 3WMEA 2RH5A 2GAOA 5CK5A 2CCJA 3NTUA 4C0LA 3OEHD 2AN9A 4JLVA 4JVSB 5E4FA 3KB2A 3ZZUA 1T6NA 3IBYA 3T35A 3EXAA 3GLHA 4IVRA 3LDAA 4TTPA 4AYXA 2HJGA 1G291 3LBIA 4DXAA 4U02A 2OXCA 3LH5A 4LOAA 4A82A 1N6KA 3E5HA 3NIBA 2HJVA 2LKDA 1E79D 1XMVA 2PX3A 1N6IA 1A4RA 3PIRA 4LY6A 5EP4A 3UG7A 3X2SA 3ZVNA 1Q1EA 1G7SA 2CBZA 4LHZA 5FTNA 1A2KC 1J7KA 1XEWY 1EK0A 1VDZA 3AP3A 1G8GA 1P9NA 2QEQA 3R9XA 1AKYA 3KKMA 1XXHB 4Q7KA 5FR2A 4TYNA 1ETUA 3TR0A 1U94A 4JLKA 1VCOA 4XWAA 4G1UC 2NO7A 3QUSA 3BE4A 4Q19A 3B60A 3MMPA 2CCKA 4LHYA 1RRGA 3B6EA 1JEDA 1G16A 4OJQA 3W6PA 1XTJA 4Q7JB 5FOSA 5BYJA 4GBMA 4XVRA 1XDBA 3ADBA 3LQQA 2IWHA 2VTKA 1YHNA 1M1YE 4PO1A 3QG1A 3QKSB 3DL0A 2ZUCA 4DUGA 1NMZA 1SXJD 2GF0A 5EE1A 5JS7A 2ZI7A 5CB6A 2X2FA 1OXVA 2JASA 5CIWA 3SN6A 1ZU5A 1M7GA 2PEZA 3ICEA 3U3JA 2E87A 3LD9A 3NDBB 4HZIA 1Q1QA 3CRRA 4YC7A 3ZLJA 4QGHA 4FWIB 2BEKA 4M0LA 5GVRA 1PJRA 4ACAA 5F98A 3QVUA 1AS2A 2GJ8A 4BFWA 4CW7A 1RJ9A 1TQDA 5AJZA 3W8NA 4KITB 2J7KA 2Z0MA 2FZLA 2ZRLA 4RKFA 4N1AA 1ONBA 4DRZA 1G3MA 5DYGA 2VH5R 4RFVA 3T1OA 4B35A 1S8FA 4IHQA 3VHXA 4DZZA 2RHDA 3AKYA 3VU9B 1Z5ZA 2IYSA 2DFKB 1G6OA 4RVCA 3SHFA 3F0TA 3LBHA 2O8CB 1J70A 3UPUA 3AF4A 4ESHA 1ZM9A 1KGDA 1WXQA 4LUCA 2ZM5A 3DPUA 1S3GA 2FSGA 5JRZA 1Q57A 1JJ7A 2IF0A 5E95A 2AXNA 5JS8A 2VSOA 3CX8A 3SEAA 1OH6A 2A9KA 2ZS8A 5JI3E 4GMDA 4D4KA 1I2MA 4P0TA 3U44A 1HQYE 3U5ZB 3QKTA 2W6ID 5DI3A 2QRNA 4KO8A 3X1YA 1RRCA 3B1VA 2QSYA 3SOPA 2ZUDA 4Q21A 4Q7LA 3KQLA 2O8CA 1G8YA 1VG0B 2KJQA 2AFIE 1CLUA 2HCJB 2D06A 4CEIB 3BFVA 1UBFA 2V6JA 3R7WA 4BZPA 4EJSB 3MUFA 1ZCBA 2RGCA 2ZJ2A 1JNYA 3JVVA 4MA4A 4L16A 2YHSA 1UKZA 2OFOA 1TU4A 4Q4HB 3PG5A 4I4LA 2BV3A 1R2QA 2XSZA 2CHQA 5DISB 2AK2A 4M9ZA 4L4UA 3C8UA 5JJLA 3QG5A 2WV9A 1VCMA 1Q1ZA 5IDVA 3GLGB 4C2TA 1UDWA 5JHGB 2PBRA 4Z54A 1BIFA 2C2HA 3A6PC 3QKUA 2H92A 2CK3A 1G4AE 1ESMA 1T4GA 5C46F 1TAGA 2D2FA 1CR4A 2C77A 1KSJA 1Z47A 4L9WA 4Q4HA 2HDNB 4R7ZA 1NJGA 3UATA 4A0FA 3GFOA 3P4YA 3AVYA 2JDIA 3OZXA 4M9SA 1W5SA 5J4LA 1OPXA 1D8TA 2GRJA 1XWIA 3EARA 1PUJA 1GAJA 2G88A 1Q44A 2QT1A 3KQKA 3QF4A 4B6EA 2VP6A 1TF5A 1TMKA 3CBQA 1AM4D 2J7PA 2CE2X 3MWKA 2OBNA 3K0CA 1KJYA 1Z2CA 2H16A 1E2MA 1DOAA 3TSWA 5JLJA 3G0HA 1JAHA 2GHIA 1Q3HA 1YR8A 1Z0KA 1KNQA 2Z5FA 3EPKA 4X8LA 2NO0A 1KSHA 3BERA 1R0WA 1VCIA 2Z43A 4TT3D 3QXHA 1UKEA 3PQCA 4KV9A 3KB1A 3CWQA 1KJZA 4ESVA 4PAOA 1ODFA 2ZETA 3ASZA 2FFBA 1NBMA 4Q66C 3TNFA 4OQFA 5IHPA 2YVUA 3K0CC 1AZSC 1KMQA 3WBKA 2CNWA 1F6BA 3MRSA 3M4YA 2R44A 1GRRA 1P9RA 2XTNA 4ERNA 1S4QA 1VMAA 2BCJQ 1GITA 2NO1A 3U4QB 4CT5A 1NVVQ 4Q5IA 4TWZA 4B71A 1ZAKA 5L8VA 1CKEA 4AWXA 6Q21A 1KJWA 2CJWB 1NP6A 1XBTA 4C0QC 5G41A 3VKHA 2REXB 4RCZA 3M0EA 3ZS9A 3LVRE 3E2IA 4QGFA 4RZXA 3DOEA 1E2LA 2OE2A 1SVIA 3GQBA 3SFZA 2FDCA 2W0SA 4W7SA 1A2BA 2IXGA 2F1JA 4AI6A 4IOLA 3MSXA 1N6OA 2FWRA 1DG1G 1EX7A 1D9XA 5FBVB 4MDEA 2ZAOA 1X8LA 2CJWA 4DT1B 4HZUB 3D7MA 2HXSA 3K09A 5LB2A 4KVAA 1VIYA 4ZDKA 2ZR9A 5KDOA 4Q4LA 4EQ6B 3KQUA 1XFAA 4BLOA 3PENA 4TYPA 4YMVA 2GJKA 4NCJA 4MGZR 3LA6A 3RC8A 1KI4A 1QVRA 3OAAA 3Q72A 1T8TA 2A30A 2V9PA 3K8YA 4XTCS 3TSOA 3WMFA 1UBGA 5SZIA 2H18A 2VQSA 2XJ9A 2WWHA 3FMIA 4PAQA 1OV4A 3N70A 4I1OA 1OSNA 2QZ4A 3W5JA 1II0A 3K09C 5F3WB 5KUTA 1VHTA 1AIPA 2A7QA 1SXJE 4HYYA 1BH2A 1MABB 4JVMA 1GUAA 2XEXA 2C9YA 3KUCA 1XB2A 1YRAA 4G5OA 2D62A 2J5XA 2R6CA 2WJGA 4LC0A 4LBYA 4ZIRA 1PLKA 4D80A 4EFNA 4AY2A 3BXZA 1W4AA 1NIPA 2GCOB 4C0AC 3RRMA 2WIAA 1IJFA 3FGNA 1DBSA 3Q5EA 2WWGA 1DG3A 3EZ2A 2BIFA 2QP4A 2OXRA 3K9NA 3NEJA 5FI0B 1NVXQ 5J4VA 1LVGA 3VR5A 1CJTC 3K0FB 3R8CA 3SFVA 4CEJB 4LWZA 4RFSB 4V0NA 3TAHA 3OE7A 2YZ2A 4ON9A 3Q7QA 3EW9A 3UWOA 1LS6A 1W0JD 4G5RA 3RS5A 1H8HD 2GEVA 5KSOA 4OHZA 3LW8A 1E2JA 1Q0UA 4EPYA 3FVQA 4DLWA 2D3WA 1E98A 2EFEB 1W5TA 1ZW6A 5DN6A 3THOA 3SYLA 1LTQA 3QXSA 2WICA 2CL6X 1MRNA 5LPNA 3IDQA 1CR1A 1E96A 4LHXA 3AVUA 3KTAB 4L5BA 3CNOA 4ZPXA 3QI2A 4DKXA 4HUTA 1A7JA 3C41J 2GZAA 521PA 2H5EA 1QDEA 1T3LA 4IVPA 4IDQA 5GJBA 4RFSA 1SVOA 1X8JA 3JZMA 3WMGA 4F38A 2IS1A 3GD7A 3K1JA 1KMHA 5FBQB 2IWRA 1ZIPA 1E2GA 2YWHA 5CYOA 3VAAA 2HUPA 4GPTA 1TNDA 1E1QA 5EQTA 1ANKA 2WMNB 4RD4A 4Q9IA 1EFRA 5LDDC 2QGNA 2WSMA 1IJEA 3AVTA 4YXWD 2ZRNA 1XMIA 1YRBA 2VSXA 1C4OA 5EE9A 3KXIA 1P6XA 3K53A 4NYIQ 1UEJA 4F7WA 4LBVA 3K70B 1TF7A 4PSKA 2GJSA 2WWYA 2GETA 1XEXA 3D6TB 4CDGA 1QG4A 3C4JA 4WZAE 1CRPA 2AXPA 4R9UC 2CK3D 2YWGA 2ZVPX 2ZYWX 3GCGA 2D4HA 5HZKA 1QHYA 1T0HB 4ACBA 2OAP1 3CF0A 3U60B 4BLSA 1NG1A 5IK2A 2CHGA 4IXMA 2JDID 1XF9A 3FYHA 4ARZA 2PZGA 5HE9A 2JATA 3RHFA 3AM1A 1M8PA 2XITA 4RZUA 1M2OB 4PPQA 4CVNA 4GDFA 2VP9A 3ZVRA 2JLUA 2ZJAA 4JLAA 1GILA 3DM9B 5JCPA 2J7PD 2O8DB 4Q1AA 1HQCA 1N5KA 5CDFE 3KDSE 2YWFA 4BZQA 4G5SA 1NL3A 2DY1A 4QKQA 3EZ6A 2N46A 821PA 4JL8A 2ZU6A 4FMDF 5G53C 3GLFB 4X8OA 3BIFA 1D6JA 2HLDA 4YQFA 1JI0A 1NKTA 2UZ3A 2GAAA 4PXAA 4PHFA 1M6NA 2HCBA 2BBOA 4BLQA 4M1YA 4F4CA 2F3TA 4HUQA 3F5FA 2DYKA 3SE0A 3FHOA 1NBMD 2ZU0C 4LV8B 4O25A 4MYUA 3BOSA 2BCGY 2J45A 2CNWD 2C78A 3M1IA 4MKHA 3FTQA 4URWR 5BN3A 2RGGA 2NTYC 1KY2A 1OXSC 2AD1A 4BLRA 3BH7A 2QT0A 2IYUA 2AWOA 1HA3A 4LHWA 1BYUA 1Z0AA 1P60A 1KKMA 1U0JA 1R0YA 3GFTA 1CRQA 3KXKA 3ONWA 4MRPA 1XD2B 1KO1A 5KDDA 4FW9A 2VL7A 4I81A 3EZ7A 1OYYA 1MO6A 2K5UA 4NCHA 3KQNA 1W47A 2JLXA 3PUXA 3OEHA 4US1R 2R8RA 3TKLA 2DWQA 1JBKA 3LX5A 3BGWA 4Q1EA 4B6FA 3I72A 4GL2A 1F60A 2QMUA 4MGYR 1R5OA 3AKCA 3QKRB 4PTLA 2IYYA 1EXMA 2EVWX 3JZAA 4WW0A 4JLDA 1XJ0A 5KPDA 5TDHA 4LJ4A 4AD8A 1ZNXA 2F43A 1OW3B 1P75A 2MMGA 4MRSA 3EAQA 4C0JA 1KNXA 4P4UA 4E22A 4M9QA 2JLWA 3MCAA 1F48A 1AQUA 3EA5A 2ZRHA 3OAAD 3RRZA 2QUZA 2IUSA 3BJIC 4QRHA 3LLMA 2FN4A 4PPGA 5EE3A 4DJTA 3SU8A 3QKRA 2XB2A 1Z63A 2XNDA 2REBA 2GVDC 3KL4A 4B76A 5JMTA 3TQCA 3CRQA 4LX0A 5TMPA 5FTMA 3A1SA 1DVRA 1KTVA 3W6NA 1ZNZA 1S3SA 4QG7A 1XXHE 5FFMA 1ZM2A 2XTMA 5BWMA 1NG9A 2P6NA 4Q9JA 2BM1A 1Y3AA 1SXJA 3T1QA 4AC9A 3I1FA 4LV5B 4KLNA 5J4HA 3K9LA 2Z83A 5FPSA 4W9MC 1CJKC 1TQ4A 4HAWA 5GADl 3GJ7A 3QNUA 1NN0A 2PLRA 1CEEA 4GP6A 4IKEA 4BFXA 4PFSA 4QGAA 1GSIA 1KI9A 2PLFA 4CRWB 4FMCF 1LW7A 3K0AB 3OE7D 3BD9A 2OILA 5JZVA 2OBMA 4ZO4A 2WKQA 4C30A 1P61B 2BVNA 3C5HA 5DN6D 1II9A 1VPLA 2BMEA 1KO8A 1IQPA 1HH4A 5BW8A 1NNEA 2V7QA 3L0IB 1NLYA 3GLIB 2QNRA 2WPDA 2EFHB 2QTFA 2V1UA 5AJYA 1FX0B 5FTKA 4UQOA 4GZLA 4A8JA 3TMKA 1GM5A 1KI6B 2WJIA 5AWFC 1E9SA 3PEVA 1TX4B 2QP3A 1F2TA 2ZJBA 2ECKA 3RSLA 1K6MA 5JCZA 1E69A 5AK0A 3QSYA 2CVHA 2A5JA 4KYUA 1OIVA 3HR8A 4B2IA 2XAUA 2JLZA 1EFRD 3A4MA 1E3MA 5L3QA 2RGDA 2ZJYA 1C1YA 1ZD8A 4PO9A 2W6IA 2Q0HA 1DAEA 3A36A 2CDNA 4POAA 2XZLA 2E9SA 2ZSFA 1EESA 1D2NA 4A8JC 3VKGA 3LVQE 1FX0A 4KJZA 3A4NA 3C5CA 4ABYA 1DS6A 2QMHA 1XTKA 3WY9A 2FJUA 1GDDA 2XB4A 1RZ3A 2AX4A 2R6FA 2UVQA 4LJ9A 4PC2A 1BO6A 4Q47A 1OFHA 4DCNA 3QQ5A 2VHUA 4PX9A 2QM7A 2JAQA 4YMUA 1M74A 2I3BA 4Z8YA 2C99A 4LPSA 4PPFA 5EXSA 1FQJA 4NYMQ 4IOKA 5IK2D 4QJ5A 3Q85A 1RRPA 5H1YA 1KK0A 3RWOA 2FSFA 4KFTA 4F93B 1N0VC 4PO8A 4QBGB 1SVWA 1OYWA 2O0JA 3MAAC 3U3MA 1WP9A 4PHGA 1DAMA 1U0HC 5FTJA 1OF1A 1R10A 3BWDD 1RC8A 1EX6A 1HURA 4TMWA 1E9AA 3X1WA 1GRNA 3K9HA 3QXJA 4RD3A 4IXNA 5P21A 5K8UA 2OESA 5DE3A 3GPLA 1UADA 1G5TA 2R62A 3GLGE 1NMXA 3TRFA 2HLDD 2JGNA 2EWWA 4RKEA 3OHMA 1KI1A 5AUQA 2WHXA 1IHUA 4US2R 3R8FA 1YZUA 4IFEA 4PPNA 2WJHA 1CJMA 2OM2A 4HAZA 4TLBA 3WP1B 1YZGA 3DVLA 1WE2A 5D3MA 5L3SB 2ZR7A 2VPPA 1R7RA 3H86A 2Q21A 5CLLA 3ZQJA 3HPQA 4GMXA 2R65A 1E9RA 3CH5A 3VKWA 1IY2A 4P33A 4ZDIA 1OH8A 3WYAA 3RYTC 4XOIA 421PA 1W4BA 2XXAA 2KSQA 2G0TA 3GP8A 2OAQ1 4JYCA 3X1XA 4URXR 2VIIA 3VQTA 2YINC 1FFHA 1WF3A 3KX2A 4OHXA 4UXHA 3B13B 2O8EB 4WA7A 5JEEA 5EZ5A
chains in the Genus database with same CATH superfamily
3GVPA 3PQEA 3T5GA 1WBDA 4K9MA 2QRJA 2YMQA 2X0JA 1YB1A 5SYAA 5F3RA 4A6DA 2W8ZA 3R6DA 2X5XA 2Z1MA 1Q11A 4RDCA 4WAUA 2OENG 5BXQC 3M6VA 4X7RA 1L6IA 4ZTBA 4JSTA 3BQMB 4HPWA 3DH0A 4LF7B 3PXEA 4ZKEA 3ODGA 5F9MA 3U4AA 4I9NA 3F96A 2CD9A 1FLDA 3QFRA 4PSVA 4BVAA 3IUYA 1EP9A 2I80A 3SK0A 5KWJA 4PFJA 1LXCA 1MO5A 1DC7A 1T1SA 1TVEA 2QBYB 4BKUA 1Z6ZA 3DAGA 1DQSA 4M0FA 2OY0A 4N7RA 3QPDA 4YRJA 3E22A 2IHZA 2YHIB 2E4ZA 1J2RA 1TCAA 3PGVA 4ZOCA 2VTVA 4NS1A 4MVJE 2O2EA 3VZCA 2BGGA 3SC2B 5CB4F 1F1BA 2FUNB 3AY6A 1WV0A 4ZVVA 3ZBUA 3KELA 4BL5A 4GX0A 1FK8A 3OU2A 3FE2A 4R1SA 1BN6A 2I4MA 4JLNA 3V6LA 2V7UA 3OFKA 5EJ6A 3HWX1 5DH9A 3VPAA 3TCNA 2IDMA 3R23A 5EP2A 2W5UA 3LXRA 4PLYA 4H1UA 4YMGA 2VQFB 1P2TA 3LX4A 5A04A 4TGLA 1XDWA 1N5JA 1IB0A 3R5HA 3LUPA 1FJHA 5IYZB 1T3TA 1JHYA 2NZXA 4LAFA 1ZUWA 4L4ZA 5CVTA 4ND7A 2JH3A 1JKJB 2KLBA 4IOMA 3VI4B 1XG5A 4GC5A 5AVOA 1QKKA 4FBGA 2BMDA 4IGEA 5C3UA 5FLXA 1FFEA 3BGSA 4FZVA 5FPHA 4PC3A 4I2NA 2FN7A 2G0NA 2GSDA 1TK2A 4M37A 1GGJA 4ZJYA 3HA3A 1NKVA 4BGDA 4KFSA 2UYCA 5JCJA 1H2YA 1Y9DA 2Z6QA 4BQIA 2GZRA 3PC6A 4BLPA 1U9IC 4HN4B 5H4GA 3A9CA 1V7ZA 2F1RA 2OCBA 3EC1A 3ZD8A 3ANTA 4ITRC 2P11A 4AKEA 3L07A 3QFFA 2ZE6A 1L7PA 2BRUC 2H29A 1E3LA 3HFRA 3QELB 4GQAA 2BEWA 4PINA 2V7QD 2PT7A 4IGKA 3MMXA 1TE2A 4N3AA 1ZXLA 2OFWA 1CQJB 1C30A 1SD2A 1ZJ6A 4XXHA 4MQMA 1W0JA 5E6RB 1WXDA 2SCUB 1JKJA 1QB7A 1RHJA 1ZN2A 1OLOA 3AW9A 1RPAA 3CNHA 3OUZA 4D3DA 1P73A 4PZLA 4CT0A 3ZJTA 1FY2A 4B33A 3F8TA 4W82A 4Q9HA 5AJTA 1H8ED 1G6HA 3CXUA 1CZHA 1M2VB 5EL0A 2FQWA 4DC9A 5KTYA 1XIVA 1G3UA 3FMVA 1E7WA 4NC9A 4QL3A 2WG0A 3P9KA 4TTJA 3HXLA 3RJTA 1GAXA 2Q1WA 1YS2X 2QVXX 4LOHA 3RFTA 4NH0A 3V42A 4O2LA 1OX4B 1BMDA 2BKVA 1BWPA 1CQJA 2HMTA 1Z62A 4J4TA 4N7BA 1E7SA 5E6RA 3OIVA 3VC2A 3NM4A 4XYGA 5A2GA 1I2DA 3H9EO 2YXPX 4NENA 2RC6A 2DU8A 2HNBA 3PXUA 4M1SA 5AW2A 4Y6RA 3HYNA 3ETGA 3IKJA 1XU4A 2PMKA 4P1ZA 1D0IA 3AY3A 3N2IA 2OZEA 5CLQA 5KWIA 1TTQB 2I1WA 3BWVA 3R5SA 1YVUA 3RV3A 4BPBA 1G17A 1QRAA 2NSLA 1JQLB 1WMSA 2HBYA 1H2RS 1T6YA 3R5JA 2JZOA 3WIDA 3NC0C 4TS9A 2B1RA 5IG2A 4HL6A 3N28A 1TCCA 3MWDB 2A8YA 4GGPA 1BGWA 4RIGA 1A5SB 2EU8A 1DOZA 3D8SA 3Q3GE 1ZVMA 3A1VA 3OQJA 5A0FA 5JR3A 5MN5A 3NEAA 4W5OA 1M2KA 2BC9A 3DVQX 3HYRA 2PQ0A 4UXIA 4L85A 1J22A 2VDUE 3E7FA 4KCGA 4N5DA 3THYB 1LPMA 4BN0A 1NDUA 4EJSA 1RWVA 4OSEA 2P62A 4FYVA 5K6AA 2Q6TA 4MVJM 3RVJA 3T9AA 5I7RA 1GA4A 3KM0A 5FFNA 4TYWA 4ZQGA 1RMYA 1YE5A 1YB4A 2X8AA 4EPXA 4OHYA 4A1FA 3QEOA 3TSAA 2P0AA 5EMNA 5I9IA 4I19A 2G67A 2QGZA 3N2GA 4M9XA 1L4MA 2NT3A 1RWMA 1QX4A 1X19A 3P45A 1AK2A 1LX7A 4C0BA 2YV1A 3G9ZA 3VR1A 3GLGA 2CDAA 4AJIA 3SR0A 1U28A 3PXGA 5FX2A 1F5SA 1II8B 2BM0A 3R40A 1E0AA 2OHJA 2XUDA 3PUIA 4A26A 4A5OA 5JQGF 4FX2A 2ORED 2PUCA 2P4QA 1XYVA 1BCSA 3RQIA 3IHLA 1BYIA 1ZKMA 1G19A 2YYSA 5GJWC 1TJ4A 2P9ZA 4IV0A 1K5GA 4N49A 1EBBA 3MZ0A 1PEYA 4PYLA 3TJZA 1IN4A 1CP3A 4A4DA 1F0PA 5LLSA 1XCJA 5EZ6B 5CEFA 1Z8FA 1A8SA 3JASB 2AX3A 2REQA 4G1MB 3CISA 1PR0A 2FJ0A 1JE0A 3DLHA 2QE7D 4X41A 4EHBA 1MG5A 1XCBA 1RMQA 3D1VA 3MTIA 4TSKA 3PNYA 2RCNA 4R69A 2PMCA 1II8A 5CT6A 5AM4A 1MA0A 4TV9B 3PZBA 4LF4B 1R9GA 2FHPA 2PL3A 1AKRA 2YV4A 4XJXA 1QIKA 1TO1E 3VXKA 3QJYA 5AW7A 4D3YA 3GLFE 7MDHA 1TLTA 1MLDA 3EGDB 4Y9TA 4NR0A 3LKBA 5SYNA 4JP1A 1GQQA 5I7SA 4YYZA 2J0UB 3IAUA 1EGMB 4MUMA 1DTSA 4A8TA 3G9XA 2QM3A 2JIPA 3C3YA 3FFAA 1P7ZA 3AW8A 2M98A 2VT3A 1J90A 2E4YA 3F74A 1ML3A 4RF2A 1WUTA 3EAGA 1Z88A 4IFBA 2O14A 3H97A 3L2OB 1EG2A 1XNJA 1CJUC 2V7GA 3K9QO 4AJKA 5BVHA 5EOVA 5AHOA 4BNKA 2VWHA 3EIEA 4ZOLB 5DCWA 1UKYA 3TQTA 1T4MA 3QQPA 3K94A 1E2BA 1AT1A 1KA9H 1X6VA 3OURA 1JIQA 2C4HA 3ELBA 2L0XA 3IS3A 1MOSA 3KKLA 3NEPX 2VYQA 4GXQA 2J0UA 4IDPA 1JDUA 4OTZA 2FX2A 4W7HA 3L8FA 5FV7A 4ZI7F 3U4QA 1CS0A 3LPDA 4R9VA 4C2BA 2OHVA 4DHEA 3KFXA 3U1TA 1TO2E 2IHYA 4HYTA 4R41A 1RLUA 1J49A 2JCGA 1EKXA 3BICA 1ZVJA 2HO4A 2VWQA 3HDTA 2N75A 2JBAA 4S1TA 1RLIA 5DTRA 1M34E 3GH1A 4LJAA 5CLGA 5HG0A 5TPZA 2OC9A 2J0SA 4CTNA 3SQDA 4ZOLA 2BDUA 4MVJA 2XCTB 4BQRA 1JYSA 1KE1A 2Z58A 3B2NA 2PYIA 3OFNA 1W36B 3SKVA 3I9KA 4LJ5A 2GN2A 2CLSA 4PX3A 3A58B 4OGWA 4U8GA 5DSZA 4EFLA 4NAHA 4U7JA 1AKNA 4EELA 3KOUA 1P2VA 4P22A 2H1HA 4D8TA 5ALZA 2C2BA 3F9RA 4QBIA 1KBOA 2I1QA 2I7DA 3MT0A 4YMTA 3HGQA 4JIGA 4LE1A 3AI1A 2WA2A 2FMHA 3AB8A 1WZIA 1U99A 4BO8A 2XT0A 3NAMA 4DCCA 1OLSA 4EPRA 1D04A 3JATB 1E32A 1XZPA 3PCTA 2RFLA 3RS3A 4GRDA 4CIYA 2ZOSA 4XCXA 3KLNA 3HB0A 4UDOA 3GFVA 3RUAA 3H1FA 4L51A 3PNSA 1ISIA 2P4EA 1ZDMA 3W8EA 4BMYA 5E1MA 2R8OA 3EB9A 1EFPB 2YWCA 3CR3C 3AEKB 2R5FA 4FCTA 5IFKA 3OIYA 5CNIA 1EQ2A 2OZPA 1JSLA 4BEWA 2TMDA 1WVMA 4FTWA 2HSEA 1XC7A 1NAIA 1SUAA 2NXWA 1BSVA 2QDKA 1AB6A 3HJNA 3QOFA 1MABA 2PKEA 4QJBA 2DPHA 1T34A 2QU8A 2Q7OE 1O95D 5CRIA 4CI0B 2IIBA 2WZQA 1SZPA 2EV9A 3JATA 2BZSA 4HDCA 3X44A 2X0IA 1F3OA 2WNIA 3E03A 3H8VA 2Q29A 1CERA 3C7TA 3KALA 3KXLA 1XLTC 3EIWA 2FPRA 5AVKA 2JIZD 13PKA 4PYMA 4TUYB 1N6NA 3M89A 1EFPA 4JLWA 2G76A 1KDYA 3OZUA 5AKHA 3T95A 4JYBA 2VPYA 5EVJA 3TLAA 3MA0A 3HVRA 5FWXB 1T5IA 4NZYA 3B2QA 1XRMA 3ZE0B 1ZLYA 3ICWA 3ND5A 4KI0A 4RX1A 4EA8A 4I6EA 1Z75A 1NMQA 1H2HA 2HU8A 4I1RA 4AVYA 5AO9A 4C07A 4E07A 4OL9A 4QWWA 5BWBA 3HV0A 5CBPB 1XQYA 2GVZC 3DM5A 3EDOA 4D0NA 1UJBA 2L82A 2IEAA 3BXGA 1RP7A 4KAAA 1L1FA 3HO8A 5K4HA 5BSEA 1YJ8A 2ZROA 1HX7A 1L7NA 1E99A 1Y6ZA 4ISCA 5GJCA 5YASA 3W4IA 1ONOA 5B2EA 2PKXA 4QNRA 1H4VB 1P39A 1YL5A 4WFIA 2OVFA 3M6LA 1LQ2A 1GXSA 3OFJA 3DFFA 1ZM4A 4LQ4A 2FEMA 1QIGA 3FTNA 1SO8A 3ACCA 3BRWD 3IMKA 2XB8A 1DWOA 4E21A 2QROA 4NCKA 1IPEA 1RWQA 2NAFA 3TKAA 4CMAA 2IYAA 4P3YA 2CJFA 5CBPA 2OQIA 3DZDA 3GEPA 2AH5A 2BT4A 1Y6GA 2AF4C 3D6NB 2ST1A 3GUCA 3IE0A 1KK2A 4JJ8A 2GFQA 4FT2A 3KEQA 4H7HA 4P4SB 1E9EA 1JBEA 1E1CB 1FNSA 2RAFA 3NIGB 3I6QA 3PC4A 6AT1A 5BUSA 1K7XB 2IK8A 3OKPA 1TLFA 3R5FA 2CWWA 5FL7A 3VOTA 1E58A 1T5DX 2CNOA 2ZBRA 4JT4A 5HBRA 2CKDA 1EAYA 1Z5UA 5E3JA 3QWBA 1XFDA 3AESB 3LY5A 1JS1X 2NQTA 2YVLA 3CZPA 3OWXA 4FS8A 4XQCA 3GH3A 4R8RA 1ESCA 1FNMA 1Q0LA 4KQGA 4OJNA 1G8FA 1RYZA 4DLTA 4DRYA 1ZJZA 2AKAB 2K6GA 2YXDA 3L8CA 4HI0E 3EJ6A 3OEYA 4XWGA 1KWKA 2XYPA 1UDCA 3MRTA 4J29A 3QU5A 2ID8A 4PNEA 2DBYA 1TQHA 3IIMA 1R18A 2GPBA 3SNKA 1DXQA 4FONA 1IBKB 2QD5A 2WJ3A 4ZCMA 2ZBPA 5GTDA 4TROA 4IDOA 4Y2HA 5GOZA 3PWSA 2ZE5A 3VAYA 1CR0A 1ZJ4A 5HS6A 3EA4A 4HB0A 2Z8YM 3L4BA 2DB3A 4P4LA 4KN9S 1VE1A 3WGTA 5FI1B 4F8YA 1Q1AA 2VRCD 1AXRA 1QNFA 4C20A 4MIOA 1TTHA 3KUUA 4JBYA 1NKSA 2K7ZA 4NEGA 5K3AA 3RF7A 4CM9A 3DWIA 4BB5A 2H7XA 3RYCB 3NBYC 1FFCA 2FZGA 3VNRA 3VR4D 1C0KA 1K9VF 3TQRA 2ZJ3A 2Q2OA 1QP8A 4FK8A 1P2FA 1YJ5A 4S35A 1SELA 3T5AA 1KAHA 1Q5PA 2NV2B 2YQ4A 3RODA 3TAUA 5T4FA 4ILEA 4KU4A 4EPWA 5B6IA 3GLFA 2HZ7A 2O54A 3RIGA 3DYVA 3O82A 4S1OA 3QBTA 4RAOA 2GJ4A 1TMGE 3C3KA 3OZDA 2PWBA 4G0NA 4NARA 5KYUB 1JHRA 1LS1A 1TF2A 4PE5B 4DTCA 3AHJA 1QHIA 5B2FA 1OX6A 1QLJA 1DIBA 4UVIA 3MLBA 5AM0A 5KTNA 3VFDA 3S2GA 3TWOA 4AMZA 3R3YA 4EY4A 2E48A 2HD4A 2I7CA 3DZFA 3L3BA 3BJMA 2WTBA 2EP7A 4A2QA 5CCBA 1I2AA 1Z33A 4JFAA 2OGUA 4YALA 4UMVA 4H4EA 1T15A 2OFXA 4WVLA 4MP8A 5JXHA 1PHRA 1VI5A 4D4JA 1DFHA 2CLCX 4XEHA 4DDHA 4K26A 1QQ5A 4RVGA 1XD9A 3CKMA 2Q3HA 5KB3A 1CSEE 4JT2A 3RVNA 4DV3B 1C9KA 1SBNE 3IKMB 1U8FO 3NC1C 1L1RA 5BN4B 4BVLA 3UB3A 1UP7A 2P30A 1JZTA 3HSYA 1GU1A 2BWJA 4YLGA 3THXA 1AMOA 1IZ7A 4DR2B 4H77A 4OI1A 1UM9A 1NV8A 3P9CA 2ZBUA 4UC0A 1C3OB 3RJ5A 3DMNA 3K4HA 3UIEA 3G0IA 4MEBA 5J1SB 2O1WA 3BJEA 4UNPA 1M34A 3DSRA 4LA4A 5BVGA 2ZQYA 1CJVC 4GE0A 1E92A 1A9ZA 1NJFA 3K7EA 2A5FA 4JJ6A 3MRVA 4WDQA 2WZBA 2CLLB 1IN1A 4BMVA 2I6UA 1D09A 1X92A 1KYYA 3UT5B 2QRUA 3IYLW 2RB4A 3L4SO 4LJYA 3OPQA 3UANA 1DUVG 2VP4A 3P2MA 1CTQA 1ODIA 5A6SB 6YASA 5HXAA 3G79A 1B8VA 3HUTA 3RFUA 4EF5A 1Z4KA 4JZYA 3KWJA 3ZDBA 1PYGA 3LF2A 2ID7A 3O1JC 4IUCS 1AZWA 4XD7D 3T7SA 4O0MA 1HT0A 2HA2A 2YRWA 2P5TB 1QG0A 4X7PA 4AZVA 1VXOA 2CXRA 2XWPA 3WIUA 1NPYA 4F5DA 3L8ZA 4UUMA 3GCDA 2Z8YA 3ZGLA 3VC7A 1SN7A 3K05A 4R6WA 3P97A 3ROKA 4D8YA 3C8HA 4PZ9A 4UAGA 1Z5GA 4GKVA 3SZMA 4IX1A 5B58C 2ABWA 3QHPA 2WJYA 5A6SA 2D54A 5TQJA 2E85A 2HEIA 1VSVA 2FKNA 2O3RA 1JG7A 3LQYA 3I6IA 1KC3A 3ORYA 2KQUA 2I6QA 2M6RA 1FDSA 3GNTA 3NLLA 4JJKA 1SOUA 3KSUA 3NWJA 4MMZB 2C5BA 4BASA 2OMKA 3I8OA 4IVQA 1H69A 2D2VA 1W19A 3IQHX 2LCIA 1FDOA 3PR3A 5LJIA 2RI0A 2BR4A 4F2HA 4IXTA 5KX5B 3KPVA 3T1NA 4RKYA 4UBIA 2F3QA 4CODB 4A27A 4MUNA 2A5DA 5KJ1A 1AK1A 1NFFA 2LP4Y 4IUYA 5GZ6A 4FFVA 4LMAA 1YZQA 3KR1A 1BVUA 5TLSA 4TYQA 1L3BA 5BXYA 4BNIA 4YJ2F 3CRW1 1GIAA 1ZMRA 4JC4A 1B23P 2QGFA 2BY4A 2YQ5A 1H8EA 4XASA 3D0OA 1F17A 2PQ6A 4X91A 1EVZA 2AR7A 3C6XA 3E15A 4OP3A 2AR9A 4YT5A 2ZUTA 3Q0IA 3DV0B 1XDZA 4HO1X 1IBSA 4KWTA 5FD8A 5BV1A 5GM2A 4HV4A 5IASA 4GT1A 3BB4A 3C24A 4FBLA 1VLMA 2HJSA 1N0WA 1R6DA 3FFWA 3WFIA 4PX5A 3TIXB 3L77A 5BPHA 1ZD9A 4IMPA 5EKXA 2QAJA 1T4DA 2TECE 4FUTA 4IGAA 1NYRA 3AP1A 1RKUA 4DSNA 6REQB 3AFMA 4PRLA 4AUMA 1HNWB 4QFBA 2EX0A 4D4HA 1EA5A 3HXPA 4I8IA 1P3DA 4OBXA 1S01A 2QQ5A 1I3MA 3JYPA 3ZE9A 5DTIA 3K4QA 1YS9A 3EBLA 3IVXA 4ENWA 1DX6A 1RWXA 1TMOA 2GXSA 3DV0A 4P31A 3KJIA 3NO4A 4WZAB 4DARA 1LBEA 2FW7A 5DO9A 3BTSA 1W4ZA 3H9BA 3O8RA 1C9DB 4AZ0B 1Y34E 4B2LA 3UJCA 1S2MA 4EYOA 1LLFA 3RIYA 1OVGA 221PA 1M8FA 3RD5A 1BXRB 2R96A 3L1KA 5AM1A 3TFWA 3SDBA 5HKKA 2CUKA 1L4YA 1WXWA 3BGDA 1MT0A 2E1PA 3GJ8A 2PX8A 1I3NA 4ENRA 2WF7A 3OE1A 3IAFA 2PSEA 1CJBA 1OZAA 3NUZA 4M38A 3K1TA 4PSDA 1QQAA 4R31A 4FZ3A 1OI3A 3S2ZA 1Q1BA 5TQ2B 1TYBE 3CRZA 5K05A 721PA 1YZFA 1GZDA 4RY0A 1H3FA 5F2EA 3FPKA 4YIHA 2JLAA 1UQUA 4MJ3A 2GK6A 3KQWA 4EATA 1WF6A 2BR5A 4YRAA 4KTTE 4DREA 3CX6A 3EFOA 1S8NA 3AV3A 3AJRA 3FPCA 3KJFA 3KJQA 3LBAA 4HDRB 4Q9DA 3VPXA 4QJ3A 1V37A 1RW4A 2PU7A 2ZSBA 2ASEA 3PXCX 4IQFA 4ZXPA 1BXRA 1UDRA 3CZCA 4WI1A 3RKUA 4DN6A 1YACA 3LMKA 2Y1CA 4MGEA 3R7BA 3ESRA 2WHPB 4JBNA 2VT7A 3ZG6A 3IUJA 3B36A 4F92B 1IWBB 4QYXA 4YJHA 1KVUA 3CXRA 1S6YA 3OU7A 4WZBB 2QYOA 1G9XA 3CY6A 3HV2A 1U7HA 1FDTA 4IDNA 2ZBDA 3TLXA 3IPRA 1KPGA 2GM5A 4NG4A 1TT7A 2OOSA 1PL6A 3ODPA 3GLQA 4HGZA 1A5TA 4HB2A 5ICMA 2QE7A 1QGDA 4E6PA 3AR7A 3L6BA 4BX0A 4M8NE 1Y42X 4V0RA 1EWVA 2VEOA 4HX9A 1KJQA 4XUGB 1BD4A 3ZY4A 5EFZA 2CGEA 3MVEA 4RTSA 2CYAA 1VP3A 1NVVR 3G9UA 3CH6A 1TAHA 1WLSA 2RCYA 3P2KA 4G86A 1T1JA 2QUIA 4R7GA 2V6IA 5B53A 4BNFA 2QI9C 4CL3A 4LS3A 4UUBA 2H7CA 4EX6A 3SXUB 4FZRA 5JNWA 1K8RA 1HM5A 4W6ZA 4BAGA 3A6JA 5FBRB 1QK5A 1FFAA 2WVHA 4YRKA 1NE2A 4KHZA 4YV0A 5A62A 3TG2A 1M0WA 2HN9A 2WAOA 1X7GA 4QU8A 3FAKA 3V4ZA 3E1KA 2WUGA 2AOUA 4J2TA 1EUDA 4BFLA 3S29A 3BWEA 3KYIB 2VDLB 3STYA 3N8GA 3FTPA 4RQBA 4CQLB 3G5TA 4LYFA 4NK5A 5K0FA 1U4OA 2JGKA 3JZIA 1GHTA 4PU0A 2WAMA 5CFZA 4F9TA 3H75A 5IKMA 1U0LA 1SCBA 2IHUA 3EASA 1M3SA 2WUFA 3PBKA 4JNKA 4MVCA 1C4WA 3GPDG 4AJNA 1LU9A 5BOSB 1A4IA 3B89A 3E8XA 4RK0A 1DCTA 3P9QA 5E7MA 2WTXA 4O2AA 4DCVA 4KPYA 5IFLA 2ECQA 1KYIA 3PRYA 4N54A 1GO2A 2UVPB 3V4LA 2NO9A 3L0ZA 1DAHA 2TMKA 2WM8A 2WZCA 4LJLA 3IDAA 1GTSA 2J32A 3B3QA 4JC8A 3MBIA 4LKOA 2BEVB 3DO6A 2WJWA 1UP6A 3TNLA 2MCFA 2FCAA 2BGJA 3EQ8A 4ZVQA 3BGOS 1YHZA 5BV8A 3CZ9A 4IIUA 1PR4A 2BKEA 2XRFA 3ETNA 3I39X 5A5EA 3LZCA 3LZDA 3PTLA 2ZE7A 2D1TA 3HCAA 4YPFA 5ABPA 3IL2A 1SQSA 1XTVA 2LBPA 1VPTA 4MR8B 3D8NA 3SDSA 4RACA 5K3DA 2KW5A 1Z4NA 4YAKA 1U1FA 4LXQA 2UVPA 3LUCA 2IVZA 5I9NA 1E94E 2SKDA 3EF3A 3K5WA 5DXAA 5ECYA 3ABIA 1QZUA 5HQ3A 4RGBA 4W7IA 2BEVA 4MI1A 4M87A 4CUKA 4QWMA 2XV1A 3U56A 3BH0A 3T3EA 5HPYB 1NT4A 1CVRA 3CUEF 1IZ0A 3L7DA 4C7OB 1H2FA 5D5PA 1DOHA 1XMXA 4HFJA 5B7PA 4ZAGA 1U5AA 1MW8X 1E0SA 4Q18A 1D2AA 3GRPA 2OT3B 1Z4MA 3FCXA 1GAEO 2OLKA 4TMYA 1P29A 1GZ5A 4BY9E 1QZXA 2QLJA 3HYTA 5FO0A 4EZIA 2CFOA 2QPAA 3O21A 4EPTA 3WL7A 1B0PA 4MYDA 2K7FA 1SWVA 5H3LA 4NP6A 2Y27A 1I8TA 4NULA 1H4QA 3LL4A 3D1JA 1O95A 2P4HX 4G24A 3GZNB 3WZLA 1PRYA 2EXXA 2HPZA 2P7HA 4KKVA 2M6LA 2B8WA 2A67A 1IN7A 4GX5A 3BJZA 4WBNB 2JIZA 1ABBA 4C7OA 1U8ZA 1JXMA 1TD9A 1M2HA 5ITZB 2OP1A 3L4JA 4KNYA 2P2ZA 5IVHA 2MU1A 3H7IA 4N18A 4B7XA 5M29A 3KPUA 4JJZA 3WK5A 4JZKA 3IP9A 5EIFA 4MTCA 3WC4A 5C80A 5CFOA 3A3NA 3U44B 1GPUA 2WVJA 3OM9A 4B44A 3NFYA 2W70A 2WILA 4E1BA 2GD0A 4Q4AA 4LYJA 3CLTC 3CW2A 4FJ0A 3TXXA 1ZU4A 3MYRA 3UWMA 3A6KA 2EJCA 4CUJA 5JBIA 1KYTA 3LO5A 4ZMBA 4MVJH 3ORFA 4L8GA 1F6DA 1GKLA 4WBNA 5JJIA 4DA7A 4IJVA 4P86A 4WL0A 1EMDA 3URKA 4OI4A 1DXHA 3H65A 1EK6A 1P9WA 2PANA 2JKZA 4YJ3F 4HNAB 2IIVA 3CRNA 3MGGA 4PEVA 1YJAA 1NI4B 2QNBA 4RVDA 4BUCA 4X85A 5CAEB 3I45A 1EK2A 3PPXA 4IIHA 4P92A 3UMFA 4AMVA 3HWRA 4EIWA 4R1OA 2HBQA 2OOKA 4NE9A 4F2WA 1DIOB 4D45A 2CXHA 2VNSA 4L3VA 4TS3A 1TOAA 2FA9A 2QTTA 2IDKA 3EC7A 4QYWA 2OK8A 5TY0A 2RAUA 3ZV3A 4F5ZA 4XYLA 5KKAA 4ZTZB 4EDHA 1Z0DA 1PK8A 2WIDA 4H7PA 3TTSA 3ZHRA 4AG3A 4FFRA 1VLVA 1GZHB 3AVPA 4K3UA 1CUWA 3PIDA 4HN2A 4Y18A 3H8JA 3HDJA 1DBQA 1VI6A 2Q3FA 1SCNE 1A72A 2GCPA 1T1EA 4EZEA 4IR7A 5AJXA 1SCQA 2D0OB 5J58A 4HNAA 3L7CA 1T0JB 3ZVLA 4KO1S 2BSQA 3ADOA 3TR5A 4UTXA 1NI4A 3UTCA 3QF4B 5J59A 5G0VA 1DKOA 5KTPA 4LC9A 4JAVC 2MOKA 2HBZA 4QT0A 3W5BA 3ASUA 4Z3OA 4Y2YA 1DCMA 1J8MF 3CT4A 4W1PA 3FWNA 4PAGA 1MJGM 2BKUA 1IIRA 2ZULA 1NBHA 4K1XA 4E30A 4QE3A 1N8KA 2RK6A 3WGNA 2IHNA 1LNSA 1L5MA 1ZUNB 2AZTA 4NPAA 4MTLA 1QF6A 5BO5A 2NSYA 4CDGA 3L04A 4DCGA 2IU3A 2RGAA 1SULA 2Q3MA 1NGSA 3CJTA 3H0KA 3O90A 3NI2A 5HIKA 2VNKA 2CBGA 2CXUA 4DLBA 2G17A 2P3SA 5GVSA 1G21E 1AUVA 3PVCA 5JS1A 2SBTA 5GAJA 1T3SA 1Y81A 4Q6BA 1Z83A 4BFYA 2XRYA 1EJ6A 1V1MB 3HKEB 5DTMA 5EPEA 5EMLA 5BQXA 4I6JA 4RVSA 1MO3A 3MTDA 4C7KA 5JAOA 4GECA 1FSGA 4CTKA 1NQAO 3RO7A 1N34B 1J9GA 3KEMA 4Q37A 2BM9A 2CFIA 2FOXA 2JA1A 3LXXA 1QLWA 3N6RA 1V2HE 1THZA 2DMRA 2C61A 2PKYX 3CC8A 3ITDA 2VDRB 4R6XA 5CJ2A 5FI3A 1P7YA 4YQEA 3WYGA 4L6IA 3HJFA 3TX2A 2ZQ5A 1QHEA 1V3VA 4GVXA 4QVGA 5HCUA 2DFNA 3A6LA 1A95A 5FQOA 3SZUA 5FOTA 4A0GA 1NZDA 4D8UA 4G3XA 4U3JA 4DA4A 2NSDA 2XRMA 2NG1A 3C1UA 3GJ4A 4GZ3A 5CYFA 3WV5A 3RVPA 2PKQO 4AKGA 1K1EA 1UPBA 3HLKA 1L4NA 5BSVA 1E1DA 3SQOA 4A6XA 3CB2A 3CPSA 3DPIA 4MAMA 2XOKA 4WT7A 5CM2Z 5A0TA 2GO1A 2QAGA 4I46A 5DNDA 1M76A 4D9MA 2IYEA 1SM4A 3RB8A 2ISQA 3MFYA 3CX4A 5I5GA 2JGEA 4BU1A 4DV7B 1A9TA 3LX8A 3PX7A 3HJRA 2WJZB 1FJGB 2BE9A 4UM5A 3BT7A 1TK9A 5CTAA 4QLBA 4KKXB 3L02A 4NEHB 3U17A 2FNAA 1CR2A 4BXOB 4FS3A 2ZJ5A 3SLKA 3L1HA 3THWA 1MR3F 2C9BA 1X3LA 5HOQA 4PYRA 1ZCJA 1U6JA 2BF4A 2OGTA 4H3HB 1ZNWA 2NWQA 4LRSB 4MPDA 4MW7A 5KSPA 4DANA 4NEQA 1E2EA 4YT4A 4EO4A 4K6FA 4G0UA 4CKXA 1ZH2A 1TUIA 3CEMA 3G2MA 3UAVA 2ZSEA 3CX3A 1JEEA 1RTKA 2R8XA 3O84A 2G08A 4P7BA 4QSHA 3VC1A 1CB0A 1QR2A 4EEXA 1PJAA 2N0SA 4I3FA 1FYWA 1PT6A 4MAAA 5HUHA 4EJFA 1HLGA 2JG3A 1RDFA 2WKWA 3EXHA 5CDSA 4BXOA 3IGFA 4UXJA 1GL9B 3AHIA 2O3UA 3I3SR 4ZQIA 5IMSA 1VBNA 2OXEA 5I8ZA 1MJGA 4DUGD 4FWBA 1PGOA 3QY9A 4Q1VA 4WY2A 3CRMA 5HUQA 3FLEA 1OXTA 4JXKA 3E48A 4KIFA 1VKOA 4MW1A 4QOSA 4GW3A 3H83A 4BO7A 3ZDEA 2EKBA 5K8JB 1OCEA 4Z1MD 1VKRA 3R09A 2JI4A 2RHGB 1KJNA 1OIXA 1UT5A 4XM0A 4PGMA 1D4ZA 1RHUA 5BP7A 3L8DA 3OQHA 1WPQA 4GI5A 3AIMA 5TS3A 1ZYUA 4BEJA 3SDZA 3QTLA 4MVJG 5DB4A 1OKKD 3K0HA 5TPWA 4ETNA 3U6BA 2C0CA 2PRZA 4OG2A 3EPLA 5CEJA 5AW1A 3CLTD 4UHDA 3DZCA 4G4SP 2Q5CA 5DNYB 5FOVA 2IUUA 5KIAA 1EH5A 3L43A 2J3HA 4HDAA 1Z2AA 4U7WA 4TQGA 3RS4A 1W36C 3DDUA 3CZ4A 1SMKA 1YULA 3H3XA 2PUWA 4D57A 4IBOA 4M36A 2XF8A 4C0HA 1NRXA 1U6IA 3NCHA 2C54A 2IY8A 3FOZA 5MHTA 2XE8A 1XTIA 3BGVA 2ZAIA 4C6TB 1MQAA 1QPGA 2HJ9A 3L9XA 4NXMB 2FV8A 3ZX5A 2R8ZA 3CIOA 4BAUA 1X7ZA 1MC8A 3PFBA 1W6UA 5CUQA 1F8FA 4N3BA 4MDYA 4XIFA 5EFOA 4DFDA 5KCMA 4F3TA 3M6AA 1JJVA 3I30X 3IVMA 1GGVA 4DCSA 3CNNA 2Q9AA 4GRAA 2FOLA 2H9IA 2OO5A 2COEA 1N2ZA 1HEIA 1Y8CA 2C8LA 3S28A 1ARZA 3LJKA 3H2KA 3TIVA 1V35A 4LGMA 4YJKA 5CDUA 2ZPAA 1J4AA 5JG7A 3WGYA 1POXA 2V4ZA 4GR4A 3VJRA 1T2DA 1AHIA 1DZIA 2HV8A 4EX7A 2VG8A 4KQ1A 1M1XB 2XB9A 2C3PA 1IBRA 1UBEA 1Z06A 1Z0IA 3D5QA 5EINA 4ZT2A 5BOSA 2JAHA 4RCVA 4H3KB 3INGA 1NZJA 4EARA 2QLNA 2WJVA 1XJCA 2BFPA 1RBYA 4HLDA 4MWDA 1MAWA 5TR9A 3RASA 3VVCA 1H4TA 3T5PA 5H0IA 3TSZA 2VXCA 4C6SA 1KU6A 4ARCA 4ARZB 1KZYC 3NDPA 4L9SA 1N4DA 1G6Q1 1HZJA 1LQTA 1ZVQA 4JDPA 4Q48A 4HAXA 4ZKDA 2WSBA 1C8LA 3EDYA 3DKRA 3EY4A 1DJLA 5JWOA 1FCJA 1TUEA 1RWOA 2GM4A 3QOWA 1RXYA 4FGWA 4JOCA 4Y0VA 1T36B 2Z98A 1PW7A 5DPMA 3T3GA 3UFXB 4BLWA 4G5HA 3Q7TA 3FKSA 4WN9A 1E3EA 1Y3BE 2RHCA 3AXSA 3DMRA 3H1PA 1VJDA 5HA5A 1MB4A 3IEVA 1GSOA 2W83A 1W59A 4K8RB 2EQBA 4PZUA 4INJA 1QPZA 2WTEA 2A59A 4ES6A 5CVJA 3AFIA 3CE6A 1OXXK 2W2KB 1JDZA 2DULA 4LHSA 1A27A 3I73A 4BPRA 5AW8A 2QAIA 1QMGA 1WJGA 2VJLA 1RJGA 2X5KO 4JSRA 4M7OA 3DL2A 3OI7A 5NULA 1E2KA 1RD4A 1PT9A 1TL7C 2BJWA 2QTCA 3MLAA 3G1WA 1DWPA 4TL8A 2ZJ8A 3DDCA 1DTEA 4XDZA 2W4QA 3HCBA 4HDSB 3VHRA 3DMDA 1CULC 1PZHA 3AG5A 4KJXA 3V1KA 1M83A 3EEQA 3QWIA 4E08A 1U81A 3PWKA 1R50A 3KTDA 4J1NA 1T36A 3TW0A 2Q50A 3MWJA 3A6GA 1AOXA 1FDIA 1J39A 1U5BB 3FVVA 3M34A 4LJ8A 3UFXA 1NLZA 2IS2A 4X7MA 1S3IA 2ZKIA 2IW3A 3KKPA 4B3TB 2O8FA 5KS2A 5TXGA 4JGBA 1NFQA 1A9XB 2W2KA 4N01A 5EZYA 1PWZA 4IIJA 2PIAA 1UZAA 3QHQA 2VI5A 4GX2A 3PI6A 3ZYCA 5JI2E 3Q3EA 5JC8A 5TQ0A 1DKRA 1UBHS 1TZ2A 1VKHA 3EEYA 4WCDA 4FSHA 4C01A 4DQKA 3L5OA 4HDSA 5JDIC 2VWPA 2O1EA 3R7NA 4XUCA 4X6YA 3FPFA 1WMFA 2ZIFA 4TKVB 3TI7A 4DLKA 5I8WA 5JWHA 2GN8A 1D4FA 1GV0A 3FKJA 5BSFA 3LQ2A 1U5BA 2IPNA 3ML1A 1KY3A 2WABA 4GDMA 4RGYA 3OICA 1J2TA 3ZH9B 1JVSA 5ED0A 5A3QA 3KJZA 2Y1EA 2XUKA 4I3GA 4ZHQF 1F8YA 1FW6A 4DV5B 1P4AA 2ZIEA 1A9XA 1OAAA 1R4MB 1K6JA 3NHAA 4M1TA 1TEXA 2JFQA 2W2LD 4P82A 4YFYA 2EGGA 4IMJB 4LE2A 3NKFA 3UVEA 2F43B 4A03A 4K6GA 1P0IA 4TL6A 3ZQKA 2FTKE 2AUNA 5ETJA 3PFIA 3BMNA 1IBCA 5FYQA 1EFKA 4LCBA 1NVDA 5IVDA 3RBZA 1S2NA 1YQ9A 1ZM3A 3LHDA 4DQDA 2RKBA 5EJMA 1IVYA 3RG2A 1I7QB 4F6LA 4JIMA 1NM5A 3H05A 3WWPA 3I9JA 3F67A 1ZINA 5DN9A 4Z7JA 1T9AA 3SX4A 1R4MA 4II2A 1L5HA 3ZWWA 4XVUA 1AXEA 1GVHA 1VHWA 3DYBA 3W34A 2Z2ZA 4ZVRA 5DBHX 4DJJA 5A5VA 1P0QA 1XQ6A 1JDSA 4M60A 2P9JA 4UJ3A 2IKQA 3S2SA 4EG6A 1SXJB 1IYZA 3INNA 2Z56A 4QTXA 4Y6SA 4E46A 1I7SB 1L9XA 2F7SA 3R6GA 4MV5A 4PCAA 1VECA 2G9VA 4W5NA 1E1MA 1PFWA 2X1VA 1USKA 1E9FA 5HK9A 2WF5A 3OUUA 3V00A 2RAVA 2JS7A 1P2UA 3LCVB 1W36D 3EEBA 3EA0A 2Q45A 1W5EA 1D2MA 3NALA 3HXOA 4V03A 3LUGA 4DNPA 1T0PA 3WLLA 3WIBA 2OO3A 4EO7A 4UOZA 4IUDS