1JJVA

Dephospho-coa kinase in complex with atp
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
205
structure length
194
Chain Sequence
MTYIVGLTGGIGSGKTTIANLFTDLGVPLVDADVVAREVVAKDSPLLSKIVEHFGAQILNRAALRERVFNHDEDKLWLNNLLHPAIRERMKQKLAEQTAPYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARSANFEQIQRIMNSQVSQQERLKWADDVINNDAELAQNLPHLQQKVLELHQFYLQQAENKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEPHOSPHO-COA KINASE
publication title Crystal structure of dephospho-coenzyme A kinase from Haemophilus influenzae.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transferase
total genus 72
structure length 194
sequence length 205
ec nomenclature ec 2.7.1.24: Dephospho-CoA kinase.
pdb deposition date 2001-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01121 CoaE Dephospho-CoA kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1jjvA00
2O52A 2HT1A 3UK6A 2FZLA 1MO4A 1GG2A 3P1JA 1KSFX 2OESA 3QIAA 3QE0A 4HAWA 1ZRHA 5FBWB 4I81A 5BYJA 2CE2X 4XJXA 3AVUA 1DTSA 4R71A 2DY1A 3PCRB 4Q9JA 5L3SA 4XTCS 2A2ZA 4YQFA 2KSQA 1SVIA 1D5CA 2C9CA 2I4IA 5DGXA 5KYKA 3WXMA 2NZ8A 1KI3A 4HZUB 1LW7A 2J0SA 2ONKA 3VR3A 3TBKA 4Q4HB 1HA3A 3O47A 1XTJA 3DDCA 3U7HB 1NN0A 5DYIA 3LXRA 1ZMXA 1G3RA 1U8AA 4ITRC 3WHLA 4MA4A 5DYGA 2F1JA 1Z0FA 1GM5A 3U60B 2B21A 1FQKA 3R20A 2IF0A 4D4JA 5FBRB 2JLSA 2I3BA 2GJSA 2NGRA 3PV0A 5BN3A 2QSYA 4WAUA 3F5FA 1Z0JA 1L8QA 4IEEA 4AD8A 2ERXA 2O8BA 4BGDA 5TARA 1KMHB 2WKQA 3EARA 4OI0A 2ODNA 4CGZA 1YRBA 3MSXA 2R6GA 4R7ZA 2VEDA 1EK0A 2FG5A 3KL4A 2CVHA 1YZKA 4Q18A 2VQSA 1W7AA 4B3GA 1W2GA 4NYMR 3B9PA 3B8HA 1VYVA 1BKDR 5BN5A 2CHGA 3OIVA 3AVTA 1G3MA 3SJCA 1ESNA 3WMEA 4TYWA 2WJIA 4HAXA 5BXQC 1Q3TA 5JS7A 2BKEA 4V0MA 2V1UA 4A8JA 5F3WB 1KHTA 1NG1A 2V54A 3A37A 3ETLA 2VP4A 3QENA 1IONA 1JPNA 4UNQA 3QKSA 1GUAA 1PV4A 1OIXA 2CL7X 2QP4A 2GXSA 3IHWA 4D4KA 4C3ZA 5J40A 5HCIA 1IOZA 3BK7A 1K6MA 1FP6A 4EPWA 1AS3A 1OW3B 3ZGXA 3GP8A 4IVRA 1T5LA 3CRW1 1GKYA 1UDWA 5KNDA 5C4MA 3AM1A 3BH0A 4X8OA 4EPYA 3L82B 2ZJ8A 3LV8A 3GLIE 4JJZA 4NDZA 3IIKA 3TK1A 1F2TA 4LJ7A 1XNJA 5KDDA 4O3MA 1RE0A 3A4MA 2XB4A 4Z8XA 1Q3HA 1NG9A 3W8RA 3JVUA 3VKWA 1R6BX 1T9HA 3Q7QA 1YZGA 3O8CA 5AR1A 4OBEA 4DSUA 1E9SA 3KKPA 4Q21A 2ZE5A 4JIMA 2HEIA 1FOEB 4QBFA 3QQ5A 3GQBA 1XXHB 3LBHA 1U0JA 1OFUX 3SOPA 3T5DA 4PPFA 2F3RA 3T06B 1FX0A 3TNFA 3DM9B 4BLSA 2ZRHA 4F4CA 4RCYA 3SJZA 4MDEA 4LDJA 1MT0A 2R8RA 4AYWA 4H9GA 1Q1QA 3E70C 2QSZA 4TSFA 3IUYA 2ZI4A 1TQDA 3R8FA 3OF5A 3K0CA 1G9XA 3U6KA 1AS0A 5CM9C 3C5HA 1Z8FA 2BMDA 2H8KA 3CNNA 4MYHA 5JWHA 3Q72A 3MFYA 3TR5A 3KQLA 1S8FA 5J4LA 1EFUA 3KQNA 1DE0A 4XH9B 3LQRA 4DCNA 3WNBA 1C1YA 4B74A 2QEQA 3KJIA 3SEAA 2BCGY 2B92A 2HCJB 1E1QA 3FMFA 3LX8A 1U9IA 5JCZA 2G88A 2GJAA 1OXVA 1QVRA 2WICA 3FVQA 3DMDA 2IS2A 1P2VA 4FMCF 4HYYA 5E3HA 3U5ZB 5JWOA 3QXXA 5JHGB 4TSFD 4EKDA 4AWXA 1YR7A 1OE0A 5FTLA 3BRWD 2REBA 3MLEA 1NMZA 4WIAA 3OHMA 1XPRA 2QMEA 1T8UA 1D9ZA 2O8DA 1E2LA 4V02A 2CMKA 1GIAA 4A36A 3JZAA 2YKGA 3CRMA 2ANBA 1F2TB 2DR3A 4R98A 1K5DA 2FF7A 1E1QD 2FSIA 2ZJBA 3BB3A 3B13B 4LJ6A 4Z54A 2KBFA 4GPTA 5DE3A 4ERNA 4KHZA 4JLOA 5LBIA 1AKEA 1B0UA 4CEIA 2DPXA 4PC7A 5BWMA 5JI3E 4FWTA 2D62A 2GAAA 2QPTA 4QGAA 3UIEA 4Z8YA 5TMPA 2GTPA 3N2IA 4PHGA 4Q1AA 1H65A 2OV2A 2RKOA 3FHOA 1JB1A 4KODA 3SE0A 3HR8A 4E09A 4QJ3A 2ORWA 3D7MA 4WA7A 1ETUA 1I4DD 3U2QA 1YZUA 4DJTA 1DAGA 4JLDA 1QHSA 3B5JA 3CF6R 1N2CE 1IN6A 3GLHE 3AVVA 2PEZA 1COWA 2QAJA 2IYLD 4JLVA 4L15A 4MGYR 2WIBA 2IYTA 1VIAA 1J2JA 1D2EA 1E2KA 3EZ2A 4GRAA 3SI7A 2V7QA 3QXHA 4LHZA 4LYAA 3T61A 1E9EA 3EZFA 3SDZA 2CNWA 2XSZA 4ZCLA 2ZUDA 4QG7A 1I4LD 4M9QA 4I1OA 2BIFA 1QVAA 5FUYA 1TQ6A 1N0VC 2WJGA 3AF1A 3G5UA 4OI2A 3TSOA 2FA9A 3EIHA 3KTAA 1RRCA 3LNCA 1JXMA 2Q0HA 2VSOA 4DCUA 1CJMA 3RSLA 3GEEA 3OEEA 4KBFA 1OJLA 1OYYA 3A1VA 2GXUA 1WDTA 2RHDA 3PUXA 3N2EA 4PPQA 2OCYC 4DIDA 1K8RA 3GJXC 5CJ2A 2LKDA 821PA 1UKEA 1XJQA 3C15C 3K0AA 1W36C 1KKLA 4C0BA 1XEWX 4M1MA 2V7QD 1GRNA 3FB4A 2QP3A 2CNWD 4MGIR 1N0WA 2XSZD 1J99A 3B6EA 2PMDA 3NIBA 1NVVQ 2OAQ1 3BBPA 3GLIB 4CF7A 4MYUA 4EFMA 2F7SA 1RPZA 4DLVA 3UXMA 2O8FB 2ZS9A 1E2FA 1DADA 3EA0A 4PFSA 5LPNA 4KFRA 4IOLA 3BC1A 1GNRA 3ICEA 1SXJC 3RSOA 3AUXA 3L0OA 1QG2A 3UG6A 3B7GA 4PSKA 3RS7A 3OEED 4OQXA 2GCNA 1KI7A 2VP5A 1KI1A 4PX9A 4TLEA 4UKDA 2XOKA 1FPMA 2G1JA 2MSEB 2OXCA 4ZKDA 4TLCA 2N1BA 3MUFA 2ZI6A 3ZS9A 2C8VA 3BS4A 3WBJA 1MKYA 4EPVA 4B3FX 3GFPA 3PUWA 3VX3A 5KSZA 3TAUA 1G5PA 2QRZA 4DLZA 3RVBA 3ZH9B 3LA6A 1IM2A 2RB4A 3D31A 3NWJA 5FPKA 1G3QA 3OAAA 3I8XA 1RKBA 4M1WA 5JBQA 1DBSA 1TU4A 5AK0A 2FGJA 4N3NA 4KO8A 1MOZA 1CIPA 3BXZA 3SN6A 1ZM2A 4DLTA 3U4QB 4IDQA 2JLYA 1XTKA 1EFTA 3FGNA 4NHOA 2XOKD 3DEFA 2Z83A 4D0LB 4NMMA 5CLQA 1D9XA 2WM9B 2ZTSA 2D2FA 4BFUA 2FMXA 3KTAB 1Z0IA 4C0SA 1L4UA 1HV8A 2VP0A 1E0AA 1NVVR 2WMNB 1RRGA 5DHAA 2BJVA 5CB8A 3KFVA 4PO1A 1P9NA 4B44A 4BWYA 3ZD7A 2BHRA 4HLUA 1QHXA 1E2QA 4RD1A 3BFKA 3OAAD 2Q9BA 2ODBA 2ZAMA 3K0EA 3K0AB 3KXIA 3C4JA 1CXZA 4Q02A 1E2NA 1DAEA 2RGXA 5KDLA 3KUDA 1Z6XA 2XZLA 1JQLB 1YKSA 4PC3A 3VKHA 2IYQA 1IN4A 2ZR0A 1T8TA 1CEEA 2O0JA 2ZU0C 1Z63A 1ZUNB 4I4LA 1U2RA 4EQ6A 1XB2A 3SYKA 1E9CA 4BE7B 2RGBA 3GD7A 4PR0A 5E7MA 1M7GA 3U7EB 5KOYA 2QMOA 2ORVA 1TEVA 2WV9A 2ERYA 3GLFA 2YOGA 3CIOA 3A6PC 3I5XA 4JJKA 2WWGA 1G64A 5DISB 2QTVB 1II8B 1SULA 4WZBE 1IN7A 4MITA 1CJTC 2FPMA 3QXCA 3SC3A 4HAUA 3MMPA 5L3QA 1G19A 1OB5A 1IAQA 3RC3A 3NBFA 1G1MA 2K5UA 2RGNA 2Z4SA 3GLHB 1KNQA 5EE5B 1YZTA 1KY2A 2PEYA 2IUSA 2AX4A 4V03A 4JKYA 4FMBB 4ZCMA 2GXQA 2OEPA 1G5RA 1KDTA 1YR8A 2MSCB 3RABA 3QPVA 5K8LA 3F8TA 4LV5B 1FQJA 1YVDA 3RANA 2QGZA 4MKGA 5F2EA 3VHLB 3K0FB 2OLKA 1OF1A 3A1SA 2HUPA 2JJ8A 1DOAA 2AXNA 1G4UR 3MD0A 3LWNA 2PLRA 1QZXA 1Z2AA 1QDEA 1WBDA 2JJ1A 2JLQA 4Q9KA 2F1IA 3TMKA 2TMKA 1ZVQA 1ZU5A 1FP7A 5AJWA 2REOA 3A4NA 4LK2A 2O0HA 5AUPB 1NN1A 5E4FA 3VR5A 4G5GA 2JCSA 3U6BA 1RZ3A 1J70A 2CEAA 4RD6A 5GVSA 3BH6A 1N6KA 1DAMA 1FFHA 3CR7A 2B7CA 3Q3JB 5EP3A 5KSOA 1GITA 3I8SA 1AQYA 2C99A 4Q00A 4TYQA 4HZIA 4PSAA 5EUQB 2IWHA 2PJZA 5G3YA 1TTTA 5AJXA 4LPKA 1D2NA 2FEMA 4KFSA 5AJZA 4AI6A 1N5IA 2AKAB 1GKIA 1H8EA 1S1CA 3GFOA 4DIEA 3EPLA 2BMFA 3FTQA 4GOXA 4BLTA 4V0LA 1IQPA 2ZSEA 2JJ1D 4Q9IA 1E0KA 4MRNA 4PZLA 4EQ6B 4L5BA 1TUEA 3X1ZA 1G8FA 1EESA 2YYZA 1AGPA 5J5CA 1PLKA 1G7TA 2ZRJA 2ZITA 1GL9B 2IYZA 4IKEA 4HUTA 4C2UA 3LW7A 2AXPA 3Q9LA 1DG1G 1JEEA 2PH1A 2D7DA 1F48A 4OYHA 3LVQE 4D80A 4Q48A 3V00A 5H70A 2ZRAA 5FUXA 1H8ED 1J8MF 2ASEA 2WVJA 4B3XA 4TLAA 3NEYA 2D4HA 3KB2A 4DEYA 4MH0R 3U44B 4IFBA 4L16A 1KI6A 3THYA 2OILA 1P72A 4Q4AA 2H57A 3FDIA 2ZYWX 1M7HA 1TF2A 4XSHA 2REXB 3THOA 3K70C 4XVQA 3VMFA 1EFCA 1NVUQ 4QHSA 4AURA 4LJ8A 3ADKA 2JLZA 4TTQA 1H8HA 1IJEA 2IYSA 4WXRA 3R7WA 2CE7A 1W1WA 3SR0A 2FSGA 3UKDA 2Z43A 4B76A 2GEDA 2ZUBA 2R6CA 4DHEA 2BV3A 2IEZA 4KLZA 2EFGA 4RY2A 1S0UA 1G8HA 2GAOA 4PPNA 1V43A 3MJHA 1QHIA 3JVVA 1JQJC 5JEDA 1VYUA 1QHHB 1U8ZA 4FCTA 3QVVA 5FOTA 1FUUA 3ASZA 1P60A 5EP2A 2WJVA 2QBYA 4Q7JB 5DSZA 1XCGB 5CK4A 4ARZA 1VDZA 5JCPA 1JJ7A 1H8HD 4IEIA 4TLBA 3SYLA 2QG6A 4E22A 1E32A 1OFTA 4QL3A 3IKJA 1JAIA 3PUVA 3QOFA 4DRZA 1GSIA 4NCJA 1NVWQ 4POAA 1E9FA 3AKEA 2IYUA 5DLQC 4B34A 5FPTA 5AUNB 4CDGA 2EFCB 3FKQA 1T3SA 4PZZA 1M8PA 4BZXA 4QRHA 1P75A 2PL3A 5SZJA 1OB2A 4BASA 4OQMA 4URXR 3ZVMA 1P2UA 1BYUA 3I62A 3PITA 2GEVA 5TY0A 2A5JA 3VHXA 4DSNA 2WWHA 5ELXA 4V0KA 4TLDA 1OSNA 3KUCA 2ZRBA 3AP1A 1KAGA 4LCBA 1ZJ6A 2XGJA 4HDCA 4I1UA 3B1VA 4PHTA 1GFIA 2PZEA 4W5WA 5FL3A 3FHCB 4A0GA 1D2MA 1KDOA 1TMKA 3VNUA 1OLOA 1NL3A 1NP6A 1M2OB 4ZDJA 1AM4D 5DH9A 2P67A 3NC0C 4LJ9A 3R9XA 5F9HA 2IXGA 5E7JA 2GESA 5AUQA 1D6JA 1X1RA 4B47A 1KI8A 1E1RA 4GDFA 2QTHA 1ONBA 3FFBA 4GZLA 3HU3A 4KYUA 2ZSDA 4Q1DA 5FTNA 1DS6A 3FFAA 2B7BA 2FU5C 2ODWA 3L8YA 4WXPA 1O87A 1U81A 2F1RA 3OIUA 2C9YA 4B3DA 3D8BA 2FFAA 4M21A 4TWZA 4CT4B 4CEJA 1Z3IX 1KSHA 3LO5A 4EDHA 1Z0AA 4OK3A 3MWYW 4Q7MB 3L8ZA 4FINA 2FWRA 3KQUA 2V55B 3WP0A 4W9MC 4BFZA 3OZXA 2NOAA 4L8GA 4RZXA 5JZVA 4ZV4A 1A5TA 1E9RA 3ONWA 2QBYB 2JLWA 1BOFA 4OJQA 4DLUA 1CR4A 2VYFA 1VKJA 1A82A 4C0KA 3T1OA 1E1RD 4P4SA 3SHWA 1FZQA 1BO6A 1KK1A 4P3YA 4WBSA 5EXSA 1SVKA 2F43A 4CEHB 2P3SA 1G17A 4D4MA 2YV5A 4LHWA 4MRRA 4PO8A 2ZUCA 4QNMA 4TL6A 2F3TA 3LX5A 3WHKA 2PLFA 5DI3B 4ACBA 1KZGB 1XP8A 2ZPTX 4WVFA 5FUVA 4DLYA 4KCGA 2O8CA 5FTMA 1TPZA 4ZIRA 5HZHA 3NXSA 2OE2A 4KU4A 1P2TA 3K53A 1I2DA 3LBIA 3AVYA 2CLCX 5FL7A 4C0AC 4OQNA 4NONA 3CH5A 1E2DA 1UJ2A 2VHJA 3SJAA 2P6UA 3UWKA 1UEIA 3Q7PA 2VHCA 3A4LA 4JLMA 1MRNA 2GF0A 3U3OA 3FKSA 4AG5A 2XTMA 2O5VA 1MO5A 3GEHA 2P2LA 2NO9A 3QEJA 2QU8A 3NKVA 4NYIQ 3O8BA 4OHVA 1U99A 2IUUA 5KTYA 4DVGA 1C4OA 2IW3A 4A9AA 1XMVA 1XPOA 4YC7A 1Q44A 1W47A 2FPLA 1XTSA 2JJ2A 1KJWA 2DFLA 4AG6A 1N5JA 1HURA 4PQRA 1NVXQ 4BLQA 5L8VA 1Z28A 2CHVA 2C78A 2QPAA 3LLMA 2OG2A 3MGCA 5FL7D 2GZDA 5DN6A 2DCUA 3GJ4A 3BJIC 4HATA 3RS4A 1OXTA 2JATA 2B6HA 4PC6A 4QBIA 5G53C 2ZI9A 4GOJA 3K09C 3GJ0A 3FKSD 1XD2A 5CB6A 2D74A 3I92A 2BVNA 2F9LA 5FR1A 4O2RA 3ICQB 1X1SA 5JS8A 4A82A 4FI3C 3OESA 4TL8A 4BUJA 1IXZA 4LZZA 4US1R 3O8DA 3FWYA 5SZHB 1XD8A 1UFQA 3QXSA 1ZD1A 5FTJA 1OT3A 1UPTA 2OAP1 1YZNA 4Z1MA 4C0JA 3HU2A 1NLFA 4GFDA 2W6JA 2A9KA 4ABYA 1N3BA 3DOFA 3X1DA 3FMOB 4LWZA 2JJ2D 3FYHA 4LYJA 1OHHA 2IX3A 1L4YA 1MV5A 3GLGA 3KQKA 1IY1A 1T0JB 2VF8A 2WBLC 3ND9A 4AKIA 1AJEA 1OFHA 1YQTA 3C7KA 1C9KA 4Q9HA 3RWOA 1LF5A 2MMCA 3EIEA 1NLYA 2F43B 5DN6D 2XEXA 4ESVA 3NDBB 4DKXA 2J0QA 3IBYA 2V4ZA 1NSTA 4B3BA 1LS6A 3CPHA 1F2UA 1Q1ZA 3FMIA 5IRCD 4JL8A 4LGMA 4HDQB 2FFQA 1ZUIA 4OI4A 4XOIA 2QZ4A 2HF8A 1P2SA 4CYMA 4NCHA 4IDOA 4NYIR 4MRSA 4Z1MD 2W6JD 3D3QA 4HAYA 4NL4H 3CRQA 5L3SB 1KO5A 1DO0A 4R2IA 1OHHD 5KHOC 4A15A 3TUJC 1E69A 1NY5A 1XMJA 3CRRA 4DT1A 3ADDA 4KV9A 3HWSA 1TF7A 4GL2A 1KK3A 2ZJOA 3ZQ6A 3KB1A 5CIWA 4DLRA 2AL7A 2GWHA 4Q1FA 1KO7A 2GEUA 4DB2A 3SFVA 4F92B 2AK2A 4GMXA 2CLSA 5HPYB 3AF0A 3AKDA 1NKTA 3I32A 5FPHA 4FMDF 5TB5A 1P5ZB 2RH5A 3K9GA 4JBYA 5G40A 2CK3A 1PJRA 4KSCA 5H8WA 1JAHA 4EFNA 4H1UA 1PUJA 3DO6A 3FHTA 4M1TA 3I1FA 5CYOA 3AEZA 4HAZA 3AVWA 5GJWC 2O8BB 2PX0A 4AYTA 1XD2B 3AH8A 1XEXA 1E79A 2IEYA 1QHGA 4KAXA 1ZW6A 1VG0B 4DXAA 1YZLA 3GEIA 2OCAA 2QN6A 2DFTA 2KI5A 2Y8EA 1N6IA 3KXKA 3LXXA 1LFDB 5M04A 1WB9A 4QM7A 2WOOA 2D3WA 2CK3D 2XJ9A 1EGAA 4RKFA 1X3SA 4ZI2A 3X1XA 1P3JA 1NIPA 1R4AA 1W4CA 4A8JB 4C9BA 4JYCA 3V4FA 4L9WA 2VSFA 4F7WA 2QA5A 4A2PA 1HY3A 2CLDX 3QKSB 4B35A 4AKHA 3CNLA 4PAQA 2J1LA 2NO7A 3ZJYA 2NZJA 1XTIA 4P32A 1VCMA 1Z2CA 1F2UB 4TMKA 1X6VA 4V0NA 5TVKA 2OXRA 4AK9A 4QM6A 1E79D 3GJ8A 1KKMA 2YVUA 2ZEJA 2FN4A 1JNYA 1Z47A 2UZIR 5KSPA 3BD9A 3CONA 4GZMA 1SVMA 3I3SR 3B60A 2SHKA 1TQ2A 1WMSA 4FWIB 4S35A 5CLLA 3KJHA 5JMTA 2GDJA 1E2EA 3EPHA 1E9DA 5FUWA 3UMRA 5CK5A 1HUQA 4FMCB 1DAKA 2ZI3A 1R8SA 3TKLA 3X1WA 3Q5EA 1N6HA 2CL6X 2A7QA 1SKYE 4TMXA 1Z22A 3VR6A 1QHYA 4K8OA 4NZYA 4LY6A 3E2IA 4JVMA 4Y0VA 1E2HA 1Q20A 3LDAA 1LTQA 2J3EA 3PEYA 2GILA 3S1AA 2ZJYA 1FX0B 5A0FA 5B30A 1G7RA 1G7CA 3AVPA 2NTYC 1HQYE 2F6RA 1UBFA 1F6BA 3VTKA 5TXGA 1A2KC 2GETA 1U9IC 2EFDB 5AUOB 4D2IA 1UBGA 4OK5A 4W7SA 2WWYA 1ZC4A 3LBNA 5B64A 4C4PA 1D8TA 2HT6A 5TV2A 5EP1A 4XSGA 1DAIA 1WQ1R 2QMUA 5FTKA 5D3MA 4KFTA 2QAGA 4B48A 2OBNA 3FOZA 1E2GA 3L0IB 4D82A 4G1UC 3SFZA 1SXJA 1NRJB 2ZJZA 3BORA 1FTSA 2WIAA 3KJGA 3QF7A 3TVDA 1ZNWA 3LFUA 3IHLA 4HEJA 2QT0A 3RRMA 4LC0A 4C0QC 1IY2A 5KPJA 1ZD8A 3NG1A 2E87A 3BB4A 5GVRA 1COWD 1Q21A 4A0HA 1W36D 4EAQA 3EA5A 2I1QA 2GZAA 2XTNA 4LPSA 2FE4A 4M0LA 3AGQA 5EJEA 3MRSA 1VTKA 3QPUA 4HB0A 4LC1A 5IHPA 2IUTA 5KPDA 1II9A 2FSHA 2ZQ5A 3B2EA 3VR2A 2GXAA 3PIRA 3MAAC 2O8DB 1YE8A 3C41J 3UG7A 2PMKA 1SXJD 5DHFA 3SJBA 3R9WA 3THWA 4DLXA 4JBXA 1GRQA 1SHKA 4Q03A 4YMVA 3P4YA 3P27A 2IYVA 2XX3A 4CEIB 2FV8A 3C5CA 1AZTA 3QEOA 2WWXA 1AA9A 2ATVA 3GLFE 4QHTA 4BRUA 4G01B 1P9RA 1MR3F 3LQQA 3Q5DA 221PA 3IPXA 3IEUA 4JLAA 4D25A 1UBCA 3ZZTA 5G41A 5CDFE 4W5JA 4N1AA 4QNRA 5AJVB 4GNKA 3EWSA 2D7CA 4II7A 1KK0A 3M6AA 1F3OA 5CM8B 1A4RA 3K1JA 2EW1A 2YOHA 3A1UA 2CCJA 1YZQA 1X8LA 2PBRA 1F5NA 2ZJ5A 3AP3A 4LYFA 1FNNA 4BLPA 1VIYA 2EVWX 2ZANA 5BQ5A 3RRYA 4JLBA 3AVXA 3FPAA 4O2LA 3C14C 4B2PA 2ONJA 2QAGB 4QKQA 1CR2A 1KIMA 1Z0KA 4F91B 3SBDA 3CUEF 4S2EA 1TU3A 5CJPA 5C2JB 2V6IA 5F9FA 3KQHA 2OFOA 5EE1A 4WZ6A 1LS1A 3W5IA 2EQBA 4G5OA 1YHNA 4P33A 3TJZA 4A2QA 1N6NA 2R62A 1E0JA 3PEWA 2AN9A 4LJAA 2OBMA 2YZ2A 2JIZA 1KJZA 3IO5A 2BM1A 2YJTD 4PHFA 5EXXA 1WBBA 4DUGA 1KYIA 3PR1A 1HEIA 3DZ8A 4YXWA 5J47A 4B33A 4AC9A 1IN5A 3ND8A 3W6OA 3EZ7A 1S3SA 3TIFA 4B2IA 4EFLA 3LLUA 3F0TA 2CCKA 2Z5FA 2ZRKA 1XMIA 3IDQA 3L2OB 5J4KA 4HLCA 1KK2A 1SKYB 1OV4A 1J7KA 2C98A 1ZCBA 2H92A 2AR7A 4BFXA 2MMGA 1UM8A 4DB4A 1Z83A 4MKIA 4N0DA 3GJ5A 1GTVA 2ZJAA 4OQFA 2Z6VA 4MDFA 3SQXA 1N25A 4URVR 4LYHA 3EPJA 1W0JA 3HR7A 5CDFA 4Q4LA 2JIZD 4J0QA 3HJNA 4C7OA 5FI1B 1VG1A 2WAYA 4LRWA 1MABA 1P62B 2CHQA 2OFXA 2IYXA 2GBLC 2XJ4A 5AJYA 4YXWD 1ODFA 3X1YA 2J59A 1E9BA 5J4YA 4KVGA 4LJ4A 2IS4A 1NBMA 2XITA 2PZGA 1PLJA 4KVAA 3EASA 4FW9A 4UNPA 2R9VA 1S9DA 5UKDA 1OYWA 5ANRB 1RYFA 3M0EA 3UPUA 4XVUA 2WSMA 2WZQA 4V0OA 1J90A 3BH7A 5JSZA 3A36A 1T0HB 3QPWA 3DVLA 4M1KA 2OSBA 3REGA 1Z5ZA 1KY3A 1NJFA 1ZM7A 1TQ4A 3A58B 2QI9C 1W0JD 3RS3A 1T3HA 3H1TA 4CW7A 5JHHB 2WTUA 4E07A 1RYHA 4EJSA 1L2TA 2OZEA 3JZMA 2AFIE 3T35A 4B3CA 3KZ1E 2J41A 2P6RA 1PLLA 4P4TA 1E4VA 2EYQA 4IHQA 3PVSA 1OIVA 1NBMD 3CRVA 2ZYVX 1NLZA 1VECA 3I4LA 4DWJA 4IJMA 2RAPA 5JJIA 2ZYTX 1XMSA 4RZUA 1XRJA 5F98A 4OHWA 3ZDQA 3AUYA 2VA8A 4FD2A 2ZROA 3FMPB 1E4YA 1Y63A 1NN3A 2AWOA 2HJVA 3THXA 2J0UA 1SQ5A 1BMFA 2XB2A 3DZDA 1R7RA 4IDPA 4LHYA 3AV0B 1A7JA 3ZLJA 4A1FA 2ZE7A 3IBGA 2R2AA 4ZKEA 2C5LA 1ZBDA 1DAHA 3QG1A 2F55A 3GLFB 2V1XA 4DDVA 4N0EA 2ZE6A 2H17A 3PXGA 3DM5A 1GILA 3QNUA 4M9ZA 4YLGA 2RCNA 1G6HA 2VLIA 1O3YA 1NIJA 2XZPA 3GFTA 4XIGS 2CJWA 1LF0A 4IFEA 5L3QB 3B1YA 1CJVC 1MABB 4QFMA 2ZRLA 1E94E 1BMFD 2CCGA 1BS1A 3RAPR 2BBSA 5JI2E 4LBZA 3EPKA 3LRPA 2W2TA 2FZ4A 2BCJQ 1CRPA 1ZUHA 3I61A 2X77A 4TTRA 5DI9A 3K70D 2IS6A 2BBOA 2AD5A 5B57C 3CW2A 2BWJA 2KE5A 1E6CA 2FOLA 1U90A 4TQAA 3BFXA 1N6LA 4A6XA 1IY0A 4E03A 2WSSA 2QT1A 3K8YA 2V8OA 4IXMA 4GBMA 4EJSB 1G3IA 3G0HA 1ZM4A 3ASYA 3REFA 2DFNA 1IJFA 1FTNA 2D06A 4BEBA 4Q19A 4XWAA 5JRZA 2J9RA 2HJGA 1UKYA 2GCOA 4W5HA 1UKVY 2G77B 4TMZA 1G18A 1KDPA 1P6XA 2QMHA 5HKKA 3B1XA 4XTRA 3I72A 4JYBA 4B6FA 5E95A 2VBCA 4EPXA 5EXPA 4DCSA 2J0UB 4NBSA 1CLUA 2QE7A 1EWQA 2V9PA 2WSSD 1Z07A 3LH5A 5LD2C 1P7CA 2OCBA 3UATA 1I2MA 1UEJA 5KU1A 5GJVC 4YDHB 2NPIA 2CDNA 2IK8A 4OL0A 4KXFB 3MWJA 3IEVA 2ZRFA 5JJKA 1Q0UA 2GNOA 3HPQA 1ZC3A 2J46A 3WRXC 5HKKD 4QHYA 1RVDA 5K8UA 2G1KA 4LSGA 1IN8A 3AB3A 3TLXA 3P4XA 5EE3A 4NCIA 3BAFA 1NMYA 4RZ2A 1XEFA 1HE1C 1VHTA 3PEUA 1OIWA 3RC8A 5HE9A 3HPRA 5FPSA 2ZVPX 4NTZA 1R0WA 2QE7D 1KI6B 3THYB 4AIIA 4F38A 2ANCA 2YWFA 3IQXA 1Z29A 4URWR 2EFHB 4Q4AB 2AKYA 2G3YA 3O8RA 4G3XA 4LHXA 3QJYA 4NYJQ 2W0SA 4OKSA 1AS2A 4QJ4A 4NH0A 4M2LA 1EFRA 4QGHA 2CBZA 3CX7A 2GA8A 2Q21A 4PXAA 3R7WB 5L3RA 3EC2A 4NCKA 1OH6A 4CT5A 1KO1A 1A2BA 1W5TA 3CWQA 3NHBA 4I1SA 4QJ5A 2A5GA 2IWRA 1JI0A 3LD9A 4BQSA 1X8KA 5KNCA 3IGFA 1TX4B 2FJUA 3TAHA 2FFHA 4NPHA 2BM0A 2QQEA 4M8NE 2BC9A 1Q1EA 3CO5A 3RS2A 3TUZC 1R5OA 3VKGA 1W46A 1AK2A 3Q8XB 1U0HC 1Z0DA 1E96A 5KO2A 2GK7A 2GCOB 3LVRE 3SZRA 4P0TA 1YR6A 3MJRA 4M9SA 5JWRA 2VRWA 1JECA 2WWWA 5JEEA 621PA 1EFRD 5IDVA 3ZS8A 5P21A 1HT2E 1YR9A 2GJ9A 1QF9A 1TADA 2R6DA 4ARZB 1A1VA 2P6NA 4D4LA 2OFWA 4QGGA 4GMDA 5FOUA 4TZ6A 4MQBA 3IQWA 3GLGE 3PUYA 4JS0A 3PJRA 4I1VA 2LCFA 1ANKA 5C4GB 1N6RA 2ZSFA 2RGAA 2QNRA 2YC4C 4XD7A 4MUAA 1ZIPA 1RRPA 3IIJA 1KNXA 4IVPA 3G82C 2VL7A 2IHYA 4JL5A 3W3AA 2GF9A 3M1IA 4TMVA 5TDHA 2GJ8A 1B23P 3QKRA 4F4IA 4JVNA 1VHLA 2UKDA 3L0SA 3P32A 4DLSA 3U3JA 4NYJR 4KBGA 1EXMA 4BLRA 5AWFC 1KO4A 2HXSA 5JECA 2WJHA 2G9NA 4MKFA 1IHUA 4RSGA 2DYKA 2HYIC 3U3RA 4XVRA 5LB4A 4B75A 2QQ0A 2EWWA 1V5WA 4HB4A 3NVAA 1S1MA 4NU0A 2XNDA 5FR2A 4LX0A 4JVSB 2ZJ2A 1KSJA 2VP2A 4XD7D 3T5GA 5D3QA 4BRWA 3Q85A 2OBLA 5FPYA 3W8NA 2GZHA 3R8CA 1MH1A 1DAFA 3CX6A 4A4DA 2EWVA 2A3RA 1JALA 3BWDD 2JLRA 3AVOA 2J5XA 3NEJA 2BMEA 1CP2A 3DOEA 2HXYA 3P26A 3SHFA 5EQTA 4ZCIA 3CLVA 2DB3A 3EG5A 1YJ5A 5FOSA 1W4AA 4XWKA 2ZS7A 1QBKC 4CEJB 4Q1BA 5EZ6B 1WXQA 4HSEA 1NJGA 2IBMA 3EWAA 2XNDD 2RGCA 4KFUA 4GP7A 1XXHA 4F4JA 2ZVQX 3QKUA 2ZRDA 3W5JA 4LI0A 5K8TA 1E2IA 3AKYA 3QUSA 3IPYA 4PZYA 2ECKA 2IXFA 3ZVLA 2QL6A 1Z6GA 2ZI5A 2IYYA 3AKCA 3J81k 4P4SB 3U7FB 4PAOA 3QKTA 1ZNXA 1NKSA 3KJEA 1SVSA 4OHZA 1IXSB 1EX7A 5E7IA 4ACAA 2XZOA 2IT1A 4NKRA 1XZPA 4CVNA 2FPKA 1X86B 3ZIAA 1R2QA 3W34A 2YNMA 3CX8A 4TL7A 3MWKA 2O8CB 5HZKA 2VF7A 2ZSAA 1GP2A 3QKRB 3HYTA 4ZIRB 5IT5A 1LB1B 2IL1A 4ILEA 3DKVA 3IO3A 2Q3FA 4WOPA 1JJVA 1Q57A 4DSOA 3KKMA 1NNEA 4JL6A 1KGDA 2BJWA 5LDDC 1DEKA 4ON9A 2W00A 1BYIA 3D6TB 4HB3A 2A78A 2BEJA 4RVCA 4RCZA 4JLKA 2ZRCA 4LV8B 5KNBA 5FOWA 2Z0MA 4QXAA 1JXOA 5CYPA 3T15A 2ZRMA 1S2MA 1Z6AA 2YHSA 3RYTC 4D26A 4TMWA 3MCAA 4G5SA 3ZIAD 1X8JA 2KWIA 4JT2A 2Z4RA 2NG1A 5FFMA 1OKKA 4PANA 5A4JA 2KJQA 2YWEA 1P4SA 3GJ3A 4HI0E 1VCOA 2VHTA 1YU9A 1R5NA 3KX2A 1M7BA 4X8MA 2G6BA 2C96A 1R8QA 1GRRA 2ZXUA 1G41A 4ASUA 4A8JC 1XDBA 1R0XA 2O8EA 1JR3E 1Z6YA 3DHWC 4RD0A 2D2EA 4UNNA 2FFBA 3PENA 1T4GA 3NHAA 3TE6A 4ZDKA 4MGZR 2JLVA 1S3GA 1EX6A 4Q4JA 3X2SA 4KSBA 2ZE8A 3K0SA 2J0VA 1WP9A 4FMDB 3RLFA 4MYTA 4D0GA 4TN1A 3SBEA 1G6OA 4LBYA 4OQLA 4DCTA 2VPPA 2A30A 4X8HA 3EW9A 4OHXA 2UZ3A 1Q1BA 2DWOA 1OFIA 2DWQA 3QBVA 4FIDA 1R10A 3GLGB 1OKKD 2NIPA 1OXUA 1S4QA 3PG5A 2A5YB 2ZRPA 2F1HA 4ZPXA 5HR5A 1ZYUA 3TVTA 4MRPA 1ZIOA 3VFDA 5C18A 5L3VA 1SXJE 4ASUD 1E0SA 2V3CC 2J87A 3GCGA 2VO1A 2E1RA 1IBRA 3AQ4A 1JR6A 4KJZA 1RC8A 3E5HA 1G291 4NCNA 2R6FA 3AGPA 1CULC 1Z06A 4DSTA 5BW8A 2R65A 3GJ6A 2QY9A 2VP6A 1J8YF 2QM7A 3M4YA 2JDIA 3NBZC 4JKIA 2X19A 1QRAA 3WYAA 1RFLA 1G7SA 4UNSA 2ZRIA 421PA 2OHFA 1ESMA 1SGWA 4H1VA 3CM0A 1CTQA 3EAQA 3SQWA 2B8TA 3UANA 4G5QA 3RNLA 4RFSA 5H68A 1G20E 1N6PA 1VG9B 3DMNA 2H1LA 4DT1B 2DHRA 3ZYCA 2W83A 1UDXA 2FGKA 4AY2A 4A0RA 1HQCA 4JSYA 4B43A 3ZZ0A 3B82A 1GDDA 3TW8B 2QROA 3ZVNA 2CVFA 3CR8A 3E1SA 4K46A 1WE2A 4BLOA 1G3UA 3K0CC 2HLDA 3OEHA 4TTPA 1LNZA 2AWNA 3OE7A 4M1YA 1EFHA 3ZVRA 4YMSA 2QUZA 3EXAA 2MSDB 1AGRA 4A0FA 4QOSA 1G8YA 3GLIA 4UXJA 1TNDA 1TUIA 2JDID 4UXIA 3NC1C 2O8FA 1T6NA 1N6OA 2W58A 3TRFA 1NN5A 3QG5A 5HE8A 4FCWA 4JLPA 1CJKC 1JR3A 1TF5A 2C2HA 4R9UC 4D81A 3BGWA 2IYRA 2WJJA 3EIQA 5LB2A 2O8EB 4C0LA 1GNPA 121PA 4Q47A 4IOKA 1AKYA 4LOAA 1XEXB 1KI9A 4Q4JB 4ZDWA 4TT3A 5BN4A 4BPBA 1OPXA 2G0NA 4IVQA 1OXSC 3B78A 4IOMA 5H1YA 2HLDD 3OEHD 3OE7D 4UQOA 3NBYC 3NBXX 4L9SA 3GPLA 3NH9A 4RD2A 4JBWA 3H86A 4LV6A 2VIIA 4URYR 3OIWA 1XD9A 2ZREA 3LAWA 3TQCA 2WWIA 1OH5A 2LWIA 4KITB 1OH7A 1CF4A 4BZPA 5EP4A 2ZR7A 3NDPA 1SVOA 3QVUA 1JR3D 1Q22A 2VHQA 4PPGA 2JLXA 1U0LA 4UJ5A 3GMTA 4TYNA 4ESHA 2V6JA 4EIWA 3NTUA 1M6NA 1N0UA 4LUCA 3EX7C 1F60A 2ZU6A 3W3ZB 2W0MA 2FEOA 3QBTA 1VYTA 3TQFA 5J4HA 2OM2A 3U4QA 4Q1EA 4TT3D 4EUNA 1W2HA 2GCPA 1T3LA 1KO8A 1GOTA 2GRJA 1CS4C 2WKPA 1E98A 4RJLA 5SZIA 3WY9A 3P20A 4B2LA 2AD1A 1R0YA 1GNQA 1DG3A 4MRVA 4AKGA 2IHBA 1KOFA 4M9XA 4BFSA 1XJ0A 4UJ3A 5KUTA 4MKHA 1W5SA 2KB0A 1SVLA 4RFSB 3U3MA 1JBKA 3VR4A 4A6PA 2VP9A 1II0A 2H5EA 4HUQA 4RD3A 1KSGA 1XPUA 4A2WA 1CR0A 3BFVA 1US8A 4IRUB 5FOXA 4TYYA 1ZP6A 2ORIA 3WMGA 1N5KA 4X8LA 4YDSA 2XTZA 2NPFA 2N46A 3OFNA 6Q21A 1W0KA 1AIPA 4TL9A 2F9MA 1E2JA 4Q66C 5CITA 2PJRA 2ODEA 4QC2A 1NF3A 2ZRGA 2AK3A 2BEKA 2HF9A 4Y0AA 1UADA 1W4BA 3BB1A 1HH4A 5BYKA 4CIDA 3IIMA 4IDHA 4Q1CA 5EE0A 521PA 2QAGC 3S1AB 4ZI3A 2DFKB 5EUMA 5JFGA 4TYPA 2PT5A 1QG4A 1ZNZA 4BFWA 3V4RA 4ZDIA 2ZI7A 4PC2A 1TL7C 2FH5B 3CPEA 1II8A 1NBME 4FN5A 2WKRA 2WOJA 5EXTA 1W36B 5EE9A 3B9QA 3CNOA 3MG9A 3MWLA 3OFND 1KMQA 1W0KD 4MYCA 4B71A 3AF4A 2RHMA 4JT4A 3KFXA 2OCPA 3N70A 4IXNA 2RGDA 4M1SA 4US0R 4ZO4A 5D3MB 3GLHA 3KKOA 1DPFA 3UMFA 4GOKA 4M53A 4PQYA 1E9AA 2HV8A 2NMVA 1SXJB 4BECA 1GL6A 4D0NA 1ZD9A 1ZM9A 3WMFA 2R44A 3TSWA 2W2VA 5SZKB 1LY1A 3CBQA 4O0MA 4DEXA 3K0FA 2QPOA 2P65A 2C95A 2JEOA 3CH4B 1NMXA 3DPUA 4TQUS 2QENA 1E2MA 2EYUA 3SYNA 2FSFA 4U02A 2WPDA 2JA1A 1GWNA 3I73A 1G16A 4FCVA 5JLJA 2JGNA 3QY0A 5KDOA 5IK2A 3WBKA 1K5GA 4PHHA 4A92A 1PZNA 2XAUA 1Q12A 4HLQB 1MO3A 1GVNB 2GBLA 1U98A 1G8GA 3GJ7A 4L4UA 4KLNA 4PC1A 2VHUA 3K9NA 2W6IA 2WHXA 2NQ2C 3AF3A 4HUQB 1DARA 2GVDC 3WYGA 2OUKA 4Q01A 5FBVB 1US8B 1XEWY 1TEXA 3ADBA 3THWB 2DBYA 1HYQA 2C77A 3HYRA 3W6NA 4RD4A 1I4TD 2YC2C 5DNYB 3B85A 4JLJA 2L0XA 3ECCA 3A1TA 3K9LA 3VU9A 1RW4A 1VCIA 1UF9A 1VMAA 2UVQA 2PZFA 2WPDD 3K9HA 1XJCA 5J4VA 4AYXA 1GL7A 2BMJA 2YWGA 5CIQA 4UXHA 4DUGD 5IK2D 4TZ0A 4R2HA 1W44A 3KXLA 4P31A 5G3ZA 5B2ZA 2ZS8A 2B8WA 2GK6A 2HDNB 4EPRA 4NP6A 1NSFA 2VH5R 3CF2A 5FBLB 2H18A 2W6ID 1Z08A 3R9IA 3VX4A 4HLUC 1KTVA 2ZRNA 3UMSA 3CZQA 2Q9AA 4DDTA 3AVQA 4LBVA 3T34A 5DO9A 3U3KA 2X2EA 2NO1A 1HTWA 1CRQA 4K81B 1Y3AA 4KYIB 3T1QA 2C03A 1XF9A 1Z6TA 4YMTA 1E2PA 4DBLC 1XCMA 2BDTA 3T1TA 3KDSE 1ZM3A 1JEDA 2A5DA 3W6PA 2C04A 1XU4A 3U44A 3V9PA 1P61B 4C0HA 3I5YA 1VG8A 2QRNA 1KZ7B 2E9SA 2BKUA 3VNVA 5JJLA 3UWOA 4GP6A 2PT7A 2QP9X 5FI0B 3RRZA 3H4MA 3SU8A 3CZPA 2Q3MA 2WWFA 1WRBA 1N5LA 4HLDA 2CXXA 2GHIA 4WW0A 3BOSA 1W49A 5GJBA 1T91A 1KAOA 1KJYA 3QF4A 4E5UA 2BBTA 1FNMA 2ZAOA 3QSYA 2OT3B 3C16C 4DZZA 3ZQJA 3W9YA 4Z51A 2XXAA 4B6EA 1G5TA 4BEJA 4XWOA 3TUIC 2H16A 1RIFA 3SNHA 3EZ9A 1OH8A 5K8IA 4YONB 2RGNC 5KSYA 2JAQA 4O25A 4JVLA 5GJCA 2EFEB 2GKSA 1RRFA 2R6AA 1G4AE 3H2YA 3W90A 1ZCAA 4LJYA 1QHHA 1DVRA 2WAXA 2G83A 2O0KA 2EU8A 5FH9A 4Q9LA 1SZPA 1TAGA 1JPJA 2IA5A 4HDOB 1YRAA 1E3MA 3C8UA 3VU9B 3WNCA 1WA5A 3N5CA 3WNDA 4Q7KA 2A5FA 2GVZC 2G0TA 4IW3B 1WF3A 1XZQA 2ZETA 1IXRC 2I1VB 4B32A 721PA 4C7OB 3TSZA 5GADl 1BH2A 4OHYA 3RHFA 2NO6A 4EJSC 2KBEA 4HAVA 1GZSA 4BFYA 1UKZA 3A8TA 1GKUB 4MUBA 1XTQA 2IS1A 1AQUA 2YWHA 1HE8B 1RJ9A 4P4UA 4FXPA 3DL0A 3RRNA 4I99A 1CKEA 1CJUC 4PAMA 1SKQA 2ATXA 4Q5IA 3TR0A 2NO0A 3TH5A 5JSZB 5JRJA 2YINC 3ZD6A 1EWRA 1XCPA 2YOFA 1FUKA 1W48A 4QBHA 4F93B 3SS8A 3BERA 4PQFA 2Q9CA 4MGKR 1SVWA 1VCNA 2ZR9A 3CKLA 4IDNA 1DELA 1M1YE 4IOJA 4C2TA 5FOVA 1MRSA 3FE2A 4G5RA 4U7DA 1G21E 1LV7A 3F3YA 2C9OA 1ZINA 1OXXK 2ZIAA 3QF4B 1U8YA 2QGNA 2VSXA 1BIFA 3VR1A 5C1BA 2WJYA 4M1OA 4M22A 1XTRA 2XXAB 1LVGA 2DWPA 3THXB 3T12A 1PUIA 1XFAA 3PFIA 3QXJA 3TW4A 3U61B 1FW6A 2N42A 1HT1E 1WCV1 3HU1A 4PTLA 5FBQB 3T1VA 3DKPA 4JMPA 4YMUA 2IF2A 1KDRA 3VAAA 2BBWA 2HCBA 3K70B 1CBUA 2H7VA 3AF2A 1KI2A 2QORA 2VTKA 5EZ5A 3B1WA 4PSVA 2J45A 2PX3A 5B58C 1ELOA 3AP2A 3KKQA 2AFHE 5HCNA 2P5SA 1UBEA 2OLJA 1PVOA 1XWIA 4JLNA 4RKEA 4CEHA 2CJWB 2QM8A 2ZSBA 3PUZA 5A5GA 1R5BA 2WMOB 2XNSA 2OO7A 1FL9A 2J7PA 4JZKA 5DI3A 1CU1A 3KKNA 4U5XA 2X8AA 4G0NA 4HB2A 4BFTA 2P0EA 1L7VC 1R0ZA 1RJ9B 4BFVA 4CRWB 2X1VA 4URZR 1U94A 3NH6A 2BOVA 3IILA 1T5IA 3L43A 3ADCA 2RGGA 3BE4A 4LJ5A 2ZYUX 4DLWA 4KI0A 4EPTA 4DCVA 2QTFA 2IYWA 2Q6TA 4DC9A 2FNAA 3HDTA 1NY6A 3CPJB 4HZUA 1XX6A 4QBGB 4GT1A 1P9WA 3BIFA 3LW8A 1QHNA 2P5TB 1EG7A 5LD2B 2GJKA 3A1WA 3CF0A 1DO2A 3ZZUA 1M34E 4Q4HA 1S96A 2JLUA 3PEVA 1CR1A 3OIYA 2J7PD 1SHZA 2RGEA 4TQ9A 4LBWA 3WYFA 2AHOA 3L0PA 1UAAA 3WP1B 4US2R 1G8PA 1XXHE 4NE2A 3H84A 4M4SA 3EC1A 1ZNYA 4LHVA 4JSTA 3PQCA 5HTKA 2X2FA 4OK6A 3CWZA 4OI1A 3WRYC 4URUR 4GI7A 4U00A 1KMHA 4OJKA 1ZAKA 3U7GA 2FX3A 3RWMB 4BZQA 4WZAE 1W4RA 4DDUA 1AZSC 1KI4A 2ZM5A 4UNRA 1GAJA 4DDWA 8OHMA 1VPLA 4QGFA 4CZ2A 4B73A 4Q7LA 3VQTA 2IXEA 4GSYA 1XBTA 4PO9A 3B1ZA 2LKCA 3H0KA 2J7KA 2W2XA 4C30A 4TMTA 3EZ6A 4D6PA 4RFVA 1S9HA 1ZU4A 1AN0A 1P73A 2PCLA 2Q3HA 1MO6A 3CB4A 3RDPA 3HP1A 4RZ3A 3RS5A 5C46F 3QI2A 5IF9A 3TGPA 2FDCA 4V0ME 5DIFA 2JASA 3K09A 1M74A 1FMJA 2CL0X 4AKEA 4NYMQ 1E99A 3LY5A 1NI3A 2RMKA 2IC5A 2PCJA 4YMWA 1FMLA 2HYDA 3RS0A
chains in the Genus database with same CATH superfamily
3UK6A 1GG2A 3A1CA 2WF7A 1HO3A 2FLVA 2OESA 3CEHA 3QIAA 4E70A 1CF9A 1DC4A 2BZ0A 4I81A 1XR3A 4ZICA 1IZ8A 4BNYA 2DH6A 1QGDA 3Q2IA 4LNAA 1YL6A 4UDYX 4XJXA 3AVUA 1JYEA 4TTVA 3PNLA 5K03A 3FPSA 3FPHA 1J20A 10MHA 1CE8B 2XECA 2NVUA 4R3WA 1QRSA 2JIRA 2JGAA 2KSQA 4YI3A 5JG7A 1Z4NA 1KY4A 2C9CA 3OLCX 3JVIA 5EMNA 3WXMA 5ALTA 4HZUB 3NV7A 3EN0A 1RKUA 1SD1A 1ZOIA 4Z9AA 2PUAA 2JS7A 1UPAA 4D7AA 1ZCJA 2AVNA 9GPBA 5JXWA 3O47A 3HV2A 5JSUA 3LYUA 1G21B 1A7AA 3MINB 1NN0A 1S8NA 1WY7A 3OI7A 3D0RA 3LXRA 2OCXA 1NE2A 4C0XA 3F4LA 1G3RA 2HBRA 1J97A 2DC1A 2PA3A 4NOMA 1BX3A 5K3CA 4EW2A 4URFA 4DNPA 1EXVA 4H0CA 3PGJA 3O74A 2F1JA 4MIYA 1K98A 1O7JA 2ZUWA 3MEQA 1ILEA 1FQKA 2AMLA 1CZUA 5AM4A 1KY5A 3BVPA 3R20A 5F1YA 2B1RA 3UWPA 5JFOA 1NYQA 3KZVA 3MTIA 2C4VA 2GJSA 1FJGB 2HMVA 3QVKA 4E2WA 3BJMA 2H2FA 1ESEA 4JLSA 4LMRA 2FB9A 5LZ8A 5DN9A 2YFHA 2JD1A 4RFLA 5CDUA 1U80A 3GYBA 3GLVA 2P7HA 4FOPA 5HILA 3CKMA 3VDRA 2Q46A 2VEDA 2FG5A 3VR3D 2Z5LA 1NOIA 2JFQA 1W2GA 3TX6A 1B2LA 5JVDA 2PXHA 1S3IA 1QQ5A 3B9PA 3URMA 4B0PA 1TFRA 3B8HA 3FWPA 4WKOA 2NYUA 3OIVA 1NX6A 3ET4A 1NPTO 1G3MA 3LVFO 4ALMA 1E8NA 1ESNA 2Y3IA 1T24A 4D97A 3OPVA 2WJIA 5BP7A 4TYWA 5K01A 4B5LA 3A7EA 1SMKA 3LQ2A 1PJ8A 2BKEA 4V0MA 4MARA 3JVDA 5F3WB 1NG1A 1DBWA 1KC3A 1JPNA 1QRDA 4QPPA 1EDZA 2I03A 1DAOA 3QX3A 3V7FA 4H35A 4WCFC 2Q1UA 2GXSA 4D4KA 1L8AA 2QSJA 1Z8HA 4C3ZA 2X5XA 2BZSA 3BK7A 5KNDD 1T0UA 3ELBA 1XJ5A 2C58A 3Q7TA 3BXGA 1T36A 4P54A 5C32A 1T5LA 3WZLA 1GKYA 2VUSA 2HZBA 2PE5A 3AM1A 2HK8A 2I6SA 4GAEA 1NDQA 3BH0A 5EJ7A 3I0ZA 3Q8KA 1WF6A 3L82B 4TVKA 3WGJA 2QJOA 4RTMA 1LC0A 4J2TA 1DTWA 3LV8A 3T4XA 2QSUA 2K87A 1LPAB 4DAEA 2QM0A 2QYSA 4GGOA 1OLSA 3IIKA 4UAUA 1QIFA 2NU8A 1XNJA 2Q1YA 3H2IA 1T8WA 2BI7A 3U0BA 3T9DA 4QUBA 3WGKA 4O3MA 1RE0A 3T5MA 1QGAA 3A4MA 1GNVA 1Q91A 3TGWA 4D4HA 1Q3HA 3B7PA 4DR5B 1J0BA 3W8RA 3JVUA 4BFCA 1NG9A 1QIGA 3BWMA 3RBVA 4EO9A 1HPLA 3KQTA 1OZFA 1QU3A 2G4LA 3OZTA 3O8CA 1KQFA 1O0BA 1NX9A 3AC0A 1Z2EA 3JY6A 3KKPA 3L1HA 2Y66A 4L0MA 4TS9A 4JIMA 2HEIA 4A2CA 4X63A 1IPEA 4QBFA 1QH1A 5CX4A 5IDYA 5AP9A 4D79A 2PGOA 1EA5A 1OFUX 3EH2A 5ETJA 2COKA 2L69A 2IZZA 3DM9B 4JI3B 1U3FA 5INTA 1JLMA 4XVCA 2Q0SA 1A76A 4RA6A 1DT5A 1Q1QA 3GUVA 4FLEA 4WZAB 1I01A 1DX9A 4TSFA 1ZSYA 3NIGB 4AMGA 3H9QA 1CUJA 5DGDA 3VDNB 1N36B 3OF5A 1XDDA 2G5TA 2VJAA 4EF6A 1I14A 1J24A 1G9XA 4K6CA 3T0GA 3MUEA 5I47A 1EZ4A 1KVRA 4KUEA 3C5HA 5CM9C 5TQ0A 5JVDB 2BMDA 5C3MA 3CNNA 3K5PA 4MYHA 1Q17A 3CG0A 1SG9A 3MOIA 3Q72A 4IH1A 1S8FA 2AQHA 4IRXA 1UDRA 2OLEA 4NJMA 4YN3A 1F51E 2GBFA 3PA8A 5J4LA 4CLRB 1SN7A 5K0ZA 1DE0A 3KQNA 3TLGA 3WNBA 3HL0A 2FLKA 2QEQA 1RWWA 4OLHA 3FPBA 3SEAA 4GKAA 3UYLA 2G0AA 3FMFA 3LX8A 2GJAA 1OXVA 2FW9A 2WICA 3GEDA 1LZLA 1K1EA 1V0JA 3FVQA 3DMDA 1PFWA 4BNVA 2IS2A 1O6BA 1YACA 2VZ8A 4JI1B 4DV3B 3QXXA 4XM2A 1T4DA 1H2YA 5JHGB 3DB1A 4K86A 4LISA 2A1IA 5I9BA 4MTLA 1GHTA 1P6UA 1YR7A 3PUJA 5TT0A 3R7LA 5JQGA 3PQDA 4MRMB 3WWYA 4CI9A 4RW0A 1U0EA 1EUDB 3T3GA 1ESCA 3G2KA 3OHMA 4B6JA 3EQ6A 1LJ8A 2O8DA 1M8KA 3F3SA 3HEAA 5KU7A 1E2LA 3H3FA 2FUKA 3VUEA 4FZRA 1FUYB 5ESDA 1OLSB 3JZAA 4JOBA 3WK9A 4J29A 2E21A 2NU8B 3UKJA 4BNDA 3V1LA 4YIKA 3BB3A 4Z54A 2L42A 3MUOA 1C3EA 4PCVA 3A6KA 5DE3A 3HKBB 1ZEJA 2J3KA 1DPGA 4CTKA 4DQXA 5A5VA 3LLVA 4LJLA 3HVIA 4U7HA 4UDXX 2DPXA 2QD3A 5BNFA 4Q9DA 3Q2OA 3S40A 1KFBB 3W9SA 5IAAA 9LDTA 3WWCA 5TMPA 5GM2A 3TZEA 2GB4A 4KGVA 2AEEA 2RKOA 2H4WA 4P3PA 3LDUA 3RYCA 4MW1A 4WA7A 1PWXA 1HNNA 1I4DD 1DRUA 3AKZA 4YPVA 4DJTA 5MHTA 2ZT8A 4LY0A 4L3OA 4C01A 2NU9B 4RZSA 2PZBA 1GQ2A 3DDSA 3EY4A 5DXFA 2F1KA 5FPQA 2I76A 4MB2A 1XE3A 4I8XA 5COBA 5E6SB 1I3OA 1YMVA 1D2EA 4GRAA 3T61A 2V7QA 2CNWA 1MVLA 2MDTA 3QFCA 4ZCLA 1GV1A 2D1YA 2R48A 1I4LD 3G2JA 4CMHA 4RY9A 4B8YA 3AHJA 1Y6QA 2Q4RA 1YV9A 3IPLA 2LV8A 2BIFA 1QVAA 4NJMB 4N3BA 8ADHA 3FTFA 1CQXA 3HRKA 2WTMA 3RUPA 4AL4A 1WJGA 1BVRA 3ES9A 4QQFA 3TLGB 5TT1A 2EKDA 3IR5A 3ONEA 4BATA 1XKQA 2JGDB 4MYRA 3VHQA 4C2AA 3NM5A 2A92A 3HYLA 1CUDA 3A3NA 3I9LA 3OQIA 5DJ5A 3A9TA 3GEEA 7MHTA 2P2NA 1W5AA 3A1VA 4OUKX 3ZCSA 3Q98A 1RC1A 2ZK7A 4JOSA 3IAHA 3IIIA 4LNUA 2OC4A 3MT9A 1YMQA 5CJ2A 2QQFA 4D9BA 3QITA 1T3TA 5JISA 3K0AA 2AI1A 3DOOA 4OQQA 3RK1A 1ISJA 2YCLA 3IE2A 2A0UA 3GT3A 5DYNA 2ETVA 3OSUA 1U3VA 1VP3A 4S1WA 5LLSA 1SUBA 3BBPA 3GLIB 2YV1A 4EW1A 2F7SA 4YRKA 5IXJA 1RPZA 3NANA 1KEZA 1ZJZA 1QO9A 3CS3A 2CBXA 4PFSA 4ENQA 5LPNA 1X1AA 3NBQA 5AD1A 4ZAFA 1SXJC 2YY5A 5EJ5A 4BNDB 4KX5A 3RSOA 5BVHB 1QV9A 4TXNA 4ENUA 3UG6A 5T6MA 3B7GA 1JG1A 4GICA 3IUMA 1KI7A 2ZPUA 4TPKA 2HCTA 2CUKA 2CDCA 4MXDA 2C8LA 2QKYA 1RAHA 5BN4B 5IBRA 2FSVA 2G1JA 4RORA 2OXCA 4TLCA 3A11A 5KYUA 3OO0A 3IB6A 1VPWA 4NVRA 1Z4MA 3C3PA 2A3NA 3H42B 2ZI6A 1CCWA 2HB6A 1E2UA 2J3QA 1WUYA 3GPCA 3QMWA 4G0VA 2C8VA 2FW0A 2ZOSA 5J2TF 3VYWA 4XWWA 1NDHA 5JC1A 2VAPA 1T6BY 2LDBA 5HIJA 3S7ZA 2P2ZA 4LZWA 3EDYA 5JAOA 1TAUA 3I2YX 4UOQA 2P9FA 3O73A 4YCDA 2HA2A 3K05A 3IX7A 2PQ6A 5K3OA 3RIGA 2HRZA 2X4DA 4EUEA 5LWQA 1XL1A 4UU1A 2HO5A 4P3KA 3QIVA 3S2IA 1I4OA 2AE2A 3O1HB 1TYAE 2WF8A 4M1WA 1BNCA 5AK0A 3MOGA 1IRIA 3IAS1 2PTGA 4KO8A 4Q3DA 1MOZA 3FLMA 3U4QB 2YXNA 3JWGA 1ZQ1A 3GCXA 3GFVA 3DEFA 3FNIA 2XYQA 4Y2TA 4NMMA 2WM9B 1YSCA 2H5JA 1Z7GA 1Z4QA 3HCRA 4OMUA 1N2GA 2D2FA 5JALA 3OWXA 5LQUA 2FMXA 3IVMA 1FC0A 1Z0IA 5DKFA 1L4UA 1HV8A 1BU8A 2VP0A 3NW9A 5IP5A 2PJDA 2I2AA 2WV7A 3KFVA 1P9NA 4B44A 5I45A 5AI4A 3PTZA 1NTRA 2R86A 5J43A 3ZD7A 4C5CA 1QC5A 2BHRA 3GELA 1QHXA 4W1QA 2FSSA 3OY7A 3VO9A 5JCOC 3PWTA 5I7RA 3OAAD 3P2OA 2Q9BA 3K0AB 4BO2A 4C6RA 1GRVA 4ZQCB 2OK7A 2PH5A 3T3PB 3SSAA 3K0KA 4UBOA 3EUFA 4JZYA 1TKRA 1E2NA 5TQJA 1CY8A 4BV3A 1UPFA 1JHQA 1EFPA 3V8PA 4W9RA 3AR6A 2JFGA 2CYAA 4JLUA 3BX1A 3RT1A 1T8TA 2VYCA 4FGKA 1YJAA 2R3SA 4UU8A 4V0RA 1WZNA 1U2RA 3OMXA 2JC3A 4D42A 4JQZA 2JBHA 3I45A 3ZY4A 4L78A 1JB9A 3UC9A 2W4IA 1EVEA 3Q0TA 3JD1A 4PR0A 2WC1A 3EXHC 4YRLA 1M7GA 3U7EB 1WZ2A 1WCWA 1KZ6A 3WK5A 2I6TA 5KOYA 4G2TA 1EINA 1XZ8A 5K4GA 3UBTA 4AIRA 2C9BA 2YOGA 5I7OA 3I5XA 3EBOA 5DISB 1X80A 1SULA 2CLIB 4AS1A 2RJOA 3VU1A 2PMEA 2XMDA 2GFQA 4KKXB 4KNYA 3SC3A 1J9GA 3HYNA 4X45A 3LU1A 2IPNA 3L0BA 4GC5A 3MTBA 2I6QA 4YDRA 5I4KA 3RC3A 1OB5A 3ZE7A 2Z8XA 4CV1A 3N39C 2IPAB 1RMYA 3KPWA 3KR9A 3K20A 2RGNA 5E6UB 3L05A 4D4IA 3JATA 1RYEA 2PEYA 2IUSA 1FCJA 2PGIA 3JWHA 4HSGA 4RIEA 5JR3A 1KYYA 1U1EA 1D5WA 1HYGA 5EWMA 5KJFA 2JH3A 2OAGA 3U4GA 4TVBA 1WIWA 5EERA 4LV5B 2QUIA 3WLTA 3RANA 1T2NA 2PBFA 2VXBA 3GDHA 1C8KA 3K0FB 4GEGA 4NNPA 2HMTA 2V9CA 2XYPA 3A1SA 2OM6A 4TZKA 1Y8RA 1N78A 4JBGA 4UZEA 3UJHA 1GSOA 1O6ZA 2PLRA 3A9SA 2YCBA 4FS3A 2JJ1A 3DXYA 4KO3S 4IIYA 2JLQA 1I3LA 3CUVA 3BGOS 3NJ4A 5JCJD 1Y6RA 1ZVQA 1FP7A 3DT8A 4YQEA 2OSVA 1S7CA 2YXDA 1TD1A 2O0HA 2PX5A 5AUPB 5EMKA 3WISA 3ODGA 4PLGA 1J70A 4N40A 5GVSA 1GDHA 1N6KA 1X7ZB 3BH6A 1PP4A 4LRTB 5EIWA 1GITA 3ZHTA 1XVAA 3HCFA 1QC5B 5A2GA 4HZIA 4L51A 2BEUA 3OLQA 5ALWA 2Q62A 1XTBA 3TOVA 1VJDA 2OHHA 1N5IA 3QA9A 4HGRA 4PY2A 1AHIA 1PWHA 4XUEA 3TR6A 1TI7A 2I3ZA 4JY7A 1UJ5A 1CB7A 1Y1LA 1Q15A 2BMFA 2HQRA 1EFPB 1G2IA 3QFHA 3HXTA 4JGBA 4BLTA 1FX1A 5JANA 2FY8A 1I2ZA 3BD6A 4Z99A 3H04A 1TUEA 2CJFA 5LL6P 1XT6A 1V7PC 1G7TA 2NUAA 3G5MA 2W93A 1DKOA 1GL9B 4ZAGA 4HUTA 4CLDA 4DTIA 4WZBA 2PGNA 4CCSA 1JEEA 2P9ZA 3TK1A 2JW5A 2CMGA 1QB7A 1HQKA 3G6KA 5FD8A 4JT8A 3V00A 3M81A 3MQ2A 3KYJB 4O5OA 5H70A 2ZRAA 4U6QA 5FUXA 5D3KA 1H8ED 3UQZA 3KLNA 1M0EA 2JCGA 4IICA 4FQ7A 4LQLA 3O9ZA 1ISIA 3P9CA 3QVSA 4JC4A 4NZ9A 2WVJA 4WEQA 3RRXA 5B53A 4DR4B 1CB0A 2H4JA 3LC0A 2WWVD 1WCIB 4L7QA 5EOVA 4DEYA 2FWNA 5EJAA 4J4TA 4IFBA 2NPOA 1C4XA 3IJRA 5EWMB 2H57A 3FDIA 3KVVA 1M7HA 1JKFA 4L50A 4LXHA 2RGWA 4FYKA 2GZ2A 1XN1A 3PJEA 1LZKA 3M6UA 4PF1A 1M2OA 2QRHA 3C1AA 4EUKA 3C8DA 3AB8A 1EFCA 2QUHA 1GN8A 1T1RA 4QHSA 4XE5A 2GCEA 4J94A 5C7LO 5HIIA 1GR1A 1JR4A 3PPWA 1TD9A 2PSDA 1B43A 4H4CA 5I4BA 1M33A 1UXIA 2FSGA 3S5JA 2Z43A 1V11A 3P9KA 3MS7A 2JANA 4B76A 5C5EA 3JQAA 5LM3A 2R6CA 4ZQEA 1K89A 4BNZA 5FDFA 1JDSA 1S0UA 2HK7A 1XTTA 1UJNA 5LCXA 2XRYA 4EEKA 4XM1A 4DCCA 3B2QA 1TO6A 4PPNA 1V43A 1XRMA 2J9YB 3MJHA 4Q3BA 5LMZA 2H1OA 3WLFA 3DAFA 1VYUA 4K9SA 4WK2B 4UZFA 5JEDA 2BEUB 2C84A 5JRDS 3P4UA 3QVVA 1FUUA 4ND8A 1XU9A 1A8QA 5I7WA 2WJVA 4Q7JB 3NAMA 5ALGA 3LUCA 2YJ5A 5CK4A 5ERGB 3DHVA 1NBWB 4ARZA 2ZT5A 1GGMA 2WABA 2WYOA 2JL1A 4DLLA 4UUQA 5AO9A 4AP6A 2W7TA 3A9UA 4W8OA 1OFTA 1E6LA 2VNSA 3G7SA 1ST2A 2HEGA 2R4UA 4QEKA 1P1BA 1YZ3A 3N59A 4QEDA 3V5NA 3VR4H 4CF4A 4QPCA 4ARAA 4POAA 3AKEA 1XO1A 2PMCA 2H4FA 2KLBA 2QVYX 3CLUC 3WL7A 1H6CA 4BZXA 1SIBE 1QYCA 5SZJA 1OB2A 2GPJA 4WZBB 3RU9A 5HUJA 3QHQA 5JS1A 3AOGA 1T4BA 2VH1A 1WUKS 3PDCA 5AESA 1TZBA 3ZVMA 3N0RA 1UDCA 1V5GA 4RIGA 2CLMB 5CT5A 4DSNA 2WWHA 3FFXA 4FW8A 3GROA 2CD9A 3KQPA 3OPQA 1WR8A 1QX4A 4M8SA 3ORQA 3WRYA 2ZRBA 4AKTA 2QZSA 3LO8A 3GHYA 4LCBA 5EIEA 5DX8A 3U4IA 2XGJA 1GZ5A 4ZP1A 3AY3A 2VAMA 1WCXA 1LPMA 4EZBA 1L8XA 3W7VA 1BN7A 1KDOA 5FIUA 4C1NA 3HMQA 3Q3CA 3GG9A 1RPTA 4QELA 1T9GS 3L06A 1NP6A 1M2OB 2ZYDA 4WMLA 4ZDJA 1ZKMA 2P67A 4I50A 4OG2A 4P83A 3HLYA 4R8RA 4BNGA 4C88A 3R9XA 1KA9H 5AW5A 1C8BA 2QG9A 2XA9A 3NVMB 1DAPA 4FKMA 4Z0PA 3TL2A 2WA1A 4PLTA 2NP6A 3PYXA 4U7FA 1ONBA 3FFBA 3Q12A 3HU3A 2A0YA 2WD8A 5IUNC 1DS6A 1V11B 3FFAA 2FPGA 2FU5C 2ODWA 3BHNA 3L79A 1P7YA 1U3WA 3KZNA 3L8YA 5C8DA 1U81A 1VHWA 2C9YA 3EXG2 1M66A 2FFAA 3MQ4A 4M21A 1QIJA 1Z3IX 3LO5A 4MIOA 3EOBI 3DTTA 4OBWA 4CR6A 4K6FA 2Q7XA 4RHYA 5G02A 3E5MA 4LDPA 4W1PA 3TQSA 2K2WA 3IV7A 4DVJA 1DIRA 1NF2A 5K51A 2RARA 4G8CA 1U2DC 3OZXA 3CLRD 5ADVA 2RG1A 1VLQA 4Q9NA 3ZV3A 1UBUS 1XU7A 3FCOA 4RXUA 3E81A 1OBVA 5EJFA 1BDMA 3ONWA 1SQ0A 1WW2A 4OJQA 4AZTA 1CR4A 1C80A 5B4VA 2IELA 4AUNA 4L6AA 3V2HA 3LP8A 3J7AC 4C0KA 3T1OA 3QH4A 3RVKA 5DBFA 1VKRA 1RAGA 3OQ1A 4GXRA 4WBSA 3VZDA 4B83A 3ZLUA 1E1DA 4DBVO 5I5EA 1GXSA 3VYSB 4B8WA 2O3TA 1G17A 4OM8A 4D4MA 2IY8A 1GZ3A 1TB4A 4MRRA 4PO8A 1TE2A 3DEAA 4PE5B 5CR9A 2F3TA 3QUCA 2FZKA 4JYZA 3DOUA 3GNLA 4Z2YA 1RR6A 2QYTA 1WNTA 1XP8A 3JZIA 4DLYA 5FUVA 1M3SA 5FYQA 5FTMA 3DVAA 4MVJA 3OZEA 4YWHA 2O7RA 3RKUA 3MTJA 1NONA 1RXYA 1X7DA 2EC5A 3U4CA 4TSKA 1FDTA 4ZIRA 4HNVA 3C0KA 3K53A 1PJ3A 3LBIA 1T1SA 3TPZA 3AVYA 3ETJA 1CDDA 1Z18A 5THKA 4C0AC 3VKFA 4RV9A 4G9EA 3HB0A 2R6JA 1UJ2A 3H2KA 4MQEB 5C5CA 3R7SA 1OI2A 3M6IA 2O9JA 3IIEA 3SJAA 1B3BA 4QUJA 2P78A 4PONA 4D43A 1MRNA 1I24A 1XQWA 3FKSA 3GLSA 1D1SA 1MJ5A 2XTMA 1RYYA 3MIZA 4IUBS 1NW4A 3F90A 2ADOA 3GYGA 1ZHOA 1PHPA 2NO9A 1KKUA 3DQPA 4DJEC 2Z30A 3L6CA 1KF0A 4OHVA 1E18A 1P1RA 2D00A 2IUUA 4DVGA 3DFIA 2IW3A 2B5WA 4A9AA 4CG1A 1XPOA 3SQMA 3R9XB 2BTQB 2FPLA 2J33A 3SLGA 4DV2B 2P2YA 1TQ8A 1UPXA 3IP5A 4PQRA 4OH7A 1Z28A 3BL5A 2CHVA 4M49A 3L7JA 3LLMA 1OD6A 1QYVA 1ZEMA 3U17A 5DN6A 4DCMA 4QECA 2DCUA 3ROQA 3AUFA 4BNFA 4WY2A 3DTYA 3F1KA 4PSUA 3UAOA 1KOJA 3E35A 4HC4A 4WCFA 2QU7A 4A26A 4CCWA 4YMGA 1PF7E 1XZJA 1TXGA 2GEBA 5I9LA 2DMRA 5CB6A 1Y8CA 1UZAA 3WE7A 1BE1A 1EZZA 3HLTA 4PINA 5D5HA 5FR1A 1X1SA 1AQJA 4LZNA 4A82A 4FI3C 3RHTA 5JS8A 4US1R 1YXMA 3KE8A 1Z6PA 1V95A 1ONPA 3E4DA 3E3LA 2R4QA 2FR1A 1UPTA 2NZ2A 1SC6A 1VBNA 3BN3A 3CBGA 3DE3X 3NUZA 1NLFA 3HY6A 4GFDA 4ZANA 3C3MA 4TV8F 2JCXA 3HWWA 2XCIA 3DOFA 3PQ2A 1IRXA 1YAHA 2WG0A 5IUKC 1KZHA 1L4YA 1LKZA 1IY1A 3GRVA 2WBLC 1AJEA 2XUJA 3PS9A 4I9HA 4MQEA 3C7KA 2FHSA 3OCJA 4MMXB 3ELUA 5DGCA 1LF5A 3EIEA 4OMCA 5HP4A 4LK3A 4J9UE 1GPMA 3ENWA 1MW8X 3C43A 3PUHA 3DT6A 5DM4A 1ISHA 4DKXA 1ORTA 1RXEA 2ZTMA 4V39A 3AR8A 5EFOA 1F2UA 4ZAXA 1SOVA 3FMIA 2C97A 2R7AA 4DLBA 1IHOA 4HDQB 5DW0A 3V7UA 3IOYA 3F9IA 4L5JA 2OD9A 2HQ1A 4UOEA 4O4JF 4QDJA 1PYGA 2HF8A 1PS8A 1XAGA 3KPUA 4GZ3A 1SKAA 4NHEA 4CYMA 1GEEA 1KYXA 4IDOA 2MHCA 4KUHA 3W5CA 3UJPA 1X74A 2NACA 4GOLD 3GEGA 5L3SB 1R12A 3IOCA 5FV7A 1E8MA 5KHOC 3D43A 4A15A 2R00A 4BMCA 1E69A 1ZHHA 1XMJA 2H31A 4QFDA 2XQIA 5EHGA 3ADDA 3M9XA 1Q92A 1KK3A 3O2JA 1W4ZA 4MVJH 3RTAA 3KB1A 1C7JA 1P7ZA 3IP7A 2GEUA 1NQ5A 5IT0A 2YYYA 2V9ZA 1XCOA 2CLSA 5HPYB 3M6XA 5AI5A 1W87A 3NBUA 4KMRA 3ZKAA 1JHDA 4CBVA 3W4JA 3ILVA 2I7CA 3AI7A 4JBYA 4BO3A 1YNSA 3TZCA 4YX9A 2FQXA 1M6WA 5G40A 4TRNA 1ZD2P 4WK4B 2A9RA 4YCMA 4ER6A 2XW6A 4Y8VA 2QN3A 5H8WA 4WN3A 4H1UA 1PUJA 4UC0A 4EFNA 2D2XA 2ZWVA 3UV3A 1WSWA 2XH8A 2YZGA 4B0OA 2WYIA 4PU0A 4LGCA 4XX1A 3A4VA 5BN3B 2IGBA 1X2EA 4QUIA 4M1TA 4OREX 5HF8A 3MQFA 3EEOA 4PYOA 5JJCA 1HKUA 3PPXA 3V7NA 1XEXA 1JDBC 4KAXA 2L17A 2C1XA 4L75A 1VG0B 3I2IA 2EBFX 5FUQA 1YZLA 5EZSA 2GD0A 3REQB 1I10A 5FTWA 2ZIGA 1MRZA 3RFTA 2VUTA 5DM70 2OZKA 3PRHA 4IGAA 4CV2A 5AVSA 1CUIA 1QZUA 3QOWA 1N6IA 3KXKA 2OVBA 1JIUA 3DLTA 3IJPA 1ZWKA 4F9FA 3I01M 1JU3A 5HK9A 1NT2A 2JI4A 5H4GA 2DFVA 3KNZA 1H5NA 4MPPA 5LA6F 4R1NA 3H3XA 2RCYA 2J3DA 3WMXA 1F6WA 4GYWA 4ND1A 1E3EA 2QA5A 3NT5A 3L7OA 4EATA 2P4QA 4PAQA 2J1LA 5JYBA 1USWA 1VB5A 3TQTA 5C53B 2LNDA 1Z2CA 5EKSA 2H0QA 1F2UB 2VJCA 3CCBA 5TVKA 4AK9A 3EDRA 1E79D 4G1MB 5CNJA 1SOUA 3H5TA 1KKMA 2B94A 1V37A 2GX6A 2O2EA 2Z9CA 4XIFA 3B9RA 1JNYA 3PC7A 2HD4A 1Z47A 2Q2WA 4O4HF 4X6LA 1O94C 2UZIR 3ZDFA 5T3UA 2XQJA 3DSRA 4WSOA 2ZJ1A 4JB8A 3CONA 4GZMA 5C3UA 1L7OA 3LX4A 3CE6A 4DSZA 2SHKA 2HR1A 2JCVA 3OICA 3I83A 2DGDA 1WMSA 3GDFA 5CLLA 5JMTA 3O1JC 3EVGA 1E2EA 3ABSB 1E9DA 5FUWA 3UMRA 1V4NA 4HX9A 3SJ7A 5CK5A 3ESAA 1HUQA 3SC2A 2ZRQA 4FMCB 5BRNA 1Y3BE 4BIMA 2N0SA 4PRYA 4HMQA 4BEVA 4ER7A 3LQYA 3S2FA 3N6XA 4IKOA 4EG3A 2XA2A 3KSZO 3H16A 2RHOA 2PUTA 4HGPA 1E5QA 1VFNA 3UCXA 4CPDA 4NZYA 5LZ9A 1RPJA 3MWGA 3PC4A 4LY6A 2JHCA 1JG4A 3CLTC 1E2HA 1H1LA 3I2KA 3I2GA 1IJKA 2WKWA 3GQBB 2Z3ZA 3EGDA 5HW0A 3ZIUA 3PEYA 1K27A 4LX8A 4EB6B 1A77A 2VT2A 3UENA 5A0FA 5B30A 1G7RA 1G7CA 2ASVA 2NTYC 2PD6A 3AVPA 4LE2A 5KVCA 3QBEA 1UBFA 1F6BA 3IRUA 4KXWA 3SC4A 3T3NA 2GETA 3OZ7A 2EFYA 3FNGA 2EKLA 2Q5CA 3CO0S 5DNCA 1L5GB 2B34A 1P1CA 4G84A 3K1ZA 3C7AA 4OSEA 1Y8AA 5DXJA 2I8CA 1ZC4A 4OU5A 4KE7A 3QWAA 2NTEA 4XW2A 2FZVA 2Z5GA 3DAYA 1X92A 3N7TA 5ECWA 5SY9A 5TV2A 3VR6D 1UBMS 2XF8A 1OU0A 1KE2A 2QD1A 4GX1A 1C8LA 3FY4A 1JI3A 1KFCB 5D3MA 2TRSB 4Y6RA 5GGXA 1NBOA 1KMIY 4FP9A 4P7JA 5LKRA 4RVHA 5DCUA 1POXA 2C5FA 5EKXA 3FOZA 2NV6A 2HU5A 3SFZA 1SXJA 1NRJB 3BORA 4R8KA 4FT4A 5TF4A 4HDNA 4JU8A 4NBWA 5IKOA 1IY2A 2WYWA 3G9QA 1SA0A 1ZD8A 2W43A 4N39A 2CMHA 5KQLA 1Q21A 4BAGA 4RTSA 2LVBA 4B6SA 1W36D 3FUCA 1Y4SA 3EA5A 3T7TA 2GZAA 2XTNA 2C2OA 4IQ8A 4J43A 3AGQA 4EHNA 1D0SA 3MRSA 4WACA 2IHVA 1ZGJA 4Y7CA 1VLMA 1OR8A 3LPLA 4LC1A 1OROA 1PZHA 3OZWA 3DLHA 2CXPA 4F4DA 2GXAA 1XDUA 3LK7A 3V2IA 4FK8A 3PVZA 3NT2A 3DTVA 2PBLA 1NP7A 2PZMA 2QLBA 2QRUA 4HHEA 3OUTA 2PMKA 2XE8A 1ABFA 2ZSHA 1WPRA 3SC2B 3IP9A 5HM8A 3GRUA 1O97D 4BKOA 3SJBA 2XKBA 3V4OA 5CFLA 3BMQA 4I0WB 4LF7B 1RADA 4JBXA 1SHKA 1X7XA 4W6ZA 1K4YA 3JALA 2XX3A 2FV8A 1LK0A 1AZTA 1BQ4A 2EKQA 3TX2A 2B99A 3QEOA 2WWXA 4RGVA 1RVV1 2H3HA 5E2BA 4N54A 4BWVA 1QGED 3LQQA 2X14A 4R8VA 4KPEC 4JC8A 4DJJA 2Z4TA 1UBCA 1TKCA 2XDQA 3E0QA 4PZCA 4YCJA 1P1KA 1QCDA 4QNRA 1PWYE 2IY9A 4QU8A 3VR2D 4FFNA 1YS7A 3ANLA 4K6OA 3LWZA 3OETA 4PZ9A 4EMTA 2VYVD 5EHXA 5ER6A 1X14A 3DQZA 5HUQA 3W5AA 1QK4A 4OTZA 1KPIA 2EW1A 3BG5A 3DE7X 3ESDA 1RPNA 1ZH4A 4IDBA 2WUVA 4MQ6A 5JCOA 2CCJA 3FOBA 1GGEA 1LTHR 1MD9A 3G2LA 3QXGA 5BUZA 3MN1A 1X8LA 2B78A 3KUXA 4J0CA 5LBTA 2ONYA 4OKNA 1DJMA 1F5NA 5CURA 3CLSC 4LYFA 3VVMA 3U26A 1N9GA 1AHPA 4I66A 2EVWX 2K7ZA 3LBYA 1JHVA 1V2GA 2P41A 5BQ5A 4JLBA 5K0NA 4TXJA 3AVXA 4YEDA 4MMYB 3I64A 1ABEA 1UMCA 3FPAA 3INNA 4YRRA 5CXQA 1ZVMA 5IW8A 1JQKA 2C9MA 3AERB 4BFLA 1ZH6A 4BTEA 3I9OA 3EXHA 2YASA 4F91B 1FLAA 1TU3A 2SICE 2XQGA 1YQXA 4DDMA 1VKZA 2G04A 1P6QA 2GNAA 2QZ9A 1X39A 3OE4A 1V6AA 4O8ZA 4FEEA 4HDNB 3KEMA 3BFPA 1N9ZA 4WZ6A 5GONF 4CG0A 3R3XA 1WS6A 1SA0B 4PGMA 1E5VA 1YHNA 2HTFA 5CP8A 2OB2A 3TJZA 4N5MA 4A2QA 1Y7TA 4WJKB 1W30A 3TOZA 1M1ZA 4OOEA 1YRHA 4Z2AA 1SPXA 2YZ2A 3C4QA 3UO8B 3RB8A 5FBHA 1LPBB 5DB4A 2BM1A 3AUTA 4DUGA 4CKWA 3AO0B 5DP1A 1RWMA 1H0KA 1HEIA 1EKXA 5J47A 3A1NA 1SU6A 5DM60 4B33A 3R23A 4N12A 1VBFA 3W6OA 1XDSA 3SK0A 4GLLA 2WE8A 3EZ7A 5IJAA 3VSCA 1S3SA 1ZR4A 1FFSA 3FI9A 1PFKA 1UC4B 1W96A 1Y1RA 2P6OA 3F0TA 2ZRKA 3K4PA 1KK2A 1X7XB 3JALB 1I2BA 4W8HA 3SAJA 4LRXA 2P9TA 2AR7A 2PT9A 1XKXA 2VZ9A 3ODPA 3MA0A 4ROSA 3BWBA 3RTDA 1D03A 4MKIA 4DB4A 1BMTA 4N8DA 3B53X 1WMDA 2A35A 3SQXA 1N25A 4LY3A 4ZRNA 2VBGA 4FTWA 3WLHA 1EZ1A 3JARB 2HC9A 4C7OA 3ZK8A 1QGZA 2WPNA 3HUTA 2XDQB 3WV4A 3JRNA 4F85A 4CL2A 4RNDB 2OFXA 4MCHA 2A0WA 1DRKA 2IYXA 3X1YA 2GLXA 2RC6A 1OCEA 2CXRA 3D4IA 1G9TA 1FMCA 1HI9A 1UR5A 2IZOA 1NBMA 2XITA 4LJ4A 1PLJA 1A9PA 2Z08A 3G68A 3QPDA 4L5CA 2TMGA 4YECA 3IUSA 1W8IA 3KTDA 1NFQA 2FP4A 1IM8A 1YRWA 3KJXA 1CP3A 1RYFA 3QUTA 1J49A 3TMAA 2PIAA 4XASA 3FNHA 1PJQA 2H7XA 1G63A 1UIRA 1M2VB 1ZK3A 4GXQA 1PS9A 3AOEC 4M9CA 2OMKA 1NVEA 3RC7A 1FP4A 1QNLA 1T0HB 3DVLA 3F6SA 3MC1A 3QPWA 1NI4A 3R6DA 3H7AA 4M1KA 3VSEA 1Z74A 4CCAA 1K7CA 1U7WA 3P2EA 3U09A 2OL4A 3NHWA 1KYQA 5AJTA 4L5AA 2AFVA 3WZ2A 2YRXA 3G8AA 1RYHA 4G1VA 5C4IA 4PX5A 4CQMD 3KZ1E 5MN4A 1I7NA 5HMLA 2J41A 1PLLA 5AK4A 3MMNA 4G0ZA 4IHQA 3BCHA 1PV1A 3IAM1 1P5JA 2ACKA 4DILA 3C74A 4UCQA 3IODA 3KT8A 1E5LA 1AKQA 1V7CA 3HI4A 4NCBA 3A1FA 2RAPA 3L8GA 1FYXA 1XL0A 3R09A 1GU0A 2VRNA 1X1QA 1S3FA 1Y89A 2ZYTX 5FLEX 4AJJA 3K7EA 3ZDQA 3D9QX 4M3NA 3AUYA 3SMQA 2HBZA 2I5PO 4PLVA 3O3CA 3FMPB 3FX2A 4LOHA 1Y63A 2AWOA 1NN3A 2HJVA 4HY3A 2VYQA 1Z73A 3WA6A 5DYYA 4DMGA 2G36A 2XB2A 1SVNA 3DEJA 1J5PA 2Q8QA 1LBHA 2XWBF 2ZIZA 3LQKA 3PA6A 4IDPA 3AV0B 3QVJA 2ERCA 5F2OA 1L5NA 4HDKA 3GH1A 3THRA 3Q87B 1WQ3A 2EQAA 3GG2A 5B12A 4ZKEA 2HIAA 4WXEA 1V7QA 1TCUA 1GFZA 3L4BC 3GUCA 2UUCB 1JSRA 4YJ3A 1NYTA 1U8TA 3HJHA 3ZDDA 3O75A 1JMKC 1UT6A 4UPVA 2AG8A 3FF1A 1JKJB 1L9XA 2CLFB 1B14A 2GERA 4C0JA 4FUQA 3G0BA 2VLIA 2PZAA 4DRYA 1FSPA 2Q99A 3KOXA 1BH6A 1BRTA 3LL4A 4MPRA 3GFTA 3U49A 1WDKA 2CJWA 4TXMA 5L3QB 3N2LA 2IUFA 1U5BA 3DDWA 4XLTA 2ZRLA 2BFCB 1J2YA 1SQSA 2ABWA 1A98A 1BMFD 1C30A 4J4HA 5AW1A 2J3MA 1CUUA 1VE7A 1SC9A 5JAMA 2BCJQ 1JIVA 1XCJA 3H99A 1RP1A 1WTCA 4TTRA 5DI9A 2GN4A 4HQFA 2FP4B 4RJIA 3R5XA 3ZY3A 5B57C 3K70D 2IS6A 2OBXA 1P0FA 2PYDA 3UJ9A 4GPAA 3K1AA 1M2FA 1AC5A 4CM1A 1ESDA 1FFDA 1C7IA 2JGIA 4HNAA 4INZA 2JFFA 3ZHUA 5ITZA 3PXCX 1D1TA 3QWIA 1AKRA 1ONNA 3T1NA 5BMVA 4A6XA 4E5DA 1BWRA