1JJVA

Dephospho-coa kinase in complex with atp
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
205
structure length
194
Chain Sequence
MTYIVGLTGGIGSGKTTIANLFTDLGVPLVDADVVAREVVAKDSPLLSKIVEHFGAQILNRAALRERVFNHDEDKLWLNNLLHPAIRERMKQKLAEQTAPYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARSANFEQIQRIMNSQVSQQERLKWADDVINNDAELAQNLPHLQQKVLELHQFYLQQAENKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DEPHOSPHO-COA KINASE
publication title Crystal structure of dephospho-coenzyme A kinase from Haemophilus influenzae.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 72
structure length 194
sequence length 205
ec nomenclature ec 2.7.1.24: Dephospho-CoA kinase.
pdb deposition date 2001-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01121 CoaE Dephospho-CoA kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1jjvA00
4RCYA 3HJNA 1G291 4PAOA 4AURA 1CEEA 1FPMA 1VTKA 1YZKA 1YRBA 4POAA 2R6FA 4B44A 1VECA 3DVLA 1P7CA 2WJGA 1RRCA 4QHSA 1EWRA 1YZTA 5J4KA 4ERNA 1CLUA 4CEJB 2JATA 1E2GA 4U00A 3RAPR 1P75A 3WNDA 4D82A 1NG1A 5GJCA 1KI2A 2CJWA 2RCNA 4Q4LA 4DCSA 4P0TA 3IDQA 4IHQA 5M04A 1QG4A 4M0LA 2V9PA 5SZKB 1WF3A 2ORVA 2W2VA 3V9PA 2F55A 1F2UB 4NPHA 3QUSA 4ZDWA 4BFUA 4LJ6A 5EE5B 2IEZA 2JGNA 3HYTA 3EA5A 1EX7A 2IHBA 1X8LA 3CRRA 5EJEA 2XSZD 3QG1A 4LJ7A 2VA8A 4B3BA 121PA 4OI0A 2Z43A 3K70D 1AJEA 1KY3A 2GNOA 4EDHA 4M4SA 4CEJA 3W8NA 2CHVA 1MV5A 2GKSA 1YKSA 4TMKA 4UJ3A 3SYKA 5JI2E 2OFOA 2ZRHA 4TYYA 5FR1A 4TLDA 4RD4A 1CIPA 1RC8A 1H8HD 2PT5A 3AVWA 1OH8A 3QXHA 1F2UA 2AWNA 1IN6A 3FHTA 1J7KA 4QJ4A 2WZQA 4D2IA 2QAGC 1SKYE 2H7VA 4B3XA 2GHIA 4MKHA 2ZJ5A 2GXSA 4G5OA 1PV4A 1SKYB 4CF7A 2JJ2D 1X86B 3SE0A 4AYTA 3QXCA 4ZV4A 4G01B 2E1RA 1E9RA 4QNMA 3X1XA 3E5HA 2WAXA 1R5BA 3FHCB 4F7WA 2QBYA 3QXJA 1DEKA 3QPVA 4IJMA 3EIQA 4LK2A 2ZSFA 4TMXA 1NVWQ 2J87A 1VCIA 2W6IA 3NG1A 5EP3A 1JPJA 4MYCA 4WXRA 3SJCA 621PA 5G53C 1E2FA 4WZAE 3ZIAD 4F93B 2C78A 5AJZA 3FMPB 5F9HA 1COWA 2RKOA 3DEFA 1N3BA 5G41A 4IOMA 5KPDA 1Z2AA 3VKHA 2ODWA 2GJ8A 1WBBA 3UWKA 3L0PA 2NGRA 4C2UA 5EZ6B 3ZJYA 4Q4AB 5CIWA 3SU8A 5J4LA 5CLLA 4BRUA 2QY9A 3BH7A 2REBA 3QIAA 2VSOA 1OHHD 3GJ3A 4P3YA 4H9GA 1AN0A 1U99A 1Z2CA 2AD5A 3TSOA 4F4JA 1KJWA 1YJ5A 4QBIA 2AX4A 4HB0A 4GP7A 1CRQA 3RS2A 1SXJD 3IHLA 3G82C 4HUQA 3FKQA 3EZ2A 1G5RA 4WVFA 3GJ7A 3NKVA 1CP2A 1T8UA 4YMWA 3BGWA 1II8B 4RZUA 3TE6A 4CEIB 4HDCA 4Q4AA 3TNFA 5KSPA 3T5GA 3T5DA 4MDEA 1E9DA 1UKVY 1Q3HA 1S1CA 1Q22A 1XEWX 2N1BA 1L4YA 4GRAA 1AZSC 3RDPA 1E2EA 3SBDA 3WMFA 5C18A 4EJSB 3F8TA 4XJXA 4Q4JB 2NPFA 4RJLA 2QSZA 3EASA 4BPBA 3X1WA 4OHYA 2GWHA 2GJAA 3KJIA 2BKEA 2FGKA 4IEEA 3M6AA 5EQTA 3SOPA 3ZZTA 5AUQA 1CS4C 2UZ3A 4DZZA 5J4YA 2LCFA 4TLAA 4HSEA 4N1AA 2B6HA 3R20A 3QJYA 5C4MA 4BFSA 4DRZA 1II8A 1ZNXA 2IYTA 2AR7A 1MOZA 4P4SB 1G4UR 2F1JA 4V0KA 3SBEA 4CEIA 2PEZA 4FCVA 3LX5A 3L43A 3U3RA 3BWDD 1T0HB 1KI6B 4CYMA 4AKHA 4ESVA 3OEHD 4RD0A 2GAAA 2MSDB 2Q6TA 4MRRA 2ZI9A 4EJSA 1M2OB 1DAFA 1A4RA 4Q4JA 4U7DA 4FMDB 3U2QA 2PLFA 1TNDA 3SQXA 5E7IA 2LKCA 1VG8A 2I3BA 2JJ1D 3LA6A 4Q9IA 4Z1MA 3AF0A 1JALA 2D2FA 1BH2A 4KYIB 5GADl 3GFOA 1UM8A 2KWIA 1M8PA 3KKPA 3LBHA 3CRVA 2GA8A 2X1VA 2AXPA 1GILA 1Z0FA 3NH9A 4Q9LA 2KJQA 4RD1A 5IT5A 4P4SA 4ZKDA 1VMAA 1YQTA 1EK0A 2OILA 2VEDA 2OXCA 3A4LA 2WMOB 2YHSA 5DH9A 5G3YA 1IY0A 2JAQA 1ZD8A 1CTQA 4NCKA 1JXOA 3T15A 3U7GA 3F0TA 2WOOA 3K1JA 4C0HA 1XXHE 4QBHA 4FN5A 2CDNA 1CJKC 1XXHB 4PC6A 2XNDA 2OFWA 2P5SA 3I1FA 4LUCA 2WJIA 1SGWA 3CUEF 5EXPA 2SHKA 2XJ4A 3AVQA 2WPDD 1VHLA 2C98A 4B6EA 4QNRA 2ONJA 1Z29A 2Q0HA 5JRZA 5AJXA 2F1RA 4XVRA 4DSUA 1P2UA 2JEOA 3RWOA 1Z0DA 5CK4A 4AKGA 4KSBA 4B6FA 1GNQA 4XTCS 3CX8A 3U60B 1MRSA 5IRCD 2B8TA 1E1RA 1CJUC 2FV8A 4MKIA 1Z6YA 3N2IA 4R98A 2ZYVX 4KXFB 2YOFA 3K9HA 3MD0A 4RZ2A 5BXQC 1J70A 1FL9A 3RWMB 2C2HA 3MLEA 4IVQA 2E9SA 1ZD9A 2IUUA 1XXHA 2YNMA 5JECA 3CM0A 5DN6D 4GT1A 4EAQA 3IEVA 4OQMA 1NVVQ 3D31A 3T12A 4YMTA 2F3TA 3TBKA 2C95A 3IEUA 5FOUA 1YZUA 1UEIA 3DM9B 1S3SA 2XTNA 3AF1A 3SDZA 3T1OA 4BLPA 5JMTA 2P6RA 4TZ0A 3IIMA 1E94E 1LNZA 4NYJQ 1T6NA 2BV3A 2Z83A 4PFSA 4LHZA 4C30A 3DO6A 1XFAA 3EARA 3MUFA 1FTNA 3U5ZB 4MGZR 4PZYA 1KZGB 1XJQA 5K8LA 3U61B 2NTYC 2A30A 1XTJA 1GTVA 1O3YA 5F2EA 2IYLD 3UG6A 4A8JB 1NIJA 3ECCA 1S8FA 1UFQA 2VHCA 5B57C 4N3NA 2IL1A 5EE3A 1Z3IX 3JVUA 3DM5A 3HP1A 4V0LA 4J0QA 2AD1A 5HCIA 1W2GA 2ZJ8A 4PAQA 4RZ3A 1IN7A 1E2KA 4KVGA 2QRNA 4MUAA 2VTKA 3W8RA 2G83A 3LRPA 4Q1DA 3CONA 3NVAA 4QG7A 4FCWA 1Z6TA 3BBPA 2MMCA 2AK3A 3QF4B 3PV0A 1Q0UA 2JLRA 2ZR7A 5SZIA 3TR0A 3KFVA 5CJPA 3LVQE 2EQBA 1QHNA 2V1UA 1G8PA 1NRJB 1Z0AA 4FCTA 4W5WA 4AI6A 3CNLA 3PUXA 4NYMQ 3U3MA 1F3OA 2IF0A 5JRJA 1JAIA 1XD9A 2CK3D 1Z5ZA 4RCZA 2FOLA 3QKRA 1I2DA 2O0HA 3QVUA 2R2AA 5F98A 4C0BA 5JSZB 2PCJA 2ZYTX 3ZYCA 5KDDA 4V02A 1QHSA 3WXMA 4DSNA 1AKEA 2IXGA 5AJYA 4FI3C 3CH4B 2UKDA 3QF4A 5C2JB 1U8YA 3I92A 4EFMA 2I1VB 4FIDA 1Z22A 2ZROA 4NCHA 3I8XA 3TUZC 5J4HA 1ZIPA 4BFVA 1NJGA 4K8OA 2ZAMA 4PO1A 1RE0A 1S1MA 1ZW6A 4XSGA 2A5GA 1HA3A 2Q9BA 3I73A 3KUCA 3GPLA 1QHXA 2J0QA 5JSZA 3V00A 3KQNA 4V0ME 4DT1B 4TQUS 1RRFA 1R0YA 4AD8A 2OCPA 3BAFA 3ZLJA 2IYWA 2CEAA 4HB3A 3CZPA 1W4RA 1XEWY 5FPKA 1SZPA 2GEDA 3E2IA 5K8IA 4RSGA 4TZ6A 1YE8A 1EX6A 3B85A 2B8WA 3THWB 5L8VA 2QT1A 3K0AA 2PBRA 1RZ3A 4GOXA 4TT3D 4X8MA 1OF1A 1RRPA 3SNHA 1BMFD 2CL7X 3OHMA 4C0KA 1AS0A 4NONA 4PSAA 1OXTA 4AG5A 3RC8A 1DAKA 4JL8A 1S0UA 2KE5A 1OKKD 3ADDA 3W9YA 4Q1EA 4DEYA 2EWVA 2WKRA 2DBYA 1XB2A 1E9CA 3K8YA 1T3HA 2CHGA 4V0MA 3SJBA 4BQSA 2ZRMA 3PVSA 1E99A 5KDLA 2XITA 5L3RA 1G64A 2WJYA 3CF0A 5B30A 1C1YA 2IYVA 1P73A 3FMIA 4BEBA 2VP5A 5D3QA 1KDOA 1T5LA 1XTIA 4N0EA 1W36D 4PSVA 1MRNA 3THWA 2XOKA 2W6JD 4NYMR 2OBLA 2YYZA 3CKLA 2ERYA 4LZZA 1JEEA 4P4UA 2MSEB 2GXAA 1XTQA 2A2ZA 4DDVA 5HZKA 3B9PA 2CXXA 4TMTA 4H1VA 4DLXA 4MA4A 3WYAA 1OYWA 3TIFA 5AK0A 2ZSEA 3LLUA 1DAGA 1VIAA 1JPNA 5DIFA 1W0JA 4Q18A 5HZHA 3QOFA 3RC3A 2FEMA 4DXAA 4TSFA 1XCMA 5CLQA 1TX4B 4XIGS 1HT1E 5C4GB 2HXYA 2D7DA 3PUYA 2DFLA 5UKDA 1OB5A 2YV5A 4NP6A 4DIDA 3BRWD 4FMCB 4W5HA 4ON9A 4GNKA 1NN1A 2QP4A 4KO8A 2O0KA 3BB1A 3BH6A 4WXPA 3IILA 2H8KA 4DVGA 1G8FA 4B34A 1OXUA 1E4VA 3CIOA 1CR2A 1YZGA 5DO9A 1J8MF 1ZCBA 3OIYA 2BHRA 4H1UA 4LYFA 4WBSA 3RS5A 2IX3A 4CGZA 2HJVA 5LD2C 3U6BA 4D4LA 3MJRA 4OHVA 3NBZC 2F7SA 2REOA 4HI0E 1D9XA 5JI3E 4C0QC 2YJTD 3GJ8A 1CF4A 4PO8A 1E9BA 1ZC3A 3OE7A 3C16C 5BN4A 1YZQA 5FL3A 3P27A 4MYHA 1AGPA 1DAMA 4IFBA 1HUQA 3VTKA 3HYRA 1SHZA 3EW9A 3B78A 4UNPA 1G8GA 1QHHB 1ZINA 4GMXA 2W83A 2AK2A 2A5FA 4TWZA 5CYPA 4ZCIA 4PTLA 4DLRA 2B7BA 2OAQ1 2GF0A 1OV4A 2GZHA 5DLQC 4NZYA 4TTPA 1Q1EA 1A7JA 2QEQA 3VHLB 5JFGA 2JA1A 1TTTA 4V03A 2LKDA 5CYOA 2GEUA 1CULC 1GG2A 1KO5A 1L4UA 2YOGA 1N5JA 2QTFA 1XMJA 5EUQB 4M1OA 2VPPA 3PUZA 3NBFA 4IOKA 2XTMA 3DMDA 4OJQA 1TQDA 1EFTA 4TL7A 2EWWA 3Q7QA 3R8FA 4KFTA 1E0JA 1FQJA 1K6MA 4YXWA 1IONA 3F3YA 3BFKA 1X8JA 1PLJA 1IHUA 3HU1A 2ZYWX 4ZDJA 1LVGA 3ZQJA 3CO5A 3FYHA 1S9HA 3ZD7A 1EGAA 1KSFX 1Z0IA 3C8UA 2IYYA 2MMGA 4KHZA 3K09C 4QBGB 3TVTA 5LB2A 4GMDA 1G41A 3QBVA 2GTPA 3UK6A 3IKJA 1ETUA 4Q01A 5ANRB 3A1WA 2FFBA 3B1WA 1P9RA 4ITRC 1FZQA 4JKYA 1KI8A 4HB4A 5KDOA 4B2IA 1Z08A 3LLMA 3WMEA 3V4RA 2GVZC 4A0RA 1XMVA 1RKBA 5KSYA 3FMFA 4NCNA 2P5TB 3FWYA 1II9A 3ND9A 3VU9B 2BDTA 3IQXA 1WCV1 1M74A 4HUTA 2ZJYA 1XCPA 3QG5A 6Q21A 2GJKA 3WP0A 5K8UA 3U6KA 5FPHA 3B5JA 4JJZA 3OESA 1JR3E 3I5YA 1X8KA 4HDQB 3W90A 5FBWB 1FNMA 2EFEB 2VL7A 4LJ4A 5EUMA 1Z63A 4JYCA 1HY3A 1G21E 1KDPA 4Q48A 4XOIA 1ZNWA 1D6JA 4JLMA 3WYGA 4C9BA 4ILEA 1Z6AA 4LJ8A 1DG3A 3VR4A 2BJVA 3KX2A 4UNQA 1OXSC 2ZRDA 5FTMA 1NY5A 1UKZA 3VU9A 2VP2A 2H17A 1MH1A 2B21A 4Q7MB 5HCNA 2J0UB 1CR0A 1PZNA 2OCBA 2JLQA 4BFZA 4O25A 1XTSA 3B9QA 2BBOA 4JIMA 3NWJA 1JJ7A 1JR3A 2QMOA 4ZKEA 2QM7A 1OYYA 3AUXA 5FOWA 1U0JA 1XEXB 1FX0A 1W1WA 1JECA 3B1YA 5KU1A 3GCGA 3S1AB 3THYA 5JEDA 4LPSA 1X1SA 4V0OA 4LPKA 4TLEA 2BWJA 4Q7KA 4XWAA 1EFCA 1N6KA 5KYKA 2XXAB 2WAYA 5KO2A 4Q02A 4MITA 2J9RA 4LBZA 2ZUCA 1SVSA 3Q3JB 3T61A 5KNCA 4PC3A 5CDFA 3B7GA 2GZAA 3I5XA 1ZAKA 1DG1G 4A0FA 3L0SA 1N6OA 1QHYA 4DBLC 2P2LA 2RGEA 1HT2E 4OQNA 4G3XA 1Q57A 4E03A 1G5PA 1OLOA 1XRJA 1M34E 1SVOA 2BBWA 1FOEB 1WDTA 1QZXA 2CHQA 1SVLA 4LBYA 4PX9A 1NNEA 1NIPA 3PXGA 4LSGA 4A0GA 4D6PA 4IDPA 1XEXA 821PA 1XJ0A 4IXNA 3S1AA 3QKSA 1IN8A 3ZVNA 1FNNA 1KK3A 2C9YA 2V54A 5JZVA 3QF7A 2CL6X 4Q03A 2ZUDA 4NDZA 4JMPA 1JQJC 1E32A 1ZMXA 1P2VA 2WICA 2ZU6A 4LBWA 4JKIA 2IYRA 4Z51A 1S2MA 4QJ5A 3K0EA 1KK1A 2AXNA 4GDFA 3JZAA 1FMLA 1GSIA 2JDIA 1GRRA 2CNWA 4QGAA 5HE8A 1US8B 1GITA 2CCJA 2J7PA 4QBFA 3EPKA 2NQ2C 4A4DA 2FWRA 1NMXA 2DWPA 1A2KC 2R44A 4FMDF 5FPTA 4PSKA 3NC1C 4DB2A 1S4QA 3D3QA 2I4IA 2WSSD 2G3YA 4DUGD 3AKDA 2A3RA 2FPMA 3WYFA 4M1KA 3A4NA 1RIFA 5D3MB 4A36A 2QPAA 3VR5A 3T1QA 1LFDB 2KBFA 2H16A 2Q9AA 4JLBA 2YKGA 1KNXA 3GJXC 3WMGA 3CPHA 3VR1A 5L3SA 3T35A 1VDZA 3KL4A 1DOAA 5G40A 2BCJQ 1T91A 1XF9A 2ZETA 3KFXA 2UVQA 3DDCA 4JLAA 2QTHA 1SHKA 1US8A 2VP0A 1W47A 3CWQA 4G5GA 5AJVB 5FR2A 1E9SA 3U3JA 2QBYB 4MUBA 2QAGB 1N6PA 2J1LA 3P1JA 4EPTA 1T5IA 2W2TA 1E2PA 5AJWA 2AL7A 5IK2A 4GPTA 5HR5A 421PA 4DHEA 2Q21A 3CLVA 5E7MA 1XTKA 2B92A 3OFNA 4D26A 1C4OA 2VF7A 1TAGA 1KSHA 1G9XA 2N46A 3LV8A 1HV8A 3KXIA 4AYWA 2GESA 3BC1A 2YWGA 1IM2A 5D3MA 2ORWA 2VSXA 1T4GA 4LHVA 5TDHA 4B74A 3AGQA 2R65A 3B60A 1ZUIA 1OFTA 3GMTA 4JVLA 4PO9A 3TAHA 3KQHA 2YOHA 3IGFA 2FGJA 4N0DA 3E70C 3KUDA 4L9SA 3WRXC 5BW8A 1E79A 4AG6A 2ZVQX 3VNUA 4Q47A 4Y0VA 3K70C 1GDDA 3T1TA 1TPZA 1I4LD 3ADCA 4D25A 2QAGA 721PA 2XSZA 1FQKA 4YDSA 3IPXA 1KAGA 2XB4A 4O3MA 2F6RA 3KJEA 4CT5A 3GFTA 4UQOA 3C14C 1E2HA 4ZDIA 3DZDA 4HUQB 521PA 4ASUA 3A8TA 4HLDA 3K9GA 3WHKA 1N0VC 5BWMA 1GL6A 4HYYA 1TEVA 2QROA 1Y3AA 3CX6A 3EWAA 4MH0R 2JLSA 1G18A 1G5TA 2PZGA 4ZCMA 4MRNA 1E9EA 2GBLC 1X3SA 4PR0A 1KKLA 4PXAA 3NIBA 3Q7PA 4OI1A 3CWZA 3KB2A 4JZKA 2AKAB 1CKEA 4DKXA 2X77A 1JB1A 1W4AA 5TB5A 3TQCA 1BO6A 3U4QA 4PANA 1I4DD 4OK6A 1ZU5A 2PT7A 1DS6A 1XWIA 5L3VA 4FMBB 3QEJA 2O8DB 1XD8A 2R6DA 2P6NA 1UJ2A 1N6RA 2CVHA 3UANA 2IYZA 4IDHA 3AGPA 4TMWA 2RGNC 2WSMA 1M6NA 4RKEA 4AKIA 4MRPA 3EWSA 4BZXA 1KK2A 2CBZA 4IXMA 1G20E 4LGMA 1M1YE 5FUXA 1AS3A 1UPTA 2R6GA 4TQ9A 4R9UC 3ZVMA 3RSLA 3QSYA 2RGNA 4IDQA 3B13B 4LJ5A 1E3MA 1TADA 2C8VA 3Q5EA 4Q5IA 4BUJA 1N6IA 1ODFA 4I1UA 1CJTC 2WBLC 4OHWA 5DHFA 4GZMA 3REGA 4G1UC 1U94A 2GCOB 2WMNB 4KODA 3UKDA 3KXLA 3IBGA 5BQ5A 4LV8B 1OH5A 3I62A 2O8DA 4XWKA 4LWZA 5C46F 1CXZA 4MDFA 3X1ZA 1TUIA 2OLJA 3KJGA 2Q9CA 2GILA 4W5JA 2YC4C 3C15C 1SXJC 4GI7A 2VIIA 5HPYB 1LS6A 1VCMA 3I61A 4GZLA 1PVOA 1JBKA 3P20A 5E7JA 2WV9A 3CNNA 4QRHA 5H1YA 1OFUX 1KSGA 4RD3A 3CF2A 3VR3A 2O8EA 4TYQA 4EFNA 3GLIE 4P4TA 2WWYA 2V3CC 4BLSA 3GLIB 2IYQA 4M21A 1HYQA 2DYKA 1AIPA 4Z1MD 4EPVA 4GOKA 3A1VA 2GCOA 3LXRA 4D4MA 1G7SA 3CPEA 3DOFA 3ZQ6A 4HAXA 1JJVA 3LQQA 3KQLA 2RHMA 3WP1B 3LO5A 4QHYA 1GKUB 2V1XA 4FW9A 3VAAA 4K46A 1X6VA 1LY1A 2C04A 1XPUA 3E1SA 2AFHE 4QOSA 1G4AE 5HKKA 4M1TA 2EU8A 1TF7A 3Q85A 4NHOA 2VHQA 3A36A 4LC0A 2NIPA 5KPJA 2BBSA 4A1FA 2QMHA 2H5EA 4URVR 5AWFC 1XJCA 2QNRA 3THXA 2XNDD 3GLIA 3HR8A 3GLHE 4LJYA 1G3RA 2ZJOA 4OI4A 1VHTA 2F43B 2IK8A 3GLGE 3GLHB 3GLGB 5FPSA 3RYTC 1ZM4A 1W49A 4DSOA 3QXXA 4CVNA 4B32A 4RZXA 3LNCA 1K5GA 1PUIA 1T0JB 1F5NA 2HCJB 4CEHA 3UMRA 2R6AA 3JVVA 4HB2A 3ZZ0A 1E1RD 3K0CC 2HLDD 3EIHA 3SC3A 3TW8B 3NHAA 2ZANA 1E2LA 5EE1A 2IYSA 4US1R 4URWR 2JJ1A 2V7QD 4DLVA 1TQ6A 4YONB 1F48A 3BB3A 4JSYA 5KSOA 1IBRA 3K0CA 1U90A 1KMQA 2XAUA 2G6BA 1AA9A 3CB4A 3LD9A 1GM5A 2F43A 2FU5C 3DMNA 4JLKA 3GLHA 2HEIA 1H8ED 4JLNA 4C3ZA 1E2JA 5H70A 3GLGA 4BFXA 1IAQA 4MYUA 1EESA 2FMXA 1PJRA 2H1LA 3KKMA 4L9WA 1W0KA 4DCTA 2X2EA 1ZM2A 3PEWA 2VO1A 2BEKA 1R6BX 1ZNYA 2ATXA 1E4YA 5BN3A 3NDPA 3M1IA 3PUWA 1KGDA 4QGGA 1K8RA 1P6XA 2OHFA 1XMSA 1XP8A 3IHWA 1SVMA 5GJWC 2IXFA 3AKEA 3AVOA 4UXIA 5EXXA 3SEAA 5FTLA 4IVPA 4X8OA 1G3MA 1G3QA 1GOTA 1KYIA 2NO1A 3ETLA 4LCBA 1WRBA 1R4AA 3EXAA 2WPDA 5IDVA 4G0NA 1S3GA 1Z06A 2DPXA 2FPLA 1HTWA 2Z4SA 2J46A 4FMCF 3K0FB 1GKYA 4UKDA 2ODEA 3ONWA 1OW3B 4JJKA 2RGAA 4DDTA 2FPKA 3KTAA 4XD7D 3CF6R 1BYUA 4QL3A 1W2HA 3H1TA 2ZSDA 3AH8A 2VLIA 4MRVA 1WXQA 1DAHA 2NO0A 3QKRB 2FSHA 2RH5A 3SN6A 2QE7A 2J59A 5J40A 2DFKB 4RFVA 2ZE6A 4Q19A 4EFLA 2NO9A 5CJ2A 3K0SA 1E0AA 1WQ1R 4RVCA 2IS4A 5EXTA 5AUNB 2C03A 2R6CA 2VHJA 1TF2A 1ZBDA 4KFRA 3LW8A 3EIEA 4Z54A 4DC9A 5FOVA 3BOSA 2V6JA 3K0FA 3EAQA 4O0MA 2ZI3A 1HEIA 3KDSE 5TARA 2JLVA 2QQEA 2RGBA 4HLUC 1NL3A 1OH7A 2F3RA 1G7CA 3NXSA 4BFWA 2R8RA 1BYIA 1YZLA 3KXKA 3SJZA 2BCGY 2D06A 3D6TB 2PZEA 1DO2A 4HLUA 3LBNA 3ZZUA 2ZM5A 2ZRGA 4PQFA 3L2OB 5BYKA 3KJHA 2BOVA 1E98A 4MGKR 1F2TB 1Y63A 3B1XA 1WE2A 3B1VA 2F1HA 3WBJA 2QGNA 1IXRC 1AGRA 2QQ0A 5KHOC 1AS2A 2OT3B 4O2LA 1KIMA 3FFBA 4WZ6A 5FH9A 1ZU4A 3PENA 4JLPA 1DELA 2FF7A 1NLYA 5AR1A 4F4CA 3K0AB 4M1SA 3H86A 3EZ6A 3X2SA 1U9IC 1GL7A 2FSFA 2OCAA 4CRWB 2OBNA 2O0JA 3HDTA 3BJIC 2IUSA 3DL0A 5CIQA 4DWJA 1U9IA 1KK0A 1P61B 1YRAA 3LAWA 3MJHA 2GXQA 3HWSA 1LTQA 1UDWA 1WMSA 2RGCA 4OJKA 1F2TA 4PC7A 4A6XA 4DCVA 2EW1A 2GAOA 3U7FB 1Q1QA 4CIDA 3VR6A 3SR0A 3A1TA 5FOXA 2ONKA 1TQ2A 4GBMA 1KI4A 4KJZA 3TVDA 2VP4A 4E5UA 5B2ZA 3EPJA 4C0SA 3CNOA 2ZYUX 4G5RA 1QBKC 2A5JA 4UNNA 5IF9A 4II7A 4NMMA 2ORIA 2JLZA 2D7CA 2NPIA 3AB3A 5CM9C 3RS7A 5JHHB 2FFAA 3FFAA 4HLQB 3LBIA 4LHYA 4A0HA 2ZXUA 2QRZA 1CR1A 2ZSAA 4DLZA 2XOKD 2ZRKA 1M7GA 2GCNA 5KNBA 1HQCA 1JI0A 1YVDA 4MQBA 1ZM7A 1A82A 1NN5A 2KBEA 4Q1FA 3MGCA 5JCPA 1X1RA 5KNDA 1EFHA 4DCUA 4C2TA 4GOJA 1KTVA 4NE2A 2ANCA 1IJFA 1II0A 1P2TA 2WKPA 2Z5FA 4WIAA 2W2XA 5DI3B 2CLDX 2Z0MA 1W0JD 3C7KA 2CL0X 2ZS9A 4L15A 1NP6A 4TL6A 2C9CA 4M22A 1N0WA 2EFHB 4JSTA 3U7EB 3P4YA 1KDTA 4OQXA 4PZLA 4TT3A 4PHGA 1VYTA 2QG6A 1C9KA 1L2TA 4HAVA 3C5HA 4OK3A 1NKSA 1BS1A 4B47A 1G6HA 5FPYA 1KY2A 2JLYA 4Q9HA 5DGXA 3WY9A 1GL9B 5DE3A 2Q3FA 3B1ZA 4IFEA 2HF9A 3UIEA 3THOA 1W36C 2FZ4A 5LD2B 2D4HA 3O8DA 5LPNA 2PL3A 1TQ4A 2OAP1 3PQCA 4LHXA 5DI3A 3AVXA 3W34A 2J5XA 1GUAA 2G77B 2VHUA 1E1QA 2XZLA 3W6NA 4PPFA 5JLJA 5CITA 1ZRHA 2W6JA 1ELOA 2QORA 2J0VA 2J41A 1MO3A 3AF3A 3OE7D 4KVAA 2VRWA 2WWWA 1Z28A 2GEVA 2XEXA 1Q21A 3MWLA 3RHFA 4OQLA 1TF5A 2VH5R 3N2EA 4NBSA 5FBRB 2WWHA 1ZNZA 2HXSA 4R2HA 1B23P 2OESA 1DVRA 2JASA 1JR6A 1G8HA 3M4YA 3IIJA 4QFMA 4A2WA 4JVMA 4DIEA 4LDJA 4BRWA 4KLNA 1R2QA 1VYVA 4I4LA 2J0SA 2IF2A 3AM1A 1CJVC 3Q9LA 1SVKA 4M9SA 3MG9A 4KU4A 3I72A 2XNSA 5JBQA 4LY6A 3DHWC 3OEED 4DLTA 1UKEA 4C0AC 4S2EA 3EX7C 2VSFA 3AP1A 3JZMA 4NCIA 1N5KA 4EPWA 4B33A 3AKCA 4YXWD 1WBDA 2JLXA 3BS4A 4KYUA 4Q1BA 3J81k 4BASA 3QVVA 4FD2A 2NO7A 4B75A 5EE0A 2O52A 2G88A 5G3ZA 1N5LA 3AVTA 4A92A 2A7QA 1Z0JA 1T3LA 1XX6A 1AKYA 5F9FA 3LXXA 1XDBA 1KMHB 3C41J 1XTRA 4MKFA 2WHXA 5LB4A 4WW0A 1IY2A 3CPJB 1A5TA 1KHTA 2HDNB 4ZIRA 4B3DA 5JJKA 3RRZA 3W5IA 2ZUBA 2GF9A 3C4JA 3GJ4A 4LRWA 1PUJA 3NEYA 1N5IA 4KAXA 2A9KA 3AKYA 2HCBA 2ODNA 3FKSA 3VQTA 2IA5A 2ODBA 3K09A 2H92A 2X2FA 5DHAA 3DKVA 3RS4A 3N5CA 2GXUA 2WKQA 3AV0B 3SZRA 3W3AA 2XB2A 2QENA 1VKJA 2DCUA 1RFLA 2NZ8A 4QHTA 3VR2A 4DB4A 3G0HA 1GRQA 4FXPA 2RAPA 1KMHA 3CR7A 3OIWA 1GNPA 2KSQA 4XVQA 4AK9A 4GP6A 4HZUA 2VP6A 4OKSA 1OFHA 2OEPA 5FL7A 3RRMA 3ZD6A 3AP2A 1XZQA 5JEEA 3ADBA 4CT4B 4S35A 2EFDB 1L8QA 2GVDC 5FUYA 1JXMA 1ZP6A 2NG1A 221PA 2XZOA 2AFIE 1IN5A 1FX0B 2ECKA 1DE0A 4F4IA 1B0UA 4JBYA 2JIZA 4C0JA 3O8RA 4YLGA 2PX3A 3PEVA 1FP7A 1E9FA 4OL0A 2C5LA 4BZPA 5CDFE 1JR3D 5LDDC 1IY1A 1KJZA 2QM8A 3K9LA 2A78A 5JCZA 1OE0A 2ZJBA 3LVRE 4UXHA 1G7TA 3U3OA 4KITB 2ZE8A 4MRSA 4X8HA 3KZ1E 4BE7B 1ESMA 3MSXA 3ZDQA 2BIFA 4DLUA 3EZ9A 4C0LA 4K81B 2FZLA 4R2IA 1R10A 4M1YA 3CRQA 3OIUA 4JYBA 4IDOA 3RS3A 1HE1C 2BM1A 5EP4A 3QKSB 2FA9A 1NBME 2W0MA 3OAAD 3QKTA 5C1BA 3ZGXA 3QENA 1D5CA 3A1SA 2ASEA 1GAJA 4Q66C 4FWIB 4ZCLA 4DSTA 3NBXX 1A1VA 3VNVA 5TV2A 3KQKA 4C7OA 2ERXA 1R8SA 2VP9A 2YVUA 1I2MA 3P4XA 3PITA 1IXSB 3QXSA 3SYLA 1UADA 3QEOA 3WRYC 2ZRIA 4ZDKA 1XNJA 1IN4A 1E2IA 2P67A 1XU4A 3H0KA 1W44A 3RRNA 5IHPA 1P62B 3QQ5A 1GWNA 3AQ4A 3PG5A 4JS0A 2PH1A 2D62A 4TYWA 1NG9A 3M0EA 1UBFA 2NOAA 2QP9X 3EPHA 1EFRA 2YINC 3ASYA 1TEXA 3TRFA 2CNWD 2WJJA 4TLCA 1MT0A 4LC1A 1NBMA 2Y8EA 4WAUA 1YR8A 1E2NA 1GRNA 1XD2B 2ZS7A 3MRSA 2VBCA 4P32A 3VX3A 3GLFE 2QU8A 2ZI6A 1QG2A 3TSWA 5L3SB 5TMPA 4YMVA 4IKEA 3GLFB 5KOYA 1XCGB 2J45A 2G0TA 4ZO4A 4O2RA 4B2PA 3KQUA 3UXMA 1E2DA 1Z07A 3MWJA 3N70A 1XBTA 3NDBB 1SULA 2VYFA 2RGXA 1ZD1A 3SS8A 2MSCB 4TQAA 2D2EA 2XZPA 3GEHA 2P0EA 5FOTA 4AIIA 1LF0A 5FI0B 1E0KA 2EVWX 4IOJA 2YWHA 5F3WB 1XD2A 2O8BB 4D0LB 1T8TA 5IK2D 3QKUA 4URYR 4EQ6B 4AY2A 3GLFA 1P9WA 1N25A 3OFND 3TMKA 5CB8A 2OO7A 1OB2A 2IC5A 3SJAA 3BK7A 3X1DA 1KAOA 2XGJA 4JVSB 4C4PA 1YU9A 3IBYA 2PMDA 3W6OA 1OIVA 1UF9A 2RGGA 3KB1A 3BXZA 3CX7A 4CDGA 2CMKA 3UPUA 2J3EA 1P4SA 3OZXA 1G3UA 2RMKA 1H65A 3RANA 3K70B 1NVUQ 2WWFA 2WM9B 2K5UA 1E79D 2BMDA 4U02A 5DYIA 3BORA 1GKIA 1UKYA 1KI7A 3EG5A 2CVFA 1DO0A 1MO4A 2WSSA 1U0LA 4DUGA 1AM4D 3BH0A 1NLFA 5AUOB 2O8BA 1XPRA 1DAIA 3UMFA 2W6ID 1W46A 2Q3MA 4EQ6A 1SVIA 1W5TA 2W00A 3LQRA 2GZDA 3BB4A 3PR1A 3U4QB 4ASUD 1COWD 4B3CA 3FVQA 1KO8A 2QP3A 2QGZA 2TMKA 3HPRA 2CCKA 2DR3A 1V43A 1D2MA 3X1YA 1Q1ZA 3LDAA 3GQBA 5DISB 2GK7A 2V55B 3A4MA 1NI3A 3WBKA 1OXVA 1QVRA 1D2NA 1KO1A 1NMYA 2IT1A 1NSFA 2V4ZA 3AF4A 1NN0A 4AWXA 1BIFA 2WOJA 1VG1A 2ZU0C 1R5OA 3GJ6A 2ZE5A 1H8HA 3ASZA 4LYJA 5HTKA 1HQYE 1UBEA 1MR3F 4X8LA 2GBLA 3EC1A 2KI5A 1KO4A 5E3HA 2N42A 4NYIR 3VX4A 3NC0C 2ZR9A 3IO5A 3ICQB 2IYXA 2JJ2A 1XMIA 1U0HC 2ATVA 1VCNA 4KBFA 1DBSA 4LJ9A 4RKFA 5FTNA 1QF9A 4CZ2A 3UMSA 4HZIA 3LY5A 1FUUA 1SXJE 4PPGA 4PC2A 3ZIAA 3PEYA 5J4VA 1SXJB 2O8EB 2ANBA 2PX0A 2QL6A 1XEFA 3AUYA 2IS2A 1SKQA 1OFIA 2WTUA 2HUPA 4M9XA 4Z8YA 2IXEA 3RS0A 5TY0A 3TSZA 2ZPTX 4B2LA 4XWOA 4Q1AA 1LB1B 4EPRA 4OBEA 1T3SA 1Z0KA 4ZPXA 1NN3A 4JL6A 4DLSA 4JL5A 5FTKA 1OHHA 3PEUA 1VYUA 5KSZA 3FB4A 4M53A 1AQYA 3QBTA 3EC2A 2WIAA 1GVNB 1FUKA 1ZUHA 3CZQA 3R7WB 3U7HB 4IDNA 1R0WA 1W4CA 1SXJA 3SQWA 3WHLA 1ZC4A 2AN9A 1QRAA 3THXB 1P72A 3HR7A 1KDRA 2CE2X 4Q4HB 1DTSA 5JS8A 1RPZA 4Q1CA 4M8NE 4BLQA 4A6PA 1OT3A 3TKLA 3WNBA 3LFUA 2G1KA 2YWFA 3REFA 5GJVC 5HKKD 4PPQA 5JWRA 2V6IA 1LS1A 2WVJA 4LYHA 3FE2A 1TUEA 1VG0B 1ANKA 2C9OA 3W3ZB 3GP8A 4MYTA 4ACAA 2IUTA 1YHNA 4ESHA 4CEHB 3UG7A 4PQYA 1UEJA 2XX3A 1E2QA 1ZM3A 3F5FA 4PHHA 1YR9A 3RNLA 3R7WA 4EJSC 3FTQA 3I3SR 1Z6GA 3VFDA 3AP3A 2WWIA 4LX0A 3MCAA 2RGDA 2ZI7A 2YWEA 4NCJA 4Q4HA 4DJTA 1Z83A 3B6EA 3FDIA 3TLXA 3P32A 3BERA 1WB9A 2ZVPX 5FTJA 4ABYA 1W5SA 3C5CA 2RB4A 1U98A 3EZFA 2GDJA 3OEHA 2C96A 4FINA 2G0NA 3DZ8A 3UWOA 4DCNA 2ZRNA 1TL7C 2ZTSA 4IW3B 1JAHA 3SFZA 4QM7A 1HURA 4TL9A 4XSHA 5JS7A 3AVYA 1QDEA 3DPUA 1W0KD 1TU3A 1ZM9A 3I4LA 3BFVA 4L16A 5H68A 1KJYA 1KI6A 5P21A 1N2CE 1VCOA 2NO6A 4GSYA 5E95A 2AKYA 4URUR 5EXSA 1BKDR 4WOPA 3KKNA 1P9NA 1Z8FA 3KTAB 3IUYA 4PZZA 2IEYA 3ICEA 2F9MA 3CRW1 3TK1A 1G1MA 1LF5A 3T34A 1NKTA 2IWHA 1NF3A 2Z4RA 3ZS8A 4BGDA 2GJ9A 4TYNA 4XVUA 2OUKA 1D9ZA 3TUJC 2Z6VA 1VIYA 4JT2A 3CH5A 4V0NA 2FE4A 3L0IB 1KO7A 1HE8B 2WWGA 3O47A 4F91B 3RRYA 2IHYA 3BE4A 4D0GA 1P3JA 1WP9A 2ZRAA 4BECA 3NH6A 1UBCA 3EPLA 4NTZA 2HLDA 5FBVB 4P31A 5A0FA 2NZJA 1UAAA 2G1JA 4ZI3A 2V7QA 3G5UA 1Q44A 2DHRA 2QT0A 2AHOA 2FG5A 2QE7D 4LBVA 4D4KA 1NVXQ 1GIAA 3EZ7A 1RVDA 3THYB 4I1OA 5EP2A 1E96A 4UJ5A 1JNYA 4KV9A 1G19A 2FNAA 3VHXA 1H8EA 4L4UA 4JLVA 2WWXA 1U8ZA 4DLYA 1Q3TA 4RY2A 1GP2A 1VG9B 4Q00A 3AVVA 2X8AA 2FDCA 5DN6A 3U44B 3CBQA 4KLZA 4JBXA 2JLWA 1Q1BA 4QGFA 1N6NA 1UBGA 3D7MA 4WZBE 1BOFA 4UNRA 2F1IA 5DI9A 4B3GA 4LV6A 2OG2A 3W6PA 1FW6A 5GVRA 4PPNA 1M7HA 2ZJ2A 5HE9A 2ZRCA 4D0NA 3H84A 4F92B 4R7ZA 1NLZA 2QI9C 1ZIOA 4TTRA 1A2BA 2A5YB 2P6UA 1E6CA 1P5ZB 2QA5A 2R9VA 3BD9A 2OLKA 3GJ0A 4XD7A 3VKWA 4FWTA 3SFVA 2W58A 1S9DA 1RJ9B 4A2PA 4OK5A 4A2QA 4AYXA 5J47A 2BMEA 3U44A 1CU1A 5FBLB 2QMUA 3OF5A 3QI2A 5CB6A 4A8JC 8OHMA 3MFYA 5DYGA 3H2YA 2B7CA 1GZSA 5BYJA 1EWQA 4NH0A 1W4BA 3IIKA 2X19A 3NEJA 3A6PC 1Q12A 2HJGA 1FP6A 2WJVA 4OYHA 4A8JA 2QAJA 4M2LA 3NBYC 4D80A 5SZJA 3K9NA 4OI2A 3QPWA 1J99A 2J7KA 1KI9A 3ND8A 4U5XA 2O5VA 5CM8B 1CR4A 2ZSBA 3ZVRA 2OXRA 1W48A 3MMPA 4TN1A 3FHOA 3TJZA 4I1SA 1JQLB 3LW7A 1U8AA 1VPLA 1RJ9A 1D2EA 2FN4A 2H57A 2IS1A 2F9LA 5FOSA 2CK3A 2GRJA 4NL4H 2CE7A 2EYUA 2GCPA 2HYIC 4F38A 3O8CA 2D74A 2ZRJA 4L8GA 3PCRB 5FBQB 1ZJ6A 5B64A 4D81A 4JLOA 1SQ5A 4QKQA 4R71A 5SZHB 2VQSA 2ZITA 4JBWA 1UDXA 5KUTA 3HU2A 1WA5A 3KKOA 4Y0AA 3KKQA 1CJMA 5DSZA 2BKUA 3RVBA 1V5WA 1NVVR 3TGPA 2V8OA 3BFXA 3GFPA 4Q7LA 1FMJA 4AKEA 4BLRA 2FH5B 1QHGA 2C77A 4JVNA 4KFUA 4P33A 4RD2A 2BMJA 3NHBA 1YZNA 4NYJR 4B73A 4JLJA 1AZTA 4A9AA 4PHTA 2ZAOA 3D8BA 3AVPA 3B8HA 1HH4A 3OIVA 1U81A 1PLKA 2O8CB 1ZVQA 2QUZA 5JJIA 3PJRA 1G3IA 1D8TA 5A4JA 2ZRLA 4HAZA 4OHZA 4TYPA 4LOAA 1T9HA 4DDWA 3AVUA 3R9IA 4DLWA 2DWOA 2PJZA 2PEYA 1P60A 2C99A 2ZJAA 2XTZA 4URXR 1Z47A 1W7AA 1G17A 2AWOA 3L8ZA 4TSFD 2HV8A 1SVWA 1EFUA 2EFCB 1W36B 5BN5A 2D3WA 3HPQA 2FJUA 4DT1A 1CRPA 3A58B 2GETA 2EYQA 2HF8A 4LJAA 4QJ3A 1G8YA 3TQFA 2IS6A 2FFHA 1E69A 2IW3A 5E4FA 1BMFA 4UNSA 4PHFA 5TVKA 2OSBA 3I8SA 2O8CA 4I81A 4JT4A 4Q9JA 1OKKA 1G6OA 1MO6A 1E1QD 3I32A 4QGHA 1MABB 4URZR 3CW2A 4KCGA 4TTQA 2ZI4A 5H8WA 4IRUB 4Q9KA 5EE9A 2DWQA 4TMZA 2OBMA 2ZRBA 5TXGA 1DADA 4LI0A 3P26A 3A1UA 1IJEA 4NU0A 4RD6A 1N6LA 5EZ5A 3QPUA 1OIXA 3ADKA 5LBIA 3RABA 5A5GA 2WIBA 1NSTA 1KZ7B 4KBGA 4LV5B 4PC1A 3MWKA 2ZIAA 4M9ZA 1E2MA 3Q5DA 1I4TD 3IPYA 1G7RA 4YDHB 4RFSB 1MABA 1QHIA 4JLDA 3ZVLA 1LV7A 1ONBA 2CLCX 4I1VA 3PFIA 3TR5A 1TMKA 4EPYA 1ZCAA 2QMEA 1R7RA 3ZH9B 2R62A 1G16A 1TU4A 4M9QA 4Z8XA 2OZEA 3RLFA 1M7BA 3SHFA 1ZUNB 2UZIR 1AQUA 2FSIA 1GNRA 4YQFA 5JJLA 2JCSA 4ZIRB 1E0SA 4HAWA 4TLBA 1MO5A 3B82A 5EP1A 5FUWA 3DKPA 4M1MA 4B48A 2OFXA 4IOLA 4OQFA 2BEJA 4RFSA 3T1VA 4Q21A 1R0XA 1U2RA 1EG7A 4HEJA 5DNYB 2L0XA 3B2EA 4WA7A 3HU3A 3IO3A 4D4JA 4G5QA 2QPOA 4DEXA 3AF2A 1LW7A 3ZS9A 2FSGA 3UATA 1XZPA 4E22A 1DAEA 4B3FX 4LHWA 1J90A 2EFGA 4QXAA 3QY0A 5AUPB 3TH5A 2BVNA 1MKYA 2PJRA 4HZUB 3FKSD 2O8FB 5ELXA 2ZREA 3QE0A 5B58C 4QM6A 4MGIR 4G5SA 1QVAA 4ARZB 2WJHA 5L3QB 4MKGA 2OCYC 4YMSA 4YC7A 1XPOA 4XTRA 5KTYA 3TW4A 1F6BA 2Q3HA 3OEEA 4EPXA 4TMVA 4KSCA 4ACBA 4B71A 3GJ5A 4KFSA 4TL8A 4E07A 1L7VC 4W9MC 4US2R 2OM2A 4I99A 3TUIC 4BFYA 2ZJZA 2CLSA 3L82B 4KI0A 5FL7D 3FPAA 4XH9B 2GK6A 2HYDA 4HLCA 1QHHA 3TAUA 4PQRA 1IOZA 3K53A 3Q72A 1NJFA 1DPFA 3SI7A 2QSYA 2ZEJA 3VMFA 2FFQA 2RHDA 1IQPA 4PAMA 3U3KA 4LYAA 4DDUA 4HATA 1KKMA 1Q20A 4YMUA 5JWOA 2O8FA 1OIWA 3AEZA 2IBMA 4BFTA 3VKGA 2JIZD 3CR8A 4OHXA 1P2SA 4GFDA 2IYUA 4HAYA 4ARZA 1KI1A 2OE2A 1KI3A 2DFNA 4W7SA 5L3QA 3SHWA 1OSNA 4BEJA 3BIFA 1YR7A 4AC9A 4US0R 4BLOA 3LX8A 3O8BA 4UXJA 3H4MA 2BM0A 4B43A 2GJSA 1OH6A 1ZYUA 1J8YF 4BZQA 4GL2A 4BWYA 2HT6A 2P3SA 2XJ9A 3FMOB 3Q8XB 4B76A 2QTVB 5FI1B 4C7OB 1RW4A 3PUVA 1CBUA 1YR6A 1DARA 1GFIA 5J5CA 4EUNA 3MWYW 2G9NA 2I1QA 1RYFA 5K8TA 2ZE7A 2PLRA 1R8QA 2PCLA 3SYNA 3MAAC 2ZQ5A 4IVRA 2PZFA 4Q7JB 4A15A 2IWRA 3RSOA 4IEIA 4ZI2A 3R9WA 3WNCA 5GVSA 2DFTA 2ZRFA 1FTSA 2NMVA 4BLTA 3T06B 2YZ2A 5JHGB 1E9AA 3R8CA 3FOZA 1ESNA 2FEOA 2CCGA 1FFHA 2YC2C 4NKRA 4CW7A 4HAUA 3IQWA 2OV2A 1JEDA 3LH5A 2HT1A 2VHTA 2W0SA 4QC2A 1KSJA 2LWIA 1EFRD 3A37A 1PLLA 1NBMD 3CRMA 3W5JA 1NMZA 3QNUA 2DB3A 2REXB 1KNQA 2JLUA 4A82A 5FUVA 1R0ZA 2BC9A 2VF8A 3R9XA 1N0UA 1OXXK 2QPTA 2DY1A 1Z6XA 2BMFA 2JDID 3L0OA 3FGNA 1K5DA 3GEIA 2J7PD 4E09A 1NY6A 1F60A 5GJBA 2J0UA 1IXZA 2H18A 1O87A 3EA0A 4MGYR 1KOFA 1R5NA 1J2JA 1RRGA 2ZRPA 3V4FA 1AK2A 2BBTA 3OAAA 4M1WA 1RYHA 3L8YA 4B35A 1OPXA 2ZR0A 4L5BA 2QZ4A 4HDOB 2FX3A 4EIWA 3LWNA 1N6HA 2PMKA 2ZS8A 3NTUA 2E87A 2BJWA 2A5DA 4EKDA 2CJWB 4NYIQ 3DOEA 1EXMA 2KB0A 2P65A 5CK5A 2JJ8A 3GD7A 2QN6A 5JWHA 5FFMA 3GEEA 2ZI5A 1S96A 2XXAA 3PIRA 1OJLA
chains in the Genus database with same CATH superfamily
2Z3ZA 4TV8A 1KQGA 3HDVA 2YASA 5JVDB 1FPMA 1YZKA 1ORDA 1E18A 3E61A 3G5TA 4WNCA 2WJGA 3QTBA 3RPEA 1NXTA 4DUYB 3LPMA 4M37A 3SHVA 5D5QA 1YZTA 1H2FA 3UJ9A 5HEKA 4CEJB 1U1FA 4HRXA 2H85A 3G0OA 3NNSA 4XEUA 3DE5X 5CNJA 4IUDS 4ZWNA 2HX1A 1Y42X 2GZMA 5M04A 1UOEA 4Y9SA 3ENQA 3AIKA 1Q1AA 4UVDA 3RRBA 2V9PA 4I4TB 4BMNA 5SZKB 3DJFA 3FUVA 1WF3A 3B8EA 3K9BA 3KYJB 4EUEA 2W2VA 4HDMA 3O4JA 3UB4A 4YCMA 2HA0A 4C1NA 1A8UA 2NUAA 3LCUA 3MAJA 4RHCA 4ZDWA 5C1PA 3OZCA 5EPOA 2XQKA 2YBEA 2JCBA 4ZD6A 2IEZA 2JGNA 4R1SA 3PA8A 4CG2A 1EX7A 2IHBA 2RHWA 5EJEA 4KN8A 4FT2A 3QG1A 1IZ9A 4U7TB 4KQKA 4BNGA 1RLUA 3K70D 1QIHA 1A7AA 1KY3A 3T3DA 3TD6A 4DA8A 1PD1A 2GKSA 1MV5A 4E46A 5JMWA 1GNTA 3T9CA 4BO3A 1GQSA 2ZXFA 2ZRHA 3U1TA 5IF3A 3QBDA 4TLDA 2Q5HA 1TCBA 1ZKMA 2YCLA 2ZIXB 4GI3A 2M1XA 3H9EO 1RC8A 3AOEA 4Q3OA 3UGJA 4DLAA 4I55F 1ZXLA 1F2UA 5HMLA 5CIYA 4E6PA 1I2CA 1CUDA 1V1RA 1B3RA 1V25A 3IVAA 1JU4A 5ALHA 2DE0X 1SFRA 4Y2UA 2UYHA 5F76A 2I4OA 4MKHA 2GH1A 3DV0B 1SKYB 4CF7A 3U26A 2JJ2D 4M88A 4XLLA 1SWWA 4AYTA 3QXCA 3JYQA 5L7YA 2E1RA 4BE9A 2V96A 4HGOA 5BMVF 2WAXA 3FHCB 3CINA 1W96A 2GNPA 1I0ZA 4L08A 2YH2A 4CM3A 4TMXA 2ZSFA 1IIBA 1NVWQ 2W2QA 2PDAA 4PONA 3CVVA 1CS0A 3P0JA 2DLCX 1CUXA 1E2FA 1WMDA 2H0AA 3HN2A 3KVRA 4GD3Q 3ZIAD 3TSAA 1RXVA 3KQSA 4O4LB 4WZAB 2QXTA 2WDPA 3VU0A 1UBKS 1N3BA 1YI1A 3RVLA 1Q74A 5K09A 2NACA 4O5OA 2WF8A 4FFDA 4BEWA 1DTWA 3VKHA 2ODWA 2ETXA 3C6QA 3I2KA 2QQFA 2Y4NA 5BV2P 2I80A 4HEQA 1M2HA 2GM5A 1NQUA 2NGRA 4DRYA 4PNZA 3ZJYA 4C43A 2FMTA 5EN4A 1J00A 1X7ZA 4NRDA 2C92A 1K3FA 2Z5LA 3LXMA 2VDOB 4XIYA 5CLLA 4BRUA 5LBTA 2AZMA 1QIEA 2DFPA 1T5OA 5CGZA 3EBOA 4IY1A 3AHCA 4DZTA 1GJRA 1RDFA 1AN0A 4GF5A 2QLJA 3FCXA 1MB2A 1X0VA 3I0ZA 3HWX1 1EHCA 3B36A 3DE3X 4NBLA 2AX4A 4QBIA 3G9ZA 5LNK1 1YSCA 3MTIA 1EFVB 3RS2A 2EJTA 4XLTA 2SBTA 4R2LA 5FBHA 1G5RA 2AYXA 2EP7A 4FFWA 1E77A 3NKVA 2ET6A 1IUKA 1XVTA 1E7WA 1VMDA 2OCKA 2QTWB 4G0PA 1RYNA 4H7DA 4YMWA 4F2WA 1FSPA 3TE6A 3LIPA 1EBFA 4G36A 2YRFA 4CNBA 1QJ4A 4Q4AA 4R2WA 3Q98A 3TNDA 3T5DA 3FCYA 1YL5A 1ZSVA 1XEWX 2N1BA 3NGXA 4GE0A 3KE9A 4QODA 1AZSC 3JWHA 3RARA 4GS5A 4R1QA 3T4XA 3LK6A 3GUHA 4ZJYA 4G84A 3E9EA 4XJXA 1RBZA 2H65A 1M8GA 2HWXA 4Q4JB 4XW2A 3ZQ4A 4B3MB 4ARIA 2M2IA 4OHKA 3F1LA 2GWHA 1MIHA 2H08A 4Q3EA 2K7ZA 2Q6IA 3VDQA 4XAQA 4R1LA 4F04A 3RREA 1UXOA 5EQTA 2FXVA 1NVTA 2J0EA 1VL2A 4PSCA 3S68A 5IM4A 4EI7A 2UZ3A 5ILQA 2P8JA 3EE6A 4PGAA 3HO1A 3NYRA 4TLAA 1M1YA 1Z62A 1UJCA 5BSKA 2JZCA 1K8XB 1ICIA 3ESXA 1II8A 1QYWA 4Q15A 2BDUA 1L7QA 2IYTA 1MOZA 4V0KA 1JJFA 1G4UR 1KAEA 4RWZA 1JG1A 5H3HA 1MGPA 4GWKA 1SOVA 3EMKA 1Z5PA 2PGOA 2X4DA 3COVA 4AZSA 3CH7A 4KIJA 1LRJA 3NTQA 3IVXA 3OEHD 2XBMA 1E7QA 1H6AA 1LDBA 3E22A 2ZI9A 3EYWA 3SZGA 4EJSA 1DAFA 1LBEA 1VB3A 4D5GA 1VZ2A 3Q4GA 2YWXA 2PLFA 4B83A 5ENZA 4DIBA 1RAEA 3A6HA 4PLVA 3ZCQA 1MORA 3LBYA 5JZOA 5B1HA 4M0CA 4Z1MA 4DG9A 2ALJA 1PWEA 3DTVA 1UBHS 3ZHRA 5JY6A 1R3DA 5GADl 1FXWF 1UM8A 2KWIA 3QTLA 4TZKA 2J33A 1M8PA 2IKQA 4JLSA 5KVCA 1I7DA 3T3MB 1CR6A 4FDAA 4F71A 5EMKA 4LRYA 2VQEB 4W7IA 2Y27A 1JDSA 5IT5A 2O3SA 1GA1A 4HXEB 1EK0A 3A4LA 4ARSA 2OXCA 2IU3A 4H6PA 2WMOB 2YHSA 5G3YA 3O3MB 4REQA 2JAQA 3VHQA 1CTQA 3T15A 3G1WA 4OXQA 3OOSA 5JANA 4ZTUB 4GICA 2I6FA 1DWQA 3F0TA 4MQEB 4R7TA 3K1JA 4R8SA 3W6UA 3D5TA 2D0OB 4WADA 1HETA 4YAUA 3IVRA 4XSVA 4QBHA 4HUJA 1O95C 2GBFA 3AEQA 1XXHB 2K2WA 4ZVRA 1IU9A 4GZ6A 4X1OA 3WL3A 1WAMA 4XLZA 2C7PA 1VDMA 2EL9A 5FXMA 3OOHA 3O31A 4KN6A 5F5LA 3Q3CA 1Y6QA 5DLYA 2PG3A 5EMMA 1VHLA 4LYYA 1I9CA 4QNRA 2ONJA 3O3CA 4B6EA 4BY9E 3OECA 2GS9A 2P4HX 1GUZA 2Q0HA 2SKEA 1S01A 4ZV7A 4LS3A 4OP3A 2YZKA 4KVFA 3LZCA 5CFQA 4GBGA 1E58A 3DW1X 1YCGA 1GNQA 2JFPA 2VCHA 4Z6KA 1IDN1 5ITSA 2JFXA 3LUBA 4AUKA 2HWWA 3EXFB 3U49A 4ZFNA 2DT5A 3QYFA 4KZPA 3EZNA 3WLTA 2YOFA 2Z30A 3VM6A 5BXQC 3RWMB 4DV2B 2EZTA 3ED5A 2IUUA 4FX2A 1P1HA 3SR3A 3HM9A 3RTGA 2YNMA 1TC2A 3JQ8B 5F3RA 4H17A 5EWLB 2JL1A 4X1YB 1L7EA 1QUFA 4EAQA 1S2LA 3K1YA 5FLKA 4OQMA 3G2MA 1QGAA 2VZ0A 1XLUA 4JY7A 4Y3UA 1F0KA 2Y67A 3SDZA 1MDBA 1PD0A 4G23A 4F86A 4BDSA 3H1FA 3G2IA 4MRMB 4DIOA 4LHZA 4KR6A 4NZMA 4AU1A 3EDOA 3ZWKA 1XMXA 4G0ZA 4DL9A 1XFAA 2H1CA 2DBZA 3FLBA 2BUBA 4EW6A 1HG1A 2WAOA 3LHFA 1AKTA 4CR6A 4P3KA 5F2NA 3U61B 1A1SA 1VGVA 2A30A 2IZZA 1UBOS 3O03A 4P5DA 4YDQA 5F2EA 4FK8A 2XCRB 1E3DA 1QIMA 1C8LA 1T2UA 2VJMB 3ZK8A 3GCWA 2ACVA 5K4GA 4RCVA 4AF8A 1UFQA 5B57C 3VBEA 1FFYA 4MHOA 4CKEB 3TW6A 4YYZA 3EDCA 2VPZA 3JVUA 5I6DA 3DM5A 5KYXA 1ZESA 3F7MA 1GQFA 1L7PA 3HP1A 4P7JA 4J0QA 4BU0A 1QAQA 4RVGA 1IN7A 4KVGA 4MS1A 1NUSA 2QRNA 2QTRA 1RQ2A 2RJOA 3GXOA 1TZKA 3CONA 3H13A 2BR4A 4J3NA 4EYEA 3VZRA 1C50A 4F4DA 4JI4B 3QF4B 3V1MA 4P92A 5EUCA 2JLRA 2I6QA 3TR0A 3C7TA 3KFVA 4F1JA 3L79A 2ILVA 3LVQE 5FX2A 3KC2A 3STVA 1GPNA 2EQBA 1L1RA 4FHCA 4CN8A 2DPYA 2ZIEA 4GX0A 1KERA 2OLEA 1OXMA 1QYDA 2YHIA 2ZYDA 1JR2A 1TCAA 3KQYA 3WGHA 3ANYB 4ZVVA 4IBOA 2WILA 1OVMA 5KYYB 3CNLA 3CLUD 4JJ7A 4R84A 2OA0A 4N3GA 5JRJA 1XD9A 1Z5ZA 1OXBB 2O0HA 1NR1A 5FPPA 1F6WA 4ID3A 4RJKA 4D57A 2PWBA 5JSZB 4C29A 5L4NA 3B70A 9LDBA 2Y93A 4XOUA 3ZYCA 1JIJA 1U9YA 2XDQA 1U9ZA 2Y1WA 1MQ8B 3OMWA 4FYWA 2QVBA 1QHSA 3DC7A 1YQGA 2EKBA 2GSWA 1NAIA 3O1IC 2OC4A 2IXGA 3CR3C 2BFBA 2QHXA 4FI3C 3CH4B 4IXWA 3GRFA 4F4HA 2V98A 4XCQA 2IHNA 1MG0A 2FG6C 1U8YA 1Y37A 1ZOLA 3CCFA 3HDYA 3I92A 2JH9A 3N0WA 4RFLA 2G72A 5L3QA 1KH3A 1Z22A 2JANA 1IH8A 2POQX 3IKVA 4FIDA 5AXCA 1TK9A 4PYJA 3TUZC 1HOTA 3IOYA 3LGSA 1NJGA 2Z57A 2EX0A 3IUPA 1Y82A 2A1TR 3DDUA 3NWOA 4EGSA 5FBZA 1RE0A 1VL1A 1HA3A 1UP4A 2Q9BA 3I73A 4W5OA 3GPLA 2VT3A 5L4SA 4YCSA 4B81A 3L4EA 4GSKA 2G5GX 4D6YA 3WQQA 3V00A 3EEOA 5AM3A 4X95A 3K35A 4DT1B 4ZZ2A 1R0YA 3JAKA 4RE6A 4AD8A 1Y8RB 2PUDA 1YCFA 4UTZA 1DOZA 2DTDA 5E9AA 1ZK3A 1A71A 4GXNA 4PZCA 3WIVA 4AQYB 1THMA 3JWEA 3BM5A 4QT0A 1FTGA 4XDYA 3K0AA 3HBLA 2PBRA 4GOXA 4TT3D 4QXMA 2O8NA 4G1BA 3O73A 1DBPA 2DUNA 3H4TA 4X8MA 1FK8A 2G9UA 3SIRA 1N34B 1I7NA 5AHRA 1BDBA 4II2A 2J9FA 3NEPX 4C0KA 1DXQA 1OXTA 4QBTA 1I5EA 5TLSA 1T9AA 1CUSA 3IURA 4DA7A 3CVUA 1YTLA 2YW2A 4DEYA 5T4HA 1PIWA 2EWVA 2ZBEA 1ZH4A 2DBYA 1XB2A 1KARA 1DDGA 1E9CA 1DRJA 3LG2A 2PVPA 2XMGA 4BQSA 1T2NA 3PVSA 1E99A 2C4TA 2PAFA 2XITA 2Z58A 2AMYA 2J4FA 3PHHA 2E4ZA 2HEGA 3CF0A 3GEDA 5B30A 5JDIC 1P73A 3HBFA 3QFFA 3C3MA 3BJEA 3ZJUA 2GEKA 3VTAA 1KYZA 1R74A 4IF4A 3LP5A 3VUEA 1W36D 2QQGA 2XMRA 4OQEA 4PSVA 4FYIA 1QXSA 1BMDA 2XOKA 2BGRA 1XCBA 2NLOA 4MHSA 2WJAA 4HH3C 4X7BA 5CUQA 5HS6A 1RSZA 4TTSA 4W8GA 5ER6A 2ZYGA 3C74A 3ANSA 2FI1A 3QU2A 1ORVA 3RYFA 3CKLA 1JEEA 5B6JA 3OZDA 3D43A 3TX6A 4N3AA 5IVPA 3ZZMA 3T7IA 4CF6A 5ED0A 1U9JA 3UV6A 5HZKA 1N2SA 4DANA 4H1VA 5IUKC 1FA9A 1J56A 3IOMA 3AM4A 3DOOA 3O9ZA 4U7FA 1ZD5A 3TIFA 4L6IA 3LLUA 2Q5FA 4Q18A 1WCWA 2FEMA 5A9SB 4TSFA 5CLQA 2AMFA 1TX4B 2ROQA 1HT1E 2NU8B 1OI3A 3IQEA 1DIGA 1FS6A 4EG3A 3IT2A 3DL2A 1QP4A 4GKKB 5E3JA 1YR1A 5TQVA 4KXNA 3T5BA 1CDZA 1DUSA 5EFZA 3GWZA 4YJ2B 1XZIA 2C61A 2P2SA 3GP5A 2QP4A 2YXBA 4GNKA 4OJYA 1LPMA 3P5BA 5EJ2A 3NDRA 2Q4EA 5AW4A 3T94A 4WXPA 3GZTB 1BFKA 4X65B 3W8DA 3S2SA 3QLTA 2WSBA 3OUUA 5DGDA 3ZR4B 3PL5A 3SY8A 3EFOA 3BCUA 3OIYA 4D9EA 2BHRA 2ZAYA 3W7VA 5CCEA 2TS1A 4QTTB 4OXKA 2IX3A 1PJBA 1YOVB 1AKQA 1YDWA 5EIAA 3K16A 3MJRA 4B46A 2ON6A 4M98A 2REOA 4IGEA 4HI0E 1CUFA 1XO1A 1LBSA 1M2VB 5FEUA 1CF4A 1M8KA 3KQTA 4IIJF 1G8KA 3KKZA 1M75A 1VL8A 3ZQUA 4ITUA 1H2RS 1TJ5A 5ALUA 5BN4A 1M1NB 2AOUA 3U4QA 1AGPA 4IFBA 2UUPA 1HUQA 2IIBA 4R9SA 3VTKA 2QPLA 3LO8A 1HDEA 2BHLA 3W05A 3ZHZA 1QH1A 4JYZA 5LOVB 1G8GA 1IMJA 1QHHB 1ZINA 3NHWA 3TVTA 5CT9A 2QX7A 1JEAA 3A9SA 4NFHA 1PFVA 2A5FA 2OAGA 1FUYB 1VHQA 3GA7A 4UAGA 4Y2HA 3BZUA 5KAMA 3T5CA 3UAXA 2ZUSA 3K3PA 1LLQA 2FP3A 4ZCIA 5K6AC 9GPBA 2GZHA 2Q5QA 4NZYA 4Z4CA 4YY3B 5JALA 2HSZA 4WBXC 4FC6A 3VHLB 1EUDB 2JA1A 3VYRB 1TTTA 1UM9B 2AJTA 3GFQA 3RK0A 2VYND 4O8ZA 4IL5A 3K15A 3H8JA 3KS9A 2Q1TA 3L7MA 5SYMA 3UAOA 3WWOA 5AW7A 2PH3A 1EA7A 5EUQB 2NW6A 2VPPA 4LEIA 4KMRA 4RL6A 1LW6E 1O77A 1CRWG 2XTMA 4YIKA 3T7KA 2PYIA 1TQDA 3TRDA 1KBOA 3I42A 4OSOA 4EARA 5HIIA 5A04A 3S2YA 5AVOA 3R8FA 1O97D 1QVVA 4IIEA 5TGDA 2QD2A 4YXWA 2PGAA 3Q6IA 2AN5A 3P0RA 1PLJA 2WUDA 1IHUA 1XCJA 3OWOA 4IJWA 1PS0A 1WNTA 1LVGA 5T41A 3EZYA 4AF7A 3D54D 3UTDA 3WDLA 1EGAA 4R41A 2MMGA 5P8WA 4CHGA 3VO2A 2YWBA 3DE6X 4QWWA 2E7ZA 4G41A 3MRXA 2GTPA 4IQ0A 2Q1SA 4EGAA 2D1TA 2Q27A 2VZEA 1L7NA 4Q01A 5ANRB 3KYDB 5L6LB 4IDAA 2FFBA 3QWIA 4ECAA 4BP1A 5CDGA 1PUXA 4GWLA 5KDOA 2CDAA 1YNOA 3K31A 1Z08A 4QRIA 1OWPA 4G4GA 5DMXA 3AB8A 3TQSA 3V4RA 1CX9B 2GZRA 5EWJA 4RX1A 1U4SA 4XUCA 4A0RA 3AJ9A 2JI4A 3EA4A 4H4CA 4R9RA 4Y2SA 4QGSA 2C7RA 4EHLA 5BR7A 3FMFA 4NOJA 1UXGA 5BN1A 1S7GA 4ZZ0A 2GNAA 2KHZA 3IQXA 1O6FA 4CCWA 4IHJF 5IVDA 4RGQA 4Q9DA 2GJKA 1TI7A 3A25A 3H3JA 4TZTA 3OPQA 2QZPA 4ME6A 3CCCA 5KJEA 4M0EA 3LE8A 3GBSA 5FPHA 4I9FA 4WXYB 3OESA 4YLEA 5DK6A 3SAJA 2ZWPA 3OKAA 5BOSA 5J1SB 1B93A 1KEPA 3A1FA 5FWXB 1FNMA 5DTIA 2EFEB 1BKSB 3U48A 1L5RA 4Q82A 3Q10A 4Z7QB 2HRRA 2VOJA 2A59A 4Z9XA 4B2YA 3IDAA 3BA6A 1WZ2A 1G21E 1IG0A 1KDPA 4Q48A 1ZNWA 4JLMA 3OPMA 3QVLA 4C9BA 1H93A 2ZWOA 4LJ8A 1V9SA 2JRCA 2P2ZA 3EGEA 4O4HB 1PFKA 4PCUA 1DKPA 4E5YA 3N86A 1JG6A 4RKRA 5KNBH 3KT3A 2B6NA 3EK2A 3O7WA 3TFWA 3WK5A 4RA9A 1E7YA 1KQNA 1MH1A 5AKZA 3CUVA 4Q7MB 2GHQA 1C8KA 1JPUA 4MS4B 3LWBA 3CEJA 1ONSA 3CTMA 3JPYA 3TDNA 4I5IA 1TAQA 3GYBA 4BN0A 5C52B 2ZAIA 5DX1A 4WHMA 2BBOA 1M5UA 3EEYA 4EITA 1Z4PX 2XZTA 4X6LA 4BNFA 4DLPA 1JR3A 2QMOA 1WNFA 4Y2QA 3EF1A 3TQHA 4KRYA 4Z1OA 1YI0A 4IDDA 3GRPA 3OE5A 3I1YA 4QQRA 2GM4A 2INGX 4OFBA 1JECA 1NURA 3F8SA 3MCTA 4EYQA 3S1AB 1APBA 1EHYA 4GPD1 1HTTA 2ZIUB 5F4BA 1C7JA 4RZQA 2ZQZA 1Z37A 1YB1A 4V0OA 2VJLA 2BWJA 1Q0PA 1VP9A 4DC1A 4PHCA 2DKOA 4WKCA 5JYBA 3B5IA 3BSWA 1D7AA 4MITA 4TV8B 3FROA 2X2PA 5CDFA 3VNQA 3DP7A 4KLAA 1QCZA 5I45A 3OO0A 4UBLA 1WDKA 1UODA 4HEHA 1NBWB 3O2NA 3KDAA 2IEDA 2RGEA 1HT2E 2BR3A 2XRFA 4G3XA 4L95C 2PQMA 4X3PA 4MW2A 3WLJA 1OU0A 4L4XA 2GMWA 4EL0A 3AC0A 3UOAB 1MAUA 1FOEB 1BX3A 3F4KA 2EKLA 3H11A 1PTJC 3QWBA 2Q7OE 1GYPA 2CHQA 3IV6A 1CNEA 1UOOA 2O3RA 3PXGA 2Y1GA 2WWVD 4IDPA 2J08A 5I9TA 3HN7A 3ZN2A 3NHLA 1XJ0A 3H19A 4HQ6A 4JR2A 2Y76A 3ZVNA 2C9YA 1VE5A 1J7JA 3PA6A 1DEHA 1UBSB 1UWCA 2CL6X 4R9NA 1O58A 4KEAA 4B8ZA 1ZWKA 4YRFA 1HORA 3SZUA 5DGIA 5JZBA 2BJHA 2HA6A 2KM1A 3PWKA 3FFXA 1CJCA 5C0OE 2X0DA 3IYLW 4JKIA 4Z51A 2X40A 2LR0A 1S2MA 3DDZX 4QJ5A 5DB4A 4B7XA 3KZKA 2AXNA 4CLXA 1CLEA 3NJ8A 4EJ0A 1U9CA 5CEFA 1ZVJA 2Q29A 2HIHA 1KRHA 4N47A 1MCZA 1UDBA 1US8B 1HYHA 3BWXA 2OPHA 4CQMD 3SF8A 5IZ4A 4HRYA 4HQLA 1AQNA 4FMDF 1NMXA 5FPTA 1L7AA 4P2GA 1K6JA 1M34A 1J0DA 3NC1C 4DB2A 4YS6A 4Y18A 1VA4A 3RSSA 1X1BA 2CY0A 2I4IA 4CMBA 2G3YA 3GUCA 2HH9A 4RMJA 4C6TA 2HJSA 4X41A 4EYKA 4L2IB 1ZHHA 2FPMA 3WYFA 3DLHA 3WGMA 5LUBA 3OLZA 3VR5A 2KBFA 3L1VA 4GQBA 1WXEA 3BD7A 3SS7X 4PIVA 1J22A 1JSXA 3GJXC 1SBZA 1WPXA 2CZGA 3WMGA 3VR1A 3INNA 5DM60 4FYVA 1VDZA 4PAWA 3T35A 1DOAA 3R2JA 4HQKA 5KOJB 4BMCA 3NRCA 5FWDA 1N57A 1T91A 1XF9A 3KFXA 4IH4A 2UVQA 1ISSA 2IKSA 3S2FA 5AJVB 4G5GA 5FR2A 3I8OA 5IEJA 1ISRA 1Y1RA 4JQOA 3ACDA 3U3JA 1NUPA 2QRKA 3DZKA 1N6PA 3HO8A 3B51X 5K0BA 1MUUA 1T5IA 2ZT7A 1CS0B 3GZJA 3JQQA 5HR5A 421PA 1IULA 1HZJA 2Q21A 3OQBA 4DHEA 5FNVA 2B92A 3OQIA 5KVVA 5IWCA 2W9XA 1C4OA 1YOBA 2VF7A 3NOOA 1TAGA 3TZHA 1KSHA 1OBOA 1G9XA 4OXXA 2D54A 3KXIA 4ZO6A 4LF6B 1IM2A 4B5LA 3TXAA 4B3RB 3HFJA 1DTWB 3MEQA 4E7OA 4GLOA 1SCAA 1TZCA 5HOEA 2CNLA 5K3FA 2ZKIA 2LGJA 1ZUIA 3GMTA 4QFDA 3TAHA 4PO9A 2EG9A 2XEDA 3L4SO 2FGJA 4EUFA 1D2CA 2KMLA 3EC7A 3F49S 3KUDA 4L9SA 4W82A 1X7ZB 4HFRA 2XVMA 2WKSA 4G0QA 1ZMBA 4BVFA 3Q3HA 5ITZB 4UASA 2XMBA 3K1AB 4RKWA 3WQRA 1FQWA 3JPWA 3NQ41 4JBIA 3FX2A 3BTOA 4KQWA 3TLZA 2ZM6B 5JO9A 1RJDA 3ESDA 4I9GA 721PA 2HJWA 2QE6A 3AUFA 1NYQA 1WU7A 1EJ2A 1BJRE 1WPRA 2PSEA 3KJEA 5EY5B 4ENTA 4CT5A 2AE2A 5JUWA 4Z9YA 1E2HA 3OCWA 1QFYA 4ZDIA 3DV2A 1B41A 5DRYA 1CFJA 1F4PA 3K9GA 5AVTA 3H83A 4OU5A 1W4ZA 1PR0A 2JA2A 4RS3A 3TR6A 3U5TA 2JLSA 3ZY3A 1FFAA 2YL2A 4PZDA 4ZCMA 5T67A 1KKLA 2LXNA 4FQ8A 1DC7A 4KR2A 3OLQA 1B14A 4L8VA 4BNZA 4BDTA 2X77A 1W4AA 4BVEA 4LFCB 1K63A 4L57A 2PRZA 3QVKA 4RIGA 1I4DD 2QYHA 4F4FA 1ZU5A 1XWIA 5FKJA 4OLBA 3ZI7A 4CCYA 2E6UX 3EEQA 4FMBB 4KDRA 1GA6A 1XD8A 2PD4A 2R6DA 5C34B 1WTAA 3DT6A 1UJ2A 1NI5A 1N6RA 2C82A 1KY4A 1ZCZA 1VI5A 2P9CA 3KSRA 1U0EA 1EHIA 4IDHA 4KMMA 3SHFA 4NZ9A 1ZWLA 5IDXA 3M2TA 2VHVA 4LMAA 1TA0A 2EBWA 4FGUA 4CMJA 3EWSA 2CBZA 1D6NA 5FUXA 1G20E 2W2PA 3PFHA 4KPUB 1AS3A 1UJBA 3PNMA 2RB5A 4EW1A 3G13A 2QW8A 4TQ9A 1M1YB 3RSLA 3QSYA 1BRMA 4N18A 3ZVMA 4DDKA 3R5FA 1H9CA 4ZTBA 1U0RA 2P69A 1TADA 2C8VA 3FCAA 3QELA 4BUJA 3WZMA 1N6IA 3NHYA 4N39A 4OHWA 4GZMA 3GAFA 4KQIA 2WMNB 1NAHA 3KXLA 3IBGA 3I62A 4OQZA 1K4MA 4ETNA 4XWKA 3GFSA 3WIUA 5C46F 2IUEA 1FJGB 3X1ZA 8ADHA 2Q9CA 3LF2A 5HPYB 2YC4C 4D6XA 2CBXA 4GI7A 5T6BA 3I61A 4J0DA 1TIPA 2I66A 2I87A 3DTVB 3UOGA 3WWCA 2QUBA 5FAKA 5B7GA 3RKRA 4P80A 4R0MA 2C5GA 2QV0A 3FSGA 3QU7A 4I3FA 3X0DA 2NZXA 4DMKA 4K6OA 1OILA 3CF2A 4EFNA 3IBTA 2C4HA 3GLIE 4P4TA 2PX2A 3ZV5A 5PGMA 2YS6A 2V3CC 4BLSA 2GEBA 3D3NA 2YW9A 3NT2A 4DNQA 2RK6A 1VSQA 2DYKA 1V7PC 1AIPA 3AW8A 2QN9A 4GOKA 3A1VA 5A5EA 5BSWA 5BSEA 4D4MA 4B7UA 3CPEA 4HWPA 3AEQB 2X23A 3BJMA 2H52A 4M54A 1PNOA 3PFWO 4ZOAA 1X6VA 1LY1A 2C04A 3Q0IA 3BHJA 5DTQA 5EIHA 2MU1A 1RQLA 3UYLA 2AFHE 2RGYA 3MRTA 1VA5A 1IVNA 3SXJA 4EDFA 5CR9A 1DHRA 1POWA 3TOZA 3A36A 1KJ8A 2HA2A 2NIPA 2WV7A 3GC6A 3NIFB 3VYVA 4URVR 4H27A 4ZXPA 2XNDD 2B20A 2CXPA 2Y05A 3FPCA 1KE1A 5IN4A 3AYXB 3L92A 4FR0A 4LJYA 1U7XA 1P18A 1NPTO 1LFAA 2ST1A 4WXMA 2NU7B 1Z6PA 5AOAA 5FPSA 3GGDA 3O74A 1W49A 4DSOA 3TYXA 4DAEA 2ZJ3A 3HFGA 4B32A 4RZXA 1JHMA 4DMLA 4OOFA 3C3PA 1MA3A 3RYHB 2K7FA 3ZK9A 4CEHA 1OX4A 5F3DA 2R6AA 1T4DA 3JVVA 5HIAA 5DV9A 4YFYA 3REQA 3AL0C 3CUYA 3Q11A 2QXYA 3LKBA 1NOJA 2ZANA 1C29B 1L9KA 1TKCA 2JJ1A 4HWRA 3RAGA 4BWVA 4DLVA 4LXHA 1L5MA 1Q0RA 3L6UA 4O08A 3GFFA 4HYTA 1N2GA 4YONB 1F48A 2HKIA 3MJSA 1DXHA 2QB5A 4Z4EA 2G6BA 1AA9A 1VPTA 1U5CA 3LD9A 3INGA 4F84A 5ADVA 5K0LA 2F43A 2CLMB 1UDAA 2FU5C 4JLKA 4C89A 4C3ZA 5JNTA 1H8ED 4JLNA 4AM8A 1T1GA 2DBVO 3C3BA 2CV0A 4BFXA 1XAHA 1ZPDA 2Z2IA 3OLVA 4MYUA 5AKIA 5A3SA 1HZZC 3WKEA 3ND6A 3FR7A 4MIYA 2VO1A 5A4AA 1W35A 4J7CA 4DV6B 4NSNA 2WY2D 3I58A 1E5LA 4L8FA 3Q2OA 1X9GA 3LDGA 3KR9A 2GYWA 4JC4A 3V7FA 3PUWA 4IJ5A 2EW2A 1K8RA 4H15A 1SOWA 1QIDA 1ZISA 1HZZA 1NBEA 3BMOA 1O6GA 1MOSA 3MJDA 4R1UA 1ZGCA 1P0PA 1TFUA 3TW8A 3P9IA 4LXTA 1F5SA 5EXXA 2VJYA 4UHFA 4LAFA 4GLBA 4MS1B 1RACA 2XYHA 1X8XA 2D8AA 4L85A 2H4XA 4XQEA 5IDVA 4LCBA 2N47A 1WRBA 3D6MA 5JV5A 1FNSA 4G0NA 1Z06A 3EVGA 3QE2A 1QIIA 4INJA 4MROA 1RPNA 2J3LA 4FMCF 1CZHA 4UKDA 5CPBA 3HP4A 4JJAA 4CMKA 4J4BA 4DDTA 2RE8A 3A6KA 2Z2KA 4UTOA 4LJSA 3ICOA 3M4ZA 4WASA 1P0MA 1RYMA 1V8FA 3AR7A 3QMMA 1VJ0A 1CNFA 1W2HA 4J16C 1T2VA 2VLIA 6AT1A 1WXQA 1DAHA 1MP0A 1DJOA 3ZXIA 2FSHA 3AFOA 4RL4A 3L1KA 5EFOA 2QE7A 3WJ2A 1AX9A 2J59A 2C4VA 2DFKB 3FY4A 3HUUA 4RFVA 5J40A 4EFLA 5K20A 4JODA 1DJPA 3FJYA 3KE8A 3AHFA 1PJZA 4GMKA 1SBTA 3OJFA 3W04A 3EBPA 2BFBB 2VHJA 4CETA 5K5EA 3CZCA 1D04A 4E6EA 5ITWA 4RGYA 4WDQA 4HBZA 1OZGA 3BOSA 3MN1A 2BTQB 2OHHA 3K0FA 4N8DA 1TD9A 2VG8A 3EAQA 3KV1A 3W9BA 1NUQA 4H3KB 2VUUA 3HWWA 2JLVA 1RS0A 2QQEA 4P4LA 3DO5A 4RAOA 4YRLA 4S24A 1OH7A 2QBYB 3OWXA 4LXYA 4JI0B 2YBDA 3F3KA 3PFBA 5JDCA 1FU8A 3HDGA 3QNMA 4MV4A 4EZIA 1JH8A 1W87A 2PZEA 3PB3A 2ZIZA 3ZZUA 2ZRGA 4PQFA 3RUCA 3HY6A 4TS1A 1PE0A 1C7QA 4Z4HA 3QWFA 2M6RA 3I6YA 4U9IS 3B1XA 1WE2A 2ZB7A 5EHGA 4ZV9A 2Q5CA 1YQDA 2QQ0A 3ONDA 1E9VA 4WZ6A 4B6SA 5FH9A 3PDWA 1RXCA 4JLPA 3URMA 2FR8C 4FP9A 5AR1A 4ZT3A 3V4VB 4YQYA 4YUWA 3IMEA 1Q83A 3K0AB 4IFTA 3OCJA 3PVCA 4KQ1A 4UFNA 1MQ9A 3PI6A 4CMIA 1N2ZA 3TB6A 2ISCA 1RWMA 3BIXA 3IP3A 3PGJA 4MR8A 2VT2A 4Z9AA 2PX8A 2JIPA 2GYUA 2J9FB 2PQ0A 4G0XA 3RG2A 2OCAA 2FR8A 2I4LA 4C6RA 3E1KA 3VR0A 1NW7A 1HLDA 3NKLA 3TLYA 3W2TA 1FVFA 1KPHA 2RARA 4MIKA 1WULS 5K8CA 2J9YB 4LSZA 2OD7A 1U8CB 4YAGA 1YRAA 1W30A 2HPVA 3LAWA 3DDHA 1YBMA 1UDWA 1F2TA 4DCVA 4IUBS 3C5VA 2QUJA 4NARA 2FW6A 3ETEA 3A1TA 3M5WA 3FVRA 5T3YA 4V1CA 1Y7PA 4PYRA 3DWIA 2ONKA 1VKOA 5AH0A 5BSTA 1TQ2A 1RR6A 1RI3A 1EM6A 5CBKA 2ZR8A 4E21A 2QMQA 4ABTA 1EM8B 3PC2A 3PP8A 1CZKA 3B1JA 4TKMA 3FF1A 5B2EA 3EPJA 4LZAA 2ZYUX 1QBKC 3KXDA 5T4BA 3HKDA 4M8IA 5JSHA 2JK0A 2JLZA 3HB4X 2JHPA 3KDPA 2D7CA 2BKAA 4F85A 1A8IA 2GO7A 1TMOA 1YJCA 2FFAA 1Z13A 3D2CA 4LHYA 4A0HA 4Y1FA 4KMOA 1UMBA 2QRZA 2V0NA 2PTGA 2ZSAA 3AI3A 1QONA 4LTMA 4EKYA 1B8OA 4P38A 2YZNA 2L17A 4QDZA 3N39C 1BKYA 2Q1XA 2Y6UA 3TIXB 4YPVA 3VPXA 4RK5A 4M83A 3TLEA 1EFHA 2IVZA 3NDIA 5I5GA 4FUQA 4GEGA 1KTVA 4NE2A 4ESEA 4DLBA 2Y0EA 2LVBA 2WKPA 2W2XA 3ZW8A 2JFGA 4QPPA 1EBUA 4MGHA 1WG8A 4BX9A 1W0JD 1NASA 6YASA 1KOGA 2CZCA 2CL0X 4L15A 4PYMA 4KVZA 1NP6A 1Q2XA 3PJDA 1X77A 2C9CA 3KTFA 2YTZA 4M0UA 4EEZA 1C7IA 5ESDA 5CLGA 3RU2A 4D1YA 4EL5A 2H4WA 3EFOB 3KQVA 3OY7A 5IBPA 4X1KA 3PXBA 3UQZA 2W48A 4OK3A 1SO8A 3R74A 3CVWA 1BS1A 4B47A 3DHVA 2VAVA 5FPYA 9LDTA 1KY2A 1JXAA 4WUVA 1Q0HA 3WNVA 3WY9A 4BP8A 1YR3A 1GL9B 3L8GA 1YA8A 2NTJA 2NNWB 4IFEA 4N5MA 1E5VA 3FI9A 4RACA 3ZJTA 3A9CA 4AW9A 1A9OA 4RAQA 3COZA 2HZ7A 3EF3A 1WZCA 1YDFA 2D4HA 5BN4B 5LYJA 2VXOA 3IA2A 3RQSA 4EG0A 5JD5A 3KLPX 3LDUA 4FEEA 4JC5A 1KDVA 1YKGA 3AVXA 2HGZA 2P2YA 1EJBA 3QHPA 3QK7A 3DGEC 3I04M 3QNWA 3W34A 4DS3A 2G77B 1A98A 1K2WA 1ZD2P 4EYSA 5F5NA 4DNPA 3MOIA 2XZLA 1X7YA 3ROGA 2BUCA 3VOAA 3WVNA 3WL4A 4EJ6A 1ZRHA 1SIBE 2R8XA 1ELOA 1C7FA 4Q1VA 3RUAA 2J0VA 4MPRA 4D8TA 4DQKA 3OE7D 2X0IA 4KVAA 5DGTA 4FNMA 3CN7A 4E2YA 1Z28A 4RELA 2XEXA 1U0SY 3MWLA 4F2PA 5B3LA 3E2MA 3C1TA 3VH2A 1TMGE 1J5PA 1X7XA 4H08A 5AI6A 3N8IA 1IHXA 1TF5A 4TWRA 3N76A 3N2EA 3OH8A 3P9PA 2WWHA 4R2XA 1ZNZA 1C1DA 2P68A 2FW1A 2OESA 1DVRA 5JNUA 5J2TA 3GJTA 5I5EA 5KYNA 1C81A 1UMDA 1Y7IA 1KVUA 1Q0TA 1X19A 4OHPA 3ZD8A 5HJEA 4C2BA 5KEIA 1FU4A 4QFMA 4MDYA 2CB0A 1DWUA 4GYKA 4TKLA 3RR2A 3B6ZA 3GYGA 1ZL2A 4KLNA 3JASA 4C14A 2CLEB 2O7QA 2YMMA 4OIFA 2B5WA 4I4LA 2XHEA 4BMXA 1QU3A 1RKQA 4IWYA 5F2KA 3BT7A 3Q9LA 2VJQA 3PQFA 1SVKA 4FQ7A 5EL0A 3WAKA 2GRAA 3G9TA 3RVRA 1UKEA 3RC9A 3CFYA 4S2EA 3EX7C 4K26A 1UBTS