1MXFA

Crystal structure of inhibitor complex of putative pteridine reductase 2 (ptr2) from trypanosoma cruzi
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
266
structure length
247
Chain Sequence
CPAAVITGGARRIGHSIAVRLHQQGFRVVVHYRHSEGAAQRLVAELNAARAGSAVLCKGDLSLSSSLLDCCEDIIDCSFRAFGRCDVLVNNASAYYPTPLLPKPIDAQVAELFGSNAVAPLFLIRAFARRQNLSVVNLCDAMTDLPLPGFCVYTMAKHALGGLTRAAALELAPRHIRVNAVAPGLSLLPPAMPQETQEEYRRKVPLGQSEASAAQIADAIAFLVSKDAGYITGTTLKVDGGLILARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Trypanosoma cruzi pteridine reductase 2 in complex with a substrate and an inhibitor.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 2
total genus 86
structure length 247
sequence length 266
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1mxfA00
5GZ6A 1X13A 3E1KA 3FCOA 4WOJA 3L4BA 4ZA2A 1SCUA 1WNTA 3VVCA 3HDQA 1FDUA 1JW9B 3QVOA 3MOIA 1RYEA 3VPSA 5A9RA 4PVCA 2VRBA 1JVBA 5MDHA 3H4VA 4HFNA 2P5UA 1EQUA 2OBYA 3S55A 4Y98A 2D2IA 1H6DA 1QV6A 3AUUA 4TRNA 4DLLA 5L7WA 1MB4A 3U5TA 1U3TA 4B4UA 1BW9B 2OFPA 3PRJA 1J0XO 4PGFA 3DFZA 1BG6A 2XF8A 2GDZA 1PJTA 3GZNB 2X5OA 1MG5A 2HU2A 2QG4A 3GT0A 4NI5A 1WAMA 1E77A 2VHYA 4UUPA 4Q3CA 1M76A 4RGBA 2EXXA 1F8GA 1VL0A 3WGOA 5ITWA 2FY8A 3HHPA 1HYEA 5IN5A 5TC4A 3AOEC 4IQ8A 1EVIA 4UUOA 1B8PA 1U8FO 4RLSA 3AUTA 3L0DA 4J7CA 1ZCJA 4DTIA 2GLXA 2OHXA 4UUNA 3WOHA 5I7FA 3H3JA 2ZYDA 3W1VA 4I1IA 1T2FA 1E5LA 3LT0A 2W2LA 3DZIA 3GHYA 1RWBA 1M6WA 1BWSA 1ZSNA 3F5SA 4XIJA 5EJ2A 4BGIA 4G65A 3DMYA 4YQYA 5U9CA 4IIVA 1E3WB 3DZGA 4NPCA 3L9WA 3BTSA 1D7OA 3RD5A 3HN2A 1HDOA 3JV7A 3OJFA 5LC1A 3WQSB 4PLFA 2W2KB 1PR3A 3FTPA 3ZNQA 2G5CA 4YJGB 1U5CA 4X54A 1M6HA 3KB6A 2DBRA 4XRRA 2E49A 4YT5A 4RF2A 4A10A 3PYXA 1N7HA 3CKYA 3LZ6A 2ZYGA 2E4AA 2ZATA 1B0AA 1JWBB 1I33A 1ENZA 2BH9A 4KTVE 4J3FA 5JE8A 1U3UA 4NFHA 1ADFA 2Y05A 3GGPA 4BO2A 3D3WB 3FNGA 2JD2A 4FOSA 4CM1A 4FFLA 5A1TA 1GD1O 3EMKA 3GAFA 3G79A 2AG5A 1HYHA 4L9RA 8LDHA 4B7UA 2WTBA 4LISA 5IAAA 1H5QA 1ZVMA 3RROA 1DIBA 1XLTA 3FSRA 1PWZA 4ZRMA 1KVSA 2GF2A 3NJ8A 2VT3A 5EIOA 3UCEA 3TOXA 2BLLA 1A27A 2IODA 1DRUA 1A4UA 3E8XA 4CLRB 4DMLA 4YAGA 4D7AA 2DTEA 1I2CA 2X0RA 1SEPA 3K5PA 1WZEA 2I67A 4WLVA 4YT8A 1IOLA 5K9ZA 4UVHA 1YBMA 1CEQA 2FR8A 3DHYA 4I8XA 3DBVO 1MXHA 5CPBA 4WLEA 2C82A 3OEYA 4XR4A 2ZTLA 3QLJA 2X0JA 2Q45A 1LC0A 2OXIA 3ZV4A 4Q3AA 4YJFA 3AM4A 1YONA 2WD7B 5JYDA 3RWBA 1NXQA 3EY4A 5F1PA 1N5DA 1AUPA 4J9VA 1PJ4A 4ZJUA 4J2HA 3DBHA 4AJ2A 3Q2KA 1QYXA 4NNJA 3E6AA 3JQ9A 1A7KA 2NVWA 1MP0A 1YJQA 4QQRA 4BO9A 5JC8A 1PSDA 3KYCA 3LLVA 4O59O 3DBHB 3PJDA 1LRJA 5CDSA 3V1YA 1GQ2A 2QRKA 3CEAA 2D5AA 3M1AA 4GVLA 4MVJM 2JHFA 4PLWA 3MEQA 4CL3A 1I30A 2X8LA 3WQQA 5G0VA 3P19A 5HA5A 3LU1A 4YDRA 2Q46A 3T7EA 2RAFA 3Q1LA 3K2BA 5DBGA 2UAGA 3JD0A 3TFQA 5L4LA 4BKOA 1C0KA 1DHTA 1R12A 1ADCA 2C29D 4O0LA 5BNFA 3ZWAA 4YT2A 3UHAA 2TMGA 4WLNA 3RUCA 2BGMA 1LSOA 1SEVA 4DQVA 3JYNA 4ND1A 3RUIA 4CV1A 3I6QA 4OKIA 1HSZA 3TF5A 3WMXA 4NH4A 3JQGA 3RFTA 1FJHA 3FI9A 1GQYA 2Q2QA 2AQKA 3NUGA 2VYND 4YAEA 3HFSA 3AY7A 2XXBA 5U1PA 5L9AA 1T25A 3W8DA 3CMMA 1B8VA 3L6DA 1SOVA 2C7VA 4JGBA 3BXXA 1ZK3A 2Z5LA 4QTZA 1JWAB 3JYQA 1GZ3A 1IULA 1EVJA 3Q0EA 4KUGA 3HFGA 1PR9A 2EIHA 3KYBA 1IHXA 3KOUA 1P3DA 3C24A 1M66A 1VRWA 3UFXA 1LX6A 3AM3A 1E7WA 1HDXA 3BZUA 3GG9A 3EUWA 3GNTA 1NR7A 4KWHA 4HFMA 4A26A 4BHTA 2DU8A 3JYLA 4R54A 1PJQA 3QY9A 4BMSA 2YQ4A 5IG2A 3NT5A 2Q49A 3ZHYA 3NAQA 2P9CA 2VUUA 4FQ8A 1UP6A 2WYVA 1DDOA 3P7MA 1EUDA 3U9LA 5B1YA 3PDJA 3E82A 1E5QA 2FZWA 4WLOA 1TA4A 1Z7BA 2WM3A 3C1TA 2DC1A 1V3VA 3MTGA 3WFIA 3KEQA 2G1UA 1X0XA 3QRWA 4AJHA 2Q50A 1D1SA 2Y93A 4YJFB 5C7OO 5JAZA 1JN0A 4BVAA 4Y6PA 3GUYA 4N5NA 3LF1A 1O9BA 1GEGA 3GK3A 1QSGA 3S2FA 2J8ZA 4D3DA 4WCFC 4LSWA 3OFSA 3RFVA 4TKMA 3GPDG 3O26A 1J6UA 1QR6A 3MJTA 3DZBA 5IZCA 1HZJA 4E2WA 4BQRA 1VL6A 1TVEA 4ND3A 2QZZA 3KYDA 2NSDA 4EI2A 4FPXA 4CM7A 1DJNA 2C59A 1ISGA 4DIOA 1HDGO 3JQ8A 3ETGA 1MUUA 4NHEA 1VLLA 2B5WA 3RVDA 2PD3A 5H83A 3AI2A 4Z9XA 4IM7A 1A9ZA 2X9GA 7MDHA 1OAAA 2UUPA 4LMRA 4WLFA 2YFQA 3KXDA 4GX1A 1I32A 4H16A 5CDUA 3BMNA 5JAQA 3WMWA 1RYDA 1WDLA 2OORA 3JQFC 2Q1UA 4E2YA 3D64A 3JD4A 3R0IA 1AGNA 1C0PA 2C2XA 3TNLA 3HJAA 3WNVA 1HL3A 1H94A 3SJ7A 3GEMA 4MKRA 3KUXA 4M49A 4BNFA 2AEFA 1I36A 1CQIA 4GAEA 2QYTA 4BGEA 2DFVA 4AJJA 5A9SA 4PN3A 3R1IA 4UUMA 2X58A 1I3NA 3GDGA 3IJRA 4ZVVA 4TKLA 1JQBA 1YRLA 2PR2A 3WDSA 4RVDA 2YHIB 1R4MB 2GNAA 2YDXA 3V2GA 1OOEA 2EHDA 4NBTA 4P22A 1IUKA 3NT4A 3HUDA 5DOVA 5I9NA 2WMDA 1HDYA 2AE2A 2J5KA 4URFA 5IF3A 2WSBA 3NDIA 4JBHA 4N54A 4EITA 4W7HA 5EPOA 4CV0A 2O3TA 4UULA 2WYWA 4W9NC 2HJRA 4RPKA 3RKRA 3EZLA 1B16A 4RCVA 4WE3A 1ZK4A 4OQYA 4W4TA 4IDFA 1DHRA 3QA9A 4CPDA 5EQFA 3M1LA 4ZU3A 1VM6A 2EERA 5KNLA 4CLOB 4L73A 3ZNOA 1NASA 4R4JA 5JO0A 3D5QA 2YV2A 5CEJA 4OO3A 2IZ0A 4M55A 2AEJA 1NPTO 4XGKA 4F46A 1WXDA 1HDZA 5I8ZA 2WEKA 2PKQP 5A9TA 1HLDA 1YQDA 1KEVA 4ILKA 1U9JA 4DXHA 4CQLB 5FEUA 1I01A 4Z6KA 1KC3A 1MGOA 1SB8A 4CMIA 4QSMA 1QRRA 5DNAA 4AG3A 3DZFA 3RUHA 4L4RA 4J4HA 4XA8A 4ND5A 1XU7A 4R1TA 1NWHA 3PFFA 3I83A 4CMAA 1U7HA 2JKVA 4ZQEA 3BTOA 1QORA 1EFKA 4OSPA 1BMDA 4C4OA 3F47A 3IAHA 4B4WA 4WCFB 1I3LA 3QSGA 1E3JA 4YPOA 4U5QA 4OXNA 1NHWA 3RKUA 3MJEA 3T4EA 1PGQA 4IJUA 1KY4A 4MDHA 1X7GA 1KYQA 3SC6A 1VKNA 3RC9A 1DLIA 1N9GB 2F1KA 3JQFA 3L07A 1UZNA 2OP0A 4FC6A 3VPHA 4OH1A 4ALMA 4R16A 4ZD6A 3PHLA 3JYPA 3IIEA 3JQEA 5CEEA 1H9AA 4GL4A 4JP2A 4RQTA 4YACA 1E1MA 4CM4B 2DBQA 4E4YA 2JL1A 2D0IA 2NADA 1E7YA 2RH4A 4WCDA 3RC2A 1O89A 1GL3A 1ZJYA 2NV6A 2IYOA 3DAGA 2D3TA 1D1TA 3OQ1A 4Z9FA 1DRVA 2WE7A 2R00A 3NTRA 1T2AA 1ML3A 3GMDA 3DHEA 2HMWA 5DP1A 4E5NA 1ZIDA 1QYDA 4YJHB 1FK8A 2YV3A 3W4IA 3ICCA 2VZ0A 5L40A 4NJMB 3ZDFA 4XQGA 3QQPA 2BELA 2DM6A 1HE3A 1Y8QA 4OXYA 2EJWA 2W90A 5A3JA 2BD0A 3PQEA 3CH6A 5GY7A 2FN7A 4HNGA 1DAPA 2OP1A 3VH1A 2I5PO 2QQ5A 4CMEC 1I24A 2YYYA 4R9RA 3T4XA 3WG9A 4IDDA 2E37A 2J3JA 1RM4A 1GTMA 1EBUA 3UN1A 4AJ4A 4OQZA 1QYCA 2Y0EA 3JQAD 1H2BA 4CM8B 3K31A 4JIGA 3TOZA 3WGYA 3WWZA 4FGWA 2PD4A 5IXYA 5B4TA 1EK5A 2NVBA 4FFOA 3R6DA 2EEZA 4LK3A 4XR9A 5T6BA 2XAAA 4IDAA 1SNYA 4XIYA 4DC1A 4IGFA 5KTKA 5ENVA 1BDBA 3ZZNA 4D44A 4PG4A 3BMQB 3CSDA 3LK7A 2OOSA 4DBVO 4U0JA 1ISFA 4J2OA 2CNBA 2O4UX 3WTBA 1ZO8A 3WGTA 1V0JA 3TZKA 3PXXA 3TL2A 3AOEA 3W4KA 3UH1A 3RBZA 4EUHA 1C14A 4P38A 3CXRA 4H15A 5CFZA 2A35A 4QFDA 4XYMA 1NAHA 4I9NA 2AHRA 1Y6JA 2RBEA 4UVGA 5JDCC 5JFOA 5IJZA 1F17A 4M86A 4L75A 4XQCA 1HRDA 1DAOA 4Y67A 5ER6A 4IINA 3CZMA 1QG6A 3G1UA 3RBXA 4R9SA 2X4GA 5A05A 4DYVA 4E5PA 1HDCA 4RPHA 4M1QA 3ITKA 2CVQA 1FDTA 3GRPA 2C2YA 2BI7A 4BV9A 1M75A 1NVTA 2VRCA 1QV7A 4BMVA 1F06A 4BO3A 1J49A 4BKUA 1NM5A 4IZHA 2IRWA 3A9WA 3OM9A 5A4DA 2X5JO 3C85A 1ULSA 5ADHA 1E1NA 3RFXA 2H9IA 3H5NA 2ZCVA 3L4BC 2O48X 1EUCA 5KJEA 4BNZA 4YBZA 2NTNA 4KMSA 3LT4A 3JD2A 3LT2A 3ZWNA 1JLLA 5GZ3A 2EKQA 1E7RA 2VHZA 4MVJF 2BGKA 4FFMA 4XD2A 2FPPA 5JDIC 3N7UA 3PYMA 3E9QA 2CZCA 1EUZA 1TB4A 3DB2A 1Q0LA 2W4QA 5AOVA 3ZHZA 4YR9A 1MLDA 1PL8A 1XKQA 3ZWOA 4OXKA 3ENKA 3QVXA 2QW8A 3VZSA 4PLYA 1EVYA 1D3AA 2PV7A 4LCJA 4BNGA 3UW3A 1UZLA 5JDCA 1B14A 1LDMA 5ILOA 3ZH2A 1RM3A 5FWNA 2C0CA 2AW5A 2YDYA 3ZHBA 2P9EA 1DIHA 3D3EA 3ZN2A 5I7EA 3HG7A 3DEYX 2CF5A 2C5AA 5TX7A 4KDEA 2WE8A 1GQQA 4RZIA 4J1NA 5TLSA 1R16A 2BKAA 1R0SA 1XCBA 2FPGA 1PL7A 3S8MA 4YA6A 2B35A 4CM9D 1C0IA 3JQDA 2FSVA 5ES3A 5THQA 5G4LA 1SB9A 4D0SA 3FNFA 1XHLA 3PIDA 1CERA 3CZRA 1Z45A 2YW9A 4M8SA 4ZRNA 4GMFA 1NYTA 4WUVA 1XR3A 3H2SA 2VZ9A 2JFHA 3OICA 1O5IA 1HXHA 1Y5RA 2EP7A 3W4JA 3X2EA 5HS6A 4BNUA 3I9NA 2ZTMA 4HKTA 4ESOA 1XQ6A 1IB6A 3ICPA 3OF2A 1U28A 2ZYAA 2VWGA 3UCFA 3KZVA 3ROPA 3K6JA 4Z0HO 4GSLA 1XU9A 2HAEA 3T7CA 3DBLB 4QO8A 3DZHA 3WGQA 8ADHA 4CM9A 4YAKA 2P91A 1DSSG 2EKLA 3ZU2A 3PFWO 1VE9A 4R01A 3U4HA 4E30A 1PEDA 4NMHA 1I0ZA 2JFFA 3V8BA 5G0WA 4FFPA 2A9FA 4CQMA 4AFNA 1A7AA 1PZHA 3O9ZA 1ADGA 1PGJA 5CEFA 4ALKA 4EDFA 3H9GA 1KIFA 2AEMA 4IDEA 5DP2A 3E5MA 1PGOA 2I76A 1NQOA 2D1YA 1C1XA 1H0KA 3LC7O 1HZZA 3PGJA 3WSWA 2HMSA 5G0UA 4J7UA 2R2GA 5EERA 2YV1A 4W9NA 5LDHA 5DCYA 4J49A 2G17A 3PWSA 1PJ2A 1X1EA 1OI7A 4B4VA 1PGPA 2X0IA 4GKBA 5JAMA 1EE2A 2BRUA 3VTFA 4XKJA 4AJNA 2Y68A 1GYQA 5TS3A 3SBOA 1C1DA 5DT9A 2CF6A 3FNHA 3UXYA 1ULUA 3TL3A 5I8WA 1XIVA 1ZK1A 1W6UA 3IQDB 1HEUA 2XXJA 1YOVB 1G6KA 1NFFA 3RCBA 4BNTA 2ZTVA 4E5MA 3NX4A 4WGGA 2B83A 2VQ3A 4OSOA 2GUGA 2ZQYA 5I7SA 3U0BA 4J6FA 1NAIA 4IDCA 1HLPA 4DQXA 4XDYA 1G1AA 2RHRA 4AJPA 2BFMA 5BNIA 3ZI0A 2I99A 3DZJA 5F1KA 3IP1A 4QEDA 1RM5A 3GVIA 3N58A 4FJ1A 3DTTA 2O3SA 4H7PA 4BB5A 1HDRA 5JLAA 1FDWA 1O8CA 3F4BA 1XG5A 4QX6A 3BMOB 2BMAA 2DTXA 4D3FA 2VNAA 2GYYA 2EF1A 1BRMA 5JO9A 4C7KA 4MVJG 1Y9EA 4HBGA 1BSVA 3EZYA 4CV3A 1E3SA 3I9JA 3RIHA 3A06A 1SAYA 2ILTA 4CM8A 5JYEA 1SC6A 4XDZA 2E48A 2W8ZA 2CD9A 1OC4A 4A27A 1C1DB 1A4IA 3G49A 2W2KA 4Z3DA 2P68A 5CAEA 3O38A 1H9BA 5ITVA 5KJ6A 5A5FA 3RC1A 1WMBA 1CETA 3PWKA 3WGHA 5DULA 2PH3A 2O50A 2EJVA 3UUWA 2Y1CA 1KVRA 4BNVA 1NQTA 1PIWA 3FBTA 4OOEA 5B4VA 1LDEA 2ZB7A 1Q0QA 3ZWCA 2P4QA 3VC7A 3K73O 3JQ7B 5LDGA 3JQBA 5G0SA 1GZ6A 3INRA 4D45A 1KC1A 1YB5A 4OJNA 4PZDA 1GV0A 4DPKA 3SXPA 2GCGA 4TSKA 3DR3A 2Y1FA 1L7EA 3H9UA 4PLHA 4RDHA 5DCUA 3WQRA 2GPTA 4M89A 3SX2A 5H82A 2VTDA 1EBFA 1EK6A 1G0NA 2V6BA 1MA0A 4RF4A 1XQ1A 2IXAA 1XELA 3GZNA 3K9QO 4ZQBA 3TPCA 4NR0A 3JQGB 5C37A 3CTMA 4WLUA 5A06A 3OIGA 1JDJA 5H81A 2I3GA 3U62A 4MP3A 3GGOA 2SCUA 1JKJA 3DBLA 1YBVA 3MJCA 1IPFA 2EGHA 5JW6A 5DBFA 3NTQA 2ZQZA 3OQ6A 4NU5A 2PZLA 2PA3A 4MINA 3NRCA 5COAA 3RU9A 1DPGA 2NU7A 2FWMX 1LLCA 3PLRA 3P2OA 1WPQA 1Z7EA 4M54A 2AG8A 1NVMB 3AI3A 2AQIA 2H1SA 4DPMA 5DF1A 1VJ0A 3L6OO 2IZ1A 3ZHXA 1PQPA 3H65A 3D5TA 1F14A 5EINA 1R15A 5C3MA 3A4VA 1PZEA 4J90A 4MIOA 3WLFA 5JDIA 1GUFA 1JVSA 4QT0A 1K6JA 2NLOA 3ZWVA 3ZV3A 1BVRA 4OHUA 5JXWA 2NTJA 3TJRA 7ADHA 3RAJA 4BGVA 1YL5A 1YH3A 1YL7A 4BKQA 1P1IA 4FFRA 5IDQA 5IDXA 4GMGA 4JCOA 4CQLA 2HRZA 1DRWA 1P31A 4LRSB 3FPCA 2O2YA 3GNQA 3PI7A 4E5YA 1UXKA 3O8QB 1H93A 4DBZA 3F1LA 3IOYA 4LN1A 2GN6A 4U0KA 5ILGA 1U4OA 4EUFA 2AXQA 3LLSA 4P4GA 2FP4A 1EQ2A 4E32A 2A94A 3L9XA 1GUZA 4W6ZA 4CQMD 2ZB4A 5L7TA 4CLOA 1DEHA 3Q6IA 2EW8A 3KSUA 2WJPA 4CLXA 3PHIA 1OZAA 3WB9A 1K89A 4YRDA 4G2NA 4XQ9A 3F5QA 2Y1OA 1QXSA 3MTJA 3JQBC 3V5NA 1IZ0A 3TZ6A 2X22A 1KS9A 1WP4A 1LDNA 2F00A 1GV1A 1N1GA 1N8KA 2NU8A 4HY3A 1F8FA 1GUYA 1U2DA 1YDEA 3V1TC 1VI2A 3NV9A 2X9NA 3OEWA 4RVSA 1P1FA 1PS9A 3JQ7A 1FMCA 1K3TA 3SJUA 2WWRA 2A92A 2GN4A 3HN7A 3CMCO 3QVWA 3MOGA 3NJ4A 4IJWA 2EWMA 4Y6RA 2Z95A 5TQVA 4LW8A 1S6YA 2IEDA 3GPIA 4EZBA 1ADBA 1LLUA 1NHGA 3UAGA 2I65A 1BTOA 1Y7TA 3OBBA 4YJGA 4KDFA 2VHXA 2VHVA 1O6ZA 2Q1WA 2VWHA 5TIIA 3ROMA 5BQFA 4LRTB 5HM8A 1Z82A 2ET6A 2Q3EA 2EP5A 1U1IA 4ITUA 1ZUD1 1VJTA 5AVOA 5JMPA 1EMDA 4NFYA 1SO8A 1KETA 1L7DA 2CUKA 1KERA 1V35A 2PZJA 1E7SA 2B4RO 3OMLA 4GBJA 3Q11A 1U5AA 3WIEA 4BV8A 4K6CA 4BS9A 4KTTE 4LGVA 4BUCA 3U4CA 4BO1A 1ZW1A 3UVEA 1DO8A 1UXIA 1ARZA 1TI7A 1PQUA 2BI8A 3BAZA 5AXDA 3H6KA 1DIAA 4LSMA 3FD8A 4FJ2A 4CR7A 4OM8A 1MFZA 3KYDB 4NIMA 4IJVA 1OC2A 2POQX 4F3YA 3SEFA 4GPD1 1OFGA 1ZFNA 1M2WA 3RI3A 1PJ3A 4ZQGA 3RU7A 1GU7A 4FD3A 2Y67A 2PK3A 4ID9A 2CMDA 1LI4A 4PVDA 1Y5MA 5GZ1A 5TT1A 3I4FA 3S2EA 2X6TA 1YOVA 2ZB8A 2AMFA 4HWKA 2BHLA 4BNMA 4CODB 4AJOA 5A3VA 1EDZA 4NQZA 2VCYA 3ASVA 1VSVA 3GR6A 1ZEJA 1ZKMA 1GYPA 1CWUA 3FNEA 3KSZO 3GVHA 3ULKA 3PZRA 1NWCA 1GR0A 3EK2A 5JY1A 1BXGB 3F4LA 4E13A 4R3WA 1V3TA 3O4RA 4KWIA 5L4SA 5TSDA 4MP6A 2C07A 3I4CA 5T64A 2NVUA 2C7GA 4EJ0A 2Y1GA 4YJHA 1DFHA 3K92A 4NBWA 3U4IA 2AE1A 3IUPA 4K28A 2PFGA 4N5LA 3RUDA 1LDGA 4IDGA 3PHHA 1T1SA 2W2LD 4NFSA 4JQCA 4DRYA 3SVTA 4HV4A 4Q3DA 4E12A 5A03A 3VH4A 5T8KC 4MIYA 1K6IA 1OMOA 3I5MA 2YZ7A 2Y0DA 5ICMA 5MGBA 4RV9A 4YRAA 3L4SO 4CM4A 4RLHA 2DUWA 1DFIA 4I5EA 3D4NA 1PS0A 2Y1EA 2QIOA 3HQ4O 2I9PA 1UJMA 4JJGA 1YE3A 2UDPA 4CQMB 1E7MA 1R0KA 4RVFA 2WDZA 4NZ9A 4PG8A 1Q1NA 5JNLA 2CSUA 2GZ3A 2D59A 1PS8A 3DHNA 4WNCA 1LLDA 2Q99A 5ICSA 4YWJA 5TGDA 3MJ4A 4L4XA 2HMVA 1T4DA 2Y1DA 1TT5B 4BL5A 5JMWA 4GX5A 2X1HA 3ETDA 3KVOA 4BNYA 4J4TA 3KRTA 3NYWA 4DL9A 3VKVA 3AUAA 3M2TA 4UVIA 5C5IA 1AHIA 5G2OA 3R3JA 2YHUA 3OECA 3QVSA 2VYNA 4XJSA 4YCAA 4Z9YA 3IJPA 5IDWA 2ZTUA 4YAJA 2UUOA 1FXSA 3WNQA 4EEXA 1V8BA 4XQEA 3WGZA 4BB6A 1LU9A 3M6IA 4XJTA 3VH2A 4CL8A 5G0TA 3ANNA 4CUJA 4E2ZA 3ITDA 3F46A 2V7PA 3FF4A 4F6LA 5B4UA 5BSFA 3RUFA 3Q2IA 2H63A 2PKRA 3GRKA 3ST7A 4BO4A 4NJOA 1EVZA 5LCXA 2YQ5A 1VJ1A 1ISIA 2G82A 3LQFA 3DOJA 1GAEO 4AJLA 2B4QA 2V6FA 4S1VA 4G5HA 4R5MA 4ZQFA 1Y8RA 2VYVA 4JXKA 4XWYA 3RSHA 3ZWBA 1LDYA 4P4LA 3ORFA 1IY8A 4GWGA 3WS7A 1LDBA 1ZH8A 3GN1A 1E6EA 1HSOA 1B3RA 2JHGA 1ISHA 3DAFA 4II2A 1PZFA 1ENYA 2A4KA 3P5SA 1I8TA 4MVJP 9LDBA 3MCVA 4MVJH 2O23A 4DIFA 3K96A 5KCZA 2YY7A 3GHHA 1IZ9A 3W8FA 1P74A 4FSHA 1ENOA 1F0YA 4ND2A 1CDOA 3GUCA 1LSJA 4B4OA 3B1FA 3GDOA 4FCCA 5B12A 3TZHA 4P4NA 3JTMA 3FWNA 3PJGA 1UAYA 1VC2A 2UYYA 1D8AA 2DAPA 1CIVA 5A9SB 2NWQA 1Q7CA 1GZ4A 2YUTA 4IXWA 3DMTC 2B5VA 3WXBA 1Z6ZA 3KETA 1K0UA 2Q4EA 4DVJA 5KJ1A 2FR0A 1NVGA 1PQWA 1VL8A 1NQAO 2QYSA 5A04A 3TSCA 4ALIA 4BO0A 3MZ0A 2Y0CA 5F1OA 2P5YA 3ROKA 3ETEA 4O5OA 4HXYA 4QXMA 5DDIP 1XA0A 4U6QA 4WEOA 1E3WA 3BMNB 3SLGA 3JQ6A 4I5DA 4RJTA 2Z1MA 1PWXA 5F5LA 5EMHA 3INGA 4TVBA 4EJ6A 4ALLA 3TFOA 1MG0A 3NGXA 1JU9A 4IY1A 4OIMA 1Q7GA 2PTGA 2YJZA 3ANLA 3DZKA 1WW8A 1ZBQA 5F21A 4PG5A 1GFSA 3VAZA 4DIBA 3D4PA 4INAA 1OBFO 4JX8A 1LNQA 1C1XB 1PX0A 2GASA 4MVJI 5FFFA 1Q2XA 3GGGA 1XEAA 1UZMA 4EGFA 3PQDA 3HDJA 4J1QA 3BMQA 2FOIA 2Q2WA 3VPFA 1Y8RB 3H8VA 1KVTA 4WKGA 4Z0TA 4EEZA 3ZWXA 5F3RA 2ZCUA 4BNKA 4CUKA 1KEWA 2QZ9A 4Z3KA 3P2YA 3F3SA 3E9NA 5C7IO 4JLWA 4RPJA 3TZQA 5KKCA 4CMEA 4M87A 4A5OA 2JCXA 1Y9AA 5HRUA 3JSAA 4R69A 3PLNA 2OO5A 3LT1A 2EV9A 3PZBA 1LLQA 4RVHA 1GADO 4RZHA 2H6EA 4BQPA 3EYWA 4LVUA 5C7LO 3OHSX 2PNFA 4I5FA 2X86A 1T1RA 3I9OA 3KV3O 4XX0A 2PGDA 3DQPA 1JAYA 5KVQA 4CM5A 4WJZA 4YEDA 2I6TA 4JROA 4D41A 4F45A 3VH3A 1B8UA 1X7HA 2X9VA 2PD6A 3AU8A 3EDMA 4L74A 1DFGA 1DC3A 2XOXA 2OZPA 3BHIA 5T67A 2HKIA 1KOLA 4CMHA 5L45A 4CMKA 5FI5A 1T2CA 5U4QA 4DLAA 2NACA 1CJCA 1NFRA 2QRLA 4QECA 2OMEA 3GH3A 4LCEA 1V6AA 3E9MA 1E6UA 4NBUA 1CRWG 1MXFA 3PHJA 1X0VA 4R1UA 2ZIZA 3TZCA 4CMCA 3GVPA 3DL2A 1UH5A 2IYPA 4BKRA 3SC4A 5CP8A 3WGGA 5KVVA 1Z74A 1YO6A 3STHA 1P0FA 2CDAA 3DTYA 4B8ZA 3QE3A 5CHEA 3NKLA 5TF4A 3PVZA 5A02A 4GSKA 5CDTA 1GCUA 3GAZA 1LXCA 5TRTA 1DB3A 3OJOA 3QWAA 4FN4A 3PYLA 3I9KA 1NPYA 1WVGA 4ZGWA 1U4SA 2D5CA 4B8WA 2VOEA 1E3EA 3GY0A 1ORRA 3DXFA 3HADA 3B70A 1PZGA 4TRRA 4A2CA 4P8RA 4GWKA 5G4KA 1N7GA 1B15A 2QHXA 4NK4A 2DPGA 4NG5A 4TRMA 1I5RA 2EGGA 2R6JA 4J0FA 5KKAA 4E6PA 5J23A 4PLVA 2QX7A 3IMFA 1ZMOA 3IDSA 2HJSA 4BNLA 1LUAA 1PTJA 1ZK0A 1BXGA 2RH8A 3H9EO 3KYCB 4Q3BA 5DZSA 2NM0A 4DC0A 5K6AA 1DXYA 3RJ5A 3GQVA 3B6ZA 4CMIB 4KQWA 2G76A 2HK9A 3VVBA 4E3ZA 3KM0A 2JCYA 3WGIA 4BNWA 2GRAA 2NUAA 2D4AA 5EESA 1E1LA 2NTVA 1WDKA 2J3IA 2DLDA 3FPLA 1BHSA 4XGNA 1LQUA 2VTEA 4IIUA 1O94A 5DN9A 4FGSA 3NT2A 3ZWPA 1NNUA 1W0CA 3E18A 1QP8A 4B3IA 4PLZA 4MOWA 2V6GA 3AFMA 5L3ZA 4R1NA 3MJSA 1ZXBA 1TT5A 1KEUA 2HMUA 3F9IA 3JD1A 4PLCA 5DCWA 4L76A 1TEHA 4RVGA 5COQA 4D42A 4UAGA 3WX0A 1CQJA 2J5RA 5IZ4A 5IXSA 4BGUA 3VZPA 2IEBA 4RPGA 1NBOA 1N92A 4TZTA 3IC5A 4FB5A 3WWYA 4Y6SA 3VDQA 3ZNPA 2BGLA 2VHWA 2VYVD 4TQGA 5I7VA 3JQAA 4J16A 5HWSA 1HKUA 3ENNA 2DTDA 3G3EA 4DGSA 3D3WA 3AW9A 1U2GA 3U09A 2IXBA 4K1LA 1PJSA 1FDSA 3ZWYA 4XEHA 4CV2A 2Q2VA 3TQHA 1MX3A 2ZK7A 4GI2A 5F5NA 1IPEA 5HBRA 5IFLA 1K5HA 1XSEA 3D7LA 1R4NB 5BT9A 5DBIA 3BTVA 3CE6A 3I1JA 1P1HA 4ZQHA 5A5EA 1DLJA 3HZZA 3OP4A 2NVUB 1KEPA 2VT2A 3E5RA 3OA2A 4MJLA 1XWFA 3GMSA 1DC5A 5T57A 1HE5A 4PRLA 4UVDA 4XZ3A 4D0RA 4D3SA 1Y8QB 1DJQA 4UEOA 4DYDA 2RCYA 4HFJA 4PRKA 5ENDA 3H2ZA 1ZZEA 1W8DA 1WMAA 1R0LA 4U7WA 1ZJZA 2PGJA 4I5GA 3EHEA 1HE2A 2I3AA 1X15A 4IGEA 3GEDA 2HDHA 2VUSA 4R1SA 3Q9NA 3JQ8B 2DBVO 4DA9A 2X23A 4JN6B 1NX6A 5KVCA 3QWFA 1ISMA 4KP7A 1YL6A 3QV1A 4ZHSA 1BVUA 3RUAA 3BIOA 1MC5A 4GGOA 4YTEA 1R6DA 1R37A 3DOOA 3QWIA 1H6AA 4L4SA 1E3IA 3ROQA 1U3WA 5L95A 2HK8A 3COSA 4H3VA 4MVJA 3RBVA 3G0OA 4ALJA 3GFBA 3LC1O 1B3BA 2Q1TA 1P44A 3IUSA 1R66A 4UEJA 3HE3A 1I2BA 2B4TO 2AQ8A 2HMTA 3EC7A 4FFNA 5JCXA 5JS6A 1LEHA 2VNSA 4XYGA 3V2UA 4XYBA 1O95A 4GLLA 4R68A 4IBOA 3ZCXA 4J0EA 3WYEA 2GO1A 3WIDA 4R5HA 3V2HA 3ABIA 4KUEA 3S1LA 3U3XA 4J43A 1EZ4A 4CM3A 5KJCA 3ZW9A 4TWRA 3HB5X 2ZJ0A 3UKOA 5JCJA 4XYEA 3C8MA 4RF5A 5AXAA 4YYZA 1ZXLA 3FN4A 3OIDA 4IZIA 1LQTA 2HRBA 3W6UA 2NU9A 2O2SA 3ZWWA 1JAXA 5ER9A 4ALNA 4DMMA 1EE9A 2X7HA 2PGLA 3ON5A 4B3HA 3UGKA 4HNHA 2FHSA 4JNKA 3UICA 2LDBA 2OGUA 2GGSA 4MVJD 3DFUA 3S2IA 5CDYA 1E92A 2Y99A 3PJEA 2VZ8A 5THKA 5CPFA 1HTBA 3ZU4A 1LTHR 1LA2A 2DVMA 2P9GA 5K0ZA 1H6CA 1J4AA 3BMCB 3IP3A 2C54A 2DKNA 2EG9A 2JAPA 3H7AA 3WICA 4N18A 5IDYA 3DC2A 4YXFA 1YQGA 1YBAA 3I3OA 4Q39A 3RQSA 4A7PA 5JC1A 1NR1A 4RQUA 3H9QA 3GDFA 1ENPA 1UUFA 3TRIA 5DOZA 4YAIA 3L77A 6ADHA 3N74A 2HSDA 3AM5A 4CMGA 3AU9A 4DREA 4BKPA 3BMCA 4NBVA 2AQHA 2QRJA 3LVFO 1ONOA 3KBOA 1IE3A 4Y8VA 4XRGA 3LF2A 4K26A 2HQ1A 3F1KA 4YB8A 3Q9UA 5CG1A 1XYGA 4J1TA 1VSUA 3PGXA 4TRJA 4AL4A 3AK4A 1KVQA 5JPIA 3V1UA 3VKUA 1R4MA 2YHIA 1GYRA 4O63O 2O3UA 4B7CA 3RASA 4EW6A 2DPHA 4PCVA 1BGVA 2AA3A 1T2EA 3G1TA 2YFHA 5BSGA 4BIIA 4TVOA 5KWEA 3WJAA 4ND4A 4A0SA 1LC3A 1S7CA 5L53A 3PDUA 4JBGA 3OA0A 5FF9A 1A72A 2WD7A 3UF0A 1AXEA 4L0QA 1QLHA 2CVZA 4IQGA 4MKXA 3RJ9A 3U49A 4G81A 4JP3A 4BO5A 4OL9A 1V9LA 1ZSVA 4YVFA 3BMOA 1WWKA 1ZNQO 1YQXA 3EGOA 2J5QA 4E2XA 3LC2O 3K8ZA 1RM0A 5BNTA 2D8AA 1V3UA 3IKVA 3K30A 4ZN6A 3I9MA 3NGLA 1UDAA 3NDJA 4GH5A 3WR5A 4JBIA 1TT7A 4IDBA 2FPIA 4AICA 5L7YA 4CLRA 4OAQA 4DUPA 3JYOA 3CPSA 3PP8A 1C0LA 3A28A 1PJCA 3HNPA 1P1RA 1BXZA 1I2ZA 4QFCA 5KJFA 1YWGO 3OQBA 3ZV6A 2PH5A 3VHRA 1PJLA 4II3A 1QMGA 3VTZA 4IQ0A 4PZEA 3NEPX 4DWVA 3H3FA 1VKOA 3B1JA 3WSVA 2NNLD 3GF4A 4OMUA 1YB4A 3VPGA 3OJLA 1Q0HA 4J1SA 1Q7BA 3A1NA 4QO7A 1HETA 1C3VA 1SOWA 4IS3A 4BNXA 4YQZA 2X0NA 3G17A 2CVOA 1GY8A 3MWDB 5EN4A 3GVCA 1J5PA 1Y81A 1T2DA 3C1AA 1HYGA 2IDZA 4U8GA 1A71A 1U7TA 5TNXA 2E6UX 1AN9A 3ONFA 4GGPA 1X14A 3KLPX 3DOCA 2JD1A 1QKIA 4PLTA 3M2PA 4HFRA 4E33A 4XB2A 1R4NA 3PTZA 3OJEA 3GA0A 5KIAA 4R41A 3AOGA 1E1KA 1RJWA 4RF3A 9LDTA 1TLTA 4O6VA 2JCVA 5JAIA 2HLPA 4N5MA 1G0OA 1H6BA 1P45A 5FI3A 1PU2A 1FDVA 5COBA 2DT5A 1P1KA 4GX2A 4MKZA 2CFCA 2C5EA 4HP8A 2CDCA 3TDKA 5CDGA 1BW9A 4CR8A 2PZKA 3AY6A 3B1KA 4KQXA 3WLEA 3DONA 4C7JA 1GCOA 3HWRA 4MO2A 1SMKA 3MWEB 3VOSA 3AJRA 3KLMX 4BO7A 2P4HX 1YVEI 1IHYA 4TROA 3IS3A 2B0JA 3C7AA 3VPXA 4AJ1A 4E21A 3GOHA 3ADPA 1WZIA 3PPIA 4TMFA 4IMPA 3QWBA 5TJHA 1YXMA 4BMNA 2GR9A 3FWZA 2VWQA 3ZGYA 3LYLA 2V65A 3KEOA 4EJMA 3D4OA 4FDAA 3AI1A 2GERA 4JK3A 3U4DA 1GPDG 3CUKA 3PEFA 4MP8A 5KOIA 2FSSA 4FBGA 2GSDA 2BFPA 3MJVA 1T4BA 3RUEA 3GLQA 4U6SA 1UXGA 2BF7A 3W8EA 4HUJA 3GEGA 3WBFA 4CJXA 3QVTA 2CDBA 4XB1A 4CLHA 1UDBA 3QW2A 2HK7A 1NTOA 1ONNA 1HF3A 1JTVA 4AJKA 2DBZA 2J6IA 1HWYA 3JQ9C 4HADA 4I9HA 4E0BA 1FF9A 3PQFA 1T26A 3JD3A 3KHUA 4WNIA 3QWHA 2LDXA 1LRKA 4BNHA 2RHCA 2VRCD 4EUEA 1A9YA 3H5AA 2HCTA 3GZ4A 1DC4A 4RVUA 1L1FA 3I9LA 5I9LA 3PK0A 4RO0A 1Z73A 1YJ8A 4W82A 3PHGA 3FBGA 4O1MA 4IJKA 1PL6A 4WECA 4BNJA 2J3KA 2O3QA 1AXGA 3ONEA 5JY6A 4K9DA 1F12A 4E31A 3EAGA 2GZ2A 5AXBA 1D4FA 4B3JA 5BSEA 3IL2A 3NDRA 3L6EA 2NU6A 3AWDA 4FW8A 2CY0A 2Q1SA 4A73A 3KO8A 3H9JA 3I6IA 3ADOA 1TXGA 3AUSA 1H2HA 4YT4A 3EVNA 4PG6A 1AHHA 4W99A 5JBIA 4NBRA 4S3MA 2FR1A 4WASA 1WDMA 4Q3NA 1AE1A 1DIGA 1JKFA 4J7XA 2VN8A 3O03A 1K6XA 4GKVA 1I3KA 1YKFA 2ZKLA 3UOGA 3GNSA 4D79A 4PLPA 4BO6A 3ASUA 1NP3A 2OBNA 1PGNA 4GX0A 4UEKA 3QP9A 2TMDA 4B7XA 1E6WA 3VDRA 3WFJA 3JQCA 1ZSYA 4OOFA 2VWPA 4TZKA 3C7CB 4MIEA 4OKNA 1UXHA 1YS4A 4J9UE 2Q4BA 1ZEMA 4GVXA 2UV8A 2IZZA 4XGIA 4MPDA 1GEEA 2I66A 3EVTA 4FJ0A 2NQTA 2H5LA 4XCVA 4F6CA 1SZJG 3PIIA 3OETA 1UXJA 3DBRB 1N2SA 2V6MA 3A14A 1JA9A 4BNIA 2JFGA 3ZNNA 3KSDO 5EQDA 2PWZA 1P33A 4BOYA 3BHJA 1N1EA 1QYWA 1W4ZA 1EFLA 5AQ1A 4K6FA 4CLEA 4PG7A 2DFDA 5T8KA 1XDWA 4FR5A 4PFJA 3DDNA 3OJ0A 3I52A 4CR6A 5JCJD 1BXKA 3F6YA 3GFGA 4XYLA 1E3LA 2O7QA 3WJ7A 1ONPA 3GC6A 3GN2A 4OYRA 1RKXA 4D43A 2DQ4A 2IE0A 2OUIA 1X1TA 1DIRA 2C20A 1B26A 2BFAA 2GD1O 4HX5A 4CUZA 1UAGA 3HSKA 4BO8A 5L51A 5IN4A 1A5ZA 5K6AC 3OIFA 4WPGA 5BR7A 2DUUA 1P1JA 1SPXA 2G0TA 3AY3A 3D1LA 4OGWA 3B20A 3GG2A 1LJ8A 2FZEA 1I3MA 2WYUA 2P2SA 1UR5A 2J3HA 1NQ5A 1P0CA 1UP4A 2EKPA 4EBFA 2O4CA 3WYBA 3ZW8A 2O3RA 4B79A 4FIZA 2RIRA 4GQAA 3Q3CA 3H5RA 2B37A 1B7GO 2JD0A 3UCXA 3VZQA 4IS2A 1U3VA 5EL0A 1W73A 3WTCA 2EW2A 1MC4A 5GMOA 2FMUA 4ROSA 1GDHA 3SLKA 1BDMA 2HUNA 3RC7A 3VZRA 1U8XX 4E5KA 3W6ZA 3OH8A 4NDNE 4YJDA 1I10A 4YRBA 1KY5A 1IYZA 2ZB3A 5B37A 5T5QA 5BSHA 3ZV5A 1P9LA 1Y1PA 1CYDA 1Z75A 3R3SA 1DC6A 1UDCA 4LVCA 3FHLA 1UP7A 3CINA 1LRLA 2X5KO 3ZU5A 4D46A 5AYVA 4RPLA 3TWOA 3JQAB 4I9UA 4KOAA 2WD8A 4Q9NA 4Y9DA 3C7DB 5FYDA 4AJEA 3KTDA 1QLJA 1ZMTA 1N9GA 4J91A 4A03A 5KVSA 3DBRA 2FRDA 1ZK2A 4KZPA 4IXTA 1KVUA 4CLDA 3NTOA 2VOJA 3C1OA 3WBBA 3E48A 3AFNA 5I9MA 1LBEA 3FR8A 1HT0A 4PZCA 4LMPA 2VUTA 1X7DA 3EW7A 3DWFA 3QIVA 4MVJE 4PIVA 4DLBA 3DO5A 2PZMA 1ID1A 4Q3EA 6LDHA 3K2EA 2Y66A 3OSUA 3IKTA 4I08A 4IUYA 1B2LA 1LSUA 1NFQA 3I23A 3DAPA 5JSFA 4IMRA 4UVEA 3ZWMA 4CMJA 1EEHA 4L8VA 2B36A 4Z0PA 3PJFA 4QUKA 5HTOA 2O3JA 2Z1NA 1P77A 2ZJ1A 3BTUA 2PLAA 1SBYA 4WK6A 5CG2A 1MFPA 4KUHA 4NJMA 1CF2O 4J4BA 3PWZA 4RL6A 3BA1A 2XPCA 3FR7A 1PJBA 3BYZA 3HDYA 4UREA 4AVYA 3C3XA 1MV8A 3FRJA 4DPLA 1RPNA 1YDWA 2OL4A 4N7RA 2GN9A 2GZ1A 4NK5A 1EDOA 3FTNA 3INTA 3JCZA 2PY6A 5G4KB 5TJ9A 3ZU3A 4ZICA 2W98A 1VPDA 3D0OA 4WEQA 4BNNA 2B69A 1ISJA 3DMTA 4DQUA 3QHAA 3WYCA 5HS4A 1LSSA 4WOKA 1IL0A 1GPJA 2PKQO 5L4NA 1JKIA 1WLYA 4JJFA 2JAHA 3CIFA 2NQ8A 4RORA 1E0DA 1NPDA 2GN8A 1XGKA 2HO5A 4R3NA 3O8QA 4R51A 1KBZA 3LSYA 3ONDA 3X2FA 3S2GA 3ANMA 1M67A 3GVXA 4PLGA 4EYEA 2UVDA 4ONEA 1O0SA 4IPTA 4W7IA 4FOOA 5AXCA 4CMBA 4GLOA 1YGYA 4AJIA 5IZCC 2BFOA 4FS3A 1DBVO 5TT0A 1T24A 1K2WA 4WCFA 3HDHA 1YB1A 4NU6A 2E82A 1QYVA 4RDIA 3TN7A 1DOHA 3BHMA 3HB4X 4FC7A 3LDHA 4JJIA 2R00C 1HE4A 2JJYA 3E03A 1E7QA 4CM6A 3QJ5A 2O7SA
chains in the Genus database with same CATH superfamily
3LFUA 5GZ6A 1JU3A 1NW5A 2CCKA 4D1YA 4REQA 3EIQA 3PUYA 1CFZA 2PSSA 5BR8B 3SVLA 2VF4X 4AN1A 3Q7QA 1JW9B 2BLNA 4YH1A 3IBTA 5ESRA 4LDAA 1RAFA 3MOIA 1RYEA 1FFYA 1GNVA 1QTRA 2BSXA 4E5DA 5LLDA 2HF9A 4JIMA 4QTTB 5H4GA 5CIQA 4ESVA 1OT3A 2H18A 4P53A 3QU5A 5DHAA 2D2IA 1H6DA 3AUUA 4N82A 2IV7A 5F64A 4K9LA 2J0UB 1E5DA 4PYMA 4DLLA 1O96B 1MB4A 1H2YA 1XBTA 4AZSA 2OHIA 3T3NA 2FLKA 1FQJA 4DMRA 3PRJA 3V1MA 1PZNA 1ZH0A 3QUAA 4PGFA 3IOEA 3DFZA 4ITVA 3ZW7A 3T1YB 5JUWA 4ZTUB 1IXYA 4NI5A 4ZYXA 1CRQA 5EE0A 1N0VC 1E77A 4NE2A 3V7YA 3DYVA 1D6JA 1OASA 1OZ0A 3MUNA 4HTFB 4PXYA 4B4KA 2EXXA 2XVAA 2YWBA 4PPQA 3WGOA 1SCKA 1RPJA 3QKRA 3UUGA 2FY8A 4AK9A 3NXKA 4AKSA 1HYEA 5H5JA 5IN5A 2CWDA 1BDJA 4N5DA 3OC6A 3Q41A 1Z5OA 1XAHA 2PKYX 1EHYA 1Y1RA 3SBDA 5TE9A 3NVAA 4DTIA 3X1WA 2E3JA 3HU5A 1TJ4A 1E0JA 2QX8A 2G09A 4OXQA 3DQZA 3WHPA 3P0EA 4ETNA 1XP5A 1E5LA 4M9CA 3F6PA 4AP6A 1AKVA 2D0OB 3MM4A 1Z2CA 1W85B 4XIJA 3LWDA 5HUQA 2CSXA 4DQLA 1G8MA 5CH5A 3G85A 4HAXA 1ZIYA 2N3ZA 3DF9A 3L9WA 2WT8A 5CNIA 3WLIA 3LI2A 3R5FA 1HFKA 3IAAA 1HDOA 3GBSA 3A11A 2VDMB 5LC1A 2W2KB 1UMBB 2CUZA 4F8EA 3THXA 5ALXA 1U5CA 4ENPA 4XLLA 4CIXA 3WDMA 3KB6A 1Z47A 1II0A 1QX4A 3C6KA 1A1VA 4YT5A 2ZVDA 3KZCA 4RF2A 1SVKA 3NHPA 1MAVA 4A10A 1N7HA 3CKYA 3LZ6A 4Q16A 1M8JA 3AKYA 1IU9A 3QVKA 4OAPA 4CI9A 3H1AA 2YZNA 4A15A 2JFOA 2BH9A 1ESCA 3LHIA 5ICGA 1A4XA 3DZ8A 1ADFA 3LCVB 2XEDA 3FOCA 4FFLA 2V59A 1RJDA 2JGDA 3GAFA 4DEYA 8LDHA 1HYHA 2WAOA 3JWJA 4AYTA 1FE8A 2MMCA 4ZVNA 4B7UA 2WTBA 1RXWA 3QJGA 3RROA 4DB4A 1E8MA 2X8WA 1KVSA 4K2HA 1U8CB 3NJ8A 1DVRA 2FPRA 3UCEA 3TOXA 4DMLA 1A27A 4CLRB 3ZJTA 4YAGA 1PJZA 1M2OA 2DTEA 4G37A 4ENSA 1A5AB 2Z8ZA 1WZEA 5JSZB 4JNCA 4QG3A 1RLJA 1L8XA 3NETA 3AF1A 2H06A 1SCBA 1U2QA 3TNYA 721PA 1QAMA 2BBOA 5E1MA 3DHYA 3PJRA 1FNDA 3CH4B 3CLSC 3A1SA 5G1NA 3HA5A 4L0DA 1G1MA 4GZ5A 3EXIA 1BQ4A 3F6EX 3KZXA 2HJHA 3ZV4A 4YJFA 3D1JA 2ATCA 3IUMA 3KVRA 4LTDA 4DLYA 5D1NA 1KFBB 1NXQA 3SC2A 1W88A 1AUPA 3BSWA 4L28A 4ZJUA 2GXUA 1U5BB 3DBHA 3REOA 4B6GA 1OIXA 3K6RA 3Q2KA 4NNJA 3NHLA 1QHHB 3DXZA 2NVWA 4KX3A 3TR6A 4ZTZB 1G8YA 3II6X 1BJTA 4EG5A 3O8RA 3FDXA 5FTJA 3UJ9A 2FI1A 5CT4A 3V1YA 2ANCA 2QQFA 2WPDA 3DOUA 3KSRA 5EEGA 4Z54A 2WM2A 1JSRA 3CEAA 3FUTA 4LHZA 1PDOA 3OURA 4O25A 3EIOA 3CY6A 2JHFA 3RC8A 3TSOA 4ARCA 3MEQA 4CL3A 1I30A 1X1AA 2AN9A 5CNJA 3QFTA 2WF6A 3AHHA 4WDQA 3FOZA 4H77A 4LAFA 3CLTD 4C4ZA 2UAGA 1C0EA 4ZV7A 1F3OA 2PRYA 4R9VA 4DJEC 1C0KA 3Q6NA 2H0RA 1YVUA 1R12A 5BR4A 1ADCA 4O0LA 5BNFA 3ZWAA 3R2JA 4NYIR 3KJIA 1K08A 2BGMA 4IWYA 3STVA 1KU0A 1LSOA 1SEVA 2CN1A 1ZICA 2G25A 3JYNA 3RIXA 4DQVA 2EVWX 2G4VA 3I6QA 1HSZA 4P32A 2R6FA 2G9RA 5FI0B 3WHKA 1KZ1A 4WTOA 3TOCA 3RFTA 2JLAA 1OFUA 6REQA 3AKCA 5ARDA 4D4KA 1XDUA 2J5BA 2Q2QA 3F98A 3S7ZA 1ZBDA 2VYND 4YAEA 1KYTA 3CB4A 5BN4B 1T9CA 3VNQA 5L9AA 3QNMA 3ZD9A 2FW6A 2YWGA 3EDRA 3W8DA 4ENUA 1B8VA 1GQFA 2V4MA 3B1VA 3NVKI 3QY0A 1SU7A 3I6ZA 2QZJA 4ARAA 1OB2A 2WQZA 1KRWA 4PR0A 2GXSA 2UYQA 3DW3X 4RSMA 4V0LA 2WF7A 1QRDA 3EPPA 4CDMA 2C4HA 1GRRA 4NENA 2QY6A 4M76B 4UARA 4DDUA 2QBYB 3UAXA 4U2CA 4H3KB 4DLXA 2ZSDA 4GC5A 4YJ3B 3AIIA 3FOFC 4TM7A 2WJAA 2RGWA 3IE1A 3HCDA 1AV6A 2M32A 1LX6A 3MRXA 4IFBA 3SQXA 2A9QA 3WRXC 3OKCA 3H5VA 3GNTA 1RJGA 1T1EA 1YI0A 2H3HA 4A26A 5AVSA 1OV6A 2R96A 4WXRA 3R6TA 3ZUPA 1J0EA 4RMJA 4FMPA 3TXYA 1A9TA 4JH0A 1RJ9A 3TXAA 4BMSA 2YQ4A 2FLWA 3FTCA 1AQUA 8MHTA 2PUJA 1YJXA 1YDGA 1ZL0A 4EHJA 2CXUA 5BWMA 1RQPA 2QVYX 2WYVA 1DDOA 2XECA 4XUCA 5CFLA 3O84A 5TQJA 3E82A 1MF7A 3UXEA 5AM2A 1P2BA 4DR4B 2FZ4A 1BD3A 1Z7BA 1CY8A 2WM3A 3H11B 3Q8XB 5IBRA 3UKJA 1Q1BA 2WC1A 3U7FB 3H8JA 3CA8A 3HCEA 4OQ4A 5GAJA 4H1HA 3QRWA 4AJHA 2CL7X 2Q50A 4R8LA 1EI9A 2C92A 4GP6A 4N0DA 4OXRA 4QBKA 5LZ8A 3SFVA 4F5WA 1P9NA 1MQ8B 2ODAA 3MMPA 1YZQA 2KBEA 1HQDA 3P9YA 1A9SA 3EZ9A 4OL0A 3W0LB 5ADWA 4PAMA 4ZVOA 2J8ZA 1AIPA 1X70A 4TMTA 3TLEA 5BVGA 1W96A 3DCJA 3OFSA 5HHTA 4KH0A 5KYYA 1VZ2A 4PC1A 5IZCA 3CO0S 4DSZA 3LX5A 4M1ZA 2D0DA 1XXHE 5FYQA 1TYEB 1S7GA 1TVEA 3GI1A 4JHLA 3AF6A 2NSDA 2ODPA 2Q4DA 4KMMA 3EISA 4JZYA 4NMWA 1JFRA 4DUZB 4AUMA 1I4OA 2XDAA 2C59A 3ABOB 2VJDA 3QUCA 1ISGA 2XWPA 1W5SA 2QVGA 1K86A 4G56A 4DIOA 5I7WA 3DAYA 1V6CA 2B5WA 3RRBA 3T4UA 1NYLA 4Z9XA 1V3QE 4IM7A 1A9ZA 1WD7A 4WRRA 2VRWA 2B2NA 2UUPA 1W5EA 3EFOA 5JALA 1QP0A 2YFQA 2P2NA 3EZ7A 4B17A 4H16A 5CDUA 2ZVJA 5KS2A 1MC8A 1Z2DA 2G28A 1NI5A 1HM5A 3EQ8A 4L78A 4I4TF 2OORA 4BQFA 2Q1UA 1YR9A 3HWX1 3E3NA 1AGNA 1E2QA 4PANA 5CK4A 4IIDA 3ZJUA 4UM9B 2JGIA 4MIKA 1XV5A 4DCCA 1NDHA 421PA 1EBBA 1HL3A 2X14A 1ZAYA 5I7OA 1QH9A 1TL7C 3AJ9A 3GEMA 3H4MA 5IVDA 1D6SA 4M49A 4BNFA 4ZDIA 1AVTA 1NN3A 4PZYA 1LFDB 2Y6VA 5KUTA 1QIFA 2QPTA 1Y42X 4BGEA 4AMVA 3L7NA 4J8PA 4UUMA 1KR2A 3GDGA 2C4WA 2NX2A 4N49A 1O5TA 2HXYA 1KPHA 4CT4B 1JQBA 5J1SB 2J6BA 2Q3BA 4QWMA 1YQWA 3NNNA 1YRLA 3Q2OA 3MQFA 4M46A 2YHIB 3ECAA 3E53A 4WY5A 2UZIR 5A6SB 4JEMA 4PRZA 4QBGB 2XMRA 1G5FA 2DYKA 2H5JA 2X7JA 2GEVA 2WMDA 2ZRFA 3P2JA 5HKKD 5FTMA 2WSBA 2H0AA 4JLMA 3T7JA 1QO0A 3WK4A 4HRVA 4W7SA 2YY5A 1NUUA 2NXWA 2C2MA 4KGXA 4IRXA 3LP6A 3RG8A 2WYWA 1J1ZA 2HGZA 3GJQA 4MZDA 3RKRA 5EUCA 3TS1A 3PTAA 3IRVA 1WTAA 1SQ6A 3ND7A 4Q18A 1B16A 5JZBA 3IAXA 2B78A 4RCVA 1GN8A 1KRXA 1DHRA 2OXCA 2JJQA 3ECSA 5EQFA 4JP5A 1XYVA 2EQ5A 4ZU3A 2H16A 2F8LA 4CLOB 4L73A 3ZNOA 3DH0A 5P21A 5BQ3A 1NIJA 3FVQA 4HUQB 2HRCA 4KKXB 1DT3A 2YV2A 1KSGA 2IZ0A 4W6QA 5L3SB 3R40A 1NI3A 3CNNA 4JYPA 4IMIB 4LG1A 4TUYA 3UC5A 3OTOB 3TQTA 1TE2A 2PQ6A 5CTJA 5I8ZA 4F7DA 1SD1A 4K3UA 4WOBA 1W52X 4W1SA 4YWHA 2A6PA 3GLHE 3N2GA 4ILKA 1C7RA 1KEVA 3EUFA 2CMKA 5BSKA 2ZYUX 1CQPA 2R68A 1J25A 2QN3A 4RYDA 2F9LA 5T3YA 4IDHA 3UATA 3GMIA 5A4AA 3I09A 1SCUB 4MR9A 2I7CA 1F8UA 3EULA 2A57A 3P94A 4UAJA 4QSMA 3U7HB 1E9BA 1JHRA 5DNAA 4BY9E 4WXYB 1W4BA 4K6MA 1H2AS 1L8AA 1KYYA 1VLQA 3KVVA 1F8XA 4TKZA 3U3OA 4BP8A 3NIFB 1XU7A 2N46A 1VYUA 1N4AA 1NWHA 2FQQA 2G77B 1DU4A 1F20A 3RFFA 3RHSA 1OA1A 4EQ6B 3ESYA 1QORA 2J31A 2UZ1A 4MR7A 4OB6A 5ARBA 1NBMD 1RRFA 2AI1A 3F47A 4LY3A 1K5DA 4DE5A 4NRDA 1C3JA 1MDBA 4GP9A 3RDPA 1NY6A 1NHWA 2GK7A 3RKUA 1ZMBA 4S1OA 3RVNA 3TBHA 2JC3A 1YZHA 4IJUA 4X64B 4PO3X 3A9UA 1GAJA 1G98A 3FIJA 5ALLA 4CTMA 2B1IA 2G07A 2BZ1A 3QE2A 1N9GB 3HCRA 2O0MA 4KV7A 5ECDA 2OORC 4TSFD 2RCNA 4BLTA 1RXVA 1VIAA 4FC6A 4GIBA 4OH1A 1V25A 3ZHTA 4PC3A 3PHLA 2PJRA 2IIVA 4KFUA 1H9AA 1D7AA 1T4GA 2C2BA 3ENZA 3HB7A 3G5MA 1SOUA 2ENUA 1ZJ6A 2ZRIA 4EGJA 1PEAA 3AC0A 4ZMRA 3HYCA 3SZLA 3CVXA 2PE5A 4WZBE 4WCDA 1UFKA 3FMVA 2IYXA 4HHEA 4ML3A 3D7SA 3RSFA 3DAGA 4MW9A 3ZD6A 1UJ6A 1MQAA 4JQZA 1OBVA 3L1JA 2G08A 3FH0A 3UV3A 3K0EA 2V0GA 1UQRA 4PQYA 1JLMA 1D2NA 1JLLB 2CL0X 4JDPA 2QJRA 4YJHB 1PNOA 1FYEA 3O4FA 3W4IA 2GJ4A 3ICCA 1W46A 4LVNA 1M8FA 4IL5A 3UM9A 1NUSA 4XQGA 2WWGA 4HN4B 4L57A 1KY2A 4I46A 2D7JA 4IDOA 3KKZA 2DM6A 3LDUA 1HE3A 5CYGA 4KR2A 2E1PA 1VE5A 4B43A 3K35A 1NN1A 3HDTA 4R8SA 5GY7A 2OLKA 1DAPA 2OP1A 4XX0B 3VH1A 2I5PO 3G0GA 2QQ5A 5DYWA 3ZXSA 4P4SB 4R9RA 3T4XA 3WG9A 4KIUA 2E37A 3OUTA 1BJKA 4KNVA 9ATCA 3UN1A 3BCRA 4HQ6A 4N0MA 2H29A 4EKGA 2ADFA 4HATA 4JIGA 3TOZA 2PDAA 3SWWA 2W0SA 4BYMA 2GVDC 4HS4A 4WKCA 5B4TA 13PKA 2NXEA 1K7YA 2WTEA 2RGXA 2H9YA 3MF4A 5C34B 1XFDA 5F78A 3TRIA 3WMRA 3CEMA 1E6KA 1C9EA 3OPQA 3OTGA 4IV5A 2C83A 4CKWB 5B3KA 2WPNA 1XVVA 1OFVA 1UEXC 2ADOA 2XAAA 2WT4A 3M8KA 1U2RA 3RAFC 1ES9A 1T9GS 3N76A 5KTKA 1BDBA 3I8OA 4D44A 2DR2A 2Q6OA 2PX0A 4TQAA 3TGPA 1RHUA 2O2XA 2OOSA 4DBVO 2Q41A 2P27A 4U0JA 1UMCA 3LCRA 1U2GC 5IK2D 3WRVA 1ZO8A 2P0YA 3ABRB 4INJA 1CQJB 1V0JA 5DGCA 3VOBA 2ZI3A 1EX9A 2J3DA 3RBZA 1PZXA 2GBFA 4DV1B 4H15A 3THRA 5CFZA 2A35A 1VKZA 1VXRA 1NAHA 2BDUA 3PPWA 2AHRA 1IN4A 4PY2A 1W94A 2YIDA 1Z4QA 2ZR0A 3WADA 4YMLA 5BR1A 5IJZA 5F3DA 1GL6A 1Y34E 2G88A 4RZSA 1NDUA 5FB3A 1P2SA 1PT7A 1T35A 4JI0B 1RZ3A 3NTLA 4HDMB 4IINA 3GLGE 2CXNA 4D9NA 1DKPA 1YCGA 3LPAA 3RBXA 3TLGA 2D5LA 4EENA 2I55A 3OY7A 1HDCA 1B73A 1YR3A 3QLTA 3I64A 4JOCA 4ZAYA 3OPYB 2FPXA 4BP1A 4Q12A 1QV7A 1PFQA 2QTMA 3IA7A 1MENA 3N86A 4BKMA 3AONB 1WU8A 1V43A 1H2XA 4ZYUA 1MAUA 4LYFA 3A9WA 4V03A 3NC0C 3ZG6A 5A4DA 3VDMA 4A0FA 2X5JO 5DGIA 1ULSA 3NBKA 4Q48A 4FN5A 1E1NA 3RFXA 1WXQA 3H5NA 1LBQA 4EHIA 3L4BC 2NOAA 1EUCA 3SOPA 2G9ZA 1AS2A 2YRXA 1FTSA 1K7CA 2HQSA 2NTNA 5CXQA 5KOHA 2I4TA 2ORWA 3SVZA 3LT2A 3OZRA 5DU2A 1DEAA 1JLLA 2PMDA 2VDLB 5GZ3A 3EIHA 2GBCA 1U98A 5IRCD 4AWAA 3OCCA 3C6ZA 4XD2A 1CK4A 3CNQS 3PYMA 1GM5A 1H2FA 4JVLA 1EUZA 4K0RA 4CEJA 1Q0LA 3PUWA 5AOVA 3ZHZA 4U4AA 2I7VA 1L5MA 3QKSB 1PYOA 5JZ9A 1MLDA 3V00A 2HR1A 1VE7A 1XKQA 1W36D 3AEZA 4OXKA 4LPKA 4EG8A 5ALEA 1UT8A 1SHZA 3QA3E 1E94E 4G5FA 2W6MA 4PLYA 3T7AA 3ZCPA 4KSBA 3K53A 4IX1A 1D3AA 1VPWA 1JTEA 1F4LA 2OXTA 1UZLA 1FS5A 3DZCA 3F74A 2FP4B 5EQTA 4F6RB 1DCTA 5ILOA 3EEOA 3ZH2A 2C0CA 3PQ8A 3AW8A 3ZHBA 2PYDA 2AWNA 3D3EA 3NHJA 4HQNA 1TZBA 1RWVA 3S2UA 3HG7A 4UCQA 1MB3A 4TTVA 1IHUA 2LUOA 5EQJB 3JY6A 1C4OA 3RSQA 2YJNA 3E84A 3E8MA 3GLFB 4JLDA 1FRNA 1YZGA 4R7TA 1RRGA 1XCBA 3EFEA 5FQNA 4Z5XA 4AURA 3G82C 3MTQA 4CIBA 3ZGXA 3PD1A 3BJIC 3DA8A 1PFWA 3ODGA 1C0IA 4RXUA 3U4QB 4N39A 4QU8A 4RD6A 1WCIB 3CWZA 1XHLA 1BA2A 4GLFA 4YP9A 1JEJA 2WUDA 3CZRA 2YOGA 1JQJC 5IM4F 1WXGA 2VJCA 3G1WA 1NYTA 1ZQ9A 3OJCA 4ZOLB 1U4NA 2JFHA 2EP7A 1R00A 2ZTMA 4YUZA 1WEKA 1D2CA 2VXYA 2Y4OA 4KMRA 3ICPA 1HEIA 3JWHA 1JH8A 1VP9A 2VWGA 1XFAA 4QJIA 5FPHA 3A32A 3ROPA 2E4UA 2FPGB 1FL9A 5J59A 1MABA 4X20B 2GPSA 4NKRA 4NOLA 4O1HA 1G4HA 2Q4TA 3GP3A 3WGQA 3DZHA 1L1RA 4YMHA 2FZVA 3KJNA 3BXPA 4YRIA 3IQFA 2F4NA 2R8EA 4I9GA 4EHKA 2FMTA 5KQRA 1TF5A 1KMIY 3N6VA 3U4HA 3RS9A 2O0JA 5AP9A 5HFNA 4YV2A 2JIMA 1EG7A 4ZKEA 2JFFA 5AMXA 1R9NA 5HKLA 4RV5A 3B89A 2ZT5A 2SBTA 2EF0A 2QP9X 3OJWA 3LFTA 3HCAA 2ZWAA 3TE6A 4CF3A 1A7AA 1JDBC 3O9ZA 1PGJA 5INTA 3TEFA 4ALKA 4EDFA 4N12A 4ZVTA 1KIFA 1NC3A 1Y7IA 3ZDEA 2NIPA 2VAWA 5DP2A 1VPTA 1KDRA 3PGJA 1RBZA 3B8HA 3CZPA 1YTLA 3LC7O 3RRFA 3WSWA 4UNRA 4CG1A 1V71A 1LX7A 4HO1X 5CRIA 3R8FA 4LZWA 2XTAA 2YV1A 1QRAA 2FQYA 4P0PB 1M5RA 3BFPA 4FKZA 5A6SA 4KQFA 1N57A 3EVGA 4EA6A 5EHIA 4D96A 1YQEA 4B4VA 2X0IA 4N8SA 3S29A 3BDIA 3WV5A 1TEXA 4HGRA 4XKJA 3HR8A 5FNVB 3TGLA 5BPFA 1ZJ4A 4UC0A 2WWFA 4KGDA 4IOKA 5FOWA 4B6OA 3QMVA 5CM2Z 3F6RA 1KYVA 1LH0A 4DDTA 4RGYA 5JANA 3BREA 5TS3A 4HEA1 5EFZA 3SBOA 1HKHA 5EXPA 3TNDA 4W5OA 4CGYA 5E38A 4TKUA 3K05A 5TV2A 3TL3A 2D62A 1W6UA 1BH6A 4EGCB 1KDZA 1ZWLA 3W3ZB 1J9GA 4YJ2A 3AHEA 4Q19A 3SOZA 5DHFA 2WIDA 3ICQB 5G1OA 2Y9MB 1NN0A 3SJBA 4DM7A 1V6SA 1AQIA 4LJSA 3COVA 3ZDBA 3BF8A 2B83A 1Y5IA 2K2WA 3FBWA 1BYIA 3OF3A 2MJLA 3UQYS 2ZQYA 1O9HA 3U0BA 5I7SA 4MW6A 4GRDA 3TB6A 2BMDA 3OKPA 1EA5A 5JZVA 5AI9A 4MLDA 1J1UA 2FZKA 3K3PA 3KJEA 3TRHA 2P3QA 5ESXA 2ZYHA 4IAOA 2BFMA 5E8RA 4F2WA 1LPOA 3CBQA 3ZI0A 3B1WA 3QVVA 5F1KA 4KXXA 3L7AA 1BWQA 4LWQA 2BFDA 4KO3S 2NXJA 3IP1A 3MG9A 4QEDA 1G4AE 2CBGA 1PT6A 1WXFA 1Y3IA 2XWBF 2RK3A 5G1PA 2XLCA 3IQIX 3P45A 4UPEA 2ZUDA 5KBYA 3F4BA 2HHAA 3I9V1 2GYYA 3I2YX 1UK7A 4H35A 5AVYA 2VUHB 4IFEA 3S2ZA 1JXOA 2DCMA 2VF2A 1ZD4A 3V4OA 1EK0A 4C7KA 4D4HA 2PSEA 4FXPA 2WIFA 2C9CA 4GO1A 3EZYA 4LOJA 1DTSA 4ZDJA 5CVDA 2ZAIA 4NVRA 4JI3B 4F5EA 1UKEA 5AKHA 4KN9S 4K2AA 4BVHA 1UEJA 3FOBA 4A27A 3KVNA 2XYPA 2FRVA 1C1DB 3HJNA 3OOYA 3AF4A 3QELA 4JP8A 1W19A 3G49A 2ZLBA 1EGVB 3IP5A 3RIYA 3O38A 1S0UA 1MJHA 3DMDA 4C05A 1V1RA 2PLWA 5KJ6A 4X00A 5AK4A 4KR3A 3D2AA 1Z7YA 1OLSA 3PWKA 4C30A 1V1MA 2QX9A 3P2KA 3EQ7A 1M34A 5ULLA 5LOVA 4BNVA 1FYXA 4L4YA 1LI7A 2HJ9A 4YJ3A 1Q0QA 1OGYA 4GMXA 2JBWA 3ZWCA 2XGJA 1WHSA 1T34A 1RYBA 1Z0FA 4LDZA 2PUBA 1BU8A 2VA8A 1PV2A 4AIIA 5E6UA 1X80A 2YR0A 3N9IA 5J4YA 1QE0A 1YB5A 4JY7A 5K3EA 3S2YA 5IJ0B 5KREA 3ZDYB 4UHBA 1P2VA 4U00A 1OAOA 5E7IA 4EP1A 2Y1FA 1CUSA 3E9DA 2V96A 4PLHA 1TX4B 1AB5A 1QOZA 3D8RA 5BN4A 1P61B 1MJGA 2CNKA 2D00A 3N53A 2OCIA 4HDSB 3IESA 1XQ1A 3OU7A 1UWLA 2QMUA 3PXEA 4OG2A 4MDYA 1JMKC 1JIJA 4KNWA 4WH0A 4WLUA 3O92A 3E9ZA 3T3PB 3WGUA 5EXXA 1AV7A 3TR5A 3BWVA 2FSFA 3H1BA 3GGOA 4Z8YA 3AVXA 1S8NA 2SCUA 2WV7A 3MJCA 3Q0TA 4IKEA 5GVRA 4DQKA 5DBFA 3MINA 3OQ6A 4JX9A 4QTUB 4F2DA 3NRCA 1COWA 5AM1A 4BAZA 2W2OA 3DP9A 2P9BA 4N8EA 4PWYA 4XCXA 3WLAA 4DUYB 2YVQA 4HMQA 1S9HA 2Z04A 3SY8A 4COOA 1OH7A 3TVYA 3BF7A 1VJ0A 2DPXA 4L85A 1RCTE 4BLWA 5EAIA 1U0SY 5ELXA 3VKHA 1F14A 1JQDA 4S2EA 1PZEA 2JB9A 2X42A 3PDIB 3NI2A 4MIOA 2ATIA 5A7FA 5B7GA 4EPTA 4NECA 4UTRA 5JDIA 1JVSA 1R8QA 1P62B 2P4SA 3LC0A 4I19A 5CW1A 5AJXA 4QT0A 2GA9A 3ZY6A 1O2DA 1VLVA 4L51A 1QLWA 1BZYA 2Z83A 3D31A 4Q5IA 3U26A 4IKPA 4UTVA 4WINA 2FXVA 2YHSA 3IMEA 3TJRA 1ECPA 4BGVA 1RT9A 4BLUA 5BYAA 1YH3A 1M5UA 1YL7A 2F1RA 1P1IA 2W6ZA 3BL5A 4X61A 3ZBQA 4WN9B 4EBBA 4JCOA 1QRSA 4Q7KA 2G6TA 2HRZA 4ERNA 2BMVA 3FPCA 4RS4A 3PI7A 4M83A 3KT6A 5H7XA 3SYRA 3O8QB 5FOXA 3T3GA 4TOIA 3GLGA 1EIZA 2RHTA 4H1WA 2E4ZA 1W6RA 5H3LA 3FOAA 3H0EA 3BRWA 4AMZA 1U4OA 4DLNA 1R10A 4EUFA 2P1DA 3K8OE 1AT1A 2I2CA 3EB9A 3WBJA 1VYVA 2BP7B 4YYEA 4EARA 3FHOA 1KJIA 2I33A 5DI3B 5TXGA 1VI6A 5L7TA 2QUAA 4TS9A 2XNSA 2QRVB 3BWEA 1C4XA 1DEHA 3Q6IA 3HHEA 1P60A 3KSUA 5JSZA 4CLXA 4U7GA 4ZI7A 3CCCA 4FMDF 4B84A 3WB9A 1RI4A 4YRDA 4UAVA 3F5QA 3D7MA 5I01A 4FP9A 3E22B 1VB5A 4MV6A 4RFSB 3V5NA 3OCUA 5IJAA 1N1GA 1YS6A 2Y1XA 3V1TC 1EFCA 4RENA 4B0OA 1JEEA 1F8FA 1YDEA 2XRFA 2GJ8A 1VI2A 3NV9A 4EA7A 2IV2X 2HIMA 3MPOA 1WB4A 3OEWA 2XZOA 4U1RA 1P1FA 3E5NA 1J00A 1NZDA 1Z08A 3JQ7A 5BN3B 3V7UA 4HWSA 1G60A 3C5VA 2RGNC 5HCNA 2GT1A 4G1VA 4GT1A 4GMDA 5FJIA 4OQDA 2QT9A 4I8DA 5CBPB 3MOGA 1NBME 1OKKA 2EWMA 3AB8A 2R7MA 2Z95A 1YVRA 2D0PB 3HWWA 3IP9A 3SNHA 4BZXA 3MTDA 1UFQA 5LUAA 1T8PA 4BN5A 4QXQA 4MPPA 1BTOA 4B6FA 4CNQA 5L3RA 3WQBA 5I4BA 4KDRA 2B8EA 2ISQA 4JA2A 2ET6A 5EC8A 1JFSA 2QXUA 3H1GA 5AQEA 4CDRA 5M2QA 4HNSA 2WJWA 4MW2A 1SD2A 4UM7A 4V1CB 1W85A 1ECLA 3AR3A 4FBLA 5AVOA 3T1QA 1KSJA 2A1IA 4UATA 3SKVA 1QRTA 1GNRA 1DWPA 3TAUA 1YUMA 5CB4F 3V8PA 2PZJA 2FSVC 2VJQA 1VLZA 4B6RA 4KQMA 4N3BA 1GPLA 4F1WA 1QTQA 4GBJA 1IG0A 1OIVA 1U5AA 4KCGA 2K87A 3WGKA 4BECA 4K6CA 3BJZA 1H3EA 2JLWA 3HJFA 4G09A 2HQOA 4BO1A 4N6GA 5HKOA 2A9KA 3Q0IA 4K86A 3UVEA 3VM6A 5JWOA 1Z88A 1DO8A 2NU8B 5DX0A 4GEGA 3EVZA 2C4VA 3BAZA 4JR0A 3JAMA 2A1UB 2FFRA 4LSMA 5AH0A 2I54A 1JHOA 3JS5A 2XODA 4OM8A 1MFZA 3CNOA 3EWAA 3LBFA 8ABPA 2O1XA 3GLIB 5BR7A 3DXYA 3SEFA 4N9QA 1ZFNA 2RAUA 4PR3A 4S1WA 1M2WA 3O90A 3KLOA 4NCNA 2VHCA 2JJ1D 1KMMA 2WZBA 3E8SA 4YMWA 1GU7A 2Q6IA 4RKYA 4ACBA 4EH1A 4DJTA 1G8HA 4QYIA 4ID9A 2UUCB 2VTBB 2Q4RA 3B6IA 2CB9A 4PVDA 4CEHA 4IEFB 4LY9A 4BRSA 1ZGGA 4WFKA 4Z7QB 1Y6GA 2X6TA 3KZMA 2Q07A 2PZGA 4HWKA 4JD5A 4MAAA 4AJOA 1C7ZA 1EDZA 2NAFA 7REQA 5KNDD 2C00A 3ASVA 1NI4B 2EWVA 1XMIA 3QM1A 3TMAA 3GT3A 1ZEJA 1ZKMA 2RAPA 3IUYA 4REQB 4TTPA 5FL7A 4BFCA 1CWUA 5BOSA 5AW2A 1ZWKA 3GVHA 4Z4QA 1O0CA 1NWCA 1P2FA 1Q1QA 1Q16A 3QXCA 5JY1A 3ZD8A 3KQUA 2VP5A 3F4LA 2MSLA 1V3TA 1VLMA 1UBGA 1W1IA 2VQDA 3N59A 1T6XA 4QGGA 4MWZA 1Y6FA 1H8HA 5LXTF 2WTAA 1UAAA 2G8NA 3T1NA 3I4CA 1A8UA 2NVUA 2K2QB 5AW6A 3B6MA 1TM2A 2BSAA 2JGLA 5L8VA 1QH8A 1DUSA 2CCGA 1XZAA 2A5JA 3GMTA 2GJAA 1XD2B 4PAOA 1MB0A 3SVTA 4Q3DA 4MEJA 4P3NA 4MUEA 3UK6A 4D4GA 4MIYA 1SUPA 1ZVJA 3VPAA 3GGCA 5AW7A 1N5MA 1RS0A 2Y0DA 1L8QA 3B9BA 2H8KA 3L7CA 4PYLA 3H1PA 3TQRA 4B9AA 1GZSA 4EM6A 1N34B 1MO6A 4CM4A 2ID9A 4OFZA 2XGGA 3CLUC 4P9NA 2Y1EA 4LJKA 5FO1A 3TYXA 4MYDA 2QIOA 3QPCA 4KQ9A 2BGRA 1UJMA 2XRYA 3LBIA 2LGJA 2UDPA 3T3DA 4CQMB 1E7MA 4YMUA 1R0KA 4RVFA 1INLA 2OHGA 4YCDA 2JG3A 2DKFA 4PG8A 1Q1NA 3ZK9A 1WVIA 4KIFA 3JQQA 3NO4A 4ERXA 1LJUA 4AKTA 2D59A 4KPFC 3GLHA 4LBYA 4X7RA 3D8UA 4AXXA 2Q99A 1Z5ZA 4RSRA 1VKJA 5BN5B 3GLUA 4ZPJA 1COWD 3PT9A 3EFBA 4L0CA 1T29A 1HG1A 1RADA 1W25A 1TT5B 4P82A 3T0GA 4C6TA 1BHQ1 1ECJA 3ETDA 1LBHA 3KVOA 3OD1A 3RS3A 3W2IA 3KRTA 3ND8A 2E0IA 3SFZA 4KH1A 1ZHHA 4DL9A 3W34A 3MNFA 2UZAA 3M2TA 3A4MA 3BZBA 4G5YA 4UVIA 2JATA 3EPRA 4LYEA 5NULA 4B6SA 4Z7JA 4YMVA 2VNHA 3VU8A 4B81A 3I32A 1RZRD 4PPNA 5K8JB 1XMOB 2ZULA 3HA2A 4HH4A 1ZUNA 1H05A 2VYNA 5K0BA 1FNSA 1E4EB 2ZRPA 3F78A 3IJPA 2IF0A 1CQWA 4Z9YA 3IRUA 5DNYB 4BFSA 2IL1A 4F4IA 2FA9A 2JFNA 1MZPA 3LCUA 4LEIA 5EIBD 4CI0B 4KXMA 1MIHA 1DEKA 1QONA 1CZOA 1RQNA 2Y92A 1AF7A 1BU5A 2NSYA 1F2VA 4X3OA 4A82A 4EEXA 1YIDA 2F48A 5KTPA 3DFKA 3VR2D 2JJ2D 4GOJA 4WGFA 1QANA 2EBWA 2Q5JA 2FJPA 4CUJA 4E2ZA 3ITDA 4YP6A 5BSFA 1P5JA 3AEYA 1QHSA 5IM5A 3RUFA 1W0KA 3C7KA 4BO4A 1EVZA 2YQ5A 2YNMA 3EQ9A 2QV7A 5D3MB 3WC4A 1OLXA 3E27A 3WYDA 2J6HA 1A97A 4AJLA 2V6FA 4OHKA 3L8HA 1Q15A 1NOJA 2WJIA 4G5HA 1IAVA 1T0IA 3PFKA 4YLGA 4MEBA 4O2BA 4XWYA 4US2R 4YDQA 4C0QC 2O57A 1KA9H 3LAWA 4TS3A 3K9LA 4DV3B 1IY8A 1Y4UA 2I87A 4CCYA 3ADDA 1II8A 2OC4A 4B9EA 3RLFA 1B3RA 2IHUA 4RQBA 1XTSA 4LOAA 1AJEA 3SXUB 3VDXA 4ZWNA 4FGZA 3MS2A 3BS4A 2FEPA 3ZJYA 1P0QA 4F2GA 4QZVA 1ENYA 3KOZA 1Z6PA 1S4QA 4MW4A 3FPFA 2NUPB 1LLFA 2XWQA 4N3NA 1MNQA 1NXOA 1U7UA 2V9ZA 1P74A 3NORA 3STWA 1ENOA 2Y76A 4Y6OA 3GUCA 2OCBA 4BFTA 2JFXA 4FCCA 1YE8A 5DGXA 1MA3A 1CY0A 1L7RA 2OE2A 4P4NA 3T12A 3TZHA 1S2MA 1VIYA 2HIGA 2XIJA 4HRAA 5FA6A 1FTGA 4UM9D 1UAYA 3I6MA 3V80A 4YUWA 1D8AA 1O6FA 5DNCA 3TEJA 3VJMA 3DUFB 1T9ZA 1TQDA 3A2LA 1ECCA 3PNYA 4IXMA 3KETA 1E32A 1GGEA 1Q92A 4YRGA 1RC8A 2Q4EA 4DVJA 1I4WA 2PSDA 3ZS8A 1BN6A 3IKLA 3OZEA 2QUJA 2I1LA 1IDN1 3AM1A 2Y0CA 2YZ2A 4RIIA 4RBNA 5F1OA 4NABA 2VUIB 5IHXA 1DPFA 5E4TA 3KFLA 2V3WA 3L02A 5FULA 4B3BA 4O5OA 1JL3A 2E85A 3AERA 3LL7A 5DDIP 4EPYA 1P29A 3WKEA 2F9MA 1T9HA 2EKZA 3VOAA 2Z1MA 4PC7A 1V7ZA 5F5LA 4EJ6A 5ERXA 3RSZA 1E79A 5CA0B 1RWOA 3TFOA 2FKAA 1MG0A 1FYVA 1KIAA 2JK1A 1Q7GA 2YJZA 2IX9A 2OD9A 4G07A 3VYTB 4KE9A 3VAZA 3D4PA 5LA6B 1OBFO 1BDHA 2WQ6A 2B3TA 1LNQA 1C1XB 2GASA 3Q3EA 4QUEA 3OLWA 3ZEAA 4AZ3B 1B6RA 1CUJA 1HA3A 4ENQA 3EZ2A 1AK1A 1XEAA 4AB1A 5DM70 3HVRA 4F60A 1UZMA 1V2HE 1RYFA 3AEUA 5F7JA 1FMJA 3FLBA 2HL6A 5EIHA 3T3HA 3VPFA 4RZ2A 3RU2A 5EHQA 3QH4A 1S2LA 3MWGA 4M0PA 2F17A 1Z5UA 3L92A 1D5WA 3EZXA 4MCHA 4FW9A 3U7RA 4YCJA 3K2IA 4KR7A 4UU1A 2MT9A 3F5MA 4E5SA 1N3IA 5C7IO 1D2GA 2WZQA 5KKCA 1Q7EA 2IUUA 2CXHA 4A5OA 4CMEA 5KMGB 2DZDA 3SI7A 3UTDA 1D2MA 1M34E 1R0BA 2QTZA 3KJZA 3W6OA 2BN4A 3LDAA 3BFKA 5T4HA 2EJCA 5K09A 5AVRA 2H6EA 3EGXA 4BQPA 4GPBA 1REQB 2QX6A 4DA6A 4TKVA 4JB2A 1K8RA 1G5HA 5CH3A 2EG5A 3JASA 3DV0A 4FXOA 2OO5C 3NLLA 4Z0NA 3TTWA 1T3GA 4U02A 5K2MA 5TVGA 4WJZA 4Q6BA 3HABA 3MJRA 3MMSA 4C29A 2JAQA 4QPNA 2G9NA 3WY9A 4JROA 2PUFA 3G8CA 1Z36A 1WV0A 3VH3A 1G7SA 5EJFA 4KXYA 5LQNA 5IWAB 4L8YA 2ZSFA 1NUTA 4TT8A 5LWHA 1J2UA 1X7HA 4X1OA 3E0XA 2VZLA 1ACMA 3HJUA 4GL2A 1DFGA 3V1NA 4CMHA 1KH1A 3P2IA 3C41J 5L45A 2IZ7A 1XRLA 2IXFA 1SCIA 2ZIXA 2RI6A 3JZIA 1LW7A 4I9FA 4JLNA 4WSOA 4DLAA 5KTMA 1JIKA 2QRLA 4OMDA 2OMEA 3GX1A 1Q6ZA 3KALA 3PUJA 1L4KA 4LGMA 4IIHA 1HGXA 4RIHA 4JLPA 3GO4A 2W58A 1XRPA 4RE5A 1EZZA 5EYPA 3GVPA 3DL2A 2BR5A 4DA7A 1URPA 1PV1A 5CNMA 4QASA 1KI2A 4QBFA 4ER6A 2FFJA 3RRJA 1BXRA 4HT3B 1BROA 3WWCA 1GTZA 2XMDA 4RHCA 4PC2A 3VVLA 5CCXA 3QE3A 2QL6A 5DBEX 5TF4A 1JLKA 1N2XA 4B6EA 3NIWA 4M8KA 3I04M 3OJOA 4FN4A 1SVWA 2IF2A 3BXGA 1KK0A 1NPYA 4ITRC 2QM8A 2I4LA 5C3UA 2B98A 2D5CA 2XDYA 4B8WA 4D81A 2VOEA 1Y3FE 1XCPA 4I1RA 3SE0A 3GY0A 4TRRA 2QTVA 4S35A 4P8RA 4WZBB 4GWKA 4BVFA 2FEWB 4FNAA 5G4KA 5FAXA 1N7GA 4NK4A 2QHXA 4NG5A 3MFYA 4OU4A 4C0HA 5SY6A 5KNBA 1J39A 2B4AA 1CUDA 2XY4A 1WRBA 5BRJA 4FLMA 3R3XA 1M54A 4OHRA 1JX6A 3PE3A 2MINA 4LGYA 3R74A 3SSOA 621PA 2UXDB 4PLVA 3U48A 1Y1LA 2QX7A 5EY5B 1AY0A 2DWCA 2PS9A 3IDSA 3DKVA 4ZHQA 2HJSA 2ATXA 2HCBA 1E1RA 4K1XA 3HO1A 2Y1LA 4FFBB 4XFJA 1C30A 3KYCB 5K03A 5ALKA 4Q3BA 5IEBA 3BK7A 1DAGA 3NDBB 1O6GA 2BFCB 4R1PA 4K9QA 4CMIB 4MRVA 3Q12A 5E0KB 1N2CB 2H4FA 2C5HA 2A3RA 1FMFA 3FPJA 1Y9ZA 1B0UA 2I6QA 3EZNA 3GUUA 3QVGA 4GEKA 4QOSA