1MXFA

Crystal structure of inhibitor complex of putative pteridine reductase 2 (ptr2) from trypanosoma cruzi
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
266
structure length
247
Chain Sequence
CPAAVITGGARRIGHSIAVRLHQQGFRVVVHYRHSEGAAQRLVAELNAARAGSAVLCKGDLSLSSSLLDCCEDIIDCSFRAFGRCDVLVNNASAYYPTPLLPKPIDAQVAELFGSNAVAPLFLIRAFARRQNLSVVNLCDAMTDLPLPGFCVYTMAKHALGGLTRAAALELAPRHIRVNAVAPGLSLLPPAMPQETQEEYRRKVPLGQSEASAAQIADAIAFLVSKDAGYITGTTLKVDGGLILARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 2
publication title Crystal structure of Trypanosoma cruzi pteridine reductase 2 in complex with a substrate and an inhibitor.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
total genus 86
structure length 247
sequence length 266
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1mxfA00
5IXSA 1GPJA 4RF4A 2PY6A 5GMOA 5ITVA 3V1YA 3EMKA 5KJEA 3KBOA 1IL0A 4J49A 4WNIA 3TOZA 4IDAA 5DDIP 2A35A 1PL6A 2HAEA 3U62A 3UN1A 2AA3A 2DAPA 4HUJA 1P1HA 3E9MA 4XDZA 5L7WA 4YAEA 3RBZA 4FSHA 1GY8A 3DB2A 5TX7A 3EVTA 4EW6A 3CSDA 1NXQA 5L53A 1HSZA 3EC7A 4E31A 3KETA 4EJ0A 1TT7A 1PJCA 3GC6A 4D3FA 5LDGA 1BVRA 4IDEA 1E92A 3DMTC 3DTTA 3N74A 1PJ4A 1X1EA 2WSBA 1N5DA 1PQPA 2FHSA 5IJZA 5KVCA 3BHJA 5G0VA 1DAPA 4OKNA 4IM7A 3OJEA 3VPHA 4YWJA 1SBYA 1XELA 4HFJA 1UXJA 3WICA 2EF1A 3WGOA 1AUPA 3BMCB 1KEWA 1D3AA 1Q1NA 4IDGA 4JGBA 4CODB 1U5CA 3HZZA 4ZD6A 5JS6A 1E7MA 1OC2A 2HMWA 1OFGA 4RVSA 5AXDA 3ZGYA 2TMDA 3WIEA 2VWGA 3INGA 4G5HA 1RWBA 1SPXA 1F12A 1GEEA 3W8DA 3ZHBA 5COAA 3AUAA 3LU1A 1NHGA 4ZVVA 1FJHA 3U4IA 5ENDA 3PDJA 4YJDA 1K89A 3ZN2A 1E3WB 2VYVD 4P4GA 3WJAA 5JXWA 3A14A 3GH3A 3GNTA 3PK0A 5JC8A 4EYEA 3KV3O 4CMIA 3F5QA 4DLLA 4IBOA 1GPDG 3NV9A 2AQIA 2NU7A 4J9VA 4U6SA 4YQYA 1RM0A 2CUKA 1R0SA 4J4TA 3I9JA 5JSFA 1I24A 2FSVA 1I10A 3CZRA 1DLJA 1FXSA 1NVMB 2OOSA 4A26A 4CMJA 1DBVO 3K73O 5HWSA 2J5KA 1LXCA 3C8MA 3L6DA 5JPIA 5TRTA 4BO9A 3WGIA 1X1TA 2HO5A 3BAZA 1NWHA 3PFWO 4A03A 4E5KA 2C2XA 4MVJG 4GKBA 3JQFC 4GX0A 4Z9XA 1JQBA 1ULUA 2CMDA 4DGSA 2DT5A 2XPCA 3WX0A 1SB8A 4TQGA 4JX8A 4CMCA 4WLOA 1HKUA 1NPTO 4J1TA 3M2PA 4FQ8A 4XCVA 3GRPA 3BMNB 4YT5A 3PEFA 4PZEA 3LF1A 3RC2A 3ZCXA 5KJFA 4K26A 1R16A 4WPGA 4HXYA 1LLQA 2O3UA 4DPLA 1HDGO 4XZ3A 4R3WA 1ZMOA 3WGQA 5J23A 4Q3AA 3Q3CA 1E7RA 5JAMA 4MVJD 4YRAA 3FBTA 5IDXA 1YOVA 4M55A 4PG4A 2O3SA 2DFVA 3UHAA 1OC4A 5BQFA 3PZBA 3AI2A 3L77A 1Z75A 3GT0A 2PD6A 4D42A 3CMMA 5EINA 4JXKA 4AJOA 3VZQA 5DULA 4CMGA 1QSGA 2AEMA 2OO5A 3OIDA 4J6FA 4R68A 4B7CA 1NASA 3C1AA 3M6IA 1NQTA 2GSDA 2I3GA 1Y81A 3R6DA 1VL0A 3NAQA 1H2BA 4FPXA 3IKVA 5CDYA 3H9JA 2OORA 3V2UA 4MKZA 3QWIA 2J5RA 3D5TA 3OICA 4BO3A 3DDNA 1ZZEA 1PGNA 2ZTMA 5BNIA 1TEHA 2AXQA 1ZJYA 2HMTA 4IDFA 3H9UA 3PJEA 2W4QA 3I1JA 3LF2A 5A3VA 4YTEA 4Y67A 3GEMA 1HDYA 2I99A 1N92A 2VT2A 3PHJA 4EEXA 2HRBA 3P2YA 4R4JA 4DLBA 3ZV6A 3OQ6A 3GY0A 1PWXA 1D1TA 3JQ7B 2EGHA 2PKQO 1NPDA 5TIIA 2IZ0A 3D4OA 2NADA 3COSA 5G2OA 1GZ4A 2I9PA 3OEYA 3Q1LA 4XA8A 2WEKA 1SNYA 2ZTUA 1BRMA 2NTNA 3RU7A 3RVDA 4X54A 2XAAA 3SJUA 2P91A 3QHAA 1UAYA 4TROA 3QQPA 3E1KA 1CERA 4M87A 5A04A 1ISGA 3P5SA 1WZEA 4Q3CA 3QLJA 5BSEA 1EK6A 2CDBA 1C1DA 4RV9A 2H5LA 4XDYA 2PK3A 1GADO 4EI2A 3KXDA 1XLTA 1YH3A 2D1YA 1EUDA 2IYOA 1NHWA 3SLGA 4R1UA 3HHPA 1GR0A 2VCYA 1O6ZA 4XGNA 3WTBA 4FIZA 1R66A 3UXYA 5CDSA 4D0RA 5F21A 1I0ZA 3ZU5A 3JQEA 2O23A 4BKPA 4NG5A 3L6OO 1LNQA 5EPOA 3QWAA 4EJ6A 2FMUA 2YW9A 2YYYA 4IJVA 4KQWA 4O0LA 1EVZA 4GSKA 2HU2A 2VUSA 2C5EA 3NKLA 4K1LA 1D1SA 3WXBA 3B70A 4GH5A 2A94A 3G17A 4FOSA 4UVEA 2V6FA 1C1DB 1FDTA 4PFJA 2X5JO 1P0FA 3BZUA 3KLMX 2D4AA 3AFMA 3NDRA 3RQSA 2VTEA 3LK7A 3AOGA 4HFNA 1GZ3A 1PJSA 1EFKA 3F5SA 3RKRA 3C24A 4CQMB 2Q2WA 1O95A 4UULA 5ER9A 4RCVA 1WMAA 4FC6A 4W7IA 1NP3A 1A4IA 3L0DA 1N8KA 1PJBA 3KUXA 3MJ4A 2BD0A 2H6EA 3BTOA 2OGUA 3BYZA 1PGQA 1QXSA 3WNVA 4CMAA 1UXIA 5FI3A 4WECA 4RF2A 3GK3A 3WYCA 3ZWCA 4E4YA 3U49A 3K2BA 1DIBA 4XIYA 4FJ2A 3ULKA 4J43A 3ZWVA 4U0JA 2HMSA 4P4LA 4K6FA 3KOUA 1WDKA 3JQCA 2CVZA 1U1IA 1G6KA 4ZQFA 3JD4A 4CM8A 3RI3A 2E4AA 3QP9A 3I3OA 5I9LA 4XKJA 2OXIA 3D3WA 3O8QA 2VYND 3UICA 2ZB3A 3V2GA 1GAEO 4E2XA 2DFDA 1Q7BA 3RUDA 3FTNA 4IMPA 4R51A 5EJ2A 5AXCA 2DQ4A 2IODA 1AE1A 1MFZA 2GN8A 2DU8A 4AJEA 4YR9A 4TRRA 1DPGA 4XB1A 5AXBA 2PGJA 1DJQA 1LSSA 3T7EA 4BO0A 5KKCA 3NEPX 1WMBA 1VJTA 1DC4A 1YBVA 4PLVA 3OSUA 2QRKA 1UDAA 1J5PA 2ZB8A 3N7UA 1PTJA 4BO8A 5CEJA 2X9VA 3GG2A 3FRJA 4BNYA 1GD1O 1H2HA 4O5OA 2VNAA 3VVCA 1QYWA 4JNKA 4CM8B 2O50A 3HWRA 4BGVA 1KEVA 3L4BC 4GAEA 3EGOA 3EHEA 2P9CA 1A71A 3IC5A 3TL2A 3WQQA 3H7AA 3JQAA 1M75A 4WGGA 4OH1A 1E3EA 1JU9A 4FDAA 4K9DA 8ADHA 1A9ZA 5THQA 3GVCA 4ID9A 4IJUA 5B4UA 1SB9A 3RBXA 4XR4A 3AY7A 1AXGA 4D79A 3W8FA 1K2WA 1MXFA 2X4GA 1ADCA 3PYLA 1F8GA 3WTCA 3ZU3A 4IQGA 1PJLA 1HE2A 1E1MA 5TT1A 5COQA 1GCOA 3RFXA 4PVDA 1QYCA 1HWYA 1E5LA 2AG8A 4HV4A 1H6BA 4FFOA 1GUYA 1CJCA 1HDXA 3DHNA 3DBVO 2IEDA 1N2SA 1EVIA 1T2AA 3WB9A 4Z9YA 4BVAA 1DAOA 4HNHA 1SOVA 1ZJZA 4GKVA 4BHTA 2NTJA 3F46A 4RO0A 1AHIA 4AJ2A 3WOHA 4CV2A 4FFLA 1FF9A 2Q2VA 1S7CA 5F1OA 1G0NA 2X86A 2HLPA 4WLVA 1OBFO 1DJNA 1LLCA 3H5RA 3PHGA 2R6JA 4J91A 3DZIA 1MA0A 1U3WA 2J5QA 2I66A 2OP0A 4LISA 4GVLA 3ASVA 2HMUA 4IDCA 3H5NA 3TNLA 2X0JA 5A9TA 3ROQA 1LDGA 2Y1DA 4MOWA 4BUCA 1UJMA 4YJGA 4OXNA 4LGVA 4BNXA 4EITA 2G17A 5L4LA 4YJFB 4DXHA 3DZBA 4GQAA 3RAJA 1H6CA 1HYGA 3LLSA 4WCFC 2QW8A 3T4EA 5IG2A 5FFFA 1OI7A 4BO4A 1JN0A 2P2SA 3WR5A 4D41A 5JMWA 1RYEA 1UP4A 3E03A 3ON5A 1HYEA 1P44A 4DQXA 2O3RA 3DMYA 3HADA 1CEQA 1X7HA 3NT4A 1GDHA 4FJ1A 1IZ9A 3ZWWA 1QG6A 3HDJA 4AJPA 1QV7A 1IYZA 3PJGA 1E7QA 1EE2A 3GFBA 4BQPA 3JYLA 4BMSA 3FBGA 1EUZA 4JCOA 4OM8A 4CUZA 5IZCC 2VNSA 1GZ6A 3H3FA 2VOJA 4E5NA 3EK2A 1OOEA 3AI1A 3H5AA 5T8KC 4J2HA 2BKAA 4RL6A 5A3JA 3JYNA 1R37A 3DZGA 1ZO8A 4MDHA 2H1SA 2Y1EA 3R3JA 4OHUA 4TVBA 1W6UA 5A5EA 2IZ1A 2Q1WA 4U5QA 3SBOA 3AM5A 4QXMA 3U3XA 3GPDG 5DP1A 1T4DA 3ZWPA 4TWRA 1DLIA 1KYQA 1W73A 4BNZA 1NFFA 4EUEA 4IZIA 1KETA 4BNMA 3OJFA 2Q46A 3X2FA 3IP3A 5L4SA 1U28A 2PR2A 1I3NA 3HG7A 2I6TA 4M49A 1DC6A 1O5IA 5G0UA 5JDIA 3GR6A 3L4BA 1ZH8A 2HKIA 2VHWA 4LMRA 2W2LA 1A9YA 4WUVA 1LUAA 2R00A 3KYCB 1U7HA 4A0SA 1A27A 1U4SA 4MIEA 3OHSX 2W90A 5IAAA 1GYPA 1JKFA 1VLLA 2D5AA 4R01A 2OZPA 1P31A 4O6VA 1SCUA 1IZ0A 3GNSA 4KWIA 1H93A 2W98A 1Y7TA 4WE3A 3D5QA 2GGSA 5L7YA 1H0KA 3VVBA 3EAGA 3F4BA 2AQKA 2B4QA 3NGXA 3QIVA 1DXYA 4A5OA 4ZQBA 4II3A 1PR9A 3UW3A 2ZYAA 3VPXA 1D8AA 5C7OO 3C1OA 3TZKA 1E7YA 4PLTA 1Z7EA 1Z7BA 3LT2A 1CQJA 1MP0A 1HDRA 1Q0HA 2CSUA 5AOVA 3WGHA 3UOGA 1M76A 3DZFA 3ZHXA 4BKUA 4WK6A 3JQ8A 1IHXA 1ENYA 5IDQA 2X9GA 2BI7A 3V1UA 1O0SA 3U0BA 3JCZA 2Y0CA 2GNAA 3DQPA 4MPDA 3I9KA 3WGGA 1BDMA 1ZIDA 4J3FA 3WMXA 3E82A 2P4QA 2JD2A 1ZCJA 4MKXA 1LU9A 2EXXA 2WM3A 5TNXA 1DFIA 3UH1A 1LEHA 4QFCA 1DC3A 1Y8RA 5JBIA 2DTEA 4CM9D 3UCXA 2AMFA 4NK5A 2ZB7A 4MIYA 4OSOA 5GY7A 3ANLA 4RVFA 5C7LO 2VUUA 3ONEA 4RLHA 2A92A 5L95A 3LQFA 5HS6A 3H4VA 1E3SA 4MJLA 2PA3A 2EIHA 4QQRA 2VYVA 2Q4EA 3UKOA 3MOGA 2CNBA 4ND1A 5BT9A 4DUPA 4UREA 5ENVA 3GVIA 1Y6JA 3U4CA 4QT0A 1HZJA 1LC0A 4RF5A 5DT9A 1GV1A 4C7KA 4CMHA 5IN4A 3VH1A 3GMDA 3Q9UA 5TLSA 3I52A 3NJ4A 1PZGA 4BNUA 1NNUA 2OBNA 3DL2A 1Y8RB 1OAAA 3KO8A 4IDDA 1KOLA 1YB5A 1EUCA 3PWSA 4ZU3A 2QYSA 1L7DA 4FD3A 2ZQYA 2J3JA 3U4DA 2OP1A 4GSLA 5JY6A 4L4RA 1NBOA 2PGDA 1RM4A 3HB5X 3BMQB 4OGWA 4KMSA 4L4SA 2VWQA 1DIGA 4WCFB 3ANNA 4RPLA 1E6EA 1N1GA 3QWFA 5G0TA 1HDCA 4CM5A 4L73A 1VSVA 2Q2QA 3RUFA 5CG2A 3EW7A 2DVMA 3OA0A 5TJHA 3TSCA 4EUHA 4CM7A 4EUFA 3V1TC 1B8UA 3ZWYA 1PWZA 1WNTA 4NIMA 2OHXA 2J3IA 4DL9A 4YT2A 2Z1MA 3S2IA 4CQLA 1DFGA 2DUUA 4MVJA 3NT2A 4TSKA 5KIAA 1KVRA 3ZU2A 5T57A 1WXDA 2JAHA 2JD1A 5JCXA 1BDBA 1HTBA 2OBYA 5DNAA 2C07A 1B26A 2GERA 1LRLA 2ZB4A 3IUSA 2PWZA 3NYWA 5H83A 4CMEA 2JHFA 4ZRNA 3GRKA 4UAGA 3C85A 3SC4A 4G81A 5JCJA 3G49A 4J1SA 4BKOA 1B8VA 2IYPA 4GGPA 2DKNA 1AN9A 2Q1UA 3DBLB 3WYEA 4OSPA 2PKRA 4P38A 4QO8A 3TN7A 4ZQHA 3S8MA 1H9BA 1F8FA 4MVJM 3DOJA 4D7AA 3JQ9A 1N7GA 5G4KA 1N9GA 2X5OA 3BMOA 1M67A 2AEJA 1HT0A 4YRDA 2QYTA 3CUKA 2DM6A 2Q4BA 3GA0A 4DTIA 1SO8A 3GDFA 1PJTA 4BMVA 2WD8A 1LSUA 5C3MA 2RCYA 4J0FA 4IDBA 3R0IA 3QSGA 3H6KA 3L9WA 4U8GA 1E1NA 1F14A 1RYDA 5HBRA 3DBHA 1E77A 2EJWA 2Y99A 5HS4A 1Y9EA 3OBBA 4N54A 3GLQA 4NNJA 4TKLA 3S2GA 4BKRA 3IDSA 2Y93A 3GVXA 3VKUA 2EKPA 3MJEA 1UH5A 1NYTA 5G4KB 3BTUA 4CPDA 2PV7A 4J7CA 3U5TA 3H9EO 2PTGA 4B7UA 1HEUA 2FP4A 4NK4A 3F3SA 4PLFA 4FJ0A 3UCEA 3V5NA 4JQCA 2IRWA 1E7WA 3RUIA 2B5VA 4IINA 3WNQA 1GUFA 3HDHA 2PH5A 3AM3A 1ZXLA 1LDMA 1ZK1A 2AE2A 4WASA 1TT5A 2F1KA 3OJLA 1BSVA 3FNGA 2PH3A 4JBGA 3EY4A 4YCAA 3A06A 4YAIA 3W1VA 4WEQA 3ZW8A 1OZAA 1SAYA 4NU6A 3RSHA 9LDBA 2C59A 2X0NA 4B3JA 1PZEA 3ZV4A 3CIFA 1JAXA 2PLAA 5DCUA 1XKQA 3ANMA 1GL3A 3F1KA 1C0KA 3A9WA 1V3VA 4HNGA 1V35A 4KDEA 2FY8A 3ZU4A 2O3JA 3GHYA 2EJVA 4YBZA 3VPFA 4DPMA 3MTGA 4DYVA 2GN6A 5DOVA 1T26A 3N58A 2DBRA 3NRCA 3ONFA 1MXHA 2Y0EA 1T2DA 4ILKA 1GYQA 1HSOA 4MVJE 1WVGA 4MVJI 2IEBA 2JFFA 2EEZA 3CH6A 2CVOA 1VKOA 4LCJA 2GPTA 2DPHA 3RJ5A 1PZFA 4J1QA 1T4BA 2FZWA 3GDOA 1DRWA 5K6AA 2FRDA 2DBVO 5F5LA 3A4VA 4XD2A 2WYUA 4WLEA 4CMIB 5ITWA 3EZLA 4IPTA 1VL8A 3KTDA 5T5QA 2GYYA 2YV1A 1CQIA 4WNCA 4D46A 4CMBA 3RUEA 1PQUA 2POQX 5IDWA 1NR7A 4E32A 5AVOA 5FYDA 1VM6A 4ZHSA 1DC5A 5G0WA 1PS9A 3F47A 5JO0A 3WQRA 4FC7A 4PLGA 4ZQEA 1R6DA 3W4IA 3UFXA 4BO1A 1B14A 4J2OA 2VYNA 4LSMA 2OMEA 3OH8A 4PG7A 1W0CA 4CR6A 2YY7A 5ILGA 2B5WA 5I9MA 1XCBA 3EDMA 2E6UX 3FNHA 1Q7GA 5ICSA 4YAJA 1QORA 3QVTA 2YDXA 3SC6A 1EVJA 4D45A 1NWCA 4NQZA 3DONA 2WD7A 1XGKA 2FPIA 5EERA 4DBVO 4E13A 3ZZNA 3ZWBA 1H6AA 2GR9A 2X0IA 3JTMA 4TKMA 4DMMA 1E5QA 3HDQA 1YOVB 4BGIA 3GEGA 2A4KA 4LW8A 5MGBA 4OO3A 1ISIA 2FR8A 2RAFA 3K96A 1MGOA 1WDLA 3MJTA 3PP8A 1MFPA 1ZUD1 2HQ1A 4QUKA 4WLUA 3V2HA 3R3SA 1C0PA 1G0OA 1QV6A 1R4MA 1PZHA 4RVGA 1J49A 1D7OA 3I6IA 3K8ZA 1K6XA 4EZBA 2O4CA 4UVGA 1I2CA 5KTKA 1EBUA 2JFHA 3MCVA 4O63O 4DYDA 4J7XA 4OKIA 5EQDA 4ZRMA 1I8TA 1RM5A 5BSHA 4WEOA 4LRSB 4XGIA 4LRTB 2G5CA 4PRLA 4DIOA 2VHYA 1DB3A 2QQ5A 1NFRA 3OA2A 5TT0A 3VH4A 5BR7A 1Y8QA 5FI5A 1DHTA 4K6CA 4I5FA 4OQYA 4R5MA 2VHVA 4Z3DA 4PZDA 3GOHA 5EIOA 3RD5A 3WSWA 2Q1SA 1KVUA 3MJCA 5TQVA 5B4TA 2O4UX 5A9SA 2FZEA 3AWDA 1E3LA 3QVWA 3RKUA 2NV6A 3HNPA 4KDFA 3PYXA 3D0OA 1IPEA 1KVTA 4DQUA 6LDHA 3EZYA 3ZV5A 3PFFA 3PJFA 5B12A 3WFJA 1PEDA 3M2TA 1Z45A 4JP3A 1XU7A 4M86A 4YAGA 3EVNA 2ZQZA 4U7WA 2CDCA 3DWFA 5KWEA 2PFGA 3K31A 5JAIA 4GWGA 3AJRA 1GQQA 1O9BA 1P1FA 4XQEA 3INRA 3ZHYA 5IDYA 2Q45A 3KSUA 4MINA 3RUAA 1Y8QB 1MC5A 4A2CA 3LC2O 5ILOA 1TA4A 4GBJA 4NBVA 3ZW9A 2ET6A 4GX5A 1CF2O 3GHHA 5KJ1A 4KZPA 3OJOA 3WLFA 3VC7A 3AUTA 2G82A 3ADPA 1RPNA 4H15A 4XX0A 4I08A 2UVDA 4CLHA 3SXPA 4N7RA 4PG5A 5A02A 4XEHA 3CEAA 4BNTA 3A1NA 2C54A 1X14A 4IIUA 1BXZA 2QG4A 5TF4A 2WYWA 1Z6ZA 1ENPA 1LX6A 3PWKA 4B4WA 2J3KA 2GASA 3OP4A 3ZWMA 1BTOA 1ONOA 2JAPA 1WLYA 1VJ1A 3PI7A 4PLCA 4YVFA 5ADHA 2GN9A 2LDXA 3TQHA 4RLSA 3Q2KA 1LQTA 3LLVA 5A06A 3Q0EA 4E2WA 1UDCA 5HA5A 2O7QA 2AG5A 2F00A 5JYDA 3O38A 2VZ8A 5A4DA 2HK8A 2WDZA 4RDIA 2VN8A 2BH9A 4CM1A 3C7CB 3DO5A 4NZ9A 3AU9A 4UVHA 4HWKA 2EERA 2YHUA 1PX0A 4WLFA 5I7FA 3VTFA 3TL3A 2WWRA 3H8VA 3FF4A 3KZVA 1Y1PA 1BXGA 3PHHA 4C4OA 3DAFA 3FTPA 1XEAA 5TS3A 1EEHA 4XRGA 1RM3A 3E5RA 1JKIA 1PL8A 5KCZA 3VDQA 2BRUA 3WIDA 2DBQA 4N5MA 1B16A 1XU9A 1P9LA 3PPIA 4Y6SA 1ORRA 2HCTA 1VE9A 2BFMA 4DVJA 4Z0TA 4TRMA 3FSRA 3WMWA 3U4HA 5K0ZA 3D4NA 2ZJ0A 1HYHA 4WOJA 2BMAA 3AOEA 5G0SA 5U1PA 3SX2A 1HDZA 3BHIA 2X6TA 4IGFA 1ZSYA 4TVOA 2E82A 2QX7A 2W2KA 3FPCA 5JDIC 3D3WB 5COBA 2EKQA 1U2DA 3O8QB 1B3RA 4FFMA 1C3VA 3IL2A 4UUMA 2I65A 1EZ4A 1O94A 5T64A 4KQXA 1UXKA 2JFGA 3JSAA 4RGBA 2R00C 5JMPA 7ADHA 3LT1A 2PD4A 1IB6A 1T1SA 1YBMA 1W8DA 3CINA 2B69A 2D8AA 3OETA 1M6WA 4I1IA 4B4OA 2HJSA 4IXTA 4KTTE 2R2GA 4J9UE 3S2FA 1PJQA 1YKFA 3PIIA 1BXKA 4YYZA 5KJ6A 1PU2A 1FMCA 2JD0A 4IMRA 2Q1TA 2GN4A 2PD3A 4MO2A 4Q3EA 2GO1A 2QZ9A 2CD9A 5F5NA 2QRJA 4YACA 5FEUA 3F4LA 4U0KA 4MP8A 1MB4A 4J90A 1DOHA 5A05A 4Z6KA 2NACA 1E3IA 1X0VA 4S3MA 3IOYA 4P8RA 5DCWA 4NU5A 3WJ7A 4MP6A 4BO2A 1QYDA 2D2IA 3LT4A 3JQAB 3AY3A 4UVDA 3VZSA 1QMGA 2QZZA 4F46A 2YV2A 5JY1A 3Q11A 4GLOA 4QO7A 4E2ZA 3GZNA 2NQ8A 1VL6A 4KUHA 3H65A 3JQBA 4CM9A 3GAFA 3WBFA 2B4TO 3OMLA 4LN1A 1ARZA 3RIHA 1N7HA 2V6MA 1U4OA 1XQ6A 3NDIA 2ZJ1A 4MIOA 1HF3A 4CQMD 4I5EA 1M6HA 4NDNE 1U7TA 3MOIA 2Y67A 3DZJA 3KSZO 5T6BA 4PLYA 4QTZA 3TZQA 5L9AA 4OOFA 5C5IA 1C1XA 2PZKA 2VTDA 1PS0A 3ENNA 4ND5A 3I4CA 1X15A 3RFTA 1WDMA 1B15A 1YO6A 1H9AA 3OEWA 3HB4X 1EBFA 4JIGA 2WYVA 4HFMA 1YXMA 4CM4A 4AJNA 1DIAA 4D44A 3T4XA 4D3SA 4IGEA 3CKYA 3ETEA 5HRUA 4INAA 3FR7A 1BGVA 4E6PA 4I5DA 1N1EA 4ROSA 3BA1A 4R5HA 3ZH2A 3TZCA 4TZTA 5FWNA 1BWSA 2DC1A 3GG9A 3FPLA 1PR3A 1QLHA 4LSWA 3H9GA 5DP2A 3X2EA 4RF3A 1JVBA 4YJGB 5JDCA 2C29D 5C7IO 1PS8A 3WDSA 1QRRA 1LDNA 3MZ0A 1YBAA 5CPFA 4CR8A 5DBFA 4KP7A 2PZLA 4LMPA 2C20A 2D59A 3QWHA 3B1KA 3JD0A 4YDRA 2VQ3A 3CMCO 4WKGA 3PQDA 4YRBA 1KIFA 1NAHA 3P7MA 1FDWA 4AVYA 2E37A 5L3ZA 2UDPA 1I33A 3PHIA 3WQSB 3ZNNA 4M1QA 2RHRA 2FR1A 3QWBA 3OFSA 4XGKA 3E48A 3HN2A 3DZKA 1H6DA 1BW9A 3A28A 3NTQA 4GL4A 4CLEA 1LI4A 4QFDA 3K30A 1NTOA 3HE3A 4XIJA 3TF5A 1U3VA 4U6QA 3DXFA 1I3LA 1T2CA 3I9NA 4ITUA 3GDGA 4DC1A 2HUNA 4CM6A 3JV7A 3WGYA 1E3JA 2FN7A 4DC0A 1L7EA 5KNLA 3H3JA 3W6UA 2H63A 3UAGA 4FBGA 4CMEC 5AQ1A 1PGPA 2NUAA 3TFOA 2HMVA 3RCBA 4RDHA 4RVDA 4JJGA 1DRVA 5CP8A 1TVEA 5DBGA 2GZ1A 1LLUA 4FW8A 2Z95A 3GGGA 2O48X 3MJSA 5CG1A 1ZMTA 4I9NA 5EL0A 3SJ7A 2VOEA 1WWKA 4IQ8A 1UDBA 2B36A 3KYBA 5JNLA 1KERA 3WYBA 3JQ9C 5B37A 2BF7A 3TOXA 1C14A 3C7AA 3NDJA 3CXRA 4XQCA 1HE4A 4NBWA 3K6JA 1VJ0A 1VI2A 2P9EA 1YS4A 1EDZA 2O2YA 2GLXA 4Y6PA 1VPDA 4W6ZA 5I9NA 3GGPA 1U3UA 1U5AA 1A72A 2CDAA 4FN4A 4J4HA 3D7LA 4S1VA 4J7UA 4ZGWA 4XYGA 4CUKA 2NVBA 2DBZA 1NAIA 3W6ZA 3DHEA 4UUNA 1UP6A 4Z0PA 3S1LA 1H5QA 2Y1FA 3DAGA 3P19A 4NJOA 3LT0A 4AICA 2RH8A 1V3UA 1ZXBA 3ZWAA 4EDFA 5CAEA 3M1LA 3KB6A 5EN4A 1ADBA 1JTVA 5BNTA 1FDVA 1X7GA 1LA2A 1T25A 2YQ5A 3JYOA 1YL7A 2HK7A 1P3DA 1K6IA 1M66A 2VUTA 2OFPA 4P4NA 1P1IA 1TXGA 4TMFA 3JQ8B 3OF2A 5KKAA 3VH3A 5KVQA 1F0YA 1IPFA 4IZHA 3DOOA 3LVFO 1TB4A 1WP4A 1Y9AA 1ONPA 4FOOA 3PDUA 5FF9A 4G65A 4FFNA 2QIOA 4N5LA 1XQ1A 4R1TA 2CF6A 3PQEA 4XB2A 2QRLA 3B1JA 3JD3A 4MKRA 2XXBA 3LC7O 4N18A 1YQGA 1XYGA 2EG9A 2FPPA 3PVZA 4BIIA 4Z3KA 3K5PA 5ER6A 2ZYGA 3E18A 2WE7A 1JDJA 4NJMA 4GGOA 4OYRA 2B35A 6ADHA 3G3EA 1P77A 3MWEB 3LC1O 5BSFA 2O3QA 5AYVA 4RPHA 2JCVA 3PWZA 5DZSA 4RPKA 3PIDA 1HE3A 1P0CA 4XRRA 4ND3A 4KOAA 4BQRA 1Y5MA 1RJWA 1R12A 3LSYA 1CDOA 2IE0A 3Q6IA 4J16A 4PLZA 3UUWA 2X9NA 3ZWXA 5K9ZA 5L40A 2E49A 2YFQA 4L8VA 2X22A 4F3YA 7MDHA 1J6UA 4IUYA 2GZ3A 3ZDFA 1PGOA 3DOCA 4HADA 5K6AC 2YV3A 2C82A 3PRJA 1NVGA 4CL3A 1ZKMA 2ZATA 1K3TA 1YONA 3GUYA 2GD1O 3HDYA 4XQ9A 5CPBA 3TWOA 4KWHA 2I67A 3C3XA 3ICCA 1K5HA 3JYPA 4NJMB 1LBEA 3R1IA 2PKQP 1A4UA 1EFLA 3QVOA 4M89A 4H3VA 1LTHR 1LC3A 3IJPA 5F3RA 4DWVA 1Y5RA 3QRWA 4NBTA 3RC9A 4E5PA 1KY4A 3FCOA 1ZSVA 3TJRA 1NQOA 3VZRA 2RIRA 5CDUA 4JBHA 5EQFA 3DAPA 4HKTA 4IXWA 1T1RA 3CTMA 4IY1A 5H81A 3ZWOA 4F6LA 1VKNA 3IKTA 3ADOA 3ASUA 4FB5A 2GF2A 1NPYA 2DUWA 2ZK7A 1P1RA 3AW9A 2VHXA 2YFHA 3HSKA 3GZ4A 3VOSA 2Z5LA 5DN9A 2IDZA 4WOKA 2NM0A 4AJ4A 4CQLB 5DF1A 3DHYA 2ZCVA 4URFA 5CHEA 4HFRA 3QVXA 1FDSA 2X0RA 3QJ5A 2ZTLA 3I23A 1GYRA 4CLRA 3OM9A 3GNQA 3C7DB 1HRDA 3WWZA 1E6UA 1YB1A 2EGGA 3BMCA 4PCVA 3IMFA 5A03A 4CJXA 4W9NA 1XWFA 2C7VA 4PN3A 1GFSA 3GVPA 1YQDA 4MVJH 4CR7A 2HJRA 2ILTA 1YJ8A 1XSEA 3I4FA 4P22A 5EMHA 4B8WA 3ZI0A 2UYYA 1N9GB 4TZKA 3BMOB 1U8XX 4DIBA 1GQYA 1XDWA 3E8XA 3UVEA 2NTVA 2ZIZA 2HSDA 4JROA 4PGFA 4A27A 1E3WA 1LJ8A 2PNFA 1U9JA 3WGZA 4YJHA 1DSSG 4JJIA 4L4XA 2VZ0A 4ALKA 4BGUA 4QECA 1ONNA 4ESOA 2NQTA 4CLRB 3WG9A 3E5MA 1MG0A 1XHLA 1Q2XA 1IUKA 1CWUA 1RKXA 2FOIA 1U3TA 2VWPA 2Y1OA 2YDYA 1F06A 3DBHB 4D3DA 3T7CA 4CLOA 4JBIA 4W82A 4B4UA 1YE3A 4YPOA 2O7SA 2EWMA 1EQ2A 4BNHA 2AE1A 4BOYA 1KY5A 1PQWA 4XYMA 5MDHA 3SVTA 1TI7A 1YVEI 2P68A 3B20A 3DC2A 4A73A 4QX6A 3WSVA 4ALJA 1J4AA 2DPGA 1EVYA 3DBRA 3EUWA 4BNNA 3KM0A 4UVIA 4Q39A 3PHLA 4DREA 4YJHB 1VRWA 4XYBA 1EE9A 1TT5B 1F17A 3BMNA 2Y1CA 2PZJA 1TLTA 4Y8VA 1YGYA 2SCUA 1XIVA 4A10A 3FR8A 1UUFA 4CLOB 4OIMA 2Z1NA 5C37A 1GEGA 2BFAA 4BNIA 1P1KA 3IQDB 2EHDA 1UP7A 2JCYA 3FN4A 3GQVA 1ZK3A 4AJIA 1ISHA 1G1AA 2X23A 3GN2A 3H9QA 3IAHA 4CV0A 5L51A 5GZ1A 1ENOA 1LSOA 3O03A 1PJ3A 5CEFA 4B3IA 1I36A 4RQTA 1E6WA 4Q3DA 3PGXA 1KVQA 1O8CA 3DBRB 5JYEA 1JKJA 3PQFA 2J3HA 1EDOA 4M54A 5F1KA 1T2FA 3ABIA 4CV3A 1R15A 1VSUA 3GF4A 3GUCA 4R9RA 2B4RO 3O4RA 1HLDA 1ULSA 3B1FA 3NX4A 1YL5A 1BVUA 1EQUA 4BB5A 5BSGA 4GVXA 1PGJA 1MUUA 1KEPA 2VRCD 4RPGA 4XYLA 1KC3A 5JO9A 4ONEA 1ML3A 5JW6A 4KUGA 1GU7A 1YWGO 2UUPA 8LDHA 4L76A 1BHSA 3JD2A 3KEOA 5TC4A 4R1NA 1UAGA 1U2GA 3SEFA 4NH4A 3L4SO 2C7GA 4NHEA 1L1FA 3G1UA 1FK8A 1LRKA 5CDGA 2JJYA 1FDUA 1E0DA 3L9XA 3RBVA 4E12A 1SEVA 5JCJD 4NFHA 3MEQA 4E21A 4HX5A 3ZHZA 3JQ7A 1IE3A 1CETA 4ZICA 2BFOA 4PIVA 4FFRA 3AOEC 2B37A 3TZHA 2O2SA 3GN1A 4GWKA 4ALNA 4BL5A 1LQUA 3O26A 1Q0QA 2AEFA 1IY8A 2Y1GA 2NU9A 4EGFA 4OXYA 2C2YA 1MC4A 2RBEA 2V6GA 3BTVA 2GCGA 3LYLA 4BO5A 5KJCA 4GI2A 1ZVMA 2OL4A 5B1YA 4TRJA 1DHRA 3KYDA 2B83A 2BGMA 4H16A 3ZNQA 1SZJG 4RQUA 3I6QA 2WD7B 1ID1A 3HN7A 3DMTA 5JE8A 4BNKA 2Y68A 3D4PA 2NVUA 3ONDA 3QA9A 1H94A 1Q7CA 2Q50A 4NR0A 2EP7A 3HUDA 3UGKA 1LDYA 4EBFA 1R0LA 1KC1A 1I01A 3B6ZA 3RROA 1S6YA 4IJKA 5U4QA 4XQGA 3KRTA 1OMOA 2Y05A 1R4MB 2E48A 3F9IA 4LK3A 2EV9A 4E3ZA 5DOZA 4Y9DA 2BELA 2AQ8A 3UCFA 3P2OA 4H7PA 4PZCA 2G76A 3PZRA 3HFSA 3INTA 1Q0LA 2EP5A 1X7DA 3LDHA 3G1TA 4UUOA 1QYVA 4YA6A 3S55A 3ZNOA 3K2EA 2P4HX 3CZMA 3KYDB 4GPD1 4RZIA 3JQBC 3OECA 2RHCA 3OQBA 4JP2A 3HJAA 1QR6A 2P9GA 2XXJA 3ZNPA 5JLAA 4CQMA 4RVUA 2NVUB 4E2YA 1KBZA 3ROKA 5CDTA 1HL3A 4NMHA 1I3KA 1ENZA 4WLNA 5A9SB 4Q3BA 1JVSA 3EYWA 1ZEJA 4OOEA 3WBBA 5LCXA 2BI8A 4HY3A 4LVCA 5JFOA 3JQGA 4YAKA 5ES3A 2NNLD 4D0SA 2UV8A 4JN6B 3ROMA 3CPSA 3ITKA 5F1PA 4A7PA 3S2EA 3QE3A 4AFNA 2X5KO 3VH2A 5I8WA 4BO7A 4ALMA 3G0OA 5EESA 3JQFA 4LCEA 4BNFA 1MX3A 2NLOA 1HXHA 4DBZA 4PVCA 2X7HA 4MVJF 5LDHA 4GX1A 4I8XA 1A7AA 1ZK0A 2NSDA 4XJTA 3ZV3A 1CIVA 5H82A 1GUZA 4BNLA 5HTOA 1B8PA 1Z82A 5A5FA 3AK4A 4IS2A 1VC2A 3WGTA 3E9NA 3NUGA 1HE5A 1SMKA 1YB4A 1AXEA 2JL1A 5L45A 2OUIA 2TMGA 3RC1A 2HK9A 5A9RA 1WZIA 5JDCC 1PIWA 3GEDA 3Q2IA 3NTRA 3JQGB 4DQVA 2VT3A 2EW8A 2J6IA 5IN5A 2PZMA 1Z73A 2UUOA 2VHZA 4FGSA 3AU8A 3AUUA 4CUJA 1WW8A 1XR3A 4NI5A 4GLLA 1E1KA 1R4NA 2X58A 3DZHA 4AJHA 2EKLA 1DIHA 2B0JA 4JK3A 2AQHA 4CMKA 2CFCA 2BGLA 4Y98A 4GMFA 2FSSA 4B3HA 3ETDA 4OJNA 1B3BA 1WPQA 4MVJP 3FI9A 1ZNQO 4J4BA 2DTDA 1LRJA 3KSDO 4CM3A 3ZWNA 3PYMA 4QSMA 1R0KA 4E0BA 3GPIA 4N5NA 5TSDA 3WS7A 5G4LA 5HM8A 4R41A 1P45A 3GFGA 4O59O 1P74A 2G0TA 1BXGB 1I32A 3K92A 1ISJA 1SOWA 1YL6A 2YZ7A 1SEPA 3GGOA 2CF5A 3VKVA 1W4ZA 2XOXA 1ZSNA 2X8LA 1R4NB 2GUGA 3JD1A 4L74A 4B4VA 1BMDA 4MP3A 4JLWA 1ZFNA 2CZCA 4BNJA 3H2SA 2WJPA 4ZN6A 4YQZA 1K6JA 2BFPA 4AJ1A 3QV1A 3QVSA 3VAZA 1D4FA 4AG3A 4YT8A 1U8FO 4BO6A 2W2KB 5GZ6A 3GAZA 5U9CA 1EK5A 2Q3EA 3W8EA 4Y6RA 4B8ZA 4RORA 4UEOA 5IFLA 1YJQA 3OIFA 3U9LA 4YXFA 4R16A 4RPJA 4DRYA 3AM4A 3FD8A 4IJWA 4RJTA 1ZK4A 2WMDA 1LSJA 1B7GO 3O9ZA 4F45A 4E5YA 5IF3A 3L07A 3DFUA 1KS9A 2Y66A 4ZJUA 1MV8A 2CY0A 5T67A 4CV1A 2V7PA 3K9QO 4BNWA 1ZW1A 2BLLA 4YJFA 4NBRA 2I5PO 3Q9NA 5I7VA 1NFQA 1T24A 2Q99A 1Z74A 3F1LA 5CEEA 5JC1A 4J1NA 3RUCA 4G2NA 3DEYX 3GVHA 1UZLA 3STHA 2YQ4A 4IS3A 2ZCUA 3RU9A 4PG8A 5L7TA 4YT4A 2D0IA 2FR0A 3VPSA 3MWDB 1DRUA 5DCYA 1O89A 1V6AA 5KVVA 3GZNB 3ST7A 2IXBA 1UZMA 4M8SA 5CFZA 2C5AA 1YDWA 4BB6A 2NWQA 4D43A 1GQ2A 2V65A 4IIVA 3KLPX 5IZ4A 2J8ZA 2FPGA 1AGNA 2A9FA 3KHUA 5IXYA 3OIGA 4RVHA 1UXHA 5LC1A 3KVOA 4FS3A 1YRLA 3AI3A 4L0QA 4WCDA 1JLLA 5THKA 1ADFA 2V6BA 1HDOA 1PL7A 1ZBQA 3VZPA 2X1HA 1C1XB 1LDBA 1JW9B 1BG6A 4FCCA 1MG5A 4HP8A 4W7HA 5DBIA 9LDTA 1V3TA 2GRAA 3PXXA 1LDEA 4CM4B 3ETGA 4CLXA 4EEZA 4EJMA 2I3AA 3DR3A 1NQ5A 4I9UA 4Q9NA 4Q3NA 2ZKLA 4BS9A 4B7XA 4W99A 4BGEA 2NVWA 2RH4A 1ISFA 4BV9A 4XYEA 2Y0DA 3ENKA 4F6CA 4LVUA 3G79A 1PJ2A 2O3TA 1ISMA 4J0EA 3WFIA 3KYCA 3AFNA 1QP8A 4WJZA 3ROPA 1V9LA 2CVQA 1B2LA 3TDKA 2YHIA 2QHXA 1IOLA 3OQ1A 3CE6A 1XA0A 4DMLA 1UR5A 4XWYA 2D5CA 1NX6A 5TJ9A 1P1JA 3ICPA 4BNVA 4R9SA 4L9RA 3NTOA 3RC7A 4OMUA 3RJ9A 2YJZA 1WAMA 5B4VA 5L4NA 3PLNA 3F6YA 5KOIA 4ALIA 3IUPA 1QLJA 3QY9A 1QKIA 3W4KA 4BNGA 4II2A 1HETA 2UAGA 4FR5A 1T2EA 2VRBA 1BW9B 4ND2A 3U09A 3DFZA 3I9OA 4JJFA 5JAQA 3VPGA 4ZA2A 1SC6A 3D64A 5AXAA 5KVSA 3ITDA 3JQAD 3PJDA 3JQ6A 1X13A 2I76A 2YHIB 1P33A 4O1MA 4OL9A 4BV8A 3RWBA 1CYDA 2FWMX 1DO8A 4UEKA 4AJJA 2HRZA 1KVSA 4ND4A 1PSDA 3E9QA 2DLDA 1A7KA 2VZ9A 4NFSA 1I2ZA 1YDEA 1I2BA 1XG5A 2WTBA 3BIOA 1DEHA 3I9MA 4W9NC 3HFGA 3MJVA 2XF8A 3L6EA 3BTSA 4ZQGA 4W4TA 3QW2A 5GZ3A 2IXAA 2D3TA 3FHLA 3NGLA 4BKQA 1MLDA 3H2ZA 4FFPA 3I5MA 4ALLA 3KEQA 1E1LA 3I9LA 5BNFA 3OJ0A 4PLPA 2HDHA 4AJKA 3AUSA 4DPKA 3IJRA 1YQXA 3ORFA 1GV0A 2H9IA 3AY6A 3D1LA 4RZHA 1KEUA 4AJLA 5A1TA 1HLPA 2JKVA 4OQZA 1NM5A 1LLDA 2WE8A 5TGDA 2P5YA 1V8BA 2AHRA 3FWNA 2VWHA 3C1TA 4B79A 2BHLA 3JYQA 4OAQA 1E7SA 3IIEA 2NU8A 4UUPA 1JAYA 1ZK2A 3RFVA 3WLEA 2BGKA 3JQDA 3FWZA 3NT5A 2LDBA 4HBGA 4KTVE 1I30A 2GZ2A 3BMQA 3LZ6A 4WCFA 4UEJA 2EW2A 4CLDA 2JCXA 4DIFA 3E6AA 2W8ZA 1B0AA 3PGJA 4R3NA 3TZ6A 3GMSA 4C7JA 4GMGA 2Q49A 1AHHA 2NU6A 3V8BA 4PLHA 1M2WA 3I83A 3SLKA 1DFHA 3PLRA 3HQ4O 1HZZA 4Z9FA 4DA9A 3D3EA 4PG6A 3UF0A 4NBUA 1IHYA 1GCUA 4YEDA 2G1UA 5IZCA 4YB8A 4BMNA 4E33A 1DDOA 2C0CA 5T8KA 4R54A 4CL8A 1I5RA 2P5UA 2ZTVA 4E5MA 2DTXA 1NR1A 2IZZA 1JWAB 2YUTA 2PGLA 1IULA 1X0XA 4R69A 3VTZA 4QEDA 1C0IA 4GX2A 4XR9A 1A5ZA 2GDZA 4I9HA 3TPCA 4I5GA 3IP1A 3MTJA 4TRNA 4FGWA 4AL4A 4PRKA 3DBLA 1K0UA 1UZNA 2AW5A 3PTZA 4L75A 1GTMA 3FNEA 1JWBB 4XJSA 5ICMA 4E30A 3RASA 2VRCA 4DLAA 5I8ZA 1C0LA 4IQ0A 1JA9A 4NPCA 1V0JA 1QYXA 4PLWA 3W4JA 5JAZA 3NJ8A 4Z0HO 1NQAO 1ADGA 1UXGA 3FNFA 3RUHA 3DTYA 3TRIA 1ZEMA 4OXKA 3VHRA 3VDRA 2JHGA 4KUEA 1NVTA 1DIRA 3BXXA 1CRWG 3BHMA 4R1SA 3TFQA 4NFYA 4K28A 1I3MA 5I7SA 5I7EA 1EMDA 2W2LD 2ZYDA 1J0XO 3M1AA 3WWYA 3IS3A
chains in the Genus database with same CATH superfamily
3SZMA 1XJ5A 4RTQA 5FV4A 2FZCA 4RF4A 2PY6A 4RWZA 4QDJA 4M4SA 4QZVA 1R8YA 3OTHA 3QI2A 1XVVA 9MHTA 2EL9A 5A0FA 2WF8A 3KBOA 2WY2D 3RGGA 4DS3A 4ETIA 4ZCRA 5LOVF 3VU3A 4DA6A 3L8ZA 4WNIA 1YE5A 1M54A 3OCWA 5K5EA 3SR3A 1E8NA 4AYWA 1R0XA 2IS2A 3QBTA 2RGEA 2HAEA 4H0NA 4MMXB 2GZAA 3IO3A 1VYVA 4R3UC 3N39C 3OT1A 2DAPA 2JS7A 3UN1A 3URKA 3GP5A 3ES9A 5K3FB 1P1HA 1USUA 3KXPA 4XDZA 1V7CA 2OB2A 1OH6A 3RBZA 1LNZA 4FSHA 4I19A 1GY8A 2QD4A 1JFFB 3HYSA 1BA2A 4M1SA 3I2IA 5DW0A 3EVTA 4KKVA 4ODIA 1WB4A 3AQ4A 5T4FA 1HSZA 3E7PA 3CCCA 4XEUA 4G4SO 4I8IA 4QM6A 3NYIA 4P80A 4KEAA 4EJ0A 3GC6A 4D3FA 5LFAA 4TYPA 4CETA 3A10A 1BVRA 1KAEA 3V8NA 1PFGA 4FSXA 3DMTC 3EEIA 5FA8A 1PJ4A 4ARCA 1BROA 1FPMA 1PQPA 2VJMA 1IEXA 5EJFA 2HWUA 3TMAA 3BHJA 5KVCA 1QCCA 3I5AA 2DSNA 3VPHA 3M1IA 3OJEA 5EJIA 1J0EA 2PM8A 2ZDQA 3AEXA 5C7YA 1UXJA 3BK1A 3SEAA 1L7OA 1GFIA 1AUPA 1ZRMA 3LDGA 1Q1NA 4IDGA 2I8CA 5EMJA 4JGBA 4CODB 3A4IA 3CEHA 3HZZA 3EPLA 4KE6A 3B7WA 3TNYA 1QQTA 4ZVQA 1BQ4A 4NS1A 1L8XA 4H6VA 3KQYA 2VK1A 1OH7A 3CVOA 1Z5GA 4TS3A 4WAUA 1QVWA 1KDYA 2WHQA 1K98A 2TMDA 1UADA 4K0KB 3O8LA 5EWMA 4M36A 2JLCA 1F12A 1QDUA 4Q4CA 5JZSA 5COAA 1NJ8A 2ETXA 3MRTA 3AEUB 3GUZA 4JT8A 1O4WA 4YJDA 4LHSA 1K89A 3ORSA 3TXAA 3VHXA 5JAUA 4C1BA 1NZDA 1QAOA 4BQQA 1QIIA 5JXWA 1DO2A 1E2QA 1ICIA 4DA7A 3KR9A 4CMIA 2V7GA 3I1IA 4DLLA 3CQ9A 2H54A 4L5BA 4RY2A 1EKXA 1GN9A 2AQIA 3G0BA 4J9VA 4YJKA 2HRQA 2IV2X 3KUCA 5JSZA 2CUKA 3NZEA 4Q4AA 5GJWC 4KXXA 5JSFA 3SHOA 4MUAA 1L5OA 2WFZA 2FSVA 3DVSX 3FUCA 1JQEA 3KJIA 1DLJA 1V2HE 1ZGCA 4P58A 2GAJA 1KK0A 4RMGA 4CMJA 3Q9SA 4Q1CA 3A3PA 1PT9A 4OXRA 5KTMA 2IP1A 5TRTA 1F2DA 3WGIA 4FI3F 2HO5A 1DKPA 1NVFA 2JI8A 3W8RA 4E5KA 5SZIA 3PG5A 4MVJG 4GKBA 4KK3A 4GX0A 5LNK6 1Y6QA 3F8SA 2P75A 4I6EA 1XEXA 4YQEA 4B73A 4IMJB 4YCNA 1GR1A 1RWQA 1Z0FA 1C2YA 1AS2A 4PC3A 1YZYA 2I3ZA 4HAWA 3EQ2A 4KO8A 3QUQA 1NUAA 1SCIA 4J1TA 3JWPA 4BRWA 2JZCA 4XCVA 3AX6A 4XUEA 1KSJA 5CK4A 3PEFA 3OQMA 2DQZA 3E0XA 3WLOA 2FOXA 4OKSA 2B1JA 4DPLA 3OZ7A 1NVDA 2BLNA 2YWGA 3WA7A 1Y8ZA 5DH9A 2GMWA 4KYUA 5IJWA 5K0BA 3CVJA 4DCSA 3WGQA 2YHAA 3QHQA 2FW7A 4Q3AA 4UOEA 4Q3LA 5LQSA 3ICQB 3WL4A 4BZXA 4OBEA 3D2LA 2FDXA 3ZDDA 4N8EA 3C2QA 4PICA 4QNNA 3GJ7A 5K4AA 1JQ3A 1YCDA 3TB4A 4M55A 1N7IA 3BWCA 4OL0A 1WHTB 3RS5A 4XWTA 2DFVA 1OD6A 4JI6B 3PZBA 3L77A 2YWJA 2IYSA 4FE3A 3PIRA 4C08A 1GNPA 4K9KA 1UAAA 3LGSA 2PD6A 4D42A 1CNMA 3FDFA 4FT2A 4QPJC 3BWMA 5EINA 5GPBA 3COZA 5KEIA 3VZQA 1K9VF 4YRKA 2PUCA 4GI1A 1JT9A 2X42A 3E58A 1ESDA 4ZCPA 4EBBA 2AEMA 4NZNA 1RKUA 1QF9A 3C1AA 4HWTA 1NQTA 4C4PA 4DJTA 3EGXB 1KYYA 3LL7A 4M6WB 4N41A 1WPXA 5KQGA 1H2BA 2QY6A 2W2MA 4OXQA 3TBHA 1MEEA 3EXFB 3H9JA 3PC6A 4YRJA 2VQEB 1K7XB 2WJVA 4LZLA 3CN7A 4N7JA 4KBYA 4NAVA 1ZNYA 4D0GA 1V3QE 3LG2A 5BOSA 4MA5A 5A62A 2CK3A 2QQEA 2QBYB 4HLCA 1G6OA 1JIVA 2PS3A 4KSBA 5EIHA 3UWOA 3AETA 4ZV4A 4BVGA 4IDFA 3H9UA 5AI6A 1YQEA 3IPAA 4NX2A 4PZUA 1NF8A 1AK9A 2JDID 1E9SA 2O2CA 3BCUA 2QY9A 4Y67A 2I2XB 5ALNA 5DHRA 3RRYA 1HDYA 2EZ9A 2RGDA 1VIDA 2VT2A 3HVIA 1GCIA 3P2YA 4NCAA 5BVHA 4WXMA 4KXQA 4LZWA 5CA0A 2HI0A 3SNKA 3AUKA 1MH9A 1IN6A 2VBFA 5G3YA 5IAKA 2IJGX 1T0IA 5NLLA 5JQGF 2P3LA 1RMYA 2VBGA 5LPNA 3W7BA 1TVMA 4H08A 2WEKA 1SNYA 2O0JA 3G5LA 2UYCA 1BRMA 1W8IA 1Y82A 4YDHB 4YRQA 5BVGB 2MYTA 3ZXIA 1IUNA 2QJTA 2P91A 2ZI6A 1C2TA 3CLHA 3KU1A 1NC3A 2OC9A 5KX5A 3E1KA 3JQPA 4K2AA 1ISGA 1SOAA 5KSZA 4Q3CA 1QGUB 4N3BA 2HB6A 4KL8S 4LJAA 5IKXA 3EWIA 4FLFA 2H5LA 4W8OA 3VNAA 2BFCA 5D5QA 2WWWA 3ESRA 3RE1A 3CRNA 1XLTA 4GOMD 4P0QB 5EXPA 2QRQA 4EGQA 2HN9A 1CDZA 1LPPA 1M2NA 2CBZA 3EIUA 4Q9KA 3ESZA 3M6UA 2VCYA 3HPRA 4Q6BA 5CTAA 1KO8A 1GZDA 1NJ1A 1O6ZA 1VJGA 1YA8A 3K94A 4MYRA 3RK1A 3SKXA 1R9GA 1YVUA 2WMYA 4RUKA 4LTDA 2CMFA 4WVLA 1I0ZA 1XCMA 1E62A 3JQEA 7REQA 3H42B 5AKXA 5DT2A 1LNQA 3ZY5A 5EPOA 2BTEA 3GQBA 2Q5JA 4ER3A 5CM9C 3P96A 1R6BX 4KBFA 2Y4OA 4GSKA 2VUSA 1M2FA 2APJA 4C0SA 3WXBA 3UGJA 1SQFA 1I6WA 3RFFA 2A94A 3FA2A 3G17A 4FOSA 3COJA 2V6FA 1C1DB 3IULA 2BHTA 2EDCA 4G9BA 1OFTA 2JF0A 3T3EA 5HMLA 4YAFA 2AMLA 2D4AA 2GM5A 1J70A 1A2BA 1YZHA 4ER6A 3GLKA 2VTEA 3FYSA 3LK7A 1EFKA 1P2UA 2I7TA 2QL6A 3C24A 3RYFB 1O95A 4UULA 3TQOA 1IBLB 2N46A 4C04A 5T4BA 4ECAA 1J0BA 3DM5A 1PD1A 1THGA 1SC1A 2BMFA 2NSLA 3A4TA 1QZZA 3BB3A 1QP0A 3VU9B 5CJ2A 4C0XA 5HRCA 4M8KA 1SQ5A 2F43B 5FI3A 3SR0A 4ZYXA 3OPMA 4R83A 3ZWCA 3T6KA 3VBCA 2XYQA 1DIBA 4FJ2A 1AMOA 2VSQA 3FF1A 3GFOA 5FBQB 3VR6D 3WWOA 3ZWVA 1J9GA 2BR5A 1O9GA 2R84A 2PT9A 2HDOA 1VLVA 4DUGD 1FX0A 4K6FA 2OB1A 4QUBA 3KOUA 3VSDA 3OOHA 1ACMA 1ST2A 3FNIA 1CY0A 3G82C 3EG9B 3QE2A 3P71T 4MUNA 4C7MA 4JI4B 1MJFA 3AJDA 2R11A 2ACVA 3HY3A 1TM5E 1HLFA 2WV9A 3I1YA 4Y2VA 2VYND 1OLXA 2V5AA 3SG0A 3UICA 3HB0A 1T2NA 2FOLA 3OG9A 4GM1A 2XEDA 4OAPA 4E2XA 3FTNA 4GLFA 4MGZR 3QUSA 4IMPA 5F33A 4DDUA 4H1TA 2DQ4A 3D8HA 3O7MA 3WJ1A 4B5KA 2CLFB 3I12A 3PJRA 3K72B 1Q15A 3DHWC 3JW8A 4AJEA 4TRRA 5AVTA 1UMDB 1DPGA 2V98A 2YXNA 1TZBA 4OGFA 2PMKA 5BQ5A 4F85A 2IIBA 2L0XA 3COYA 3GO4A 3HO8A 3SPXA 5KKCA 3K09A 4HLNA 2EJBA 4PHHA 2ZRIA 1VJTA 1UBKS 3MOSA 5CYPA 3SYRA 4CTJA 1YBVA 1FXUA 1UBFA 2QRKA 3EXAA 3OSUA 4GD3Q 1ICEA 2F8LA 4WFIA 4LF7B 1FQWA 1GG5A 1UDAA 2H2WA 2QG9A 2ZB8A 3N7UA 4P84A 1OX6A 4U9HS 3USCS 4YMTA 5CEJA 1FNMA 4FFBA 4O4IA 5FLKA 5JAHA 2SBTA 4R8SA 2DFPA 2XB2A 4DVGA 2ZYHA 4EHAA 1NNEA 2NP6A 3HWRA 3SFTA 4LNHA 2E4UA 1DX6A 1KEVA 1Q12A 4JC5A 5IXJA 4GAEA 3IC5A 1BE1A 1KO7A 1H4VB 3L7KA 1F8XA 1HG0A 4IXMA 3JQAA 2DEUA 1MW8X 4RMIA 5KKNB 3V46A 2VP2A 3U39A 2HF2A 1Q92A 4U2DA 1OBHA 2QE6A 2ZRGA 4FMCF 4LOKA 3T54A 2YL2A 3O73A 5HX7A 1PFWA 2VP5A 4U7FA 2XKJE 1RYYA 4EZEA 3OLYA 2D7DA 4D79A 1C8VB 3Q8KA 2A88A 1EX9A 1FP7A 3USZA 6REQA 3VM6A 4QXPA 3K6KA 5E2BA 1A98A 3ZU3A 3HGMA 2IPAB 1HE2A 4DY4A 4W1SA 1GCOA 5COQA 3O6VA 3MCUA 2AVNA 4YUWA 2VH2A 4D9NA 1HWYA 3BX1A 3PITA 2FETA 1GA4A 1H6BA 4N01A 1S1MA 2FMIA 1GUYA 1XZAA 2PNJA 3OTGA 1HDXA 1LLFA 2QLBA 2BZ0A 3DOIA 1N2SA 2TECE 4HJXA 4QUDA 3WYFA 3DH0A 4HNTA 1XTTA 2IXDA 2PSHA 5L8VA 4UFPA 2ZRLA 1DAOA 4HLQB 2A5YB 2V7UA 1ZJZA 4YRNA 3QPDA 1NJ5A 2IW3A 1II8A 2QX4A 3GXOA 4RO0A 1AHIA 3CZ9A 4DLSA 2MHCA 2WUFA 4QXOA 4ADSG 1TRKA 2DPLA 3K9FC 5KQLA 4REQB 5F1OA 1BWRA 3IP9A 3REFA 4DLXA 1LBQA 5CYGA 5JTUA 4Z7QB 2HLPA 1U3GA 2DY1A 4TTIA 5D6NA 4YYEA 1CJVC 2FWRA 4G3XA 4RTSA 2VIIA 3HBAA 4H7DA 3H84A 2R6JA 4J91A 4M0CA 4MULA 1G41A 1MA0A 1NM5C 3KJFA 4RYDA 5M7EA 2HMUA 4LPSA 2B8TA 2JH9A 8OHMA 1WTCA 3LYAA 4JLUA 3L8YA 4Y0VA 5A9TA 3ROQA 2ENUA 4D80A 1LDGA 3U56A 2Y1DA 2BFEA 4MOWA 4RESA 4HF7A 4LXGA 1ODJA 4LGVA 4C05A 4YJFB 3O8RA 2I4MA 4LNAA 2E4WA 2X5NA 3C3DA 3OIVA 4FZ5A 1P6UA 1FFYA 1KJZA 3RH0A 3KE8A 3WA6A 4D9HA 3JX9A 1Q22A 1KMCA 4XPIA 1Q0UA 2QNRA 4EZBA 5HKAA 1HNXB 3HJTA 4LOIA 2G1AA 4EM6A 1W49A 3LXXA 4BO4A 4D41A 4FEAA 4B6RA 1T5DX 1NP7A 2VAPA 4UU8A 2FPRA 2GPJA 2KWIA 4QBHA 1CE8B 4Z8YA 5GJCA 4TV8B 1H4QA 5E1DA 4X3OA 2RAPA 1Z0JA 4ZHQB 4E46A 5J4YA 1C3XA 4AJPA 3PC2A 5HZHA 5H4GA 1LY1A 3ILXA 3BM5A 2I6UA 2W7TA 1XCJA 3EFOA 4OM8A 4MRSA 3MGBA 4EPVA 1FQOA 2VNSA 3NM6B 3H3FA 5IZCC 2VOJA 4F97A 1V5FA 3JAKA 3EXIB 3TIIA 1MO2A 4CKXA 3FOBA 3H5AA 2OXCA 5HF6A 2J9XB 4J2HA 4LXIA 3L43A 3EARA 1PAUA 4HQNA 4HAZA 3MTQA 1U63A 3KOWA 4JDPA 2ON6A 2Y1EA 1B00A 4OHUA 2QLNA 3AUXA 4TVBA 1FYVA 1E69A 2E6KA 2Q1WA 3T5MA 5C9ZA 3RRMA 3AM5A 4AUEA 3JRNA 3OUZA 1T15A 3U3XA 5HCNA 5EPUA 1T4DA 1NF3A 4N49A 3RKSA 4B6GA 3I6ZA 2C5HA 3ZLJA 3PUZA 3QHPA 1YDMA 4LXTA 1D09A 2AZMA 2Y2UA 2VHQA 4TWRA 3JR3A 4BNZA 1Q7TA 1NFFA 3HWSA 2VL7A 3H04A 4FGKA 5C1DA 4L7VA 1SCDA 1RNLA 3SMQA 1UBGA 4BNMA 5KNCH 4RAQA 4HVCA 3FJYA 5HCUA 2V0CA 5L4SA 1U28A 2IV3A 3WAGA 1E3MA 4F2GA 3CURA 1W5BA 1RQXA 1S4QA 4ZCQA 5E7QA 5CW1A 3RS4A 1L5HA 1IDOA 4EKEA 4KXNA 3MCWA 1KI7A 3KB2A 1WZNA 3A1CA 3KKQA 4LMRA 1EFPA 3HKBB 4FYHA 3PUYA 2FQWA 1NP6A 2I91A 2R00A 2F9MA 4CTOA 4C9BA 3L7MA 3O3OB 3QEOA 1FFEA 4EPWA 4NE9A 2P62A 1GYPA 3AIKA 4EATA 3IUYA 4R01A 4ZYVA 1KI8A 1O94D 1AMUA 4LFBB 1Q3TA 1WXGA 2JFBA 1CUSA 2FJ0A 3OQIB 2J6CA 2W98A 1Y7TA 2C1ZA 2O06A 1NSFA 5IWAB 1RT9A 3EAGA 2CHUA 3DSRA 5F9FA 3ADCA 4HWSA 1DXYA 1T5IA 3WMRA 2PKXA 3AG6A 4NICA 4C87A 1KRXA 1SK9A 2QLFA 5CIQA 3CR3C 1XUOA 4LE0A 3QX7A 1UM9A 2QS9A 5JS1A 4EB3A 3C1OA 1KMQA 2OV2A 3LFUA 1DV2A 1Z7BA 1VKZA 2O20A 1CQJA 1MP0A 1JMVA 1HDRA 2L2QA 2XOKD 4MAFA 4O2AA 1M76A 3BL8A 3DZFA 3ENWA 3JVIA 4PSCA 3U44A 3AFIA 5ALRA 5CJPA 3GZJA 2X9GA 5F4ZA 4CG0A 4KR7A 1YRBA 3V1UA 3O2NA 4H3KB 3YASA 1IIBA 4N0MA 3H5IA 4YRLA 3R0JA 5FBHA 3SFVA 3CLRD 3JATA 4EJSA 3ZY4A 5CXQA 1UBSB 3S7TA 3LX4A 1K66A 3M6VA 4GP7A 1B0UA 1PLKA 1YHYA 3IVCA 4WGFA 3T35A 5LQKA 3QPVA 4CWAA 5ICEA 2CFIA 1ZCJA 2JD2A 4IUCS 1KYVA 1LU9A 2YOGA 2Z43A 1JAZA 3UJ9A 3RRFA 1XRPA 2HQSA 3TIXB 2NZVG 1T9GR 4DIMA 2O8BA 4LF6B 3TH5A 2YBDA 2AMFA 2ZB7A 3EQ8A 2NUPB 4OSOA 5GY7A 2FNAA 3VO1A 3EDCA 5JD3A 4UHHA 4RVFA 3ZDXB 4MDEA 5C7LO 1IMJA 4RLHA 3RVQA 4L22A 2H48A 1Z39A 1MPXA 4EB0A 4LDNA 5HS6A 3H4VA 1E3SA 5DLYA 1I14A 1NKTA 2AV6A 5E0KB 1C9JA 1COZA 4QYIA 2FEXA 2E7ZA 1EFHA 2Q4EA 5DISB 1G5PA 1KZ7B 2PWYA 4ND1A 3HM9A 4UREA 4YMGA 5I51A 1L4BA 3U4CA 1QS0B 1HZJA 4DDHA 1SOUA 4C7KA 3TKLA 1PKEA 3DYBA 1YVPA 4PONA 4DNQA 4WJLA 4E7OA 1GDTA 3Q85A 4G4JA 4KDCA 1OAAA 4K9RA 3K0CC 2ADOA 3E27A 1NVAA 1KOLA 1B41A 3BT7A 2WJAA 2VT6A 4Q9DA 4DCTA 4PX3A 4X3PA 1L7DA 4JB8A 5KYYA 3ZDQA 1B6RA 1I9CA 3PF8A 3ZXXA 3H5WA 4DV4B 4X60A 2J09A 4L4RA 3HYNA 4M0LA 3D8UA 5IX8A 3HB5X 4U7HA 4ZT4A 2PLRA 3TB6A 4L4SA 3ZHSA 3IT2A 3KR0A 1XE3A 3AP3A 3AV0B 4WCFB 1V7PC 2AN9A 2JG3A 4QDZA 2IZOA 4L08A 1E6EA 2CC2A 2C94A 2E4XA 3LX8A 2X8WA 3QWFA 4IHJB 4XSVA 5G0TA 4P7BA 3Q6MA 1N8NA 1PR4A 1CUEA 4I1YA 1VSVA 2Q2QA 4MICA 4JOSA 4CM5A 5JD5A 2DVMA 1CR4A 3OA0A 5DK6A 1K92A 2K6GA 3RNOA 2CL6X 4CM7A 3V1TC 3LIPA 5A4AA 1GDDA 2R7MA 3R3ZA 3C8DA 5EC8A 1GTZA 2RB4A 1JDUA 1WNTA 5IRCD 3KT3A 3THWB 3RG2A 2J3IA 1YRHA 3SK0A 3WOVA 2Z1MA 1D6JA 1KP2A 4I81A 1H8EA 1VE7A 4TSKA 2JKZA 3CR7A 4X0EA 5ELLA 1RYFA 5EKXA 3W5UA 3W05A 1SKAA 2JD1A 4KQ1A 3X1ZA 1BDIA 2JGEA 5EMMA 1BDBA 1HL7A 4DEXA 1T5LA 2P1RA 5HGJA 1KQOA 3M33A 3ZU6A 2GERA 1LRLA 1ISPA 1YRQA 2IHKA 1GZSA 2OCKA 2PWZA 3IUSA 1DEXA 1DOZA 3PQ8A 4KVAA 1KAGA 3MMPA 1CZKA 2OXEA 3C85A 3LBAA 3L7DA 5JCJA 1O6FA 3SC4A 4BLQA 4EENA 4F72A 2JKYA 1C8LA 2D8MA 4PQGA 4BKOA 4KR9A 5C1OA 2GOYA 1UKZA 2DKNA 1XEFA 3GFPA 2PUEA 2Q1UA 4MJXA 1Z83A 3DBLB 3AHEA 3C3MA 5LYYA 4FZRA 3OZTA 1VP9A 2QPLA 4GRAA 5HUHA 2DQKA 1F8FA 4RPCA 2MYNA 3R7NA 3DOJA 2FZKA 2O5EA 2PZFA 3PE3A 1YR7A 2ESRA 1N7GA 1WLSA 3W0LB 3Q41A 1N9GA 4C0JA 4Q47A 5JNRA 3DMRA 4RULA 3OEEA 4YRDA 3CF4G 4DB2A 4GZLA 4K6MA 2CYBA 2OORC 4DTIA 2QAGC 5FOVA 2CJFA 2IBTA 4TL6A 4Y2JA 5HXAA 2WD8A 3NHKA 2JFZA 1RR6A 1O5TA 5THXA 4J0FA 3L0YA 1A4XA 4ZVLA 3ZBUA 4GOJA 1AZWA 4U8GA 4CKCA 1V8DA 1E1NA 3L02A 5LZ2A 5FPKA 1RYDA 4PQRA 1XCLA 2F7SA 3T3MB 1Z5VA 2EJWA 1VRVA 2BCEA 3E7DA 1RXVA 1L7NA 5SV2A 1OW3B 2OQIA 4JYAB 2R4UA 4RCZA 1W6RA 3D4BA 1MO3A 5LYJF 1OIXA 2W6JA 3IDSA 2Y93A 4YI5A 5ALOA 1Y9JA 3TW0A 4WNAB 5EIBD 3B12A 3ED1A 3MJEA 3PNMA 3K0SA 3H2HA 1NYTA 3GIWA 3BTUA 4HUQB 1T5SA 2DH6A 2PV7A 2RHHA 3H9EO 1W581 2PTGA 4G8BA 1CIPA 3P9QA 1I4LD 3UFBA 4NK4A 3F3SA 4JSYA 3EISA 3BMXA 1DTWB 1R74A 1VIYA 2G71A 1P2VA 3PWTA 3KUDA 4KMOA 2WICA 3WNQA 5EFOA 4OIFA 4MI3A 1WUJS 4GQIA 3HCCA 2R7KA 1KXZA 1L5RA 1FY2A 2GHTA 3FNGA 1X87A 5ED4A 2IOQA 3EY4A 2JCGA 4BO6A 5A5GA 4NNPA 5EWLB 1CJKC 1VBNA 3P0EA 3PNVA 3SXUB 5BXYA 4PFQA 2E9SA 3WC4A 4DV1B 1QBGA 1YZQA 1Z63A 4WEQA 4EG4A 1SAYA 4R0NA 4IIXA 4LTMA 2HRRA 3C74A 3EDOA 5AUPB 3ZV4A 1FE8A 5BV0A 1XB2A 1WB5A 1G5TA 2HBYA 3F1KA 3HABA 2Q4OA 1JQLB 3A9WA 4HNGA 4G0ZA 4I1RA 3GLVA 5FBWB 2RHTA 1YI0A 3NBUA 3LY5A 5JZOA 1KQGA 1V35A 2FY8A 2WWVD 2FX2A 1Z38A 1ZRHA 2EJVA 2GK4A 1Z28A 4XLZA 3QELA 3VPFA 3MTGA 2K7FA 3ZDCA 4I99A 2GN6A 5DOVA 1SUDA 3RC8A 1KAQA 2PVPA 2EQAA 4CQJA 4GIBA 3L1JA 2DBRA 3ZGOA 2XCSB 5AKEA 3T1VA 1GTL1 2Q2OA 1BCSB 4E1VA 4FEGA 2H0RA 2JAWA 2DG2A 1GITA 1HSOA 3P2JA 3H5VA 4ERXA 1SOMA 2Y1WA 2Z2KA 1ZH0A 5ALGA 3CH6A 5KPJA 1QAMA 4ML3A 3RJ5A 1PZFA 1X70A 1T4BA 3KTFA 1V8ZA 2ORIA 3LUFA 2ABWA 4R2JA 1DRWA 3UPTA 2FRDA 2PUFA 4IH4A 4E1BA 2G8NA 3A4VA 5FKJA 1VA4A 3WGLA 4WLEA 1EX1A 2FW0A 3AF5A 3B7PA 2A1TR 2XWBF 1DQPA 3CT4A 4IPTA 4I55F 1L1QA 2NT3A 3ZDEA 2Z58A 5T5QA 2GYYA 4GOKA 4D46A 4BUJA 5KSYA 2C0QA 2WI8A 2PUVA 2IKSA 3PXDA 1SQ0A 3VPBA 4S2UA 3RUEA 3LP5A 2B34A 4Y1RA 1T9KA 1VM6A 2JGIA 1DC5A 4MB6A 3JWIA 5C8YF 1LPMA 2ZUWA 3OZRA 4FONA 4FYJA 3UFXA 4G0MA 3WB2A 2C5GA 2XF2A 1VMEA 3KXIA 1GL7A 1WXXA 3CRRA 5EXTA 4BBPA 5JRDS 5REQB 5I4KA 4DJ5X 1M1NB 5CLQA 3OE5A 3OQHA 2AI2A 3EDMA 1D2RA 2G9QA 4J0HA 9GPBA 1TCBA 1TZKA 4FUQA 1DCFA 1M34B 5KYVA 5CH3A 5GONB 1IIRA 2FDRA 3PSHA 5CD9A 1NXWA 4C7OA 1P75A 1RAIA 4GPAA 4R1PA 4D4HA 2FZ5A 4FYVA 1GPAA 4I3GA 4WZZA 3GU3A 3BWXA 3IR6A 3VJLA 3DONA 1GKKA 2WD7A 1VYTA 3C70A 1K6EA 4J0KA 3C4QA 1H6AA 4GR5A 2W6CX 4TKMA 5FPPA 4DR2B 1VLJA 3BHNA 3U13A 3HDQA 2G72A 3AR5A 2O2EA 1NDHA 2Q3BA 1P7VA 2CJWB 2FLVA 2OPBA 1AGXA 3MJTA 4BX2A 5KDDA 2IIVA 4TQAA 4NENA 2A57A 4QUGA 4K86A 4MR8A 4KGZA 4HB3A 1E2UA 1QV6A 3TVDA 1KY2A 1U0LA 4RVGA 3CX8A 1Y4DE 4FNAA 4GPEA 4LJLA 4NARA 4EKDA 1J7KA 4S2EA 1XQYA 5KTKA 1D5CA 1I2CA 1L3BA 1DC8A 1R8XA 1RI3A 1K7CA 3LPDA 2HCJB 3GWGA 3JVUA 3MCVA 4BV2A 5KYWB 1KSHA 4UMDA 5KS2A 2GBPA 4OKIA 5EQDA 3EB9A 2J0VA 3HLTA 5BSHA 1GVHA 3R0VA 2C8LA 1U1GA 1K5GA 2G3YA 1HNWB 4I9GA 5HJEA 3WL3A 1GRCA 2PLFA 5HVNA 4YECA 1SA0A 3VH4A 1Y8QA 5TPWB 3O74A 4ZI7B 3CPJB 3FKSD 4Z3DA 7MHTA 4BBJA 3GOHA 1RRFA 1XNJA 1IEQA 1KH2A 4HB0A 1V4NA 4RX1A 5K99A 2ZJZA 3AWDA 3G2QA 4MRAA 1VDMA 2UZAA 2W4MA 3RKUA 4ZDJA 2NV6A 3HNPA 1SGWA 4KDFA 2ZWOA 2R8OA 4G4IA 1VL5A 1KVTA 3IE2A 4G5GA 1QO7A 3EZYA 3PFFA 3PJFA 5HE9A 3THYB 5I8PA 1N25A 1ZM2A 4MCIA 2D2EA 3M2TA 1G4HA 1T4GA 1Z45A 1USWA 1XU7A 2R6AA 2VJYA 2X4IA 1R5BA 3NIDB 3EVNA 3I04A 4H1HA 3R76A 4CEIA 5JI2E 1C0EA 3KLNA 4PTLA 1JHXA 1M8PA 5TQ2A 2GYVA 2PFGA 3SJAA 5C53B 1FFCA 1XZQA 5JAIA 2OM6A 2VZLA 1DQYA 2OV3A 1P1FA 3V4ZA 4ZTBA 2OSBA 2H16A 1MNAA 2JGDB 3R24A 3X1MA 2X3UA 1XJWA 1Z4QA 3KSUA 3M9LA 3NM4A 4KN6A 1NNLA 5FBKA 2HXGA 3UO8B 5JZVA 3RNLA 1N5OX 3IAEA 3R6TA 4MIKA 2AF4C 2WUEA 4QYTA 1L9XA 1TA4A 4NBVA 2V7TA 4HVLA 3IEVA 2ZPUA 1JEYA 3PENA 5KJ1A 1XWWA 1JQ5A 3OWOA 4G25A 2XDYA 4HDMB 3RSGA 1EUDB 1ZCFA 2IZ5A 1REQA 5CVCA 1V9CA 1FSGA 1TA0A 1JDVA 3CZQA 4CLHA 4N7RA 4CGZA 3VNQA 2UVQA 3G8DA 4PG5A 4P92A 2Q2NA 4RQAA 4R84A 1DQSA 3DZDA 3LL4A 1WSWA 5JSYA 5GADl 2C54A 1OXKB 1JSRA 1TIPA 1Z06A 2QG4A 1I6LA 2Q9AA 3CY6A 4GRIA 4J75A 1U8YA 3ED5A 4JB3A 2AC7A 1ENPA 4LJRA 2IU4A 3EIWA 4BVHA 3GLHA 4MW1A 1UFVA 4YAUA 4B4WA 3KVNA 3PDHA 1UPBA 2GASA 2AEEA 2J3KA 2P7IA 4I5IA 1NBME 1Q84A 2WIAA 3OLCX 2QTZA 1BTOA 1P73A 4DABA 4HDSB 4Y1FA 5AVWA 4YCJA 2D2VA 2PWAA 3BPSA 3PI7A 3TTVA 2JLSA 4YVFA 2LDXA 1CNFA 3BIXA 3SC2A 3WDMA 1W36C 1JR3E 3GJ3A 3Q2KA 4H0FA 1NY6A 1JSXA 3QNUA 3I8XA 1BNCA 4E2WA 5K8JB 2AG5A 3GJ0A 3GMTA 5KTYA 1UIRA 3IPCA 3F0TA 5JYDA 1E2MA 2WUGA 3W2HA 2QN9A 3UPUA 4ZMBA 2JIRA 3ZGXA 2WDZA 4RDIA 1MU0A 2VN8A 4UTZA 4YIKA 3WK7A 2YHUA 4EHFA 2ZRPA 3BDAA 1NZJA 4ZVKA 3KXKA 4MPJA 3H8VA 3N2GA 3COWA 4EKNB 1Y6FA 1NQUA 1E4EA 3PHHA 4C4OA 1SD5A 3G68A 4OHRA 4NC9A 3G0GA 4JI3B 3FMFA 2P0AA 3E5RA 3WLNA 1Q0TA 3VR5H 2OGWA 5J5CA 1Q3HA 2QT9A 3WIDA 5B1SA 1WZUA 3TJZA 1DJLA 1G8YA 2ZJ2A 1ORRA 3OOJA 4EK9A 2BDEA 3FDJA 3IKLA 1RBYA 4Z0TA 4HQFA 5AVJA 4NCXA 1G55A 3U4HA 3PKJA 5K0ZA 3D4NA 4WOJA 3HDTA 3SE0A 4QPCA 1L4GA 1N5IA 4WKNA 1FRQA 3ERCA 4K6OA 1MEJA 4BLTA 2ZKIA 2W0MA 1Z5OA 2DJ5A 4TVOA 1Y42X 2QX7A 4I4TB 3TRHA 5JDIC 4BQIA 1NI3A 2JVKA 3D3WB 4FFMA 4M8LA 5COBA 4ENRA 5BSWA 3LCRA 3CGWA 4MVXA 1GGKA 4ZANA 3IL2A 4FMDF 1BKYA 1ZC4A 4KQXA 1GG2A 4RGBA 7ADHA 3C6QA 2ANCA 1QHYA 2I29A 3DPUA 2QVXX 1IB6A 3KTAB 3OHPA 2RH5A 2ZW9A 1TPZA 5D00A 3ZGLA 3HBJA 4CVNA 3NI2A 3LUGA 1M6WA 4DV2B 2VAMA 3GEHA 5J43A 1X7WB 1MO4A 1FP4B 2HJSA 3FHOA 4L6CA 2R1VB 4PHTA 2R2GA 3IIKA 3IODA 4J9UE 5B1HA 2RGNA 4B2PA 1MORA 4BDTA 3W3AH 1BXKA 4KAJA 1KMHB 4N3CA 4KC0A 4RU1A 5B6PA 5KNBA 4KGXA 2ZRAA 1WVIA 4ZK2A 1SXPA 2BBSA 2JJ1A 4ZCTA 5F5NA 5ABPA 1P4RA 5FA6A 4YACA 5GJVC 1CS0A 3UMMA 2H1CA 2C3UA 4MP8A 3BEDA 2BKEA 1Y1SA 2Y9PB 3EIFA 1S2DA 4D4KA 3OZXA 4S3MA 3DAOA 5HIIA 1XD9A 3V3KA 1N2XA 5H16A 5IJ9A 1VB5A 3LT4A 1VKHA 1C9EA 4A8TA 3KOXA 1VXOA 1D0SA 3VZSA 5K8VA 2J46A 3DQZA 3IMKA 4QGHA 5DTQA 4ZQIA 4F46A 3GT4A 2P8JA 4PHFA 4QO7A 4E2ZA 3GZNA 4IJMA 1GKUB 2AFVA 2XXAB 1UT8A 3H65A 3MLAA 4JKYA 1DEAA 1SXJD 1U0NA 1IK6A 1HTWA 1TMKA 1UBEA 1RXYA 3MNFA 5KNDA 2NUTB 3KJHA 3OMLA 1ZJ5A 4PYLA 5DB4A 3WBFA 3DQQA 4ZFNA 1BKDR 2V6MA 4P4UA 1QK3A 3FUWA 2NXNA 1QHXA 4Y1GA 5KOJA 2ZJ1A 3OIYA 1HOXA 3C5EA 4I5EA 1JJVA 1M6HA 5JJCA 2YH2A 2RB5A 3DZJA 1WSDA 4MTCA 5DGCA 4X63A 3F7MA 3E9RA 4IIBA 1JG4A 2ECKA 5C5IA 4ND5A 4IQFA 3V7UA 2WAYA 3OEWA 2AWOA 5HQ3B 5BW6B 4JIGA 2ZRMA 4CM4A 1YXMA 2WUDA 2NYVA 3Q4GA 4JT9A 5BW8A 3GLIB 5CBPB 4OMCA 1N2IA 3RUPA 4QIHA 4XCQA 2FJPA 5CIWA 5DYIA 3EVGA 4XIIA 1RWVA 1XAHA 4Y9UA 4NV1A 2WD9A 5ALUA 3IBTA 4KFSA 2QZ4A 4IUBS 4M3NA 5HIMA 3ZH2A 3TZCA 4LCBA 2YJGA 5H9WA 1R50A 1WF3A 2F2TA 3IJEB 1FTQA 4ZEMA 3X2EA 1QLHA 4QM7A 5DP2A 1JVBA 1XAGA 4J7AA 4F6RA 3RYIB 2H9YA 1T3LA 2YNMA 3K9BA 4WBNB 3QXHA 2CBXA 3H1BA 3L8DA 4YPFA 1NG1A 4FILA 4H77A 5C1PA 5KTOA 1NNSA 3W5CA 3DO6A 3W5BA 5K3AA 3VO9A 4XVCA 5JOQA 1YVDA 3CH5A 3P9KA 2ZU0C 2VQ3A 3VR3A 4HT3B 1NAHA 4AVYA 4C7BA 4YMLA 1JQJC 2E37A 1R8SA 2JCSA 4E5UA 2XNSA 5L3ZA 3N75A 2Z9DA 3ZNNA 3RF7A 5L3SA 1U7OA 2WTAA 2A67A 5BMOA 2CT8A 3KJQA 3OFSA 1UC5B 5IYZA 2EX1A 2OFOA 4F2HA 5ADVA 3VPCA 1BW9A 2A30A 4GL4A 4HLUC 2KW5A 4ZQCB 5K0FA 2CKDA 3PT9A 1TKBA 1LI4A 2VHJA 4AT1A 3KVVA 3HE3A 5DIFA 3TF5A 4AWXA 2FSIA 1I3LA 2WINI 3SX0A 4ITUA 1OY1A 3CNEA 2I6QA 4DC0A 1E2HA 1MV5A 1QCYA 2KX7A 3O8OA 4ER0A 5CVJA 1C3JA 4YDQA 3R23A 5KNLA 5IFKA 2ZAYA 3HFJA 3W6UA 4YUYA 4P7FA 4YRPA 1J2TA 1W5AA 2H63A 1U2RA 4KXVA 3RT1A 3QU9A 3GPCA 3AKZA 3RCBA 3UK6A 1B76A 2QW1A 1PYDA 4PZ0A 2HA4A 1DBIA 1DRVA 2RCNA 3UWKA 2HMAA 3PUVA 2ID8A 4RZXA 5HNKA 4E94A 3ILSA 2Z95A 1JZTA 4EQZA 1L2TA 3CW9A 3A6PC 2IH2A 4Z51A 1GG9A 3L4EA 2I78A 3FY4A 4L0DA 4JL6A 1KERA 4GOOD 3GI1A 1RWMA 4GI7A 3G7UA 5IKEA 3HA2A 4Q05A 2VXCA 4FXOA 4GOLD 4Q1FA 3TOXA 2VDQB 3C7AA 2F90A 3CXRA 1UCFA 2A9JA 1HQYE 1RPAA 3GD7A 1VJ0A 3BGVA 3EUFA 1D2AA 1OYWA 2VP6A 3V9PA 2YJ3A 3VKHA 1GCGA 2GQ0A 2FSGA 4GBGA 2HJ9A 3R0QA 1KBQA 3FTEA 1C4WA 4JEHA 1Q2UA 1G3IA 1TIKA 3GGPA 1U3UA 3HWWA 1A72A 2IITA 3RGWS 2H2IA 4GL2A 3VZDA 1M8FA 2Q9CA 5HKLA 1YNSA 3CFYA 4PYRA 4J7UA 3Q7EA 1F6WA 1QHSA 2F8MA 5JBNA 2H31A 4QDUA 2NVBA 3RRJA 2DBZA 2PMDA 2GH1A 1P4GA 3W6ZA 4PXAA 1UBNA 3X2SA 1UDXA 2B0CA 1JHYA 3IDAA 3NHRA 4HXEB 1XQ9A 4NJOA 2XYHA 4AICA 1DT3A 3L0CA 1WQ1R 3FB1A 1CRQA 3AEZA 1AK1A 4QYSA 5CCXA 2L82A 5CAEA 2O6LA 3KWMA 3T5TA 5BNTA 1OI4A 4QAJA 1E66A 5GV7A 1X7GA 5CFRA 2YQ5A 3CLUC 1RQPA 1YL7A 4U2FA 2BFDA 3TLKA 1S8OA 4RK1A 5KTRA 3OZCA 1JG6A 1N57A 1B0PA 2B82A 3PNOA 1P1IA 3HNOA 3JVDA 4L5YA 3AR2A 3JQ8B 4JEIA 4L57A 4LXXA 3AKCA 4YUXA 1VECA 3LUJA 4URHA 5KKAA 4F2DA 1DZ3A 2IOFA 5KVQA 3ZE6A 4BN0A 1VG8A 4YDSA 1JXMA 3GGCA 4KR2A 4PF1A 1ZD5A 4EW2A 1K63A 2QIOA 3PR2B 4N5LA 5AMXA 1XQ1A 4R8LA 3A4YA 3TG2A 2YJ4A 1ZGAA 3PQEA 4PSDA 4CT0A 5CLJA 2QRLA 3J81k 3A32A 3FVRA 4CTKA 3JD3A 3AR9A 3PQ5A 3NW9A 1W30A 1R0BA 2GZHA 1DWOA 4E5DA 5K6RA 1E0AA 1CNEA 5E1BA 2A33A 3FHJA 4V2IA 2GVNA 3CVVA 2G7MC 2GWRA 4AWAA 4BLOA 1AVTA 5GV8A 3G2MA 3HU2A 4JZYA 2Z8YA 3G3EA 4HGQA 3MWEB 4Q48A 4CN9A 4NQRA 5BSKA 3LC1O 5A2QA 7ABPA 3TEFA 2ZIFA 2JCVA 2ZE7A 4NESA 4RPKA 1U0OC 4LY6A 4FBLA 2VUIB 4NZOA 3BEOA 3F5DA 1GZHB 1HE3A 3U80A 1Z56C 1OTHA 3FYHA 1IN5A 3G9XA 4MUIA 3ZKWB 4EI7A 4BQRA 3IGFA 1IXRC 1HRKA 1U0FA 4LVOA 3MPOA 4V03A 5F7OA 1OFUA 5H1YA 3KBBA 5L40A 3QKRA 4Q7JB 2X9NA 3AR6A 3DAYA