1MXFA

Crystal structure of inhibitor complex of putative pteridine reductase 2 (ptr2) from trypanosoma cruzi
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
266
structure length
247
Chain Sequence
CPAAVITGGARRIGHSIAVRLHQQGFRVVVHYRHSEGAAQRLVAELNAARAGSAVLCKGDLSLSSSLLDCCEDIIDCSFRAFGRCDVLVNNASAYYPTPLLPKPIDAQVAELFGSNAVAPLFLIRAFARRQNLSVVNLCDAMTDLPLPGFCVYTMAKHALGGLTRAAALELAPRHIRVNAVAPGLSLLPPAMPQETQEEYRRKVPLGQSEASAAQIADAIAFLVSKDAGYITGTTLKVDGGLILARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 2
publication title Crystal structure of Trypanosoma cruzi pteridine reductase 2 in complex with a substrate and an inhibitor.
pubmed doi rcsb
source organism Trypanosoma cruzi
total genus 86
structure length 247
sequence length 266
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1mxfA00
1E3IA 3BXXA 3DHYA 3KB6A 4RLHA 4GKVA 5CG2A 1EVIA 1F17A 3GAFA 1UZNA 3TFQA 5CDUA 3OICA 3U09A 4WNIA 1GYPA 3GPIA 1Q2XA 3ORFA 5G4KB 1B8UA 1NR1A 3EVTA 3G1UA 1Y8RA 1EE9A 4BVAA 3NTRA 4LISA 2E4AA 1IULA 3H2ZA 3I3OA 1P1JA 4I8XA 1BWSA 2YHIA 1T24A 2YV1A 2E49A 3DXFA 1PZEA 4CV2A 4UVIA 1QYCA 3HJAA 1XQ1A 3KBOA 1GUFA 1Z7BA 1A4IA 4W4TA 3ABIA 3ENKA 3VDRA 4PRKA 1T25A 5FI5A 4WEOA 3ANMA 1ONPA 3U4HA 3C8MA 3WFIA 3LZ6A 1NM5A 1HYEA 5BSFA 4A26A 3PFFA 1M2WA 1ZK2A 3GT0A 1WDKA 2IODA 1JKFA 2BELA 3T4XA 1PJ4A 2PTGA 4FJ2A 2GZ3A 4MVJA 3T7CA 3WBBA 2Q4BA 2CDAA 2D5CA 3H5AA 3WQRA 1EFLA 1OC2A 4OJNA 3DMYA 3VPSA 1D7OA 2AQIA 1JVSA 3NTQA 4I5FA 5FF9A 4CM5A 4EI2A 1VC2A 5L95A 3UH1A 4U6QA 1R4NA 1ISFA 3GHYA 1ZUD1 2O3SA 4D44A 3BTUA 3LQFA 4I5GA 2W4QA 4BO2A 3JTMA 1Q0LA 4AJLA 1Z74A 4WPGA 3VPHA 4LRTB 3W4KA 3WOHA 3GG2A 3EY4A 3JYNA 3VKUA 2Y05A 2A94A 2P9GA 3KSUA 3S1LA 4XYGA 1YJ8A 1NWCA 3NRCA 3WYBA 1U3UA 4CMAA 4CM4A 2ZYAA 3NDJA 3CH6A 4FN4A 3VPFA 1NXQA 4RF5A 1M6HA 1MB4A 3K30A 1W6UA 1DO8A 3ZWBA 3F3SA 4I9HA 3F1LA 4O6VA 1DJQA 5KVQA 1U3TA 2B4RO 4RF3A 3VH2A 1HEUA 4BL5A 1GUYA 2HQ1A 2TMDA 5COQA 2V6MA 2QYTA 5DOZA 1AE1A 4BNTA 3HQ4O 3ONFA 3P7MA 2WD7A 5EIOA 3EYWA 3DBVO 3FBGA 4Y6PA 2R00A 3H65A 3UHAA 1J4AA 2IE0A 5GMOA 4YT4A 5AVOA 4J2OA 1B15A 2D3TA 4NU6A 5BQFA 3PYLA 4YDRA 1ZK3A 1D3AA 1CIVA 5TRTA 1ENOA 2NADA 3U4CA 1MXFA 1E6EA 4EITA 5L7WA 3UW3A 2ZJ0A 4F3YA 1YOVB 1U3WA 4R4JA 5B4UA 1UXIA 1DFHA 1I3LA 4TZKA 4XYEA 4M89A 3R6DA 1VKNA 4N7RA 4XR4A 3FWZA 4BNYA 2DAPA 2CNBA 2OUIA 1IHYA 4MP6A 4CMEA 1XKQA 3OEWA 2FP4A 5KJEA 4D41A 3L9WA 5AXAA 2Y0CA 3VHRA 1P3DA 1Y9AA 3BIOA 3ZZNA 3AI2A 4QTZA 4CMKA 5EQDA 5I9MA 2FPIA 2X5KO 2JKVA 1ADFA 2W2KA 4DUPA 1PGOA 3VKVA 1Y7TA 1HYGA 5ILOA 2EHDA 4XYMA 4YJFA 1ZJYA 3BMCB 1CETA 1MFPA 1YL6A 1E1NA 4Z6KA 4DYVA 4HY3A 3JQAD 4RF4A 3D64A 3HDHA 1Y8QB 5C3MA 2E37A 2D4AA 1T2DA 2JJYA 3G79A 2PD3A 1GYQA 4BKOA 4DC1A 4A10A 5ADHA 1VRWA 1DDOA 1KY5A 3K6JA 3RUDA 3RKRA 1IOLA 2J3JA 2YUTA 3H7AA 1YB5A 4XGNA 1PGNA 3HSKA 5I9NA 4WLUA 1NP3A 2WMDA 3EGOA 3PQFA 3E8XA 2Q1UA 4IQ0A 4PZEA 2QIOA 1G6KA 1DBVO 2VRBA 3INGA 4DRYA 4S1VA 2FPGA 5EJ2A 3WMXA 3ZW8A 1A27A 1XSEA 1P74A 2EG9A 3C1TA 4Q3EA 2C7VA 4TZTA 4OM8A 1KBZA 2EERA 4BGEA 2FSSA 4UEJA 4GL4A 4Z3DA 4E5NA 1DLIA 1SPXA 2OL4A 4BO0A 1R15A 2X0NA 5ICMA 4YQYA 1HE3A 2HUNA 4FOSA 2PGLA 4CLDA 4XQGA 5A9RA 4PLZA 4OXNA 1DXYA 4YT8A 2BHLA 3KOUA 3D1LA 2WM3A 4HP8A 3QVXA 4M1QA 4R9SA 8ADHA 5JW6A 3GEDA 1IZ9A 1FF9A 4AFNA 5KJ6A 4IINA 3TZ6A 2Y1OA 2IZZA 4ALLA 3GN2A 1FDVA 4IUYA 1E6WA 4PN3A 4EYEA 4ZICA 1HSOA 3GH3A 3RFVA 1TLTA 1WNTA 4IPTA 4P4LA 5CPFA 1ULUA 2B83A 3WFJA 4Q3NA 4WLOA 5L4LA 5G0TA 1PJ2A 2I67A 4EUHA 5JAMA 3C7AA 3T4EA 5JY6A 4E5PA 4OH1A 3SLKA 1UAYA 1P1RA 5TQVA 3ZWOA 3PZBA 2VYNA 4WCFC 4XQCA 1DC5A 1LBEA 1QSGA 1RPNA 1GQQA 3HDYA 3A14A 2Q3EA 1KC1A 1BHSA 4ESOA 2OO5A 3UKOA 4MIEA 4WCFB 1C3VA 2HJSA 3NKLA 1NTOA 3AFNA 4E2WA 1PGPA 3RBZA 3H9EO 4JJFA 4BGUA 1U1IA 1ZMTA 3OEYA 3L9XA 1RJWA 3Q3CA 5C37A 5KJ1A 3M1AA 3IJRA 5T67A 2PKRA 3U4DA 4XKJA 4WLFA 2CDCA 1IHXA 3WG9A 3ZHBA 1JVBA 2WSBA 3BMCA 3BTSA 3QWHA 1PR9A 5JMWA 1H94A 4IQGA 4J4TA 4GGPA 1MG0A 2JCXA 3HZZA 1A9ZA 1H2HA 1UXJA 2GF2A 2GZ2A 2VNSA 3WNQA 3GVCA 5HM8A 1I8TA 4FS3A 1LSSA 2Z95A 5CEJA 1U2DA 2X0JA 1UP7A 2D1YA 4A5OA 4WASA 3LT4A 2WYUA 3AWDA 4OAQA 4U0KA 5JDCA 3AY3A 2ZCVA 1P9LA 2CF6A 5DBIA 5DDIP 2HK7A 3DBRA 1H9AA 4NR0A 3GGOA 5JYDA 2PR2A 2Y1GA 2PV7A 1I2ZA 1HDYA 1MLDA 1NQAO 1EUDA 1HDXA 1Y5RA 1HZZA 2DQ4A 3JD0A 4JIGA 3JD4A 3QVTA 1ISIA 1J49A 3IKVA 2V7PA 5FI3A 4PZDA 1PZHA 5LDGA 4DVJA 4NBWA 5I8ZA 4E3ZA 2O3TA 2EF1A 4XEHA 2PZMA 4DQXA 1CJCA 5TT0A 4FC7A 1NVGA 4II2A 1ISJA 4O5OA 1WW8A 4OSPA 2VYVA 4W7HA 3ZWCA 1UXHA 4IXTA 2B4QA 2BKAA 1V3TA 4RCVA 1E1KA 1QLHA 3AI1A 2NU8A 3AUSA 3JQAA 3QIVA 2YZ7A 2NACA 2GERA 1YL7A 2AEJA 3DWFA 2VZ8A 2DLDA 1IB6A 4UVGA 1ONNA 2YHUA 4BNUA 5IZCC 3ANNA 5CPBA 3JQFA 1C0PA 4JNKA 1O8CA 2EKQA 1IE3A 2FHSA 1HE5A 1NR7A 4XA8A 4MDHA 4Z9FA 3FNFA 2AEFA 1VJ1A 3ZV3A 4E2ZA 3WWZA 3NX4A 4JJGA 3QW2A 3W8FA 3CE6A 1P0FA 2OP0A 5TGDA 3DOJA 4J4BA 1PJCA 3S2EA 1I30A 2J3KA 3E18A 3GLQA 3HUDA 4B7UA 4CPDA 4DMLA 3OJ0A 5K0ZA 2I3AA 3RFTA 2X9GA 2QRJA 1Z82A 1JN0A 4CR6A 1Q1NA 3VPGA 1QKIA 2BFPA 1AUPA 3KSDO 2R6JA 3MJSA 3AY6A 4ZQGA 5DCUA 3QLJA 3WNVA 3E9NA 5JBIA 3RBXA 5G0SA 3O8QA 1ZK1A 1PGQA 5KKCA 4WLEA 4IJVA 4BNWA 4FPXA 3TN7A 3F46A 5CFZA 1ZKMA 1DRUA 3WGOA 4P4GA 2HMTA 1CEQA 1EVJA 1T4DA 1ZK4A 5CHEA 1HYHA 1VL0A 5B1YA 1A7AA 1ADGA 4ND2A 1PQPA 4D42A 3OA2A 4PLVA 1WDMA 4J1TA 3W6ZA 1D1SA 3RC1A 1LQTA 4E21A 4GSLA 3GDGA 3KLPX 1D4FA 2X5OA 1LU9A 5A5EA 1AN9A 2WTBA 3WJ7A 2G5CA 4FGWA 4GX0A 4CM6A 2V65A 3WQSB 2GLXA 4ZGWA 1I33A 4EGFA 2HK9A 4CUZA 3TDKA 4E2YA 5THKA 1SEPA 1JTVA 1LDNA 1P1FA 1H9BA 4Y6SA 3KUXA 1F14A 1MX3A 2HMUA 3M2TA 5I7SA 2JL1A 2QRKA 5L45A 3A1NA 3PDJA 1IPEA 4KTVE 1JLLA 3PXXA 3UGKA 2AHRA 4UVEA 1YBAA 5TLSA 1H0KA 4G81A 2P9EA 2EP7A 4FFRA 2OBYA 4UAGA 1Q7GA 3LC1O 4YCAA 4AJPA 4E5KA 2B37A 4QX6A 4XD2A 5C7IO 1E3SA 2HJRA 3PJEA 2Q45A 2PWZA 3V5NA 2HMVA 2D59A 1YGYA 4W7IA 4XIJA 2WEKA 1ULSA 4NG5A 5A06A 4RL6A 1HF3A 2ET6A 4U6SA 4MKXA 2AW5A 3C7CB 2UUOA 4U5QA 4N5LA 1GL3A 3DAPA 3U5TA 4FDAA 5F5NA 3GGGA 2VOEA 3LDHA 5B37A 4B3IA 2UV8A 3ONEA 1E7YA 1DOHA 4B4WA 5CP8A 1DIRA 1UP6A 2E48A 3LC2O 3UUWA 2RH4A 3WLEA 3ZWXA 2RIRA 4RPLA 3DEYX 5FYDA 1KEPA 3GEGA 4EJ0A 3IS3A 3QHAA 2QX7A 5AXBA 4HX5A 4DWVA 2NU9A 1N92A 3FNGA 3NGLA 4JXKA 4DLLA 2I9PA 2ZTLA 4RORA 2VT3A 4AJJA 4OQYA 1P0CA 4J49A 1HE2A 4L74A 3X2EA 1BG6A 3KM0A 4B4UA 3E6AA 5DP1A 1JW9B 3DHNA 1WP4A 2DUUA 1H6DA 4NNJA 2ZIZA 3JYPA 3ZWMA 4C4OA 3GHHA 3OJFA 1BDBA 1B7GO 1XDWA 5BNFA 1HLDA 4NBUA 1ZVMA 2VZ0A 4KZPA 5BNIA 4FSHA 1V3UA 2PY6A 3PYXA 1RM0A 3G17A 1ENZA 1E0DA 1FMCA 2DC1A 3HN7A 3NYWA 3QY9A 1VJTA 4JLWA 4XRGA 2HSDA 4CM1A 4BHTA 2EW2A 2O50A 1U28A 5I8WA 3RAJA 3D5QA 3OP4A 3ZV6A 3MWEB 3TFOA 4R01A 1LTHR 1TVEA 4RPGA 2P9CA 4CQMB 5KJCA 2E82A 3D7LA 4LSMA 1TA4A 4MIOA 1EK6A 4GPD1 2Q4EA 2UAGA 3N74A 4GBJA 1E3WB 1LLCA 2X8LA 4KQWA 4RVGA 4TVOA 1DHRA 1W73A 2CUKA 4XDYA 2AEMA 3RCBA 5KOIA 2CFCA 2NTNA 5JDIA 3F4BA 3INRA 1MG5A 4E12A 3Q6IA 4ITUA 1N9GA 2IRWA 2PLAA 1UJMA 1T2AA 1R0KA 5DBGA 1B0AA 4GH5A 1N7GA 3PYMA 3Q11A 2VOJA 1CQIA 4IGFA 5T57A 1PJQA 4L9RA 4LW8A 2Y67A 3I9NA 4TRMA 4WLNA 1SZJG 5DBFA 2DM6A 2VUTA 1T2EA 3IAHA 1MC5A 1O94A 4JCOA 4OYRA 4AL4A 4CLOA 2IYOA 4JN6B 4BQPA 1X0VA 4IS2A 3UFXA 3A28A 3AFMA 2NTVA 1ORRA 3GNSA 2EEZA 3RROA 3TNLA 2I65A 4BO6A 3C1AA 3E5MA 3TOZA 1KY4A 3VH1A 1NBOA 5JC1A 4JX8A 1T2CA 3NEPX 3PJDA 5B4TA 3JCZA 2UYYA 4YA6A 1BMDA 3P19A 3SJ7A 4AJHA 2HRBA 3W1VA 1VE9A 4Z3KA 1C14A 2OGUA 1A4UA 4XQ9A 2C7GA 3IOYA 4BKPA 2YFHA 3PQEA 1SAYA 4ZQEA 2UVDA 2AXQA 3FN4A 3WMWA 1HWYA 2CY0A 3WGIA 2FZWA 1P33A 1GAEO 1FDUA 3ZWAA 4WOJA 2C54A 3SLGA 1F8GA 2PH5A 3NT5A 3FHLA 5IDQA 4PRLA 4B3HA 3DTTA 3GGPA 2D2IA 4Y9DA 4Z0TA 1Z45A 2WD8A 4O0LA 1GCUA 5A3JA 4BGVA 2QHXA 4AJOA 2CVQA 4CM9D 5EQFA 1HKUA 3AOEA 5CDSA 3FNHA 3BTOA 5A03A 4XJSA 3QWAA 4R51A 1LQUA 2EP5A 4BMNA 3FCOA 1B14A 3MTGA 5GZ3A 2HO5A 1EDZA 3ZDFA 4J2HA 2GUGA 2HMWA 5CEFA 4KWIA 2PGDA 5HBRA 3P5SA 1GADO 2AG5A 4PLWA 5JMPA 2J5QA 1XG5A 1XHLA 1XYGA 3QWFA 4Y8VA 3VZQA 1UP4A 3DBLB 5U9CA 3WLFA 1YDWA 4WUVA 4J7XA 4I9NA 1PQUA 2Q99A 1ZK0A 4ZVVA 1A5ZA 3W8EA 1EEHA 5KVVA 2YW9A 3U9LA 1WAMA 4BO5A 2ZJ1A 1ZBQA 3H3FA 3VZRA 3Q0EA 3DL2A 2H63A 1JKIA 1TT5B 3PHLA 3NJ8A 2QZZA 2XAAA 3EMKA 3GRPA 4Q3AA 8LDHA 3ZHXA 4CLXA 4KP7A 4ZRMA 1I36A 1R16A 3BMNA 2GN8A 4R1UA 3NTOA 3WS7A 3ZU3A 3INTA 2C5EA 5EL0A 4GKBA 4ND4A 1C0LA 3GRKA 3RU7A 3QRWA 2XXJA 1ZCJA 4FCCA 5L4NA 2J5RA 1I10A 4IDGA 1ENPA 2BI8A 4XX0A 4J16A 3PWSA 4QXMA 4N5NA 2QRLA 3OQ1A 3TL3A 5CDGA 5TSDA 1G1AA 1ZSVA 5EERA 5K6AA 3I9OA 1YE3A 3D3EA 4IJKA 3QA9A 4PZCA 4G65A 1ISHA 2BLLA 4J1SA 4OO3A 2FZEA 3DR3A 2HCTA 4I08A 5LC1A 3UVEA 4RJTA 5EMHA 1HDOA 1NPTO 4TROA 4JP3A 1E3LA 5J23A 4WLVA 5L7TA 3A9WA 4YJHA 3AM5A 5DULA 4DL9A 4D0SA 4UULA 2AE2A 3I9JA 3PK0A 4HNGA 4FB5A 3I9LA 4ALNA 4YXFA 2C59A 2GDZA 3Q9UA 2X5JO 2GASA 1LLUA 1OC4A 1FXSA 1DC6A 1DIBA 5DCYA 3PI7A 1A71A 1PL6A 4N5MA 4IM7A 1A7KA 1O9BA 4J91A 5KWEA 2VN8A 4CM8A 3OF2A 3Q2KA 3ULKA 4CV1A 2HRZA 4HUJA 2FOIA 3BMOB 2J3IA 4DIBA 3BMQA 3H8VA 1V6AA 2YY7A 2RH8A 4LMRA 1YB4A 4MKRA 5AOVA 1B26A 1E7RA 2J3HA 3AI3A 4W9NC 1NPYA 1NQTA 3DBLA 4IJUA 3JQGB 4GVLA 4GSKA 1WMAA 4ALMA 1B3BA 1JDJA 2G76A 4EJMA 1Y81A 3GC6A 5G0UA 3IP3A 3MJVA 3QWBA 4ND1A 1U7HA 4BS9A 3ZU4A 5G4KA 1V9LA 1W0CA 1B8VA 4PG8A 1ZEJA 4H7PA 5I9LA 7ADHA 4YJDA 1YWGO 2Q2QA 3E48A 1WWKA 2C2YA 3C7DB 1LC0A 1GZ3A 5ICSA 1PJLA 5GZ6A 4AJEA 1YBMA 5IF3A 3FF4A 5IZ4A 3O26A 4CM9A 4IY1A 3O38A 2IEBA 1DEHA 4DA9A 4IBOA 3HADA 4JJIA 1X0XA 3CMMA 1I3KA 1KS9A 1WDLA 3RC9A 5MDHA 1RM5A 5TX7A 1NPDA 3ZV4A 1H6AA 4NQZA 1KYQA 4ZA2A 1DRWA 2PA3A 1MUUA 4Q9NA 2H1SA 3HFGA 5H81A 1Q7BA 3I6QA 4O63O 4B7XA 1HDRA 1R0SA 3WDSA 4LMPA 1CDOA 1PS0A 2GGSA 4UREA 1Q7CA 1GY8A 4H15A 3GDFA 1XCBA 2P4QA 2FPPA 2WJPA 3UICA 1F0YA 4HV4A 1O95A 3AUTA 2C5AA 2YDYA 1PGJA 4MVJM 4Y67A 4NFHA 2JD0A 4I1IA 4IDCA 5BSHA 1K5HA 3JQ6A 2WYWA 1DPGA 1DHTA 4RLSA 3JQEA 4GMFA 1TT7A 4ZRNA 3ZNOA 1O6ZA 4NFSA 4LVUA 5A02A 1ISMA 4RF2A 4IMRA 3LF1A 2D0IA 3B70A 4II3A 4PLFA 4Y98A 2OXIA 1UDBA 4ZQFA 4Q39A 2GYYA 3F9IA 3M1LA 2B36A 4YJGB 4ALJA 3UN1A 1QP8A 2P68A 4NDNE 1BGVA 3GVHA 4E2XA 1NAIA 3BHJA 5JYEA 4AVYA 2YV3A 1F8FA 4PG4A 2X1HA 1TXGA 2X23A 1MV8A 3ETGA 3NGXA 1HSZA 2A92A 4B4OA 3NT2A 4BKUA 4YRBA 5IAAA 2H9IA 2HMSA 3FPCA 4FFLA 4OKNA 4C7KA 5MGBA 2EGGA 4D43A 1UXKA 2PH3A 4GX5A 3U3XA 5JXWA 1ID1A 2PZKA 1AXEA 2ZB4A 3JYLA 3F4LA 3RQSA 4YACA 1V35A 1LRKA 4IS3A 4MP3A 4UUPA 5JLAA 3LVFO 3DO5A 2W2LD 2DT5A 2JCVA 1YOVA 4XWYA 1O0SA 2PD6A 3BYZA 3P2YA 4IIUA 2DBZA 4J9VA 2FRDA 3DB2A 4GQAA 1L7EA 4L75A 3GZNB 2NVUB 2VTDA 5L40A 3DZJA 4RPJA 1R66A 2YQ5A 4UEOA 5DZSA 3ICCA 4IZIA 2NQ8A 1C1DB 4CMIB 4HFRA 4U0JA 5H83A 4W6ZA 3DOOA 3U0BA 1LXCA 4KDEA 4BO8A 4OGWA 1UUFA 1YH3A 2EW8A 2X58A 1MC4A 4CR8A 4EBFA 4ND5A 3I83A 3H6KA 1SMKA 3H5RA 2FN7A 2HK8A 3E5RA 1NFFA 4AJ4A 1SOVA 1N7HA 4E13A 3GA0A 3LT0A 1LLQA 1Y1PA 1HETA 2HU2A 1PL7A 4TKMA 4WOKA 3E9MA 4CL8A 4OIMA 1QR6A 1TI7A 3DZFA 4JGBA 1C1XB 1Y8QA 2FY8A 1ZNQO 3PP8A 2O7SA 2DPGA 1ZXLA 3E9QA 4Y6RA 1B8PA 1XELA 2Q1TA 1LSOA 2A9FA 3DDNA 1LEHA 1LRJA 3WSVA 3SX2A 4ZQHA 3ZGYA 1XR3A 3H2SA 3GUYA 1DIHA 2ZK7A 2Y1CA 2IDZA 2C82A 3F5QA 2Y1FA 3KXDA 1U4SA 2O3RA 3AOGA 4BO1A 4YWJA 3RI3A 3ROQA 1YQDA 4BNNA 1KERA 4HBGA 4A27A 1I24A 2IXBA 1AHIA 5AQ1A 3VH4A 3B1FA 3GVXA 4K1LA 1B3RA 3TZQA 3HE3A 1MFZA 3KO8A 2QG4A 2VHZA 2X9VA 1ZH8A 1WMBA 2WYVA 3DQPA 1GTMA 3ETDA 1EK5A 2J5KA 2W90A 1NFQA 3GUCA 1I2CA 3UXYA 3UOGA 2BGKA 3LSYA 3IIEA 1EQUA 3OM9A 2I76A 4QFDA 2O2YA 4H16A 2AE1A 1V0JA 3EW7A 1GQ2A 2Q50A 1GZ4A 5AYVA 3K73O 1ZXBA 3LT2A 2I5PO 3I4CA 5ILGA 3D5TA 1D8AA 3HHPA 3ZWPA 4FFNA 1QORA 4E30A 5T6BA 4BMVA 1UDAA 4EUFA 3SXPA 1CRWG 1PZGA 3H9GA 4Q3CA 4XZ3A 3RU9A 2POQX 4R1SA 1SCUA 1ZJZA 3LK7A 5B4VA 4ZJUA 4BKQA 4EZBA 2VUUA 5U1PA 4J1NA 5FEUA 1K6JA 1GD1O 3G1TA 1QRRA 3KZVA 3K92A 4KUHA 2VTEA 1OMOA 1DFIA 3RUEA 3VZSA 5BSGA 2BMAA 4CMIA 1J0XO 1VI2A 4PLYA 4RVUA 4R9RA 4WCFA 4DQUA 3ASVA 3L0DA 2FR1A 3KEOA 1IY8A 3DZKA 3I6IA 4BNLA 3E82A 2C20A 1E6UA 3Q9NA 4DPLA 2OHXA 1XQ6A 4DIOA 2EJVA 1TEHA 2AG8A 3UAGA 1HZJA 2XOXA 4FFPA 4JK3A 1V3VA 3PDUA 4A0SA 3ZNQA 2BFAA 4PVCA 4OMUA 2B5VA 4S3MA 4D3DA 3GN1A 1PR3A 1VKOA 4HXYA 3GOHA 3STHA 4PLPA 4RVHA 1B16A 2OORA 3TZCA 1DLJA 1K2WA 3B20A 3EZLA 3IMFA 5U4QA 4WEQA 5LDHA 4DQVA 4YBZA 4CUKA 4RVFA 4RQTA 4FOOA 3ROPA 4C7JA 1AGNA 1P1HA 5A9SB 1S7CA 1N5DA 3I9MA 2PZLA 2F1KA 2FR0A 4FC6A 3MEQA 5G2OA 3WIEA 3ZHYA 2AA3A 2DBQA 1ADCA 1PJSA 4JQCA 2W2LA 4XCVA 1Q0HA 1QYWA 3TZHA 1EQ2A 4YAIA 2QZ9A 3HNPA 1E1LA 1LUAA 2ILTA 1YJQA 3PHGA 4YAJA 1QYDA 3GEMA 3KTDA 5KTKA 2GD1O 3N7UA 4XB2A 1M66A 4GLOA 3BTVA 3L77A 3VTFA 4CUJA 4B8WA 2NVWA 3MZ0A 4DXHA 5CDYA 5KVSA 5G0WA 1WPQA 4UVDA 3PRJA 2OZPA 5G4LA 1NAHA 2NWQA 1M76A 1PTJA 3GPDG 3ONDA 2G1UA 3HFSA 1QLJA 5FWNA 1PSDA 4RPHA 3ASUA 5T5QA 4EEXA 1LSUA 5TC4A 3S8MA 1NVTA 3WSWA 4L8VA 1IYZA 3OETA 4Q3DA 3ZHZA 4DBVO 4E32A 2HAEA 1UAGA 4XYLA 2J8ZA 1UZLA 2YJZA 4YAEA 5ES3A 4F46A 5DT9A 4ZHSA 1S6YA 3GNTA 5JY1A 1U5CA 1HXHA 2HDHA 1P31A 4BO9A 4D3SA 4CJXA 2QW8A 5F1PA 4CL3A 2RHCA 1NQ5A 2EXXA 3WICA 2VNAA 4CQMD 3U49A 3AM3A 4A73A 5IZCA 1GUZA 3CZRA 4YAKA 4D79A 3O9ZA 1EFKA 1PIWA 4NJMB 4CV3A 1P1IA 1ZW1A 3U62A 1P44A 6ADHA 4CQLB 4LSWA 4LK3A 5JO0A 5JO9A 3PQDA 5DP2A 5CDTA 3B6ZA 1P1KA 1RYEA 2I99A 4K6FA 5F1KA 1H6CA 4M87A 4J3FA 1KEUA 5EESA 3IC5A 4BNGA 2C07A 3TSCA 3PJFA 1KVSA 3H5NA 3CEAA 1Y6JA 5BNTA 1XU9A 3COSA 1PJBA 1OI7A 4L4SA 3D4OA 4E4YA 5BR7A 3HDQA 3QQPA 4EUEA 1RM4A 5F21A 1E1MA 2QQ5A 3DBHB 3BA1A 1LRLA 3GAZA 5TJHA 4BNZA 4XQEA 1EE2A 1QG6A 3UCEA 3MOGA 2HKIA 4PVDA 4FFOA 3F5SA 3L6OO 4TRJA 1OFGA 3JD2A 3TOXA 4FR5A 4INAA 4U7WA 3L6DA 4XYBA 5JCJD 4JBGA 3PFWO 4IGEA 2AMFA 3LYLA 5G0VA 3RUFA 2GO1A 4OQZA 4TSKA 5DF1A 3WYCA 3DFUA 4IZHA 4MIYA 2GSDA 4NHEA 4XR9A 3WQQA 3PGJA 5DNAA 3GQVA 3RJ9A 3S2GA 1LDEA 4Q3BA 2I3GA 4QQRA 1GDHA 4NH4A 4P22A 1KEWA 2NU6A 3QV1A 3RBVA 2ZATA 9LDBA 4BIIA 1PWZA 5KCZA 1DIAA 4Z9XA 2AQHA 5F1OA 1RKXA 1YDEA 3PLNA 3PWZA 2C29D 3KV3O 1E77A 1HDGO 2DU8A 2Q1WA 5HRUA 4YT2A 3DAGA 2P4HX 1BVUA 2LDXA 4NI5A 4DREA 3RUAA 2ZTVA 3OBBA 3IL2A 4R5HA 3KHUA 1DC3A 3RFXA 1JWBB 1K6IA 1B2LA 2ZKLA 1CQJA 2GPTA 4QEDA 4GX1A 1SOWA 1ISGA 3L07A 4NJMA 3WYEA 2IZ0A 3HB4X 1SBYA 3CXRA 2GZ1A 1Y8RB 1PL8A 1KETA 1XGKA 2PNFA 4YQZA 1HDZA 1NYTA 3T7EA 1X1TA 4EW6A 3W8DA 3E1KA 5HA5A 1O5IA 1ML3A 5JC8A 4RVSA 2JAPA 1ZO8A 5EPOA 1QV7A 3JQ7B 3ZN2A 3OIGA 1YS4A 1Z75A 4WE3A 2NQTA 3RUCA 1GR0A 2CMDA 3QWIA 3VOSA 2B0JA 1PWXA 2O23A 2GNAA 3KETA 3ZNPA 1E7MA 1ONOA 1GCOA 1Z73A 3MOIA 2E6UX 3MJTA 3WX0A 3JV7A 4I9UA 4LCJA 1WZEA 3G0OA 3AJRA 2Y0EA 3C1OA 1RYDA 4BOYA 1ENYA 5IDYA 4W99A 2Q2VA 5A05A 3F1KA 4J0EA 1DFGA 1VL8A 5IN5A 4BNMA 1T4BA 3DC2A 3NDRA 4D7AA 4DC0A 3JQ9C 4UUMA 2X6TA 1E7QA 1U4OA 1R4NB 2DBVO 3KYCB 5IN4A 3AU9A 4DTIA 3ICPA 3PPIA 4WGGA 2G82A 3D0OA 6LDHA 3ZI0A 3C3XA 2NV6A 3D3WB 1PEDA 4D46A 1YB1A 2GN4A 4CQMA 2O4CA 3DZHA 5I7VA 3FRJA 4PGFA 3RIHA 1N8KA 5ENDA 4DLBA 3U4IA 1XLTA 3AU8A 3CUKA 1EUCA 3DZIA 2YYYA 1NFRA 3ANLA 4JBHA 5JPIA 1E3WA 3TPCA 4CM4B 1I5RA 4MVJG 3C24A 3RASA 4DPKA 4BO7A 4ALIA 4KQXA 4MOWA 1H93A 4PG7A 4P4NA 1ADBA 3ZCXA 5KIAA 2JD1A 4HFNA 3I1JA 4NIMA 4CLHA 1BXKA 1JKJA 4BNHA 4D0RA 5I7FA 1E7SA 3OFSA 4UUOA 2EJWA 3ZH2A 4MO2A 5LCXA 2R00C 3L4SO 1EVZA 2WD7B 5DOVA 3IP1A 4WK6A 2VHVA 1EDOA 1D1TA 3OA0A 2CZCA 3LLVA 5TF4A 1H5QA 3Q2IA 5A9TA 4E5YA 1ZSNA 3ST7A 1X15A 3ADOA 5HWSA 1BW9B 2X9NA 2EKPA 1IL0A 3C85A 4AG3A 9LDTA 4FD3A 3WGQA 1K6XA 4KMSA 1KVRA 2VWPA 3TF5A 4ROSA 4JBIA 2NNLD 2VQ3A 2CSUA 2DBRA 4WKGA 4TWRA 1NASA 4BNIA 4R16A 4N54A 5JCJA 2VCYA 3GFBA 4CMEC 2DPHA 5A3VA 1JAXA 3HDJA 3OIDA 7MDHA 1I2BA 4OKIA 3AUAA 3GFGA 4R1TA 3JQ7A 3PVZA 1U7TA 4J6FA 1Q0QA 3TZKA 5JAIA 4MVJE 4CM3A 3SBOA 4E33A 3A4VA 3F47A 2Y68A 2ZCUA 2OMEA 3GNQA 4L0QA 1R37A 5AXCA 1XIVA 5HS4A 4HADA 3K96A 1DB3A 3K2EA 5ITWA 4BQRA 5GZ1A 3H9UA 2W2KB 4DMMA 1X14A 3W4JA 5JS6A 2ZB8A 2Q2WA 4RDIA 3TWOA 1F06A 4K26A 1VSVA 1Z7EA 3ZWVA 4YJFB 5K9ZA 5EINA 1R6DA 5ER9A 5C5IA 1YONA 1EUZA 2DFDA 4QO7A 3GVPA 3ON5A 3KYCA 4Z0HO 4J7UA 1QMGA 3JQ9A 4NBVA 2VHWA 4OOEA 2YV2A 1NWHA 3KYBA 4CMHA 2ZYGA 5IJZA 4PG5A 3D3WA 1FDWA 3IKTA 2VYND 3GZ4A 4NZ9A 4FW8A 4BO4A 1I01A 1LA2A 1OOEA 4KUEA 4EJ6A 2A4KA 1H2BA 3SJUA 3ROMA 3PJGA 3KRTA 2LDBA 3L4BC 2Y99A 1GEGA 1QV6A 1GPJA 1GEEA 2B35A 4B8ZA 4BO3A 4NU5A 4FJ1A 3LC7O 5IDXA 3RC7A 1VPDA 3WTCA 1NHWA 3HB5X 3TJRA 2GN9A 4BB6A 4CMBA 3JQDA 3VDQA 3H9JA 3JQBC 3VAZA 2V6FA 1W4ZA 4CMJA 1DSSG 3I52A 3A06A 4GWGA 3PTZA 2IEDA 2DUWA 1U5AA 4YRDA 5F5LA 4BMSA 1TT5A 1LI4A 3OHSX 3LT1A 1IZ0A 4OXYA 1XEAA 3EAGA 3ZWNA 2NVBA 3PGXA 5COBA 4XIYA 3RUHA 4HFMA 4DGSA 1BW9A 4MVJP 2QYSA 3FTPA 3ZWYA 4TKLA 1LDYA 3SVTA 4BNFA 3UF0A 1OBFO 4TQGA 4KUGA 3IJPA 1QYVA 1QYXA 2NU7A 4RVDA 4GGOA 2P2SA 4BV8A 4HNHA 4WECA 3TRIA 4BB5A 1K89A 2W8ZA 5I7EA 3QJ5A 3FSRA 3ZNNA 4M55A 4CMGA 3QVOA 2X86A 4WNCA 4RV9A 4W82A 3ZV5A 4MVJF 3I23A 3W6UA 3EDMA 1WLYA 2C2XA 1BTOA 1VSUA 2VT2A 1HTBA 1IUKA 1U2GA 2BGLA 1YRLA 2FWMX 1CF2O 4FIZA 4OHUA 1U9JA 2UUPA 2BFMA 1OAAA 2RBEA 5L51A 4YEDA 2VYVD 4CLRB 4BKRA 3H9QA 1JAYA 3IDSA 4LGVA 2DKNA 4LCEA 1Z6ZA 4HFJA 4BUCA 4GX2A 4RZIA 1X13A 4PLTA 3GK3A 4J90A 5T8KC 4BNKA 1E5QA 5JAQA 2VZ9A 3PLRA 2H5LA 3LF2A 2PKQO 5HTOA 3R0IA 5JDCC 3QVWA 1G0NA 1DAOA 3BMOA 1TB4A 1F12A 4KDFA 4XJTA 4R1NA 1GV1A 1VL6A 2NUAA 1MA0A 4F6CA 1PJTA 4ID9A 4A03A 3JQGA 3WWYA 4PLCA 3DBRB 1EBUA 4GLLA 3CINA 3VPXA 4WCDA 2JFFA 4CMCA 1LJ8A 3MJ4A 4J1QA 3L4BA 3CIFA 3LU1A 4W9NA 4YRAA 1T26A 1IPFA 2OOSA 2JCYA 4OL9A 1V8BA 2BD0A 2Z5LA 3PZRA 4OOFA 2Z1NA 3BHMA 5CG1A 4M8SA 1SO8A 3JQBA 1GU7A 4YAGA 4BNXA 4A2CA 2RHRA 2XF8A 3CMCO 4GWKA 3V1YA 3V2UA 3OH8A 3JSAA 1K0UA 2X0IA 1UDCA 1NVMB 1U3VA 1MGOA 2XXBA 3O03A 3OJLA 3UCXA 4R68A 1JWAB 5L9AA 1AXGA 4U8GA 2Q46A 1UZMA 3FR8A 3P2OA 4FQ8A 4P38A 3NT4A 3CKYA 1PZFA 3H3JA 2HLPA 3KVOA 4AJ1A 3D4PA 1T2FA 1XA0A 2AQKA 2Y1EA 4LRSB 3JQAB 4CV0A 2ZTMA 2W98A 5A5FA 4FJ0A 4FGSA 2Z1MA 1H6BA 1R12A 1OZAA 5AXDA 5KVCA 2ZB3A 1X1EA 3JQFC 1YVEI 4IQ8A 4AJNA 1LSJA 4HWKA 4GVXA 5ER6A 4R54A 4G5HA 1CWUA 3OQBA 2GRAA 3GF4A 3JD3A 4MJLA 1P77A 1WXDA 4IDDA 2JFHA 3BZUA 4ZQBA 4R5MA 3K31A 1E92A 4GI2A 4MP8A 1N1GA 2RCYA 3V8BA 3PHHA 4BNJA 4YVFA 2PKQP 4PFJA 1G0OA 4CLRA 1NHGA 5KJFA 2BFOA 3NJ4A 3KEQA 3FD8A 4JP2A 1YBVA 2OFPA 3G49A 4TVBA 4QT0A 2O3JA 2Y0DA 4YPOA 5GY7A 3FBTA 3JYOA 3FPLA 4YJGA 4TMFA 1NNUA 1L7DA 3SC6A 2FR8A 1GQYA 1X7DA 4BNVA 1YKFA 5T8KA 2CD9A 3DZGA 3O8QB 1EBFA 1GFSA 3Q1LA 4L76A 2RAFA 1JQBA 2Y1DA 3WJAA 3IUPA 1CERA 2DTXA 5JSFA 1DC4A 1W8DA 4RO0A 2X22A 3JD1A 1RM3A 4RPKA 4DPMA 2CVZA 3K2BA 3GMSA 1I3NA 1DAPA 2EGHA 4N18A 4PLHA 1HE4A 2H6EA 3G3EA 3WTBA 2Q1SA 2GCGA 5TJ9A 2BGMA 4IXWA 4QFCA 1SEVA 3UCFA 1BRMA 2X0RA 4FFMA 1M67A 4ALKA 5FFFA 4F45A 3GY0A 4QSMA 1LC3A 3K5PA 1FDSA 2GN6A 5A04A 1SNYA 2JFGA 2Y66A 1M75A 3GZNA 4NBTA 4TRNA 3WB9A 4Z9YA 2NVUA 3CTMA 4IMPA 4L4XA 2R2GA 4NMHA 1T1RA 3QP9A 1HT0A 4OXKA 5C7OO 3DHEA 1CYDA 1C1DA 3ROKA 3WBFA 3WGHA 5A1TA 1X7HA 1SC6A 3QVSA 1E3JA 3I4FA 3PWKA 2AQ8A 1HRDA 5B12A 3AUUA 3OJOA 4IDFA 4M54A 1E5LA 1T1SA 1KOLA 3WGGA 4NBRA 5DN9A 2JD2A 4EEZA 4QUKA 4HKTA 3S2IA 1E3EA 1SB9A 4F6LA 3EK2A 3N58A 1YL5A 1I3MA 3L6EA 4L4RA 5COAA 2X4GA 4XGKA 3PIIA 2PZJA 3FNEA 4K9DA 1KVUA 1VJ0A 1C1XA 1DIGA 3VVBA 4IDEA 3LLSA 1FDTA 3DZBA 4R41A 3V1UA 4CR7A 1DRVA 2EWMA 3CPSA 3AM4A 2ZTUA 3R1IA 3RSHA 1PX0A 2DTEA 3VVCA 4AJIA 2P5YA 4B79A 3JQ8B 3WGYA 1UR5A 1KVQA 2B5WA 1HDCA 1A72A 1X7GA 3TQHA 2NSDA 3EUWA 3EHEA 3V2HA 5JFOA 3WR5A 4IDBA 5CAEA 1EZ4A 3EZYA 3EC7A 1KIFA 2IYPA 4M86A 1K3TA 1Y5MA 4JROA 2UDPA 3JYQA 4BGIA 2PGJA 4D3FA 2NM0A 1HL3A 5ITVA 1VM6A 2I66A 2EKLA 2GR9A 1KEVA 3B1JA 4M49A 3AY7A 3SEFA 1YQXA 1R4MB 2NTJA 3FI9A 1GZ6A 1YXMA 1GPDG 4ND3A 3W4IA 3M6IA 4NPCA 1PU2A 2YQ4A 4J43A 4O59O 5JCXA 3AW9A 1Y9EA 1GYRA 1KC3A 2DTDA 1XWFA 2EV9A 4XB1A 2FSVA 4AICA 4IIVA 4PG6A 3WIDA 5F3RA 3OMLA 4CODB 3CSDA 2P5UA 4YTEA 3WGZA 1LDGA 4I5EA 4H3VA 4BV9A 4UEKA 4DIFA 5IDWA 2CVOA 3IQDB 3GG9A 5HS6A 1HLPA 3I5MA 5JDIC 1UH5A 2O3QA 2DVMA 4DBZA 2G17A 1WZIA 3R3SA 1P45A 1BDMA 4PIVA 4E6PA 3HN2A 1ZEMA 3DAFA 5L3ZA 1PQWA 4KOAA 1PS9A 4OSOA 1N9GB 1M6WA 1A9YA 4XDZA 5TNXA 4PCVA 3KYDB 4URFA 3FTNA 4E31A 2XPCA 4J9UE 3JQCA 3HG7A 3GR6A 5DCWA 2ZQZA 5KKAA 3GDOA 3QE3A 3OJEA 4P8RA 2O48X 4RQUA 4CLOB 4YB8A 2YDXA 4XGIA 3BAZA 2VRCD 2BH9A 5IFLA 2BRUA 2IZ1A 4CLEA 1JU9A 1U8FO 4Z0PA 1L1FA 2IXAA 2O7QA 1N2SA 2BF7A 3B1KA 2O4UX 3F6YA 1YQGA 1ZMOA 3JQ8A 4G2NA 3K8ZA 5A9SA 3ADPA 1E7WA 2VWGA 3VH3A 3IUSA 2B69A 2WE8A 4I5DA 1I0ZA 3MWDB 1MP0A 3E03A 4YR9A 2VHYA 2TMGA 4B4VA 4QO8A 2B4TO 5C7LO 3ZU5A 1BXGB 2BI7A 1ARZA 1ZFNA 4YYZA 2YFQA 3S2FA 4NJOA 5KNLA 3CZMA 3DMTC 4PLGA 1U8XX 2CF5A 3RVDA 2I6TA 3X2FA 3AOEC 5T64A 3KLMX 5JAZA 4O1MA 5IXYA 3PHIA 1JA9A 3V1TC 1J5PA 2D5AA 1R4MA 4IDAA 1PJ3A 4GMGA 3M2PA 1I32A 2ZB7A 5JNLA 3TL2A 3PIDA 5ENVA 1AHHA 3BHIA 1SB8A 3VZPA 3EVNA 3AK4A 3VTZA 3PHJA 2VWQA 4MVJD 1O89A 1C0KA 3O4RA 1DJNA 2OBNA 2F00A 4XRRA 5EN4A 3GMDA 3MJEA 4DYDA 5CEEA 1QXSA 3S55A 4LN1A 1BXZA 1LDMA 3NUGA 1LNQA 3HWRA 1BVRA 4DLAA 2Q49A 2P91A 1MXHA 4K28A 4ZD6A 1KVTA 4X54A 2J6IA 1FJHA 5BT9A 2A35A 2DFVA 1EVYA 5A4DA 1LLDA 2C0CA 1WVGA 3FWNA 4ZU3A 3ZU2A 3RC2A 2SCUA 2CDBA 4KWHA 3RUIA 1PS8A 4J7CA 4R3WA 3SC4A 2ZYDA 3MCVA 5H82A 1GV0A 3DONA 3KYDA 3PEFA 5L7YA 1NX6A 2ZQYA 2V6GA 2D8AA 4CQLA 4MINA 4ZN6A 2FMUA 2PFGA 4MKZA 2YHIB 5JE8A 1ZIDA 1VLLA 2JHGA 2PD4A 2V6BA 3MJCA 3OQ6A 2PK3A 4AJ2A 1LDBA 4RDHA 4NK4A 2G0TA 2VUSA 3BMNB 4D45A 4AJKA 1ZSYA 2VWHA 3ENNA 4R3NA 3ZWWA 4CM7A 4L73A 5TS3A 3KSZO 1NQOA 2VHXA 5TIIA 2JAHA 4ONEA 2O3UA 3ZW9A 1J6UA 2WWRA 1EMDA 3ITKA 1UXGA 3NDIA 2EIHA 4B7CA 2JHFA 5L4SA 5K6AC 3NAQA 2O2SA 3DBHA 4QECA 4J4HA 4UUNA 3DTYA 3RKUA 1FK8A 4MVJH 3RWBA 4GAEA 4NFYA 3I9KA 5IG2A 5IXSA 3OSUA 4KTTE 3WGTA 3GVIA 3ITDA 3DFZA 5THQA 1BXGA 4NK5A 4FBGA 3R3JA 3K9QO 4K6CA 1ZZEA 4ILKA 4LVCA 2OP1A 5BSEA 3DMTA 4YT5A 4YJHB 3OIFA 2Y93A 4MVJI 1BSVA 1R0LA 3ETEA 4RZHA 3D4NA 1RWBA 4TRRA 3FR7A 4J0FA 4E5MA 2NLOA 3QSGA 4UVHA 4A7PA 1XU7A 5L53A 5TT1A 3V2GA 4WJZA 4B3JA 4R69A 3H4VA 3RD5A 3VC7A 2WE7A 4EDFA 1YO6A 4IJWA 3RJ5A 3WXBA 1N1EA 4E0BA 3BMQB 3DOCA 2WDZA 4CM8B 2VRCA 2X7HA 1LX6A 4RGBA 4MPDA 3OECA 3NV9A 1C0IA 3MTJA
chains in the Genus database with same CATH superfamily
3KB6A 4RLHA 4U7HA 5FADA 3C41J 1PYGA 4HAZA 1CUWA 4NAVA 5EVCA 3H1TA 1F17A 4CVNA 1S2LA 5AT1A 3BD9A 4IHJF 4A2QA 5JJCA 3MFYA 3R4VA 3NHRA 1V47A 5HIAA 3B38A 5ALIA 5FPHA 4MYRA 3EVAA 4I8DA 4N0MA 4KWEA 3P9PA 4BMOB 1B8UA 3UAOA 2GK3A 4P0PB 2RJ3A 4QT4A 4MRAA 2E4AA 1AM4D 3I3OA 1GKKA 2O05A 2E9SA 3T34A 2JDID 2X19A 2YIDA 3CS3A 4FILA 3KKZA 1ZOOA 2IYUA 2YV1A 5DB4A 1UANA 1QYCA 3OZWA 4C30A 3HJAA 5IJ0B 4N3BA 2LCQA 3WL6A 2X4LA 2YZMA 3COPA 1SHLA 2O7NA 1VYVA 3ENKA 4DMHA 5AW1A 1FZQA 3JZDA 5IT5A 3JRWA 5F51A 1ONPA 4EYQA 1ST2A 1V5IA 1FP4B 2AF4C 3LZ6A 3O21A 3KJQA 1CX9B 2J87A 4RHFA 1CY0A 1EGQA 1HYEA 4G6ZA 5IAEA 5J3JA 2KBFA 1AK9A 1JXOA 1XL0A 1R8YA 1WDKA 2IODA 3FFTA 5FAXA 3T4XA 3CPEA 2AKYA 2PTGA 4FJ2A 5BRAA 1XBTA 1V2HE 4HSEA 1NBME 2EIXA 4KI7A 3TGWA 3QPWA 3DTVD 2PNJA 1Q3TA 1L5MA 3LT5A 1GG9A 1HRKA 3WQRA 4MR9B 5TGTA 3V46A 2YJTD 1EFLA 4PCLA 4OJNA 2CJPA 4OY3A 5L95A 3L0YA 4NXNB 4CM5A 1RRFA 3L8YA 4IH1A 5ELLA 2GHQA 2DETA 2ZRHA 1R4NA 3G2JA 2FPPB 2J3DA 2VPWA 4YWHA 4QEZA 3TI9A 3I01A 1RYMA 2GN1A 4JXZA 2O3SA 3IQWA 3GBPA 1ZGAA 2W4QA 2SKEA 3KS9A 4KXLA 4BO2A 3QENA 4DZRA 5HUHA 2GCIA 4AJLA 1G8PA 3SS9X 1F1JA 3HYTA 5REQA 5FBVB 4KAXA 1PFUA 3JYNA 4C0HA 3IT1A 2P9GA 1U90A 2RGDA 3H1EA 2NSYA 4DLKA 1BVYF 3EG9A 3LVQE 5IMBA 1QUFA 4HQKA 5E1BA 2E89A 3NRCA 4HS9A 4R31A 2ZI9A 2GILA 3VSEA 2ZYAA 2EQ5A 1DO2A 4YCJA 4FN4A 2I2AA 4RF5A 2BYTA 2VP3A 1MB4A 1GN9A 3EEFA 1P2FA 3BQMB 3LPCA 4QBHA 7REQA 1LI7A 3FPJA 1QK3A 5KKNB 4CRWB 1W5AA 2QAGA 2R1ZA 2X6QA 3F1LA 2Y9PB 1NQUA 1UFVA 3USES 4OX9B 2BJWA 5EHNA 1OB5A 4ER0A 1KMHB 1HEUA 3ZBTA 4BL5A 6PFKA 5COQA 1GNPA 3DLBA 4OHBA 4FINA 1UM8A 4R40A 1D4OA 1KEEB 2FJUA 2GARA 3K9BA 1NW6A 5BSUA 1AK2A 3G2QA 5JCOA 5JFGA 1PLKA 2R00A 2IHKA 2X15A 3H65A 3R7NA 4RYDA 2BZSA 5A4AA 1U7OA 2EBUA 3OT1A 3QEBZ 1XMQB 3FKSA 4YT4A 3N87A 2AOVA 5EXDA 4EYGA 1QM5A 1Z0AA 4PPGA 1XMXA 2JAWA 2FDCA 1XKLA 1Q12A 3SY8A 2OV3A 1RDFA 1TVCA 2BL4A 2OCAA 5I4CA 1D3AA 1ENOA 4OF4A 5DISB 3AMVA 3U4CA 4EITA 4QLAA 4FZJA 3E7PA 4I81A 1LWOA 2FRDC 3TLMA 3VSDA 3ERCA 1SVMA 2CBXA 5B64A 1UXIA 5E2AA 5JXGA 2I4TA 1E64A 3BJEA 4XYEA 3Q8KA 4M89A 1VKNA 3OQPA 2EKZA 4V03A 1CY2A 1D0IA 3OKAA 2P4UA 4M1KA 4XR4A 3SZLA 3WAKA 3PC4A 2OUIA 4MP6A 2C42A 4PX3A 5EFZA 1VI6A 3LE8A 2XMDA 5KJEA 3WZLA 1K27A 4TTJA 4URUR 4II7A 1S5PA 3UV7A 1H5NA 4EHBA 3AT1A 2LD4A 3R0XA 4P7JA 3SBXA 2JBWA 1Y9AA 3BIOA 3FSGD 5MHTA 1OASA 2V6JA 4BEBA 5A0VA 3EAFA 5JNTA 2W2KA 5K3SA 2ZRNA 4DUPA 4BY9E 4H35A 4EIWA 3DD5A 1Y7TA 1HYGA 3ZI4A 2EHDA 3KL4A 2G0NA 2BMEA 4G0OA 1ZJYA 4YJFA 1QGOA 2J4CA 1PG0A 3BMCB 3IPRA 4FFDA 4FNAA 1LTKA 1NG9A 2BGJA 1YL6A 3LHKA 4I9FA 3V9AA 2DFKB 1EVQA 1DBIA 4ZWNA 6AT1A 1L4LA 3G79A 2PD3A 1QG2A 3ILSA 1NUHA 2HD4A 2VAVA 3JPYA 2XQJA 1WU8A 1IK4A 3MJDA 3GZJA 4KFRA 1ZH4A 1VRWA 2PT7A 1QAOA 2P8SA 3KB8A 3P4XA 4O4LF 1A5AB 2FN3A 4DNQA 3KCQA 3CFYA 3H7AA 4XGNA 1PGNA 4WERA 3TQCA 3HEAA 1CQZA 2CEKA 2FLWA 4F3NA 5C5DA 4F92B 5HIKA 3FW1A 1ZR4A 4DSAA 2V3CC 1HEIA 4X95A 1KR5A 3EGXA 1JEQB 5EP1A 1MF7A 4Y18A 3ROFA 3WMXA 3ZW8A 4G8JA 4E70A 1XSEA 1CS0A 2YXPX 3O7WA 2LIPA 4OB7A 1V37A 3TQRA 1ILWA 1FL9A 2CK3A 1NI4B 4OM8A 1O4VA 5D3MB 2ADMA 5B30A 4UEJA 1JUDA 4ZVRA 3WAJA 1TZMA 4TS4A 1FPQA 4BO0A 1R15A 4WZBE 1EXNA 3SG0A 1PO7A 4K6OA 5ICMA 3JQQA 3W5JA 3RAFC 1M1YA 2CE7A 2FCAA 2PGLA 2WLSA 3OFNA 3MYRA 4XQGA 4CLDA 2XXAB 4Q4DA 3FSJX 3LDAA 4OXNA 1DXYA 1TECE 2WJWA 3G8AA 1HT1E 1VL2A 1HQKA 5JW6A 5EEGA 1IZ9A 3ND9A 5KJ6A 3QH4A 2YC2C 1NN1A 2QPLA 2Y1OA 3PC2A 1S8NA 2IZZA 3TZ6A 3ZGLA 3W6OA 2I54A 3GN2A 3L5KA 4IUYA 4EYEA 2HW8A 3T5GA 1ABFA 5IAGA 3RFVA 3R23A 4YV1A 5LP6A 4IPTA 5CPFA 2V0CA 4ZV4A 1ULUA 2P67A 1CU1A 1R9MA 1N6OA 2WF8A 2ZW9A 3ND7A 1T3TA 4UUQA 1NNEA 2QPOA 1L4GA 3E15A 1NJGA 3L8MA 4WLOA 1KYVA 3RE1A 4UNPA 2H17A 1PJ2A 5ICGA 2I67A 5JAMA 3T3IA 1NBAA 3C7AA 2J5BA 3EPPA 3HCAA 4G0PA 4Q7KA 5LKRA 3SLKA 1X94A 5TQVA 2VBGA 3ZWOA 1UJNA 2HV8A 2VYNA 1DC5A 1II9A 3HDYA 3A14A 4ZFNA 3V3KA 1BHSA 1KI9A 1ODIA 4MIEA 4WFKA 4AMYA 1MQ8B 3NKLA 3ISJA 4WCFB 3AFNA 1PEKE 2WJZB 3A6LA 2C4MA 3FDFA 4M0FA 4N0DA 4E2WA 1QFYA 3RBZA 1REQB 1VJDA 1JHAA 4CL2A 3H9EO 5I7OA 4BGUA 1QH1B 3L7AA 1IM5A 1JI3A 2WTMA 3GWGA 2W2MA 2VATA 2OECA 3ZLTA 4DILA 1WB9A 3U4DA 1LBTA 4XKJA 1IHXA 2GTPA 3IXQA 3V4SA 4G0ZA 4ZT7A 2WSBA 3S2SA 5BOSA 2P5TB 2C2WA 3STUA 1FQOA 3QWHA 4X1KB 2J67A 5FB3A 2WQ6A 2B8WA 2IYSA 1A82A 2VTVA 2ES4A 1KFCB 5JMWA 1H94A 3KZOA 4IQGA 3I39X 4LYFA 5FV7A 3B7GA 1X1RA 1H1TA 3AIKA 5K0FA 4MEBA 2B92A 4CE6A 5C5EA 3KQKA 1UXJA 2Q1YA 2PRYA 2GF2A 2GZ2A 2VNSA 3IDQA 3GVCA 2IU3A 3II6X 3MLAA 1L5KA 3NATA 2AC2A 1I8TA 1W19A 1KZYC 4WH0A 5HKLA 2L69A 2YTZA 4M9ZA 3KT8A 4HWSA 4O2RA 3KDSE 3HR7A 3PG5A 4TLLB 2L18A 4WASA 1BA2A 2J4DA 1FA9A 2CD7A 1LPBB 2WYUA 3LT4A 4IX9A 4OAQA 1SZCA 4OHWA 4PTLA 5FRDA 4Y2XA 3W06A 3ZXXA 1C9EA 3RFFA 3AY3A 1SXJD 2ZCVA 4CTNA 2ZZKA 1MIHA 1TJYA 1XD9A 4M1EA 2RBKA 1SA0B 2HK7A 4P36A 2FLKA 1EJ6A 1P0MA 3P0FA 1N6PA 1JU4A 3AESA 4FGUA 1ZU5A 4UJ3A 2NT4A 3JXEA 3QE9Y 1I2ZA 3AILA 2HR1A 1G9SA 2I6SA 2VPQA 2ZE5A 4ENTA 2V0NA 3ZHSA 5E6RA 1SN7A 3QBEA 3H2BA 3WWCA 2PS3A 2RBGA 3G5TA 2R8OA 2ZJFA 3GPCA 5BORA 4AXBA 1IOWA 1GSHA 2HJWA 1J49A 2YWDA 5FI3A 1MRZA 3JSXA 1WXGA 2ZYRA 2XR1A 4DVJA 2XTZA 4NBWA 3TTUA 4BVGA 2Z6AA 5B1HA 2FK8A 2O3TA 2TMKA 5AVUA 1UWCA 5CNIA 1ZKDA 3GFQA 3CUWA 4II2A 2WWIA 1ISJA 4OH7A 5ITSA 3WRVA 3Q5DA 4IFEA 4O5OA 1OBCA 2NYAA 3F71A 5FO0A 4B6JA 3NTVA 2B4QA 1V3TA 5GONB 5BR1A 2XQKA 2QN7A 3MERA 5CLLA 4DR5B 3JQAA 3QIVA 4NOKA 5F9MA 5FR1A 4K88A 1NONA 1Q0TA 3PCTA 5AVJA 1J22A 1ZJJA 3K0FA 3QUCA 4TWJA 2YW2A 4A82A 2ODTX 3CISA 2YHUA 5F3WB 3WE7A 4BNUA 2JLBA 3I1FA 3ANNA 4OVKA 3S2UA 5CPBA 4CDRA 3GCGA 3JQFA 3CVUA 1I80A 4FYHA 4BXOA 4KC0A 2E4YA 2EKQA 2XQIA 4YLEA 1BS2A 1FMLA 1SQ0A 1SXQA 2NYUA 3ESBA 2E2WA 2TSYB 4WZAA 4ZXPA 5EWLA 1FW8A 2DWUA 2XCQA 3DP9A 3EY9A 1U8UA 3QPAA 4QXOA 4XA8A 4Z9FA 1WLSA 2BZ1A 5CX1A 3S5JA 3DP7A 3EOZA 1OQAA 1TO2E 3PGMA 4P53A 3LMKA 3NX4A 4Q7JB 3KCNA 1IJEA 1M54A 4WKBA 3HA2A 1P8AA 3BWXA 3CHYA 3HR4A 1II8B 1RWVA 1WCYA 2A0KA 3CLKA 4O2AB 4UE6A 4AKIA 1H2YA 1DCTA 1AMUA 3E18A 4X6LA 1NRJB 4HDAA 3RFTA 2X9GA 3GCZA 1Z82A 5AW5A 5AJZA 3WMEA 4JWTA 5CDHA 4RTRA 1OJ7A 1Q1NA 4D3ZA 2ZRQA 3T0IA 3QELB 4HD8A 3KSDO 1J07A 1HE1C 2IQIA 1W88A 2R6JA 2WPNA 1T13A 2PX2A 4ZQGA 4ENVA 5L3QA 1TM7E 4CNQA 3UJPA 2EATA 3E81A 3EEBA 1H8HD 3BC1A 1VB3A 2G5TA 3O8QA 4JYBA 3RBXA 1PGQA 2G3YA 1JLHA 3MGCA 4AROA 3VYRB 5JH7B 3T1QA 1VYHA 3TIXB 2X2PA 3TRFA 4P4GA 2DX7A 3TQSA 1KQFA 1JHYA 1CEEA 1CEQA 1N2XA 2ZI7A 1RAIA 4Z8XA 1UBUS 1HYHA 3UA4A 1FX1A 5B1YA 1A7AA 3KKPA 1QIGA 3OA2A 1XK6A 3W6ZA 3WHIA 1AKVA 3H2YA 3Q3VA 5KDLA 3WRXA 3GDGA 3KLPX 2CHVA 2X5OA 4N4AA 4RSMA 1W25A 3P5BA 1LU9A 1T43A 3RS7A 4DIUA 2C2HA 2YWBA 2HIMA 5A5EA 4KMMA 1PL0A 2X4DA 4C87A 5I3CA 2AC7A 2G5CA 2OA0A 4CM6A 2VH5R 2V65A 3KEGA 4MZXA 3WQSB 5DM70 4OK6A 4EGFA 2HK9A 4AK9A 1K8ZB 2BDUA 2ZVQX 3TYXA 2HV9A 2XJ9A 5THKA 2NU6B 2QYOA 2VTBB 3WYNA 1P1FA 1H9BA 3QEMB 2X0DA 3KUXA 2ECOA 3ZEAA 4YPVA 5DXJA 1NVBA 5H59A 5AJXA 4ZDJA 2QRKA 2FAXA 4XARA 4DV3B 3CNBA 2CDRA 3D8SA 1IPEA 4KTVE 3GMIA 2P69A 4F5YA 1VLZA 2AHRA 3A1UA 4UVEA 3KQSA 1SIUA 3LX5A 5E9AA 3VJMA 1GAWA 4OFBA 3OT5A 3JAWB 4UAGA 3LC1O 4LAFA 4YCAA 2B37A 4QX6A 3V1MA 1XNHA 4AUNA 2C9OA 1X77A 5AM4A 2PWZA 2AFHA 3V5NA 3W5DA 4TTRA 4B43A 4XIJA 1XPOA 3KOYA 3GJYA 3SIWA 2D6FA 4NG5A 3OF3A 4PIPA 1HF3A 2ET6A 2IYQA 2XT6A 3R3YA 4IV0A 2R8YA 2RGBA 3U5TA 1ESDA 2JBHA 4FDAA 4JNCA 2FFJA 1BQ3A 4KQEA 2YY6A 3EF3A 5FJIA 1I4TD 4MJ7A 3Q3HA 2UV8A 3FVVA 1DTWB 1PE0A 2NZUG 5EIHA 2QQFA 3V7UA 1E0AA 3AIIA 1Z34A 2C99A 3DAYA 3RUPA 2YVUA 1TIKA 1WUTA 1U9IA 4O5AA 1U3FA 4WTOA 1MTOA 3KJZA 3WLEA 1KAEA 1G5IA 2RIRA 3M9XA 5LQNA 1M83A 3B1VA 4Y3UA 4R0MA 1NRXA 1NUAA 2QRVA 1OX4A 3GEGA 1PFYA 4EJ0A 2JASA 2Z4SA 4DWVA 1MNQA 3V8NA 1N92A 2DPXA 4JXKA 2I9PA 2YWJA 2XZTA 2ZTLA 3KV1A 4GR9A 4RORA 4AJJA 1YB2A 2PIDA 3MTQA 3PDWA 4OQYA 2FJPA 3S99A 1HE2A 2QMHA 3D8BA 4S1PA 3SKYA 3A10A 3X2EA 1BG6A 2QLFA 2X41A 4DLXA 1N25A 2VK1A 5ICFA 1I6WA 1ODLA 3E5NA 1YZHA 4EI8A 3COJA 4MVWA 1WP4A 2DUUA 2V96A 4K6HA 2CGEA 3TEMA 3TGPA 4HS4A 4NNJA 4BBPA 1KMQA 1G5PA 3QEJA 3V8QA 1T8UA 2JJ2D 5HGXA 1BDBA 4BFVA 1GPLA 3RU3A 3ZBPA 4KZPA 1Q1ZA 1R9GA 2DFTA 2Q3DA 4FSHA 2PY6A 5D6NA 1G60A 3PYXA 2ZU0C 1ENZA 2DC1A 3WSTA 2A86A 4QGAA 4G36A 2O57A 3KUCA 2Q4OA 3HR8A 2ZEJA 1Z4NA 3QOFA 2O50A 1U28A 5JBNA 3RAJA 1RWNA 2YYAA 3UMSA 2NO5A 2G4LA 2VR1A 4R01A 3J7TA 1LTHR 4RPGA 5HJ7A 4FU0A 3CBQA 2WHPB 5IJ9A 5KWSA 1O3YA 3O47A 3J80A 5CM8B 3QVLA 5DIZA 1C4OA 1EAYA 3DQQA 1TA4A 1TGYA 2QM0A 4MIOA 3MD9A 5CW2A 1E3WB 4UHJA 5KTOA 1ZIYA 5LXTA 1BN6A 2X8LA 3OX1A 4KQWA 4TVOA 3RWMB 5CTAA 1NTRA 4D6XA 5KOIA 5J4HA 1QHHA 3KU1A 1F8YA 1OV4A 5CB8A 1GM5A 1RD4A 3E7DA 3CGWA 2Y1XA 3V1KA 4F56A 4PCAA 3W5HA 5IX8A 4TL7A 1VCMA 2IRWA 3VI3B 3UXEA 1IAVA 1N7GA 1Z06A 2VHUA 3PYMA 4ZOEA 4C7MA 2R11A 1RHQA 4KPGA 5AKZA 4IGFA 4B7CA 1DS6A 1XVUA 5T57A 1PJQA 2RHBA 1S01A 4IHJA 4TRMA 1NXSA 4JOCA 1QRTA 1N5OX 4OLAA 1FTNA 4UE2A 2FPLA 2BOVA 4AF7A 3AJEA 9ATCA 4MKHA 2O8FA 2QRMA 3GZTB 3IAHA 1MAUA 3V1LA 4MGYR 4OYRA 4CLOA 4RMJA 3LX6A 1EQAA 3DT9A 4BQPA 2IJGX 1X74A 2O2DA 3UFXA 2PZGA 3B48A 3P0IA 2BKXA 1H2EA 1VA4A 2JJQA 3TOZA 2F43B 3KYJB 1KY4A 3X1DA 4YRZA 4CIAA 5JC1A 2Q29A 1T2CA 2EFJA 3NEPX 2ECPA 5B4TA 3TLGA 4XSVA 2VHCA 1JPVA 2UYYA 5BR8B 3A58B 4AJHA 3I61A 2GETA 1YASA 5EE0A 4A2PA 1GR1A 3QI2A 2R44A 1A4UA 4Q7MB 2JFZA 3IVAA 5I7UA 5GV8A 4JITA 3MWDA 3ILHA 4W6QA 3BXHA 4IQFA 10MHA 2XGJA 3RYFA 2WINI 2UVDA 3FN4A 4HO1X 3VC3A 1RAFA 1M8FA 4GEKA 5AIAA 4UFPA 2EU8A 4AY2A 1P33A 2HUPA 1FDUA 3DG9A 3VJLA 3EFOB 2C54A 4WOJA 5FPKA 4TMTA 1QP4A 4OGKA 3FHLA 3I04M 3MQ4A 3X1ZA 4Z0TA 4MV7A 2RHMA 4LGMA 1H65A 2OHOA 1Z45A 1GCUA 5J2UF 1OLUB 4C0LA 3G8DA 4AJOA 2CVQA 1ODSA 1NZDA 1JMYA 3IT2A 3A9UA 5CDSA 4IYJA 1UC5B 3A1CA 3AUKA 3A36A 4UCWA 3BTOA 3U39A 1T6BY 5A03A 3GJ8A 1QR2A 4XJSA 4DCGA 1RWPA 1OIWA 4BYMA 4CF5A 2EP5A 2XE4A 4BVFA 3FGNA 1U0FA 3HY4A 3SI7A 3IDOA 3OLXA 4BMNA 1JQJC 3VJKA 3LBFA 3SF8B 5GZ3A 3SKVA 4KV9A 4CFSA 4EW1A 3RB8A 4TVSA 1T5BA 1WDWB 2OYCA 2G25A 4J2HA 2GUGA 2ZVPX 3B1XA 1YQQA 4GGMX 3MWEA 4KO1S 3C1UA 1C9KA 3F97A 4KZKA 4O3MA 5HBRA 3P5SA 4F4IA 2VYCA 3FHTA 4C0BA 1A69A 4PLWA 3ZDEA 2CZGA 3ER8A 3SR3A 4RABA 1GGJA 2I4RA 1Z5OA 2J5QA 4RC9A 5JYBA 4L07A 1XG5A 3QWFA 1XYGA 1H5UA 2C4VA 4IRXA 5KYVA 3WLFA 2ATIA 1E79D 2A5FA 1MIOA 2NSLA 2O2EA 3N07A 4DNFA 2ZIAA 4KPYA 1N75A 4YRJA 2X8AA 3VSCA 2JC3A 3N2YA 2F9FA 3A3PA 2IBSA 1F4PA 4MV4A 4MYSA 1UC9A 4R8SA 5DX0A 2OWEA 4ZV9A 3EQ2A 3WJ1A 1TL7C 4TTQA 3HO8A 2ZJ1A 3P45A 3L49A 3TJZA 3WXMA 1D2HA 1ZAKA 3GPLA 1YZFA 4KIGA 5PGMA 3IV7A 2XAAA 2ENUA 3D2AA 3EMKA 3NJ8A 1C41A 3ZGOA 5E1MA 2BR4A 3DFIA 4HLNA 4Q7EA 2FWPA 3LGXA 1I36A 2BP7B 3M6LA 3PNPA 5ISMA 1PQYA 2ODQA 3BMNA 4M9RA 4R1UA 3NTOA 3OEEA 3TOSA 2ZSDA 3WS7A 2C5EA 2WIKA 2QE7A 3LBYA 3WHLA 2WTAA 4IUDS 4CHTA 3QRWA 4LY3A 4AXXA 5BMVB 4WV3A 5ETJA 3DLTA 1A9XB 4OI4A 4DLVA 2Y76A 1I10A 2EEPA 2I87A 4TS9A 4JL5A 3TAUA 1YBFA 2GCOA 4J16A 3H16A 1NW9B 3BERA 4JEHA 1CF9A 1F9AA 1W30A 2H7CA 4S24A 4TN1A 5CW1A 5CDGA 1XAJA 5K3OA 4OQFA 2C61A 1CR2A 3LWZA 4OD0A 1T91A 5BT8A 1Q57A 2LV8A 3D3EA 4QUGA 7GPBA 2J0EA 5K0JA 1H1LB 2L0XA 3AEUA 5T4HA 2Z43A 4O8CA 1XVVA 5DWVA 1L5RA 4M38A 1TVKA 1U2GC 1YACA 2BLLA 2EFYA 3A26A 3BB4A 3FFAA 3GX1A 2PCJA 4IO0A 4J1SA 4H6XA 1OZHA 1PNOA 5EMHA 5CB6A 1U0RA 3M5CA 4YAUA 1MEOA 1ETUA 2ZT8A 3FRHA 3HABA 2J59A 2XTNA 3CBGA 3BGIA 4G67A 4AYWA 5L7TA 3K1AB 4YJHA 2JBAA 4UUAA 4KQ2A 4Q1VA 4UNRA 3HKBB 3PK0A 1KP9A 3R76A 1GCAA 4FMBB 2VQ6A 1IG3A 1JS1X 2IV3A 3FYUC 1FLVA 4ALNA 2PG3A 4AZWA 3CXUA 2C59A 2GDZA 2X5JO 5LJIA 3E0QA 2GASA 4EMUA 4AG6A 4ECEA 3AVQA 1OC4A 2XMGA 3QX3A 1N2CE 3PXAA 1E1RD 5DCYA 4O4LA 3AVWA 1GTL1 1PL6A 1UM9A 3LPDA 4JOQA 5FOSA 4A0GA 4QUJA 4EG0A 5IYZB 2XDAA 4Y6OA 1WBJB 3GARA 4RM2A 3T7JA 3ZOKA 4G0QA 4J91A 1XVAA 4K3VA 5HJ2A 4KE8A 3CJQA 4FNGA 4PU0A 4CM8A 1PFWA 3ULKA 1RQRA 2JLYA 4HUJA 1XPRA 4NBLA 2OB1A 2J3IA 2B7BA 2ADFA 3TLCA 3EPKA 2AMLA 2J1LA 1V6AA 3HZRA 4BE7B 1YB4A 2NUPA 3ZE7A 1E7RA 1N0WA 4PC2A 4BAUA 2YN2A 2O0MA 1NQTA 3KUDA 3SP1A 4QRHA 4RE5A 2JZCA 3K05A 4ENQA 2B94A 5KYGA 4IIJA 1KJYA 3R5JA 1RC1A 5ARDA 3CW2A 2CNLA 5G0UA 3T06B 3TR0A 3UM9A 5FUQA 1KU6A 4ITVA 2XB6A 1WF3A 3OZXA 1FQWA 3JY6A 1P8JA 3EOBI 1PNVA 4K8OA 3LI2A 3DJFA 2I2CA 4GYWA 2PGIA 4KRXA 4PG8A 4H7PA 1UFKA 2RONA 4Q4HA 7ADHA 3MHTA 1YWGO 3E48A 1TX4B 3UB2A 3BKXA 5KQGA 3DOHA 4C2BA 1RYNA 1S9HA 3VYVA 2YS7A 4IDPA 4JOSA 4CKWA 5LB2A 4WBSA 1FDOA 4EO4A 1GNVA 1JDPA 4I50F 4FEGA 5FNVF 3G2NA 4MV1A 3SSAA 2B9EA 2ZJAA 5I7WA 5LD2C 2C5SA 4LYJA 2GM9A 3OM1A 4HEJA 2ERCA 4C43A 5D7NA 3HADA 4ZEMA 3WLIA 1DJMA 4N0QA 1KS9A 4DJAA 3QITA 2ZJZA 2X42A 1WDLA 3PNSA 1RKBA 4TM8A 2BKLA 4I3GA 4NPHA 5LVAA 2C7RA 4NICA 4FXPA 3WRWA 4RZ3A 1MUUA 3NZEA 4R2KA 4ZODA 3VR1A 5BV2P 3IX7A 1YSCA 2C3UA 4D8TA 1UBEA 5BUCA 3QKIA 3RS9A 3I6QA 3K4QA 3N5CA 4NCBA 4EKIA 1TU4A 4OXQA 3T9EA 5H70A 2GGSA 4XWOA 1INLA 4DR3B 4BCCA 1W96A 3BD7A 3SAJA 1OYOA 1YR8A 4WKPA 5F5XA 1RT9A 2FSFA 1OAOA 2WJPA 1UDRA 1Z3IX 2AR9A 3RRJA 4HV4A 2IIVA 4BPBA 1CUAA 2YDYA 4ER6A 4MVJM 1VGQA 3CNQS 4I1IA 4IDCA 2HU7A 4WXYB 3BDAA 3UWSA 4F4UA 1K5HA 4ISCA 4E1AA 2UUAB 2FP3A 4LBZA 3H8SA 1KJ9A 2C2ZA 1ZD4A 3JQEA 4W9RA 2LKDA 1E62A 4ZRNA 3T4UA 3TM4A 1HYQA 1WG8A 1TA9A 4LVUA 5KQPA 3BK1A 2GF9A 2UVPA 3A11A 2XNHA 5A02A 3HJGA 1NW3A 3LF1A 3NHBA 4KQKA 2XJ4A 3R7DA 1J8FA 3H19A 4MLZA 4PLFA 2TMYA 1SZDA 2HM7A 3F98A 3HPRA 4YJGB 2J07A 6YASA 3ZJ4A 1YFJA 1DG3A 4DDVA 1BGVA 5DM4A 1L5ZA 1JIUA 3N39C 2YV3A 4KAFA 2X1HA 3IKLA 4G1UC 4RFSA 4YP7A 4L9WA 5GWXA 3WK9A 1UKVY 3NGXA 1HSZA 1Z5VA 5EZ6B 4UTNA 5IAAA 4DABA 2CXSA 2JIDA 1MO5A 1RZ3A 1S8AA 1QUEA 4M8LA 3IAEA 1I6KA 5MGBA 1KRWA 1PR6A 4ZO8A 4RHUA 1D07A 1T9BA 4X1OA 1PT6A 3LOPA 3G82C 1ZN9A 4R2JA 4KAAA 1JSRA 2C5FA 1GPWB 3FX2A 4M6WA 4F4HA 3HGMA 4M0PA 2PYZA 2J30A 1EGAA 1G66A 3C8ZA 1RWMA 2P2ZA 4GW3A 5LB4A 5IKMA 5KMGB 1Z7GA 1JDUA 1U7XA 4D3XA 1U6IA 1US8A 3V4RA 3FOWA 2CXPA 2B30A 4TZ0A 5FUXA 2HQRA 1Z8NA 1NVVQ 2XQGA 2W7TA 5JLAA 1IY9A 2XGSA 3FI0A 5JSZA 1H2WA 2Q3HA 3ESZA 1DKLA 2WU0A 2JCVA 1YOVA 3AEKA 4Q34A 5DYYA 5DV9A 4BFSA 2GZDA 3E4CA 1V7ZA 2FRDA 5K99A 1B6GA 1RBYA 2A1UA 2VBFA 3MINB 5GVRA 4XE5A 2VTDA 3ZWDA 4WXHA 3DZJA 4HUTA 2YQ5A 5GJBA 3MFQA 5EJ6A 3UOAB 5H8WA 4EPXA 1OBOA 4HFRA 2EG5A 2DR2A 3AF5A 2REOA 4L78A 4Y2YA 4G89A 5LWHA 3DE1X 1AKUA 4B6OA 4BO8A 5IVKA 4OGWA 5K01A 1FW6A 2EW8A 1ECLA 4YT2A 1CUFA 1MC4A 4JKIA 3PUKA 3I09A 1XAHA 3H6KA 3NIBA 4JYCA 3H5RA 2HK8A 4QDTA 4D02A 4ZVQA 3EZFA 1OA1A 3OM8A 4HVCA 1OYVA 4RJJA 4AUMA 9MHTA 2ZIXA 1XKTA 5G3ZA 3A6DA 3KOMA 1VE5A 1X1SA 3CO5A 4OIMA 5SY6A 1TYAE 1TI7A 5FULA 4F06A 3TCKA 2J9FA 5IUJC 1J9ZA 1Z6YA 1Y8QA 4K0KB 1ZHFA 2ZBDA 3C3DA 5G1NA 2Q1XA 2XE8A 1RXEA 1ZXLA 5CK5A 4PZYA 5TXGA 5AM2A 3I5YA 2BFEB 4KLAA 4QU5A 5NULA 2Q1TA 1KPGA 2A9FA 2X1VA 1LEHA 4OATA 4Q1AA 3CIOA 4NPAA 3R0VA 3WSVA 4B7ZA 5EIEA 2IYVA 1EFPB 3H2SA 1RI1A 4EMSA 3D6NB 4KAJA 5GIOE 1IN6A 3KXDA 4OHKA 1OXTA 4LTMA 1U4SA 4MV6A 3N6RA 4XXHA 5DSTA 4A23A 1T5LA 5HZHA 3RI3A 1QNFA 3ROQA 1YQDA 2ZBFA 4G84A 5F3DA 3I34X 4BNNA 1S96A 5BSKA 4EEKA 1MC8A 2QLMA 1KOJA 3BRQA 3AVUA 1M2VB 4KXYA 4NJEA 2XUFA 4Y2SA 4BUJA 3RRMA 2NO7A 2QVBA 3FDZB 3G0HA 2CNOA 2CEAA 4HXEB 4O33A 4UZEA 2OLEA 3SC3A 4B6SA 2O5EA 3E53A 1EK5A 2J5KA 3GUCA 3RVMA 1TC1A 1G55A 2H1CA 4V0KA 2G9NA 2ACVA 4FWTA 2I76A 2O2YA 3QPVA 1EFRD 3IAS1 5G02A 3SK0A 3AWIA 3JW8A 4QUDA 5KX5B 4QUBA 5K05A 3N6VA 3E84A 1S2OA 1ZXBA 4GXQA 4XJXA 4ZYUA 1PF7E 3S28A 4EHIA 1FFWA 1V16B 1D8AA 4M98A 4MXDA 1K5DA 4KO3S 3HH8A 4E30A 3EA5A 5T6BA 1ODCA 2A9QA 1UDAA 1USKA 4N1AA 3PFNA 4BMVA 1D1QA 2AXEA 1D5WA 1FOEB 5WRFA 3U37A 4CN8A 2NN3C 1C80A 1TU3A 2P7HA 2XVYA 4XZ3A 1SCUA 4UMVA 5LOVB 2UXCB 3EZ7A 1TFRA 5B4VA 1CK4A 3H4MA 4OUDA 1JYEA 1WXEA 3NVDA 1IEQA 4GOMD 4F04A 1XTTA 4L4YA 1UBOS 2VDKB 2FPWA 2WUFA 2XRMA 2GAIA 4R9UC 4JI5B 3I5XA 2ZBGA 4BTLA 1OMOA 4R0VA 2DGDA 3W7AA 3VO2A 4P34A 2BMAA 3IEIA 3AB7A 1VDMA 2PRKA 4R9RA 3V2IA 3Q5GA 4DG8A 3GUZA 3T52A 2WYOA 3H5OA 1IY8A 3DNMA 4M99A 5LUBA 1VL1A 4Z4IA 1AHNA 1F8UA 4JVLA 1OXMA 3I6IA 4QFBA 3W2HA 1NBIA 3E82A 1P3JA 4RK4A 2O14A 1QLWA 1RS0A 3P97A 6REQA 1XE3A 3NBXX 1KBOA 3TX2A 1AT1A 3A4LA 3L04A 1FDRA 4TPKA 1G42A 2QX8A 2UYGA 2WT4A 3L82B 3ZIUA 1ZGBA 2DUMA 3UAGA 3AR7A 4A0SA 2BFBB 4AF8A 4QUIA 4S3MA 3S68A 4DA6A 2FX2A 1MB2A 3STHA 2VNIA 3CPHA 3NHKA 4PBTA 1R74A 3BJRA 3B20A 1Z37A 4LJYA 3LHIA 5U4QA 4C14A 2F9MA 1DKUA 5LDHA 1AKWA 3CLSD 4YBZA 3PRYA 4CUKA 2VA9A 4RVFA 4FOOA 4UAJA 3ROPA 4N7BA 1KJIA 4U2EA 1X7XB 4X6YA 2AH5A 1TQHA 2GZMA 2YH2A 1S7CA 3FVWA 4UHDA 5IDVA 2P9ZA 2PZLA 5T3UA 5H3CA 1QRUA 2QMUA 3WIEA 2XGOA 2AA3A 4MW9A 1IB0A 4NY1A 3UB4A 2DJ5A 3EYAA 2QL6A 3L01A 5F64A 2YHBA 1GPMA 2HPZA 1J97A 2GX6A 1EQ2A 4DA8A 4YAIA 3HNPA 3LIIA 4LOKA 5IAJA 4B3DA 4DN6A 5I51A 5DTMA 3ZLBA 3PHGA 2HDOA 2X8JB 4YAJA 3Q40A 3L8FA 3GGDA 3QFFA 2C9YA 2X7XA 3UYLA 1M66A 2EL9A 3Q0TA 4GLOA 3VTFA 2Y1WA 1OLOA 4J0QA 1GG2A 1I1NA 3NNNA 5EJ9A 2XWBF 1F3OA 4AMUA 3FCEA 5KTRA 2N9UA 4YRRA 5FEMA 3OURA 3SYMA 1PV2A 3QG5A 1H4TA 2OZPA 2GWRA 3O1HB 1NAHA 2Q8NA 3KKOA 4UVDA 1KQ3A 4A6PA 3QBDA 1M76A 1PTJA 1MABB 3ONDA 2G1UA 4GP9A 4MR7A 4WACA 1DJPA 4UCFA 3SM3A 2PQMA 5K6TA 1ZP6A 2ZUFA 3WSWA 1BKDR 4Q9KA 3AF3A 1C3EA 1E94E 4I4IA 2QMZA 5E4FA 2QQ0A 4E32A 4ZKEA 4BN0A 3DQZA 4UXJA 2DOKA 2D2FA 4A6XA 4A0HA 2JB9A 3NANA 1SVNA 5HKAA 3DL7A 3SDBA 3FPSA 4F46A 5DT9A 4E4RA 1HNWB 3B51X 4Y9RA 3RANA 2YOHA 3PUHA 5JY1A 2C4HA 2J9ZB 2Q5HA 5FWDA 2EYQA 1P31A 1SUDA 2ZRBA 4MW5A 3T38A 3LJKA 1W2WB 5K0NA 1YD7A 2IVZA 2XHEA 4CL3A 1Y37A 1FU4A 2RHWA 2Q62A 1BEEA 2QVLA 2IEYA 3QF7A 4A73A 4PQGA 4L0DA 3X2SA 3CZRA 1M2EA 4BU1A 3HCRA 4CV3A 4W5TA 2WM8A 1P44A 1UOPA 1ADYA 1U1EA 1JL3A 4IO1A 2Z1DA 1VPLA 3SYTA 3LW8A 5DTIA 1A0OA 3DPIA 4GPAA 2DH5A 4I2NA 2GVNA 3RVRA 4FKZA 3BEOA 5DP2A 3W2IA 3LTNC 3N6XA 4DRXA 5F1KA 1U7PA 4B45A 1TZ2A 2EZ8A 3NFYA 5JI2E 1E1CA 1KEUA 4F2PA 2DULA 1TK2A 1IJKA 2Q4RA 1IRXA 3CEAA 4U9UA 3E3NA 1PSZA 3I2FA 1XZHA 3D4OA 1T9CA 2PCLA 3R20A 4Y2RA 2IE8A 2XB2A 2VKTA 1QF6A 4AN0A 2J3LA 1LB1B 1UMCA 3MOSA 4FGLA 5LQSA 4EPYA 3L8EA 2QQ5A 3DBHB 3WQHA 2HF9A 1POXA 4NAUA 4XQEA 1XU4A 4FCWA 4RTJA 1GQOA 1PDVA 1D6SA 2OGTA 2G5GX 2X5XA 1RTTA 3EDRA 3OUZA 3CRNA 3PVSA 4BNDB 1QGUA 4P2BA 3TLBA 1F6BA 5EYPB 4FR5A 5E8RA 2I7DA 2Q6OA 2V4ZA 1KAOA 3ITNA 4P4UA 4B2IA 1TEXA 3PPWA 1K5GA 2H1RA 2ZPUA 5E7MA 2WR8A 4QJ3A 1KH1A 4JBGA 4IGEA 5BVGA 1VI5A 2H2AA 2XECA 4INPA 4RQAA 5G0VA 2XDYA 4XM0A 2ZAYA 1Y48E 2I29A 1BA3A 2GO1A 1CB7A 2R2AA 3F78A 3GCDA 3GT3A 3NONA 5DF1A 3DFUA 3NR2A 5GGYA 4NHEA 3WQQA 4BX3A 3QHPA 4TMKA 2HLDA 3TIVA 3R7WB 1YA4A 5ALJA 3UK2A 1E9EA 3ZXIA 1F4VA 3DEJA 3DKIA 2QQEA 3MJHA 5I7HA 1QGYA 5CT9A 1QTRA 1IIRA 4FX2A 2NO9A 4GP7A 2HNKA 5LYJF 5HM6A 1DIAA 2VSXA 1OKKA 4B9AA 1HL7A 1XN1A 2FZVA 3B3GA 2HEGA 2AQHA 4XB6B 1CRQA 1K8XB 4I6JA 5JRZA 4JJKA 3PWZA 4H3HB 1VE1A 2C29D 1E77A 1IG0A 1HDGO 2DU8A 1WJGA 3R0QA 2RHDA 4G1MB 2OXCA 4YHBA 2R97A 2HU8A 2VS1A 3MGAA 4HLCA 4N82A 4W63A 1Q44A 3TJMA 3I76A 2LDXA 4F97A 4DSUA 2HA0A 1JG7A 3GXBA 2V3WA 1AKRA 3RUAA 5JPCA 3R9XA 1VKZA 4MYCA 4Q9AA 4EHJA 1X1BA 5KTMA 1DC3A 4ZMSA 2GBGA 4V38A 2ETXA 1HTTA 3CA8A 1JWBB 4TTPA 7ABPA 3L8ZA 1N3LA 2O5CA 3TSWA 1HFJA 1BDJA 2RAPA 4GX1A 3K3PA 1WHTA 1RJ9B 2OV2A 2AR0A 2QLLA 3F96A 3KTAA 2ZBPA 3HB4X 3L07A 1Z8FA 3LUPA 4MW2A 1QCYA 5K4GA 3CXRA 1O97C 1PL8A 2GZ1A 2ZANA 3P2MA 2ZVJA 4XLZA 4YQZA 5DK4A 4BVKA 3BB1A 4TXMA 1VCIA 2ECKA 3TB4A 2VDRB 2VQEB 3NFRA 1D0VA 2HBQA 3C3MA 4H08A 3E1KA 5HA5A 4R98A 1EX9A 4U9IS 3AETA 5K3FB 5JC8A 5JARA 2QENA 4HRAA 1ZO8A 2OM6A 4F9GA 5H4HA 3EDOA 1NM5C 3JQ7B 3LM8A 1K3UB 1G8KA 1PFKA 4KWCA 5AKGA 4IKEA 2B8JA 4CTMA 2QU8A 2NQTA 1V45E 5KSOA 1WSAA 1GR0A 1P5JA 2F1IA 3BRWA 3QWIA 2B0JA