1MXFA

Crystal structure of inhibitor complex of putative pteridine reductase 2 (ptr2) from trypanosoma cruzi
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
266
structure length
247
Chain Sequence
CPAAVITGGARRIGHSIAVRLHQQGFRVVVHYRHSEGAAQRLVAELNAARAGSAVLCKGDLSLSSSLLDCCEDIIDCSFRAFGRCDVLVNNASAYYPTPLLPKPIDAQVAELFGSNAVAPLFLIRAFARRQNLSVVNLCDAMTDLPLPGFCVYTMAKHALGGLTRAAALELAPRHIRVNAVAPGLSLLPPAMPQETQEEYRRKVPLGQSEASAAQIADAIAFLVSKDAGYITGTTLKVDGGLILARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 2
publication title Crystal structure of Trypanosoma cruzi pteridine reductase 2 in complex with a substrate and an inhibitor.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
total genus 86
structure length 247
sequence length 266
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1mxfA00
1AGNA 4OSPA 3NDJA 3BA1A 2Q46A 3LC2O 1LXCA 3WGOA 4D3SA 2HMSA 4AL4A 1Y1PA 1UXGA 5BNFA 3UHAA 1WDKA 2VUTA 3UW3A 1P9LA 3C85A 4L74A 2EW2A 3PP8A 4HNHA 2DLDA 3WFJA 4B7UA 4FGSA 4A27A 3JQ8A 3JQBC 3K8ZA 2I3GA 3PYMA 1UP7A 3PDUA 3PHJA 4NQZA 4FD3A 5ICMA 5LDGA 4PLVA 1DB3A 1RM5A 3E9MA 1Y9AA 3FN4A 3I4CA 4KWHA 4L4RA 5G4KA 4MIEA 1I10A 2NVBA 1O5IA 3LT1A 2G5CA 4GH5A 1BXGA 2O2SA 1BGVA 3S1LA 1C1DA 4NR0A 4Z3KA 5L51A 3GH3A 3TRIA 3I4FA 1GQQA 3JQGA 4BB6A 4GX1A 5T6BA 4JQCA 5CP8A 3GUCA 2VOEA 1X7HA 4Y6SA 1R4MA 4RPKA 2VZ9A 4IZHA 3WWZA 4O5OA 4RGBA 3C24A 4JNKA 1X1TA 2B5VA 2CVQA 5DP1A 4O0LA 4D79A 3ZHXA 4E2XA 4B3JA 1RM0A 4YJFB 4Q3AA 4D45A 3PZRA 5DDIP 4QECA 1ZSVA 1UJMA 3ROPA 3DOCA 4RPLA 1QYDA 4W6ZA 5JE8A 4B8WA 3ZHZA 1T2DA 3EMKA 4K6FA 5I7FA 4D3FA 3FPLA 4PVCA 3R3SA 3WBBA 3PYXA 3BMNB 3DMTC 3KYDB 4ND5A 5ADHA 1N7HA 3PLNA 4R1UA 2EV9A 5JPIA 4ALNA 3INTA 2AG5A 3O9ZA 3GRPA 3ZWVA 1PU2A 5CAEA 4W9NA 4BNTA 1DRVA 3A1NA 2H9IA 4HBGA 3EW7A 1HDXA 1K6IA 4L8VA 5TGDA 2ZJ0A 4YJHA 1HSOA 2AEFA 5A03A 2GN9A 2AE2A 4XQEA 2PKRA 4KUHA 2JL1A 1MG0A 4EW6A 4L4XA 3NV9A 1ULUA 4J43A 1CJCA 1HYGA 5JYDA 1E7YA 2GGSA 3B6ZA 3D7LA 1G6KA 4U0JA 3IJPA 3HB4X 2CUKA 3F4LA 5G2OA 2C07A 2G1UA 1XCBA 1MLDA 3RIHA 3TOZA 3ZN2A 2WWRA 5AVOA 4A26A 1E3WA 3OP4A 1EZ4A 4Y98A 4EEXA 1ZBQA 4RZHA 3JYPA 2V6MA 3DBRA 1VL6A 4PLWA 3QW2A 2W8ZA 1QRRA 3L6DA 3A06A 2HJRA 3ZV3A 2ZJ1A 4BVAA 3JYOA 1BWSA 4AFNA 1HSZA 5U9CA 5DF1A 2CVOA 2RAFA 3UCFA 4A7PA 1VI2A 2PK3A 3GDGA 1N5DA 1YBMA 3ZU3A 3GC6A 2HQ1A 5DCUA 1DAOA 2ZIZA 3L0DA 4MKXA 1N2SA 5TS3A 3RUFA 2Y66A 1D7OA 2X86A 4XGNA 4DGSA 2EP7A 4NNJA 3FTPA 2P9EA 1YGYA 4BUCA 3KV3O 2F1KA 2FMUA 3V1TC 4BO8A 1PQWA 4D0SA 4M49A 2QZ9A 2QRJA 3OBBA 4AJHA 1Z75A 1ZK0A 3ONFA 1HYEA 1AXGA 3I23A 4YJGA 5I9LA 3ZZNA 3DMYA 4J9UE 4RVFA 3W8DA 2NVUA 1E5LA 4GL4A 5A02A 3CSDA 3T4XA 4ZRNA 2NACA 4M8SA 3IP3A 4OYRA 5AXDA 4Z3DA 5EERA 4PLHA 4IQ8A 1Y7TA 5THQA 3OHSX 4ID9A 4FN4A 1E7SA 3RBXA 2HK9A 1Y8RB 4ALMA 3H5RA 4I8XA 3L77A 2QX7A 5MDHA 2X4GA 1RPNA 2QHXA 3W4JA 3V2GA 3KLPX 3ZU2A 3F1KA 1QMGA 1LEHA 2W4QA 2QIOA 1A71A 2FPGA 5CG2A 4CMIB 2ZB3A 3OIDA 3K30A 2ZTLA 4OM8A 1PJ2A 5L53A 4B8ZA 2HMTA 1QXSA 3VVBA 1H9BA 1NVTA 1YOVB 4A03A 1I36A 3DC2A 2H5LA 4KTVE 4MP8A 2NNLD 4I1IA 3CZRA 2B35A 4OMUA 5F1PA 1HRDA 4ITUA 1Y8QA 4KTTE 1M2WA 1SB8A 3D3WA 2B4TO 4DIOA 5CFZA 4D44A 4PZEA 3C7DB 2BGKA 4PLYA 1E1NA 1U4OA 3KM0A 3HNPA 5H83A 4BNVA 2Z1NA 2EEZA 3S55A 1XQ6A 7MDHA 3LT4A 2CDCA 1PL8A 3D0OA 1P33A 4QFDA 4DUPA 4XCVA 4CMCA 2UV8A 3CPSA 1PJTA 4CMAA 1HL3A 3AUTA 4CM3A 5CDGA 3AOEA 5A4DA 1RM4A 5G0SA 1YBAA 3VDQA 2X9GA 2C59A 3ZDFA 1ZO8A 1NWHA 4FIZA 4BGEA 5FF9A 2VRCA 2RH8A 1PJ4A 2UVDA 3G3EA 4A10A 2BH9A 4XD2A 5COAA 3P19A 3RBVA 1X13A 3WDSA 1TB4A 3BTUA 1B8VA 2AHRA 3KETA 3L6OO 3TWOA 1TT5B 2XAAA 4PLPA 3TZHA 3JQ7A 3MJ4A 4R9SA 4C7KA 5CEJA 4RVSA 4YT5A 3ANMA 2D4AA 3LLSA 4MDHA 3RC1A 3QVXA 2X9NA 3H3FA 4PVDA 1Z73A 4HWKA 1PSDA 3SEFA 2WMDA 3A28A 2D2IA 2VCYA 3L4BA 5IDQA 1IULA 5A5FA 1FK8A 4H7PA 3AU9A 2Q49A 1HDRA 2O3JA 1F12A 5K0ZA 3NGLA 4QEDA 1DC4A 3AUSA 1HKUA 4BKRA 2NUAA 4WOKA 1IHYA 1ZJYA 4BNYA 1X14A 4KQXA 1LC0A 4P8RA 2V7PA 1VC2A 1EQ2A 1O89A 1LU9A 4DC0A 4DXHA 4PG8A 1T1RA 1ZZEA 2DM6A 3IOYA 4U6QA 4DBVO 4HY3A 1PEDA 1WXDA 2PV7A 5DNAA 3E1KA 4IDFA 1GEGA 3IIEA 4L9RA 1E7RA 4UVEA 4BNIA 4ZN6A 5JY6A 2I65A 3WR5A 2C5EA 4J16A 3ZWAA 3NRCA 4CMEA 4QX6A 4I5FA 3X2EA 1NNUA 1PZFA 2NV6A 2VYVA 4AJ2A 2QRLA 4KQWA 1J0XO 4UUMA 4DREA 1QSGA 1K2WA 5I9NA 3RUIA 1PZHA 3GN1A 2GRAA 4XJSA 2NQTA 1H93A 2EF1A 2GSDA 4PLGA 2J3HA 1HE2A 3ZWOA 3JYQA 1SEVA 1LBEA 2VQ3A 5LC1A 1LSOA 5GY7A 3CUKA 1SPXA 4U0KA 3PHLA 4NBUA 4CR7A 4AJPA 3GVIA 2FSSA 3C1AA 5AXAA 4D0RA 2WD7B 1H2BA 2OFPA 3KVOA 2JAHA 3G1UA 1S7CA 4MINA 5FEUA 3BMOB 5A06A 1BMDA 1V35A 4U8GA 3E5MA 4YRAA 2GUGA 1SZJG 1T26A 1H6DA 3WJAA 4GLOA 4IDAA 3FRJA 1NBOA 1TVEA 1W8DA 3QRWA 3CEAA 1NFQA 3U4HA 1L7DA 1UAGA 3NTRA 1Y6JA 4CM8A 4I5GA 4MVJP 1ZMOA 4D41A 1DRWA 2IZ0A 3PQEA 4E31A 5BNTA 4GVXA 2TMDA 1JLLA 4YBZA 9LDBA 3ZNOA 4BOYA 3EUWA 4IJKA 5IN5A 1MFZA 2GZ2A 5CPFA 4MP6A 3FSRA 2IZZA 1NR7A 1SC6A 1GCUA 3WNQA 1XYGA 3FR8A 2Y1EA 3RCBA 1LSSA 3GPDG 4RDIA 1ZIDA 4TWRA 1BTOA 3AFMA 3WGZA 5TC4A 3O8QA 4P38A 3LC1O 3LLVA 4II3A 2O7SA 4ILKA 1U28A 5IG2A 4CV0A 3GR6A 1HDGO 3MOGA 1YDWA 4CMBA 1F14A 1B15A 2YQ5A 2HMVA 4B4VA 3D4NA 3GZ4A 3OH8A 1LSUA 4P22A 5JYEA 2O4UX 4NBWA 1WW8A 1PGNA 1P1RA 3E48A 4B7CA 2V65A 2YFHA 1UUFA 1V3UA 4BO2A 1XQ1A 3B1JA 4E2YA 1ZFNA 3RFTA 3ENNA 4WUVA 1D1TA 4Z0PA 3MZ0A 1K0UA 5JMPA 3A14A 2Q99A 5TNXA 5KIAA 5C3MA 1H9AA 2JHGA 4L75A 2BF7A 3PYLA 3GG2A 4NI5A 3W6UA 1U2GA 3WTCA 5JMWA 4J9VA 1BHSA 1UXJA 3I6IA 4J7XA 4RVUA 5DOZA 1KVSA 2C5AA 2Z1MA 3ST7A 3H5AA 3ASVA 3GVHA 1U5CA 3Q6IA 4OQYA 3B70A 4KWIA 4I9NA 4BNHA 1VLLA 3ZV4A 5IDYA 4NFSA 5T8KA 4R3WA 5JW6A 3W6ZA 5C5IA 2Y99A 1T2FA 3AW9A 3GN2A 5FYDA 1EBFA 4RLSA 3WGTA 5GZ1A 2Y93A 4E2ZA 3CIFA 2BGLA 1PJCA 4BS9A 4WEQA 1MUUA 3BIOA 3NT4A 4QFCA 1PS0A 3G1TA 5JC8A 2NWQA 2Q4EA 4IJVA 4DPLA 1GPJA 1P45A 5FFFA 5IFLA 1Q2XA 4WOJA 2D5CA 1GCOA 1UH5A 6LDHA 2NSDA 5IZCA 1VKOA 3ZHYA 4CQMB 3HDJA 1IYZA 3DB2A 4NMHA 1YE3A 4U5QA 1ZK2A 4Y8VA 3VH4A 3S2FA 2Q45A 1B3BA 4CLRB 4J90A 1DAPA 1OZAA 4NBRA 4OKNA 1F06A 1KEPA 2PZJA 3QA9A 2UYYA 3PWSA 1IY8A 1EBUA 1ENYA 1WMBA 4I9UA 2B37A 4EJ6A 4NJMA 3G0OA 9LDTA 1PIWA 2I66A 4FOOA 3OF2A 1EFLA 1BW9B 3L4SO 1QYXA 5ILOA 2J3IA 1U3UA 4KZPA 3AY3A 2P91A 3FR7A 4G81A 1GUFA 4H15A 1WAMA 3PWKA 2DBVO 4KDFA 4YAJA 1H94A 4R01A 3WG9A 1R4NA 5CDSA 4DVJA 4E5KA 2DFVA 3JQBA 3R0IA 3GMDA 4HFJA 4BO4A 3WYEA 3H9EO 1K6JA 5KVQA 4CMHA 1VM6A 2WE8A 2PGLA 1YL6A 1LUAA 5LDHA 5KVCA 4WNCA 4ALLA 3MJTA 4QUKA 3RUEA 1RWBA 1YQXA 2DUUA 3T7CA 2PD6A 2NTNA 1H2HA 3UCXA 3CTMA 2E48A 2IXAA 3H2SA 2VRBA 3L9XA 3Q11A 2A35A 2X0NA 4RVGA 1DJNA 4R69A 4UUPA 3ROKA 3JD4A 1QKIA 5KOIA 2O3TA 4OOEA 1MG5A 1WDMA 1U5AA 2VT3A 1LDYA 2X1HA 3GMSA 3INGA 1P1KA 4WGGA 1C0LA 4DPKA 3NT5A 1XLTA 3VH3A 2D1YA 3H9JA 3FF4A 3MTGA 1HDCA 5THKA 3HFGA 2OZPA 1C14A 1SOWA 5GZ3A 1TEHA 4FSHA 5KKAA 3SBOA 3FNEA 3UVEA 5A5EA 3V1YA 1PJQA 3UUWA 3OEWA 5G0TA 2IEDA 1P74A 4W99A 1HZZA 4B4OA 3JQAB 2DPGA 3OQ6A 1RM3A 1U8FO 4BL5A 2QRKA 4J7UA 1C0PA 2I99A 3EVNA 5K6AA 2YDXA 3H8VA 2D3TA 4ZHSA 1R16A 1ADGA 1CWUA 4JK3A 3CZMA 4YQYA 4GSKA 4QXMA 3BMQA 4FJ0A 3AM5A 4BB5A 3ZWPA 1LSJA 1BVUA 5F5LA 4DC1A 2BMAA 3AM3A 5IDWA 1CRWG 4OSOA 1BG6A 4RVDA 1BRMA 2I6TA 1WZIA 4JBGA 1MXHA 1VRWA 5ICSA 2JHFA 1N92A 3A9WA 4NH4A 1YVEI 1P0CA 4EYEA 2NU7A 3KB6A 3FWZA 1V3VA 1U9JA 5I9MA 4PLCA 3HSKA 1P1HA 1YONA 4WJZA 5C7IO 4Z9YA 3RAJA 2P68A 1MX3A 3AWDA 5JLAA 4BMSA 2GYYA 1T4DA 3C1TA 3I3OA 3QSGA 3WQRA 4BNWA 3DFZA 5A9SA 5KNLA 4MVJA 5KTKA 2HUNA 4BGUA 4W7IA 2Q2QA 3DHNA 5DBFA 4BKUA 3MJCA 5BSEA 1GU7A 1R66A 2QQ5A 4E32A 5C7LO 3UCEA 1DFIA 1Y9EA 2V6FA 5L4NA 1JKIA 3WMXA 2RH4A 1ENOA 1WP4A 3HG7A 3M2TA 1P31A 2W90A 1EVJA 3PGXA 1NPTO 3I9NA 4CL3A 2X58A 2GLXA 1GADO 2O3UA 4LW8A 4XDZA 4XQ9A 4BNFA 4EITA 3I5MA 1UAYA 1HTBA 2EG9A 2ZQZA 4TKLA 4Y6RA 3U4CA 5JFOA 4C7JA 4Q3CA 3TL2A 4BMNA 3DL2A 4FJ1A 1Y81A 3H6KA 1MFPA 4N5NA 1ZH8A 2OL4A 5TT1A 5EN4A 1ONOA 2PZLA 3JQ9C 1T4BA 3HUDA 1KY5A 4YDRA 1NR1A 4DQXA 1QYWA 4YJFA 3KYCB 5B4VA 1UP6A 2DTDA 3WFIA 3JQDA 5JC1A 3RD5A 1JU9A 2VZ8A 1HXHA 2JCVA 2B0JA 4EUEA 1LLDA 1XSEA 3DHEA 4YT4A 3CE6A 1VE9A 3OMLA 2DVMA 4J49A 4J2HA 3BMNA 3KYDA 2YHUA 2CF5A 4F46A 5I7VA 1UR5A 3VAZA 4CR8A 3TF5A 2J5QA 2ZK7A 5BNIA 3GPIA 4CMGA 3QVOA 3QY9A 1GFSA 1EUDA 1DRUA 1GUZA 3OFSA 4RCVA 3PIDA 4MJLA 4M54A 5KJEA 1IHXA 4OO3A 4CODB 1XEAA 1U3WA 3VKUA 3UFXA 5ITWA 3F3SA 3GRKA 3OJOA 4YAKA 1PTJA 2YYYA 2HRBA 2VN8A 5AOVA 3WTBA 2O7QA 1LRKA 4F3YA 2HRZA 4WPGA 3TZKA 7ADHA 4BQRA 2VUSA 4ZD6A 3BTOA 1XIVA 3HADA 3JYLA 1C0KA 3PJEA 1E3IA 2JD1A 1ZW1A 4WLNA 2EERA 4LGVA 4AJ4A 1MXFA 3QIVA 1N1GA 4BO1A 3A4VA 4CLEA 4JROA 3GVPA 3K6JA 4WLEA 1GV0A 3KZVA 4ND1A 5I8WA 1JVBA 4YQZA 1U1IA 5F1OA 3QLJA 2XOXA 4IMRA 3GT0A 4NBTA 5A05A 4CL8A 3OICA 4I08A 3O03A 3ETDA 5ILGA 1B3RA 1VSUA 3FNGA 1UXKA 4LCEA 4WCFB 4DMMA 5C7OO 4Z0HO 4AJOA 1E3LA 3ZWMA 3TFQA 3ZNNA 4TSKA 3CXRA 4W7HA 3I9JA 1VPDA 3DEYX 4C4OA 3WICA 3OJ0A 1YB4A 3G17A 4FFOA 4J1TA 1Q0QA 1HE4A 2QG4A 3SLKA 1T2AA 4E3ZA 2AA3A 2YDYA 4GAEA 3WGGA 2VNSA 4XWYA 3BTVA 4JGBA 4XYLA 1UZMA 3MWDB 5BSHA 1CF2O 3ENKA 4YTEA 1PZGA 1H6AA 2ZB7A 3PFWO 1GY8A 3ICCA 5U4QA 3C3XA 4XR9A 2WYVA 3F4BA 2LDBA 4R54A 5B4UA 4IJWA 1KBZA 5I8ZA 5JAIA 1IB6A 2BI8A 4PN3A 2O50A 1PZEA 1IUKA 3W8FA 1EK6A 1ID1A 2QYSA 1ZJZA 2VUUA 3F47A 3PRJA 4TRNA 1Y8RA 3RI3A 4WE3A 2C54A 1KVTA 3C7CB 4K28A 3FBGA 3T7EA 2X5KO 3BAZA 1OBFO 3I9KA 1L7EA 1GQYA 4MIOA 2OO5A 4CMIA 5L3ZA 4ZQBA 2JD0A 2J5RA 4QSMA 5ES3A 1U2DA 3R1IA 2G0TA 5HS6A 3QWBA 2WYUA 4BNLA 2E6UX 3NTOA 1YOVA 3F5QA 2AMFA 4KUGA 4YEDA 5JDIA 2I9PA 3UKOA 2FR0A 1LDNA 1YWGO 4I5DA 4RDHA 2PD3A 5B1YA 4QT0A 1W0CA 3GGPA 2PZKA 1E7QA 1DIBA 4HFNA 4GWKA 3VVCA 2Q1UA 3AK4A 4J3FA 4GX2A 5CEEA 3Q9NA 4IXWA 1EVYA 3ON5A 3ITDA 4XZ3A 3LZ6A 2ZTUA 2OXIA 2PLAA 3GQVA 2E37A 4HX5A 3RU7A 1GPDG 4GMFA 3DBLB 5DT9A 1J4AA 4XYMA 3GY0A 1RKXA 3ZU4A 3M2PA 2VNAA 1LX6A 5DCYA 4CLOB 1IOLA 3IQDB 3TZ6A 5C37A 3K2BA 3SX2A 2WE7A 3FNHA 3LC7O 4NBVA 1NWCA 4CM6A 1QP8A 1KS9A 3LYLA 4IJUA 3ITKA 1EVZA 1CQJA 1PQPA 4OL9A 1GYRA 1MC4A 3AM4A 4YXFA 4R5HA 2OUIA 5T67A 2I5PO 3EDMA 1M75A 5CPBA 1B26A 1R6DA 2DBZA 2YUTA 1QV6A 3W8EA 4WCFC 1WLYA 4MPDA 4WASA 2PGJA 4AJKA 1TT5A 2JCXA 1E5QA 4CM9D 2GZ1A 2DTEA 3QJ5A 4CV3A 1ZEJA 2DKNA 4KP7A 4UVGA 4PIVA 2QYTA 4R4JA 3KTDA 3D4PA 3KLMX 5I7EA 2PGDA 4TKMA 1AHIA 2Q2WA 2VTDA 2XF8A 1JKJA 1K6XA 1WPQA 2X0JA 4TZTA 1LNQA 4OXKA 2P5UA 1A5ZA 1X7GA 3JQEA 1CERA 4NIMA 4E21A 3JD1A 3HQ4O 1PL7A 4HKTA 4RPHA 4ZQHA 2EW8A 2XXJA 5JAQA 4WLVA 4UULA 5B12A 1O6ZA 3OJFA 1DIRA 3R6DA 1DLIA 1O94A 2D0IA 1ISIA 3H9QA 2XXBA 1ZMTA 3UAGA 1E3EA 4RO0A 2VHZA 3GFBA 3PTZA 5IF3A 5JCJD 3VPFA 4RJTA 4WK6A 4JJGA 4W9NC 1XWFA 3IS3A 3LQFA 3NEPX 4XR4A 1V6AA 1U3TA 3MTJA 1KIFA 1VL8A 1PL6A 2YFQA 1BVRA 4CLHA 2AEMA 2LDXA 5JDCA 5K9ZA 3CINA 1K89A 5CDTA 1T2EA 3JSAA 3V5NA 3ULKA 1YB5A 3PQDA 4A5OA 2B4RO 1EMDA 1EDOA 3LU1A 4EUFA 1K3TA 5T57A 4YT8A 3TZQA 1E1LA 1I2ZA 4XKJA 1KERA 4PCVA 1LTHR 3PHGA 4BNGA 3LF2A 1GZ6A 4RF2A 3KBOA 2WD7A 4R1TA 5IJZA 2Y68A 3N74A 4CQMD 3JQ6A 2EKQA 3QQPA 5JNLA 4D43A 3BMOA 1EE2A 3FCOA 2DTXA 3KSUA 3LK7A 1I3NA 2IYOA 2VT2A 1DIAA 5TJHA 3ABIA 1DC6A 5H81A 5COBA 3OQBA 2EIHA 1EE9A 2O23A 3PJFA 2B5WA 3C8MA 4DYVA 3H9GA 4DPMA 3TSCA 2EP5A 2A9FA 3PIIA 3MJVA 1YB1A 4I5EA 3OECA 4ALKA 1O9BA 2B83A 3LDHA 4B7XA 3PPIA 2HAEA 2W98A 4YA6A 2ZYAA 1NQ5A 1WNTA 2Q1TA 4E5PA 5EQFA 3WYCA 3MJSA 3OIGA 3H5NA 3HZZA 3UXYA 4G5HA 2J3KA 1DC5A 4DLLA 1EDZA 2BFAA 2AQIA 3Q2IA 4YAEA 3ZHBA 1HZJA 3JQFA 1JA9A 3R3JA 3BMCB 2POQX 5DN9A 3AFNA 4NFYA 3FD8A 3QWFA 3MOIA 4CUJA 3U0BA 4RQTA 5JSFA 1NVGA 4ND3A 2W2KB 3ZV6A 1MB4A 2PNFA 1GUYA 2BRUA 4UEKA 4JJIA 1CIVA 2B36A 2J5KA 2PKQP 1GYPA 4Q3EA 4CQLB 8LDHA 2OP0A 2GERA 1V8BA 5L4LA 1UZNA 3D4OA 4N18A 3QWHA 3JD2A 4B79A 4BKPA 4FC6A 4X54A 3WNVA 1PX0A 3AI2A 4IXTA 1OFGA 1LI4A 4BNUA 3EHEA 3TN7A 4FB5A 2B69A 2J8ZA 2WJPA 2GD1O 3PFFA 1WWKA 4XRGA 2QZZA 4EJ0A 2UUOA 1DJQA 4BO5A 4OKIA 5TIIA 4K6CA 3OJLA 2FR1A 3FI9A 3GK3A 3KOUA 1GDHA 2PR2A 3H65A 1GTMA 4NU6A 3IKTA 1GR0A 4UVHA 3NJ4A 2UUPA 3EC7A 4CMKA 5L7WA 3ONEA 5HRUA 3FHLA 4PRKA 1NX6A 1YH3A 4EEZA 1T25A 3G79A 2GASA 4DRYA 1J6UA 4LVUA 3JQAD 1YDEA 3QE3A 1PJSA 2X7HA 2YJZA 1DHTA 5F5NA 4N5MA 3UH1A 3OA2A 4BMVA 1I30A 2H6EA 3DZKA 3V2HA 2YY7A 1JAXA 3NYWA 3QWIA 3ZV5A 5KCZA 3X2FA 2FHSA 2Y1OA 4ZGWA 3P2YA 4GGOA 5U1PA 2CZCA 4CM7A 2BFMA 1HEUA 3U3XA 3FPCA 4AJNA 1HDYA 4CQMA 2IYPA 3UF0A 4D46A 3DOOA 4CLRA 1LLQA 2A4KA 1HT0A 4Y67A 1F0YA 5EQDA 1OMOA 4GQAA 5G0VA 5EMHA 2Y1GA 3WGHA 3AOEC 3VOSA 2BHLA 1H6CA 3DZBA 4LN1A 3SC4A 1V3TA 4XB2A 4Z6KA 4BO0A 2CDAA 4IDCA 4AJEA 1BW9A 2DT5A 3DBVO 3SJ7A 1VJTA 3PZBA 1ZVMA 1KC3A 5MGBA 4CLDA 5FI5A 2YW9A 2HK7A 5FI3A 1IE3A 1U4SA 1RYEA 3IAHA 3IUPA 1ISHA 2ZTVA 5BSFA 4JXKA 4OXNA 3ASUA 3QP9A 2ZCVA 4ESOA 2NTJA 1NAIA 2Q1WA 1IPFA 1A72A 1HE3A 2BFPA 4NK5A 1U8XX 3PJDA 1FMCA 5LCXA 5ENVA 3GVCA 3L07A 1T2CA 1LQUA 5JO9A 3E9NA 1E6EA 4QO8A 1QLHA 1UDCA 2Q1SA 4JBHA 2WEKA 4XQGA 2Q3EA 3RKUA 3TOXA 2I3AA 1LJ8A 2NVWA 4MVJF 3QWAA 1HE5A 2WTBA 4J7CA 4PG6A 1GQ2A 3ONDA 1XU7A 4IQGA 4Y9DA 1B8PA 3E6AA 4RQUA 3TPCA 5HA5A 1N9GB 1LDEA 3C7AA 3JQ9A 2O3SA 1L1FA 4NK4A 4M87A 1M6HA 4HV4A 1I2CA 3H7AA 3I1JA 4E12A 3K73O 1P1FA 4W4TA 4GI2A 4YB8A 1KOLA 4K9DA 3GVXA 3HWRA 1T1SA 4FFRA 3SJUA 5ER6A 4YAGA 2A94A 4EUHA 2VHXA 1WMAA 6ADHA 1LDBA 4FJ2A 1U7TA 1ZEMA 2BI7A 5KWEA 4H16A 4ZVVA 5IXSA 3BHMA 5EIOA 3PDJA 2EXXA 3PWZA 1HDOA 1B14A 1DOHA 4G65A 4RF4A 4DQVA 4W82A 3NJ8A 3K31A 3PLRA 1HLPA 3ANLA 4GSLA 3U4DA 1ULSA 1ZKMA 2P4HX 2GN4A 1B7GO 3JQAA 4M89A 1N7GA 3GOHA 4CJXA 1W6UA 4IBOA 4DL9A 4IIUA 4MVJI 3U9LA 1ZK3A 5IN4A 4AG3A 4XB1A 1B16A 3EK2A 2DAPA 5KJFA 1I33A 2F00A 3RBZA 1I3LA 3D3EA 4U6SA 5T5QA 3RROA 4CM4B 4BNZA 1Z82A 2HMWA 1LQTA 4L0QA 4HNGA 2FZWA 4AVYA 4N7RA 2NM0A 3WOHA 3DMTA 5DCWA 3OETA 3QV1A 3VZSA 4JCOA 2FZEA 5CHEA 3RWBA 5HWSA 3IP1A 3ZH2A 4WLFA 1KEVA 4IGEA 2FR8A 4JP3A 4MP3A 4XYEA 3VTZA 2IE0A 2OHXA 3DZJA 1JWAB 4Q9NA 2BELA 1G1AA 4U7WA 3GHYA 1EUCA 4WLUA 3VPXA 2JFFA 1YRLA 1IZ0A 1NPDA 3N7UA 1X0VA 3GA0A 1XDWA 1UXIA 1DHRA 5CDUA 3S2IA 1NHGA 4P4GA 2P9GA 4ZJUA 1DSSG 1ADCA 2PFGA 1TI7A 4NG5A 1NFFA 3VZQA 1P1IA 1UXHA 1GV1A 1U3VA 4FCCA 1ISMA 4F6CA 1VJ0A 3PEFA 3F5SA 2P5YA 1N1EA 3NT2A 1CYDA 4OQZA 2SCUA 3DBHB 3O26A 3LSYA 4ROSA 1JWBB 1JW9B 2Z95A 4E2WA 1ADBA 2GNAA 5BQFA 2C29D 2CSUA 4BGVA 4FBGA 4RLHA 4XJTA 3ZW8A 3W4KA 2W2LD 5IZ4A 1DFGA 4GWGA 4DLAA 2EKLA 5A04A 3AUUA 4NFHA 3GF4A 1NQTA 2PWZA 4RORA 5COQA 4WEOA 4RVHA 3QVWA 3F9IA 1ISFA 1JKFA 3WGIA 1NAHA 2VWPA 3KUXA 2Y0EA 3DO5A 5DZSA 3U5TA 1LRLA 1ZK1A 3B20A 4FC7A 4GBJA 3ZWWA 3E5RA 5JO0A 3S8MA 4XRRA 4P4LA 2HLPA 1JN0A 4YAIA 4KOAA 1ADFA 4J4TA 3DZIA 1LC3A 3BXXA 3GEGA 3KYCA 2Y1CA 4J2OA 4OIMA 5JXWA 2VYND 3JQCA 3K92A 4BO6A 2I76A 2HU2A 5T8KC 3WWYA 1E77A 3GDFA 2EWMA 4Q3NA 2C7GA 4J91A 3WIEA 3UICA 5GZ6A 3S2GA 2OP1A 1C1XB 1QYVA 4Z9XA 1PR9A 2HSDA 3Q9UA 1XGKA 2C82A 4L4SA 5TX7A 1A7AA 4E30A 2PH3A 1DDOA 4PLTA 5IZCC 2D8AA 1NTOA 1ZXBA 1A4UA 3GZNB 4OHUA 4ZICA 4IS3A 3M1AA 3DFUA 2NADA 3GFGA 1ZUD1 3DDNA 2B4QA 5HBRA 4E13A 4WLOA 1T24A 2JKVA 1X0XA 1O0SA 3ANNA 5ENDA 4KUEA 3TQHA 3DZFA 2PZMA 4B3HA 4BHTA 4E5MA 4B4UA 1KETA 1TA4A 2Q50A 1CQIA 4OXYA 4ND2A 3RVDA 4XIJA 2OORA 2VHWA 3QVSA 4A73A 5IAAA 4E33A 2IZ1A 2NU6A 4BNMA 1X7DA 2O3QA 1R0LA 1W73A 2AW5A 4TRJA 3I83A 1G0OA 3DTYA 3CMCO 1I5RA 2BFOA 1Q7GA 1SNYA 4YT2A 2O2YA 3KEQA 1GZ4A 1A27A 1QORA 4BKQA 1CDOA 1B0AA 3HDHA 4CV2A 2FRDA 3IL2A 2R00C 1NQAO 3K96A 3ZNQA 5CDYA 1JAYA 3P2OA 1NHWA 5KJ6A 1BXZA 1SBYA 1ZXLA 4TVOA 5TLSA 1TXGA 4WCFA 2Q2VA 1TT7A 1Y5MA 1DO8A 2RBEA 2YHIB 3EY4A 2VHYA 3LT2A 1ZSYA 5B37A 5I7SA 4S1VA 2X0RA 1XR3A 3WLFA 3QVTA 4BQPA 2W2LA 3AU8A 3NTQA 4GPD1 1WVGA 1Z45A 3IKVA 4FGWA 1A9YA 4KDEA 1PGOA 3SVTA 2ILTA 4YYZA 4OGWA 4CMJA 4EJMA 4QQRA 3E03A 1E7WA 1ML3A 3E82A 3WBFA 4M86A 4URFA 1ZK4A 3NGXA 3G49A 1I8TA 3JQ8B 1IZ9A 2FOIA 2GR9A 2VHVA 3DWFA 4GX0A 1FXSA 1RJWA 3GLQA 2C2YA 3RASA 2O48X 4AJJA 3F6YA 3FWNA 3LVFO 2X6TA 2IRWA 5G4KB 1XG5A 3LT0A 2GDZA 2NLOA 2UAGA 2VYNA 1BXGB 1UDAA 4BV8A 1C1DB 5IDXA 4IS2A 5HTOA 2AQKA 4NZ9A 3JQGB 4Y6PA 4XDYA 1O8CA 4JJFA 2E82A 1PS9A 3I9MA 3H4VA 3WLEA 4IDGA 1YQDA 3ZI0A 2P4QA 5K6AC 1R4MB 4RV9A 5GMOA 5EESA 1QLJA 5AXBA 1ENZA 4K1LA 2HMUA 3K9QO 1YQGA 2FPIA 5BT9A 1GZ3A 3W4IA 2HK8A 4H3VA 2FSVA 5G4LA 3GG9A 3DZHA 5DOVA 3BYZA 1KYQA 3RUAA 1EQUA 1G0NA 4YRDA 4CR6A 2EHDA 4NJOA 2X5JO 3RSHA 3GEDA 5T64A 4PZCA 1XU9A 2ZB8A 3WQQA 4EZBA 3HN7A 4IGFA 3I6QA 4TROA 1F17A 3Q2KA 1SOVA 2Y0CA 3ZWXA 3PHHA 4GVLA 3M6IA 3GHHA 2EJVA 3PK0A 3DBLA 4OH1A 4D3DA 4BNNA 1YL5A 3AY6A 4ALJA 4BO7A 1YBVA 3O38A 4JLWA 2C0CA 3TL3A 4CLOA 1HYHA 1BDBA 4RPGA 2PY6A 4YJHB 3KEOA 3VKVA 3KHUA 1K5HA 1Q7BA 1NVMB 5IXYA 1A7KA 3ZCXA 2VRCD 4IUYA 1SCUA 2ZYDA 2IDZA 1P44A 3FBTA 2ZB4A 4DIFA 3RUCA 3JD0A 3RQSA 4NU5A 4A0SA 2FWMX 1D4FA 1P0FA 3ROMA 1VJ1A 2V6BA 3DONA 2EGHA 3O4RA 5A1TA 1AHHA 4J1SA 3WSVA 2CDBA 4LISA 4RL6A 2Y1FA 2FP4A 3DQPA 1E3WB 3C1OA 5TJ9A 2Y05A 1DBVO 4XA8A 1NFRA 3PXXA 2O4CA 3D5TA 3VPSA 4XYGA 1H0KA 2X0IA 2Z5LA 3DBRB 1FF9A 2JCYA 3KSDO 1OI7A 1BXKA 4O63O 5KKCA 4E4YA 1QV7A 4YVFA 3PI7A 3V2UA 4PGFA 2BD0A 1I24A 3DTTA 3Q0EA 4PG7A 4M55A 4R1NA 3CKYA 1D8AA 2ZCUA 4Q3BA 3AJRA 1EUZA 2CNBA 2GCGA 4K26A 4ZU3A 5KVVA 2VWQA 1MA0A 4GKBA 2J6IA 4FS3A 4R3NA 4CV1A 1GEEA 3VDRA 2EKPA 3RJ9A 1PS8A 2P9CA 2FY8A 3KXDA 5EJ2A 3ZU5A 3EAGA 4TVBA 1OC2A 2VZ0A 4GGPA 4N54A 3VTFA 2VYVD 2AEJA 3JYNA 2ZQYA 4UUOA 4YJGB 5EINA 3PHIA 2D59A 1KEUA 4BNKA 1SO8A 1ZSNA 4CLXA 4GKVA 2C2XA 1CEQA 1NPYA 5A9RA 1ISJA 3GDOA 5G0WA 4FQ8A 4UAGA 5AYVA 2NVUB 3ZWNA 2ZKLA 3WIDA 1M67A 1KVUA 4BV9A 2HCTA 2H63A 4FFPA 3V8BA 1ZNQO 3HDQA 3PGJA 1SMKA 4Z0TA 2ZTMA 1FDTA 2AG8A 4IY1A 3GNSA 4PFJA 3L6EA 3ZWCA 5BSGA 1EK5A 4XEHA 1IPEA 4XQCA 4YACA 1M76A 2PA3A 4UEJA 3TJRA 1DXYA 3NDIA 1KC1A 4XX0A 1V0JA 4J6FA 1U7HA 1LA2A 3W1VA 4OOFA 3ZWYA 1SAYA 1SEPA 2X9VA 4GMGA 4ZQFA 3OA0A 1ORRA 1E3SA 2JFGA 2YV1A 3I9LA 1FDVA 3MCVA 4IQ0A 5JAMA 3DR3A 4ZQGA 4LMRA 3INRA 5EL0A 5L9AA 4LRSB 3AI1A 3P7MA 3TNLA 5TT0A 1DLJA 1Y8QB 3VZRA 3HE3A 3D3WB 4CM1A 4O1MA 2R2GA 2YV2A 1E7MA 1W4ZA 4IDEA 2CD9A 4MKRA 3K5PA 3WGYA 4UEOA 1E0DA 5DP2A 3RC9A 4AJIA 1Q0HA 1I0ZA 1AUPA 4YR9A 4JP2A 5AQ1A 5CEFA 1DIGA 2JD2A 2EGGA 1QR6A 5ITVA 1P1JA 3DAGA 4R5MA 1ARZA 3IMFA 5KVSA 3EVTA 3GAZA 3E9QA 2G76A 3ORFA 4A2CA 1WZEA 1E6WA 5L4SA 2G17A 3BHIA 3OIFA 1HWYA 4P4NA 4IMPA 1R12A 4J1NA 5BR7A 2H1SA 3GNTA 4WCDA 2CVZA 1DPGA 3DOJA 1PJBA 4E0BA 3WX0A 4YRBA 3TZCA 4YCAA 2AQHA 1VKNA 2JJYA 3BMCA 4DA9A 3GNQA 3SLGA 4B4WA 4EGFA 3HFSA 5JCXA 1R37A 4XIYA 1PGJA 3L9WA 2Y0DA 3S2EA 1LLUA 1YJ8A 2CY0A 4GLLA 3VC7A 1C3VA 2W2KA 3EZYA 3WGQA 4CQLA 1AE1A 2I67A 2E4AA 2RHCA 3OM9A 5DBGA 4WKGA 2BLLA 2WD8A 2D5AA 1E92A 3RFXA 2RHRA 1Z6ZA 3P5SA 2WSBA 3E8XA 5DULA 3JQ7B 4R16A 1XKQA 4DWVA 3MEQA 2Y67A 1A4IA 5JAZA 4TRMA 4FR5A 1X1EA 4LSWA 4ALIA 4BKOA 2NU9A 3I9OA 3KRTA 4ND4A 1SB9A 1NM5A 5L7TA 3U49A 1P3DA 3CMMA 3FNFA 4HUJA 4II2A 4CM9A 1JQBA 2X8LA 4CUZA 1N8KA 4J1QA 3K2EA 4IZIA 1GAEO 1Z7BA 4JX8A 3WS7A 5G0UA 2JAPA 3NAQA 1NASA 3GGOA 2JFHA 1NQOA 4F45A 1E1MA 5JDIC 1PJ3A 3DAPA 3OQ1A 4NPCA 5B4TA 2AXQA 1YXMA 3IDSA 1MGOA 4FDAA 4B3IA 3ETGA 4PLFA 4CM5A 4BO3A 4IM7A 3JD3A 3HDYA 4D7AA 4DIBA 2PH5A 4RZIA 4E6PA 3F1LA 4NDNE 2GN6A 4DTIA 1O95A 2AQ8A 2DPHA 4INAA 3T4EA 3PQFA 1E3JA 2GO1A 3LF1A 4YWJA 2EJWA 3UN1A 1PR3A 5JCJA 4UVIA 2Y1DA 1PWXA 4O6VA 1XELA 4YJDA 4E5NA 3BZUA 2NQ8A 3ROQA 3MWEB 3Q3CA 4QO7A 2G82A 4MO2A 1YO6A 4FPXA 3NUGA 1F8GA 1I2BA 1BDMA 3VH1A 3AOGA 2VWGA 1AXEA 4BGIA 5FWNA 4MVJH 1X15A 2UDPA 3FTNA 3ZGYA 1KVQA 5DBIA 3JV7A 3NKLA 5HS4A 3AUAA 2OGUA 2P2SA 3NX4A 1LRJA 1YJQA 4AJ1A 4UUNA 1TLTA 2OOSA 4BNJA 1MV8A 3RUDA 4IDBA 4NHEA 3WQSB 2RIRA 5JY1A 1KY4A 2IODA 2HKIA 4OJNA 4LRTB 4J0EA 1FDUA 3CH6A 1D1SA 3B1KA 4Q3DA 1OC4A 3DHYA 4MVJM 1VSVA 3ADPA 3M1LA 4FFNA 1BSVA 1FJHA 4CM8B 4LMPA 4MOWA 3VPHA 4WNIA 3D5QA 1VL0A 3OEYA 4Z9FA 3E18A 5KJ1A 3PVZA 4JN6B 5ER9A 1ZCJA 3RUHA 2GF2A 3GUYA 4FOSA 1N9GA 2VWHA 2DU8A 4EI2A 3WMWA 1JDJA 1J49A 3SC6A 2GN8A 5A3VA 1LDMA 3VPGA 1Z7EA 2OMEA 2BGMA 1HDZA 5TRTA 3O8QB 1DIHA 2PTGA 3RJ5A 3WB9A 3DZGA 1GYQA 3ICPA 2WDZA 2DQ4A 4D42A 4XYBA 2DBRA 1ONPA 2A92A 3BTSA 1D3AA 3OJEA 4ZRMA 1S6YA 2PD4A 3AY7A 3RU9A 5JDCC 2YV3A 3ADOA 1GD1O 2PKQO 1QYCA 3L4BC 3WYBA 1MP0A 3NDRA 1HETA 4N5LA 4O59O 4MVJE 4IDDA 4TQGA 1I3KA 4MKZA 3MJEA 4EBFA 4YPOA 4FFLA 4HP8A 4HXYA 2CFCA 2TMGA 4RPJA 3JCZA 4BNXA 1NXQA 3KO8A 4PG4A 1YS4A 4QTZA 2GZ3A 3D1LA 2C20A 4UREA 4TRRA 1ENPA 4HFMA 1M6WA 1WDLA 1Z74A 1OAAA 4G2NA 1LDGA 5JS6A 1R0KA 1PGPA 3Q1LA 1EEHA 4R1SA 3KSZO 4R51A 5F3RA 5HM8A 4CM4A 4CMEC 4J0FA 4JIGA 5EPOA 1RYDA 1FDWA 4OAQA 4CPDA 4TZKA 3TDKA 4BIIA 1E1KA 4MVJD 4DMLA 4M1QA 1XHLA 1H6BA 1EFKA 1KVRA 1PWZA 3IJRA 4I9HA 4ONEA 5A9TA 3HB5X 5TF4A 1H5QA 4IIVA 2HDHA 3GAFA 4PZDA 2YZ7A 1DC3A 1I01A 2E49A 2ZATA 3IUSA 4ZQEA 3VZPA 1P77A 3JTMA 2C7VA 2R00A 3RFVA 1PGQA 4RF3A 4UVDA 5L40A 2VTEA 4L76A 4DLBA 3JQFC 4LVCA 5F1KA 4AICA 1B2LA 2J3JA 4FW8A 3DBHA 4RF5A 4NJMB 4FFMA 3U4IA 3ZW9A 3H2ZA 5L45A 3STHA 5KJCA 1EVIA 2OBNA 2RCYA 4WECA 8ADHA 1MC5A 2FPPA 1PQUA 3DXFA 3HJAA 4HADA 2ET6A 3EZLA 4DBZA 4F6LA 5L95A 4ZA2A 1R4NB 3U09A 4IPTA 3VHRA 1ONNA 3V1UA 3ZWBA 5A3JA 1ISGA 1DEHA 1PJLA 1AN9A 4EDFA 2IXBA 4TMFA 1UP4A 2BKAA 1JVSA 1F8FA 1QG6A 4GX5A 1Q0LA 2Q4BA 1A9ZA 4J4HA 1OOEA 1E6UA 2ZYGA 1J5PA 3RC7A 4JBIA 3QHAA 4CUKA 2AE1A 4MIYA 2NU8A 1Q1NA 3WXBA 4PLZA 3H9UA 3UOGA 1NP3A 3DAFA 2X5OA 2NTVA 3EYWA 5TSDA 2HJSA 5F21A 1Y5RA 1I3MA 2YQ4A 3N58A 5L7YA 1CETA 3WSWA 1GL3A 2CMDA 3OSUA 1R0SA 3ETEA 1Q7CA 1UZLA 2FN7A 2HO5A 1C1XA 3SXPA 1DFHA 3AI3A 3COSA 4PG5A 3TFOA 4PRLA 4BO9A 2DUWA 4R9RA 2X22A 3BHJA 2DC1A 2CF6A 2WYWA 4LCJA 3ZNPA 4DYDA 3F46A 1I32A 2XPCA 1UDBA 3GZNA 4IINA 1YKFA 1M66A 3HHPA 2X23A 4LK3A 4S3MA 2OBYA 2GPTA 1V9LA 5JBIA 2O3RA 4LSMA 3GGGA 2V6GA 3EGOA 1XA0A 3RC2A 1B8UA 4L73A 2DFDA 4R41A 5J23A 4E5YA 4XGKA 3BMQB 1IL0A 4Q39A 5H82A 2WM3A 3RKRA 2QW8A 3UGKA 2R6JA 1JTVA 1LLCA 1NYTA 3B1FA 3D64A 4KMSA 5TQVA 3WJ7A 1HF3A 3H3JA 3VH2A 2VOJA 4DQUA 5AXCA 2DBQA 1C0IA 1R15A 3HN2A 2IEBA 3GEMA 1HLDA 1FDSA 1KEWA 1YL7A 4HFRA 3IC5A 4MVJG 3U62A 5CG1A 4XGIA 3I52A 3KYBA 3PJGA 4R68A 4J4BA 2YHIA 5A9SB 4AJLA
chains in the Genus database with same CATH superfamily
3IVRA 3ZHQA 3A6ZA 5FLKA 3NDJA 3BA1A 3AG5A 1L5NA 1BQEA 4HSGA 2VTBB 3LUFA 3TVYA 4D3SA 3SBDA 2EP8A 1CNMA 1P0PA 3PC4A 2HMSA 3M6XA 5BNFA 5CLFA 4H0NA 4B4DA 1RU3A 1REQA 3JATA 5EE5B 1U0NA 2B25A 2WM8A 3RYIB 5K6RA 3KKNA 3GZTB 4L74A 1E1DA 4QWWA 3PP8A 4DLYA 2XRMA 4LHZA 1RYBA 5D6OA 3E3NA 2HLHA 2I3GA 4UNSA 4C3ZA 2E7ZA 4NXMB 2REQA 4CG0A 2HCJB 1LPPA 2J9GA 1QU3A 4NQZA 1JQKA 2LIVA 5ICMA 4A2PA 3G0IA 5LDGA 3R9IA 1I5OA 3WA6A 3D7KA 1RM5A 3FN4A 1Y9AA 1YU6A 3LT1A 3MLBA 2O2SA 3EFOA 3HNOA 5E1DA 2FVXA 1WOYA 4F4HA 3GH3A 2IYTA 1F2UB 1PZNA 3JQGA 3UV7A 4YBRA 4BB6A 3VR0A 3KJNA 3AHCA 4M0UA 5DNDA 2ATVA 3EC2A 1MD9A 1KH3A 4AG6A 1R4MA 3D7NA 2VZ9A 4ZT3A 1C9JA 4I2VA 5BYKA 2W43A 4RGBA 4RETA 1OVGA 4LY6A 3C24A 5EEGA 3GRAA 2I4NA 3B3JA 1BE6A 4Y2UA 1K5DA 4D79A 3G2NA 3B7PA 2KWIA 4KPYA 2BDEA 1RM0A 2JLYA 4PAWA 3RIXA 1CJTC 1UT8A 2QR2A 4LXXA 4R81A 1XTSA 3ROPA 5JE8A 2BFDB 5FFMA 2VPTA 2NMVA 3FE2A 1E3TA 3AETB 3WMGA 4IX9A 4UM5A 4CF4A 1EVLA 2M2IA 3FPLA 1QZ3A 2Z8ZA 4H59A 1CUHA 3DMTC 3K71B 1JQDA 1HGXA 4D9EA 3KLBA 3EOZA 2EV9A 3FB4A 3DMDA 3IBSA 1L4EA 4V3CA 3N2KA 2CL0X 2COUA 2WKQA 1XJ0A 1JAZA 3ZWVA 5BYAA 3SNHA 4HD8A 2P3OA 3WGLA 1SBIA 2X19A 3W77A 4HBGA 1KRWA 3W06A 4JEMA 1HDXA 4KHPB 1Z25A 4GM4A 3Q72A 2HU8A 4QHYA 4ZDIA 1FJGB 5M7EA 2P3LA 1LY1A 1VJDA 2ZJ0A 5ECYA 3LQKA 4RH0A 1KO8A 2B7LA 1VHQA 2YVUA 2AE2A 2HHCA 3AKEA 4IJ6A 3EDOA 4XQEA 5CT6A 2PKRA 5T3YA 4QLBA 5H4GA 3J81k 3GRRA 4BQIA 1MG0A 4EW6A 2VPWA 4XD7D 1AQJA 3HLYA 3UFXB 4M60A 1MORA 2PAAA 3HS3A 1XL0A 2ZYSA 4IYRA 4J43A 5AI0A 2A33A 4P54A 5AKEA 2OAQ1 3B6ZA 3TH5A 3D7LA 3TDMA 1NJFA 1G6KA 3PJRA 1FFXA 4X93A 3S70A 4WFIA 1EUQA 3ICOA 4FP9A 3RSCA 5D3MA 2G1UA 3GLIA 2GBCA 4RYLA 5KNDH 5AVOA 1HEIA 1YQWA 2X15A 3K1AB 4Q3OA 3OP4A 4TL6A 4BVGA 3C6ZA 4MI1A 1FJXA 4UMVA 2GXQA 4EX6A 4GRIA 2L69A 3ZTWA 3DEFA 1A9XB 1IZZA 1Q16A 3K7EA 3QW2A 5B53A 3AHJA 2W8ZA 1QRRA 5IYZF 4HWSA 5LBIA 2ID8A 2V7QA 2NT3A 1IJEA 2J07A 2ZJ1A 3LWBA 3ZV3A 4LNAA 3RSLA 5EJ5A 1DWUA 2IKSA 2CVOA 2X2FA 4NOJA 2RAFA 1E2JA 4YRCA 3SEQA 3UCFA 5IUJC 3GDGA 2YC2C 1ST3A 4FBLA 4OJTA 4QIHA 2W6ID 3EA5A 5EE1A 4F8EA 3OHMA 5JALA 1TO6A 4FYJA 4PQEA 1O94D 2RH5A 1YVRA 1Q7TA 2NTEA 1DAOA 2ZIZA 3RRZA 4MKXA 3ME5A 4KOEC 2C4WA 5DHFA 2PUJA 3RUFA 1SC1A 3L7LA 4XGNA 1T15A 4TYWA 2FX2A 3CF4A 4LCBA 3ZJTA 1C7RA 2ZE8A 3KV3O 3MD0A 4ES6A 2BUBA 2Y1XA 5BVGA 3P9YA 2G4CA 4KVZA 4Y2QA 2ZYWX 1AXGA 1T9AA 3I23A 4YJGA 3Q15C 3ZZNA 2HHAA 2P0AA 4NICA 4MQLA 4RVFA 2L0XA 1MN6A 1RLMA 1HBJA 3BE6A 3M8KA 2NVUA 1JQAA 4PHGA 4GL4A 1KY3A 1RXUA 3JWEA 3TD6A 1EWVA 4ZRNA 3T1VA 1QIHA 3M6UA 1K7CA 1AKVA 2NZJA 1C4XA 2WWIA 4OYRA 4YMIA 5AJWA 3FYSA 3KJZA 1DC7A 3G0BA 1SBTA 3HWWA 4DMKA 4PLHA 4IQ8A 5TMBA 2O54A 3BK7A 4ID9A 1NN5A 4K9OA 1V1RA 2DUJA 2BL4A 3PNPA 1N0VC 4UM8B 3K6SB 3PUWA 1HFWA 4Y1RB 5F9HA 2WFLB 3E81A 3IV7A 3L77A 1M2GA 3PL5A 3LUKA 3WQBA 4DADA 3DS8A 4XW2A 1DQRA 4G0XA 4OYLA 5P8WA 4N3BA 3ZU2A 5HMLA 4AMZA 1ZJWA 3WL8A 1J99A 5FBQB 2OD2A 5KS2A 1B6TA 4FDMA 4UW9A 5CNIA 4JH0A 1JSZA 4DQLA 3LC0A 1BU5A 1WR8A 3LECA 1V6SA 2Q3LA 1TM1E 2W6OA 4AZ3A 1H9BA 1YOVB 2QT0A 3EB9A 4NWIA 4TTVA 2QQGA 1VIMA 3LE8A 5BSTA 4URVR 4QPJC 1U9CA 1GRNA 2BMDA 4JGIA 5ARDA 4E46A 2DP4E 1V1MB 4HQ6A 3GEPA 1E6MA 2B35A 4FYXA 1XRRA 4OMUA 4Z1OA 2JJ8A 1HRDA 2YZGA 4OHYA 4AZVA 3URMA 4WBSA 3B78A 4L3VA 5JAHA 5JSZB 1Y8QA 3GRFA 3K0AA 3N70A 1II8A 1M2WA 2ZVPX 4N6GA 1SB8A 3I12A 3D3WA 2B4TO 4OH7A 5CVVA 4CFZA 5J4LA 2O8BA 1JG1A 1RAFA 3PSHA 3I34X 3BK2A 3JYHA 1W36D 2GEVA 1MHPA 2J4FA 2YYZA 4PZPA 1FNMA 1E0SA 2BGKA 4QLOA 4BIMA 4BZZA 2O8FA 1R6VA 3HNPA 3LUHA 4QM6A 2BHRA 3C45A 5A6VA 1J42A 2KS6A 2WFAA 1PL8A 2LBPA 2PLRA 4DUPA 1J0DA 5CYOA 3ETJA 3FCSB 3FSEA 3HLTA 3OZEA 3FF1A 5FXMA 5K0NA 2UV8A 3CPSA 3D0QA 1HL3A 5CVDA 1K6EA 3AOEA 3L1HA 3T3MB 4ZAVA 1ZN9A 4GSYA 4HSEA 5G0SA 3VDQA 1TJ5A 3DB1A 3G9UA 4EMBA 2X9GA 3LNTA 1L4BA 1VYUA 4LNUA 3FAKA 4OX9B 1U7DA 2OESA 3HDTA 4YROA 2RH8A 2M6LA 3SZOA 1B23P 1EGMB 1F2VA 1A50B 5LMNB 4OI0A 2J41A 3DZ8A 3E9ZA 3WDSA 1L7XA 4GEKA 4EB6A 4IUCS 2JFQA 5IM4F 2P78A 4PANA 3TWOA 2Q2NA 3FPSA 4FT2A 3JQ7A 2VRWA 2G63A 5AH0A 4DTCA 4HN9A 3VR4D 3FUXA 2P9JA 4YT5A 2CMGA 5FOXA 3LLSA 1DKPA 3CSSA 4MDHA 3FUUA 1G1MA 3O9MA 4C0QC 3DW3X 4U2BA 2WV9A 4DJFC 3QVXA 1KP2A 3DT6A 1B93A 1D2AA 1NBMA 2WLTA 3H3FA 2GRJA 4HWKA 4J1TC 1SVOA 2CNNA 3M6AA 3ODGA 1N0UA 4HRXA 1QDLB 1QLWA 2D2IA 1XB2A 1UBFA 3AV0B 1IULA 4JQOA 5A5FA 1FK8A 3A0RB 3MIIA 3TL6A 2RG7A 1F12A 3L7KA 3T1QA 2K7FA 1NUAA 2JKYA 3NGLA 4PNPA 4JVSB 1D4OA 2C31A 1YV9A 5EXSA 4P8RA 1L5OA 3WK8A 2BEVA 1TPZA 1XVUA 2V7PA 1LU9A 4DC0A 3CWCA 3OTQA 3C3DA 4PG8A 3HB1A 4U6QA 2PUEA 3LKVA 4HY3A 1PEDA 2X8WA 1L8XA 4H1TA 1IY2A 1BXRA 1GPLA 4JT4A 3LW7A 4UVEA 1FYFA 5FBLB 4BNIA 1C7ZA 1DCKA 2I65A 1DELA 2QTLA 5E1BA 4CTNA 2QW0X 4QX6A 1JAIA 1VBKA 3PNKA 4I5FA 2FUG6 1W25A 1NNUA 1SJ9A 4YMWA 4ZO7A 1PZFA 2NV6A 3FMOB 2QI9F 2PLFA 2HH9A 4KVAA 1VBMA 4MQ4A 4XOUA 2BR3A 4M1WA 2W7TA 4KQWA 3HBMA 2JA2A 1AS0A 1QSGA 1PZXA 2KJQA 5AVZA 2GRAA 2HK6A 3MWEA 1YUMA 1QDUA 2E4ZA 2XRYA 4PC6A 3DG9A 5LQSA 221PA 2VQ3A 4YN3A 2Q6TA 4I4NA 5LA6F 1N0IA 3IKLA 5MN4A 1JV2B 3H2JA 4U0KA 2R79A 3HM9A 3QPVA 3PHLA 3F49S 2K6GA 3FG9A 4AJPA 2RD2A 1AUVA 2R8BA 3AF5A 2HFJA 1FFHA 3PSAA 4GLJA 1H2BA 4MTCA 4DA6A 4MW6A 3KVOA 2JAHA 2LZ0A 4R2MA 3N0RA 1NW3A 1FMJA 3BMOB 1ZG3A 1K3UB 1Q21A 2ZI9A 5K8LA 4XIIA 3JR7A 4LTNA 3W3AD 3ZK8A 5JNWA 4LV8B 3WJAA 2QX6A 1KO7A 3BFJA 4CIDA 4L8FA 1BH6A 4I6GA 2E4VA 3T35A 1MB9A 3O3OB 2Q8NA 3CB2A 4HB0A 4W5HA 1V4NA 2J85A 2YVQA 2H65A 3F5FA 3U4HA 3AKZA 1LV7A 1UBKS 4MVJP 1ZMOA 1P80A 5AKXA 1S9HA 3M34A 4CCYB 5IANA 4E1BA 4YBZA 4DHWA 4BAUA 5IN5A 3GP3A 4FTWA 5CPFA 4CG3A 4B8YA 4D98A 3FSRA 1WUKS 1NR7A 1SUCA 1U2EA 2FMKA 4IV5A 1XTZA 2VJPA 4G1MB 2RHMA 1G21B 3B7GA 1ZIDA 2PS1A 2ZRIA 4MARA 2VXCA 2FHPA 4B3MB 4LDQA 4UZEA 3FMFA 3O8QA 3A1SA 2UVPB 4BFTA 4CKYA 5JTUA 2O7SA 3T7DA 3UEOA 2J9FB 2R8XA 4GOJA 4MROA 5TQ2B 2V4MA 5GIOE 4JOCA 2J32A 3I72A 1F2DA 1B15A 3KX2A 2YQ5A 3FUTA 3KJEA 5JH7B 1IDOA 1YACA 1Y3BE 3FDJA 1XTJA 4ZODA 3ZWQA 3AQIA 2PS0A 1WW8A 2CBXA 4WOPA 1PGNA 1A4XA 3A3KA 3W5VA 1P1RA 4B2IA 1X80A 1DPFA 5AJYA 4H6PA 3R24A 1XQ1A 3KUKA 4DAEA 4LYHA 2IPOA 3RFTA 4JB3A 5HJEA 1P6UA 4LMBA 1XNHA 1JFLA 1GRVA 4LJ5A 1LVUA 4NXNB 4DLRA 2NZ8A 5TNXA 4OLBA 4HNVA 1TKAA 1T5TA 1XZMA 2O7VA 5E6UB 5E9JA 5DB4A 3JY6A 4L75A 3D6VA 3KDSE 3Q2OA 4AX8A 4MAFA 3EEYA 4DILA 4Q7QA 5IK2D 4NI5A 3PDWA 3T06B 1U2GA 3W6UA 1ULTA 2GJAA 13PKA 4WNAB 3I6IA 2WUDA 821PA 5DSXA 4FHGA 3ASVA 5C1IA 2ONCA 4LY3A 5FWXA 4NCHA 1OZHA 2X5XA 1ODSA 3EF0A 5GV7A 3UMSA 4BNHA 3E7DA 4NFSA 1BX3A 3CEJA 4R3WA 1ITZA 4JL5A 1XRSB 5T8KA 3W7AA 1Y9JA 5JW6A 3K2IA 2OLEA 1ZI6A 1ZU4A 5K0CA 2Y99A 3FB1A 1RAHA 3UJBA 1WB9A 3DDHA 4RLSA 1FMTA 4M1EA 2RHOA 4BS9A 4F21A 1MUUA 2QLTA 1V43A 1PO7A 2PRYA 3NT4A 1DXHA 1JZTA 4FINA 4BLTA 5KREA 4K9LA 3G1TA 5JC8A 2BEWA 2NWQA 3YASA 5FFFA 4QDZA 4B33A 3MWFA 3INNA 5IFLA 3QVLA 5EWMA 2PRJA 1T5BA 6LDHA 1N3IA 4QFBA 3ZHYA 3OQNA 1IYZA 5BO5A 5BN4B 2YVKA 1C9NA 1QVAA 4Y8VA 1KOJA 2FEKA 1XTTA 3D8HA 4M99A 1LK0A 4KZKA 2Q45A 3FDZA 5I9TA 1B3BA 2XKBA 3FPGA 5BOSB 4MYCA 5LQNA 4AUKA 1XK6A 1A2BA 3PNLA 4OHMA 4MW4A 4BRSA 1OZAA 3BCUA 5HQ3B 2QAJA 1ZXXA 4OKNA 5I9BA 3HU1A 3TBKA 5DNUA 3PWSA 1XMSA 1EBUA 2BN4A 3A9VA 4Q48A 3PKJA 1ESZA 1PW7A 2QJTA 2VJKA 3GJ5A 4KI0A 3DEJA 1EFLA 1POXA 3L4SO 4GG1A 2WKWA 3OO0A 1KSFX 5MF6A 5E4TA 3DKRA 3TLYA 4G81A 3CR3C 4B75A 4XAQA 3PWKA 2DBVO 4QAQA 4KDFA 2BFWA 3SF8A 3MILA 4QTXA 1R4NA 3C6BA 4X8HA 4DVJA 1GO2A 2W8BA 4NE9A 2PQ2A 3IODA 4NSNA 4QUEA 4BYGA 4W1QA 5JQGA 1HYBA 3R0IA 3W2GA 4CIVA 1Q0UA 2ZUVA 3G82C 2F4VB 4IDNA 3WYEA 5KVQA 2ERXA 1VM6A 1DAIA 2X0EA 3A26A 1TUIA 1P81A 1ES9A 4ARCA 1TO2E 4AB1A 2HJHA 4IV8A 5L3SB 5AI9A 1N7JA 3VV3A 4UM9B 1JH9A 1QH8A 2HSZA 1YJCA 2PD6A 2ZVQX 1H2HA 3UCXA 2QTRA 1HURA 4FGUA 5IX8A 4Q15A 4ZGBA 2ZWMA 1H8EA 4UZFA 1G5RA 1QK5A 3DV9A 1TECE 4JMLA 1N2GA 4KMOA 4U3JA 2X0NA 4Y2HA 3WBJA 1N34B 3G2PA 3TTXA 3U7EB 4P2BA 4RCYA 4IDHA 2Z9CA 4PSAA 1ZESA 4CDGA 3JD4A 1QKIA 3AJEA 3NBFA 4MV6A 1ECBA 2IYZA 1J8DA 1OX4B 1JA1A 2O3TA 2UZ1B 4OOEA 3KJHA 2DERA 3KUUA 5HG0A 1KOGA 3INGA 2X1HA 1FUUA 3ZV7A 4GM0A 1AKNA 2LRHA 3GV0A 2O19A 2CLSA 1UQUA 4DPKA 3D0KA 1XN1A 1XLTA 2WJVA 3AKYA 4X1YB 3CX6A 3H9JA 3VH3A 2G83A 5AUOB 3UMCA 3HFGA 1FNDA 4A15A 1C14A 4UKDA 3QXJA 2I7VA 3DZCA 3FNEA 4Y9UA 2Z8YA 3UVEA 1NQWA 4JZYA 4GL2A 4P81A 3CISA 3P27A 3F2IA 4C2TA 3BIWA 2ETXA 1I1HA 2IEDA 5KNBH 1TYEB 3PUJA 1Y48E 1HZZA 2YXBA 1XCLA 3BIJA 3JQAB 1ECPA 4FOTA 4UDNA 5AI8A 4B4OA 4RS3A 2W42A 3A3NA 1U8FO 2ZIXA 3WZ2A 3EW9A 2HDOA 1C0PA 4J7UA 3EVNA 2QN6A 1R16A 16PKA 3K6RA 4TUYB 4BFCA 4G5RA 4GSKA 2PZEA 2WJYA 4E7OA 3W1WA 3AP3A 1QFSA 3CZ4A 4LJRA 5FP0A 1H0HA 4Q1FA 3K05A 3P4UA 3AM3A 1CRWG 4Q1DA 1KMNA 3Q12A 1MT3A 1MXHA 2C9CA 4OAOA 2JHFA 2DWCA 2LIPA 4NH4A 2ZZNA 1YVEI 2Y4NA 1LVHA 2QS9A 3KB6A 2FMTA 3HCFA 3Q8LA 1ZGJA 4HK4A 4BNDA 1KAMA 4YQFA 3LHFA 4M1OA 5JS8A 3HSKA 5TEWA 2I2XB 4ZAZA 2P0EA 5C7IO 1W88B 1ZQ9A 5KYVA 1MIHA 4FZVA 2BE9A 4AKTA 4K9MA 4TSFA 4BMSA 3H3XA 3L5KA 3QZUA 4KQJA 3IQGX 3HR4A 3QSGA 5D87A 2C4KA 3WQRA 3RGGA 3DFZA 1LF0A 2VDWA 3PDHA 4RVOA 1E6LA 1EUCB 1LFAA 1IFXA 2YRXA 3PUHA 2HUNA 1CZLA 1N1MA 1RCTE 1L0BA 2RGDA 5J5VA 1INLA 3NRBA 4ZHQA 5BSEA 1B0ZA 5E38A 4TKZA 5C7LO 1KZ1A 4EUEA 2DR3A 5AOBA 3PQ2A 2NT4A 1K4YA 2R2AA 4ZDWA 3ZGNA 3IAM1 1T36A 2C94A 4PSVA 2CUNA 2I71A 1HT2E 4GE3A 4BGDA 4YDQA 1WB4A 2J9YB 2JI9A 3R7WA 3M2TA 1P31A 2ZSJA 5B58T 3V6MA 2KSQA 2Z58A 4AN4A 3ANTA 4EX7A 4IFTA 2GLXA 4ZVQA 1GJRA 2C7BA 2RG1A 2O3UA 4LW8A 4BNFA 2EKZA 1UAYA 2QV7A 3BHNA 2ZT8A 4JLVA 1N1DA 4KQ1A 3V1MA 5JFOA 2YYAA 3P9CA 3LBIA 4M37A 1J2UA 5EZSA 4FJ1A 4MRMA 4FCVA 4JI7B 1Y81A 3H6KA 1U8UA 2IGTA 1O96B 2OL4A 721PA 3ZDYB 2X9LA 3N3AC 5SY4A 2AR7A 4MPRA 1RCUA 3F3YA 4RA6B 3RAGA 4LWZA 1NJ5A 1QYWA 4RMJA 5DYWA 1KEEB 2YV5A 1LPOA 3A37A 1HDIA 2Z09A 3ANSA 5E3IA 2QMZA 5IWAB 5BPFA 3ZVNA 3KYCB 1UP6A 4N9WA 2Y0PA 3UWSA 1H65A 3WFIA 4AKIA 2YS6A 4X95A 4JLJA 2IIQA 2VZ8A 4EECA 2JCVA 2B0JA 3DHEA 3UTCA 1T13A 1P6XA 2DVMA 2ZT5A 3HVRA 4GO1A 2GN1A 2A14A 3BMNA 1CJMA 3X0DA 4MW1A 3R5XA 4OU5A 4F46A 4YRGA 4LA4A 3OE7A 1E5DA 4FOPA 3HCAA 4GDMA 1A5AB 3SC2A 5BNIA 3QMMA 4GZ5A 3GPIA 3ORQA 3C3MA 3O8OA 1TZMA 3AR2A 4JUAA 4CMGA 1Z4OA 2R8YA 4JI6B 4BX9A 3DLCA 2Q9AA 1L8OA 3W2IA 2XB6A 4L7VA 4O4LB 1DRUA 1NF3A 3DHVA 2HA6A 4K0KB 2IF2A 2Q5QA 2QRPA 3PIDA 3IEVA 2BEKA 1IHPA 4GPAA 4DJ5X 1PBNA 2JRCA 5CB4A 3M5WA 1SUBA 4UU1A 3C48A 3OTGA 4XCXA 3UAOA 3BRCA 3V4OA 1ORDA 2C8VA 2CBGA 5CVEA 3P0FA 3AR7A 1W1WA 4KSBA 4LJKA 2IH2A 2G08A 3A9RA 3VKUA 2IV3A 1J70A 3L04A 2WW8A 5E7JA 6Q21A 2OQIA 4MICA 1A77A 1PK9A 1PTJA 2HRBA 2VN8A 4Q3LA 3RS5A 1RBYA 1LRKA 2O7QA 3MYRA 1NI4B 5IBCA 4G41A 5EIXA 3FNIA 1IN4A 1CQIB 7ADHA 2V98A 4ZD6A 3RFCA 3JYLA 1WHSA 3BJRA 5AM2A 3BFPA 2JD1A 3BGOS 3QOXA 4WLNA 3JAMA 3NTUA 3HBNA 2WNHA 2C3OA 4L07A 4AJ4A 4DDHA 4L6CA 1ZA2A 1L3IA 3EQ6A 1XYVA 2AN9A 3BVPA 4O25A 1UBTS 2CJXA 2GSWA 1E99A 1HL7A 2W2MA 3C5CA 2J9ZB 1FTSA 1PKEA 4ND1A 5DU2A 1MA3A 3SFTA 1MX1A 2GH1A 2TS1A 1ZD5A 1JVBA 4AJLA 4YQZA 5DGHA 4EW3A 1L4GA 3QLJA 2XOXA 5LXTF 5I5GA 3LA6A 1RNLA 1JEOA 3E22A 3TTWA 5A2QA 3OICA 1DG1G 2R68A 2YS7A 1M83A 2PVPA 5F52A 4BBZA 3UM9A 1B3RA 4CHTA 2Q9BA 2BCEA 3FNGA 1UXKA 4O2BA 3QFCA 4YRPA 4C03A 4Z0HO 1T1IA 1CSEE 4RE5A 2C96A 4F12A 2I1WA 3KL2A 2F67A 4M53A 3UH0A 3UK0A 4DLPA 2CFTA 1T4CB 3R23A 5FB3A 2ZS8A 4KYIB 4TSKA 5K3EA 4WZBB 1XCOA 4Y9RA 3R5KA 5EGSA 4BEVA 2M1ZA 4JX9A 5BN3B 3U0VA 5BWCA 2WKSA 1YB4A 2GZAA 5H0IA 1KXZA 2PZBA 4KGDA 3M4JA 1HE4A 3SLKA 2LD4A 4BP1A 2AA3A 2BTQA 2FKNA 2YDYA 1T2UA 2GK6A 4KFUA 4LWQA 4WZ6A 5CK5A 2FYTA 1DAEA 3GJXC 3VU8A 3BTVA 4XGRA 3B3QA 4AK9A 5BSHA 1N3LA 5DTJA 3R5SA 2WLSA 1U8ZA 1DEAA 4L2IB 2OHOA 5E8RA 3UHPA 4TKUA 5MHTA 3B2NA 2X7JA 2Y9PB 3H5IA 2XWBF 3EIWA 3K9LA 3KQTA 2FEPA 3F4BA 3IDFA 4GW3A 1UEJA 3IKJA 4X97A 5KDDA 3PFCA 3VKHA 1SKAA 5JG7A 3MQ4A 3TJZA 2A3NA 3WGVA 1V1JA 1J0AA 3UOAB 1RXIA 3IIIA 4RGVA 4LFCB 4IVPA 3A6KA 1PZEA 3FZNA 5EQJB 1KGDA 1T0UA 2QYSA 1ZJZA 2F17A 1I1NA 4MPPA 5ALKA 3RI3A 2W4MA 1FSSA 1G3QA 1KVTA 1PG2A 1RQLA 2C54A 3N6RA 4K28A 5JANA 3FBGA 4W1RA 2IUTA 3OQIB 2C4NA 4X61A 3VSDA 2X5KO 4JBXA 4KE6A 1Y3IA 3VO2A 2RHLA 5CLJA 3BREA 4MIOA 5EHQA 5GAJA 5D3KA 3PNSA 4CT0A 1FS4A 1FP2A 1UBOS 1VMIA 3KKOA 4OFBA 2C8LA 4EZEA 3R1IA 5EOVA 4EY6A 2JJ1A 1ODIA 4S24A 1XDDA 4AUEA 2WYUA 3EGVA 2DFNA 3HP4A 4BNLA 2E6UX 1K1EA 3AHIA 4H18A 1BZYA 2B1JA 2GPYA 5HHTA 2O07A 3N5KA 5JDIA 2I9PA 3IFSA 3LUPA 1YKSA 4MQUA 4BAZA 1LDNA 1YWGO 3KFLA 1J2YA 4RDHA 5B1YA 2I2BA 4AROA 5C5DA 2DFKB 1OFIA 1EWRA 3DFMA 3FYUC 3IELA 4BVHA 3RARA 4MH0R 2XT0A 5CH5A 2Q1UA 4E03A 2GTPA 2QRZA 1EVYA 3ITDA 3O8RA 4MQ6A 3VBEA 4Q6WA 2O7NA 1V8ZA 2ZTUA 5AW6A 2IX3A 3NHBA 3GQVA 4N82A 1YTUA 2JLVA 4GMFA 5J1TB 4R9VA 1DAGA 1J4AA 4HDNA 3ZIAA 1NW9B 4XYMA 1QRAA 4BP8A 1R27A 2I87A 2QORA 3ESYA 3LCCA 5HMMA 1IOLA 2ZROA 1CP3A 5C37A 3LXRA 3SX2A 4QA9A 3AHDA 4MR9A 3F9CA 1H8HA 2WE7A 3VQTA 5JUWA 1NWCA 2YFYA 3VZBA 3TCNA 2CUZA 4FXPA 2CK3D 4I46A 1KS9A 4IJUA 4QUDA 3TMKA 2CHEA 2DQZA 4YAUA 1QRSA 3RU2A 1J20A 4HNSA 3ZLTA 4EI7A 3V8RA 3OU2A 2C5FA 1GYRA 3U7IA 1WCIB 1YB2A 2VH5R 1BX0A 3D43A 4IO1A 1FQOA 4QKQA 1XPOA 4XQCA 2M98A 4EO7A 3RRMA 1COZA 2QYHA 4JJ4A 4DKXA 3FNRA 2G4VA 1FZTA 4MQEA 5JRZA 2QVGA 4KK3A 1O9HA 2DBZA 1ZBDA 4TYYA 1M10A 1ZHFA 2XDAA 1WUYA 3S99A 2VYQA 4WASA 3VUFA 2O8EB 2PGJA 4AJKA 2KMLA 2YMPA 3H4IA 3W5JA 4CM9D 2P2DA 1IAVA 1SXHA 2Y76A 3ENVA 3JU3A 3VZRA 1ZICA 4KP7A 2PH7A 3UYKA 2IELA 4D3ZA 5KOHB 1Q19A 2NSJA 4R4JA 5CK4A 3MJDA 2KB0A 3PNMA 1QBGA 1XKTA 2PGDA 1X7YA 2YNMA 2IWHA 1PI3A 1AHIA 2VDRB 3ZDXB 2QPTA 1WV0A 2G1KA 3F6EX 3CFYA 4WK0B 1W5TA 5F33A 5BNWA 1JKJA 1K6XA 2R1VB 1GKLA 2X0JA 4JBLA 4ZREA 1LNQA 3G89A 2P5UA 2ZBEA 1A5ZA 5C8YA 4AZWA 5ERGB 3NEYA 2H51A 4E21A 3IT0A 2AHOA 4DDVA 4X41A 3VNQA 2P1DA 2J33A 3JD1A 1AN0A 1VYTA 3HQ4O 1JEAA 4X90A 2GYWA 3DCJA 3RREA 5BWOA 4P4TA 4B5KA 1H2RS 1R0CA 4HAWA 4WLVA 3CZPA 3KDAA 2YZNA 4E2FA 1O6ZA 5B12A 1DIRA 1SCBA 2QVLA 3WYNA 4JXXA 4IOMA 1XYYA 1DLIA 4OLFA 5A71A 1XMQB 4NCKA 1XZCA 1ECFA 1M8GA 2D0IA 1RHMA 2XD4A 3X1DA 4L0CA 1L4MA 4RPIA 5AKYA 5H3HA 4MWCA 4PE5B 5D00A 3UAGA 1TCCA 4RO0A 2PUHA 3PTZA 5F1YA 1RCFA 1U9IA 1UMBA 2CNKA 4DDTA 5IVIA 1X74A 4BMXA 4OU4A 4ENQA 4RD4A 3QEMB 4W9NC 1XWFA 3O4IA 2JLBA 3NZEA 4RSMA 1U3TA 3VV2A 3NAGA 2HA7A 4X44A 5I3CA 4CLHA 5JDCA 5K9ZA 1CY8A 1CD5A 2WWVD 3TLCA 2IEGA 3UT5B 2EFCB 1ZAYA 1K7FB 1T2EA 3ONNA 5KTYA 1XZDA 2BC9A 1RP7A 2XEXA 1EKXA 1GZHB 4LKRA 3WWOA 3W3ZB 2CFSA 4KXWA 3TPFA 1CUWA 3E9YA 3EPJA 3LU1A 3CZ9A 1K3TA 4EATA 3UK2A 4OQQA 1F2TA 4YT8A 4D6YA 2CVHA 1T3SA 1ZVKA 1FP4A 3HXPA 3N1UA 2RHJA 4K2AA 4MUHA 1E4EB 1EVEA 1U04A 1VP9A 1WF3A 4XKJA 4EVQA 3R75A 1GZ6A 1YF3A 4TTPA 3KBOA 2WD7A 3EG5A 2R44A 1RI5A 2ZG6A 5A5EA 3JQ6A 5F2KA 2MHCA 4D0NA 1P4SA 3MAAC 1NLFA 5JNLA 4MZDA 4D43A 1Z4QA 2W93A 4KXQA 4MV3A 4IRXA 1I3NA 2VT2A 3I37X 3SYTA 1OV6A 1NUPA 3N0TA 5JYCA 3IAS6 5UKDA 3LD9A 1A2OA 1F3OA 3R7FA 1VPVA 2NZ2A 3DOFA 4B3CA 4CNQA 1W48A 2B5WA 2IPXA 3A1UA 3C8MA 4JUFA 4QVGA 1X1DA 2B1QA 2IZ7A 4F06A 2YVLA 4H3HB 4C7VA 2Q6IA 4L4UA 5KSWB 2IBSA 2VT7A 3DYIA 4HLUC 4O08A 1NSFA 4PHFA 1L5KA 1Y42X 4I5EA 2WQZA 2A57A 5IC6A 3NS7A 1Z0UA 1BHO1 4Q5IA 1IHDA 2HAEA 3SICE 5F76A 1OH7A 2JPDA 5TPWB 3UJ6A 3GFPA 1WNTA 1U3GA 1QP0A 3H5NA 5KNCH 4QUHA 2J5BA 3HPQA 3NC4A 2YXNA 1BX1A 1W4RA 1U3FA 2J3KA 2YZMA 2N3ZA 4IXDA 4FW9A 4DDWA 1EDZA 1FEZA 2BFAA 2AQIA 3C3EA 3P9SA 3QBJA 3TGLA 3HKBA 4YAEA 1Z5GA 1CUBA 1ZX1A 3UGQA 3EPRA 3EVAA 4IIJF 1XEXB 3RRBA 1JA9A 3QU2A 4R7TA 4HTFA 3H5OA 2YJ6A 2P9BA 1G3UA 4NFYA 3FD8A 4X1OA 3MOIA 4IG9A 3LPMA 1T0BA 1XAGA 1SXJA 2W2KB 1GZSA 2BRUA 3OLVA 4GIBA 3GDWA 3GJ4A 4UEKA 8LDHA 1L8QA 2OP0A 2GERA 4MJ3A 3V97A 2ASVA 3E3MA 4MNTA 1G98A 2C2KA 2IJGX 3QWHA 4FI3C 3ZQJA 3WWCA 5JQGF 1AKRA 4MWDA 4O0MA 4EW1A 5KU1A 1I7SB 3NWPA 1UOOA 2H1OA 3QI7A 2QQFA 4BNUA 3RV4A 5FPQA 5AHRA 4EYOA 1V16A 5GJWC 2GFIA 2R6ZA 1JHRA 2GD1O 3HGTA 1S2MA 3NU1A 2HSWA 4LOJA 3RU3A 4DCVA 4XRGA 2QZZA 4NENA 2O1XA 1FRZA 3R7BA 1R5NA 4DXDA 3ECSA 3GK3A 3W34A 4PRYA 5IBPA 3T5GA 4UARA 1YFLA 4KNYA 1ISRA 4QGBA 3NJ4A 2ZUFA 1U8CB 4UXHA 2JFYA 4IAOA 1E0AA 4C07A 2VSYA 4QOFA 4YJ2B 3V32A 5HRUA 1L1RA 1YH3A 2JFZA 4JWKA 4E4TA 4D4HA 3HGMA 4EEZA 1BDIA 1T25A 3U16A 2GWRA 4QOEA 2PWBA 1BCSB 1T1GA 1CUGA 4LDZA 4DRYA 1PJZA 1UPAA 3JQAD 4IKPA 3ZGLA 1WTAA 1YDEA 2XX3A 4F6RA 1THMA 1TX4B 2PUTA 4B81A 3U7RA 1WCWA 4N5MA 5AVXA 1AK2A 5DSTA 3DZKA 5KYKA 1LBQA 2X6QA 2HSEA 5BVHB 3Q8WA 1JAXA 3MGAA 3QVGB 3ZEIA 2A7XA 3PDIB 4G4IA 3X2FA 3P2YA 3PITA 2E0IA 3HY3A 2CZCA 3LXMA 1PF7E 1HEUA 1U7ZA 2B6HA 4YV2A 2RB5A 1ODFA 2IYPA 5EP2A 4JHLA 4LQCA 1SCIA 3COPA 4CLRA 1LLQA 1QE3A 3V7YA 1HT0A 3AR8A 4Y67A 3RSOA 2C1XA 1D5CA 1Z18A 4EF6A 5EMHA 2JDIA 3IPYA 5TR9A 1H6CA 3ASYA 2QG9A 2IYNA 4G85A 5EUMA 3DCNA 5KYWB 2GETA 4ACBA 1NURA 5K8TA 2HUPA 3RS4A 1HMPA 4BBAA 4LF7B 4AJEA 2DT5A 1MJFA 1K7SN 1VJTA 3PZBA 4Z0NA 2Q6KA 3BH6A 3SJ7A 3USZA 3H1PA 2Q3FA 4OHKA 1TK2A 4HOYA 1SG0A 4CLDA 1A8SA 4Q4AA 5FI5A 2PYZA 5EKXA 1MQ8B 4NV3A 3PX3A 1X39A 3IAHA 1RYEA 2C95A 5FRDA 1FS5A 2ZTVA 4ZYXA 2OG1A 3QM1A 5DJ5A 2PUAA 2JLCA 4Y2GA 3ASUA 5DK4A 3QP9A 1BKDR 2ZCVA 2HQOA 4ESOA 2R7KA 1IPFA 1HE3A 1UKAA 1WZUA 2IYEA 2FX3A 2H1IA 1U8XX 2AT1A 5DHRA 1K08A 4TX1A 1Q0ZA 3U9TA 1PSWA 5EY5B 5DN6A 4W7SA 3EDQA 1D07A 3HYCA 2O0LA 1LQUA 4K6GA 4NJEA 2O57A 3MB8A 1IQPA 2V45A 1QLHA 1TJYA 1UDCA 3GFRA 2WEKA 2JZCA 4RPCA 4EFKA 4GI5A 3REGA 3RKUA 2WHEA 2I3AA 2J7KA 4KQEA 3QOWA 4MKFA 1NYRA 3QWAA 2KQUA 2O2GA 1HE5A 1FVXA 1T3TA 4Q9JA 3TZEA 3UENA 4C9BA 6PFKA 4ZHQF 2NYVA 4OB7A 1O58A 3SYLA 1TYBE 5EZ6B 2HLDA 4GBED 4IQGA 4Y9DA 3C74A 3LUCA 4DBLC 3IP8A 1NXXA 1ID8A 1K0FA 4RQUA 2JGEA 1N9GB 2QUIA 2PJRA 3HI4A 2JI6A 3C7AA 4KE9A 3JQ9A 2O3SA 5CURA 1L1FA 4XFKA 4CFSA 4NK4A 2GAFA 5D7NA 5DMHA 4YP9A 4HV4A 4E12A 3DM5A 4E88A 1P1FA 3IH5A 4W4TA 2FWRA 2Q62A 4YB8A 1J56A 3SY8A 4E22A 3NHAA 4B0PA 1AF4A 4DA8A 5MFPA 1RHRA 2H52A 1QK4A 3DEZA 3GVXA 1RVDA 3HWRA 3RADC 1N3YA 5HKAA 2XXAB 1A7UA 1BE8A 3QXHA 3I32A 1XVTA 2A94A 1USKA 1WMAA 1XTQA 2WZDA 2JRLA 3A6JA 2VATA 1WHTA 4MUMA 1Z8HA 4ZT7A 2QGNA 1YR9A 3ADKA 1H23A 1B74A 2NO4A 2OCIA 2WT4A 3BHMA 4H16A 4OA8A 5EMMA 2ZU0C 5H02A 4JP1A 3W9BA 1VKRA 2CB0A 4IKOA 1KU6A 1QGYA 1AA9A 3KSMA 2JJ2A 5IJ9B 1CYEA 5IKEA 3NJ8A 3STVA 1DBPA 1X9IA 1HLPA 3K31A 2MINB 4GSLA 3BRWD 4IG4A 5BWNA 3FCYA 2CXOA 4IF4A 2R96A 1G5PA 2IOHA 2OCDA 3OM1A 3U4DA 1OXSC 3RTGA 4RMIA 1N6NA 4Q7MB 1H9CA 4UHHA 3X44A 2I4TA 4OGLA 2R97A 4QGHA 2QL9A 3SX4A 3WHPA 4XVRA 4OD0A 3U9LA 3CPJB 4ZT2A 5LA6B 2FQWA 3ZX4A 5IN4A 4IHAA 1YFKA 3FPEA 3U7FB 1R8JA 5BSVA 3OD5A 4BLSA 2A1IA 4IHKA 5KJFA 2F00A 5FKJA 3RBZA 3V2IA 5EUQB 3AT1A 1BFKA 2COEA 2HTEA 2PLNA 4GOOD 4LDAA 5JNUA 2Z08A 3LGXA 3CZCA 2WFMA 4QU0A 2HMWA 1YVPA 1QE5A 2V55B 3HYLA 2FZWA 5EWJA 5BR1A 3WOHA 1EESA 1T6ZA 4QBHA 5KYXA 1S3IA 3OETA 5C34B 2ZVDA 3VZSA 4MAAA 2QLMA 4JCOA 2FZEA 2W58A 1AZTA 1Z3CA 2AEEA 2BGJA 4M1ZA 5ILQA 2X2EA 3G0GA 4X3PA 3EGXA 2K87A 1UPUA 2ES4A 2FR8A 2ORIA 3QQ5A 4XYEA 4EIWA 2PPLA 1W29A 3DZJA 1JWAB 4WLUA 4NF2A 3GHYA 3KUDA 4EM6A 1OYVA 2Z9BA 3JR3A 3N7UA 3M3DA 1EVQA 1X0VA 3AXTA 3NBYC 5AKGA 5CB4F 3ZLVA 1UXIA 1DHRA 1JR3E 3P0RA 3F6RA 1ZMRA 2W2OA 5EGNA 2R6CA 2P1ZA 2NZUG 2C3UA 2R66A 4GE0A 3TIGA 3UJ3X 4Z53A 1STOA 1ADCA 3AIIA 1GA6A 3NDPA 4HEHA 3WIUA 4ENVA 1P1IA 1BJRE 1GV1A 1ST2A 1UXHA 5AKZA 4RHYA 2V7UA 1ISMA 3DFFA 5KKNB 3K0FA 1VJ0A 4PINA 2D74A 2W2NA 2XBMA 2IS1A 3B9PA 3KWLA 1PT7A 3OFNA 2SCUA 3LGAA 4CKBB 5KC8A 5LOVA 4Y2SA 5BQXA 1JWBB 2V7WA 3NETA 4TYMA 3UPDA 3GLKA 4ZCMA 1HH4A 5KBYA 4NCJA 1OWPA 2PXCA 1R0YA 4DLUA 2YUIA 5BQFA 3R7LA 3ZCQA 4IWXA 1WUIS 2X13A 3GLHE 3ZW8A 3DVRX 1VIDA 1DFGA 2OD7A 3B3GA 4DRXB 3RTCA 1XZGA 2IQ5A 4RE6A 1BDJA 1JR3D 2V03A