2PG3A

Crystal structure of a queuosine biosynthesis protein quec (eca1155) from erwinia carotovora subsp. atroseptica scri1043 at 2.40 a resolution
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
230
structure length
221
Chain Sequence
MKRAVVVFSGGQDSTTCLIQALQDYDDVHCITFDYGQRHRAEIEVAQELSQKLGAAAHKVLDVGLLNELATSSLTRDSIPVPDNTFVPGRNILFLTLASIYAYQVGAEAVITGVCETDFSGYPDCRDEFVKALNQAIVLGIARDIRFETPLMWLNKAETWALADYYQQLDTVRYHTLTCYNGIKGDGCGQCAACHLRANGLAQYQKDAATVMASLKQKVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Queuosine biosynthesis protein queC
publication title Crystal structure of hypothetical protein (YP_049261.1) from Erwinia carotovora subsp. atroseptica SCRI1043 at 2.40 A resolution
rcsb
source organism Pectobacterium atrosepticum scri1043
total genus 81
structure length 221
sequence length 230
ec nomenclature ec 6.3.4.20: 7-cyano-7-deazaguanine synthase.
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06508 QueC Queuosine biosynthesis protein QueC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2pg3A00
1O94C 1PFUA 1LI7A 3MUEA 2DERA 4G5FA 1ZUNA 2AKEA 3FDXA 3IOBA 4ND7A 3COVA 1N3LA 5KCMA 2CSXA 3TZLA 1COZA 1O0BA 3HV0A 1I6KA 1KP3A 1O95D 2D13A 3A04A 4Q93A 4TS1A 1EFVA 4KPUA 3CLUC 1LW7A 3FWKA 4CT0A 2H2AA 1H3EA 1O0CA 4AS1A 1KQNA 1XJQA 3LE8A 3PRHA 4NZPA 2EJCA 1K92A 2A7XA 1EJ2A 3N9IA 2QUHA 3H97A 1WXEA 2TS1A 4HK4A 3IMGA 1EXDA 1U3CA 1H3NA 4ZT2A 1P7PA 1WQ4A 1OWMA 1EFPB 4MW1A 4GRIA 3ZUGA 1N2IA 1MJHA 1NYLA 4G5YA 1WXGA 3P52A 1N2OA 3ND6A 2J08A 3FH0A 1N1DA 2ZP1A 1GPMA 3CLSD 3PNYA 5K0SA 3CLRC 3K32A 5HG0A 1JILA 2J5BA 3NV7A 1U3DA 3UK2A 4NATA 4AQ7A 4ND6A 4WSOA 3P0IA 3COYA 3KT0A 1O97D 1JZQA 4MW5A 1CT9A 1XNJA 2OV4A 3CVVA 3N8HA 3UMVA 3TQIA 3CLSC 4PBSA 4X0EA 3CR8A 2CFOA 2B7LA 2YXNA 2C5SA 3A05A 1JIKA 1WQ3A 4OJMX 3H9BA 4OUDA 5FNZA 4CDNA 1JEEA 2BTEA 2GM3A 3QTBA 1M8PA 4MUIA 1TYCA 3CLTC 4UZFA 1WKBA 2J09A 1M8KA 5AHWA 2BYTA 3NBKA 3FIUA 2O5RA 4BWVA 2D54A 4MW4A 1WXFA 2DR2A 2PZAA 3H99A 4MWBA 2CV2A 1XNHA 1FFYA 4EF6A 5J59A 3QE4A 1PFWA 4QREA 3KFLA 4MQ6A 3G59A 1KR2A 1MC1A 4QBTA 4MW2A 1U0BB 2E0IA 4KR9A 3IODA 1Q11A 1IH8A 3VU8A 4XFDA 5J58A 3LOQA 3D6UA 1KP2A 1MRZA 4RUKA 3SYTA 3A2KA 1NZJA 3HL4A 1IVSA 1K4MA 1R6TA 1A8HA 2NZ2A 1KAQA 1XNGA 3IMEA 3CVYA 2QTMA 3KT6A 2JANA 4JZYA 3FOCA 3SEZA 1DNPA 1KQOA 4WNYA 1YI8A 3DLAA 1UFVA 1VBMA 2YWCA 4ZCQA 3SZGA 1ILEA 1WXIA 1Y42X 4NX2A 1M8GA 3ZJUA 4DE5A 1SURA 3DV2A 2YWBA 3D6VA 3IOEA 3TNJA 2WQ7A 1JMVA 3OTWA 1J1ZA 4GU5A 4I6GA 4QRDA 3IUBA 3ZGZA 4ARIA 4YP7A 4YMIA 1NURA 1YUMA 3L93A 4XSVA 5JBNA 4MUNA 1V47A 5H16A 1T6YA 4EG5A 2A1TR 1M8JA 3IDFA 1IFXA 2AG6A 4L2IA 4U7JA 1R6UA 2X1LA 2WSIA 5J5AA 1MAUA 3PNBA 1WZ2A 3GLVA 2QTNA 1KAMA 4YP5A 1YIDA 1N75A 2EL7A 4CQNA 1PG2A 1O95C 3S3TA 3IVXA 3MMXA 4R0NA 2IJGX 4EG7A 2OQ2A 1D2RA 2AZXA 1QJCA 3RHSA 1OBHA 5BNZA 1NI5A 4ZT6A 2CV0A 5IHXA 2XRYA 2E21A 3TZEA 3X1MA 1G8GA 4ZT4A 2QTRA 3RBAA 1VLHA 4E1AA 1F4LA 3LCJA 1KH3A 3FG9A 1PG0A 5TS2A 1N77A 2X1MA 2GOYA 2A1TS 3AG6A 3X1KA 2R5WA 3DO8A 4ZT5A 3PNVA 1H1TA 1IQUA 4J76A 1J09A 4PY2A 3AL0C 2QJFA 1QU3A 1H3FA 3CA8A 3PXUA 1O97C 2Z09A 3C8ZA 1EUQA 1EE1A 2PXHA 1EFPA 1OD6A 1GAXA 4EG1A 1O96B 1MB2A 4ZCSA 1GTRA 2DETA 1QU2A 3RK1A 1TYDE 2HMAA 1WXHA 2PIDA 3IMCA 4MVXA 1TQ8A 4YBRA 3COWA 2ZUFA 2CYAA 2A1UB 2IP1A 1J21A 1QTQA 1F9AA 3KT8A 1J20A 1TFUA 3P0HA 3ZXSA 1U7DA 1OWLA 1ULHA 1VL2A 1MAWA 2CYCA 2JAXA 3GMIA 1IRXA 1NUTA 1FYDA 4ZT3A 4KR7A 1I2DA 1G59A 1YIAA 1KORA 3FNRA 2Z08A 2VTBB 4U63A 1GN8A 4UZEA 3MXTA 3COZA 4JXZA 1IQ0A 1OWPA 5TEVA 1EUYA 3A4IA 1WJGA 3L92A 1M1ZA 4K03A 2PZBA 5LFAA 1QQTA 3IUEA 2Z3VA 3FHJA 4EG6A 1JZSA 4HJXA 3HMQA 3IVCA 3ZJVA 4MVWA 1VBKA 4EG3A 4YP6A 1NUUA 4I6JA 2DLCX 1Q19A 1JECA 1N2EA 1EFVB 4KPUB 1MBZA 1Q15A 3FETA 1MB9A 2PFSA 3ZIUA 1O94D 1K4KA 4DDHA 2VTBA 5DK4A 4DNXA 3GUZA 5TEWA 3CVUA 2WB2A 2QUKA 4EFKA 4MUEA 5LLTA 3H05A 2QUJA 5IJXA 3MLAA 2A84A 4Q16A 4KKVA 1YUNA 1GZUA 3ND5A 4JYZA 3N05A 4MUHA 4U8HA 3I05A 1F7UA 3SEQA 4K0RA 2ZUEA 3CLUD 1QRTA 2G36A 2QUIA 5HUHA 3INNA 4EG8A 4FZJA 1K97A 1T9GR 4HJRA 2WQ6A 1IHOA 5HUJA 1MOPA 1ZH0A 4NAUA 1N2HA 2CYBA 3UC5A 1T6XA 2RD2A 5DB4A 3VRHA 3P0JA 3VGJA 2J4DA 1I6LA 4I6EA 3TS1A 1JGTA 1KH1A 1J70A 4MW6A 3KT3A 1QRUA 4MULA 1KH2A 4S1OA 4KR6A 3H9CA 3IVGA 4G6ZA 4EGAA 1B6TA 1PFYA 1O6BA 3CLRD 2X3FA 4XFJA 4R2LA 1ZH6A 5KHAA 2A86A 1V8FA 3RJZA 4EG4A 1S4MA 4JFAA 4OUDB 3E27A 4NDAA 2O8VA 4MUKA 3ELBA 5H7XA 4MUJA 4MUGA 2A88A 2JA2A 3HGMA 3AIIA 5TGTA 4PBTA 1TEZA 1G8HA 1YULA 2RE8A 1N2GA 4MLPA 1T9GS 1JIIA 1N2BA 5F23A 2DXIA 2A4MA 3Q10A 2GKSA 2HGZA 4ZT7A 3UOWA 3ISJA 3ILVA 1NUPA 1HYBA 5EKDA 1R6XA 5DEOA 5KWVA 4MW9A 2IELA 3SZ3A 3NBAA 2XRZA 5LM3A 3HZRA 3OP1A 2CV1A 1GLNA 2E89A 1N2JA 4ZCRA 3JXEA 2DUMA 3CLTD 2X0KA 2CT8A 4A91A 4DDMA 2QJOA 4NAHA 4H3SA 4RPIA 3RFFA 1KKUA 3M5WA 3TQOA 4DJAA 2HZ7A 5DASA 4JXXA 4MW7A 1X6VA 4MVCA 2H29A 1NP7A 1IQRA 1G8FA 3ZJTA 3K9WA 1KQPA 2V0GA 4DLPA 5FO0A 3IH5A 3IOCA 2I1LA 1X8XA 3G5AA 2VXOA 2D5BA 1O5TA 1U7XA 3MLBA 3DPIA 3QTTA 4J75A 1LI5A 3Q12A 4R2MA 3SDBA 3ZXIA 4MWDA 1QRSA 2PZ8A 3FY4A 3G6KA 4MUFA 1NUQA 3SP1A 2DEUA 3AFHA 3AG5A 3F3MA 2PG3A 4MAFA 1RQGA 1GTSA 3RK0A 2NSYA 1I6MA 2E18A 3CVWA 1JIJA 4MW0A 1ZJWA 4F3RA 3HFJA 4P2BA 1O96A 2V0CA 2DPLA 2YY5A 3FI0A 1F7VA 1OBCA 4MVYA 3ND7A 4MWEA 4ZCTA 1Q77A 4F4HA 1QNFA 1TYAE 3CVXA 1TYBE 4HPWA 1NUSA 4CDMA 2A1UA 2J07A 1OWOA 3U1VA 1T6ZA 4L2IB 1N78A 1WY5A 1M83A 4DDKA 1VBNA 5K0TA 3BL5A 4PBRA 1NSYA 1PFVA 2CUZA 3AKZA 3X1JA 1BS2A 1M8FA 3Q4GA 1JEDA 4ZCPA 3N2YA 4MWCA 3UY4A 1J1UA 1JHDA 4ARCA 5FO1A 1OWNA 2QJTA 1WOYA
chains in the Genus database with same CATH superfamily
1D2NA 3JVDA 1TQDA 3EMKA 4PIVA 4DILA 5D01A 1TYEB 4MOWA 1NY5A 3DBIA 3SMVA 1WZIA 4NE9A 2PXXA 4Q4JA 4GMFA 3T5DA 1VE7A 5E3IA 1N5JA 5ITWA 3LK6A 1TW3A 1T5IA 2ZS9A 1U7ZA 1VHTA 3H19A 1J2TA 5TQ0B 3SHQA 3TYXA 4URXR 3F9RA 5CFZA 4PXAA 1DIAA 1HDGO 4RWEA 1UF9A 3QENA 1EXVA 1XG5A 3DLTA 4KIWA 1MMFB 4NBNA 1ZMTA 2JIRA 3CRNA 1M5UA 1Y6JA 3S40A 4EMUA 5BQ5A 5IJWA 4KO2S 4Q7LA 1FYEA 2HJVA 4V0KA 4OATA 5I7SA 4G0WA 4WBNA 1YGPA 1GG5A 5C8YA 4C1NA 2EJCA 5COBA 2IYQA 3H0EA 4FW8A 1RAIA 1YOVA 1JLSA 5CEEA 1N36B 1FP7A 2JFYA 3W3AA 2QA5A 3L0PA 2V7WA 3S28A 2QRMA 2ZJAA 3L8YA 3LDAA 1RDFA 3F6CA 3QOYA 4DNFA 3FAKA 4ESEA 1G38A 4EH1A 1ZJYA 4G9BA 2QI9F 2GDJA 1WXGA 3OF3A 4Y2PA 1N2OA 5I45A 1L7NA 5CVDA 3F6BX 4OL9A 2J3DA 5BNWA 4UAGA 5FR2A 3VNBA 5KC8A 2PCJA 4MVJI 2BHRA 3GAFA 4KQIA 1ZW6A 4ZHQB 1W73A 1E1DA 4BCDA 1Q1QA 3LIIA 2CCJA 4ME6A 5ULLA 4BFLA 3Q7IA 1JAIA 3QX9A 4QHYA 4DJFC 3UK2A 4ZKDA 1KBOA 2CXUA 2M32A 5IM4A 3CZPA 3PNOA 4FDUA 4RIIA 4LZLA 5CW2A 2WV9A 2HNKA 1SG0A 2CMHA 1K88A 2OCBA 4Q19A 2ZW9A 3P4UA 4QA9A 4WKBA 5GZ6A 3QPUA 5J5VA 4GSLA 3HMKA 4ZO6A 2JGJA 3FSGD 5ALZA 1IVNA 1OU4A 3HBAA 4D44A 2R7NA 4U2KA 5G02A 2WG2A 4FKBA 1SCKA 3VBEA 4PEVA 3PBKA 2COEA 3ICCA 5LSAA 3LYLA 2IOHA 3ZLJA 1WD7A 2C2ZA 1ELOA 3HA7A 3ZNQA 5BWNA 5H9VA 4IKPA 2QSYA 2P8JA 1CUBA 3MS2A 4QWMA 1WQ3A 3VZPA 3GQBA 3LDFA 4YV0A 4G0MA 1JLLB 4JL5A 1Q14A 2ZYRA 5BWMA 2REOA 4YCLA 2FSVC 3R8FA 1H8HD 1NU6A 2VHYA 3M9XA 4M0PA 4MARA 4NJEA 5HS4A 2FPRA 1TIPA 3LQ2A 2JHCA 2I2XB 3CLTC 4ZMBA 3UT0A 1C9KA 3W8EA 5KYWB 1QVVA 1U0NA 2NUPA 3NBKA 3QUQA 4YDHB 2ZRAA 4YIKA 2ORVA 1G63A 2JIOA 4BNUA 5BMOA 4L6IA 4QDTA 3TRDA 5ITVA 5JWRA 5H81A 5A4IS 1AK2A 3LVRE 5EJIA 3VKWA 1NQUA 2JIPA 1GUZA 3AP3A 4G85A 4N8DA 4BLRA 5ITZB 1KYWA 1OUMA 1YKGA 1Z5GA 2AE1A 2V1XA 3H99A 1T24A 1F5SA 3R5JA 1FFWA 4N0PA 4MWBA 2JIZA 5IX8A 1T4GA 3LYHA 1KMIY 2AKAB 2V7GA 3K7EA 5FX2A 3T0FA 3NT4A 4L9WA 2XQKA 4YROA 3E2IA 1P75A 2QUZA 1MZVA 5JLJA 1L8QA 1VSTA 4K9LA 3HBNA 1TRHA 4TXHA 1KR2A 4X71A 1MC1A 5AJTA 1SA0B 1FTGA 1HPLA 1LDNA 4OPMA 2WJAA 4TRRA 2E0IA 2QR2A 2HYDA 3MAJA 1ADYA 1Q50A 5AJVB 5ALJA 4BNHA 3LUAA 1GZVA 3IUMA 4HH3C 4R31A 1EFHA 5FBKA 1Y5NA 2ZBUA 2D1QA 3H9JA 2YOHA 4LC9A 2DTDA 4TV9B 3PFIA 2VF5X 3AZPA 3QFCA 1KP2A 2Q0XA 2AQHA 2WNIA 3EWIA 3BE6A 1PS9A 4U4AA 1XX6A 3T4XA 1PGOA 2H63A 3RVKA 4FGLA 3MUFA 3CF4G 4D4JA 5C8ZA 2HC9A 3CINA 2NG1A 3DOJA 3QEKA 2UZ1A 1DKRA 4XOUA 3DHYA 5C3UA 4RULA 2Z6QA 1TF7A 2FWBA 1B15A 5HYVA 4HDSB 4KQKA 5JALA 4QG3A 3FOCA 1VC2A 3UENA 3RRFA 3SEZA 3KOWA 4J4BA 3HRIA 4RK5A 1GFZA 3M4NA 3L04A 1VBMA 1OFIA 4DA6A 1TT7A 3IE1A 1W6RA 1HE4A 3FIJA 4QU9A 4CMJA 4F4UA 3VV3A 4IHJF 2Q0HA 3MTDA 2HMWA 2HU7A 1CQJA 4BO0A 1GGKA 3LYAA 1GXSB 2W2MA 1YRYE 1NN0A 2FUKA 4I9FA 2ZJ0A 3IUBA 2OVFA 5A3RA 3MQ4A 2I4NA 2OD9A 2XH8A 3QVTA 1QANA 2JFOA 2PE5A 1NURA 3CH6A 1K3UB 2BZ1A 4XOIA 2UYQA 3OO1A 3I6MA 3ZCTA 4CM9D 1ZHHA 1JEJA 4KGXA 2HHCA 5SZJA 5B3KA 3KTFA 3JYHA 2GZHA 1NVGA 1N1GA 1UJ2A 1XMVA 2QTTA 3CUKA 5F5LA 5SZHB 2DTXA 3ZWPA 1ZJ4A 4D42A 3DDOA 5IUNC 1R6UA 2VF4X 3B70A 5CR9A 2A0KA 5AVQA 2AE2A 2DY1A 4UU8A 2FMHA 3G5UA 4RO0A 1CZLA 1E66A 1IN8A 2ATIA 3F96A 3HQ4O 2VATA 5DO9A 5HUQA 1U11A 1RC0A 5AVJA 4XCVA 3V80A 5EIWA 5BQOA 1KZHA 4ZJUA 1QE3A 4CKEA 3BORA 4S35A 2OYRA 1AMNA 1NMZA 3FF1A 3CSSA 1CDDA 3BAFA 3KSMA 4OHPA 2W2KB 5ICFA 4ENTA 1I2AA 2GZSA 3DZFA 4E07A 1E96A 1IK4A 5FNVB 9GPBA 2PXAA 5CBPA 3VR2A 2G0AA 2P91A 2FPWA 3F47A 9ATCA 1QAOA 1YNOA 3KB8A 5EI5A 2CZQA 2Q28A 1SQ5A 5IWCA 4TLEA 1W5EA 1IHXA 3WKEA 5C81A 5CAEA 2MINA 1X7ZB 4MCAA 2C5GA 3MLEA 3NTRA 3OM0A 4G36A 5KC9A 1NW6A 3WLKX 3UPDA 3E9EA 3FMIA 2F9LA 2FETA 3CTMA 3GRUA 2XWJI 5SY6A 4WLEA 3Q9SA 5DYGA 1DT3A 1Z0UA 3OM8A 3LPDA 4JXJA 3GMDA 2JLWA 3IB6A 2Y0DA 2G77B 1N2CE 2WZBA 1KO7A 1ISIA 2R79A 1U0HC 2X6QA 3QSYA 1FSFA 3D6NB 2G63A 3THRA 5ALWA 3LTNC 3ZWXA 3OPYB 4UBLA 1AQYA 2AC2A 3ILSA 2JKZA 4C29A 4MLDA 3EFEA 4B3XA 5L53A 1W4LA 4AP5A 1LEHA 4Q21A 1ORRA 1GKUB 2XQJA 6REQA 1Y1SA 1SHKA 2AI1A 2Z2KA 5DHUA 3OTHA 3AVWA 3O9ZA 3QW4B 3V34A 1RM5A 1YACA 2ZSIA 4RPGA 3BHJA 1U8UA 5CLHA 3V7YA 4BXOB 5ECGC 4NH0A 4M0DA 4GRDA 2PLWA 4JITA 4AZVA 2HV9A 2GFIA 3ZXSA 4JIGA 3I01A 4U7PB 5K01A 5CLQA 1WXWA 5EWLA 1SVLA 1OZGA 1XMPA 2FU5C 2PQ0A 4OP3A 3LT1A 3UV3A 1E7QA 3CT6A 1H4QA 1R66A 1FXWA 3U7JA 2UZIR 5JYCA 1RADA 3R4CA 3THYB 3RO7A 4UEQA 1XDSA 5F1YA 5LYJA 2WT4A 3NANA 3DXYA 1KEWA 3QBJA 1JFSA 2GERA 2QGNA 4YCAA 1HH4A 3OPMA 4XFKA 3COZA 4LYJA 1A9QA 4JXZA 1HZZA 4NCNA 3ZHRA 3M6UA 5BSWA 1L8XA 1R8SA 3A14A 5CB0A 4RA9A 2J33A 2FSSA 3BBPA 3ASYA 3WQRA 1NTRA 2FPIA 4ZVQA 4HGNA 5T8KC 3PQ5A 3R5HA 1EVQA 4XA8A 2J6BA 4PSAA 1MD9A 2UZ0A 3EAFA 5H02A 1O0SA 3IJPA 1G3MA 1GEGA 4S0XA 3VI4B 2FKAA 3FMFA 3ZR4B 4BO9A 1B0UA 1C7FA 3W5DA 5EWJA 3KHUA 2VUHB 3VVLA 4L4RA 3PNKA 1DZ3A 3ITEA 4NFHA 1QBKC 2JG3A 3B6IA 1T36A 3JV7A 4Q9DA 4U3JA 1CUUA 4MPTA 4YMUA 3TX2A 1XTBA 2HL6A 4RAQA 1FDVA 3IIMA 5AK6A 3V48A 4GDFA 4MO2A 2WB2A 1L7AA 1QVRA 2KPOA 4WZ6A 3N76A 5AOVA 3EGDB 4MEJA 5J2TF 3W04A 3CGWA 4ETNA 1TK9A 3IESA 4HFJA 1YQDA 4D0SA 3G2OA 4HPJB 4CL8A 2VDRB 3H9EO 5KNCH 4CBVA 3OE1A 3W2IA 3WJ7A 3O2JA 1I4EB 1WU8A 3VKFA 2I54A 1CJSA 2G7ZA 5J23A 4M9CA 3R23A 3CJTA 2BKEA 3ANTA 1W29A 3MT7A 4CMEA 1MX5A 4HB0A 5JS2A 1OSNA 2QRVB 2CL7X 4YR7A 2UKDA 2W6NA 1SO8A 1UBJS 1UMDA 1YH3A 1GTJ1 2BEJA 5IC4A 5EZYB 1XEWY 4P4SA 4LMRA 2CFRA 1ZH0A 2JCVA 3N7UA 5TGZA 2CYBA 3GJ5A 4UTZA 5DH9A 2QPLA 2XNKA 3OMLA 4GPEA 5TPWB 3VU0A 4BZQA 4C4PA 3GELA 5E7MA 1HFKA 1Z3IX 4GUAA 4KXYA 4FYYA 4YFYA 4HZUB 3VRHA 2EERA 1SUIA 1B76A 4Q34A 2AD1A 2WZDA 1UZNA 2Y6VA 3HA3A 2HFKA 2QSZA 1SBNE 3HN2A 4KACA 4KI7A 4N6NA 5IJ9A 3GLIE 4TN1A 4NG4A 1KY3A 4GPBA 3KDAA 5FDFA 3U3ZA 4M76B 3HR4A 4ZQCB 3AM1A 5BNTA 1RSZA 2VSNA 5JW6A 2JAPA 2JVKA 3UWKA 2P6PA 1HE3A 3CLRD 4LFBB 1R2QA 1H0RA 4R8MA 3WLIA 4RVGA 5KX5F 3ENKA 1ZDMA 1DKPA 2IYSA 2DUNA 4J94A 1KRXA 4LDAA 5H4GA 3OZAA 4B8YA 5DSZA 1N92A 2FGJA 1WEKA 1GNQA 2O7RA 3GVCA 3PHIA 4IIUA 3M1LA 4YJ3A 2B4AA 3A6PC 3TLJA 1W6UA 3ELWA 2OCAA 4GPIB 4LJ5A 3N6XA 1PQPA 4ABYA 2TMKA 3ST7A 1LVHA 1GGMA 1V7CA 3MB8A 3RUEA 4BBJA 5TGTA 1V37A 4I3HA 3AY6A 4G4SP 4PSVA 4CKCA 1UKVY 4JD5A 4H15A 4G2TA 5CT4A 2RI6A 3BRSA 3CX4A 3N2GB 3W6OA 3WQQA 4FWTA 4ZHQF 4DQXA 4CM3A 1KAEA 1X70A 2Y1FA 3RR2A 4ADSG 3RFTA 5IS2A 3KBBA 3RAPR 1YT5A 2BP7A 1QZXA 2CXOA 2QVXX 4ZO9A 3ILVA 3SC4A 2X6RA 2ZBDA 1H4VB 3M6XA 4ZOQI 2V4MA 4QEZA 1C3XA 5IJAA 3LUCA 2P2GA 3W5SA 5A06A 1WDKA 4JUAA 1B14A 4ETIA 1ZMBA 1W0KD 4ALMA 3F5QA 3WV5A 1ESEA 4X1IA 2V9PA 3AVYA 1CB0A 1GUYA 5BY2A 1RWVA 3GY0A 4RSGA 2GKOA 1ZQ1A 3OJWA 3WOHA 4DJAA 3ORQA 4GC5A 3NIWA 4OBWA 4YXWA 1P4SA 2P9QA 4DBVO 2WD9A 4MRPA 1HUQA 4QJBA 2DX7A 3WNVA 1GDHA 2UUPA 2EBHX 3PCTA 4I50F 1U4SA 2EKBA 3C5WP 3Q1LA 3K9WA 2AFRA 3UCXA 3IH5A 2P9JA 1GZ3A 3L1VA 4J2OA 3QWBA 4KVFA 4PHTA 4YQEA 3T3PB 3E2MA 1KFEB 2ODEA 1HOTA 1PBNA 3NTVA 2G9NA 1ODFA 4F3CA 2ZE7A 1TO2E 1FDWA 1KZ1A 1PJ4A 1U5AA 1ZXBA 3HHPA 4OH7A 3VZCA 1QRSA 3PP8A 5EXXA 4DA4A 1PZFA 1HEUA 1CEQA 4IV5A 3EEQA 5B4TA 1KMHB 3HH8A 1IHDA 1Z7BA 3G2LA 2EWMA 4PGAA 4ZK2A 1IUNA 3VYVA 3WGKA 2XTJA 1O4WA 5HIJA 4TROA 721PA 4CM5A 5IJ0B 3WP1B 2FPPA 3UUFA 3FHOA 5IAKA 1KWKA 5JAMA 4ED9A 1XZCA 2FRDA 3O2QB 2VFAA 4IXMA 3UJ6A 3M1IA 3JZAA 4DA9A 4Z54A 3WMWA 1D04A 5ICSA 2V0CA 3JYOA 1XGKA 4IV8A 3QM1A 4I66A 4YALA 2GM4A 1Y3IA 4LZPA 2JCXA 4JLAA 5EAIA 3RAJA 3T5BA 2GN6A 3H2JA 1DAMA 3V32A 1JSCA 4URZR 2DWOA 3KKQA 3C8MA 3AL2A 3QVOA 4L2IB 4DDKA 2C03A 2OUKA 1EGMB 2PFKA 3VHQA 3ZI7A 4BP3A 5CD9A 3CIOA 4W8GA 4Y1FA 3RADC 1FF9A 2FEKA 5IK2A 3ESBA 1TEXA 2FDRA 2YR0A 4LF9B 2PMDA 4W82A 5B2ZA 2QMEA 3O31A 2W00A 3D3QA 2FW1A 4IJQA 4E03A 1E6UA 3QP9A 4WI1A 4ZCPA 2PU5A 2ATCA 1KSJA 5TMBA 2P9EA 2WYWA 2DR3A 4MEBA 2PTHA 4DIUA 1UM9A 1X7WA 2AXPA 3E4DA 4P5EA 3UHAA 4GECA 3GLGE 3ILXA 3NTUA 3UB3A 1Y4UA 3OPXA 1CYEA 4N5LA 2I8LA 2XW6A 4G5XA 3UB4A 3LPCA 1R6AA 1K6XA 2EFEB 4TYQA 2CBGA 3L0CA 3IOBA 1AKMA 1D1TA 1XTRA 4BHTA 2IK8A 1BCSB 3IKTA 5HIIA 5JEDA 1ZD1A 2OBXA 4I9NA 4YH1A 4F7WA 3IHLA 4LZAA 3G88A 2QLTA 2O2ZA 1BA3A 1ABBA 5E2BA 3VU9B 4PWYA 3BD7A 1E2HA 1RQRA 3HDTA 4TWBA 3OIVA 1HRDA 2IYWA 1U81A 2ST1A 4QYSA 3RYFB 3VJRA 3B3JA 5JCOA 2VCYA 3UJBA 2B1JA 3BCSA 4CV0A 4ZOBA 1EK2A 4P81A 4OHFA 4XLLA 3TSOA 4NZPA 5EQTA 4HFRA 2ZIWB 2YFYA 1R5BA 4TMTA 4A2WA 4TYYA 2EFJA 3KKMA 2YJ4A 4RTMA 3PFFA 4OLBA 3HPQA 1H3NA 1JJ7A 3MSXA 1B4DA 3JVEA 4ZT2A 4NQRA 4OBXA 2W58A 3G5LA 4Y2VA 1RXEA 1UC5B 2R25B 3L77A 3TUJC 2AIRA 3DNMA 1BX3A 1QGAA 3RG8A 4B9AA 5EHXA 1UINA 2ZUCA 4B3DA 2A30A 3B1XA 2Q4EA 3PDHA 4K05A 4PTYA 3SU8A 1N5DA 3IAXA 3D43A 5HRAA 3UMSA 5C9ZA 3K0AB 3D2LA 4L4XA 3D4LA 4JU9A 2ZP1A 4KOEC 2FLVA 4HB2A 5HM8A 4N48A 1ID1A 4JXKA 3AUKA 4XB6B 3A9WA 5K2MA 3D0RA 2XADA 3OX4A 3ZK8A 3ZV3A 1WETA 3PJDA 3N8NA 4OYHA 3SQXA 4WSOA 5JZSA 3OFND 4AUNA 1GCIA 1LTKA 3N87A 2G5CA 5F64A 2G83A 4OLHA 3WMEA 4KH1A 1ZI9A 4WXRA 1JDTA 4HX2A 5KZMB 1GU0A 3N70A 1MFPA 3PQEA 5EKXA 3DD1A 4DQKA 5ELXA 4R54A 2EKLA 3GFPA 5ICGA 1F2TA 3Q6NA 4JQSA 1XTZA 1LX7A 2VDWA 5A9SB 2R4QA 4RQBA 1ONNA 3PI6A 2C5AA 5A0VA 2BR4A 1WM1A 3CLSC 3F1KA 4MKGA 2P9GA 4PBSA 1V3VA 3VUFA 3CR8A 2AJLI 3JATB 2FEPA 3I76A 3TEFA 4LNHA 3OM1A 3REOA 4B17A 1G4UR 1U2GC 2AEJA 5CDHA 2FWIA 4WT7A 1UMBA 1CHNA 4OU5A 2ZT7A 4BE4A 4CDNA 3OZRA 4IJVA 3JTEA 3R3JA 1G21E 1BGXT 1TKBA 1TYCA 1F5NA 4GXQA 4Y2GA 1QLHA 1OLOA 2COKA 1JDUA 1I6WA 2D2EA 3I9V6 3NJ8A 4NDNE 3N2NA 1EZ1A 4RFSA 5ALEA 4I46A 3TCNA 4D9FA 2JJ1A 4KN9S 4ZANA 5FUMA 2EQBA 1GOTA 4KN5A 1D8AA 1RRPA 3S68A 2GASA 3BWDD 3ZQ6A 3ZZNA 1UP7A 1E4EA 3FDFA 1DX4A 2H0RA 2ZSJA 4ID3A 4P58A 3WY9A 1USGA 4YECA 4MQ6A 5BW8A 3OFSA 3O2SB 4MQUA 4XDHA 5EEGA 1XD2B 2EDCA 4G67A 2PVPA 4RDCA 1CZKA 3FE2A 1RI1A 1KZ7B 2XY4A 3IQIX 3VDNB 1IHUA 1KU0A 4NHEA 3TD6A 4BNYA 1RJEA 5KYVA 1FFBA 5TGDA 3LUJA 1IH8A 3DEKA 1U2EA 4D8UA 3W5JA 1W5SA 1JR3E 1PP4A 1BQ4A 1QH9A 1ENYA 3NH6A 2J9XB 3D5TA 4IQ8A 5FBWB 2BLLA 4BJ6A 2O8DA 2QAIA 2W6ZA 4P92A 3CIFA 3LWNA 1RLIA 1EA7A 5TF0A 3ESRA 3GEMA 5H8WA 1X13A 3WLFA 1BA2A 1N5LA 1W4CA 1WG8A 3U17A 3O93A 3DCJA 4OTZA 2ECOA 1YJXA 1CUHA 2OHOA 2F4VB 1UDWA 1OLSA 3CW9A 3PIDA 4Y0AA 4AJPA 1JH8A 4YAIA 4KE9A 5KEIA 2O7QA 2C95A 1GL7A 1NBMA 4FYVA 3WGZA 4JA2A 5JSFA 3NHLA 1AA6A 3ZH2A 3ZJUA 5I3ZA 2ZT8A 3ZE2B 5FAKA 2PKQP 2QZPA 5YASA 1Q6ZA 4BLQA 4DE5A 4FBLA 3W6PA 3SXUA 5LBTA 2QIPA 4L6CA 3KJIA 3RTAA 3UXMA 3KYJB 4U02A 2RKBA 4KXXA 1L4GA 1Y34E 3PGA1 1P45A 3SXJA 4GP9A 2PX0A 4DQUA 4CLOA 2RAPA 1P8AA 3IBCA 3UICA 1CUXA 1YS1X 3HYTA 2MCFA 2F00A 4C76A 3K53A 4YT8A 4M8IA 1MAVA 2OCKA 1J0DA 2A1TR 2F1OA 2VHJA 4GW3A 1CY4A 3M6LA 1EIWA 4PLCA 4WWHA 4PVDA 5DIZA 2ZGVA 2GWHA 3HO8A 3OLWA 1Z4KA 5EZYF 3M49A 3BMQA 3RIGA 2N0SA 3L01A 1KAMA 1C9JA 3IYLW 2VYCA 1EX9A 1NWCA 2RJOA 5JQGA 3G23A 1V2GA 1WDWB 2I4RA 4RNDB 4C03A 2YN4A 4MV7A 5LJIA 2WB4A 4MWGA 1ZICA 3KRTA 2ZVDA 5CFQA 1DIBA 1XZGA 2FR8C 2C8JA 1WPRA 2AMJA 5JCZA 5FOTA 1XQXA 4H4EA 1A4UA 4PPQA 1GPAA 1ZOPA 2GEBA 1SWWA 2ZBGA 2DUWA 4L57A 4U0JA 3RSQA 3WRVA 2H1IA 4A0RA 4B3FX 1QJCA 5CM9C 4ZJZA 3KJEA 3NPAA 1R0KA 1OGJA 4P7KA 4FQ7A 3B1VA 1PK8A 3GP5A 1H0HA 2OXFA 1LJUA 2QB5A 4P3PA 5GOZA 4RA6B 1SCUB 4WZBE 2C3MA 1V8OA 1O03A 3F9CA 2QN6A 3AU8A 2W9XA 3DYIA 4EHAA 4PRYA 2EFYA 3I2IA 5HQJA 3HXLA 4LVOA 4CIAA 2H2WA 2V9ZA 3ZWWA 1G6KA 2O9JA 2X7JA 3MWDA 4ZU1X 2Z43A 1PNTA 4NONA 3BSFA 4NLLA 5AW5A 2DQSA 3DVRX 3RBAA 1F4LA 4XYMA 5LA6A 2GUWA 3V2IA 1EK6A 3EY4A 5K3OA 5WRFA 1NVAA 4LMBA 3ANYB 4XUCA 4YMSA 1GQQA 2X3YA 3II6X 3LIPA 3T52A 2NTYC 4BNXA 3UT5A 4EY5A 2QX8A 2QI9C 3KOOA 2BGLA 2EG9A 3QOFA 4GE3A 1H1TA 4M0LA 1K6EA 1M2GA 2OENG 1FVOA 2CHQA 3AJ9A 2QJFA 2PJUA 3DW3X 4XM0A 3WHLA 1GM5A 4K6OA 1D8TA 2Z09A 2CHVA 1NRWA 3GXBA 2G8LA 5CK4A 4MWOA 9ABPA 2IS2A 3NTOA 4O63O 4HX5A 2AG5A 3QVXA 4I8XA 3T38A 3DT6A 4C21A 2DR0A 1BMFD 1DIGA 1EUDA 1TQ8A 4QT0A 3IQGX 1XBTA 3EX7C 1FFGA 3IV7A 4D0LB 2ZRCA 3I9OA 5CYGA 1QX3A 1ZYUA 2D0DA 3IUJA 1KVRA 3DBHA 4PZZA 4QUKA 1YAHA 3FTQA 4IMPA 1A8UA 1S8NA 3PU6A 4B5LA 4QQKA 2H7VA 1JP7A 1Y8AA 3FYHA 4YMTA 5LMNB 4INOA 1FNBA 1P3Y1 1I7LA 5ENDA 3CZ5A 3VR4A 2C4HA 1ZWKA 3VKHA 4WUTA 2C84A 3WHKA 1EU1A 1X0XA 3OLVA 4B1FA 1DCFA 3L7LA 4AI6A 1CP2A 1F17A 1XJWA 1RTTA 1EDEA 2NXEA 2VOJA 4GMXA 3TW0A 4A15A 4LISA 1XU7A 4R3WA 3WRWA 1JHOA 2I6TA 4MHTA 3A28A 2PA3A 2W6ID 4IRUB 3DMTA 4AN4A 3GYGA 1DTWA 3B51X 3K5IA 3LJKA 3RLIA 1YRLA 1IE3A 2ZUVA 1ND6A 4ZQFA 1X39A 2OSBA 4BZPA 2JH8A 3G1WA 1QHNA 4LEIA 3L7DA 5CXXA 3B9QA 4WEOA 3KBOA 3CZRA 2V3VA 2WHYA 4RGBA 2NACA 5F1KA 4EB6B 1Q15A 2IU3A 3ETHA 3LQRA 5KS2A 2V4UA 3S0JA 4YASA 2P6MA 4WBNB 4DV3B 1F8UA 3PEYA 4ZJYA 5C8YB 2CEKA 4ZOLA 2KW5A 1K27A 1YDEA 1EG7A 4J7AA 1DJMA 4CMKA 1W2WB 3DEYX 3K71B 1N2SA 2Q4TA 3KAJA 2WKQA 5M7EA 4C9BA 2Q7OE 3P9QA 3MMNA 4N3GA 3FOZA 421PA 3EGXA 1QYXA 1SJ9A 2C4VA 3DOHA 1DUIA 4GX2A 4NK4A 1WW8A 3WWEA 4CN9A 1SCAA 2JD0A 1EEHA 4HAWA 5AM2A 3ANLA 1JHZA 2FH5B 4P5DA 5JZOA 5CVJA 4DLAA 3ZIAA 2NP6A 3IT2A 3AI2A 3VKUA 3SSAA 5BV2P 2PCLA 5I9TA 3FVTA 3KTAB 4EG8A 1QP7A 3LCVB 2X0DA 3K94A 1TUBA 3A10A 1PG5A 2GFQA 4TN5A 1L1EA 3QVJA 4R8VA 2O8CA 4IDBA 3QOXA 2JAUA 1VYVA 1HNZB 4JB0A 5FWYA 1IIRA 3U1BA 2HA2A 3N39C 4TMWA 3RVBA 1ADBA 3K2IA 1U3WA 5G41A 3IIIA 4YXFA 1T6XA 2WSSA 4NENA 4LGYA 4Y2XA 1BVYF 5FV7A 4XQCA 4Z6KA 3M6MD 2MR6A 1SKMA 1Z68A 2X77A 4AMZA 4RFVA 3H9GA 3FR7A 2AB0A 2GEDA 3M1AA 1FL9A 5EIHA 1QHIA 1TJYA 1NJSA 3QH4A 3G9TA 2QM7A 1ZRHA 2F59A 4X7PA 3H9CA 3SJUA 4ZXFA 4B0PA 5LR6A 4V02A 3RI3A 1E9AA 3TQCA 1O2DA 1UBLS 3E1GA 1G5PA 2FI1A 3WNDA 3SQWA 4ZQGA 4JLWA 3I2GA 3VAZA 4R2LA 1R88A 1ZD4A 3HCBA 4G84A 5CHEA 3GQBB 4EKYA 1DUVG 1W49A 4BGUA 4G24A 3M1YA 1DKUA 2HPVA 1Z08A 2CNWD 3E27A 4BGIA 5BVHA 4B8WA 3I6QA 4NJEB 3F2VA 4UC0A 1IZ8A 3Q8XB 4XIGS 1CS4C 4AY4A 3TKLA 4UBJA 1HURA 2WIBA 2EJWA 4Y2SA 3RFVA 5AUNB 5IZCC 2WF5A 2GBIA 3DLHA 3V9PA 2QZ9A 2GO7A 3WWZA 5JSZA 1EDOA 2IF2A 5F9FA 4C5BA 4M9ZA 5IAGA 2ESRA 4MRVA 4X45A 4V1CA 4A8JA 2WRZA 5E4YA 4C04A 3IXMA 2LPMA 3T95A 2HN9A 4W63A 1D4OA 3AEYA 1ZI8A 3C4JA 5EIOA 2D0PB 3I5UA 4KHZA 3BMCA 4BO8A 3LRTA 2D2XA 4A2QA 3JQBA 2DLNA 4IIEA 5JFOA 3ZK7A 4OQQA 5H3LA 4OL0A 2VDLB 1WIWA 2PLRA 3HZRA 1Q44A 1GLNA 2E89A 4NICA 1T9DA 3KTOA 5AKZA 4UJ5A 2V6FA 4LYGA 2P2SA 1KFCB 4EKGA 2X0KA 5I8WA 5ILOA 2IYNA 3DHVA 3R0JA 1RYHA 1PS8A 3I09A 3FSJX 3PC8A 1H9BA 2DPYA 5G1NA 4FYMA 2ZWAA 5CLGA 1P1CA 2GVDC 5DASA 3T12A 3GEHA 4EYEA 4IEEA 3WMFA 1QYVA 2Q5EA 2PUGA 1PI3A 2DQ4A 4LHEA 1P72A 4FDMA 1WLYA 3CJQA 2O0MA 1XZBA 3TE7A 3VDQA 3SYMA 5IT4A 1AQIA 2NADA 2QOEA 5AXDA 1DBPA 2P9TA 2WF9A 2M2IA 5KNDA 3HPRA 2UZ1B 2RCNA 4NFLA 2VH5R 2WFMA 2ZB2A 3QU4A 4J0KA 3IEKA 1PJTA 3GDFA 1I36A 5HX7A 4WTOA 1FRQA 1QJ4A 2ECPA 4BDTA 1LI5A 4BB6A 1R9GA 4DR3B 4WK2B 2DBQA 2H2IA 5NLLA 3H2SA 2CVHA 3RUCA 1UBEA 2XVMA 1B8PA 3LGXA 1FFHA 2DKNA 3SP1A 1XA0A 1ZD8A 3T7RA 1GZSA 1CQJB 1Z0KA 1NWHA 2H3HA 2R47A 4LE2A 4OM7A 4ZEXA 4IVRA 1U2QA 1G16A 3QXHA 5A71A 5AJYA 1L3BA 1P9OA 5CVVA 2W7TA 4MS3A 2X2OA 4QD3A 1I01A 3L8FA 1ULUA 3ONWA 3VISA 2KLHA 3N07A 3NCHA 4BVGA 2MU1A 4FILA 2VR1A 1O9BA 1E2NA 4L4YA 4DB2A 3SIXA 1T1JA 1TB4A 4XM1A 1CUZA 1NUSA 4AF8A 3RRYA 1SBYA 5A7GA 3TE6A 1NQOA 2XUOA 2IZZA 4FBMA 4LX8A 4BFTA 4AKEA 1SKUA 3TZHA 1U2DC 1GL3A 3HU2A 1R64A 4XEHA 1EVZA 1PFVA 4HMPA 1L1RA 4OQXA 3DQZA 3PQ8A 2ETVA 4RYDA 1TK3A 1JUDA 4L5BA 1XFAA 4E13A 1I3OA 2EBUA 3OHMA 3BXEA 3KD3A 1ONBA 3VXKA 4CKEB 1JHDA 1M9NA 1NFFA 3T9DA 1AKRA 1C4KA 1E9CA 4PLHA 3VM6A 5K3BA 2CJXA 3SGLA 1QK3A 2C7VA 3STHA 5K6RA 2JK1A 1TMOA 1LI7A 2BEWA 3B7GA 1T29A 3NXSA 4UARA 4WK0B 5CBPB 5HHTA 1XF9A 1V4BA 3OE7A 4GLFA 2WINI 5FUWA 3L6BA 1RFLA 4ZDWA 4EMBA 3IUYA 2WKWA 2AVNA 4N5HX 2QRGA 3TSAA 4FFLA 1L1FA 1HDEA 2ZBVA 3CKLA 3ECSA 2MINB 2P0EA 5CAEB 1Q7CA 1LA2A 1L5VA 1NVBA 2QZJA 3K6SA 1J5EB 3E7PA 1O0BA 1UAAA 5MGNA 2P65A 4O08A 1WAMA 3FKSD 1D6JA 4X60A 3JQQA 4IOMA 5K09A 3E9YA 1G98A 5JDCC 5ER6A 1KJJA 3HCPA 5I4IA 5ADHA 4AS1A 4ARZA 1SXJD 3U1TA 1DKMA 1Q6YA 3S55A 5DOVA 2RCYA 4TTPA 4TS4A 4UREA 4BQPA 1C30A 1FBNA 2QL7A 4JODA 3IMGA 2OA0A 1IN4A 1FYXA 3HSKA 4E1BA 1J5PA 2I33A 3I6YA 3KUDA 3UUEA 4DN6A 5JYBA 2P5YA 1P7PA 1E99A 3CJRA 4WASA 4QXQA 1NXXA 3GW8A 5IJ0A 2OOSA 5FLEX 1K75A 2QLNA 3DKVA 1VG9B 4DY6A 1FRFS 1CR1A 3B60A 6REQB 1DEOA 3RJ5A 4Q47A 3WK9A 3U4CA 1BMTA 1LV7A 1T3ZA 1F6DA 3R7WA 3M0EA 4EITA 2HA7A 3UPTA 5FV4A 1FXUA 1GPMA 2H18A 4TQUS 5IULC 2ZBFA 4GBJA 3ESXA 3U19A 3EPJA 1XTVA 3CLRC 3I8OA 4R8SA 1D2CA 2YV4A 1JVBA 3FPBA 5EWLB 4A0GA 3S99A 2QP4A 2XTNA 3PFHA 2AMLA 2BD0A 1BX0A 1YE5A 5DBEX 4OKSA 1W93A 2W93A 3KFXA 1BXKA 4Q48A 4ZAVA 4DZTA 3NAGA 3GX1A 4RY2A 3I5AA 1JSXA 1ZKDA 1T5OA 4K9PA 2X13A 3WSTA 2UYGA 2PKWA 3VJLA 5LYJB 4GICA 1JFTA 1ZUWA 3LUDA 3RPEA 2IXBA 3SICE 1XQVA 4HUQB 2E82A 3GFFA 3GXOA 3EZNA 2BHTA 1B00A 4QAQA 4Q3AA 3N3AC 4RA9B 3AOEA 4KIUA 3ICVA 4QGFA 1QR6A 4BEVA 1LLFA 3NX4A 4BYGA 1PKXA 2FPIB 2DB3A 3MCZA 4OAPA 3EODA 4P4GA 5HKLA 3OPVA 5L3RA 1AOXA 2HJRA 1I5RA 2P3SA 1HX7A 3FYUC 4GR9A 4HH4A 2VSQA 2X6TA 4ILEA 3R9XA 4RJLA 4XYEA 2WPDD 4MHOA 2OPHA 3ED5A 3K0FA 2WW8A 2BGKA 3QPCA 4DAOA 3KVOA 1RRFA 4HNAA 1IIBA 1U0OC 5T67A 3UJNA 4RADA 1IXRC 4H08A 4ALJA 4BMNA 4R1LA 1ONSA 1TK2A 2WD7A 1PK7A 1T36B 1ULBA 4U3JB 5EFOA 4BKUA 3WKAA 1ORHA 3LT5A 3A1TA 2CD7A 4R05A 2XCTB 4B81A 3GFTA 4S2EA 2XZTA 1M2KA 4L8VA 1XKQA 4OOEA 2J8ZA 1ZPDA 1SBQA 2YQZA 2Y77A 5DN9A 3CEPB 3T3DA 1YRBA 2FK8A 3MCAA 4L3WA 4BB9A 4HQ6A 3EGVA 3ADOA 2B0CA 2WM9B 4Z5XA 2BSQA 1LDGA 5DHPA 1AX9A 3K20A 1YCFA 1X1EA 1KOLA 3QE4A 1U65A 2BE7A 1XFDA 1EK1A 5EE0A 2G1PA 1E20A 5BW5A 5K45A 4MDHA 4HWTA 5EXPA 2DWUA 3PHCA 1AQ6A 1RRKA 3QUCA 3OJ0A 3TKAA 2ZYAA 1J2RA 2IWRA 2B99A 1BJKA 3GH3A 1UMDB 3VO2A 3G49A 4P4SB 2VQ3A 1K68A 2B1QA 4GWLA 3SQMA 3TMAA 3ZTTA 4J7XA 4G0PA 4CV2A 2DECA 3EIXA 4EB3A 1WBDA 3O1HB 4LS3A 4GMDA 3U2QA 2F7SA 4DVJA 5AXBA 3HL4A 2H1VA 3FGOA 2XCOA 4MUYA 1JTFA 3ZEAA 3T1HB 2X14A 1N9GA 3H86A 5IJ9B 3SHTA 1HV8A 4CUJA 1OBOA 1AH2A 1WMBA 2XTAA 2R3SA 1N5IA 4G09A 3E9DA 2OMKA 1W7AA 1VHJA 2I3BA 4RESA 3R3UA 5EZSA 3X2FA 3NCTA 2F1HA 3ZI0A 1H1LA 4LPSA 2ZB4A 4WBNF 5C8YF 4OP1A 3BH6A 2XKBA 2ZUWA 2GZRA 4UAUA 1WXIA 1Y42X 3WGVA 4RLQA 3VGPA 1QFYA 4BVEA 3E15A 4GKKB 1DAKA 3RS0A 2F9MA 2H59A 2BUCA 2JI9A 3FWNA 3K96A 2GEVA 2JBWA 3FDJA 4KUGA 5JNUA 1EXMA 2JDIA 3CZCA 4J0FA 3B6EA 4YJ3B 3PWZA 4GH5A 3OOJA 1H2BA 1Q1ZA 3UMFA 3I5XA 2IOYA 3UANA 1EAYA 1MTOA 2I1WA 2MYUA 3NFRA 2WABA 3GVHA 3OQIA 4E30A 4EZIA 3HG7A 4B2LA 5BP7A 5IVKA 3KCQA 3WK6A 4CKCB 1JWAB 1U8TA 1O08A 1OROA 2Q3CA 2J32A 4CG2A 1SC1A 1UOPA 1VYHA 2ROQA 3PITA 1ABFA 1E18A 1TCAA 4LGMA 3KXKA 4IKOA 4FLMA 7MDHA 4CQJA 5K0BA 4HL6A 4U7JA 1P5RA 4W7HA 2BP7B 4DNOA 5KCZA 1U8FO 3E8XA 4B87A 3JSAA 3JVIA 1JAYA 3NBQA 3OCCA 3PYXA 1OTYA 1DMRA 1CE8A 5L4LA 1NXQA 3WTBA 1NX9A 2J0QA 4XVUA 2CUNA 1IN6A 1R8JA 4PO9A 4XW2A 4BE9A 4GS5A 4KITB 2J0VA 4O59O 5EIXA 2QLLA 2RGYA 4JVSB 3EUAA 4WADA 4Z86A 2ZKLA 2JFNA 3OCYA 5JPIA 2NX2A 1I2ZA 1N0IA 4EX6A 3EGIA 2NXCA 3QE3A 2OLEA 5MN6A 1MG5A 4DWVA 2QTAA 3WX0A 1FMCA 4Q12A 1Q0ZA 1NQWA 3EVAA 4BEWA 1W36B 4LF5B 1RZ3A 2NT3A 2CJWA 2JD2A 1RHKA 2LKDA 5KWJA 4Z4GA 1VJGA 4LY3A 3R9WA 2ZVPX 5I7WA 4JLJA 3AETB 2H5EA 1V1RA 2C8LA 1EQAA 1XXHA 2WJIA 5C7OO 4YONB 1LDYA 2Q3EA 3M2PA 2HNAA 5FULA 4N47A 1JJVA 3C6KA 5JYDA 4C0AC 2XMCA 3TTYA 3BIWA 2RMKA 3A1VA 1M6WA 2OWDA 3H11A 5IMBA 5H68A 4RDHA 1U8CB 3DE4X 1H05A 2ADOA 2G3YA 3DE7X 3FG9A 3TG2A 3C4QA 4P2GA 4GRAA 1C0LA 1KJ8A 1M2JA 3T3HA 3J80A 3FWPA 3F7OA 3LG2A 1FLVA 3MOGA 4OHCA 5CCDA 3GFVA 1U99A 2NU6A 4CKXA 2G72A 1RQ2A 2UUBB 2GCGA 1IQUA 1P0MA 2Q4OA 3PUYA 1N8SA 5DLQC 4X00A 5SYAA 3CWZA 3OQNA 3AK4A 4ITUA 2FPPB 2EHDA 3AL0C 1QP8A 1PVOA 3NDBB 3ZGNA 2GTHA 4EK9A 1PGPA 3V2GA 1FUUA 1Q7TA 4LFCB 4QXRA 1Q1AA 4NK5A 3RV4A 3GMSA 4QDKA 1NULA 2WFLA 2OV3A 4JJ6A 4L8FA 3A6DA 2QT9A 2DHEA 2BISA 1G2OA 2BI4A 3EIWA 4G81A 4NCIA 3PFNA 5AHRA 3DDNA 4FS3A 1NGSA 4KYTA 4XVHA 5HF6A 4HZIA 3Q3VA 1V71A 1Y3BE 1DQRA 2FFHA 2GMWA 2GZ1A 3AR7A 5DULA 3AB3A 2D5CA 4AL4A 2W4QA 1AHPA 3HVJA 4QPNA 2Y76A 4P9NA 1OWLA 3L0BA 2ZM5A 4OXKA 4FEEA 2PIAA 1IRXA 3PNLA 1RM4A 3AVOA 5B4UA 5F7XA 4HFNA 4C7OA 1TVMA 4IGAA 3PG5A 4KR7A 2C97A 3FTNA 3JQFA 2XUKA 5JNWA 3KOXA 3KJXA 4FT2A 5CPBA 1R8QA 3FNRA 1UM9B 1X7WB 1X7HA 2J3KA 4MWZA 4URWR 5DXJA 5I5GA 1EBFA 1M2OB 2VUIB 1PZHA 4XSGA 1IJBA 3FOFC 3JZMA 4NZOA 2I76A 2BFOA 2CFCA 4LZZA 4TMFA 1ZJ6A 2DWPA 5J4LA 3LVBA 1WJGA 3L3BA 3NR2A 4KP7A 4LOIA 2GRJA 1KIMA 4LXUA 4MVJF 5IXYA 1JQKA 5LFAA 5KAMA 1E2LA 4JIMA 4NWIA 3J7AC 4UBKA 1KDTA 1KAGA 2WUFA 3QJ5A 3OWOA 2Y99A 3D4IA 2WJZB 4UVHA 4W8OA 5EUMA 4KKXB 4QM6A 1FTNA 1VJ1A 4GOLD 4A9AA 1C2YA 1SZJG 3HFRA 3QKSA 2R86A 1I32A 1DLJA 1LSJA 1PFGA 5L95A 4MVJD 1NAHA 1Z13A 3VFDA 3WSWA 5LPNA 3FCOA 4IS2A 2ZRLA 1EVYA 1EGVB 4H35A 1L4MA 4WOCA 4RV5A 1POXA 4WZAE 3O8LA 3FKQA 1BGVA 2CJFA 3ZY2A 1GCGA 1MPXA 5TV2A 4DLZA 4E7OA 5A2QA 3TFOA 1X0VA 3SZMA 3OURA 5B7QA 4FNAA 4F91B 3ZC3A 1F6BA 1LF0A 1FDIA 2A84A 3OQ6A 1Z16A 1QWOA 3A31A 2CBZA 4PCAA 1RZVA 3MNFA 1XIVA 1P7ZA 4KXLA 5U9CA 2EEPA 5U1PA 3WVNA 4U8HA 1YHZA 2WBLC 3CC8A 4PLTA 4W7IA 1L7BA 5AIAA 1V5WA 2W8ZA 1G2QA 3H3JA 3ONEA 2FXVA 3FA2A 3LHDA 3FOWA 2ZROA 3AM3A 4DA8A 5JFGA 1YJCA 2AG0A 1XAGA 2ZYDA 2HWUA 1X77A 2PUDA 4YP9A 1B43A 1XTKA 4BWFB 1PL7A 2TMYA 1W0JA 3Q7RA 4HPXB 4GVLA 2ZWPA 2X1VA 2HMSA 2R48A 3GJ0A 2A5DA 2ICAA 4DYHA 4Z3OA 1NVFA 2Q6LA 4M4SA 2O3TA 3QFHA 3GCZA 4YWJA 1UMKA 4BNZA 2ECQA 2HY7A 3EMDA 4HMQA 1MTZA 4QX6A 5AW1A 2ZYTX 5LOVF 1O7JA 2RD2A 1EFUA 2CUKA 2HMUA 2NQ2C 1CZHA 4R5MA 2HR1A 5ANRB 1XWFA 5A5VA 3ITNA 2HUPA 2WUEA 1XAJA 3VNRA 4BFSA 2QPAA 1F2TB 5ES3A 3GHYA 2VDWB 1MO3A 4P4LA 3T4PA 5E9AA 5L9AA 2Y27A 2FFBA 4KGZA 5LP1A 2D2VA 3OESA 5FYDA 3QX3A 4WESA 4MYTA 2P68A 3QVMA 2R11A 3RTGA 2N47A 3P2YA 4RK0A 5AVXA 1VPLA 2I4LA 1WB6A 3KV3O 1G17A 1IBMB 1L8LA 3STWA 1PW5A 1WMDA 1PT9A 1UMBB 1QV7A 1V8FA 3NDJA 4YJ2A 4PLGA 1VJDA 1XCBA 4JLPA 5JWHA 4IHQA 1UBHS 1N8TA 4IYRA 3EBPA 5ALOA 1ZVQA 1HI9A 2DH6A 1JQBA 5HW0A 4EY3A 5EERA 1VLQA 2W6JA 1SK8A 2ERYA 1HF3A 1ZUIA 2P9YA 3FX2A 1ZD9A 3LO5A 3BCRA 4RFSB 5CFRA 1YQTA 2WYHA 5A5EA 1FVXA 3BD6A 3CZMA 1TQ4A 1TZBA 1I2CA 2YVQA 3B2EA 4J16A 2W6PA 4B46A 1PW7A 3DUWA 4P0TA 3UOWA 3WGGA 1CY1A 3PJEA 1RYEA 4AICA 3O3MB 1E4EB 3UJ3X 2R0QC 2WP8J 1JYFA 1FXWF 2QYHA 3O1IC 3F4BA 1B0PA 4N1AA 3OQHA 2RONA 4F3YA 5LYJF 3CH4B 2HK9A 3JXEA 3VOTA 3NP7A 3EEYA 4D1YA 4A91A 4BQIA 3ZCUA 3IPYA 4UAJA 4LE0A 1A9ZA 3LF2A 4NABA 1KO4A 2H4HA 4QNMA 4Y30A 3GBPA 2B92A 3K0KA 4R9NA 4ZU3A 4L0MA 1ZISA 2O8DB 1SAYA 4JI3B 2R00C 3U44A 1L7QA 2AFHA 2HBQA 1DJNA 3QMVA 3ZJTA 1PKEA 3K9LA 4E11A 3KSAC 3K1AA 2GX6A 3IOCA 2OHXA 5E8JA 3T99A 5HM6A 1ZR2A 1SUWA 2OXRA 3F8SA 4X97A 1CPYA 4BOYA 2AHOA 1CY7A 1VSQA 1OLSB 1I0LA 4R2MA 1H22A 2HWYA 3LY7A 4E31A 1CX9B 3L40A 4D4GA 1GFSA 3DFMA 1SC3A 3M6FA 3DF7A 4ECEA 1VGQA 3BIOA 2C3YA 2OHVA 4AFNA 2ZJ6A 5KNCA 3R6LA 4QAJA 2C2OA 4KAJA 1HYHA 1UM8A 3AEQA 2RG1A 1ZHOA 1P9WA 3AG5A 4IIDA 4PZ9A 3SXUB 3EXHA 3SX0A 1VRWA 3GARA 4WGGA 3NFYA 3RVPA 5CEJA 1I1OA 1YDHA 3AFIA 3CONA 4P2BA 3Q7SA 4X63A 4C08A 4JI0B 2AK3A 3HFSA 4Y7CA 4CLOB 2EXXA 3AZOA 1PJAA 2GPTA 1Z0DA 3NHSA 3T7IA 4F1JA 4Q1BA 2ZREA 4D46A 1T8SA 1UDCA 1TYAE 1K2VN 3OAAA 4HPWA 4MCHA 1Y9EA 2AV6A 2V65A 3KUKA 2VZ9A 4RD4A 2CY0A 3G79A 2MTBA 3X43A 5JAOA 1THZA 4AZWA 1XLTA 5CFLA 1YONA 2JC3A 3PJFA 1UJ5A 3D02A 2WOJA 4Q4HA 1BXGA 3Q85A 4LSGA 3BMQB 4P38A 3TAXA 1VJ0A 1RXVA 1VXRA 1CY6A 1QFJA 1KAOA 5F2EA 1NXOA 1SUPA 5JQGB 3KYDB 4DEXA 1BG6A 2H4XA 3CX8A 2ABWA 1GR1A 2WZCA 4O2LA 4HWPA 1E6MA 1QUFA 5C0OE 1Z5UA 1RRVA 4LJ8A 3AR5A 1E7MA 2C2GA 4MRRA 4O4HA 1ZHFA 3H5OA 2JI4A 2WT9A 3E7XA 4MP8A 4V0RA 2PK3A 2UVQA 3Q2KA 4WFIA 5JRDS 3JQ8A 1N0HA 1WVGA 2PRKA 3U49A 2K7ZA 1DQZA 1RBQA 2QRUA 1N3LA 3GEGA 3V4ZA 4JNKA 2VH1A 1I14A 1W4AA 2C9YA 4MR9A 2NUTA 3AL3A 4FMDF 4NOJA 1II9A 2B1IA 1ZFNA 5SYNA 4RK4A 4LK2A 3OCVA 5LMZA 5IWAB 4H7HA 2HWWA 1GRNA 3ROPA 3JR3A 3RIYA 1V6SA 2SKDA 4MKFA 4IJ5A 3SM3A 4D8YA 4IMRA 4BMSA 3QUSA 4X8OA 2AOVA 1UBGA 4TTSA 4E08A 2ZSBA 3KQOA 3UT5B 2G08A 3FBWA 2XXJA 5J5CA 5BPFA 1RKVA 5K1ZA 2VDNB 5FUYA 2OCPA 5D5QA 3NIFB 2XYHA 2DUUA 3LLCA 3ZJ5A 3G13A 2GCPA 5B3JA 2CGEA 1OVMA 4RF4A 1BCRA 1QAMA 1W44A 3H5WA 4G5YA 4R6XA 4RTQA 1EWTA 2CLEB 1KYVA 4K8RB 1EUDB 2J08A 3HNPA 3RNOA 1FNSA 3WNCA 4EP1A 3AJEA 1COWA 1XZKA 3GUYA 3HJGA 5C35A 3D1LA 3K5HA 3LLVA 3PNYA 2HRCA 1VKRA 1G55A 3KEGA 1NTOA 3DNFA 3EDRA 3OFJA 2EVWX 3P0EA 4LGVA 1FS6A 3H87A 4L5JA 3AEZA 2ZUTA 3M6AA 1V41E 1TM5E 3DV9A 4Y2JA 4JT4A 4C05A 1JHUA 3OT1A 4WQMA 4C30A 1SCBA 4IINA 1RP1A 4GI3A 4MCJA 1AK1A 3A9UA 1EK0A 4MW5A 4TTQA 4B6RA 1G0OA 2JJ8A 1UDBA 3GNTA 4IZIA 2ZB7A 4LYHA 3VR5H 5D2CA 3HDVA 2WVGA 1W36D 4YXWD 1Y1TA 3TQIA 1L7EA 4OHBA 4NTZA 1FXSA 2P41A 3KSDO 3WBJA 1VYUA 1HETA 1DTWB 3CRW1 5EKSA 3I1JA 4N3BA 1CUYA 3DBOB 2WWXA 4QTUB 1ZL2A 4QVKA 3KQNA 4IY1A 2HQ1A 3UMYA 3RAEC 2E5LB 2DRIA 2BDEA 3VYRB 3OKAA 2VQSA 3QY9A 3VSDA 2VPQA 2VT6A 3EVEA 3WBKA 5KQLA 4NIMA 2XNDD 2VHXA 4LCBA 3GJ3A 2ZYUX 4MV4A 5CYFA 2JD1A 3P9IA 2OV8A 3TR6A 4G1VA 1IN7A 2QENA 4UATA 5C5CA 2FQXA 1G3IA 4LJ6A 4WBSA 3VSBA 2ZYWX 3ZWYA 1OAOC 3TLXA 4B4KA 5CIYA 2O5RA 2WMNB 4OQLA 3FYDA 3OZXA 4IUBS 1OC4A 2FUNB 2WU4A 3AHEA 3K73O 2NAPA 4Y2YA 2BFDA 5FF9A 4D99A 2OBLA 4DUPA 1UOOA 4E88A 4N3CA 3WOVA 2HMYB 3KXIA 4X5OA 3WRYC 1Z56C 2CV2A 3KVNA 2GCOA 3EISA 4AQYB 1QQ7A 2PMCA 2Z56A 1Z2EA 1BW9A 2BM1A 1XCGB 3TKYA 1JFLA 5B53A 4B7UA 4O1HA 4TQGA 1EFCA 1CBUA 4WFKA 2ZIFA 4BFZA 4G07A 2IOQA 2FJ0A 1KOFA 4LUCA 3IJ5A 2NUAA 1P7YA 3JD0A 5BT8A 2YWXA 2Z8XA 3MCTA 3QVSA 4ISCA 1NOJA 1TUBB 1A97A 5IK2D 3OLYA 1OYOA 5AP9A 3AESA 4CM8B 1EBBA 5FWYB 2AG1A 3O4VA 4NOMA 3LOQA 3EDQA 1QR2A 5BXQC 1KBZA 1MIOA 4YRCA 2Y1XA 5BSMA 4NENB 3DTYA 3DEJA 2PH7A 3EQ9A 3HU5A 3IP7A 2C98A 3KWLA 4RUKA 5ESWA 2P2CA 1L4NA 3ZLVA 4A6EA 3AM5A 4PYIA 1C7JA 1KGDA 5ALXA 1A5BB 2F43A 1H9CA 3H1PA 5KNBH 5K3CA 1LDEA 1M74A 1GG8A 3I2HA 1PTJA 1Z2CA 2HB6A 2ODBA 2WVHA 3W77A 2Z2ZA 5HKAA 4EQZA 3EMBA 4LOJA 2VLBA 1P5FA 1XHLA 2HEGA 3AUSA 3PHGA 4F3KA 3U13A 3ZD7A 2FJUA 2YICA 3JSXA 4UHBA 3O4JA 3SE0A 2JS7A 3SSNA 2YWCA 2D62A 3OFKA 2IU0A 4JGBA 3T0IA 3LC0A 1VI2A 1HDZA 2J1LA 2PLFA 1YR9A 1Y3HA 5AM5A 1WL8A 4ZQHA 3PXEA 3R8CA 2I87A 5BVHB 5KJFA 3UJ8A 4BIMA 3I58A 4OA8A 2B1RA 5DWDA 1NIPA 4KJZA 1Z8DA 3EB9A 4PPGA 4CDMA 4CCAA 4F0JA 2XAUA 5JSZB 1YUMA 2D59A 2Z4SA 1RPAA 4DCSA 4Q9JA 4G23A 3G2MA 1SEPA 4HMOA 4GEKA 3V8EA 4BBZA 1PK9A 4V1CB 4RF5A 4A8JB 1MH9A 4H2DA 4F97A 2IXGA 2YRWA 4YIHA 4O3FA 3RVLA 3AI7A 4BVAA 2HMTA 2WAOA 1MAUA 2ZJBA 5CURA 3BMCB 2HA6A 2JJ2A 3ROZA 2C0PA 4CLEA 1U3UA 3IR6A 3GH1A 3FD8A 2V6BA 1N75A 4MI9A 4TKUA 4Y6QA 4YBZA 4ZV9A 4MTLA 1WQ1R 1U2RA 2PSSA 5AW6A 5JAPA 4HOYA 1RYNA 2PKRA 2JLZA 3BDIA 3D59A 3HP7A 1AD2A 4X6YA 3HXTA 4O02B 1SXJC 1EVJA 4P3XA 3GLUA 2QRLA 4KLNA 2JFPA 1NW9B 4PAGA 3GUVA 3RVDA 4CR8A 3ORHA 2WIDA 5LZ8A 3THWA 4JSYA 2FMTA 1DUSA 4I5IA 4IS3A 2ZOSA 3NHYA 4X8MA 5JS1A 2UYCA 3CKYA 2C0QA 3GUUA 4A26A 3JQ9C 1S0UA 5CB4A 1JG4A 4W5HA 1YCDA 5DDIP 2W2NA 3F49S 4PLFA 4BPRA 4MUMA 4W5NA 3WWYA 1WNFA 2FSGA 4FFRA 4DA0A 3KB1A 1VLHA 3R9KA 3LCJA 3FTDA 1AV6A 1RCFA 3LUGA 1GFIA 1QZZA 3PDJA 3TM4A 1EJBA 5CH3A 2PUEA 3KZOA 1XCOA 3QPBA 1UEXC 2V6MA 3ESDA 5JH7A 3NNSA 4X24A 1GPLA 3DO8A 4ZU6X 1S7GA 2R8YA 3KSUA 4P0QB 1SOAA 1FJHA 1PN3A 3JYLA 3UQZA 1CZNA 1TMGE 3AF2A 4LNAA 4O29A 2JGKA 5HR5A 5JNTA 2QN7A 2H6EA 3QMWA 5EJFA 4QGSA 1V9SA 1NMSA 1DPFA 4Z3DA 2NXJA 2FPSA 2WILA 3V3KA 4IIGA 3P9SA 4BKPA 1WXHA 4FMBB 1MCZA 2JJ1D 5KBYA 1PYOA 1QIMA 1RS0A 2NZXA 3MT8A 4YQZA 2OG1A 3U4HA 1PHRA 4NCJA 4JP1A 2WE7A 4MA5A 2FF7A 2YCLA 4BYMA 2X8WA 4QYWA 2Y3IA 3GCGA 4O4JA 4PR0A 1E3MA 2CYCA 2ZRKA 3WAJA 3AJDA 3ZBPA 1PR5A 4Q4CA 2Z30A 3DPSA 1DDGA 1LBIA 4J29A 4K2HA 4W6ZA 5JRZA 3V8VA 1I2DA 3PI7A 3IP3A 1SWVA 1V7ZA 3EQZA 4M1TA 4PAOA 5CNMA 3PHBE 1CLEA 5A9TA 4RTOA 1W25A 1SQ0A 2BEWB 2XMRA 3BRQA 3NVDA 5E2IA 4C0QC 5TEVA 3FJOA 1BKDR 3C6BA 5CCEA 1KYYA 3GIDA 4J2TA 1M1ZA 4LJ4A 2IKQA 1TO1E 2HF7A 3EN0A 1BNCA 3PNPA 4HDOB 3TOXA 3ZKWA 3ZHQA 4C7XA 1T2AA 4MX8A 5DYIA 3WLHA 3BGIA 3K6SB 3I2YX 3KQTA 1CR4A 4EA6A 1QRAA 2CCKA 5HNKA 2IUEA 3PC7A 4WVFA 2IP2A 3IO3A 1Q19A 1NN3A 3R3VA 5AICA 2BI7A 5F35A 2ZE5A 5KOIA 1Z0IA 5D6OA 2Q6IA 1D9ZA 1SMKA 3LBIA 4DM7A 1NBMD 5ADWA 2FN7A 3C8DA 2QRQA 4ARZB 2X7HA 1DBRA 4JJKA 2EIXA 3SJZA 2VUSA 5E7QA 3RVMA 2VYVA 3R5TA 1C30B 4D4IA 3CVUA 3EZLA 1H2XA 3SN6A 5LLTA 2PX4A 2QZ4A 5ALHA 4M36A 3HUUA 4G65A 3RJMA 3D3NA 2A57A 3FCUB 4CXMA 4DR6B 3H7AA 5F2KA 4IDFA 3WA6A 2IIBA 1LV8A 2QAGB 4HWOA 2RK6A 4GOJA 4JX8A 1GQFA 5J40A 1NVTA 1TF2A 1W5TA 3G2KA 4K81B 4LOLA 4LY6A 2WHPA 2R84A 2WV7A 2Y9PB 3RKUA 3VC2A 1OXUA 4RL6A 1YF3A 4IDOA 2FN8A 3L4EA 3UAXA 3R7WB 3RKRA 4IG9A 3HSSA 3FJ1A 3UATA 1W2HA 1W5FA 2ZRBA 3FB4A 3WLMA 4M0KA 3T9EA 1V8BA 4LJ9A 3WLTA 2FG7C 3LSYA 3K1JA 4ZDJA 4HAXA 4CKYA 4I1RA 4HRXA 1ZGBA 2R6AA 4TVBA 4UAVA 4YB8A 3O4IA 3BQMB 3QEMA 5K0EA 5HUJA 1FQWA 4MI6A 3ABQB 1S7CA 2LGJA 1IATA 3BC1A 1HORA 3PICA 4MQ5A 4OJQA 3HY3A 4ZEWA 1OFVA 1P77A 2GK7A 3WS7A 4CKWA 3FM9A 3U80A 5KSWB 1NXTA 3N59A 3SIWA 1A8IA 1GGJA 5EE5B 3OJCA 1QIJA 5KOJA 1BYIA 1W1IA 2GJSA 4JUCA 1KH2A 2NZ8A 3EEFA 3HWRA 2QQ0A 2OAP1 4D45A 4EJ0A 4BWGA 1EP2B 1AU9A 1PGJA 1PUXA 2HU5A 4HLDA 5DT2A 2IV7A 5K8TA 1W88A 2I7XA 3O73A 1K3FA 3LKDA 3PHLA 3BRCA 1W46A 1DC5A 2JRLA 2P0AA 2X3FA 2WWRA 5E1BA 3UIEA 4HTAA 4B2PA 4WKOA 3C3KA 2XD4A 2UZAA 3KSBC 3DAPA 3UMRA 4EKNB 3R9XB 5CH5A 4YLGA 4AWAA 3K0FB 1U90A 1AHNA 4EY4A 3AEXA 2J6IA 3IR7A 2I5PO 1S4MA 4HNAB 3WL8A 3WYBA 4JBHA 4DLNA 1KRWA 2DZDA 4L08A 2O8VA 5AJXA 1MW8X 3IDQA 2WD7B 4MUJA 5T5QA 2ZUDA 1L4UA 1OB5A 2RGCA 3G89A 1Q3HA 3WL4A 3L5KA 1AGYA 5I7AA 2V5VA 1JQJC 4KCGA 2RE8A 4LBWA 3QYAA 2FW9A 3M2TA 5EPOA 4D57A 1N2CA 4ZVRA 3VPSA 5KKNB 1DVRA 1Z38A 2P5UA 4II2A 4OJTA 4YJFA 2A5GA 3CCCA 3KPWA 3WK7A 4EZEA 1NX6A 1W2GA 3FUTA 2ATVA 3KLMX 5JECA 2IYEA 1NLYA 2XITA 5KIAA 1TGYA 5EVCA 2I34A 2P9HA 2MWMA 4RK7A 4HAZA 2RB5A 3NBAA 3MS4A 4NMWA 2E2WA 1QCZA 3ZYCA 1UMCA 3RS5A 3SD7A 5D87A 1D5CA 4DG9A 5IBCA 2F62A 2R5NA 1DV1A 2XCRB 3QKUA 3TQHA 3FYSA 5G0TA 4LDRA 1KDVA 1PX2A 4KWTA 1W1UA 3OU2A 4IDDA 1KKUA 4EDFA 4CRWB 2Y0PA 4B73A 4E5NA 1XQ6A 2O3QA 2P5SA 3QU7A 4W9MC 3OOYA 3SVZA 1RBYA 1MHPA 2B7CA 5IYZF 3ET4A 5TQ2A 1AQJA 1J0EA 4CM4B 3AUJB 4HYYA 3PPXA 4U7FA 4D9JA 2QD2A 3HBJA 3K09C 4DLPA 5CA1A 2GK3A 1N9GB 2R8RA 1HKHA 1Y5RA 1UT8A 1YDWA 2ORIA 4R5HA 5FL3A 3NYWA 5T3UA 3CXRA 4R01A 3MLBA 1EHIA 2R751 4HEJA 5DM1A 3RTDA 2PPLA 1Z75A 2DCMA 2MJLA 1LPAB 1NNSA 1PZEA 2QYSA 3Q12A 4KO1S 5EUCA 4EJSC 3E0QA 1HE8B 1JKMA 1H1LB 3KOUA 1DARA 3L7AA 1ZP6A 2DCUA 5AVTA 2DKOA 4DV5B 3CEJA 1QXSA 2GN8A 1KR5A 1DRUA 2BDUA 1CUWA 2D00A 2HCFA 3A1NA 4P4NA 5IC6A 3TDNA 3UV7A 3PR2B 3W1EA 2I1QA 1P3DA 5DM0A 3RK0A 2GXSA 1ILWA 3CVWA 2RGNA 2HH9A 1LBHA 3CWQA 2PT5A 4M0UA 3D2CA 2ASEA 3FI0A 3OQIB 4J9VA 8OHMA 4MWEA 3QG1A 5FLXA 1PV4A 3GNSA 5AKYA 1XA3A 4U6SA 5HVNA 4INJA 1C0IA 2WNSA 1ZCJA 4N39A 4PO8A 1QK4A 3BWXA 1ULAA 1VBNA 2NVOA 3ZW8A 3BL5A 5K4AA 1GAWA 1SCQA 5E6RA 4XDYA 1Z5ZA 2Y0CA 2LNDA 3FVQA 4WA8A 3WIOA 1CE8B 3IX7A 3V8BA 4N41A 5ALDA 4V3CA 4F8EA 4XIFA 3BHNA 3IQEA 3B1FA 2IU6A 3I9V1 5DZSA 2HCBA 3CRMA 4W5WA 5IBPA 4ACBA 3FMGA 1E6LA 2PSDA 1E1LA 2HLHA 2WC1A 5AKKA 4MROA 2WT8A 1WOYA 5JARA 2Q5IA 1C3LA 2IP4A 4N3AA 1ECLA 1PFUA 4PIMA 5J4YA 4CMGA 2JLXA 2QN8A 2NPFA 3G0BA 3L1HA 2CJWB 1T1GA 5EMKA 5AVKA 2QYOA 3QFRA 1NHGA 1EGQA 2BJVA 1V1RB 5IUKC 1DIRA 3TO5A 1OYVA 1XXHB 2Z0MA 4KQHA 5IAEA 1QOZA 2Z58A 2NMVA 3KKPA 3M70A 2WF7A 3ADKA 4MQFA 4I9UA 4ZMSA 5FLKA 1I6KA 3H11B 5AXAA 1QDEA 1ZR4A 3GZNA 3NYQA 1QDUA 4PAMA 4KPUA 4O4IA 3W90A 5A62A 1LW7A 4BAUA 5K3EA 1JS1X 3GLIA 4EGQA 1O0CA 1RJFA 3HHEA 1I1NA 1T5SA 4HZGA 1G0NA 2OAEA 2V8OA 3PX3A 2PUCA 1LK0A 3JWIA 4QPZA 4RW0A 2NU6B 2A7XA 4OMFG 3QE0A 3WBBA 2TS1A 3PX7A 2DM6A 2XODA 1UFKA 2XZLA 3PB3A 1M1XB 1ZIPA 3S2IA 1KEEA 3HXPA 3WMRA 4OMCA 3B7PA 1LKZA 2VJPA 4KXNA 4NNJA 2F3PA 5FJJA 2XBUA 2YJ5A 3H2GA 4KUHA 2WFLB 4BGVA 1AZLA 1DTEA 1MJHA 3ANNA 4J0DA 2CWWA 4BUZA 2NLOA 1X9HA 2CF6A 2FX5A 3GGSA 4R1SA 5A6VA 5MGBA 2IUTA 1HQKA 3FHCB 1C9EA 3CY6A 4UZSA 3MEQA 3B5IA 1CUFA 1JHAA 1EE9A 2V6JA 4F2HA 4FT4A 3PYLA 5IM5A 3EC7A 3U48A 2CLLB 4BCBA 3K32A 5JOQA 1JILA 4Q9AA 2PQMA 3HKCA 3O3NB 5E0KB 4Z4IA 1AB6A 3B8HA 3KB6A 5F2OA 4C4YA 4XB1A 4DY4A 2XBMA 4M7OA 4CFSA 1OFUX 3ER6A 1JJIA 3I30X 2VQ6A 2OHHA 3FTPA 4G5SA 4L6AA 4RCYA 5CDFE 5D3KA 3JQAA 2CMFA 4Q3BA 3RB8A 2RKOA 1IL0A 2ZU6A 3AO0B 3RRZA 2W43A 3IQXA 4O2AA 3KSZO 4X61A 1PBTA 1NQAO 2YZMA 1IXSB 5F73A 2C4MA 3ZCSA 2QLMA 4FNMA 2EJUA 4RORA 3V97A 3TBFA 2X0EA 1XEFA 4D0GA 2HIMA 4FR5A 4YTEA 3UKJA 2O5EA 1BIFA 1N6NA 3KEQA 2Q5LA 3C6XA 4JL6A 2CLHB 4P34A 3UG6A 1T2EA 4M3NA 3BDAA 3O9MA 3QKSB 3ZHUA 4C4OA 3W9UA 5E3HA 4CVNA 5K3DA 4QFMA 2A0YA 3L49A 4EVQA 4UPDA 1JEEA 3A3OA 3BILA 2FZCA 5HCIA 1ZKMA 3IJEB 2J3IA 3HBFA 1WV0A 3ZOZA 4R40A 3KWJA 3KL2A 4X44A 4UM5A 1XTTA 2BGWA 3OA0A 1JN0A 2CZCA 1MJGM 1TT5A 2DVMA 3RANA 1KJ9A 3ICWA 3V8MA 2GHIA 1WABA 2QTHA 4A0FA 4RKWA 4OG2A 3K9QO 2OORA 1WXFA 3OD5A 4COKA 2GBFA 4J0CA 2IPAB 4PZCA 4X1YA 3ZX5A 5EC8A 5DNVA 5AUOB 4B7XA 4GLBA 1SKYE 2XEXA 4DPMA 1GN9A 1HZZC 3KELA 1GSHA 4JV5B 4TMXA 4LV6A 4N03A 4X6LA 1CQZA 2V7BA 3MM4A 621PA 3HA2A 2VA8A 1NPYA 1Q1EA 1PFQA 1C8BA 2P1RA 2VAMA 3AP1A 4WK4B 1WZEA 1Z8NA 1Y1QA 3ES9A 4JLMA 4BQEA 1R4NA 3TGLA 2HEIA 4DADA 4G1EB 4JENA 5BR8B 4OI0A 3DAGA 1U94A 1O6FA 1YJBA 1ZOIA 5FJIA 3IXLA 4QPPA 3TFWA 3JQGA 2IT1A 1LK7A 2ZE6A 1CY8A 4M7RA 2EQAA 4O33A 3HCAA 3IEPA 5F7OA 4KQCA 2OM2A 4KFRA 4Z3KA 2XYQA 1TM4E 2J87A 4N40A 2NZ2A 2YOFA 4J8PA 3HCRA 2Q2QA 4N5NA 4WFQA 4CG1A 4UM9B 1XNGA 4L3OA 1FUYB 1W8DA 1Z2PX 3K92A 4YRPA 3KOYA 5JNVA 2BH2A 3EXFA 1J56A 1V26A 2HCRA 1JA0A 1QVAA 1P6QA 3FVRA 4NPHA 2GYWA 2V0GA 3SFTA 4WESB 3EIHA 3X0DA 1D7AA 4KXQA 2IXFA 5BR7A 1QTIA 1IPFA 3MERA 4KFUA 4ZCQA 1ZOOA 2CVOA 1C0KA 1CP3A 3W0LB 2ASVA 4PZAA 1V8PA 3K0SA 3JVUA 3U62A 5K99A 4OXRA 4RF3A 3OIDA 4YJ2B 2EG5A 2DJIA 2VJYA 5H16A 4M0FA 4CV1A 1SCNE 3O82A 3F74A 4UFPA 4EARA 2P40A 5COQA 2Q49A 3ZGZA 2VRNA 1EWKA 1M2EA 4J0IA 1R74A 1OLXA 3IKMB 3B48A 1U9JA 1D6NA 4V0OA 4ARUA 3H4MA 4G0XA 4A6XA 4F5YA 2C9BA 4FZRA 3SIRA 2P6UA 4HTFA 3VR6H 4B83A 4EFMA 3IDFA 1G5FA 4DL9A 4DZRA 1YZLA 1X8JA 3EG5A 3MQ2A 1MO4A 5I7EA 2FA9A 3GBSA 2I22A 1ESCA 3CPEA 5CT5A 3UA4A 4AO8A 1T2FA 3CPSA 3I9JA 2I4TA 4RF2A 1E6KA 1GKIA 3RVQA 5LP6A 1K7EB 1S02A 3L2OB 1MVOA 1ZITA 2HSDA 1QCCA 2JJYA 2KX7A 2ONJA 3K05A 2WKRA 3IULA 3RYTC 4CG0A 5JAIA 1LF5A 1YL6A 3ECAA 4AVYA 1QOQB 4D9IA 4UCXA 3ZWVA 3HEAA 2X5JO 3BF7A 3KC2A 2NO7A 2EBWA 1P1BA 3UGTA 4XTCS 1T4BA 2XUPA 2IYRA 5L7YA 1X42A 1JFRA 4BU0A 5ENZA 2OLKA 3E22A 3C3MA 5TJ9A 2GF9A 1XHFA 4JC8A 3TM5A 2G06A 3DXZA 4DLLA 5HCUA 4EZBA 1UFRA 3F3KA 3U44B 2AFHB 3INRA 1ZIDA 4H16A 3I28A 1JEQA 1HDXA 2C7BA 1SOMA 1TCCA 5F21A 1KEUA 2DBZA 3G8DA 3K1AB 4PIPA 4R2JA 3W8FA 5UKDA 5DBIA 5CFOA 1IEWA 1IZ7A 3CF0A 4LN1A 1IOZA 1V35A 3QEOA 4M89A 1RP7A 3KQHA 3AQIA 4E1AA 5TT1A 4ASUA 1BE1A 5CXQA 3H2KA 4PSCA 4WPGA 2NYRA 3K2BA 3UOGA 3RG2A 3UWDA 3CISA 2PY6A 3R44A 1SBCA 1Z34A 1V1MA 4JQYA 5C52B 2FG6C 3EXHB 2CB0A 4IMIB 4D3FA 5K6AC 2YWRA 3CYFA 1N25A 4Q1DA 3LLMA 1EUQA 1Q83A 4PINA 1EE1A 3DJFA 2IEDA 4FFDA 4K6MA 3U4AA 3H5LA 4ZRMA 1KERA 2G1AA 2PSJA 3LOUA 1OZFA 1P29A 3F9IA 4HATA 1OH8A 1GTRA 3ACCA 5B58C 1KS2A 1N6OA 2N46A 1G21A 1IYZA 1IEVA 3BERA 2JEYA 3E7FA 5KTRA 1W36C 5I4KA 1D3AA 1USIA 2F6RA 5DCUA 1Z6QA 1DLIA 3CF4A 2J7PA 3DEHA 4LJKA 2WNHA 1GZ7A 4CF7A 4B3MB 1HDCA 3GRAA 2ZYHA 2GYUA 4WACA 4BJHB 4Q4HB 1JH9A 1BXGB 3LLUA 2ZEJA 1Z2DA 2HXYA 1JXQA 2AN5A 3JVVA 2P3OA 5H83A 2QUBA 1FSZA 1GZ6A 4Q1VA 3WGJA 4M8NE 4Q3NA 2QW8A 4WN9A 2PAFA 3IUQA 4EMSA 6LDHA 1ORWA 1RYMA 1GNLA 1OREA 1TZJA 5FYQA 1KORA 1QCDA 1XP8A 2FFJA 1Y8ZA 4LYFA 3P2MA 4YP1A 3K31A 4A16A 3WHPA 3FUXA 3G02A 4O4HB 4X94A 5AKLA 4D80A 4TXJA 5F7ZA 5JANA 4X6XA 1T91A 1QWSA 1LQ2A 1S8OA 3JQ8B 4OHOA 4I5GA 2ZIXA 3PTLA 5DFAA 1JR3A 5KYNA 4AJ9A 4RVNA 2HK6A 4ZRNA 3C5EA 8ADHA 3LBYA 1FTSA 2IHZA 4JUDX 4MR9B 2ZCJA 2HJHA 2NUTB 4FGJA 3RS9A 3U37A 3W2EA 4EG3A 4HGRA 4DCPA 1AXRA 3DCNA 2DLCX 3L8ZA 1E98A 1E1CA 1GSAA 1SCDA 3B13B 1NJ5A 2DJ5A 2TMGA 3OZUA 5DHTA 4F38A 4CL0A 3ECCA 1PJSA 4MQEB 4DTIA 3C3BA 1PT6A 3P1JA 4UUAA 5CDSA 3EZGA 1QHGA 3KKEA 3F90A 1PS0A 2GO1A 2O6HA 4G0YA 4OAQA 3VI3B 1MX1A 2P9CA 2QN9A 3ISVA 1N2ZA 4TLAA 2JKVA 3BPSA 1D7OA 2EZTA 3LPAA 2VA9A 2YFHA 2QPTA 3ND5A 3VYWA 1YR1A 3D4NA 4EUKA 1ZCFA 4DB4A 1DJPA 3MTIA 3NC1C 1BCRB 1U98A 2OYSA 3P2OA 4GF5A 4I81A 4I4LA 3ZLUA 4XJXA 4B4VA 4CTKA 4DPKA 4CIBA 4RVUA 5BSEA 1RZUA 1O5IA 3MBOA 2ERXA 4EVRA 2J0SA 2QP9X 3RC2A 3OEYA 1KMCA 1XZIA 2EP5A 2XF8A 4QE3A 1BSVA 2J45A 4P35A 3H83A 3UG7A 2YVKA 3QI7A 2QRNA 1E3EA 2PBZA 4Z1MA 1T9GR 4CQLA 1C41A 3FCCA 3RYCA 1TVCA 3IAS6 2FPKA 2O07A 3QLUA 3AOGA 5EKUA 3RVOA 1G8YA