3J80A

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
b'SLPSTFDLTSEDAQLLLAARVHLGAKNVQVHQEPYVYKARPDGVNVINVGKTWEKIVLAARIIAAIPNPEDVVAISSRTYGQRAVLKYAAHTGATPIAGRFTPGSFTNYITRSFKEPRLVIVTDPRSDAQAIKESSYVNIPVIALTDLDSPSEYVDVAIPCNNRGKHSIGLIWYLLAREVLRLRGALPDRTQPWAIMPDLYFYRNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00318 Ribosomal_S2 Ribosomal protein S2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 3j80A01
1N34B 4LF9B 3T1YB 2CXQA 1N33B 1HM5A 3FF1A 2UXCB 3KNZA 2HHHB 1U0FA 4LFBB 2V4MA 1HNWB 2CVPA 1XNRB 4DV0B 2I22A 1GZDA 1Q50A 2CXSA 2O2DA 1IBLB 2AMLA 1IBMB 4JI8B 1XNQB 2VF4X 3FJ1A 5IT9A 3BCHA 1DQRA 1IRIA 4DUZB 3M5PA 1MOQA 1TZCA 2A3NA 2YVAA 4JI1B 2UU9B 4DR3B 1X9HA 1FJGB 4B3RB 1HNXB 2Q8NA 5LL6P 4IVNA 1TZBA 1VIMA 2ZM6B 4LF5B 5FLXA 4B3MB 1TK9A 4JI0B 2UUBB 4DR5B 1KOJA 2PUTA 1ZZGA 1G98A 2PUWA 5LMUB 4DR2B 5IWAB 3CVJA 4GKJB 3PR3A 5LMNB 1C7QA 2CXRA 2PUVA 4LF8B 1WIWA 3I0ZA 1MORA 3FKJA 3OTOB 3IFSA 3T1HB 3UJHA 3SHOA 1VI5A 2XHZA 5BR8B 4M0DA 4LF4B 3OOJA 1J5XA 3J7AC 4EM6A 2UUCB 1GZVA 1HR0B 4DR7B 3Q7IA 1C7RA 3ETNA 4LF7B 1JXAA 1X94A 4DV5B 4JV5B 2WU8A 4DV4B 1N8TA 1IATA 4JI5B 4JI4B 5BY2A 3HBAA 2J6HA 2F4VB 1NRIA 4X65B 1J5EB 1XMQB 4B3TB 1XMOB 1U0GA 4DV6B 4OX9B 3QKIA 2DF8A 4AMVA 1HNZB 4JI2B 2CXTA 2VQEB 1X9IA 1M3SA 2DECA 4AQYB 3BJZA 2ZJ4A 3J80A 4DV2B 2ZJ3A 2VF5X 3Q88A 2CB0A 3HJBA 3LJKA 4DV3B 3C3JA 4DR6B 2E5FA 4JI3B 2I2WA 4NXNB 4DR1B 2CXPA 1MOSA 1XTBA 1X92A 3G68A 4JI6B 2E5LB 2POCA 1B0ZA 3NBUA 4DV1B 1HOXA 4TOIA 4DR4B 4U6NA 2CXUA 3FXAA 1VIVA 4YY3B 4NXMB 4X62B 4GKKB 4LFCB 1JEOA 1VI6A 1NUHA 1T10A 5I01A 1JLHA 4X66B 3JAMA 4JYAB 4S1WA 2UXDB 3JX9A 2O2CA 4KHPB 3TBFA 4DUYB 2UXBB 3ODPA 1U0EA 2CXNA 2CXOA 3EUAA 3J81A 4LZJA 1JIQA 4JI7B 4LFAB 1N32B 4YHHB 1IBKB 3TRJA 1N36B 2XBLA 4K0KB 4X64B 2PGIA 4DV7B 2VQFB 4LF6B 5A2QA 2UUAB 4B3SB 1I94B 2X3YA 4S12A
chains in the Genus database with same CATH superfamily
2BBWA 5MGNA 3DT6A 1MGPA 5GONF 4EUSA 5I7UA 1AF4A 3OZDA 4M9ZA 5BMVF 2XE7A 4RVGA 4GWLA 5AW6A 3DBLA 3C5HA 3M89A 3E3AA 3TCNA 4KWCA 3WG9A 4KO4S 4Z7OB 4XJTA 4PQRA 4WLOA 1GGJA 2A9KA 1SRQA 2AEFA 4KR3A 2NXNA 3CB4A 4EPVA 1K8ZB 1OY1A 3SVLA 3I8SA 3C5VA 1OLXB 3TWOA 3IVXA 3VOAA 3HPRA 4RD3A 3H83A 2GBLA 5C0OE 1X1AA 4KK3A 4HH0A 2IIBA 3GOHA 4MP8A 3WYAA 3RHTA 1D9XA 2Q5JA 4X97A 4BVBA 1YE8A 3NUQA 4QHTA 3HJRA 4IHAA 1BYUA 1V95A 3FZNA 2H85A 4WL0A 4B3MB 2LPMA 2MTBA 2G1KA 2D06A 3DT8A 3PPWA 1FQKA 5M2QA 1ZONA 2HIMA 2JS7A 3LL7A 4NH0A 3B52X 1I7DA 3W8FA 1QP7A 2NSDA 2FWBA 3KTDA 2BUCA 3OEHD 4LJYA 3QVXA 2C5BA 3N8NA 5HKKD 1XKQA 5LMNB 4I8IA 4TSRA 1O6FA 2R66A 1XLUA 1TCUA 3HCCA 4BPBA 2X0RA 4DIDA 3V6LA 1R4MB 2Z4TA 3U4CA 1D04A 3A06A 3VNBA 3M6LA 2R1VA 3NYIA 1YFJA 4DR7B 2IIQA 2H1RA 3VH1A 4MW4A 5CGZA 1IZZA 2PLFA 3GEMA 5MGBA 4XX1A 5C32A 4F8EA 4BJ6A 3QBEA 1HEYA 1R6UA 3MT8A 5DM4A 4D8VA 4F1WA 2HRBA 2G9VA 1TQ6A 2ZJYA 1ZSVA 2CEAA 3RJ5A 4DIOA 4CDNA 4RKFA 3VR4H 2FN3A 4XB2A 4MEJA 2GAOA 1WU7A 1TEZA 4L57A 3RDPA 1CG6A 2X1VA 1X80A 3OT5A 2PFKA 2OXFA 1A9SA 2D13A 3HTXA 1EVKA 1DP4A 1YMQA 3QU9A 4I1YA 3QE9Y 3GGCA 3INRA 1II0A 1EXNA 2BY4A 2PNFA 3PVCA 3W5UA 4GYJA 3WO1A 5EJ5A 2AJTA 4UE2A 1EXVA 2GB4A 1QCDA 4CKCB 3KTFA 3DDWA 4L50A 2YJ6A 4BN5A 4RGQA 4M21A 3RABA 5MDHA 1TQ2A 2I4OA 1DPGA 4Q12A 3UM9A 3DZDA 2DGDA 3K8YA 3ND9A 4ZU6X 3LRXA 3N28A 1GL3A 1ZH0A 3U4HA 4BZXA 1XLTC 3UF0A 1TYBE 3KT3A 2PZAA 5B58T 5CYFA 4U2EA 3LAWA 5EHXA 1R5JA 1GA1A 3DOUA 3I4LA 3E5MA 1NATA 3PDHA 2GD2A 1GZ4A 1L5FA 2GEUA 2I03A 3BHJA 2E4XA 4JBIA 2F62A 5B53A 4Q0MA 3O9VA 3WFZA 1QVWA 3G9QA 1IHDA 3E05A 1BWRA 1NN3A 2ZUBA 1EXDA 2B34A 3AEXA 3UWPA 4P4UA 4OHBA 2JCGA 5KVCA 3K9LA 4P4SA 5LLDA 3UN1A 1N36B 4D43A 1TUEA 4KLRA 3ZI4A 1TD1A 5DYGA 1IM5A 1XDZA 1I4EB 2QRHA 5BNFA 1GRVA 1F6BA 2CHFA 4PYNA 4M89A 4ZVLA 2AX3A 3V7YA 3VR6D 1JLRA 1XJ0A 4LECA 3KQUA 1XMSA 3EDMA 3K72B 4CQJA 3V46A 5KQGA 1D0VA 1VE7A 1FXUA 1UM8A 4ZZ1A 4FZRA 3VNQA 4D80A 4H3SA 4CCSA 2W2VA 4EH1A 2EFJA 3AONB 1W4AA 2R85A 1GGEA 4FD2A 5JAQA 4BZWA 3KB8A 4GYWA 1KORA 3C4QA 3DFIA 3DUFB 3T38A 4RY0A 2IYPA 3JR3A 3NR2A 4HAZA 1G63A 1QH8A 1I6KA 1XP8A 5HNKA 4QHSA 2ZJOA 4CCYB 1BCSB 1U94A 4UTPA 2W0MA 4Q66C 1FXSA 4QJ3A 2J31A 5FWDA 4N7MA 4KMSA 1A88A 3D6UA 1B2RA 2ASVA 2R4QA 5IT4A 1U0TA 1SVMA 3ZD9A 3UHJA 4WLVA 1V5WA 1ZNQO 5ES3A 1QGAA 4ALMA 3WNBA 4F93B 2JHFA 5ICMA 2Z2IA 4ZO9A 2XCIA 2QU8A 3QFFA 2R7AA 1WDWB 3FDXA 3GFRA 4IGFA 4PIMA 1X13A 3CPJB 2WHXA 4QWMA 3WLLA 2VH2A 2WKSA 2RGDA 3CSSA 4DZRA 4EKEA 3KOYA 1CIJA 2ZTSA 3QELB 5K5EA 1NG9A 3NONA 2GLXA 3KSZO 4ZT3A 1CXZA 1DJLA 3AJDA 3C3BA 2FPXA 3F6SA 1OFTA 5CGQB 1W0KD 4YP6A 5ERXA 2PUFA 1IU9A 1HQYE 2CW5A 3U19A 3GLFB 2EZ8A 4TRRA 4EG7A 1XVUA 2JI6A 2JFXA 2PRZA 4JWTA 5DTJA 3OQVA 4EYKA 2OC4A 2Z6VA 3EN0A 1K06A 1PTJC 1Z36A 1Q7CA 1UZMA 2HHAA 2O0LA 3PLRA 1D7OA 3JQ7B 4KPGA 3RVLA 1AHPA 3FUWA 3OF2A 3KQKA 4BP8A 3VPGA 4FHEA 3HLTA 3EBOA 5KOIA 3I9OA 4GMXA 2D2IA 2HBZA 3KWMA 4M8KA 5GM2A 1P2SA 3CZMA 4MQ4A 3ZI0A 3FFAA 5DIZA 1VMEA 1GITA 3SX2A 2G06A 3P9SA 1F5NA 1L6RA 4ZT2A 2KX7A 3Q3EA 3KUKA 3VR4D 1P19A 1HFWA 4YRRA 4FLMA 4O2LA 4DTCA 1GXSA 3R5TA 3HN6A 3W2EA 3IPCA 4L4XA 1J1IA 4EB3A 2BGUA 4NE2A 2YYYA 3RIGA 4NXNB 2L82A 3MLEA 4INPA 5DXJA 4I0WB 3ZIUA 2Y93A 2PJZA 3OFKA 4PIVA 2K2QB 4RF4A 4YI5A 2C2WA 4ESVA 1G8AA 1EJBA 2W71A 1XZBA 2B0JA 4ZT5A 1H85A 4CKBA 2Y2VA 1NN1A 2AI1A 3KHUA 1YA4A 2MU1A 3ORRA 4NKRA 1P3Y1 4FFBB 3RHZA 4NEHB 2HGZA 2ID9A 3ZS8A 4G5QA 3FVQA 3VR5H 4BFZA 1T4DA 1ZH6A 3IMFA 1CEEA 1K7CA 1PUIA 4IKPA 4H0NA 1QUEA 4O0LA 3O26A 5BYJA 1TW3A 4JDPA 4UHDA 4GP9A 4L3WA 4FMBB 5IULC 1FFBA 1GL9B 1I4OA 3HKDB 3DOIA 1LJ8A 1IEXA 2NZWA 4IJMA 1T5SA 3VXKA 4A16A 1I5RA 5C4MA 1LVGA 4DA0A 3OQIA 3UGQA 5LD2B 1B1AA 1Q11A 5KAPA 2BT4A 3K0KA 4MQFA 3MGGA 4ZHQB 2QB5A 3ITNA 4Z4IA 4PPFA 2X8AA 5CTAA 2YWFA 4IDBA 4HKTA 4MA4A 3THWA 4UQOA 2OB2A 3Q2KA 1V3TA 3HI4A 5EE3A 1Z7WA 1ATZA 2QTBA 2WKPA 2ZVDA 1NNUA 1X7YB 4DLXA 4C2UA 3Q85A 1XZJA 3DW1X 4S1NA 4GOMD 3TLCA 3R4VA 4I3GA 4LYHA 1IL0A 2CCKA 4DUZB 1IZ9A 1Y5MA 3KKMA 1E1YA 4JB2A 1OAKA 3ZGVA 1NUAA 4Q6BA 2JBHA 2IXFA 4D9GA 1KDOA 1W46A 3QEJA 3QLVC 2XGOA 4MIYA 1F6WA 4QNNA 4V1CB 3IGFA 4WZBA 1ZP6A 4CEIA 2O7NA 1XTKA 1G3UA 2EVWX 1SBHA 3LVQE 4RPLA 5EEHA 2VJMB 3D6TB 1G4UR 3ORQA 2Q1WA 5EIXA 3AERB 4IBOA 1TUBB 3Q3VA 3VC3A 4TYYA 4PYKA 2QRVB 5JSKA 2OXEA 3Q8LA 2QVXX 1KU0A 3D02A 5AJVB 5E6UB 1X1EA 2BFAA 4YT5A 3AHHA 2BTQA 1JKMA 3NEPX 2VNSA 3IJRA 4WN9B 5GGYA 5AK6A 2PT5A 2B9EA 2G8LA 1FC0A 4G0XA 4JT8A 1MAUA 3DEYX 4YCJA 5DTEA 5GZ3A 2R8RA 2XHZA 4DA7A 1GTSA 4GBED 3M3PA 1J5XA 4LQLA 2X3UA 4EI7A 1V7PC 1AKYA 1GVHA 2B1JA 1VCIA 1RM4A 5LR6A 5SY4A 1XKLA 2Q9BA 5A7GA 1V8FA 3PCRB 3IERA 2E1RA 4JYPA 2FQWA 2WNHA 5KX5A 2OVBA 3BMQB 5T64A 1S01A 1N25A 1SUDA 5CB4A 4D4LA 1ULTA 1L4FA 2XTNA 2JKYA 1XMOB 2OESA 4YJ3A 3I9JA 2R2GA 2HJRA 5ENDA 2EKLA 5AP9A 1JDBB 3WV4A 3U31A 4RZXA 1PZNA 4NEQA 4FOLA 3F4BA 1V39A 1G1MA 2CL6X 2AFIE 3UFBA 1W5AA 5DP2A 2K6GA 3TZKA 5JJLA 3U7FB 1VL6A 3JU3A 1XMVA 4B81A 3IKMB 2H1SA 4EB6A 5J4KA 4R2HA 2GQ0A 3N7AA 1X9GA 5FV7A 4RMGA 4EDHA 1XZEA 1V1MA 3SQWA 4ZVKA 5DX0A 4Z0PA 3T9AA 2JHAA 1FYWA 4JVNA 3E7DA 4MGZR 1E0KA 5H1YA 4E6EA 1QDEA 3WSVA 1G6Q1 1N2JA 2Z4RA 3FXAA 4K26A 2POQX 1QBGA 4GBGA 4Y1GA 2P6MA 3T7IA 4BLUA 5BOSB 1HURA 5KWIA 4UDOA 3ZDCA 2P2YA 2UZ0A 1M2NA 2EKPA 1ESDA 1B76A 4ZVNA 3MK31 4G8JA 4DPMA 3HSKA 4G89A 3N2NA 1G7CA 1NBHA 5KVVA 1QQAA 2OAP1 1ZC4A 3ER8A 2Z30A 1ZL2A 4KXNA 4G5SA 3NGXA 4N5LA 2ALJA 4NBKA 1W2HA 2VATA 2JIZA 2VPYA 3K0HA 1UJ6A 3H4VA 3O3CA 4IXNA 1EVLA 3NG1A 4LOKA 5AXDA 5LZ4A 3IAM1 5C8ZA 1CSEE 3JWHA 4HGRA 3T5BA 3LM8A 2X1HA 5FO1A 1II8B 2PWYA 3EPPA 4O4LB 3V34A 2R8BA 4HEHA 1MV8A 3K0AA 3UG6A 3TTSA 4B3FX 5DYTA 2XY4A 4EJSA 2C7GA 1YWGO 2CJFA 4HAVA 1G8SA 1M6YA 2IHZA 1EP9A 2FTKE 4FT4A 1C4KA 2QQ5A 4ZXFA 5K8UA 3IAS6 4KGZA 1C3VA 1BDMA 3RD5A 2V0GA 4WBNA 1SKBA 4Y2VA 4WZAE 4ZO8A 1P4RA 3CRQA 4HRVA 1AXEA 2WSSD 1L1RA 4FT2A 3OIGA 4I81A 3V8PA 1I14A 3Q3CA 5F21A 4AJ2A 1KO1A 2IT1A 2RGEA 3GQVA 3GLGA 1OYYA 1PVDA 2H06A 3ACCA 1XQ9A 5AJUA 3IIMA 3P20A 3NNNA 4L72A 5DLEA 5ALOA 2VWPA 1N7JA 5EQDA 5HKKA 3WVNA 4OOEA 1OSNA 2XGMA 4MO2A 1E3WB 2IDKA 2DPHA 1IQPA 3E5HA 2YQ5A 4QYWA 1M1NA 3OD1A 3QPUA 4HQFA 2HJHA 4MMZB 3T94A 4KUGA 1FU4A 4BO9A 1HK7A 4AF7A 2SKEA 2YN4A 3A6FA 3DV9A 4D4JA 4ZCRA 6PFKA 3QYAA 3ZQUA 2NV0A 1G38A 4KIWA 1S4QA 2P5SA 3RC8A 2J3DA 2QG9A 5IEJA 1PZXA 1X8XA 2BKAA 4QJ4A 4LXIA 3W6UA 5AVYA 3MPUA 3BICA 4RMNA 1D6SA 4PWZA 1RP1A 4TV9B 3USES 2GFHA 3GGDA 1V16B 4FGJA 2NZJA 3ONFA 3M82A 3O4VA 1JZSA 4PX5A 1JDZA 1HFEL 1XU9A 4JENA 3N2EA 4ZVQA 3NTOA 3INTA 2IDMA 3PXDA 3SNKA 3HU2A 2FPOA 3KKZA 1L5HB 1YQ9A 3A9VA 2OG1A 4CG3A 2M6LA 1EJ2A 2C4UA 3GBPA 4YJFA 3W9SA 5HYVA 4OX9Y 1V1RB 1IDOA 3CEHA 2ZPTX 1PUXA 1PLKA 1CQIA 1T2UA 1A9XA 1JILA 3KBOA 4Q4LA 4B6RA 2B6NA 3U0VA 3K2QA 4PRLA 4NMHA 1E4EB 5IVPA 3F8SA 2NO5A 3EXEA 4WNYA 3VR3A 4QBFA 5LP6A 1SVOA 2GUWA 1RPZA 2WWTA 3HXOA 1JAZA 1UH5A 1R6VA 1XZAA 2QTRA 4JUCA 2WINI 3JD3A 2FW9A 4POAA 1BKSB 4AJLA 3D4IA 4B2PA 2NTYC 4ZI7A 4OHYA 1ISHA 4U8GA 4I99A 1DOHA 4KIUA 3WB2A 3BXEA 1D2CA 1KJ8A 2DBZA 1MV5A 2R25B 3KJEA 3U5ZB 2B7LA 2QMYA 3KB1A 2WY2D 4F86A 2F8SA 2ICAA 5JATA 4LJRA 4A0GA 3DO5A 1JNXX 2CHEA 4I1SA 4MV0A 1UL1X 4JVMA 4HRXA 1LC0A 2HT1A 3EGDA 1G3QA 2ZULA 2XXBA 3DFFA 2HMSA 1CUFA 2AI3A 2P6PA 1SXGA 1G9TA 3SYKA 4H4CA 3QPAA 4BVEA 1T8UA 3RF6A 1WZEA 2CNNA 1KEWA 3FKSA 3GFQA 3OWXA 1T0IA 1XZPA 4LA4A 2NU9B 4AO8A 4UTOA 2BHSA 2C29D 2VTBB 1L5RA 3D3EA 3U3RA 3OM9A 4L5CA 4B87A 5AUNB 4YJ2B 1B8PA 1X8JA 1B3RA 4X24A 4E4RA 4P3XA 3OX3A 5A3VA 3V1LA 2I4IA 1TKAA 4ZV7A 2C9CA 4NP6A 4WBNF 3PG5A 1QRUA 2W37A 4MRRA 4XGKA 3JAKB 2HMTA 4L8WB 2B78A 2J9RA 5JDCC 4BKQA 3DEKA 1LZLA 1RLIA 2M1XA 2LBPA 1GV0A 2OHGA 4KJZA 1FDVA 1OKKD 1DSSG 3GCXA 4EENA 2P2GA 3VAZA 1WBBA 1QNLA 1Y98A 3ZVLA 4JJKA 3IKLA 4MVWA 4LHVA 2PZFA 3IQFA 1L7MA 3SEFA 1ZO8A 4B2LA 2BKEA 3CRW1 4AZ3B 2LWIA 1G21E 3AESA 4GMGA 1NWHA 1TVEA 2AOTB 3LBNA 4KTTE 3DDUA 4IXMA 5JV5A 1ODSA 1EEXB 3IVMA 4Y2SA 1KH1A 3C3WA 4MWEA 4IIUA 4MDHA 4BNUA 1Z38A 4KPEC 1XVLA 1QH1B 1HYEA 1J20A 4G09A 4K7JA 4IJVA 3AJAA 1CJVC 3B3FA 3AFOA 3B9RA 1W0KA 4J07A 4MR8A 1VE3A 1XYVA 4DLRA 4FM9A 1Y8CA 4WD3A 3IA2A 4P93A 1L5VA 5FOVA 4WACA 2OPBA 1U7WA 3FKJA 3QMMA 4RWEA 2Z09A 1I30A 1N75A 3N39C 4XUDA 4LHSA 5KOJA 1DAKA 4K1LA 2EBWA 2RGCA 4GMFA 4Q4AB 3ZH9B 1R0XA 5FWXB 2WVJA 2XMGA 2GPYA 4AJHA 1JP7A 3FB1A 1TVMA 2Q99A 1G3MA 3PXXA 3ZDYB 2GK4A 5K2MA 1UMBB 1P33A 2WU8A 3EODA 4EZEA 2I87A 4EKNB 4EY5A 2JEZA 4TWJA 3VO8A 5BUCA 5IJ9A 3BD9A 4NENB 1XT6A 3B70A 4IXDA 1M6VB 1YMUA 1S3FA 4I46A 1DTWA 2AG0A 2XRMA 2H52A 2DWQA 2GO1A 3TD9A 4BO3A 4CL8A 2V96A 4BNVA 2OT3B 2QQEA 1J1ZA 4INZA 1PK7A 3NJ8A 4XIGS 2M6KA 3WQBA 4PBRA 4O2BA 2ZBQA 4B0OA 4D44A 4AG3A 3GVCA 2A33A 4FVTA 4XCQA 5HPYB 3X0DA 4KX5A 5IUKC 3A3YA 2E5FA 5LSAA 2GD6A 4BU0A 1YBHA 1TMKA 1P45A 3F7MA 3QF4A 3TKAA 4X5OA 4C07A 2W00A 3BK7A 3FM9A 3ZQKA 4TT8A 3WBKA 1NFRA 5K0EA 1SPBS 1K7SN 4M88A 2B1GA 5FNVB 4ZPJA 2LZ0A 1EUCA 4HS9A 4DLWA 1NLYA 4UM9B 3NC0C 4MRMA 1UFRA 2Q5EA 4YY3B 2FSUA 3KWLA 1WY5A 1FFXA 4UM7A 1LTQA 2Q0QA 1QHSA 3M1IA 4OXXA 3JQ6A 3X1DA 1CE8B 4D46A 3V4SA 4FI3C 4U2FA 4EF6A 4UFOA 1NVXQ 3C8DA 3SIXA 3COZA 2Q1XA 2Q2VA 5ECDA 3F49S 2O57A 2RI6A 2VOJA 2WHPB 2WFMA 2VZ9A 1DJNA 3BE4A 3NS7A 4D9EA 1KNQA 2IYXA 2UXBB 4JJ7A 2O8CB 3ND6A 1TL7C 4HQRA 4RVUA 3VHQA 1WVIA 3E7XA 3DF9A 2HM7A 3SE0A 3TSAA 4BQIA 5DNWA 2SCUB 4LDQA 5LC1A 3OPYA 4MA0A 3B1VA 2R96A 4NOMA 1L4GA 3NM6B 3GIWA 4IV0A 5JYBA 4BHTA 2V4ZA 2RMKA 4WKGA 2PA3A 4ZPXA 4YP0A 5JSYA 4KAAA 3IOBA 3TPZA 5J2UB 4CIWA 1RQRA 2JFWA 3GJQA 4J49A 2A3RA 4BL5A 1BS9A 3D8HA 4D92A 5L7WA 2IOFK 3BL5A 3AY3A 3A2NA 3AI2A 3TQFA 3VNAA 4G4JA 4XWKA 1FX0A 3VTFA 3LI2A 3I12A 4I2NA 2FDRA 2GN1A 2C4KA 1KZGB 2WE8A 3OZAA 1IBSA 1PF7E 1Y81A 2RHCA 4MKHA 4NF2A 1E3LA 4EL5A 4P22A 2ATXA 2I29A 2Z3WA 1BKDR 2GN6A 3ETGA 4RVHA 1O5IA 1RQ2A 4BNLA 4ITRC 3DE4X 4KOAA 1SKUA 3CIFA 4H60A 1QP8A 1ID1A 2QM3A 3PUXA 2VPXA 1ZU5A 3ZZ1A 1Y5RA 2JFVA 1OT3A 4V0KA 1IYZA 2JJ1A 2V6BA 3FVTA 3QBTA 1NMYA 1Y6FA 3AM1A 1RYHA 1OI4A 3KYBA 3SYRA 1PSDA 1YVEI 3ZCSA 1K8YB 2Q9UA 5JZMA 5E1OA 3RRNA 2ID4A 2Y0PA 4YXFA 3M4XA 1Y1KE 1KETA 4O29A 5CA0F 3K4QA 3M6AA 2BN4A 2G4VA 4GPEA 1XD2A 1C7QA 2QR5A 2ORVA 4BLVA 2VA8A 3IQDB 3QI7A 3R5KA 1NLUA 5F7JA 5FTNA 2IYOA 4C7MA 4RK6A 1RR6A 1Y7HA 3OE7D 2ILTA 3FSEA 3L2OB 3GJYA 1IHXA 4HP8A 2IEYA 2P69A 4PX9A 2ONCA 1Y9EA 2YFHA 4JJEA 5DV9A 1I6WA 2XODA 1NQOA 4WFJA 1FUIA 3N87A 3R0IA 4RGYA 1FSPA 2G25A 1OX5A 1CLEA 3PF9A 3FOFC 2ESRA 3KJZA 5E1BA 3BTOA 4TUYA 4KPUA 1CJKC 3PE6A 3S40A 1LRKA 2BKLA 4FHGA 3SEAA 3NIFB 4DSZA 1M7GA 4DSAA 5BY2A 1Q22A 1UZUA 3FDIA 4QRIA 2VUIB 4B74A 2FZLA 2IZ0A 1ST3A 1FFWA 2J7PD 2Z5FA 2J3JA 2ZR0A 4AMVA 2ATEA 5EWMA 3VSEA 2P9JA 2VHEA 3FJOA 1PX2A 1ZMTA 4WA7A 1GGVA 5KJ1A 3RGGA 3VYWA 3K6JA 4HTFA 4C6TB 3J80A 3S27A 2QD2A 3FGOA 1YFZA 3ZD8A 3UC9A 1KEPA 2QIPA 3C1AA 4JAVC 3SYTA 2JFBA 3EC1A 3VM6A 3WP1B 4QU8A 2JLUA 3L8MA 1OAAA 1A69A 1U28A 3W77A 4RZQA 5A3RA 2BISA 4GD3Q 3VUFA 2CE7A 3J7TA 3M9WA 3QPDA 4NZ9A 4A8TA 1O8BA 3GJZA 3WX0A 2CUTA 3NALA 4NPAA 5IDVA 4R1MA 2G4LA 2FGJA 1VRWA 4QOJA 2QX7A 1RXYA 3WMWA 2WUWE 4EY8A 1RHUA 1OI2A 2O8FA 1TQDA 3DHWC 1NULA 1ZUNB 2G04A 3OAAA 1N92A 3DFZA 4OLJA 3UWOA 3DLBA 1ULAA 3NT4A 1VKNA 2WK1A 4R1NA 3T5TA 5DNUA 4UOEA 2WB2A 1J8QA 2FRDC 4O4JB 1P3JA 1J5PA 2QP4A 1FQOA 1ZRHA 1WB6A 3RJMA 3S2SA 3R6DA 1MRSA 1MB0A 4FIDA 2WIAA 3O74A 3DBLB 4FIZA 4MW1A 2H16A 2NO1A 1LEHA 5BQ5A 5FBHA 1GA6A 2OUIA 3IRVA 1UK8A 1TI7A 4URHA 2IYZA 4L08A 2QD3A 3NTLA 3GRCA 2OORC 2DQSA 2WICA 5I7FA 1AKVA 2BKXA 4CMEC 5GJWC 3EB9A 3GRYA 1SG6A 4NWIA 2EEPA 3WQHA 3PP8A 5AW9A 3GAFA 1GZ3A 1CUZA 2VO1A 3EBLA 2CMFA 4PNZA 4J0HA 4CKEA 5JSHA 3ETJA 1CF9A 1EVZA 2IITA 2ZSJA 1X8LA 2C58A 4AS3A 4F4FA 1DS6A 3KUDA 4DT1A 3M5PA 2X5OA 1J7KA 1GTZA 5LXTB 1P61B 3ADDA 3P0FA 2W2OA 1AJEA 5DTMA 3K4PA 1TU0A 5K1ZA 3SR4A 1U99A 5AKLA 4TMKA 1U63A 3CZ5A 5I47A 3UPUA 1P1BA 1JIJA 3ET5A 2NSHA 4B31A 4F3YA 5F33A 2V7UA 1EGMB 3A37A 4XQCA 5FLXA 1F7VA 2QF7A 5K4GA 5LVAA 2OCIA 2FAXA 2W2LD 3RUCA 1RWQA 4J1QA 2O3TA 1WCIB 4B09A 2UUOA 3P1JA 4IGKA 2X8JA 3H9EO 3CX8A 1MO5A 1QVRA 1DHTA 3PFNA 4H7DA 3SBXA 2PL1A 3WLPA 5FTWA 4OGLA 2FSVC 1UKBA 2CXRA 3ZIDA 4B47A 1SC1A 4ALKA 4NR0A 5EPUA 3OTOB 4R8LA 1I0LA 1GPLA 5LZ8A 2D8AA 2ERXA 2DZDA 3PUZA 1XHLA 2P40A 2KLBA 3N75A 4OI4A 3KPJA 5CLLA 1ECGA 3RO7A 2ODWA 2GKSA 1P74A 3OA0A 1WM1A 1PQWA 1XLWA 2FPGB 1K5DA 4FXOA 2OHVA 2I6UA 4D6YA 1N9GA 1YGPA 2BGJA 3KU4A 3MJHA 1X74A 2GJ8A 2QTTA 4CM9D 4BJ1A 4TZ6A 5CCEA 2WHRA 4C22A 4PQGA 2DWUA 3FAKA 1VSVA 1NI4A 2C7BA 4OJMX 3V42A 1JJAA 4FTWA 1FJHA 3TSZA 1MAVA 2WMYA 3HADA 1DT5A 5AYVA 3Q12A 1OBFO 2X58A 1I5OA 4FYJA 4G5GA 4W6ZA 4ALJA 4AKSA 2DECA 3H3FA 4F6LA 4QBGB 3H1AA 2JAQA 3K2IA 3U4MA 3H6GA 3OQMA 3SQMA 2YQZA 2I1QA 1DJOA 3AG5A 4PGMA 3WLSA 3V8NA 4IIEA 3UWSA 4F92B 5JFTA 4HI0E 2FUG1 4XB6B 4FSDA 4EYSA 2R4TA 4L5YA 4NDZA 4JZYA 5I9BA 3M4ZA 1Z83A 3BWDD 1V9LA 4IH1A 3ZY4A 3H3JA 3RSQA 2GK7A 1ZDMA 1V3VA 4PZCA 2WM2A 2HZBA 5FF9A 1A97A 1W6UA 2P3QA 4CDRA 2D5IA 3EF3A 3ICCA 4EJFA 5DHUA 5JNSA 5K01A 1PVOA 2WJYA 3THOA 4K86A 4WH0A 3EBPA 3RFCA 1OVMA 2YUIA 1NV9A 1RIFA 4PG8A 4OQFA 3QMWA 5TPZD 4EJ0A 5A6SA 3N6VA 4I1IA 2LCQA 1PNOA 1QQTA 4D7AA 4NNJA 1GP2A 2CY0A 4GAEA 4GGOA 1POWA 2IF2A 1WG8A 4LSMA 1A5BB 1ZGCA 3MTQA 5FBWB 2GWRA 3P7MA 1ZJ4A 1P9WA 2JAXA 2O3JA 2HKIA 5BYAA 4FEGA 5DWQA 4JB3A 3CO0S 2P4QA 5E2BA 4BLSA 4KQ1A 4BX2A 3LUDA 4JBNA 4MRNA 3TAHA 3HZOA 2XT0A 2IWHA 1OKKA 1IHOA 1G21A 2NQ8A 3E9CA 1JL3A 2EWVA 4MV9A 3QUTA 4P7BA 1N0UA 3UHPA 2IU4A 4Y2GA 3C7DB 3P5BA 4PR0A 2BBOA 4ZCQA 1UPFA 1ZGBA 1B2LA 1QQ7A 3HXLA 1V8PA 3DBRA 4BEBA 4JSYA 4TLAA 1HLPA 3FOBA 2J9YB 3O5AA 1DKQA 3HKEB 2PMEA 2BM8A 1J0BA 1M0WA 2HWWA 2J67A 2RJ3A 2Y1EA 2P41A 4P98A 3W1EA 1BVHA 3DNFA 4DCTA 3K1JA 1BWSA 4KSCA 3TINA 1A9QA 2BDUA 2BRUA 3JTMA 4IMJB 4KG7A 4N0DA 5AXBA 1US8B 5LA6B 5TJ9A 4Z3KA 3BWVA 3K09A 4QT0A 4WLEA 2A58A 3IAEA 2C7VA 1EWKA 4KQXA 2ZWPA 1GKLA 3UWKA 1G42A 3EUWA 3ETLA 1MH1A 5E3HA 5IZCC 2P6OA 3L1HA 3RUPA 1T2EA 4GF5A 3RW9A 1IZ7A 1CHNA 4WVLA 3TVYA 3A1EA 3AXSA 2V6GA 2YICA 3G2OA 2NG1A 3IX7A 3QTLA 5FBRB 3RJZA 4BZZA 1JFFA 4DIMA 5JR3A 3C45A 3WY9A 3SZGA 1I4LD 3NOVA 1NF2A 3E5NA 1Z2CA 1IH8A 1WIWA 3OMWA 4GVPA 1EQ2A 1DXQA 1PT9A 2PZLA 1YZLA 3GK3A 4AZWA 2F1RA 3KQPA 1K27A 4KYIB 5DEOA 5IU6A 5K8JB 4AY3A 1QJCA 1VCNA 3G7SA 1VI5A 5DBOA 1SBCA 5F4BA 4KRFA 2V5VA 2PV7A 1SBQA 4H7KA 3UAXA 5B7GA 1Q2UA 1SAYA 2L19A 3HDTA 5IG2A 3MJVA 1PGOA 4K87A 3S5JA 3WYBA 1OXBB 2I7DA 4NJMB 1LK0A 2ZBUA 2ETVA 4PVCA 1W36C 4J16A 1YQEA 1CUYA 5C52B 3DC2A 1V11A 3ELBA 4DZZA 4YMUA 4UMFA 4JGBA 2X4LA 1PFKA 3DULA 1O4WA 1YR8A 2OCDA 3O03A 2RDMA 4DCNA 3RUEA 5DCYA 3CT6A 4BWFB 5M04A 4B3TB 4AKIA 5EIOA 4ZHQF 5KQRA 1LQTA 3HFGA 5EI5A 4D56A 4DMFA 1JE0A 3GOQA 3Q3IA 3SS8A 1EZZA 5L53A 4E21A 4Y18A 1C14A 1W2GA 5DULA 3S1AA 2KI5A 2XI4A 4BUCA 1NW6A 3OZFA 5EUMA 3RS7A 2X0NA 2O8EA 4JT4A 1Z4IA 3ZBUA 3WGIA 1H2FA 3JW8A 4BZPA 1FNCA 1R16A 4E5PA 5GMOA 1VSTA 2OKCA 3HN7A 3G79A 3RUHA 4BKUA 2JLZA 4L16A 2HXYA 4MLPA 1R5OA 2MOKA 5BW4A 2AMVA 2H2AA 3PGMA 1A71A 1MVLA 2ID7A 4PO3X 4X95A 4ZVUA 2ZYRA 3LWZA 3OE1A 2W2KB 5T6MA 4ECAA 2PR2A 2Y1XA 5JNUA 1BXGB 5DGIA 3A2MA 5SY9A 1KYYA 3PD7A 2ENWA 1GQQA 1JFRA 3JX9A 3VSCA 4BV2A 1NVTA 2EZUA 3FTFA 2G9NA 3IULA 4MDFA 4JLNA 1TK3A 4M4SA 3VKVA 1LPOA 3AV3A 1GPH1 1QHEA 5DLQC 5KDLA 2O5CA 4KXFB 3AFGA 2QPOA 3P9NA 1DBVO 1EEHA 3B3AA 3VPXA 3WDKA 4MYDA 1C9EA 4DCSA 1PK9A 1SIWA 3Q9NA 1F0KA 2QX6A 4IHJA 1COWD 2D4AA 2IIPA 3LXXA 4EQ6A 2PGIA 4JBLA 4YJDA 1QWSA 5JAUA 2ECPA 1YAHA 2PMKA 3KFXA 5FFFA 4COKA 2UUAB 3EPRA 1CWUA 1EP1B 1JDVA 1K4MA 1PR4A 3GLHE 1ONNA 2VXBA 4YRMA 2DULA 2HFKA 3IV9A 3IDZA 3W5HA 2HMAA 3OM8A 1Y1PA 1PX0A 1XLVA 2A0XA 2D2VA 2OCLA 2XAAA 4IJWA 4ENTA 1QCZA 5KOYA 1H93A 3OCWA 3BT7A 2G5GX 3K70B 1E32A 1QZUA 4MK4A 4EARA 1UMKA 3F6BX 3FUCA 1B43A 3CNLA 2Y1GA 2Q5IA 1KK1A 3Q15C 4R8SA 2C3UA 1ACMA 3IEKA 1FTWA 1SK9A 1MOQA 3GA0A 1AMUA 4O2AA 2Y1FA 3RRYA 4RMJA 3U3ZA 2UU9B 1EFKA 4CODB 2PH1A 2PMWB 2Z83A 5GV8A 2V5UA 2PT9A 1JQ5A 4YN3A 2BTQB 3UB3A 3RAPR 5I9IA 3E8SA 2EW2A 5LZ2A 5HM6A 2VSXA 1M5RA 4JEIA 2D3TA 2VI5A 3CSDA 1D2NA 2CWWA 1Y42X 4RETA 2PGOA 1BS1A 3TLYA 3II6X 3U48A 3OWOA 1E9VA 4KP7A 2C95A 5JJIA 1TNDA 3PHIA 5JOQA 4I9NA 1FFYA 4K3UA 5CD9A 4X8MA 1U7UA 2P4UA 2WVGA 3NX4A 4KO2S 4NBTA 5KX5B 3VNSA 2A5LA 4BE4A 1CUSA 1GKIA 2ZCJA 1YBMA 4G9EA 1QGZA 4X45A 4DDTA 1LDYA 3EVEA 4MS1A 2PRYA 1ZNWA 4X7BA 4YJ3B 5F98A 1IOZA 3A26A 4EY6A 4OF4A 4C7OB 2RBEA 1ZVJA 1EINA 3RHFA 5TT0A 4DMCA 2J7PA 3WLAA 5T4FA 4GEKA 5HKAA 1DIGA 4PICA 1F8XA 1V96A 4Q47A 1UBCA 4IX1A 1OE0A 2X6TA 3A31A 2VJOA 4ZJUA 5K8IA 4JKYA 3L8CA 3OLZA 4EB6B 2RGRA 1WZIA 1GNQA 4U1RA 4UVEA 1KZ1A 3MAGA 1U5BA 3BWBA 1JPUA 3A0UA 1YI0A 3SJBA 2ZWMA 3LYLA 4HWGA 1PR6A 2X9LA 3BMOA 1QIHA 5T7BA 3AHEA 4RJTA 4RHYA 4YUXA 3W3ZB 1W59A 2OHXA 1VXRA 2PU5A 3Q9SA 4UVGA 3SIRA 3OQJA 4A0QA 3QNMA 3HCOA 2QTGA 3HDQA 2CB0A 2I7CA 4I5FA 4F3NA 1WD5A 1EVQA 5ABPA 2H3EA 3F6YA 2I71A 3GD5A 1MOSA 4U2GA 3ZGYA 2DWOA 3SJCA 3W1VA 1W47A 4KO8A 2XEXA 1NFQA 3FSGA 4RM2A 3LF1A 4I3HA 2BEUA 5E6RA 4EGFA 2Q3FA 1E6MA 5CBPA 3ICQB 3HBJA 1O9GA 3AUXA 3G13A 4YVFA 1GQOA 1UINA 4UVIA 3RU2A 1YK0A 3RT7A 3WMEA 2PKWA 4ENPA 1QC5B 1YBFA 3LHIA 1E0DA 4X9XA 3T0GA 3ZV3A 2VDKB 4M6WA 3S8YA 1YR3A 1R66A 2VTVA 2A0YA 2V6JA 3S2ZA 4EJSB 1FP4B 3G2IA 5KVAA 3OU6A 3MELA 4OXNA 4LZJA 2DR3A 3HXKA 1VKJA 1PZHA 2HA4A 2XA1A 4CFZA 1NMQA 1U80A 2RIPA 1U9YA 3RC7A 1YASA 4TV9F 1XG5A 1L5ZA 1USIA 1A27A 1G5IA 1D2AA 1M10A 1TC2A 2QRGA 2VH5R 3FLBA 1ZHOA 2BCJQ 1MMFB 2B8JA 3C0KA 1XEWY 3A9TA 2AW3A 3M1YA 4L8GA 3S2IA 3T9FA 1K6MA 1L9KA 3UJ9A 3G0DA 3G8AA 4RJ2A 1EQUA 2ZKIA 4NIMA 5LLTA 3ILSA 3L7OA 3FTPA 4LC1A 1LJLA 4XASA 1QIGA 1S9DA 2IY7A 3EOBI 1ODCA 4O6VA 1IBLB 1XCGB 1UXOA 2OGTA 4RHXA 4Z1MA 1Q14A 5D6OA 1O58A 2ZYTX 3GFOA 3GELA 3LUKA 4IXWA 2WKWA 4UMEA 1BEUB 5I3CA 5JEEA 1DFIA 3CLVA 3QTBA 1M1NB 3S2FA 2W2LA 3U0BA 3C7AA 1SB9A 4P53A 2RCNA 3QVGA 4FYKA 1SHTX 1BJKA 4BB0A 2PVSA 4IDHA 1A9OA 1Z39A 4I5EA 2Q2QA 1T6ZA 4UHEA 5JO0A 3B6IA 2A0WA 1R5BA 2MMGA 2ZATA 4K3VA 4A1OA 2HF2A 4MOWA 3U6BA 3HFRA 1TTQB 2XYHA 2QMUA 2XUQA 4W7SA 5FI5A 1KOJA 1W88A 5CAEB 4YRFA 2O2YA 2VHUA 5AT1A 4MQUA 1T13A 2CJWB 1J33A 2GJKA 4B8WA 3IDQA 5K0FA 1Z45A 3BAFA 1WQ1R 3R23A 3HM9A 2AUNA 5H81A 3TXAA 2DHQA 5ALUA 1EWYA 1KI1A 2AD1A 4PF1A 4N0PA 4GE3A 1QLJA 3RE1A 4WKCA 2P27A 1TFRA 4OJTA 4CM9A 4TKMA 4WI1A 5C3MA 2LTAA 5BR8B 1CV2A 3PLNA 3OTIA 3OFVA 1A9XB 4MQEB 3PQ2A 3F2VA 1L1EA 1FDOA 1UKEA 4YTEA 4YP7A 5KZMB 5G0VA 2IHJA 1N6NA 3DEAA 3FPFA 1F3OA 3EXEB 1AKEA 2O3QA 3I8XA 5H68A 5JAHA 5KYGA 3ZG6A 2PBLA 2VHXA 3I83A 3V3TA 4F3KA 5LP6B 3DXXA 3HVUA 2O1SA 2HLPA 3RVJA 4IHQA 2DBQA 3LSTA 5LMZA 2RHBA 3EXHA 4KU4A 2CKMA 2CF5A 3MMPA 4EUEA 4YJ2F 1M75A 3EC2A 3INGA 2VDVE 4L95C 4AKHA 2J3HA 4LBVA 4YIKA 3FBTA 3OF5A 6ABPA 2FPIB 2Y6UA 4UOZA 5AD1A 3LG2A 1RE1A 2VNAA 5DISB 4CKWB 2I80A 2XZPA 2IELA 5TF0A 1DXOA 1HEIA 1S2LA 4WNAB 2X6QA 3H2JA 3U3KA 3EGDB 4HWPA 3VV3A 1QB8A 2OCBA 4B1FA 2GSWA 3MERA 1HC7A 5EHGA 2ST1A 1M2OB 2W4MA 2OY0A 2ZZKA 2VTBA 4B82A 4CHGA 4GRDA 2V1UA 1XZNA 3G2PA 2O59A 2F1HA 3OOEA 1PJLA 2LDXA 1L7AA 1P91A 1ZISA 3OCUA 4C4YA 3PRJA 5TQ2B 4R7GA 3K5HA 4S2EA 2BFFA 5K0CA 1G8YA 1UP4A 3BZUA 1RJ9A 2WSIA 5G4LA 5KNDD 3K9CA 3U62A 2P30A 3C5EA 3FTNA 4DAEA 3K70D 2CLFB 1RC1A 2O6LA 3NIBA 2ZSFA 4WOBA 1QDLB 4Z8XA 1U2PA 3T1NA 1TU4A 3C8UA 4GX0A 4D3SA 1DAPA 2WF9A 2P91A 3CHYA 4S0XA 4QBHA 4RPGA 4RULA 3KXDA 3JQFC 3I04M 5FA5A 3M6WA 4QUIA 4BFWA 1IWBB 4FCCA 1HYGA 4RKWA 2FPWA 3LQRA 4Y9UA 1QIKA 3KV3O 1WZCA 3IR6A 3DXFA 1VBMA 2EV9A 1MBZA 1SCNE 4RLSA 1HXHA 4RQBA 4RZIA 1XXHA 1MJHA 1XZIA 1U0FA 1YJQA 4XD2A 1AH2A 4ERNA 2IS6A 4CG0A 1AQLA 2I2AA 2YFKA 3FZYA 3EFEA 5FP0A 4AUNA 4CT0A 4O59O 3L02A 1S1MA 1UK7A 1PQYA 3QP9A 3R41A 5AM2A 5ADVA 3IHKA 3E81A 4J29A 1XNQB 1AHHA 3WFJA 2AF3C 3BCHA 1I32A 1W34A 2QQGA 3AP2A 3F98A 4OJNA 2MYTA 4PRZA 4R9UC 3V9AA 3WK9A 3ZCQA 1BVUA 4XYMA 3TEMA 1V2HE 2Z5GA 1UIRA 1GAQA 1B0UA 1AKUA 3FNBA 3QU5A 4MR8B 3NKVA 1NOKA 2CDRA 3HU1A 4U0KA 1VPWA 4HDQB 4J6EA 2IBTA 1KXJA 4K6CA 4HQKA 5BN4A 5C35A 2H0QA 4C0SA 1SZJG 4I2VA 3T0FA 3WIEA 2P5YA 4JJIA 3JQGA 4CMBA 2PPVA 5HGXA 5KOJB 3CVVA 3K05A 4QDZA 4KR0A 2IZ5A 4BRSA 1OHHA 2WNIA 2J3EA 3H11A 2VRCD 5THKA 1WF6A 3KWJA 1SU6A 2FDXA 2GZ1A 1W4RA 2F9MA 3BM5A 3ORFA 4FX2A 2YOHA 1PEAA 1NN5A 3CN9A 3PHCA 5BVGA 2TYSB 3LXMA 1RLJA 4TL8A 4Y2TA 3VMMA 2ISQA 4RTSA 5K9ZA 3C6MA 1BD3A 1U3FA 2NUAB 2G1AA 1K6XA 4WKOA 1PN3A 3DYIA 4OAOA 3EAQA 4PC6A 4CR7A 1AKTA 2FEAA 1DTWB 4D97A 1YJ5A 1C30B 1UZLA 2J0UB 3E7FA 5AH0A 2NXJA 4A1FA 3D8UA 4OUDA 1KF0A 2W6IA 1DT3A 4Q3KA 3K8QA 4BV8A 5JH7F 2IU6A 2R2AA 4O2BB 1HNNA 1JE1A 3CH5A 2XCOA 4K9DA 2FCRA 2KLHA 1NY6A 2IZ7A 2WJJA 4MUGA 1HEUA 4Y2UA 5F52A 3RSOA 1TJ4A 2YYZA 3LPDA 2QL5A 4HN4B 1HZJA 3QF4B 4CFSA 4XIIA 4ZQBA 2PO5A 3FUVA 2MIIA 3QVKA 4AYWA 5LZ9A 1SPXA 4QSMA 2JGEA 4WUTA 4TWIA 5EJ4A 1EUCB 5JPCA 4AY5A 1AGPA 1E79A 4YRNA 4MRPA 5F2NA 2Q62A 1MB3A 4TV8A 1FFXB 4PW0A 3T7CA 4EO9A 4ML3A 1AB5A 4JI3B 2I2WA 1VHQA 4F71A 1VGVA 1ZJWA 3IP6A 3FNQA 1ZN9A 2UZ1A 4EO7A 2GA9A 3AC0A 5JT1A 3IMCA 1I8TA 3KZMA 1QLHA 1C50A 4FHCA 1RWOA 4U7TB 3VFDA 3CWZA 4ONEA 3PNYA 3OPYB 1EHCA 5TPWA 4U7FA 1PBNA 5IKOA 4F56A 1X1CA 4YDSA 1OX4A 4ZANA 4F5EA 2WV7A 4KQCA 3DOHA 4RVDA 1Z29A 3H2BA 4KSYA 3W3AA 3PZBA 1T4CB 4KRYA 2A1IA 3P32A 3R3JA 1PNQA 2G80A 1YZQA 4UM5A 2GCGA 4C4PA 5SYMA 5JVDF 3GY0A 4H17A 4TL9A 4D9KA 2EP8A 3I32A 3GL9A 3VSDA 1GUZA 1OFIA 1QGUA 4I3FA 4BO0A 1W36D 1N32B 3K71B 3OJLA 4AWBA 4EPYA 3DUWA 3OEED 2PS3A 2D8MA 3DL4A 1HTBA 3L0SA 3H5VA 4X92A 5FL7D 4ARZB 4R98A 1ZD4A 2BHRA 2VBCA 4N3NA 3REFA 1JH9A 2R7NA 3W90A 2VP9A 4CM7A 1Z8HA 3BRSA 2C88A 4LVOA 3WRYA 1LBSA 1KZ6A 1WB9A 4Q03A 4D8YA 1G0NA 1NBIA 4OJKA 5HIIA 2OECA 4C0WA 1FXWA 2X7XA 1BZYA 3H9QA 1VB5A 4N5HX 4EO4A 1IIRA 5C37A 4TQGA 1SKQA 3I62A 1JIVA 3NDRA 1RQPA 1ZK2A 1T1SA 1Z33A 1BQ4A 3ZJYA 2XYRA 4H59A 4N3GA 1S8NA 3KYDA 3K1YA 4H15A 1N5MA 5B3AA 5JS2A 1BOOA 2F9FA 4W5OA 1QXSA 1Z75A 3LUBA 1Y3DE 3H8WA 3BVPA 4HNAB 4IDGA 3GPDG 4JUFA 4RJJA 4D0SA 5AW1A 1CY2A 3B1JA 3I6BA 2IV2X 4TS9A 1CNMA 3BILA 3LLMA 3I39X 3RS8A 4ZYVA 2WJIA 5KTYA 3PIDA 4BNYA 1GNRA 4KLZA 2AFIB 3BK2A 3ZWKA 2FSVA 4C0JA 4Q4CA 1W19A 2IPXA 1GY8A 2R5FA 3E1KA 4G1UC 4W82A 2YKGA 3NTRA 1EPUA 2GBPA 2B4TO 4HXEB 4KPUB 2P8SA 2CDCA 3A3KA 4X91A 4ZO7A 5KSWB 4RA9A 1G2IA 4YRQA 4KWEA 2Q1YA 1Z34A 2FSGA 1ZM7A 1FSGA 2D7CA 3D1LA 4MH0R 3OP4A 5E4YA 4CNQA 5FOSA 3O9ZA 1WDLA 2YVKA 4O4JF 1SOWA 4BNNA 5EWMB 3GT4A 2QRZA 1H2YA 4ZTZB 2QU7A 1M7BA 5HKLA 5BR7A 3SXJA 5F5NA 3RLFA 1MABA 2ZI9A 4X6XA 5EKDA 1PHPA 2A1UB 2CEKA 2IEAA 2MWMA 3QH4A 3OQHA 4HTFB 1GR0A 4RHFA 1AS3A 4JXXA 1SN7A 3ZBQA 3B9BA 3BCUA 3HVKA 4IOJA 1BDJA 1V5GA 4C3ZA 1TRKA 2ZJ2A 4RS4A 5GTDA 3ZTYA 1E3TA 5JRZA 2HSEA 1TCBA 3I9V6 3L1IA 2TSYB 3PA8A 3M2TA 5ENZA 3X43A 5ILGA 3HDVA 2HLHA 1HSZA 4DABA 5JPDA 3MXOA 1DQZA 1IQ0A 4OJQA 1DX4A 2FLKA 1Y9ZA 2JJ2A 3JQ8A 3C8HA 4GR4A 4XCVA 1RRPA 4RENA 4UBKA 2ZG6A 3QNUA 4QXRA 4CM3A 2O8FB 4ZMBA 1QB7A 4A10A 3VO2A 3ZIAD 1E6WA 1JJ7A 3CNEA 1W85B 5LXTF 2YHSA 3COJA 2VCEA 2ZRBA 2G67A 2HQOA 2J7KA 1R00A 1R0BA 2R8ZA 2VAPA 3BDIA 1MEJA 2P9YA 4C0BA 4WZAB 1NW9B 4EA7A 1QFSA 1PV2A 4MO9A 2HQSA 1E2JA 1XGKA 3KC2A 3CNOA 1ILEA 2O8BA 3OZSA 4KQGA 1JYFA 3JZFA 4NECA 2I6SA 4D9JA 4KXWA 4KR7A 1L2TA 1PR2A 2HLDD 4BO7A 3KWFA 2WZQA 3T3OA 1JR2A 2ZDGA 5LDHA 1CS0B 5D86A 3ZDAA 1ENOA 2Q1UA 4AY4A 1E6UA 2ZVQX 3DMNA 4P82A 2GRJA 1H6DA 2GZRA 4CKEB 3PLAE 3A6ZA 1W1WA 3PXCX 4ETMA 5JNRA 1MJNA 4LCEA 3JATA 2JFUA 1RFGE 3MS7A 1AXGA 1UBKS 2F1OA 1FXWF 4N0QA 3W5CA 3EAGA 4JQCA 4HYQA 4EKDA 2Z5LA 5ESRA 4G85A 4RKRA 3OJFA 3F5MA 1HE3A 3TM5A 4DG5A 2BKVA 4UPEA 4PZLA 2EW1A 4XWAA 1YB7A 3RRBA 3P9CA 4BNDA 1GGNA 3TE6A 3IAAA 3SMVA 5L3ZA 3WHKA 3A4IA 3MA0A 2CLHB 3SNHA 3GEDA 5EMLA 2X8JB 3MCUA 1ZEJA 1JXMA 5B3JC 4B34A 1Y6RA 3KT6A 4OU5A 4M0MA 1DB3A 3I92A 4CIBA 1T9BA 4E0BA 4PRYA 2W4IA 1YGYA 4DCMA 4YREA 4P7GA 2KE5A 4R9RA 1DV1A 5F2EA 1JEAA 3Q0IA 3QQ5A 5AJTA 1E1KA 3U3XA 2GYVA 3HH8A 4BQNA 1VPVA 5CFMA 1D07A 3C3CA 3BPSA 3GLUA 2GN0A 4GPTA 3PUHA 3BHNA 1EFCA 3GRVA 4DKXA 3HEAA 4B6QA 2EJVA 1GPNA 4DAOA 5CP8A 1O95D 2PS1A 3CC8A 5ICFA 3A1CA 3F46A 4ZARA 1AV7A 1S8AA 4MJLA 4QDUA 5FR2A 4DM4A 4DDKA 4F6CA 5H5JA 4FP9A 4AWAA 3WNZA 3C41J 2QVYX 3L49A 2ADOA 4ZJPA 1BRMA 5DYNA 3D3KA 3KUCA 4MWZA 3R0QA 2MINA 2XDYA 4GXQA 3ROZA 5BURA 3ETNA 3ASYA 5J1TB 4ER0A 1EJ0A 4JD5A 2OSVA 1H5QA 1NKVA 4GPAA 4M9UA 5J5AA 3ZY2A 4EQZA 1JIIA 4FMCB 3V55A 4D8UA 2IHNA 1U9ZA 4O02B 5KKNB 1NM5A 4OIFA 2ISCA 1LS6A 1Q0LA 3ZW9A 1R12A 3UT5A 4J0QA 4F4UA 4I55A 3V7NA 1K5PA 3R7WA 5KNBA 2EG5A 3BBLA 4J4HA 3IAM6 2X0JA 4AJEA 1TYCA 3LT1A 2FX5A 1RC0A 2RGXA 1FNDA 1YC5A 1Q84A 1E9FA 4EHAA 1AZTA 1IY9A 1QZTA 4JBWA 1OTXA 4OQNA 2F43A 1TM5E 4R1OA 4OU4A 3TUIC 2H1VA 4ZFNA 1P2GA 1Y7LA 4FWIB 4KRXA 5A6SB 4RTMA 3KG2A 5I51A 3RWOA 4P5PA 3GP3A 1JPJA 2PSDA 2O54A 2HF9A 1WZUA 2C9ZA 5KWSA 5MN4A 3JQ9C 5JJKA 3USZA 1O87A 1BFKA 1SURA 2P9EA 3PQDA 4KLCA 2GZSA 1V7CA 1NUHA 2VK4A 2VDUE 2FE1A 2QE7A 5EFZA 4FOOA 5DE3A 4W5NA 2YWCA 4FNGA 2ZSHA 2GYWA 5CFQA 3WIVA 3YASA 5EUBA 4AJ1A 3ZHUA 1G21B 5BW8A 3PQ4A 4TLLB 5B36A 4KYTA 4WA8A 5BN5B 3TQSA 2H0RA 4JVLA 4EA6A 3EGIA 1GTVA 4BGVA 5HCNA 2XGJA 3WV5A 3LDHA 4OA5A 3REOA 4CIAA 4TM7A 5JSUA 2ATVA 1N1MA 3OZXA 3B48A 3PT9A 3KRTA 2G9RA 1GHTA 1DJPA 4J7XA 4P5DA 3WLJA 3WGZA 3IDOA 3J81k 1RWXA 1KI4A 1XTSA 2ZSDA 4IVRA 4FKZA 4MMYB 4P92A 5AKJA 3VH3A 4WASA 1Z8FA 1A8IA 3ZQJA 2PV0A 1SBYA 3DTYA 4F96A 3OZWA 4RHCA 5BV7A 4LFBB 1N8SA 4HEA1 4I50A 4P9NA 4IOKA 1YRAA 4HLUC 4UXJA 1LWNA 2CXSA 3AGPA 3EZYA 3GJ7A 1GPYA 1NR7A 3TOVA 1O94D 5FWNA 1LGYA 1CJMA 1UMCA 4P4NA 2WWYA 1L4EA 3V7UA 4X7RA 2DLDA 2JIOA 3FIUA 3KX2A 3CNQS 3OY2A 1YZUA 5FDFA 2TMKA 5AM5A 1UC4B 1YK1A 1V5FA 2VRCA 3CU5A 4MUYA 2YWXA 2JLBA 5KQMA 5LDDC 4B3RB 5K4AA 4WSOA 3OQOA 1M1YE 4TTQA 3RK1A 5FTKA 3W7AA 1AMOA 2RJOA 2OAEA 2NUTA 3MD0A 5LU9A 2NSLA 1L4HA 3EIFA 3O90A 4B6GA 5ARBA 3NDBB 1FPMA 4UMDA 1A77A 3GLVA 4F2WA 2Z8YA 3G23A 1ZZGA 3IMKA 4YACA 4W7HA 4R1PA 4MVJM 1ODIA 2DKOA 1A7UA 3C74A 3L4BA 4KCGA 3ZY5A 4JR1A 1QU2A 3GUUA 1UWCA 2SHKA 3EVNA 3STUA 5LQKA 3ZJVA 2PANA 4HB4A 4J1SA 4POOA 2RHLA 2V7QD 1JEEA 1VKZA 4J2OA 4OP1A 4PLCA 3Q2OA 5CYPA 2A8YA 3X44A 5A1TA 1SIOA 3B60A 3OPXA 5HZGA 4ARCA 3DONA 5DHAA 1MQSA 1OZHA 4ZT4A 1YR1A 3Q9LA 1RJFA 1L4UA 3AR9A 4OK6A 4QQ8A 5IZ4A 1D1TA 3RIMA 5BWOA 5ALIA 3GXOA 4PC3A 3GFTA 3ACDA 4P81A 4E3WA 4MUFA 2RD2A 1TPYA 3S1AB 4WX2B 2HB6A 3A6GA 5WRFA 2O8EB 4OK5A 1GTRA 3KEFA 3PNBA 2J5RA 1ZGJA 2ECKA 2BDTA 2J0EA 1S2OA 3N0RA 1L5WA 2B0CA 2C94A 4DWWA 3MINA 4L28A 3ZDQA 4AZVA 3O8RA 3WWZA 3LXRA 3PUJA 3JQEA 3PQ7A 3WKDA 3DEJA 5F12A 3RANA 3STTA 4XZ3A 4TWBA 3ZQ4A 3FFBA 4RF3A 4DV2B 4ETIA 1A5AB 3ZDBA 3MB8A 3UQZA 5KB3A 2B4RO 2D1SA 4JH0A 3A7DA 4P6VF 4H31A 4GFDA 4QQKA 5AJXA 1FP1D 1PNVA 3I9FA 3AU9A 1ZI9A 2IEZA 3CZQA 1DMSA 3R5JA 4N5DA 1KAEA 2I3BA 2PEYA 2JGAA 3RFVA 4ZIRA 3D6MA 2Y9MB 3QQPA 4LHEA 4C4OA 4EY3A 3KVOA 4HFMA 3C7KA 4DCJA 3R7BA 2CXUA 1ELOA 3DNMA 3COSA 4PX2A 3S28A 5JIBA 1SCIA 4ARIA 3LP8A 3PXUA 2GN9A 2DY0A 2O05A 4BOYA 2C77A 4HGYA 4TPKA 2INGX 4AWXA 2DM6A 3CGGA 5GVSA 1NF9A 2PD4A 2WWVD 1QRRA 3QA9A 3ZKAA 1YZVA 2BP7B 2PZKA 1LX7A 4RC9A 4UBMA 1P7CA 2H7VA 4IIJA 2ZBFA 3EUAA 3G2NA 5ARCA 2QUAA 4DLZA 4BWVA 3KZVA 1TM7E 4MW6A 1LX6A 3L7YA 4QOFA 3QKTA 3AEUB 3Q7RA 1S8FA 3JALA 2OMKA 3P9KA 1DCTA 1G4AE 1N6LA 3F2IA 3LCUA 4I50F 1H94A 2OHOA 3VPFA 4L6CA 3QEMB 4DG8A 1QS0A 4TZKA 4TKVA 4Y6SA 2WJHA 2JIDA 1OC4A 1DELA 1X7GA 1U0SY 3CT4A 3LGSA 2HQ1A 5CUQA 3I37X 4Y8VA 4O2AB 4B3JA 1NC3A 1P0CA 4D6XA 4MVJA 3Q7EA 1R10A 3LX5A 3ZZTA 3E1SA 3INYA 2HK9A 3TX2A 2AHOA 1IBMB 3BB1A 3BB3A 3LHDA 1CUDA 2QN1A 4URUR 2P9CA 3KZXA 2BR5A 4IJ5A 2FQ1A 5TX7A 5E38A 4C2AA 3LPAA 4YT4A 4IGEA 2EYQA 1H9BA 2FK8A 3E8MA 3OIUA 5DXFA 1H05A 1JHZA 1W87A 1Z35A 4E4TA 1TRHA 1DC4A 2FH5B 3FMOB 2WIFA 3D7LA 3G5AA 4I6EA 3W9YA 4HNUA 1T8YA 2Q46A 3BGIA 3LC2O 1H0KA 1HOTA 4KZPA 3I23A 4YRKA 1QH0A 2PHZA 3MTDA 4IX9A 5A62A 2OAGA 1I3OA 1T1RA 1E2EA 4HO1X 2AG8A 3AXTA 5IH7A 1QVAA 3EIUA 4ID9A 4BYGA 1H1DA 3BE6A 1J0EA 5EZYF 4TL6A 3D8TA 3HZZA 1GG5A 2A14A 2WJ6A 4YEDA 4F1KA 2V7VA 5HTKA 3U5TA 4PY2A 4XGNA 4W9MC 3NDPA 2Y0CA 4H1HA 3MW8A 2VPQA 1KQ3A 4URXR 4GMDA 3ED1A 3DR5A 3TZLA 1WVGA 2GFQA 1P1FA 2CCGA 2BWJA 3PENA 4DLUA 5B2ZA 2R6FA 4BVAA 5FBVB 3BMOB 3NOQA 2RH4A 3N76A 2D5BA 2L42A 2P62A 4UXIA 2Q29A 3SN6A 6Q21A 4JMLA 4L51A 1KRWA 2Y71A 2AHRA 2XOKA 1TO1E 3LFTA 3CUUA 2XE4A 4X8LA 5EZSA 4BX3A 4YUAA 2RGGA 4QIHA 2DOKA 2RBKA 1WTAA 3A9WA 1N3LA 3E0XA 3OU2A 2CL5A 3ED5A 3NM4A 4B32A 3V4ZA 2B2NA 1KYVA 1SUPA 4UDNA 5ALFA 5E6RB 4B9AA 3CZRA 3B7PA 3NYRA 1C2YA 2E1PA 3LT2A 3U44B 2H2FA 2JHCA 5CBPB 3DZBA 3RC9A 4YGYA 4Z9AA 3TLKA 4CTNA 1QQ6A 3HHPA 3ANNA 4HLNA 3H2HA 1IQUA 4WLNA 1GT91 4K6OA 3IBCA 1SKYE 1M5TA 1PDVA 1ULBA 4Q7EA 4YPOA 4BQPA 1E2BA 4OXQA 1KNXA 2E4VA 2XNDD 3EW7A 2HLDA 3D4NA 3WKCA 1Q7BA 4NATA 4XRGA 1PG2A 2WF7A 4R2IA 2WKQA 1AQJA 4A6XA 2ZRIA 1SY7A 4N12A 2HBRA 4OP2A 1DIHA 1VMAA 1IXKA 2XMPA 2MCFA 1CEXA 1F5SA 1H8HA 3FLEA 3TH5A 4DQUA 5B64A 3BE8A 5T5QA 4XKJA 4TKUB 1IHYA 5JANA 3W7VA 3R9XA 4LPSA 1YQTA 3VNVA 1N9ZA 1IAQA 2QTCA 1ZH2A 4G0PA 3AF6A 2P9ZA 4KR2A 3MS4A 2R9VA 4UEQA 4L9RA 4X00A 1TTTA 1BA3A 4B45A 4QHYA 1PZGA 1T0JB 3WGGA 1VL8A 3QKSA 2UYCA 7MDHA 2XVAA 1I94B 5G1NA 1JPNA 2FP4B 3QXJA 5AI5A 2F4NA 2ZAOA 3E48A 4HUQA 5KVQA 5LWQA 1OWLA 1EK2A 2UXCB 5HILA 2WA2A 4UNIA 4ZOCA 2P3SA 3NTQA 4M99A 1HBJA 1KEVA 3BIWA 3BA1A 4ZOLB 2ZUFA 2O7QA 5CXQA 3T1VA 2XUOA 4DJAA 4D0GA 4H0CA 3W7BA 3L7AA 3IP9A 2CHQA 1W88B 1QTNA 1CF2O 1B8UA 5D01A 1OBVA 1HUQA 3D4BA 4M1WA 2XRYA 1XCJA 3NORA 3LY7A 4FCVA 5G0WA 3THRA 4NVRA 3LRTA 1CBUA 3HFSA 4GKAA 4ZCIA 1P1JA 1KOLA 5EP4A 2OCGA 3PTZA 4LXXA 4L74A 3JRWA 2Q7DA 3AJ9A 2G0AA 4K46A 3HM2A 1LW6E 2ADMA 4LRXA 5LZ5A 1QGOA 4D3DA 1X7DA 5EQJB 5CA1B 2HJSA 2Q07A 4WIAA 3CONA 1YOVB 2PT6A 3AHDA 3KAJA 1FNNA 4FEEA 3V4OA 5KYKA 4CEHA 1W44A 2EHDA 4PLVA 2FMHA 1PG5A 1E77A 3GEEA 3I73A 3GX1A 3PGKA 4IIHA 4TROA 2QAGC 3RBVA 1P0IA 1SQ5A 4GQAA 1RZUA 1X38A 5DHSA 8AT1A 2VJPA 3ASVA 2OBLA 2CXXA 4EYQA 3CXRA 1XZDA 2OYSA 3KHSA 3PPYA 4ZEVA 3BYZA 5LOVB 5SICE 2AKEA 1QVVA 3GEPA 1DKLA 3E23A 4B7ZA 5IH3A 3HCDA 3TGWA 4GS5A 3ANXA 1EFPB 1AN0A 1ZMRA 3IMGA 3RRZA 4LRYA 4RHUA 5TEVA 2GWHA 4RIFA 4RTRA 1T9ZA 4HD8A 3CKLA 4EECA 5B55A 1CY6A 1VG0B 1Z47A 3DKVA 4YQZA 5DWDA 5AO9A 3A9CA 3ECAA 1MEOA 2QRMA 1V4BA 1M2VB 4BNXA 2XGSA 2ZWIA 3GZNA 1JQLB 3AJEA 3RYFA 2QTHA 3N6XA 2DR2A 3V6MA 5E2AA 4OXRA 3NT2A 2O2GA 1BU8A 1F4PA 2QXUA 2X23A 4NYMQ 1AG9A 1ZJ6A 3T3NA 1J23A 1CULC 1J2EA 5TARA 2BFFB 2D5AA 4JUBA 1W4ZA 1PR1A 2X2FA 1R6XA 2QZZA 4H77A 4QYMA 3CR7A 3EVZA 4ZCPA 5IAEA 2N9UA 3GNSA 1ZOPA 5LKRA 1NSFA 3K9NA 3MCAA 2AZDA 2OMEA 4UFNA 2KHZA 2TMYA 4UQPA 4Q9HA 4NH4A 4XIFA 4ZMSA 4CIVA 1T9CA 3WFIA 3M0EA 3SWWA 1NSTA 2CFIA 3QPBA 4RORA 1MNQA 3QKWA 3W2TA 1NKTA 3GP5A 4OM8A 2B4AA 1WUIS 2I62A 3QE3A 5EXPA 3UHOA 2QIOA 1GSOA 5TMDA 3N9IA 3ITKA 3TI7A 3KFVA 3RIHA 2Q0SA 4ANFA 3RYIA 5AKEA 4DCPA 4DUYB 1YS1X 6ADHA 3VR1A 1GLGA 3WBFA 3HCPA 1XXHB 2CD7A 3GAZA 5HFJA 3KLPX 2WHEA 4E13A 1R0ZA 3L8DA 5EY5B 2AE2A 1V8DA 4F3RA 4PS1A 3SLRA 1BQ3A 4MICA 4WDQA 4AYTA 2Q3LA 4NS4A 5L7TA 4NZNA 4QTXA 2CUKA 4AF8A 4ER3A 1OAOC 1D4FA 3LY5A 3R8CA 4RTJA 5FEUA 1N2IA 5KCZA 2A5FA 1N2GA 3WGUA 4PYIA 1CZOA 4Q9NA 1D2RA 1KIAA 3ROQA 5TRTA 3TBKA 3V1NA 1EAYA 2ZIVB 3EZXA 4AUEA 1QRTA 4MCAA 4OHVA 4MKZA 5BN4B 2Q27A 1L5LA 2WG1A 4Q9AA 2CD9A 2G9UA 3PJRA 3IQIX 5ALWA 2HR1A 1I9CA 5AVSA 4HAOA 3GDWA 2QEQA 1XHFA 1WMBA 5ECWA 3JQGB 3SICE 5K0SA 2K87A 3AVYA 4PZAA 2RGNC 4MROA 2ZYWX 2XADA 4EZBA 3D31A 3A1VA 5LZ7A 1WUYA 3OX2A 4KV7A 3JPWA 4K5QA 4JB0A 1CQJA 1XCMA 4ISBA 1FSZA 2PBZA 1V47A 3ZTTA 4EHBA 4ZN6A 5CVTA 1ZMOA 2BI8A 1NLZA 1R2QA 1Z2PX 2FKAA 2H48A 4Y7CA 4E51A 2ZRAA 4XW2A 4PFJA 1YF3A 2AG6A 4EJMA 1FU8A 1L4MA 1J8YF 1FP7A 1AS2A 3E2IA 3KSMA 4P7JA 1DEKA 5CG1A 4LE0A 3GPBA 1E69A 4Q9LA 2I91A 1RI5A 1U9IA 2BONA 4PAMA 3RVRA 5HSGA 1AO0A 1WR8A 4LDZA 4OUDB 5DHTA 1WA5A 1JALA 1RI4A 3P0IA 1K9SA 4IXTA 2QYOA 1EDOA 4K6KA 4U3JA 1YIDA 3AL0C 3IDAA 3TZ6A 5I6DA 3M4YA 4Y2YA 2VRWA 5A4FS 3H2ZA 3JSAA 3TQRA 1MPTA 1UKYA 2YV1A 4HR7A 4JMPA 4DUGD 3UV3A 5JSQA 4BO2A 4L9SA 3JQRA 2FEXA 1K8RA 1VLZA 1XZ8A 3ICWA 3O4GA 4MLCA 3ZHCA 4BMSA 3I5YA 1SXJC 2JB9A 2C3OA 4FR0A 2VZ8A 4JLBA 4N54A 5LM3A 2WM9B 2PUAA 4NRDA 3NCHA 3G7UA 3VVMA 2CZGA 5UKDA 2OZLB 3TAUA 3F9IA 1GPDG 2OK7A 1L4LA 4R9SA 5BV0A 3IXLA 2Z2KA 3URKA 3L8FA 2EQAA 2WJZB 3EOAI 1AKNA 4C05A 4DLAA 1U6KA 4CYMA 1BXRA 3SIWA 2H4FA 3NPMA 4Y2QA 4ZVMA 1K9VF 4L85A 1J0XO 4BCDA 1EA7A 3N8KA 3MBKA 2WTAA 1UOPA 1LRJA 3BTSA 1ID8A 2IYAA 1M6WA 4R4JA 2OV8A 3ENNA 5A5FA 2OHHA 4O4HA 1OOEA 1KE1A 4OMUA 1VDZA 1K4KA 3C3JA 1YQGA 2ZYAA 4RTQA 1KMHA 5TPWB 3Q8WA 2IEDA 3AP3A 3NHLA 5DX1A 3F6EX 3ZXSA 3DH0A 4Q9JA 5FOUA 7AT1A 1OX4B 2X9NA 3GLHB 1Z4NA 1ZOSA 4QTUB 4ZOEA 2PMCA 2LUOA 2XDQA 1Z16A 3FSRA 4WEQA 1VPLA 3AVQA 4LI3X 2NP7A 2V98A 2X22A 1NJ1A 2AXPA 2ZK7A 3EDYA 3F5QA 1EG2A 1XVAA 3G85A 1EAMA 3GMIA 2REQA 1LDNA 2JARA 3A25A 4PHGA 4TMTA 3PZRA 4ESOA 5LQDA 4EA8A 1WXWA 4Q3AA 4QG3A 3TKLA 3N8GA 3ICEA 3T95A 1W0JA 1WABA 4I14A 3PL5A 3MSXA 5T8KC 3VPAA 2C83A 5F77A 3U7HB 1E9AA 2FPMA 3OJXA 3NWJA 4QPDA 5I8ZA 5HXAA 1RHMA 3J81A 1OLSB 4E46A 1OIXA 3GEHA 3I5UA 3KQYA 4E1VA 1A8PA 4QO7A 5BWNA 1ZS9A 3LY8A 2JGFA 4WESA 5ALQA 5JI2E 1QRSA 1OZAA 5COQA 2P9HA 4AXXA 3WTCA 2WYVA 3F8WA 1VL2A 4WTOA 3TW8A 3WWCA 3RYCA 2BCEA 3LX4A 3NUGA 1FYFA 3KYDB 3GARA 1T34A 2AC7A 2JFZA 1S02A 4HN9A 4QQRA 3NXKA 2E37A 2ZPAA 5BQOA 3CPHA 3KV1A 3EVBA 4IVPA 1ZKDA 1DAMA 2PX0A 4JITA 5JXIA 4J2TA 2JFOA 1VIYA 3VKUA 2B92A 2A84A 3KSUA 1SOUA 2ZETA 1U2RA 1JJBA 2A3NA 3D6VA 4BU1A 1IG3A 4YUWA 2FXIA 3H87A 1Q7TA 1JN0A 4XUCA 3DDNA 1Z7YA 2ZYIA 2ZAGA 1NP3A 1EGQA 2JIBA 4TXJA 3RC3A 5BWCA 4J0IA 5A71A 3H86A 3I30X 4GLBA 2OV1A 3JS5A 5TGZA 4ITUA 2HCJB 1WCXA 2HWXA 4FYWA 1FZTA 2GERA 1LLDA 5E2IA 3EZ2A 4C06A 4M9XA 3UMMA 3IE1A 4ZYZA 2CLIB 4BEJA 2ZYVX 4DLKA 4QBTA 5K45A 1JFVA 2VN8A 1RMTA 1EE9A 1SCUB 1TJ3A 3LUCA 3PYLA 3R9WA 2CMDA 3OFNA 4FBMA 5A04A 4Z54A 1OJLA 2NO4A 1AKMA 4XQEA 4D02A 5LQRA 1LK5A 4HDCA 4A7PA 4G67A 1DRWA 1TGYA 2YOGA 3LBAA 4YNBA 4KXLA 3W3AH 2WJVA 1TT5A 1KY3A 2A67A 3I6YA 3RSCA 3NIWA 1E2NA 2NAFA 3FN4A 4B0PA 2OM6A 4LRTB 2P8JA 4RH1A 3BXZA 2F3SA 4DJDC 1ES9A 1ZR2A 2VNJA 1Q0QA 1F6DA 3JQ8B 4JROA 4JP8A 4NY1A 1NQWA 4MINA 5CJJA 4LGYA 2XMDA 1I1HA 2WD7A 3VYSB 2B1QA 1YL5A 3KDAA 2R1UA 3HRKA 4REQA 3PJFA 4QSHA 5FUXA 4MIEA 4FOPA 3AVXA 1IC6A 5BO5A 2CZCA 3CUVA 1F38A 3CZAA 3VU0A 3PYXA 1FYXA 4MPDA 2XNDA 4RFLA 2DQKA 3AW9A 4MV4A 6NULA 1SC3A 2WYOA 4QYSA 1PJQA 1H23A 1T35A 2P77A 3OZBA 4GYKA 2YHBA 5JE8A 4DZTA 2XBMA 1OFGA 3DVQX 4RGVA 3CRZA 1ZQ9A 1A9PA 3WGOA 2WBLC 3R7AA 4BP9A 4W9NA 1WCV1 3WLOA 1A4UA 2OP0A 3H65A 4JQYA 2DFDA 4GE0A 3AGQA 1T0UA 1CD5A 3R0ZA 4RHEA 5TQJA 1L9XA 1TQ4A 2VAMA 2ECFA 4N40A 4RD4A 5FOWA 1EJ6A 5C53B 1VI6A 4MCIA 1W6RA 3M6UA 1I4DD 1HFJA 4OQXA 3MWDA 2MSKA 1SD1A 3L7DA 2IH4A 3MZ0A 3I01M 1DDIA 3MNFA 3MOGA 1QX4A 3I0MA 1OZGA 3RVMA 4U5XA 3VTKA 2YMQA 3AY0A 5CCXA 3OVMA 3FD8A 3M5CA 5EXTA 4P54A 4CMIA 2E6KA 4L0MA 5INTA 1IBKB 3H6KA 4MUKA 2QLNA 5KWJA 3V8EA 4BNDB 1GNSA 1GM5A 1R37A 4J0CA 2VQFB 1CUWA 1PJCA 5JS7A 1VG1A 4KAXA 2C5SA 4IIFA 3KLNA 1NG1A 2FCAA 3GGOA 4UMVA 3WNDA 1C9DB 4HLUA 3C16C 4RVCA 1GL7A 5HJ5A 1XQWA 1RW4A 3ZKWB 1QF7A 5F1PA 1WUKS 2ZW9A 5DSXA 4P3YA 3PC4A 3GAMA 1DDOA 1KA9H 1RXWA 1EHIA 4S05A 2F8TA 1NBOA 1AT1A 1FOEB 1NZDA 3G17A 3PFHA 2PG3A 3LPCA 2ZJBA 5DH9A 5J5CA 3FROA 1WHSA 3GW8A 3V8VA 3VKHA 1WMEA 3LPLA 4GH5A 4QDKA 4XD7A 4QVGA 4G26A 4HH1A 3LW7A 3RGWS 3RYHA 3AI3A 4WXEA 4XX0B 1E1LA 1JU9A 3ESCA 5T41A 1E2HA 2IUSA 3ESRA 4HYTA 3RFUA 1BJTA 1PLLA 1X1RA 3E1GA 1DKUA 1C4WA 2J5KA 4YAGA 5FPHA 3IIIA 1N0IA 2E9SA 2MINB 4IV5A 5D00A 3U4AA 4A0RA 3ISJA 5JC8A 1RYBA 1JFSA 3B1XA 3O73A 2WSMA 4EEKA 1UKVY 2PEZA 4HFRA 4DJTA 4TT3D 2VCYA 3SC3A 2UYOA 4LJAA 4CMJA 4IY1A 3L6UA 3OUUA 5FB3A 1W1IA 1Z0ZA 1KPGA 5EINA 1U2EA 3AR5A 4R0NA 1WY7A 3R20A 4LF4B 2C00A 4HPWA 3F5SA 2VTDA 1P2UA 2Z58A 4LZPA 4URZR 3UGJA 3KO8A 2VJLA 3R7WB 1RRMA 4I9GA 3T3IA 4Z4FA 4EIWA 2F3PA 2H5EA 4HG2A 1SUWA 2ATIA 2P5TB 3TOXA 3HXQA 4ICIA 2OGSA 4FPXA 2P9FA 2DKNA 4DGQA 2CB9A 1WV1A 3P96A 1UQRA 3WDLA 4PFQA 2V7TA 3P0EA 4X8OA 4LE2A 3AQ4A 2H17A 3IDSA 3AOEA 3AF5A 3EZNA 3JQAB 4J76A 4RZUA 3SDSA 4HEQA 1NE7A 1VHJA 1XFAA 5K4HA 5ARDA 3DOCA 1ZD3A 4PVDA 2C0PA 3PPVA 5FUVA 1SXJE 3QLJA 4DIKA 5KVSA 2WHYA 4XAQA 3TZBA 1G20E 3V7WA 1T5DX 1VL1A 5U4XA 4IMIB 1JEDA 3I01A 5EGSA 5HA5A 2W8ZA 3DLTA 3EZLA 2OXCA 3VI3B 1N2OA 2FZ4A 1Q16A 1XQVA 3DZ8A 5JAIA 4LHZA 1Y4SA 3H05A 2ZBEA 5AHXA 2XECA 2E5LB 1FFEA 1VE9A 2PKEA 1OH7A 3OZRA 1MOZA 5B7NA 1B93A 3ZQ6A 2L0XA 2GZAA 2OWDA 2WTXA 3L8YA 1M1XB 4JYCA 1XE3A 2EJCA 5HEKA 2BGIA 3E18A 3UWDA 1R27A 3C70A 2IRWA 5E7IA 5L4NA 3AY6A 4Q4HA 3MD9A 4BP1A 1H9CA 2J4CA 5CEJA 4EB8A 3NBXX 4ILEA 5G0SA 2P75A 3P5SA 5HMLA 2B36A 3I9NA 4BMZA 5C1DA 1XMIA 3ZVMA 1KIMA 2BMWA 1R8SA 2PDAA 4FNAA 5DM1A 2QTVA 3PPXA 1T3ZA 5FHQA 4CBVA 4G0OA 4DLBA 2P1DA 3VVBA 3TGPA 2C2KA 1RXVA 3W5BA 3CUEF 1LLCA 1X7ZB 3DTTA 1YZNA 5AVRA 1IUNA 3ESYA 3I42A 2CNWA 2O20A 1VKOA 3FZEA 3V48A 1F2UA 1U02A 2HV8A 2WWFA 3SHFA 4JK3A 5JQGB 2DAPA 4AJOA 1P5ZB 2J3QA 2VTKA 4YASA 3HP1A 3UK7A 4MHOA 2H59A 1K3FA 1O89A 1RAGA 2CGEA 2YXDA 1W5FA 3ANLA 4WGGA 4B44A 3F3YA 3PE3A 4Y6RA 1F8GA 1HM5A 4GLFA 3FVRA 4KN5A 2IXBA 1E96A 1ICIA 4JGIA 1P6QA 1UFOA 2B5WA 3EIWA 5C8YB 2BUAA 4QARA 5A02A 2OLKA 1FBNA 3TL2A 4B48A 1ZXXA 3TRIA 3I9MA 4UHKA 2J6IA 3ZCVA 1ZGZA 1SBIA 5DLDA 4NG5A 4XDYA 2NLOA 3HYRA 1J2UA 3K0FB 2ZBVA 2VSYA 4FOSA 3GROA 4M0UA 1MH9A 1VIMA 1H2BA 1BMQA 4HBZA 2E0IA 3JPYA 5EAIA 4CM1A 4WNIA 4MLDA 2DJIA 2ZQYA 1DLIA 3CV3A 2ZRNA 4EFKA 4O3MA 4AJJA 4C0HA 3AKZA 1FMLA 2BUBA 2PYZA 2DETA 1HF3A 5D8DA 1T29A 3TNJA 1YB4A 2BGNA 4Z4GA 1Z0KA 3JSXA 1Z6GA 4MWSA 3W5VA 3AL3A 1H9AA 3PEFA 4U9HS 2PMDA 3LCRA 2EC5A 3E9MA 3UJAA 3TB6A 1PGPA 1U8AA 1Z08A 1Q1BA 3D43A 2ZE8A 1P8JA 3GNTA 1X1BA 3LGXA 4MB0A 2NXWA 5CX1B 5ALLA 3UHFA 4CM4A 1ZKMA 4GSLA 3V1UA 3N8DA 2IJGX 2X8WA 4KIFA 2WT9A 4IO1A 2IE8A 1BVRA 1UBFA 3UQYS 3I45A 1ZD1A 2GRAA 2WYUA 3G59A 4C2TA 2PXAA 2O1EA 2BMAA 3PB3A 2PBRA 4FDAA 3EUFA 4U02A 4KFRA 5DRYA 1DC8A 3T5DA 4BMVA 5K8LA 4CNBA 4W8OA 4M55A 5I4BA 5G40A 1DRJA 2N42A 3CISA 3M9LA 4Q21A 2FXVA 1SU7A 1C8VB 2CXTA 4RTNA 3DMHA 4BNTA 5ITWA 2IS2A 3DKKA 5KIAA 1W5TA 2JBWA 2W2QA 1K0UA 1E2QA 1N9KA 1U7PA 1VCHA 2O8NA 3I8OA 3LZCA 4NZZA 4PINA 4Y9DA 1JDSA 1Q57A 1RE0A 1KJYA 1QHFA 1RYNA 3BWXA 1VLMA 3NTUA 1HLGA 1MN6A 1RU3A 5GADl 3TR5A 2WILA 4D8WA 1F2DA 3R8XA 1G2OA 5HFNA 1W35A 4MAAA 2H1HA 3HI6A 4TWZA 5JZ9A 4MRAA 2XMSA 1YJBA 4EPTA 3QUSA 3SDZA 1AGRA 5AVZA 3ZNOA 3IIEA 1OYWA 4FFOA 1JHVA 4Z5XA 4U0JA 4OYRA 2F55A 1LF5A 1E1NA 4G8CA 4EI2A 1B4DA 3SX0A 1NXOA 3D9QX 5AK3A 1P2TA 4F45A 2X77A 5DT9A 4KWIA 3HV0A 1Z2EA 2OKGA 4HAYA 3U7RA 5BWMA 2DR0A 1QS0B 1U2GC 2NN3C 4V0NA 4HSEA 3OUZA 4JA0A 2C5HA 4EOGA 2WWXA 3ODGA 1WSBA 1XVTA 3BJRA 4PHTA 3BWCA 4Y6LA 1YV9A 3WSTA 1NVAA 3BE5A 3MRSA 1GG8A 2ZU0C 4JOSA 4WJLA 4R1TA 4NYMR 2HSZA 4WJKB 2OPHA 3DBHA 3F8TA 1NBME 6LDHA 4WPGA 1YULA 1X7WA 5AKHA 1SELA 4QUHA 1IXYA 2A5YB 3AUYA 4QTZA 3A4LA 4HFJA 1MIOA 3BJMA 2X9GA 3R0VA 4KI0A 2Q2WA 3PHLA 3WZMA 3NOOA 4MGIR 1WB5A 3O7WA 4YO7A 2D7JA 5AW4A 3FF1A 2G63A 4I4TF 5CW1A 5IT5A 4KN9S 5HS6A 4OCZA 1RD4A 3AVUA 1CQZA 1SD5A 2C92A 3CX4A 3EQ8A 3C15C 4LJLA 1BSVA 2P4HX 4RV9A 4WGFA 3WO0A 3ZE9A 2D1YA 1Q0TA 1OPRA 2GKOA 4Z7NB 1SOAA 1KE2A 3FCUB 1RM5A 3IAS1 5KJEA 2VSNA 3Q40A 5AVTA 4REOA 2EKDA 3LHKA