3J80A

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
SLPSTFDLTSEDAQLLLAARVHLGAKNVQVHQEPYVYKARPDGVNVINVGKTWEKIVLAARIIAAIPNPEDVVAISSRTYGQRAVLKYAAHTGATPIAGRFTPGSFTNYITRSFKEPRLVIVTDPRSDAQAIKESSYVNIPVIALTDLDSPSEYVDVAIPCNNRGKHSIGLIWYLLAREVLRLRGALPDRTQPWAIMPDLYFYRNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00318 Ribosomal_S2 Ribosomal protein S2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 3j80A01
3M5PA 3TBFA 3KNZA 1B0ZA 3LJKA 3QKIA 3FJ1A 4X65B 1C7RA 2CB0A 2DECA 1TK9A 1VI6A 2YVAA 1IRIA 4NXNB 1DQRA 1WIWA 1HNZB 2UXBB 3IFSA 4M0DA 1VIVA 1JEOA 1IATA 4X62B 2UXDB 1M3SA 2AMLA 4S1WA 4DV4B 1IBKB 2CVPA 2WU8A 4JV5B 1GZVA 1NRIA 4X66B 2UXCB 1JLHA 4LZJA 4JI1B 5A2QA 3HBAA 4B3TB 1T10A 2E5FA 1TZBA 4DR6B 5BY2A 1JXAA 2VQEB 3FXAA 4LFCB 1MOSA 3HJBA 1X9IA 3T1HB 4LF8B 3JX9A 4X64B 4KHPB 1C7QA 4YHHB 4DV6B 4LFBB 3ETNA 1HOXA 4TOIA 2CXOA 2CXUA 3C3JA 2CXSA 4S12A 3UJHA 4YY3B 4JI8B 3J7AC 4LF9B 4JI5B 2UUCB 4JI6B 4LF4B 3PR3A 2E5LB 5LL6P 4AMVA 3JAMA 1XTBA 4DV0B 4DR5B 2POCA 2PGIA 3ODPA 3Q88A 1HR0B 4NXMB 1KOJA 4B3MB 5LMNB 4LF5B 2ZJ3A 2UUBB 2I2WA 1N33B 3EUAA 2I22A 3OTOB 3BCHA 4DR3B 1NUHA 2V4MA 2VQFB 2Q8NA 2X3YA 3TRJA 4B3RB 2J6HA 4K0KB 4DV7B 1N34B 1TZCA 4JI7B 1U0GA 3OOJA 1J5EB 3SHOA 1XMOB 2PUWA 4DUZB 4DV3B 4LF6B 5FLXA 1N8TA 1G98A 4JYAB 1X94A 2PUVA 2ZM6B 1HNWB 2CXNA 5BR8B 2A3NA 3J81A 1X92A 4OX9B 1IBMB 4GKJB 2O2CA 2HHHB 4JI3B 5IWAB 2VF4X 1ZZGA 4DV2B 1VI5A 3FKJA 2VF5X 1U0FA 1J5XA 1GZDA 2CXRA 4JI4B 1XNQB 5I01A 1JIQA 4JI2B 2CXQA 1HNXB 4GKKB 3T1YB 5LMUB 3BJZA 1X9HA 1XNRB 3NBUA 4DR2B 4JI0B 2DF8A 3Q7IA 2CXPA 3G68A 1VIMA 4DR4B 4LFAB 1IBLB 1N32B 1MOQA 2F4VB 4B3SB 2PUTA 1HM5A 4LF7B 4DR7B 2UUAB 2O2DA 2CXTA 1FJGB 1I94B 3FF1A 4U6NA 4DV1B 3I0ZA 4AQYB 2UU9B 2XBLA 1MORA 1U0EA 4IVNA 1XMQB 4DUYB 3J80A 1Q50A 4EM6A 5IT9A 2XHZA 4DR1B 1N36B 2ZJ4A 4DV5B 3CVJA
chains in the Genus database with same CATH superfamily
2R00A 3P0EA 4N82A 4YBZA 2FRDC 4CM8A 2ECFA 5ICSA 2VPYA 1Z7WA 3AR9A 1II8B 2AHOA 4EJ0A 4KPFC 3OO0A 4POAA 4KIUA 5JXHA 2RHOA 2P27A 2Q2NA 4C06A 5D8DA 3UCFA 4KKVA 4D0GA 1J56A 1NUAA 2P2LA 3LBHA 1YO6A 3MGCA 1FYDA 1BX1A 2CLKB 3EGXA 3V4PB 3WKAA 1JEOA 1D8AA 4II7A 1ADYA 2GBGA 2Q4TA 3CX4A 4QU9A 2VPWA 4QREA 3Q8MA 1ZI9A 1PYDA 4DCGA 4IZOA 2ASVA 3UH1A 4LBVA 3A2LA 5JC8A 3I92A 1E7YA 3U9LA 2ENWA 1XXHB 3MCWA 4LJ7A 5KTPA 1TM4E 1IU9A 1R18A 3GLHA 4JP5A 1BQ4A 2BFBA 4IDQA 1S4MA 1T25A 3P94A 5LLDA 3NHBA 1HNNA 5H59A 5P21A 4BZXA 3REOA 3TQQA 3ZE7A 4YO8A 4B3BA 3K32A 4PZYA 4GGMX 3UK7A 5HQ3B 3KPWA 3TFQA 1H66A 3OE7D 4YP0A 3HJBA 4EFNA 3FYDA 3BIFA 4J1NA 4EKGA 4ESOA 5KQGA 5HFJA 2A14A 4D8XA 4HDQB 4HRVA 3WKEA 5DX1A 2R5FA 5LQDA 4IV0A 3SD7A 2C78A 3TTYA 3VR0A 2FW9A 5L7WA 1P4JA 3ZD6A 1E79A 1F0PA 4OKNA 3AONB 4KQJA 4LJAA 5FBVB 4G0UA 4B40A 4FJ2A 4FOOA 3I9KA 3M3HA 1YZKA 1WW3A 5I9TA 1EXMA 2D54A 3ND9A 3RANA 1C8KA 2Y71A 4HY3A 5DMXA 4CQMD 4BNLA 1XPRA 1GFIA 3I9OA 2EVWX 1KERA 3USZA 1VDMA 2ST1A 3OPNA 2NOAA 3EIOA 1ULZA 1M6VB 2BKVA 3D7KA 4PSUA 5IAKA 5JISA 5KOHA 1V11A 3LHFA 4B3RB 1RYEA 3HG7A 4Q4DA 5HE8A 1H6CA 2DHRA 3N86A 2PH5A 4EJ2A 1DCMA 1GCIA 4BLOA 1XRMA 3E1SA 2BFCB 1UBJS 2GF9A 5HIMA 2CFIA 3ZWQA 4CN8A 3UHOA 4K2HA 4KYTA 1NXTA 2F1KA 3HUEA 1ZRNA 4HAZA 4KBYA 3RHFA 4RDXA 2HA2A 1LJUA 3EMKA 3UT0A 1HRDA 3IAS6 3NEYA 1FFBA 3T8YA 2DLNA 1U1FA 3WKDA 4FZVA 1GQYA 2DUJA 1IN1A 4DXDA 1MPXA 4HPJB 1Q19A 1EMDA 3HLKA 5CT4A 2QX9A 1WVMA 2OFXA 2HL6A 2PWZA 1ZG3A 2GZMA 1AV6A 3D7RA 3KTOA 4WIAA 4DIOA 4REOA 1YDHA 4DA0A 1H6BA 1QHFA 4LC1A 5CDFA 3JATB 3TDMA 3UWPA 4TZTA 2HF2A 4JYMA 1TK3A 1UMBB 2C04A 2HA7A 4U3JA 4NSNA 4OQDA 4YUAA 2CEKA 2XY4A 3WXBA 1E3TA 4WFIA 1CRQA 5JMWA 4QQKA 1YJBA 5T64A 3FIJA 1OV4A 4UAJA 1QG4A 3SJCA 4R6XA 3KJIA 3K70D 4JUFA 4MCHA 1ESDA 5D84A 3NAQA 4E1AA 3WYAA 2JRLA 2YRFA 2ZB3A 1WU8A 1BDMA 1Z39A 2GXAA 1DO0A 4BMNA 2IT1A 3G5AA 1H2EA 3MT7A 3KJQA 1GGKA 2GK3A 3PNMA 1WDKA 3ZCRA 3H5AA 4DLSA 2OM2A 3HB4X 2FXIA 3BC1A 4JYBA 4NMLA 5GGXA 3UMCA 1RC8A 3VDXA 4EENA 4NV3A 3BYZA 1MX5A 2WNIA 3RBAA 4RJJA 1WCWA 3AVPA 1BJTA 1IB6A 1OXXK 4IX1A 4Z9XA 1NTOA 2CE7A 1UFVA 2VTBB 1UJBA 1M8JA 2OPBA 1BWPA 3HM2A 4NDNE 1H9BA 3MC1A 1AGNA 1X7XB 3EC1A 3R6LA 2CFOA 3LY7A 3R7BA 4GC9A 3TIVA 2CVOA 2HQBA 4ZYWA 3SXUB 2D7CA 1O08A 4QOGA 3QUTA 1KKMA 3OOEA 2NU9A 3D8RA 2BFEA 3IUMA 3N8GA 4HTFB 4KQXA 2PVSA 4OHVA 4PLCA 4QPZA 1Q0QA 2FW0A 5FBWB 2XCQA 3GFPA 3NOVA 3GGDA 1UJNA 1XTZA 1M7GA 3CURA 4B4VA 3ZQUA 1D2MA 3JASB 5TXGA 4B5KA 1Z38A 4BAGA 1E77A 2E6UX 1PYOA 2O7QA 2J5BA 1FXWA 2Q49A 2Q27A 2VG8A 3EVEA 1N8NA 2Q8QA 4PLGA 1YIDA 2A7XA 4IGAA 5JAQA 4EB0A 5C5CA 5IH7A 4KQ6A 3GZNB 1OROA 3BK7A 5JJLA 3SBEA 5KYGA 4AYTA 4FDUA 1E2GA 1QCCA 1NF9A 3SMVA 3RF7A 3JQ8A 5E2BA 3SR0A 5CLLA 4RORA 4LHVA 4HGQA 3AVVA 4IS2A 3ECCA 5ESXA 1KPIA 2SKDA 2P4EA 5DRYA 3SOZA 3WQSB 4GNRA 5HOQA 3HP7A 1KRWA 1M75A 4LF5B 1YI8A 3EFHA 4DBLE 4DKXA 5AVTA 5JY1A 1T2NA 4G0YA 4MA0A 1WXXA 3KD3A 4JMPA 4RV9A 3EDRA 4PRLA 4QUAA 4Z1MA 4DR3B 1UDXA 2B4KA 3H2JA 2WM8A 4FEAA 3QE3A 4LQDA 3DA8A 3IBYA 5FF9A 1E0KA 1I2ZA 4GYYA 2QORA 4PFQA 1DAKA 1RRPA 2ECKA 3OOJA 4G65A 3ZJ4A 1T35A 4GOJA 4CIDA 3K9GA 4ZU3A 2IX3A 2RHTA 4O5AA 4GYWA 2ZRKA 4ZVRA 4AF8A 4PGFA 4MKZA 4R1UA 3U3OA 5CB0A 4CM1A 1RPZA 3UUWA 4IRUB 3SYTA 2PKCA 4KAXA 1XK7A 1SH7A 1I9GA 3EXEA 4Q1FA 2CNKA 3HVRA 2ZVQX 4O2AB 1UEXC 3ZWXA 5H02A 2JIQA 3KQQA 721PA 5PNTA 2VQ3A 3R40A 5J2TA 1WUIS 4JELA 2JLBA 2HHAA 3BE5A 3PT5A 5C8VA 1JR3E 2A1TS 3BHJA 4FFLA 1RC1A 3ECAA 1G21E 4HD8A 1NRJB 1GL6A 3OC0A 1GYRA 2NUBA 3WNQA 4MVCA 4WERA 1UPUA 2OORA 4U63A 4DEXA 3AILA 3N75A 3LD9A 5JDIC 4C0QC 1PKXA 1PJBA 2R4QA 3TLGA 1JSXA 1NMYA 2FQQA 3KJGA 4ZARA 4QWWA 3WLEA 3MVEA 4M2LA 4IIJF 4QVKA 3PLAE 1K8YB 2O3UA 4D8TA 1WUYA 3FDZA 1TIBA 1Z8HA 2MR5A 3ESDA 1DBWA 3CH6A 3KTDA 3JZIA 4TN5A 5FPSA 3RK0A 3RS8A 4U2EA 1BFUA 4I0WB 5D6NA 3RUFA 3ZH9B 5JS6A 1SG0A 3K6SB 1B15A 4ZV7A 5AUNB 1XEWX 3G89A 4G5QA 1R8QA 1ANKA 3IQXA 3I5UA 1N5IA 3RSGA 4DHWA 3EY9A 2YFQA 1Z88A 3OMXA 3BWYA 3QPDA 3IMEA 4JEMA 4N7JA 4OBEA 2X77A 4WEQA 5AI4A 3W2GA 5B7QA 4CEIA 2JH3A 4YT4A 1MAWA 2G9ZA 1E94E 2Y76A 1WKCA 4OQPA 4B87A 2XVYA 2A78A 4D4MA 1E1YA 2XB9A 3GRPA 2PZGA 4MIEA 3IVRA 1R0RE 3TR0A 4CDNA 1D2AA 1UDRA 3INGA 3ISVA 1EXWA 3L1VA 1TFRA 4G0OA 1GDTA 3K96A 4YRQA 4Z0PA 3UK1A 5JW6A 4ERXA 2L19A 3ZLUA 3AT1A 3FAKA 4X1OA 4HNRA 4NHOA 4GPIB 3RIXA 2ODEA 4JKIA 2IV3A 2CSXA 2V7TA 3NYIA 1NW4A 1KR2A 3NBMA 2QAGC 4WCFB 4MWEA 2P6PA 2LVBA 1YIOA 3O1HB 4X6LA 4EA6A 4WLUA 1YMVA 1JR6A 5LWQA 4M38A 2ID4A 3VKGA 2E0IA 2D74A 1L5HB 3LPLA 1MB4A 4XGKA 1CY2A 2FJUA 1T2EA 1EZ4A 4F72A 1OTXA 3JQ7A 3WNZA 5DV9A 1Z5NA 2R66A 3OMLA 5EZYB 4B71A 1J2YA 4XVUA 2JB9A 4HATA 1C1DB 2UUCB 4HDKA 2GMWA 4TRJA 1GZ4A 3OU7A 3WGYA 4F46A 1R0BA 2ZBEA 5ANRB 1QWOA 1SCBA 2IOQA 2SECE 2V5AA 3HB7A 4MR7A 5GONA 1ZD9A 2NYRA 5GIOE 4BX0A 2EDCA 3B36A 4PBRA 3IMFA 1SUBA 1LLDA 5KCZA 2WF6A 4B31A 3BHNA 1RWWA 2O7NA 4IV8A 1J00A 3KPVA 2LGJA 5EAIA 4RSHA 2PPVA 2WOOA 2XMGA 2HMYB 2DGDA 2QAGA 2ZR9A 3KOWA 3BE6A 4LIPD 2FZWA 5DNWA 4BIIA 2CSUA 2ZTMA 2I6SA 4XRGA 4A2QA 3I0MA 4DLTA 4UVDA 5FTNA 5E8JA 3FPHA 1IY8A 2HPAA 4PG4A 1QX4A 4PR3A 4JKYA 3RNOA 4R41A 3DP9A 4EDHA 3DMPA 3BFPA 6REQA 2XMSA 4YR9A 1XAGA 2XEXA 4KVGA 5B1YA 1NQWA 3I2YX 5JS7A 1ZIYA 2W2VA 5L7YA 4KWEA 5BMVF 5DO9A 3CVYA 3M8KA 1V96A 1HNXB 3FTDA 4ZQFA 2REOA 4D6YA 5DCYA 1IM8A 2FUG6 3GZNA 3KOYA 3V32A 3WXMA 4AY3A 2MINB 1TJYA 4IEIA 4Q1EA 1D6SA 1JR3D 3LOUA 4HQNA 4KXQA 3UM9A 3ID6C 4F6RA 2VEOA 2H5EA 4G5OA 2GEDA 2RHMA 1ZITA 4Z4HA 2JBAA 1APBA 3IALA 3HXOA 4L75A 2UDPA 4B85A 1XRPA 2GHQA 2QN9A 4ND7A 4BO5A 4UTPA 3OT1B 1EWVA 4OJQA 4N0DA 4PSDA 4EKDA 5BSKA 1E9CA 3KB8A 4RM2A 5AW4A 3IVXA 5BV2P 2DHDA 1G291 1U2DA 1WO8A 5G1OA 2HJRA 3CKKA 2YYZA 3FDFA 3I9V1 4M36A 5CYFA 3GQVA 3BX1A 3N3AC 3DVAA 3JYNA 1OFIA 4B3GA 3M4ZA 3B8EA 3GPBA 4YJGA 3ZGZA 4YI3A 2AMJA 3GN2A 3ZCUA 3EVAA 5B57C 3NPAA 2YOFA 1BMTA 4DILA 1ZJYA 2LRHA 2ZRGA 4BBPA 4FC7A 3AO0B 1M0WA 2GR9A 4R7ZA 3N2KB 2BMWA 2Y68A 3C8DA 2ZUSA 3FCEA 3O73A 1Y0BA 4Z99A 2B0JA 3BRSA 4FI3C 2WOJA 5EXTA 3KZOA 3HCPA 2OD2A 1ILWA 4M7OA 5FULA 3LTEA 1OC2A 1QBKC 3R1IA 2QB5A 3IP7A 4HSEA 3VR4D 3WBJA 4Z9YA 4F1JA 1SC4A 1TYAE 5H16A 5F52A 4F7DA 1VBFA 1SELA 4M9ZA 1OWLA 1WOYA 3OZUA 4XYMA 3PXDA 4Z4GA 4WX2B 1XEWY 3HVIA 5AK4A 1EK0A 4K2AA 4YRDA 3MMNA 1CVRA 1DRVA 3OZXA 1ZNZA 1E3LA 5HDBB 4BGVA 4BE4A 3QNWA 1C3XA 5AESA 3S2IA 4BIMA 1K0UA 2DTEA 4WA7A 4WOCA 1IMOA 3GT4A 5LC1A 5BN5A 3UTDA 1RCUA 2DG2A 1TAUA 4HCJA 2KE5A 2ZJ1A 3HJGA 3WGUA 1QB7A 3FLAA 1SZDA 3GLHE 2IP2A 2ZJ3A 4ZO8A 1ZD8A 2CHEA 3BJRA 4ER5A 2V4MA 1L7EA 1E2UA 1IC6A 1N0VC 5CJJA 3ADOA 3FBGA 4KR3A 1TTPB 4MW9A 1KI9A 1G3UA 3V48A 5ITVA 2I4NA 4DV7B 4ON9A 1TZCA 4IICA 1WMEA 4NEGA 1KO5A 2FEOA 1WOMA 3OSUA 1PBNA 2CNBA 3RKUA 3BORA 1ZJJA 1VP9A 4FXPA 5ER6A 1YS6A 2AJCA 4L3WA 4CIBA 4JSTA 1MU0A 3IP8A 4AWBA 4YMWA 3DE4X 2ZRDA 3H5NA 2VF4X 1WS6A 4MS4A 3QI2A 5ESDA 4AJIA 4Q7JB 1ESNA 1RI4A 3HWX1 1KJJA 3Q6NA 4LVOA 3WNVA 4BPBA 3NBAA 2PQ6A 3OCCA 1TU0A 4KN9S 4OXNA 3ZDBA 5LYYA 2XWJI 1J9EA 1RFGE 2WR8A 3LHIA 2KM1A 3FCSB 4MQUA 4ER7A 5BN3A 4A1OA 3G7NA 3KP1A 2ASEA 4WJKB 2AR9A 3E5RA 1TIKA 3OQBA 2VS1A 4H1UA 1UR5A 4HNAB 1LDMA 1TMGE 5JYBA 2ON6A 2REBA 3F90A 2LWIA 1OGJA 4DBZA 5K8TA 1ZMOA 4TL7A 2IP4A 2QE6A 3X44A 3ZCQA 4DMUB 4G0NA 3HVJA 3R7WB 2OENG 4GM1A 2HJHA 4OYRA 1UZUA 4XB6B 4YT5A 4YS6A 2WTBA 3RHSA 1MA3A 1SBIA 3AW9A 1T9HA 1XTUA 2IDKA 4HVAA 1HETA 3FCUB 2W00A 2PRKA 2OQVA 3KSAC 7MDHA 1TMKA 1E62A 3LZDA 3LLUA 3L7DA 2H85A 2CNWD 1TIPA 2AOXA 3FHOA 2GM9A 2YNMA 4RELA 2WWXA 3D6JA 1XU4A 1NUTA 2DUNA 4YB8A 4H6VA 4BTEA 2OILA 5FTKA 5ULLA 3HO8A 4P8RA 2OZPA 1IIRA 3A6EA 2D13A 3EGVA 4INPA 4J07A 2GYYA 4L2IA 1D7OA 2HXGA 4O59O 2OPHA 3QU5A 2JLWA 1VQ1A 3N2IA 2YBEA 5KJEA 1O94C 4FYKA 5CT9A 4KGZA 4KPEC 1CHDA 1RKUA 2NVOA 3WQRA 1E5VA 3U4QA 1I5RA 2FPKA 2LCFA 2V9PA 3H05A 4KV7A 4N9WA 1D0IA 3NUQA 3OTWA 1H9AA 3GFRA 4S3MA 1L4YA 1TZBA 4F93B 4ARCA 2FZEA 4FD2A 2D0DA 4N4AA 3HSSA 3FJOA 6ABPA 5F33A 2L17A 5GAJA 2ISQA 1XWWA 1E3SA 4LGYA 3DTVA 4BMSA 5FBLB 4NLLA 1P4GA 4AX8A 3GGGA 1D09A 2YMMA 1V41E 4RFSA 4WCDA 4V1CB 5LMZA 1XVUA 1SVIA 2Q9CA 5BMVA 3ME5A 4Z9FA 3JD2A 4Z0NA 1KBZA 3T5DA 4BKQA 1PGPA 5LXTA 4CKYA 2ZI6A 4FKBA 4DV0B 2Z98A 1KJ9A 4QPJC 1VMIA 1CZOA 2FQYA 4GI7A 4KE7A 3IAM1 2XQJA 1MT3A 1KHTA 2F90A 3DVQX 5CK4A 3SYRA 4F9EA 3OTOB 2HLNA 3SIWA 3FNFA 1V7PC 2J8ZA 2Q46A 2RGGA 2F8LA 1F0KA 5H7XA 4QT0A 2COEA 4UDXX 1UZMA 3LNCA 3PL1A 4RM3A 4Y2RA 2NP7A 1R4MB 1K7CA 3U49A 3IQIX 1BXGB 4IZ6A 1K97A 3LC0A 4UOZA 1JQBA 3RSZA 4H18A 3L7MA 3SVLA 1WKVA 2JJYA 2OHXA 2W6JD 3WNBA 4LVCA 4GL4A 3GJTA 1R4NB 2P4QA 1OW3B 3LLSA 5CYOA 4N01A 3VU9A 2KB0A 2XNKA 2YVLA 3FOFC 1OX5A 1BE8A 3RG2A 1PYGA 1U9CA 1XQVA 2Z83A 1KNXA 4IDCA 4A8JB 1M6HA 2ZVDA 4BVJA 1RLIA 2OFWA 4I4TF 3R3ZA 4B83A 5BR4A 2N42A 3ZVRA 3QW2A 2ZPUA 3RT1A 3FHCB 3GFFA 4KMSA 1G5IA 3E82A 2IHVA 2JFOA 3KM0A 3OBBA 4MQ5A 5HQ3A 1U81A 2DFLA 4NNJA 2OHFA 1H6DA 3MWKA 2QJTA 4GBGA 4YRFA 2VXOA 3UYLA 1RWQA 2WP8J 1L8OA 4UBLA 3VOAA 4DCTA 3ONVA 5LD2C 3KQVA 3EPLA 3URMA 3T9BA 4YAUA 4HRYA 1PCXA 4PAOA 1AV7A 4JYZA 2R11A 5HCNA 2LUOA 5BXQC 4WASA 1SURA 2CVQA 3PYLA 4XVHA 4TKLA 5KWSA 1VSTA 3BILA 5IHPA 5JNVA 3AKDA 4INAA 4TLBA 1GPUA 3KPUA 5EHNA 4XPIB 1CZLA 1KARA 3CF2A 4L7QA 3TX6A 4A23A 3DPIA 1OZFA 4HH0A 4CQJA 1X2EA 1DHRA 3PB3A 4WXYB 4YREA 3LGSA 2FGJA 3R3XA 3K9WA 4A8TA 2ZSUA 3QVGA 1GNVA 4EB3A 3ZIAD 1KWGA 5KNLA 3U0BA 1YBAA 3RYFA 2IXBA 3SY8A 3AM4A 2OWDA 1I30A 2BPOA 3H3FA 1NQUA 1H1LA 2X5XA 4UDYX 2IEIA 1FP2A 3RRBA 5E8RA 3SJUA 3VVBA 4AN1A 5A5DA 2MOKA 4CLOA 1NPYA 1U63A 3IBTA 5T67A 1EFLA 1QANA 2HFJA 1YB2A 1FUYB 3BXEA 3FPGA 5K7SA 3PYXA 4MRMB 4POOA 4RZSA 5IJ9B 3Q3IA 4OKSA 4LNAA 5T4HA 3P0HA 3DW3X 4J0DA 1H0HA 1GG8A 3QUBA 1X1QA 2IW3A 3VHXA 2QTVB 3P2OA 4D74A 2FSVA 3Q8KA 3LH5A 1V5EA 4HTAA 2QOEA 4XEUA 2Q4OA 2R1ZA 3GXBA 3SDZA 2OY0A 5CGZA 4AJKA 3NO4A 2ZIUB 2IU0A 3IXLA 3T7IA 1CUUA 1WPGA 5F4ZA 3WX0A 2PAFA 2QD3A 3SLRA 1RRGA 3E7WA 1JH9A 3IUPA 1VCIA 4QBFA 5TE9A 4B75A 4TMFA 2IZ6A 4AX4A 3GMSA 4YY3B 2I1WA 2N3ZA 3MTQA 4MS3A 2X8BA 1FNNA 4I1PA 2H08A 5CTAA 4HC4A 3TZCA 4DV6B 1UM9B 2VJDA 1W49A 3O8OB 2AZDA 1VRVA 2F1JA 1UPFA 1OVGA 4M8IA 4Q7KA 5ERXA 3X43A 1Q95A 3FI0A 4G89A 1IVSA 4MITA 3VPFA 2ZI3A 1Y8CA 1GPAA 1Y6RA 2D8AA 3NHWA 4HAXA 4MWCA 5EJ9A 3CSDA 3VC7A 4UMVA 5ICCA 1YA4A 4BY9E 3WRXA 4BLUA 3MB5A 2IUEA 1WQ3A 3W05A 1XEFA 4EB6B 1E3DA 1QS0B 1V48A 2FW1A 3DDHA 1YA8A 4JR1A 4DV3B 1UJCA 4RK4A 1KQNA 2WWVD 2HZ7A 1GTG1 2NTYC 4UHFA 2ZYDA 2WJZB 4M1MA 2EX0A 2QPOA 3E0QA 4DA4A 4S1VA 1PWEA 5DWDA 2B1RA 3TWOA 3G5UA 2FPXA 2LTAA 4L02A 3M89A 1WA5A 1YFZA 2B8TA 3A4IA 2R47A 3R75A 2YYYA 1VJ5A 2M1XA 3T3DA 2VN8A 4UNPA 4JDPA 3RYTC 5L40A 1FNMA 4K03A 1XF1A 3TSWA 4EEKA 1I1OA 1NBMA 1U3WA 1C8LA 2GZSA 1WXDA 2IJGX 3EZFA 4R68A 5ES3A 5BT9A 3U2QA 4DAOA 4DNXA 3M1LA 2RBKA 2XE8A 3BZBA 3ELUA 5GMOA 4MVJI 1L1FA 5JMOA 4GWLA 3EQZA 3K1ZA 1UK7A 3N7TA 2XUAA 5KOJB 1NNUA 1FU4A 1WDLA 4BJ6A 5TQVA 4MQ6A 4Y2SA 1YRQA 1Z0AA 4EG6A 4S04A 2X8AA 3EGDB 1G8GA 2QQGA 3B6EA 4JWKA 4MB2A 5TRTA 3GJQA 5K05A 3R7AA 4BGUA 4KR7A 2J48A 3AM3A 4QNNA 4MWBA 4TGLA 5DVZA 2RGNA 2WU1A 3H17A 2EV9A 5E4FA 1Z4MA 4DCNA 1DC4A 5LR6A 4B3IA 2PNFA 4D0SA 1J7JA 1QBGA 1EA5A 3VSDA 4YAWA 4MS1A 2HIGA 4NYJR 2C7PA 1XC7A 2JVJA 3I5XA 5SYMA 3OU2A 4F91B 2GCGA 2ZWMA 5TMDA 1NQAO 4D3ZA 4EG7A 1KAEA 3AR7A 1B0ZA 1KEPA 1E8NA 1Q21A 5K2OA 4JUAA 2OV6A 1PGNA 4ZDJA 3SC2A 1FNDA 1O0SA 5HS6A 4BFWA 2XD9A 4IY1A 5F1KA 1XHEA 2AJ8A 5ALKA 3G17A 5IP5A 2EFCB 4MWZA 4YRAA 5DLEA 4Z7NB 3DO8A 4YMLA 3LL4A 3B3QA 4DLNA 1RHUA 3OZVA 3AP2A 4ZI3A 2OCKA 1XD8A 4UBJA 3ROXA 4D80A 1PJCA 1ST2A 2Q5IA 3KKMA 5CMLA 1AVTA 3JQ7B 1N2SA 1D03A 2JFQA 2VHCA 5E9QA 5KOJA 4KWTA 2BBWA 5AVJA 3SHTA 1DVRA 4XQGA 4QXOA 3EFEA 4HXEB 1CQPA 2AI3A 3AJ9A 4QTXA 2D2XA 5CLJA 1XCJA 5JZMA 1WQ4A 5CUQA 4C6SA 2O8FB 2EFDB 3SQOA 3OOSA 5C31A 5CDTA 1SY7A 3T5TA 1WB5A 3P20A 1S4QA 3KO8A 4MKFA 5D87A 2MSDB 4KYVA 4L5AA 3F2IA 2UYOA 3MF4A 3PHLA 4BQFA 2E3JA 4G4SP 2A2ZA 4KW7A 3MS4A 2Q0SA 4P0QB 4F6CA 2GA8A 1GILA 1IAVA 2FCAA 2VSOA 3A9TA 3BGIA 3DBIA 4NONA 2HB6A 2GNOA 2IVFA 2QMYA 3Q2IA 2CVHA 4DZZA 1TEHA 3CZ9A 1FLAA 5EE0A 5I7VA 3V8BA 1N1MA 1K63A 1CIJA 4Y0AA 3RBZA 4E51A 4EX6A 2QTAA 3KQTA 3RJMA 2UUBB 2X0NA 1PWZA 4PSVA 4FN5A 4QJBA 5C0OE 3X1XA 2CNWA 2GN6A 1COWA 1V8ZA 4LN1A 2I6UA 3RYIA 5EKXA 4DLRA 3JWGA 5MF6A 3HA5A 1GY8A 1SQ5A 1V37A 3GJ6A 3LY8A 3K09A 3PEEA 2V8BA 3PXXA 3S1AA 1GAXA 2YY7A 2XUHA 4TZ6A 1MEEA 1DUSA 1Z5OA 1ULUA 2IY9A 3E48A 1W8IA 2CY0A 5HE9A 5I9SA 2OAEA 1ILEA 3KE8A 1FP1D 3NAGA 3NJ8A 2CFTA 1QGZA 1R16A 1HNWB 5EE5B 1QC5B 1IPHA 1R8XA 4BLWA 2RGWA 2QRVA 3H2HA 3FWPA 3L0PA 2J0QA 2FXVA 2C2KA 3U61B 4J1TC 5MGBA 3KCQA 2YWRA 3LVRE 3AVXA 3L6EA 1NXQA 3O47A 2B4YA 4ZO9A 5SICE 1KDVA 1KOLA 4MIKA 3COVA 2FN7A 1HGXA 1NJ5A 5IS2A 2WFLA 1NW5A 3C5VA 1A96A 2QEQA 4ILEA 5JY6A 5BN5B 3QPBA 2OLEA 3GI1A 4A2PA 2GEKA 3V80A 3K7EA 1CUXA 1W5EA 3N2YA 1IOWA 4M1EA 5T3UA 5JSFA 1ZVVA 4L72A 1W6UA 1TXGA 1AF7A 3OM1A 1EWYA 3R6WA 3CUWA 3OFVA 5A7HA 2ZJ0A 3AF1A 2NZUG 5BV8A 1FRNA 1QHSA 4MUBA 5AJYA 4DL9A 3K09C 3UB4A 1A72A 4WLFA 2XUDA 1LV7A 1OFHA 1RRMA 3MAGA 5I5EA 3OPVA 2NIPA 3IJPA 2RE8A 2LDBA 4ICIA 4MB0A 1B00A 2GJ8A 2H8KA 1OU0A 2WMYA 2C98A 3KLBA 1V5FA 4S0XA 2J1LA 4PC2A 4FB5A 2QJFA 3Q6MA 5G2OA 1P1IA 1JDUA 3OIFA 3S2YA 4DHEA 1W25A 3HYSA 2ZGVA 3QMPA 2YQZA 1U7OA 3VO1A 2AXNA 3MGBA 1KEUA 5B36A 3I9MA 4I4LA 4O02B 4MRPA 1M6YA 3NB0A 3GP5A 4R40A 2ZTHA 3CINA 1XRQA 5FLYA 2ZAOA 5TARA 3F9CA 2A67A 3RAJA 1ZW6A 1DC6A 4TTIA 3QKRB 3OHPA 2X19A 1JF8A 3KU1A 1JIUA 2BGJA 3OT1A 6REQB 2ZRMA 1SQ0A 1KQ3A 1DOZA 3NHZA 4PE5B 3E70C 5IEJA 2WNSA 1ZSYA 1JKXA 4BDSA 5JRDS 2OESA 2YW2A 1CY1A 2WB4A 4TT3A 2PFKA 3JZAA 5EGNA 1FMJA 3JQGB 1X9IA 4HX5A 2OBBA 2B92A 4RPKA 2Y2UA 5TQJA 4F86A 1JHMA 1WSAA 2N46A 1WP4A 1WUJS 2B7CA 3HKBA 4XQEA 2XYPA 1SBTA 2I6TA 3BMOB 4N5MA 3IR7A 5TJHA 2X0DA 4AJPA 1KTIA 3KUCA 3GFSA 4AB1A 2J07A 5BNZA 3M6UA 2WAMA 2ZSBA 1PJAA 3ZHBA 3RK1A 3BERA 2YWFA 2O1WA 4WDQA 2G5PA 1Z18A 3RNLA 1DKOA 2H63A 3B1XA 4BO4A 3JAMA 2XJ9A 3PZBA 1N2CB 1X7DA 2NAFA 2Z9BA 1ENPA 1MHPA 1PNTA 4DANA 5JV5A 3GFVA 2ECOA 2HIAA 3I52A 4E2YA 4DA6A 1I2BA 1XN4A 1MB3A 3NTOA 4I6GA 5EZYF 4N76A 3U6BA 2IODA 4MTCA 3UK6A 4COKA 1KU6A 3HNRA 1QDUA 4GAEA 1SC6A 4FZ5A 1Y33E 10MHA 4O4IA 1UC5B 2F6RA 1HK7A 2MIIA 1Z29A 2ODTX 3JALA 2PL5A 3IESA 4HYTA 2GFHA 3O8QB 3F6CA 3GRZA 2I2BA 2OORC 2YZGA 3CNHA 2XGGA 2D2FA 4IKPA 3C5EA 4M1YA 5CPFA 5L6LB 2ZM5A 5FOQA 1PR0A 1VYVA 1YGPA 3RSLA 1P73A 3CLTD 5AOAA 3UFBA 1NG9A 3QHQA 1P9WA 2NO6A 2ZB2A 2A1TR 4KPUA 4Y1FA 1IAQA 3VH4A 1F20A 4YYEA 3MHPA 1AZSC 4AT1A 4NCNA 5KYTA 3KKOA 2DY0A 3SU8A 4HN2A 3KL4A 3UJCA 3P9XA 4LUCA 4N03A 1R6TA 2ZAMA 3COYA 4ZVPA 3SVZA 3ZE1B 1RRVA 1RWVA 3PQ8A 1IN6A 1PUJA 3A1FA 3M6IA 1KY5A 5HQJA 1B42A 4IIEA 1NZDA 5HMMA 4XVQA 1H4QA 3FZQA 1FXSA 4X84A 3GA5A 4K6OA 4QTZA 5FWXA 4D97A 1J97A 4G07A 4GI2A 3BKWA 5JXWA 1DEXA 2QTZA 1XN1A 3L0IB 4B6JA 3JWEA 3OCWA 2RONA 3FG9A 3R09A 4ASUD 4AMUA 3DC7A 1A4UA 2J30A 5ICMA 4QVGA 4B48A 3KFVA 1HDOA 5E4YA 3C5HA 1UMDB 2FJ0A 3VYUB 4UNRA 5D1NA 4YP9A 3ZZ1A 5HVNA 4E70A 4PU0A 2ZE7A 1RWXA 4J0JA 4JFRA 3B1KA 3H4VA 1REQB 4ONEA 4GYKA 2YVAA 4U7WA 1WBBA 2I9KA 5LKAA 1G6HA 5HYVA 4MGHA 1QYCA 3ETCA 5A4JA 5K0EA 1ISHA 3W2FA 3FUVA 3D54D 3NYWA 4Y9SA 3OICA 1C30B 1NX9A 3MOIA 1WBDA 3WLHA 3QF4A 4UTVA 4ZCSA 1XA0A 2FX5A 2PT7A 2RG1A 1HT0A 3HPRA 4X85A 3X0DA 3LF1A 2W43A 1N8KA 3ZD8A 4DVGA 1NXSA 4G97A 4PLZA 3NIBA 1E0SA 1ZDMA 4OMUA 3NI2A 1T10A 2XNCA 3EBPA 2V74B 1WP9A 4GVPA 4JJIA 4PGAA 1J2EA 5JSQA 4QEZA 2ZS7A 1ZI6A 3A9WA 3RVMA 2IQ5A 2D00A 2W2LD 1KEVA 4TMYA 3VNQA 3MERA 1P2GA 1G2PA 1Y98A 1XNGA 2CLLB 2R65A 4HGPA 4YRGA 3GMDA 3K2QA 1P1CA 4EPXA 5EIEA 1U04A 1YS9A 2FEKA 4KN8A 3N2EA 4DSOA 4NI5A 1HA3A 2XLCA 4WL0A 3EGEA 2W6MA 1GZUA 5EEHA 1CEQA 1ODIA 1LK0A 2IDJA 4OQZA 4DLWA 5JZSA 3BTOA 5AVYA 3PNQA 3A70A 5JSYA 2JD0A 3EGCA 2QUHA 2M6LA 1XJ0A 2IOFK 2JH9A 3M6XA 3NIDB 3MT8A 4MUHA 3WGQA 3TS1A 1X3SA 2FHPA 3T3MB 4DRYA 1JN0A 1QIHA 3CEPB 3LLVA 3QLJA 3QUQA 4JD5A 4P83A 3AOGA 5CVTA 2EJBA 4O2AA 1Q74A 3EXAA 4D9CA 4HK4A 2B3TA 3L2OB 3JQ6A 2J3KA 1C1XB 2P2YA 4IHJA 3BA6A 4X93A 5IVKA 2I55A 3SEQA 1JAYA 1SVSA 4ABTA 2EKPA 2O23A 5H81A 1AUPA 5J4YA 2H9IA 3H6GA 3W04A 1Z0SA 1SCDA 3GRVA 4L8FA 4M22A 4C04A 1SU7A 1PJ8A 2GJ4A 2XQIA 4WNIA 1ZD1A 4XQ0A 1TYEB 1XQXA 1PUXA 3A36A 3V9PA 4A91A 1EUCB 1RWKA 2GRUA 1W85A 1XDZA 2VPPA 3Q7RA 4OM7A 5K0GA 4L5JA 2LE0A 3CVVA 1BMFA 2QTHA 3BF8A 3QJGA 4B4WA 4R8LA 4YQFA 3GN1A 3KYDA 3DYVA 3RTBA 1VL8A 4CM8B 3QLVA 1KI1A 1FE8A 2HEGA 4GE0A 3R3WA 1W48A 4ZAFA 2OV2A 2YJ3A 2C2ZA 4DYHA 5HX7A 4DMGA 3DBLB 4FOSA 1H65A 3PXUA 5GIPE 1ADJA 1ZK1A 2WHPA 3C1AA 3HKBB 1JQKA 2DSTA 2GPTA 1F2TA 3Q7IA 3TXAA 5JDIA 5KQRA 1M34E 5JAIA 3GBSA 3H6KA 3QWHA 1W4RA 4OXRA 3RJ5A 4H0NA 3I2HA 4D26A 1LF0A 2E1PA 1GU7A 3B3JA 3N2KA 3ULKA 4GPTA 1XDUA 3I9V6 4JKOA 4EBBA 3T7CA 1DXOA 1BVHA 3DDWA 2G04A 2OA0A 1V3UA 2PV0A 3JQFA 3WMXA 1XIVA 1CJTC 2RGXA 2IYVA 2IZZA 2P78A 4N9QA 1PNVA 5IDVA 3VZDA 4B0OA 3ZCSA 4NE9A 3C6MA 5NULA 5JO0A 2AG6A 5CB8A 1Q0PA 1BHQ1 1B0UA 3FJ1A 4TX1A 4TRNA 4X65B 4R2IA 4GF5A 3L7CA 5KO2A 1D0SA 2A0XA 1T8WA 4YH1A 4RLFA 3B9QA 2FDCA 2FWMX 1RMQA 5ALDA 3W1WA 1MA0A 1R8YA 1LVGA 3DMDA 3NQ41 4G1BA 4LMPA 5IYZF 3AVOA 4YDHB 3O2NA 3SXPA 4DIUA 3ROQA 1GQQA 4TLMB 4ALLA 2XXAB 4I1UA 3MJVA 4UUQA 4EPRA 4R0MA 4IOLA 1QO0A 4MW1A 3WLOA 5DHFA 5BR7A 2X9GA 5JH7A 3AHFA 5D5HA 2VBCA 3P4UA 2QG4A 1NW9B 3B1ZA 4BQNA 4C0BA 1JMYA 2G63A 4CG3A 2WLTA 3ONNA 2VDWB 3DXFA 3T4EA 3PICA 4D4IA 1WB4A 2D7JA 4M89A 4B82A 1O57A 4Z4QA 2UUPA 4WOKA 5CFNA 4HXYA 2VQEB 3R5KA 1CY0A 4E5DA 2V58A 3CLSC 1VG1A 4EF6A 1ODJA 1YJ5A 5HCIA 1N2BA 1T3LA 3CQ9A 4HNHA 5LBUA 3U3MA 4EATA 1RHRA 1SKYE 4G2NA 4KOEC 2BLNA 2XX3A 4ZQHA 4TWIA 4U9IS 2VNKA 4H3SA 4DQ0A 1KZ1A 3MMXA 3DOFA 3O6VA 4II2A 4X95A 4HV4A 4G09A 2ZUEA 1AZLA 4BKOA 4PRYA 5MN6A 1U1DA 1KQFA 2QXYA 4H7FA 5AHRA 2VDJA 3ND5A 1AK9A 5T57A 1ZLXA 2B4TO 2JAXA 1NN5A 3ELYA 1EM8A 2NQ2C 4CM6A 5CCXA 4A16A 4AXXA 3O95A 5CVVA 4N7BA 2KQUA 2UZ3A 3NR2A 4KIFA 5ELMA 2HJWA 3QU7A 2B2CA 1YQUA 1NR7A 3I1FA 4QQNA 1U5BA 4IH1A 5KYYA 3U5ZB 2EEPA 3MINA 4YJ3A 2H29A 1PT6A 3CKLA 4CLOB 3KSUA 4U7PB 3A6LA 3ZYZA 4BLSA 3H0EA 4XX1A 1WE2A 3WSVA 2AXEA 1P5HA 5KJ6A 5AW3A 4BO0A 4CFSA 2Q7XA 4WXRA 4Q4JB 4HN4B 4KX5A 1X94A 4HXFB 4TROA 3GD7A 4XFDA 4C78A 2TSYB 3VC1A 3H5OA 3CWCA 1XFAA 1VJGA 5HILA 3H0KA 2VZEA 1ZGJA 4BWGA 5B4TA 2F43B 1GSIA 3CUKA 1MIOB 4L4UA 4X60A 5G0TA 7REQA 1H2XA 3F7NA 3T12A 5AH0A 1L5FA 4P4NA 2HFKA 1CP2A 1CVIA 1BEZA 4U5XA 2C58A 2Z57A 4N0MA 5H68A 1G4UR 1TF2A 1ZW1A 3CWZA 3HKCB 3QVXA 4FMCB 1IJEA 4Y2YA 3V8PA 2FPIB 1RJ9B 4CZ2A 4CIAA 1JQ3A 2H4JA 3KWMA 4W1PA 3BIXA 2IH2A 2DMRA 4O4LB 1M9NA 2XH8A 4UE6A 2L18A 4D9FA 1H8ED 3ZVLA 5LQAA 1WVGA 4EQZA 2AR0A 1UKVY 1EYZA 1XZPA 3HCBA 3WFZA 2GS9A 5L95A 3FRIA 1NONA 3N0WA 3SKVA 1Y5IA 2CZGA 5LB4A 2LCQA 5CXUA 3GT0A 2D2IA 1MUUA 2NUAA 3A6ZA 1K7XB 4UCWA 4XSHA 1UOOA 4WKCA 3TSAA 4K88A 4WJZA 4KLRA 4FHZA 1AGRA 1HQKA 3K30A 1SUPA 4E4RA 2QLMA 1ZHFA 3MMZA 2C4NA 2FP4A 3SFTA 2F3SA 2ZRFA 1SCQA 5IJ0A 3KWLA 4RDCA 1BZYA 2ZJ4A 2IE0A 2PPLA 3WYGA 2I2AA 1BCSB 1FTWA 2BTOA 2RHBA 2X9VA 3B82A 1RBQA 3DE6X 3CT6A 3GUVA 2NWQA 4FJ0A 2H1OA 3GUYA 1TYDE 2V6FA 4KI7A 4GL2A 4MVJE 5HKBA 5B55A 4BEBA 4JR0A 3VSBA 3N8DA 2ZYIA 3EFOA 3L9WA 4UVEA 3JD4A 1D5WA 3RAGA 3VPCA 5F98A 1ZN8A 4G0VA 2X0JA 3MOGA 2Q2QA 3TTXA 5LNK6 3JZDA 1FRQA 2NVUB 3DJYA 2ODNA 1XZGA 4EKNB 3M4YA 1QKJA 2RIRA 2WU8A 3KTAB 1V1MA 3IYLW 2DBYA 1DELA 3GJ4A 4ZCPA 3P0JA 1L8LA 1C0PA 3EAGA 1IUOA 4M9RA 2DUMA 1P5RA 2F55A 3WBKA 4JB2A 4F56A 3MJSA 2LW7A 1PLLA 2A9KA 4KQFA 1JB1A 4PANA 2PVCA 3VFDA 1P7PA 3H2SA 4AZ3B 4OXXA 4L9WA 1Z0UA 2AOTB 3HE3A 1WMSA 3GROA 4NU6A 3QKTA 3KAQA 1QDEA 4KODA 3RBXA 3H1FA 1G3QA 2NU8A 1G6KA 5EY5B 5KU7A 1J20A 1CJMA 1YR1A 3GEGA 3O8QA 5CDYA 3P27A 4OVKA 5JD5A 2O59A 4V3CA 1S96A 2BI4A 3VR5H 2AJBA 2C83A 1ONNA 5LL6P 4D02A 2C96A 1WJGA 4GKAA 4NZZA 4UREA 2A1IA 3T06B 1K3TA 1RWBA 2QRHA 3CNLA 4MINA 3BH6A 5DLPA 2IK8A 4PRKA 5J47A 1HX7A 1K6EA 3ZV4A 4BE9A 3SEAA 4B6GA 2R00C 3HACA 2RGYA 3KQYA 4YONB 1MJNA 2RKBA 1H1TA 1HE8B 4UM9D 4HLQB 4C21A 4PFJA 4R9RA 2C2BA 3VHXB 4JNKA 1DG9A 2DKOA 3V2GA 4TWRA 4P98A 4K0KB 2Z5VA 4BVBA 4C5BA 4WBNF 4N3BA 4ZVVA 2VT2A 2QU8A 5BW6B 4HS4A 2V0GA 3IEMA 1Z08A 4AWXA 2GCOB 2PX4A 2XBUA 2Z43A 3I5MA 3KSRA 3L1JA 4OCZA 5I7FA 5KYXB 3NKLA 4MV8A 1XZAA 1UDAA 4BQSA 1FBNA 1FPMA 4F97A 5A06A 4CTKA 5DHTA 1H2FA 1NUSA 2BP7B 2VRWA 4FFNA 3WMFA 1O58A 4KG7A 1F2DA 1C3JA 4AW9A 3JQGA 3IAXA 4KAAA 1BXZA 3BMQB 3W8EA 2EKLA 2ZTSA 2ZIGA 1S2LA 1F2UB 1E6EA 1LLQA 2BMFA 3IMGA 3ZNQA 4EG4A 3H65A 1AMNA 4GH5A 1JHPA 4FDTA 1VE6A 3TMYA 1UH5A 1NVVQ 3CT4A 4FGKA 2QGZA 3E9ZA 3BJZA 5L6MB 2XZPA 1FFEA 2ZFUA 2I5PO 3W7VA 2J45A 4B4KA 1FFYA 2JLQA 2CXPA 4E7PA 3GRAA 3UAGA 1RBZA 4QPPA 1I3OA 1ONBA 1PAUA 2FG5A 4DIFA 3CJRA 4RLSA 1G4AE 1OYYA 3BWDD 1MO2A 4YJHA 5FL3A 3X1YA 4LYJA 3GFOA 5AOVA 3EWIA 4EMTA 5KMGB 4MHTA 1SK8A 3K0AA 4EL0A 1PDWA 2QT9A 1UXJA 4N8DA 3AF4A 2X8WA 1SVNA 3D8TA 3G9TA 3C74A 2AF3C 1GJRA 2MYPA 5FA8A 1EIWA 3M9XA 3AUUA 1IQPA 1G21A 2BR3A 2IYUA 4N5DA 1SXJD 1GSHA 3NRJA 3TMKA 4HJXA 3CPEA 3NGLA 1GU1A 3SIPA 4A92A 1L8QA 2AMFA 2ODQA 3LOQA 5CLQA 2QGFA 1ZCAA 5EN4A 4B9EA 2YDYA 5ADHA 1G38A 1A7AA 4FFBB 2E4VA 4I14A 3K53A 2QLFA 2BI8A 4EVQA 1VRWA 1SQFA 1Z0JA 3IUJA 1PNRA 2A9QA 3IEKA 4ALJA 1U0OC 2NXCA 1YR9A 4RFVA 4W7IA 2HWYA 3ZWOA 5EJ5A 3PHGA 4H1VA 3D4PA 1GKYA 1NAHA 5FKJA 2FEWB 3D8UA 4ENUA 4X66B 4ZN6A 1XMPA 5JS1A 4TXMA 4B2YA 4DJFC 3F49S 2C7QA 4D9MA 5DKFA 3DGEC 3QFHA 4GMFA 3ZC3A 4E4YA 5A4AA 1CQJB 3ZU4A 3NWPA 3DAHA 3DOJA 1W76A 4EYSA 2R84A 4G8CA 5EMHA 4F1KA 4IVRA 2ATIA 1Z8FA 4C4SA 2XITA 1YR7A 2D0PB 4JLAA 5EJEA 3UICA 4US0R 2DP4E 4EJ6A 3F2VA 4GOOD 1WG8A 1EM8B 1PJZA 1E6KA 3KOUA 1VCNA 4G1EB 1UXIA 1A5SB 3C41J 2GVNA 2DBRA 3H18A 1O77A 1YMQA 2O9JA 1Q83A 3N39C 4MKXA 4REMA 2ES4A 1DB3A 5FPTA 1KMMA 4FHGA 3RTDA 4EUKA 5B12A 2NYUA 2RDMA 1KZHA 1TAHA 4EITA 4ZDWA 1HYHA 3D3NA 5JAUA 2GILA 4M1SA 4OP2A 2VHXA 4F4UA 4IUYA 1KC1A 1TA4A 3I72A 4GXRA 4OYHA 4QA9A 1BA2A 1F9AA 1ZXBA 4O4IF 3EXHB 4ND2A 4URZR 4ETNA 1N5OX 4PTZA 1YDWA 4RV4A 1IUPA 5GM1A 3S29A 1XKLA 2IEGA 5DW3A 3PSAA 4OXIA 2R8BA 1ULTA 1Z6YA 1L5WA 2DJIA 1J5EB 1ZK0A 5F1YA 1O87A 1K86A 4QEDA 1VL6A 4Y1EA 3AFNA 1L5NA 4QEKA 1JKJB 2GD1O 5AJVB 1SKMA 2QM7A 4NENA 1MABA 1OOEA 3GZJA 1VSQA 4UCFA 4D0RA 2RGDA 4MI1A 4JEHA 4YUXA 3U16A 5DDIP 4L78A 4O8ZA 5DNYB 2EG5A 2XI4A 3AUSA 2O52A 3PFNA 3O93A 3HJHA 4QIHA 4QHYA 2WU4A 2BGIA 4B7UA 1T6NA 1W88A 4YWJA 2Y1DA 4NV1A 2Q07A 5AI0A 1E4EA 4B35A 4PINA 3JSXA 4P7GA 1I80A 1TLLA 5B1SA 1R0YA 1FSSA 4B34A 4C76A 5CFLA 1WHSB 4OA5A 1JG6A 3ADKA 3HUTA 3K2IA 1UT8A 1KI3A 4XOIA 2AMYA 3EHEA 5JHHB 1QG2A 3CNNA 4ZKEA 5AHWA 3DTYA 5JS8A 3N6XA 2BCEA 3DLIA 3OM8A 2KJQA 2FWPA 4FQ7A 1FNSA 3DVLA 4IIGA 1YDGA 4RHXA 5KEIA 5KC9A 2WIAA 2VATA 4MI9A 5BQ5A 4EO4A 4QARA 1IHPA 1FQJA 3ND8A 3U4GA 1E1DA 4KZPA 1IIBA 2W6PA 3IAAA 1CY7A 2FOXA 3RVKA 3O31A 1OXVA 4LRXA 5FUWA 1P6QA 4KR6A 3P32A 2HMAA 4AQYB 1DJPA 1PW7A 4ZZ3A 1EFUA 3LXXA 2Q45A 1OLUB 3G9UA 1B6TA 4M9XA 4N3GA 4MW2A 5LN1A 1R0SA 2IYOA 3BGSA 3BMCB 1T4BA 2C54A 4US1R 1CJVC 4EPTA 3H97A 4RENA 2RHJA 1WXHA 3LVQE 4Q7LA 1BDHA 2WIKA 1Q57A 3WIOA 2B0CA 4EGQA 1Y37A 4LQ4A 2JATA 4RPGA 4D4HA 1EUCA 3SYMA 4LMRA 1V39A 2V3VA 2YV1A 3K72B 1HSOA 3L0SA 4XYLA 1RMYA 2IOHA 1MC8A 2C1ZA 1Y5NA 2PSHA 1J8MF 2W2TA 3GWZA 3I2IA 3MJDA 4AS2A 5IG2A 3CJTA 1AQLA 1RQ7A 2ENUA 4URUR 3TTVA 4WK2B 1TU3A 3DF9A 3GJZA 4NG4A 1B73A 4Z6KA 2EZ8A 1OZHA 2VEDA 4H9GA 3Q3HA 4IM7A 4TWZA 1ZH4A 4JLBA 4GRDA 4W9NC 5DFAA 4CKWB 2ISCA 2RGRA 5HK9A 3QZUA 1DPGA 4EWLA 4ZANA 1B93A 1MXHA 2P3SA 1Y7HA 2HH9A 4M3NA 5ALSA 5IC6A 3WC4A 3KPYA 1Z6XA 3QA9A 2NU6A 2NTNA 3IUQA 2Z4SA 2JJ2A 4NTZA 5EJ7A 1ENZA 1OZ0A 3ORFA 3DV0B 1M2GA 5IASA 2QRUA 2IZ0A 1XLUA 3UBMA 1EEXB 1Q5PA 3UKDA 4C1NA 3SHFA 3AERB 3PUKA 4D7AA 3OE1A 3WV4A 4LOKA 2HF8A 4D9GA 3K3PA 1PS8A 2R8RA 5DW0A 1TZKA 4GZ6A 3TCKA 1M1NB 1ZCJA 3H8WA 4WNYA 3S2EA 4GU5A 1OAAA 4LTNA 4WVFA 1U3TA 5LP6B 1SKAA 1PBTA 1ZA1A 2DKFA 2IGBA 1VSBA 2H3EA 2C42A 4OIMA 4DZTA 5BVGB 2EW8A 4WESA 2VOJA 2AVNA 1QVAA 2H7YA 4L5BA 2QRGA 4TLAA 3TD2A 2ABWA 3VDMA 3QEOA 2FRVA 2Z2JA 4LWZA 5KTOA 2D2EA 1G3IA 1A95A 3ZY3A 2OBFA 2B4AA 1H4TA 1B8OA 1DX9A 2RGNC 2VTEA 3IQWA 4YMSA 3LUCA 3T7EA 4B4DA 5IZCA 3PNOA 1MW9X 4KPGA 3ESBA 3K5WA 1P6XA 2FWAA 1DIRA 4G5XA 2GVZC 3KWJA 4EO9A 3PU6A 1F8FA 4NS1A 4X8MA 3WB9A 1P4RA 5HKOA 2H6EA 3L8HA 5IH3A 2ZVPX 4OV6B 3TVYA 2JVKA 1UAGA 2E9SA 2OBXA 3CVOA 3GOQA 4MKRA 2V5VA 3ZU2A 2OXEA 5LIPA 4O4HB 1ZOIA 1MG5A 2Q50A 3QEMA 3O4HA 4NZNA 5L3SA 1PNQA 4C4PA 5D5PA 2PEYA 2H4ZA 4DJJA 2Z1NA 4GDMA 1Z28A 2ILVA 2WHQA 4YXFA 4JC0A 2ZYSA 2C97A 4NH4A 2P9FA 1Y5MA 3NLLA 1OE0A 2CLFB 5I9NA 3O0DA 1U0NA 1VL2A 4XCQA 2XSZA 4L9RA 4GG1A 3B1FA 1BDJA 1U0SY 4G0MA 2G1PA 3ZV6A 1QV9A 2JGNA 3F4BA 4XSVA 4QRHA 2ZTUA 3VNSA 2VAPA 1I2DA 3AHDA 2PUHA 3HVKA 3IIJA 3VR3D 4CMJA 4I3FA 4EFKA 4ZHQF 3VSAA 4JZKA 2XAAA 4XD7D 2BCJQ 4JXJA 4KK4A 4AO7A 4OLBA 4FYVA 3F47A 2HQRA 1X1DA 4FJ1A 1SCAA 3EE6A 3K35A 4J7AA 1ZJZA 3QW4B 1UP7A 2QRPA 3CF4A 1DSSG 2R1VA 1QIEA 4FFDA 5K01A 1SHUX 4N12A 1U0BB 4Y6GB 1Q7RA 2V8OA 3USES 1W59A 4B47A 4JLOA 4LOLA 4C2UA 1WCIA 1WUHS 3PXGA 2ZR7A 4JA0A 2FJPA 2B4QA 2JD2A 1CQIA 1TJ5A 4TWAA 4XCVA 5AM5A 4FFPA 2HLPA 1BOFA 3QXHA 2E4YA 3AL3A 1ZAKA 3VHQA 1Y8ZA 2AEJA 3JQRA 4TYMA 5DHPA 2GLTA 3N59A 3PPIA 5LP6C 4UCXA 3ED5A 4O5OA 5A4MS 2I2FA 3PXCX 2C8VA 2XVMA 4LTMA 1E4EB 2YS6A 4ITVA 3WK5A 1GTZA 2P9EA 2W2KA 3IUEA 3B1VA 2FUKA 1FP4B 1AJEA 2ISSD 1O6ZA 4NS4A 4DNOA 3BZUA 2RFLA 3QOXA 2XOKA 4FGLA 3PKJA 3OT4A 4NE2A 3QOWA 2LKCA 5DI3B 5E3JA 4L22A 3N28A 4X7MA 4IIHA 5TS2A 3V33A 4CL2A 3EDMA 1QF6A 4K40A 4QC2A 1Y4UA 16PKA 2QD2A 3CXRA 5SV2A 3UJ9A 1GZSA 3L8CA 1A98A 2IYZA 1UBHS 3EC7A 3I6IA 3WP0A 4AKGA 1YBVA 4FYHA 4RKRA 3KOMA 4DCSA 2CBXA 3FYUA 5G0WA 3IR5A 4LRYA 2O5RA 3UIEA 4DT1B 1XOIA 2Z1MA 3LHKA 1MKYA 4R5MA 1GZ6A 3S2FA 1RABA 2Z3VA 3WWOA 4UTXA 2P9BA 3UEOA 1XYGA 3WZLA 4NIMA 1G20E 3EPRA 4TYPA 2W8BA 2OHHA 2G1KA 4ZQCB 4CM4B 1F06A 5G4LA 3RRFA 3DTVB 5EKDA 1H8HA 5C1OA 4EW2A 2FW8A 3IJRA 1BNCA 3LI2A 5FL7A 5BR1A 2RIPA 3LQKA 3V5NA 2J6CA 2QT0A 2VDVE 3W3AD 3FTEA 4XUEA 2G76A 4GWKA 2AI1A 3G5TA 1Y34E 2EU8A 4OHWA 3RK4A 4BBJA 3NUGA 4AS1A 4PYIA 2FPIA 2GPBA 3BOSA 3FNRA 2K4MA 4PYKA 4TWJA 3LDHA 4X1YA 4ZOLB 4WZAE 5IXJA 4JYAB 1FJHA 1L2TA 3OX2A 4LE1A 3EWSA 4ZCLA 1SPXA 4GKJB 2BDEA 3E7XA 3BAZA 1A9TA 4ZCRA 1ECBA 2OO3A 1T43A 2AW5A 1CUZA 1MJHA 1UOQA 3EIXA 1SUSA 3F97A 3L82B 4PCLA 5A3RA 5GY7A 2IUTA 1C0IA 1ECPA 3I42A 1E4VA 4RZHA 1Z26A 1N6NA 3K94A 4NABA 4PAGA 2YXDA 2VAVA 2GO7A 2X9LA 4D4LA 5T7BA 4CCYA 3P7MA 1JQ5A 4DCJA 5HW0A 1YUNA 3T9EA 1FQKA 1T9BA 5LWHA 3DO5A 2I76A 2IHUA 4TS4A 1VIYA 2X9QA 2A33A 4AFNA 3NJ4A 2IWRA 4ZVSA 2HSEA 3AOEA 1AIPA 1QCYA 4RVFA 1EK6A 3B6KA 1XBTA 4A03A 1N9ZA 2LZ0A 2WQ7A 1DADA 1E2HA 2C2HA 4X8OA 1W34A 4EW6A 1F38A 1YRWA 3DHWC 5ITZB 4N8SA 1AO3A 4UD6A 1II0A 2EIXA 3U4HA 4MCAA 4LOHA 4RTJA 4FDLA 3CMMA 1NRWA 3DOOA 4KBFA 3RRMA 1V9SA 3BVPA 3EVNA 3DUWA 2ZRNA 4P7JA 3G0HA 2Q1TA 4J0IA 4M0CA 2WIDA 2DOKA 1GA4A 1QVZA 2AG1A 1G5HA 1YDFA 4HFJA 1CUVA 4L9SA 1SBYA 4M7RA 3VKUA 2HWXA 3DKRA 3DEZA 3MWJA 5TMEA 3MWDB 5KQMA 1WL8A 3GT7A 1ETHA 1KI7A 3ZDRA 2IUFA 1SHTX 3GFBA 3M1IA 1S9DA 3A31A 2UXBB 4K9KA 3AJDA 5CCEA 3H5WA 5LU8A 1NSYA 1F9EA 5FV7A 4EARA 4AC9A 4DG5A 1ZOOA 2HXYA 4K28A 5LQNA 4DREA 1IBKB 2WD7B 1M1YA 4PPFA 5IARA 3TNFA 3COWA 4DY4A 2BSQA 4LAFA 1EDDA 1A8SA 4UEOA 2KW5A 1EAYA 3UC9A 3V1NA 3E1GA 2L2QA 3PC4A 3ILSA 4W9RA 3B9RA 5SYNA 2DBZA 1QPBA 2HCBA 3D8BA 1ZM3A 1G5TA 3DT9A 1Z36A 2O6HA 3I3SR 3BGVA 3BJEA 2PXXA 3HYLA 3KEGA 3LX6A 4U6SA 4DLXA 4YV1A 2ZT8A 3S81A 4GMKA 3LBYA 3T5AA 3EQ9A 3MJTA 1C9DB 3JX9A 2FY8A 3BRWD 2FYTA 3CG0A 3IO3A 3LS2A 1A9XB 2I8AA 3JPWA 2PUEA 1M1NA 2E82A 2JW5A 1P77A 1QIMA 4NYMR 2WF5A 5E6UA 4B46A 1EGAA 2XUPA 4UJ5A 2PX2A 3GFQA 3MJFA 1G41A 2XKAA 3AEQB 3F9IA 2I34A 2RH9B 5LOVA 3L0OA 3OZCA 5HM8A 2IHZA 5GV7A 1QPZA 2Z9CA 2H4XA 3QNUA 4PPNA 1MQ8B 3FAZA 3LX4A 4IH9A 3Q4GA 4BFTA 4U0JA 1HMYA 2NP6A 1QHYA 1NQXA 5C81A 3OIUA 3OIGA 4H3HB 3EEIA 1NC3A 1X3LA 4G01B 5AT1A 4DLZA 3U7FB 1NGSA 3GGSA 3QF7A 2WHYA 3RQSA 4L08A 1BH2A 1GGNA 2UVDA 4JX9A 4KXVA 4OOFA 1JJ7A 4TMTA 3P9SA 4EBFA 4HL6A 5EXSA 2JIPA 3EGIA 4JBNA 3CEAA 3NNNA 4EVSA 3OIDA 4FQ5A 3H1TA 5EPEA 1YD7A 1ZXLA 3IT2A 5C7OO 3BHMA 3K2BA 2AWOA 3PXAA 4Q9LA 4BLQA 1R3UA 2PLNA 2UZ1B 3C3WA 1AKYA 2Q7DA 4EJSB 4RADA 1KQGA 4PYRA 5CHEA 4MCIA 5TT0A 2OFFA 2YUIA 1E4OA 2AT1A 1AB6A 2JCVA 1GGFA 5DYIA 3HY6A 3RABA 3TRFA 1H69A 3PDIA 1UBEA 4Y6OA 3C6YA 3R7DA 4EJFA 4QAJA 5B6IA 1BAPA 4JI4B 5FR2A 2AC2A 2JGIA 2FUNB 2BCGY 1QIKA 1VMEA 5COAA 5K3EA 3GDFA 3AETB 3TIIA 3NBUA 1M34A 3LBAA 1R4MA 4EAQA 3GDOA 3MTEA 4GX2A 3TQOA 2YJNA 4P4TA 2CVZA 3OBIA 4N5IX 1XNJA 1JQAA 3KAKA 2BM9A 1BMQA 1RJWA 2PRJA 4YFYA 3SC6A 1LPBB 1AUOA 4IWXA 1XB2A 1K8ZB 1LJ8A 3DS8A 3R2JA 5JYEA 1XP8A 5FXMA 1X70A 1M76A 3L1KA 4HB2A 4G9GA 4XR4A 3TD9A 3UGKA 1U3FA 1JA9A 3QKSB 2R1VB 4N49A 2J9FB 2WPDA 4Z8YA 1T1JA 2SBTA 3F6PA 5DBOA 3SX4A 4QPDA 3AESB 3QLUA 1Q3TA 1MBZA 3HB0A 2J0UB 3GJ8A 2MMGA 3EG9B 1T3TA 4NX2A 3PTLA 4MULA 3SSAA 2DFPA 1B3RA 1GSOA 1NM5C 1WWKA 4X7PA 1NFRA 1SKBA 2PV7A 4BB0A 2VHTA 5KVVA 3M1YA 5EHQA 2B2NA 5L51A 1FDRA 4F60A 1FK8A 3MWLA 4DR2B 5AVXA 4TLLB 3H2YA 1C29B 1E2LA 4YP7A 1WNFA 1C3EA 4Z2YA 1N9GA 5HZHA 4G4IA 2QMUA 1EG2A 3DQZA 4NZPA 2YKGA 1Q0TA 3IP9A 1U8TA 2YIJA 4JXXA 4I6JA 2PUFA 2Z04A 3COZA 4TKMA 4G5YA 2YYAA 2ZQYA 4IW3B 1FP4A 4IV5A 1SWVA 2EYUA 5ALLA 4GUAA 5AO9A 3W3ZB 3RUIA 1E7QA 3I37X 4YO7A 4OHYA 3THOA 2P5SA 5AXAA 3QY0A 4ETWA 4QYXA 2V7EA 1US8B 1VECA 1UBCA 1M0EA 1SHKA 1RM3A 4C4YA 5JOQA 1Z0ZA 1EI9A 1NMZA 3A6HA 1JXAA 3CN9A 4PFKA 4I2VA 5EP3A 1IQ0A 2C5LA 4R54A 1LDGA 5K2MA 3U9SA 4DB4A 3IT3A 1JTFA 4Q3OA 2RI0A 1ULAA 2H1HA 1P2UA 4WBXC 4IQGA 5REQB 4X6UA 1G20A 5L3QA 4MARA 5THQA 2GAIA 4LDJA 2QAJA 1G8PA 4K46A 2R8XA 3WGLA 3ZWPA 5JZBA 1P72A 2JGFA 3IS3A 3ZHCA 2DC1A 3PNSA 1ORWA 3OZTA 5C7YA 3ACBA 3MQ2A 3K16A 2QE7A 2VRCD 4R2HA 4WVLA 5EWLB 1CIPA 3FPFA 5C8YA 2OCDA 3FDJA 1KJYA 4BC1A 4ROTA 3VR6H 4ZJZA 1DX6A 3V34A 4BNYA 2X2PA 3EXG2 3WO1A 5JSZA 4EABA 1NMQA 3WSWA 3VNVA 1RWOA 3JRNA 1FW8A 1V8OA 4UM7A 4E15A 5BV1A 1OA0A 1XLWA 1U65A 2OE2A 1W75A 3WIBA 4F84A 1O94A 1HG0A 4ITUA 2PMBA 1AU9A 1JR3A 1ECCA 3P2YA 4HUJA 2G4VA 2VUSA 2TS1A 4AD8A 1GKUB 1V6SA 2V6MA 2WMDA 4IH4A 4RKYA 1G98A 1R8SA 4PICA 1CY4A 3PE3A 4UVIA 3Q7TA 1GFWA 2MWMA 1JMKC 3KXIA 3NKFA 1FTGA 3NHLA 4EG0A 1IH8A 2ZQZA 3NHYA 3KDAA 4J16C 3C48A 4I6EA 5L3SB 5KS2A 1JHVA 1Y8QA 3IPRA 2G7MC 3OI7A 4J2TA 2CL5A 3JCZA 5AW5A 3GLIA 4P82A 4RHEA 1Z33A 2ZCUA 2DLCX 2H8GA 1X8LA 4LGVA 3K8ZA 2P5TB 5AKHA 1PR6A 3CNOA 3MILA 4MW5A 3AERA 2DQYA 1QHEA 4N65A 3K1JA 2I62A 4TV9A 2PSJA 4E5UA 4ZYVA 4MVJG 3K70B 3P9ZA 4DMFA 3DZKA 1GZ7A 2GNPA 1EP9A 4RA6A 3BTVA 4B45A 4DPMA 2GSWA 3N0TA 2AXQA 5B5SA 3CIFA 1MAHA 1MPTA 4AUEA 4C4XA 4F2DA 4ZEMA 2OZVA 2WTMA 5EZ6B 1AKUA 3CUUA 4JSYA 1K92A 5FLEX 1C81A 4C0LA 1I36A 4BBZA 2A0KA 3GPCA 3NVMB 3T0FA 4CG1A 3EFBA 2JIDA 3R5TA 5CAEB 5JH7B 5DHRA 3QTLA 4BB5A 1BWQA 3DKPA 3INRA 3VPHA 2OHGA 3OEYA 1UODA 1OFUX 3CMCO 3QWAA 4OL0A 5JBQA 1S89A 1JEYB 1C2TA 5ESRA 4BO6A 4NEQA 3G2MA 4XQCA 3TLCA 5TPZA 2VZ9A 4D4GA 2OCXA 1PJ3A 2WVAA 3BFJA 3BRWA 4HZGA 4L4RA 4CT4B 4Z4CA 3VPSA 3ER9A 3GLSA 1DXQA 1DAMA 4IPTA 2HLDD 2VTKA 4OY3A 1HYQA 4LZAA 3BQ9A 2IIBA 3SDSA 2PNJA 1H4VB 1JX6A 3IIEA 4LDZA 3T35A 3TEFA 4BO8A 5JUWA 4H2DA 4LYFA 5CHYA 3QXXA 5DOVA 1YB6A 2GAFA 2IPOA 3U4CA 2POQX 1GN8A 1Y7IA 3BD7A 4JBHA 4MV0A 2C9ZA 4H4CA 2Q3JA 3SBDA 5BY2A 1AGYA 3NW9A 4Y6PA 4NPAA 5IJWA 1O95D 2VH1A 1TUEA 4QM6A 3DCNA 4ER0A 3R20A 5DNUA 1ORRA 5AMXA 3TVTA 1E3EA 2H0RA 1L8AA 1ZUHA 1BS9A 1PI3A 2JCYA 2Q6KA 3O3NB 4UNIA 5FOWA 5K8VA 5CA1F 1N0IA 3B13B 1BRTA 3CRZA 4UJ3A 2A94A 2WT9A 3KSDO 3ZQ6A 3IELA 3CLHA 1R6VA 3U4QB 4OHOA 5TY0A 1YTUA 3WIVA 3EA5A 2OEPA 1VLZA 2HA4A 4NOJA 2F64A 2QJWA 2O5VA 4R1TA 4H27A 1TZMA 2XB6A 1U8UA 3D5QA 1S8FA 1XSEA 1ESMA 3HGQA 1IPEA 1EGQA 3NBXX 4PS1A 4JUBA 2X6TA 5AKLA 2BHNA 4M1KA 2CUKA 2ZSDA 2PVPA 4GICA 3L4EA 1V16B 2I3ZA 3ORYA 1E9SA 1OFVA 1E92A 3M83A 4XJXA 4YJFB 4WFKA 1RKXA 2TMYA 4BNKA 4DFDA 1Z8NA 4CIVA 2CBZA 3FGOA 3PVCA 4IP0A 4TXJA 3DDSA 3IQGX 2JGKA 3BWEA 4F5DA 2JANA 1W2WB 2JAUA 4HVCA 3FDIA 3WGIA 1T5HX 2QQ5A 5G02A 1KETA 1P9RA 5MN4A 1KDOA 3HO6A 3MA0A 1G66A 2ZDGA 5IVIA 1I7QB 3QMMA 3G85A 2RC5A 4GM4A 4Q21A 4CCWA 3CGWA 3MXTA 3ZHZA 5IM4F 2QQEA 1H0RA 2GI4A 5EKSA 5K51A 1OPRA 4JSRA 2HBYA 3PWKA 6GPBA 1CEXA 1SKYB 5K0TA 1DT5A 3RVRA 1XZDA 3FSEA 1CKEA 2VI5A 2HEIA 4LRWA 3L6BA 2DQ4A 3HQ4O 4MPPA 1JWLA 2YINC 1QWSA 3E4CA 3PFFA 2XZOA 1J8DA 3X1ZA 5SYAA 1PQPA 1RHKA 1QGYA 4RQAA 3PLNA 1IHUA 1M5UA 2C4TA 1O95C 1EVEA 1KZ7B 5E7JA 4A8PA 4ETMA 5DM4A 1MR3F 1XAJA 1XCPA 4I9NA 4TQUS 1L5HA 4D2IA 4WLOA 1QIFA 4FUQA 4MQEB 3SZ3A 5JT1A 2QZ4A 1JYFA 1QO9A 4AKIA 2IGTA 2YIMA 4H6PA 5FORA 2HWWA 3H9GA 4KUGA 4O4JB 4EHBA 2BTQB 1IXYA 3ER6A 1ZO8A 2B69A 4GPD1 3VR6A 4ZYXA 1Q84A 3K1TA 1QQ5A 4FW9A 2RK4A 5DT2A 1T8SA 3LPCA 1Y6QA 4CGZA 3KHTA 1BJKA 1RYYA 1VMAA 3K8OE 3OY7A 5EVJA 3SMQA 1A77A 1H42A 2QRZA 3DTVD 1RJ9A 3JWHA 3N5CA 4D6PA 1KA9H 2JC3A 2J3EA 3AR8A 3HDTA 1LEHA 1Y4AE 4UU1A 1TT5A 4D0LB 4DC0A 1Y1KE 3TTTA 1G7SA 1EBBA 2CHGA 2I8CA 3LAWA 5HZGA 1MNQA 3B9PA 4G0XA 1DFGA 4NYMQ 3ZKWA 3ITNA 4FI3F 2PYZA 4WE3A 1B3BA 3R3HA 4M87A 4RSMA 4XCXA 1QB8A 3NHKA 2HX1A 4OYLA 2IP1A 4BFVA 4CFYA 2AMLA 1UT6A 3UFXA 4RFLA 2N9UA 4LDAA 2YV2A 3AL2A 3HB9A 4MAAA 3S99A 3C2QA 1KZ9A 3QXJA 4PLVA 1TEXA 2ECPA 1NT4A 1LZKA 1CY8A 3KHSA 3QE2A 2OCGA 1FSZA 4P35A 4QU0A 1YT5A 3ONDA 4D9BA 5HM6A 5DI9A 2C59A 4G23A 1JDJA 4HWOA 4ZRMA 3VR4H 3VA7A 1GNPA 4ZZIA 4JIGA 3MD0A 3BXHA 2CXHA 3EGWA 2B99A 2BM8A 1C9EA 2JLZA 1OFUA 1WD5A 2IYXA 2OQRA 2H1WA 1NBWB 2VNJA 1K9SA 2AK3A 2CLCX 3WWPA 1W5BA 4E1BA 4YI5A 2Q0HA 2BR5A 1JP7A 3JR3A 3NBYC 4OFXA 1U9IC 1VJTA 4UTZA 3FPSA 3UATA 1EU1A 2ZJYA 1A9RA 1QIDA 2X1VA 1LBIA 2ZRAA 1THZA 1KMCA 2INGX 3N07A 4L73A 1P8AA 4NP6A 4AIRA 1NXPA 3W6ZA 1KEEA 1G1MA 3PQ2A 3G2HA 3VZSA 2BR4A 1IHOA 2CCKA 3MWEB 4WLNA 1FL9A 3NBFA 2H2IA 3RSOA 1OD6A 2OUKA 1A50B 4CQLB 1O89A 3PHBE 3L7YA 4CF4A 2ZJ6A 4F4HA 2PSEA 2XBMA 2DUUA 5G1NA 4FXOA 4QDUA 3OCVA 3SC4A 4YUYA 1KEWA 1QH1B 2O8EA 1BC5A 1FDVA 3RE1A 3PC7A 2VDWA 1TZ2A 1BGWA 1R12A 4Q7MB 4TKUB 1U4NA 3Q3JB 3FKSA 3JYOA 1LDNA 1VHWA 4EHHA 1GL9B 1JVBA 1EP2B 4HPXB 5CT5A 3DDZX 1K6IA 1TC1A 3CKYA 3WLAA 2IPXA 2F00A 5I9IA 4AU1A 3I6YA 2G9QA 1V3TA 3VTFA 1BYUA 1KEZA 2PGOA 3AINA 5HF9A 1J21A 3TXXA 1VI5A 4K6HA 2EZUA 2VKTA 3QWIA 5BWCA 3OLWA 5D7NA 1KGDA 4JLMA 4PC3A 4PHCA 1ISFA 1NLMA 3ET5A 4Y6SA 4A8JC 4ZDIA 3PJDA 5G1PA 1Q7TA 3DHYA 5B3JC 1XMSA 3JQ8B 4IHJF 5JAPA 1JDVA 3F4LA 2H92A 3OA0A 3ESAA 2CL0X 4IHQA 4XLZA 5DGIA 3RQIA 1JW9B 1OUMA 1ISIA 1GUAA 1RE0A 2C82A 3WRWA 3VU1A 1MX1A 5HOEA 2WINI 3RT7A 4KFCA 1KH1A 5SY4A 2BBTA 5DEOA 4ZRNA 3ENNA 3LP6A 4FKMA 3L7KA 1M2NA 2QZPA 4PNZA 1JHXA 1XYYA 4I5DA 4ARIA 1GUBA 2C00A 3CH7A 2X6RA 2JFWA 3L4BC 3BFVA 3IAUA 3BT7A 1LQ2A 1EFKA 2F62A 3ASVA 3B3GA 1KI6A 3BMCA 3DAPA 3P26A 5E2AA 5K20A 5ENZA 1XTTA 3UAVA 2EC5A 2W2QA 4AKTA 1RLOA 4J49A 4DIMA 2P1DA 1EXVA 3FOZA 1IJFA 4U7HA 1ZMRA 1SVLA 1XDBA 3O26A 2EZTA 1BMDA 1NBOA 3D7NA 4HMOA 5FTMA 1MOPA 4K6FA 5FQNA 4AURA 1IRXA 1P5JA 2K87A 2EJVA 3NNDA 4QD3A 1A7UA 3LUPA 3ICWA 2OT3B 5BSHA 1CY6A 1ZWLA 4QQRA 5DRTA 3HBLA 1OB2A 5HTKA 2VDKB 2JG3A 1PLKA 3A04A 3F3SA 5DH9A 1Z7GA 3LRTA 2EFJA 1ECFA 4HLUC 4ZEOA 2YVKA 1U8CB 4HMQA 1QU3A 1E9FA 2PT6A 2XW6A 3EY4A 4G0WA 3M1AA 1QV6A 3BXPA 2H00A 4JGBA 3U7HB 5A0FA 4NNPA 4G5HA 4XIJA 4ZGBA 3ZV7A 2CJFA 3L0YA 4MKGA 2J3LA 3WAGA 5KX5B 4RCVA 5BO5A 3V4OA 5KQSA 1QFMA 4ZVTA 2G5GX 4XUGB 3ROFA 4G1FA 3R3VA 1I9CA 3DB2A 5E2IA 3QE4A 1H2YA 1NX6A 2PK3A 4MS3B 4V0OA 4FNAA 3UANA 4BVAA 4PNEA 5AVSA 3PR3A 4HLNA 1W8DA 2KS6A 2IY8A 3DUFA 5E0KB 5J1SB 1YA6A 3H1AA 2EX1A 4O1HA 1MW8X 1OWPA 4U5QA 3TOVA 1I4WA 2QBYA 4OO3A 2DPLA 4LKOA 2YXLA 1YB7A 3G2LA 2X2FA 3RVBA 5GZ6A 3T34A 3ZDCA 2O20A 4A36A 4MVJA 5F5NA 2DTDA 5JTUA 3IJEB 3KZVA 1R64A 4LGCA 3H9JA 4Y2PA 2V7UA 2WWIA 3RO7A 3V4ZA 1XRRA 3VH2A 1VPTA 2DFDA 1OTHA 2HLDA 3SI7A 4F38A 4HNUA 3FHTA 4U0KA 3EF3A 2CF5A 4ML3A 3ADPA 3OP1A 4BZQA 3OE7A 4E32A 1ZC3A 3DZJA 3O4RA 2UYQA 4MR8B 3VKFA 2LR0A 2C0QA 3KEQA 4Y6RA 5ARBA 1GQSA 4ZVMA 2BRUA 1Y6JA 3VV2A 4ATNA 3RH0A 4O4HA 1SWWA 2BGGA 3PRJA 1MG0A 2YQ5A 1B6RA 3FLMA 1WTCA 2FF5A 1NN3A 2FWJA 1NJ8A 4KMMA 4RBNA 2D3TA 1W5FA 1V7QA 3Q6IA 5JAZA 3PFBA 3NALA 1P5ZB 4TS3A 1C14A 3PWSA 4YR7A 1BYIA 3VZBA 1EDZA 2ZITA 4BNWA 4K1XA 1JKFA 1DMSA 1ND5A 5K0LA 4JZYA 1FYWA 4HWGA 4NECA 3N0VA 2QD5A 3W34A 5ES4B 6LDHA 4IUCS 4RVHA 3UJAA 4X71A 2RB4A 1Y3IA 3W4JA 1RAIA 4BQRA 1Y1TA 2A57A 2GK6A 2JLYA 1BSVA 2XUZA 4RDIA 4KFUA 1P5FA 4PZCA 1JRLA 1T9GS 2QTMA 2Q21A 4TLEA 1LTKA 5GJCA 1X87A 3RTAA 4B8WA 5GINE 1EBFA 3KYCB 4CIYA 3I0NA 4R1SA 4QG7A 2CUTA 5C8XA 4IILA 4W8GA 1LH0A 1AE1A 2O4UX 3DJFA 5LFAA 3D6MA 1L4FA 3Q87B 4LYDA 1Z2AA 4KIGA 2J9XB 1TK9A 3BMQA 2QTBA 1L3IA 2AIRA 3WMRA 3ZQ4A 1EUDB 1EE1A 4AMZA 1X1AA 2PMKA 4QJ4A 3VR6D 3L02A 4NMHA 1P7CA 1B14A 4ND4A 1ZMBA 1HFJA 3DTTA 4IZHA 3QVWA 2IYNA 3OTHA 4P3OA 3VMMA 1CD5A 2DXIA 3THYB 2XDAA 3DMTC 1Z34A 4MHOA 1AOXA 1DFIA 4HB3A 5E1DA 2JF0A 1COZA 2BFBB 1XTPA 2Y0CA 4KU4A 2JFBA 2GBLA 3GW8A 2JLAA 1QE0A 4V02A 3OZFA 2GB4A 1E0AA 4LCEA 4N18A 4OXKA 4Q1AA 5ED0A 2HQSA 3GX1A 1BE6A 3EFOB 2M32A 4YLEA 1XROA 1U7WA 1P45A 1YH3A 3UHFA 1Q1GA 3HTXA 2FUCA 4QGHA 1LUAA 3IBGA 3CW9A 1LF5A 1ZMTA 1O8BA 1YK1A 2VWPA 4DQLA 4JQYA 1H6AA 3QX3A 4AP6A 4PAMA 1VZ3A 1NI5A 3FZGA 3NT5A 1LX7A 3MWYW 1QH0A 2VA9A 1YI0A 1DU4A 2EW1A 3U7JA 4KAFA 2XKJE 3BREA 4EYEA 2R1UA 1J8FA 2HMWA 3SHWA 3R9WA 1QPGA 3C3CA 4PZZA 5AW1A 2BMEA 1UK9A 2QY6A 5KJ1A 1G8KA 2BJHA 1WEKA 4X63A 4DDWA 4BGDA 1W47A 1WDMA 3HBFA 3DCIA 4NXMB 1T6BY 2ZAGA 1T1RA 1VXRA 4JL6A 5DHQA 4ZEXA 3SQLA 5CG1A 2AOTA 1RPAA 4H1TA 4BYGA 3H2BA 4G5RA 1YQWA 1V9LA 2P9JA 3QUSA 1D4AA 5EI5A 4NU5A 4B2PA 4YMHA 3OQOA 2GEVA 1KTVA 2PAAA 3Q0EA 1CERA 2WRZA 2C29D 4HEA6 4WXMA 2VVTA 4ZXFA 5CA0F 1W94A 3CRRA 4JI7B 3AH8A 3T7DA 1NP6A 2N1MA 4BQQA 3MT0A 1R0CA 3M4NA 1M2HA 1MVOA 3EAFA 4REQB 2YY5A 3GOHA 4KGXA 3T6KA 2FFHA 1EHIA 3OSZA 4EB6A 4OJKA 1MRSA 2ATCA 1OI2A 4BFXA 1W1WA 2HSWA 2Q9AA 5LDDC 1YUMA 2LD4A 4JIMA 2DPGA 1VSUA 2FDRA 4MI3A 3V3TA 1JSCA 4WXHA 3CH5A 2NTJA 5SZKB 4G5FA 3AR2A 3KUXA 3GELA 1H5QA 4FGSA 4WMLA 1N0WA 2W98A 4M8LA 3PUVA 4CG2A 1TQDA 2B35A 1Z7EA 4WRRA 1B23P 2JK1A 1DKLA 1T5BA 3IVAA 3KT0A 1YZYA 3GCDA 4M76B 4TKVB 4UQOA 4UNQA 5TPWB 2VYVA 2C5HA 4EY7A 3P8ZA 2AD5A 1NM5A 1K7EB 3A2MA 4OTZA 3C5CA 2QX6A 5A62A 4Y7DA 5ALQA 5CITA 2VCEA 3N05A 1PR9A 3QVVA 4ZHSA 1MRZA 3O9VA 2VYFA 3UB2A 3KXDA 3GUCA 3F74A 1NYLA 3E4DA 4IGEA 2VHJA 2ZUVA 1NQTA 2EYQA 1QV7A 1RZVA 4Y1RB 3NANA 3OEWA 4W5WA 4EOGA 5AJTA 1EE9A 5NLLA 1JAHA 5KZMB 1ACLA 2VA8A 1ULSA 3E2PA 1Y5RA 4R5HA 2NPFA 3TQHA 3UQYS 1M6WA 1UZLA 1V43A 2HDHA 2X86A 4LA4A 3HXMA 4F06A 3PD1A 1K5DA 4ZI5A 2HSJA 4X1KA 1Y3CE 4QUIA 4UOEA 2PIAA 2PA3A 3ILXA 1QDLB 2M98A 1FVHA 3FZYA 4AUNA 4KVFA 1FDSA 2RJNA 1XMVA 4DCPA 1BXKA 3BCSA 4BNGA 4UM5A 2YJGA 3MSCA 3ROPA 4BBAA 2WJWA 1RI3A 2QRQA 1YQQA 4YRJA 1N2HA 3UV7A 5HEKA 2VOEA 3CZPA 3ZJTA 4MV9A 1JTVA 4LE2A 2AFHE 3F8WA 4HFNA 2D5LA 4P58A 2JHCA 4WGGA 3H5TA 2AFHB 1YHZA 4KACA 4F3KA 3U0VA 1ORDA 4CN9A 4DRXB 3KSZO 4N5LA 1CJSA 3M34A 4ECEA 2VQSA 5UKDA 1CUSA 1CC1S 1EVLA 4UM8B 3CSUA 5AKXA 3ANYB 1OH8A 2ZIEA 4Q93A 4MLPA 4HQKA 1DXHA 1NLZA 2EBFX 2YUTA 3K1AB 4P2GA 2FK8A 2C2YA 2PXHA 2RBEA 4JOQA 2JJ2D 4P7BA 3QU9A 4YWHA 1E0JA 1IOLA 3HUUA 3HR8A 3QXGA 3NTRA 1NATA 5ESWA