3J80A

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
SLPSTFDLTSEDAQLLLAARVHLGAKNVQVHQEPYVYKARPDGVNVINVGKTWEKIVLAARIIAAIPNPEDVVAISSRTYGQRAVLKYAAHTGATPIAGRFTPGSFTNYITRSFKEPRLVIVTDPRSDAQAIKESSYVNIPVIALTDLDSPSEYVDVAIPCNNRGKHSIGLIWYLLAREVLRLRGALPDRTQPWAIMPDLYFYRNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00318 Ribosomal_S2 Ribosomal protein S2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 3j80A01
1B0ZA 2XHZA 2I2WA 2CXOA 2DECA 2F4VB 4AMVA 4JI4B 3J7AC 3OOJA 4LF6B 2VQFB 2X3YA 2DF8A 1VI6A 4NXNB 1IRIA 2ZM6B 2CXNA 2UUBB 1X94A 1XMQB 5A2QA 3C3JA 2CXPA 3J80A 4B3MB 3JAMA 1N32B 4X65B 4M0DA 5BR8B 2VF4X 2UXDB 4DR4B 4X66B 1JEOA 1JIQA 3I0ZA 2A3NA 1MOQA 3HBAA 1Q50A 4YHHB 4DV6B 3JX9A 4DUYB 1VIVA 2I22A 4X64B 1U0GA 4DV2B 1N33B 1VI5A 4EM6A 4B3SB 1J5XA 3ODPA 1XTBA 1HNXB 2E5LB 1NUHA 1C7RA 3KNZA 1J5EB 3EUAA 4DR5B 2E5FA 3Q88A 1DQRA 1VIMA 3BJZA 5IT9A 5IWAB 3FKJA 1JLHA 1X92A 3BCHA 4DV3B 4LFAB 2POCA 1I94B 4TOIA 4GKKB 2CVPA 1NRIA 2CB0A 1IATA 1MORA 3ETNA 2YVAA 3SHOA 2PUVA 2VF5X 4U6NA 2CXUA 2WU8A 2CXQA 2CXTA 4KHPB 1MOSA 1N34B 4DR7B 4IVNA 1FJGB 2UXBB 1N8TA 1WIWA 4NXMB 1HNWB 1C7QA 2ZJ3A 1GZVA 1X9HA 1X9IA 5FLXA 4X62B 4AQYB 2VQEB 3QKIA 1HR0B 1KOJA 1XNRB 4JI6B 3TRJA 2HHHB 2O2DA 2O2CA 1TK9A 5BY2A 2CXSA 1XMOB 4JI8B 1G98A 5LL6P 5I01A 4LFCB 4DV4B 3CVJA 1HOXA 1TZCA 3M5PA 4GKJB 1U0EA 4DR6B 3T1HB 1IBKB 4LF9B 2UUCB 1HNZB 1IBMB 4YY3B 1JXAA 4DR1B 3T1YB 3OTOB 1M3SA 4JI5B 4DV5B 3G68A 4LF5B 2PUTA 4LF7B 3TBFA 1TZBA 3J81A 1HM5A 4DUZB 4DR2B 3FXAA 4B3RB 4JYAB 4B3TB 3PR3A 4K0KB 2UU9B 4LF8B 3HJBA 4S12A 2Q8NA 3FF1A 3UJHA 4JI1B 4OX9B 3FJ1A 2UXCB 5LMUB 1U0FA 1ZZGA 4DV1B 4JI3B 4DR3B 2XBLA 3LJKA 4JV5B 1T10A 1N36B 2PUWA 4JI2B 2PGIA 4S1WA 4LFBB 4DV7B 3IFSA 5LMNB 3NBUA 2V4MA 4LF4B 4JI7B 1XNQB 2CXRA 4JI0B 3Q7IA 2ZJ4A 1IBLB 2J6HA 1GZDA 4DV0B 2UUAB 2AMLA 4LZJA
chains in the Genus database with same CATH superfamily
5HR5A 1W5BA 1MA0A 3PLNA 1RXIA 1Z2OX 1PDVA 2Q6TA 3DEFA 4IIHA 1YZLA 4GI3A 1QX3A 2G28A 2B6NA 2G63A 3CLKA 4LX0A 4WE3A 3SQOA 2Q7DA 3GRUA 1GQOA 5E6RB 1E62A 3O8QA 2SICE 5EZ6B 2OV6A 1FJXA 3BXEA 1LB1B 1X7WA 3OMXA 3QG5A 3UC9A 4ZT2A 5BV2P 3PFGA 4TVKA 2IYXA 3C85A 4EDHA 2B82A 3QW2A 1Z26A 4QG3A 4YACA 4C4OA 3T1TA 3KJHA 4D9EA 5KU1A 5EQJB 4Q4AB 2D5IA 1P17A 5DBIA 4B47A 1R0BA 3KZMA 4B2IA 3EPPA 4JR0A 4N18A 1N8KA 2XITA 4X20B 4K0RA 3ZD8A 5G1PA 2W90A 4F9EA 3VR0A 4QYIB 1A4UA 5GZ1A 1JTFA 3HB1A 2WWGA 3OEWA 4ZTZB 1RNLA 4Q6WA 3EUFA 3D3NA 1CQZA 2OOKA 5EYPA 5HOEA 1KEPA 4HUJA 2DWUA 3E8MA 2AG8A 1FXUA 2W8BB 3MTGA 1A9XB 2DHQA 3IV6A 4R05A 3VH3A 1E1KA 2GUWA 1DMRA 1RBYA 3WHIA 3AF4A 3KAQA 4IPTA 2EDAA 3C98A 4C04A 4BEWA 3ETLA 5HBRA 2XVMA 3QWAA 1OZGA 3IMGA 1X1EA 2DZDA 4Q1CA 1VYTA 1SXJC 3DBLB 1SOVA 3MAJA 3OBBA 4IFTA 4L0MA 5H81A 1OYWA 1WKBA 2NO7A 1FA9A 2F1KA 2VJKA 3EFEA 3ENNA 4YAWA 3SG0A 2FX5A 3RVMA 4IXTA 3WGKA 2ACVA 3FRIA 1X8KA 1Z68A 3ABIA 2EL9A 4X3CA 3I2YX 2IZOA 3UWSA 2V3VA 2HRDA 3IVMA 1FVFA 1DAGA 1EDBA 5AXDA 4LJKA 3OQPA 3OCJA 4K9MA 4PRLA 3TL3A 1YZFA 3RD5A 3CLVA 2C0CA 5E7QA 3Q15C 1QO0A 4INJA 4C3OB 4F6RA 2I4NA 4DMUB 4H6WA 1WUTA 4C7OB 4ZT7A 1QF9A 4KNYA 1I32A 2OC9A 4LNAA 4BQRA 2ZSKA 4L2IA 3OTOB 1FL9A 1NN5A 1WMBA 4LE2A 5K3DA 4ZZIA 1CS0B 3E3OA 4X5OA 3SE0A 3W5CA 4OXNA 1B1CA 4DA9A 2R79A 3DMTC 2O8EA 3TI7A 2I71A 4L5BA 3Q98A 4RXTA 1ZN2A 3O3CA 2DT8A 3IIIA 5DPMA 4F92B 5ICEA 1LUAA 4ZODA 3TLMA 2PUEA 2PVPA 1V1JA 2JVJA 3K9GA 1RPJA 1K6XA 3Q7SA 5KSOA 4W82A 1TEVA 4X97A 1IB6A 2HDHA 1Y9JA 1S8OA 1Y6ZA 2QPAA 2I6FA 2V03A 4HSGA 1U28A 2AG5A 5HKLA 1XEWY 4RTOA 2OILA 2IH2A 2IL1A 3WIOA 1N9KA 2BZGA 3TM5A 1UKEA 9ABPA 2O3QA 1ULTA 2J6IA 3TIGA 3AESA 3GRRA 1FXWF 3WGTA 4WVFA 5C51B 5LP6A 4HMQA 4LRTB 1F1JA 4AG6A 1WBBA 3GJ6A 3N2GB 4QEDA 3AQIA 3HA2A 2E18A 4U7TB 3N8KA 3OI7A 4E11A 5LU9A 1RJFA 4XVHA 2ZWMA 2OB1A 3T94A 5KO2A 1EQUA 4PN3A 1UJCA 1ECLA 3QOFA 3SXUA 2HF7A 1RJWA 3H1EA 1JG6A 5CNMA 4YQYA 2G1AA 4HFMA 2RHWA 3YASA 2O06A 3PV0A 3QWBA 5TGTA 3S2FA 2HNAA 4EYQA 1JR6A 4YPFA 3HKEA 3CUEF 1HQKA 2WJGA 2G83A 5DEIA 2PCJA 4CL2A 2XCTB 1JU4A 4V3BA 1U8AA 1TAGA 3D8NA 1YE8A 3M83A 4KGDA 1D2NA 1ST3A 2W2KA 4F9FA 1IHPA 3U49A 2GF0A 1F2DA 1U8ZA 1ISFA 3RPEA 5ELLA 2IUFA 3BJIC 3IXQA 2WPDD 4KSBA 1KMNA 4YRIA 2JH8A 5HKKA 5I7OA 4FFNA 3AMVA 1H5QA 1FW6A 5FUXA 2O8NA 2JJ1A 4Z8YA 4ZVTA 2A4MA 5J2UA 1KAQA 1Z7WA 1SKUA 1P72A 3CHYA 3RTGA 3IX7A 1NBOA 2BGMA 5ICFA 1NMQA 1RR6A 3ANLA 1XCLA 3HL4A 3LW8A 1M9NA 2G25A 3X0DA 4XWAA 2A4KA 3OT1A 1BQEA 4P31A 2GXAA 4HADA 4JFRA 2FA9A 5AJYA 5D00A 2D5BA 3CU5A 3H3FA 3KQWA 4HI0E 3S0JA 4LFAB 4YP6A 5EPUA 3UC5A 2ZB7A 4GC5A 1U8TA 2AW3A 2VAPA 1EUDA 2Q27A 1EVLA 2BHSA 3GZNB 3L4BC 3R6TA 2GBLC 4P54A 4R16A 4RPLA 2CUZA 3TAHA 3KKMA 3CGGA 3EOBI 1RVV1 3C1TA 4BN0A 5BYJA 4X90A 1ZKMA 1BX0A 1Z0JA 1FOEB 5JISA 3KOMA 1N1EA 1L5HA 3SVTA 2ECFA 4KNVA 4B7ZA 2WYWA 4LZAA 3WRXC 1DXOA 2DAPA 3BA1A 3BGVA 3PBKA 3VVBA 1XNRB 2O59A 1V1MA 2EF0A 3K1YA 4WK0B 4Z0HO 1ABFA 3DO5A 4RKWA 1X86B 5DNUA 4YAEA 5LD2C 3FNEA 5GADl 1T2VA 4AKHA 5L7TA 3BL6A 3QFRA 4PNZA 1XLVA 2C9MA 1P5HA 1C1DB 2FMKA 3EW7A 4WK4B 2XE7A 3RYFA 1IYZA 5JAZA 4YMSA 5ED4A 1NLMA 4NH4A 4Y2QA 1OPRA 5IYZB 2XRMA 3ND6A 5ALMA 5IWCA 1M3SA 3H87A 1U7XA 1U1EA 3PR1A 4XD2A 4GS5A 1QK4A 2CCKA 2QUAA 3L84A 3E15A 3VAAA 1NE7A 3ICQB 2A7QA 1MLDA 4F56A 3S70A 2RH5A 2Z5LA 1E1QD 3HY6A 4CM8B 4RTRA 2YS6A 1RQRA 2FGJA 2GBFA 3GXBA 4X54A 1U94A 2X9VA 1UOOA 5K6RA 2R2GA 2QSJA 1EJ0A 1O57A 3QJYA 3EGXA 4XQ9A 2PUGA 1V45E 3I92A 4HDSB 3GRVA 4ZPJA 1KAEA 5TV2A 5DNYB 5IX8A 4BU0A 5KTTA 2VHTA 3RCBA 4G0YA 1I0IA 2WJ3A 5I7RA 2EQ5A 1W5TA 4YRJA 3B52X 4GNRA 2P69A 2PUWA 3CEPB 1FS4A 3K7EA 4MQ6A 3RM3A 1TEXA 3UZUA 3VR5A 1Y6GA 5A4FS 3GZJA 4Q7LA 2WTEA 1QORA 2Y67A 3QG1A 4XOUA 5CD1A 2H6EA 4P4TA 4BV8A 1Z5OA 5CCDA 2VIIA 5AVXA 1ADCA 1P8JA 2OBFA 5IVPA 5T6MA 4IGAA 1KY3A 3HYNA 4HYYA 2QSZA 1XQVA 3DE3X 4WUVA 1CE8B 3DNFA 1US8B 4IDPA 3DFKA 4ZAXA 4CEHB 4RFSB 2F67A 2H9AA 4C7MA 1K3FA 1J2YA 3WX0A 5A4MS 2EZ8A 3K1ZA 5EJ2A 3T3IA 2PX0A 3TW8A 5MN6A 1T6BY 5DLPA 2YFQA 3KKNA 3IV7A 2P8SA 2PX8A 1LK5A 2PZFA 2KHZA 4HX5A 1RJ9A 5LNK1 1T9ZA 2J3MA 2JCVA 3UO8B 1YJCA 2V7VA 1U2GC 4H6VA 3ECAA 3CJQA 1O5IA 2C5HA 5JTUA 1RXWA 4EB3A 3KLPX 1P0PA 5I5GA 2FR0A 5FA5A 4BZXA 2XUIA 4AB1A 1CUEA 3DCIA 5K4AA 4PYNA 1T9GS 3CRVA 3V2HA 1FW8A 3N3AC 1X38A 3O9MA 3CONA 3HFJA 4YXFA 2W42A 1NUUA 2JGAA 3QVKA 4FIDA 2OCLA 2XH8A 2IXDA 3F78A 4C03A 1NYTA 1KGSA 4BCDA 4ZALA 3W5UA 1AKNA 3BDVA 4EAAA 5I4KA 1KMIY 4JBLA 4Q3LA 4URFA 3BF7A 3ITKA 1WZEA 4U6NA 2LW7A 3T3MB 5IKPA 2DERA 2A9FA 2G5TA 4B3IA 1ZK1A 2FETA 2YHUA 3LFUA 4DZRA 3ZWCA 2AA3A 2CVHA 2YS7A 2RGYA 3ABRB 3O2JA 4DA0A 5KOJB 2QYSA 4BLRA 3W5DA 2HV8A 4MPTA 3DM9B 2JK1A 1A2QA 2GOYA 4JUFA 1SUSA 5FWXA 1FSPA 5JR3A 3IURA 2O6HA 3L9WA 1L1EA 1USWA 1U1IA 2DWCA 4FDMA 2ZR9A 4F4JA 4R71A 4KI0A 3FWHA 5T8KC 1B93A 2C7BA 2HIGA 1FQJA 4QBIA 5KNDH 8GPBA 3FGNA 3NOQA 3RK1A 1QHHB 3CA8A 2ISCA 5DGIA 1K8XB 4ZGWA 1CPYA 1IBMB 1FFWA 1UL1X 5DOZA 5CBPA 1P1BA 5HRAA 5K0GA 3M8KA 5EVJA 3LHDA 2A92A 5AKKA 3LTEA 1FRFS 2C29D 3RVDA 3H1FA 4U5QA 2YWFA 1KY2A 4EO9A 3OLXA 4GXQA 3FM9A 4BLUA 2EIXA 5BN5B 1WF3A 2F9LA 4KYIB 5REQA 2Y0CA 5AUPB 2O5EA 1DT5A 2ILVA 4IDDA 1RE1A 3X1ZA 4I4TF 3IR5A 4V24A 2NOAA 2FWAA 2H1CA 2YXEA 3AV3A 3MCAA 5ALKA 4YT2A 2Z56A 1C7JA 1D9ZA 1Y1KE 3E4CA 4ROTA 1E8DA 1NGSA 1B43A 3HDGA 2GA9A 3CC8A 1TD1A 3HS3A 3T5CA 4P93A 6NULA 1YB2A 1NUTA 2QENA 4UVIA 2I2DA 1LBSA 4U7PB 1ZVJA 2WFLA 1AS3A 1MMFB 5CBKA 3SSMA 2ZIVB 4KN5A 4LV5B 1C3VA 3IXMA 3L0IB 3PXBA 2B7CA 2GF2A 3PC7A 3X1MA 3WMEA 1TF7A 3EAGA 3Q0EA 3UWDA 3AHGA 4CG1A 1O7JA 5IXYA 5JRJA 5CA1A 1GITA 4UM7A 5JBIA 1WR8A 4PG4A 3TGPA 3TK1A 3ZDRA 3FRHA 1R0LA 1AQLA 1DQYA 1BMFD 2G8LA 1KERA 1SNYA 3VH4A 4NENA 1S1CA 1SD1A 3WGLA 3X1XA 1WQ3A 4X7PA 2BFPA 1A9RA 1SUBA 3L7LA 5BOVA 3EDQA 2XB8A 3NH6A 8MHTA 1GLVA 2XR1A 1EX9A 3F7TA 2EJUA 3EZXA 4YJ2A 1Y3DE 2E21A 3COVA 2WP0A 1NW7A 3CKYA 4LJ9A 4H3HB 3BXHA 1JS1X 3SIWA 4GPZA 4WQMA 1C2TA 2PU5A 1G3IA 1S6YA 3N1UA 1NVBA 3G2OA 3JZMA 2FI1A 2VZ9A 5BQXA 1G5TA 3HABA 1T4MA 1GGNA 1UDCA 1H8HA 1W93A 2AMYA 2VQ3A 1ZZEA 3MF4A 3OM9A 4OQYA 4AY3A 5MFPA 3UFBA 1H2RS 1UK8A 4MRMB 3N2NA 4DARA 4QUHA 4F71A 4OO3A 1NUQA 3VOAA 2IJGX 4A8JA 3HZRA 3JWHA 4NECA 1ECGA 3H17A 3PLRA 3WTBA 3U9LA 4BGVA 2FQQA 3QI2A 2H8GA 4I55A 4CCSA 2QNBA 3D4IA 2QGZA 4EYEA 3KCNA 2M9MA 4KR7A 5I7FA 1JFSA 3X2FA 1ZL2A 2B78A 3ZCTA 4O2BA 4IXDA 4RD3A 4IV0A 4I8IA 3DBRB 1P5ZB 2CNWA 2Z8YA 4EX6A 2C88A 2MOKA 1KC1A 3G0DA 2A14A 1G64A 2YBEA 1KKUA 2XWJI 1LD3A 1LQ2A 4IHJA 3PHCA 4JEIA 2HLDA 4UNIA 5CLQA 2ZI3A 1WW3A 2JEZA 5FI3A 2O6LA 1M0SA 1ZIOA 1N3BA 3ICPA 1BKSB 3V8VA 3LIPA 1U3GA 1USVA 3VHXB 1GTVA 5C7IO 2ZI9A 1R74A 3TBKA 1E2FA 2FAXA 2J30A 2B3TA 3UUEA 5K8IA 5JADA 2FW9A 4FMBB 3Q7RA 3LO8A 4AZ3A 4P7FA 4J1TA 3FMGA 1KVRA 3B6IA 1CDEA 5CDUA 3I5XA 3P0RA 3NDIA 1GV1A 4OJTA 1IN4A 4Q34A 5JNWA 2IZ6A 1F6WA 3BSSA 3KEQA 1PJ4A 4MK4A 4A6EA 3DTVD 2HF8A 1NLYA 3THXB 2GESA 3K53A 3LYLA 4D99A 2Y8EA 3D7MA 5JRZA 5H3HA 4TLBA 2IGTA 2HF9A 4DIKA 3P9SA 3CUVA 4XLZA 3CEJA 1GL7A 4YRFA 1T1RA 3AU8A 5DXFA 4ZZ2A 4JLDA 4OI1A 3U3MA 4Y18A 3VR5H 3NW9A 4B3CA 4ZTUB 1U9ZA 1PS8A 2Q62A 4AZVA 1TX4B 1E63A 3SHTA 3LUGA 3WC4A 2X1VA 1MO5A 4N7MA 1ZY2A 5KVVA 1SQ5A 1O6FA 4IG9A 4V0NA 3LV8A 3DDOA 3KSRA 1QTNA 1FB5A 3G2QA 5FOXA 1XL0A 1NPYA 2FWMX 1YD7A 3CZRA 1TQ8A 4M0FA 5ADWA 4RD4A 2AVNA 5BSUA 1BA3A 1KP3A 4YASA 1BX3A 1E64A 3F3KA 1GGHA 2V45A 3DFZA 5L53A 2AFHE 2YWGA 3GC6A 4UNNA 3OTQA 4DSTA 2V7XA 3E81A 1GNRA 4RVHA 2C99A 4DDUA 5IM4F 4QVIA 4WWHA 1G7RA 5JYDA 5IXSA 4JNCA 4IIBA 2W98A 3A25A 4IF4A 1FMFA 2ZIFA 5AO9A 4EP1A 4CIAA 2EFDB 3QU7A 4JUBA 3U7IA 1NVUQ 4KKXB 3LCCA 1DSSG 1Z8FA 2WF9A 2RGCA 3R5JA 4L9SA 1ZS9A 2D3TA 3RLIA 3TKAA 5IZCA 1PJAA 2DQ4A 1WU7A 5I9MA 4BX2A 3JRXA 1LS6A 1Q6ZA 3L0ZA 4X7MA 3RVOA 2C84A 2NPIA 2Y76A 3BHIA 1KHTA 3BRWD 3V8RA 2JI7A 1R3UA 3VZPA 2IVFA 3PUKA 3ROGA 3MEQA 2WWTA 1JXOA 2CHVA 2RGRA 1E5LA 3A6ZA 1FDVA 2R00A 4NKRA 2L82A 1LWOA 3DVAB 2P9JA 3KQSA 5ALPA 3AKZA 1GPDG 2XD9A 1YH3A 3SJUA 4D02A 3DBHB 2UXDB 3K0CC 4OGWA 5JLJA 2PT7A 2QR2A 3H1GA 4BFUA 3G7UA 5EIEA 3MT0A 3GAAA 3AM4A 2VTBB 2FCAA 3JVVA 1QIJA 1V1RA 2GXUA 2GX6A 2PLWA 1R4AA 4YYEA 5CFOA 2IYEA 3V46A 1OLUA 2YXNA 1TUGA 1EK0A 3HRIA 5AVWA 2QQ0A 2KQUA 3U40A 4ZXFA 4C0SA 1W581 3CNLA 3DXFA 1ECPA 3DV2A 5EMKA 1W49A 3UAYA 4WGFA 2E6KA 1EXVA 1EWKA 3I37X 1P1KA 4DL9A 1U7OA 2JLCA 2YOHA 5IARA 4NJMB 5IK2A 1P1IA 1U6IA 3MWKA 3PEEA 1GFWA 4ND4A 5A3QA 4XFKA 4MYHA 3QSGA 1EFPB 3LLMA 1FX0A 4G8JA 4W9NC 1PZXA 2A9RA 2AUTA 3V1YA 1RT9A 2MMCA 5EMNA 4QPJC 2RK6A 4D92A 4CXMA 2A8YA 5A9TA 5F3WB 3HKCA 3LC0A 4I19A 3LH5A 1KOJA 1M72A 3S3TA 4ZDWA 4F2WA 2O2DA 1USGA 1SIWA 4YRPA 2WDZA 4QFCA 1EVIA 4I08A 4C5AA 1YS6A 3GQBA 5T6BA 4EVQA 1S7CA 3D8BA 3IAHA 5JYCA 2A9VA 4U0JA 1R9NA 2AFHA 2NO9A 3PGXA 1Q22A 3LZ6A 3GMIA 3BBPA 3AEYA 5IVKA 2CLOB 3PTLA 4Z0TA 1DX9A 2OO7A 1WMEA 1C8BA 5H68A 5LYYA 3II6X 1KFCB 2DBYA 5BN3B 2AFIA 3QKUA 4W1SA 5DHSA 2NT4A 1II9A 2QTTA 1J0XO 2QW8A 3EQ2A 4MR8B 1YQUA 4L73A 4GR4A 5CA0A 3GYGA 2Q21A 3LWZA 4EDFA 2ZRBA 1RYMA 1TYCA 3N8DA 3EPKA 1N5OX 2QVLA 4FDLA 3GUZA 3G5MA 4JJ8A 4UNPA 3UMRA 1XZ8A 3OTWA 1RP7A 5EG5A 4PHGA 4JI3B 3V6MA 5KKAA 3BL8A 3UJBA 1JFLA 3OPVA 3REGA 1YHZA 5J2TF 3AKDA 1KEEA 2HWWA 3VISA 3K0FA 3IAAA 3CVOA 3W6NA 4DJDC 1AGYA 3HFSA 4WKOA 2COKA 1F8XA 3MN1A 4JGGA 3SQXA 3ZYCA 4D3XA 3HXOA 3B36A 1NX6A 1N2SA 2HA0A 2ZXFA 3N0XA 3OMWA 3AR8A 4YV0A 2XYVA 3C5VA 4ICIA 4XTCS 3ZU4A 2C1ZA 2QMZA 2IGBA 4TM8A 4Q15A 4X8LA 4KLNA 4Y30A 9GPBA 4LK2A 4HHEA 1K5HA 4V1CI 2G7MC 1JWAB 2IITA 4R41A 4DANA 1GT91 1W25A 2NU6B 4RTSA 4HO1X 2KLBA 2OLKA 2O05A 2J3HA 4BMDA 3AI3A 1YTLA 1EXDA 3DEHA 5HIIA 4PICA 4KIGA 4IIXA 1T4CB 2EL7A 4NEHB 2GDZA 4BQSA 1L5GB 2H16A 4HL6A 1U0NA 1XDZA 2R11A 4ES6A 1GNPA 1EQ2A 2HJSA 2R6AA 3MGBA 1WUJS 3HUFA 4GZMA 2DHDA 4QU0A 4B5LA 1XR3A 4OFXA 4RO0A 1M0WA 4OH1A 5IEBA 2BEVA 5K0NA 3I45A 1E98A 2QX4A 1GSOA 1NMYA 4WACA 3TVTA 5FDFA 2XW6A 3FKJA 1T5TA 1Z2NX 4UBKA 1TM7E 4UU7A 2VVTA 2GT1A 4IINA 4S2EA 3UANA 1EFVB 3WHKA 2FH5B 1VA4A 4EHBA 4MTLA 1BMQA 5ESRA 1DQNA 2CJPA 1OFIA 4EMTA 4G2NA 4HT3B 2MYUA 5IJ9B 3FR7A 1RKBA 4JGBA 3WAKA 1G3UA 1E9RA 1AA9A 4QECA 3FHOA 3L1JA 1SBQA 4OI0A 3UQZA 1Q1NA 1EFHA 2VAXA 3UKOA 1NVAA 5LQJA 4MR9A 1MJHA 3WOVA 4PGMA 2C4VA 2NXWA 3ZV4A 4KIJA 1J9EA 2C61A 4JYCA 1CEXA 5AVVA 5GVSA 2H63A 2CWDA 3E2PA 1M1NB 1NBHA 2QTAA 3QWFA 1L3CA 5EWJA 1RW4A 1AZTA 3OIYA 1JLSA 3K35A 4IQGA 2W2TA 1XD2A 2A67A 2QZJA 4E5MA 4OJQA 2LXNA 4FMDF 5T3YA 4XDZA 2PXAA 1G8JA 1V9CA 2B4AA 5ESDA 2O1SA 4IJ6A 1OZ0A 2IXFA 1LPBB 3LXMA 3O8QB 3L4JA 2OFWA 1T2AA 1NBWB 4RENA 1YVDA 2HDNB 3NBQA 2E4VA 1VMKA 3L02A 3ZWMA 1P33A 5HFAA 2ORWA 4LJAA 1DC3A 2JJ2D 2PH5A 3B3JA 2HXGA 1KFBB 1PJTA 3FJ1A 4E07A 2PEZA 3RWBA 2PD3A 2I3GA 1CZUA 5IXJA 2PN1A 2HK7A 5FORA 1WUIS 1N6PA 1E9DA 2D4AA 3A3NA 2LIPA 2VTEA 1Y8CA 2YMLA 3R5TA 4JOCA 4WA7A 2XVYA 1CYEA 4QUIA 1J5PA 4TKZA 1Q19A 3COWA 4BEVA 2A1TS 2I8LA 2HDWA 3UTDA 4HH1A 1TF5A 1UOQA 4RXMA 4ND1A 4X8OA 1ZM4A 3GELA 4E14A 2FCRA 3DKPA 3T8YA 4YCAA 5KJFA 3OH8A 4GP7A 3TH5A 3STUA 3FOCA 4LRXA 3KKLA 5BMVF 2H4FA 1KJJA 3HDYA 2ZR8A 4L4UA 4YJGA 3N0WA 1GVHA 4MW7A 4P32A 2VSYA 1XLUA 2E49A 3TRIA 4DSAA 3ZLJA 4LV8B 3PQCA 1T24A 1G63A 1WUYA 4GPAA 3GLIE 1PSWA 2UYHA 3E9EA 3U4AA 2RHLA 1IRIA 1TQ2A 3CEHA 5FEMA 4HQ6A 5I8WA 5FCDA 4CU2A 5DO9A 4UHKA 2DLDA 3TPFA 1DAHA 4GOXA 5JWOA 3MSCA 3PFFA 5CT6A 2PSEA 4UEJA 1QP4A 1ECFA 3OJ0A 4RHYA 3F5FA 2C8KA 2IODA 3NBYC 2J3JA 1G291 1EVQA 3IEKA 5F1KA 1LEHA 3WDLA 3K6RA 3WQRA 4F6RB 4J9VA 3DXYA 2GAAA 3PL5A 4JJKA 4WX2B 4DV2B 1O6ZA 4LSWA 4YRCA 2IZ7A 5FXMA 4R51A 4EA8A 2GF9A 4L2IB 3S1AA 4FPXA 5AXAA 4LRYA 4EK9A 3ZGVA 1FVOA 5DW3A 2O8EB 1C9DB 2P2GA 1FSSA 3SC6A 1F06A 5DHUA 3RYCB 2L42A 4CIWA 2QE7A 3RRMA 1ZCJA 3BE6A 2FRXA 4EGAA 4J2TA 5K20A 5E2AA 4MYSA 1RHUA 8ADHA 4GE3A 2EDCA 1A96A 2YFKA 3H6KA 3OZSA 1SKBA 3CBQA 3A2NA 3PJFA 1Y8AA 3G1WA 4J2OA 1AKWA 5F23A 3G2MA 1B1AA 3OBIA 3PQ4A 4FCVA 4CEIA 3D0OA 4HYEA 4CV3A 1D04A 2WK1A 3CPJB 2OVBA 1TLTA 1EGVB 1NM5C 3E05A 2D1TA 2QVZX 1ZCZA 2YR0A 1UDAA 3KHUA 3HPRA 1KQOA 4JLWA 2QD1A 4WI1A 2DKOA 1E2UA 4L9AA 2VJAA 5IAEA 4LN1A 1RXYA 2A9QA 3HXPA 1GTL1 2PKEA 2FUEA 2C97A 3SZUA 3LPAA 5TMPA 4CUJA 1IQ0A 1KYYA 3GA0A 1UPAA 2HGZA 3JYPA 5B4VA 1U3UA 1E2EA 1U3TA 3A10A 2WJIA 3OZWA 9MHTA 2ODPA 3SXUB 2G6BA 3LHFA 2QT9A 2FR8A 1HL7A 3X2EA 1AT1A 5A3JA 3DFFA 4HF7A 4RVSA 1R50A 1YDHA 4XQGA 2FN3A 1C1HA 1R8JA 1DC4A 1Z35A 1LV8A 2WHRA 2WIGA 3L92A 1A5AB 5FF9A 2AD1A 5K8JB 2W2KB 3OF5A 3UT0A 3L7BA 4NABA 5EJFA 4RHXA 3LSTA 4JROA 4LXXA 3KDSE 4WJZA 1MNAA 5H59A 3NHUA 4UTRA 2XCSB 3U4QA 1ZJ5A 2C96A 4JMLA 4EG6A 5KJ1A 1OXBB 5E9WA 2NVOA 3LUHA 4EUEA 1D2EA 2X77A 3QW4B 3ZDDA 3FTEA 3U44A 4CDGA 3K09A 4LQLA 2HHJA 2GFHA 3DKVA 5C5IA 2YHBA 2PG3A 3NTRA 4OH7A 1MAHA 2DFLA 4Z6KA 4MGIR 3RS3A 4U1RA 5BYBA 1CDZA 3OT1B 3X1WA 1M6HA 2AF3C 2PVCA 4HJXA 4IVQA 4P5PA 4YUAA 2YXDA 1OYOA 2SCUA 4PGHA 1FFYA 5CVTA 2X2OA 4KO2S 3RWMB 4FK8A 3VDQA 2N3ZA 2PS3A 2XHZA 2XPCA 1EUDB 1UJ2A 4CU5A 1EUQA 1ZJWA 4IP0A 2HSWA 2MINB 1D4AA 3JYNA 1TM1E 2O0LA 2RHRA 3FH0A 2FMUA 1NUSA 3KOUA 3MJVA 4IQ0A 4LJSA 5DGTA 3ONVA 4DG5A 3FOFC 3C0KA 3OCUA 2WD8A 4BWVA 3CTPA 4LI0A 1L5HB 4BO8A 4Q4JA 3FROA 3HN2A 2QRNA 2QK4A 3SHVA 2R6CA 2JJ2A 3WO0A 3BORA 4H35A 1H0RA 3NYWA 4EPRA 1Z0AA 2XODA 3IPCA 5EXDA 2H1VA 1V1MB 4U2KA 2JNWA 5AXCA 3O1HB 2EF1A 521PA 5JS8A 3T5PA 4JUAA 2YL2A 2QRJA 3BFKA 3FA2A 3ZTYA 1CB7A 5DT9A 1IM8A 1RWQA 1FXWA 1OXSC 2J1LA 1ATZA 1EUZA 4I9HA 2DQYA 5HQ3B 1GGEA 2REXB 1NG1A 2ID7A 1ZRSA 4GPBA 4XDHA 3RYFB 3N74A 2AJBA 4IR7A 1SOWA 2HJGA 3FSEA 3OU6A 4AC9A 4HY3A 3TVYA 1XTBA 2GARA 2XSZD 3SDBA 3H04A 4QOHA 3AY6A 1YBHA 1R8XA 5CB4F 4GGPA 1UZUA 5BQ5A 1D6SA 1XMPA 3KQHA 1JG3A 3TZLA 1GCAA 2R6GA 2WP8J 3RUHA 1ONOA 1RRVA 1OIWA 3N6VA 2PZ8A 5HE9A 5HF6A 4K46A 1O97D 4RWZA 1M2OB 3JAKA 4MIEA 3GH1A 2H4ZA 1DEAA 4A36A 4DCNA 3MT9A 5LA6F 2JCBA 1EEXB 1ADJA 4W5OA 2D1QA 3PIDA 2NPOA 3EVFA 1U7UA 4QBHA 5DBEX 2FY8A 4ZOAA 1P4SA 1UM9A 4FGJA 3PNBA 3EVAA 3BFPA 4IQ8A 1HR0B 1I5EA 2EFGA 3P1JA 2IW3A 4HXGA 5DWQA 2CSUA 4FEAA 5AJTA 4AG3A 1XQYA 2DPHA 2IYPA 4FOPA 4IJQA 1QZXA 5TQ0B 3E9NA 1F14A 3B8HA 3IDFA 3P9CA 3G0HA 3RREA 2H7VA 4KPGA 1U5BA 4E30A 1N6LA 1PG2A 2RGUA 2CD9A 3M89A 1EVJA 1Z47A 4GKVA 3KD3A 2DWOA 4XGIA 4D98A 2C3YA 4OP2A 2CHQA 2FDXA 3AB8A 3K31A 5DTQA 1ZK2A 1LJLA 4HWGA 2PUTA 2V1UA 1V16B 2NPFA 2PRIA 4F4IA 3FRJA 2C8VA 4UVDA 2P91A 4NBSA 5B7NA 3N07A 4OVKA 5GJCA 3NFRA 1H2YA 3K72B 4LWOA 3TW8B 3K4HA 5A9RA 3KJZA 2NYUA 3C39A 4BE4A 3TW6A 4AS1A 4MARA 2LKDA 1E6KA 1WSBA 4WKCA 2GDJA 1PGNA 2VCHA 3CPHA 4XQEA 5AW5A 1R0WA 4OJMX 3PRKE 3SOZA 3ZHUA 1CRPA 2PRZA 2DPGA 4PQYA 1PFUA 3PXDA 1KRWA 3EWIA 1QQBA 4V03A 4I1PA 3G8YA 3A26A 2ADOA 2YKGA 3FF4A 1U9IC 4PFKA 2ZWIA 1O94A 2ZBEA 3R2JA 3DYVA 1H5UA 4TWIA 3WLOA 4D41A 4CM6A 1V7QA 1LJ8A 1SBYA 1ZD8A 1QHYA 4N4AA 2ZRCA 1P31A 4RJJA 2PGIA 5A04A 4OQEA 1PV4A 4S35A 3PHLA 2J3KA 1JDUA 1ILEA 2DHCA 1DARA 2Y4NA 1K4MA 2JI9A 3EVNA 2GHIA 1YSCA 4UW9A 4HZGA 3AUAA 1PGPA 3H8WA 4I8XA 3LKVA 3N70A 3ELYA 2NSHA 1OZFA 2Z5GA 4M21A 2ID8A 3X44A 5K0FA 2ZKIA 4JASB 4BL5A 1VMAA 2X7HA 2JLVA 2XVXA 2Y05A 3J7AC 5J9FA 4ZHQF 2NZYA 3FMOB 2IW1A 4MH0R 3VO9A 1NXWA 3LUPA 1RAIA 3PE3A 2E0IA 3UKJA 5CFZA 3K9FC 3WKCA 1CUIA 3DEZA 4MP6A 4DQLA 4MUEA 2HA4A 1PL6A 3E7PA 2BMEA 1JLKA 2QTLA 1Q7BA 1HWYA 1IE3A 3L7CA 1OUMA 2P79A 4BO9A 2PHZA 4JLJA 3HB9A 1XB2A 2NUAA 3I2FA 4IDNA 4M1WA 3S2SA 4BZQA 3PCRB 1DG9A 2W5UA 1NF9A 1FUUA 3H5VA 13PKA 3AILA 2XIJA 4FXOA 2I03A 4TV9F 4EEZA 4EGSA 1CUUA 5F1OA 3ZC3A 3E22A 4G0PA 3QUAA 4DLUA 2O0JA 4ER5A 5EEGA 4C05A 3IH5A 4JL8A 5CBPB 3QRWA 4YQZA 5AKJA 2PAAA 4HRVA 2TS1A 4QATA 4AXXA 4QULA 2PA3A 3DDHA 2DKNA 4LOKA 2GSWA 3LZCA 3SFVA 3DFMA 1JQBA 4OFZA 3B85A 4DKJA 4F60A 1E4VA 1A9OA 1G0NA 3TD6A 3AZPA 1Z5NA 5REQB 3BTUA 2MSEB 1L5LA 3R5SA 2FLWA 3P9YA 1R4MA 4R8KA 4NZYA 5NULA 1PYOA 3FGZA 3MS2A 4AKEA 4RK7A 3HRHA 1KI7A 1QFMA 3DDSA 5DGXA 3BMXA 1XRQA 3RU2A 4UE3S 2Y71A 3NHSA 1PJ8A 2DYKA 4Y9RA 2PH1A 5TMDA 2WFLB 3LF2A 5SY6A 3ZK8A 4UE2A 2IHNA 1K7FB 3ZXIA 3KAKA 2XDQB 5IVDA 5KQSA 4FYJA 5AIBA 5F5XA 3AP3A 1JEYA 2OBMA 3C8MA 3VNQA 4H27A 1UOPA 3L5OA 1KR5A 1X74A 1CJKC 2WUVA 5CA1B 4PHFA 1XTJA 2RC5A 4EH1A 5L3QA 5JSQA 4DC9A 1VL2A 3AIKA 4MS4A 4IM7A 3MTJA 4I8DA 4NENB 4RF5A 5CAEB 3DWGA 5KYKA 3VSAA 2PNFA 2XBMA 2Y66A 1ZGBA 5EA2A 4LCJA 5HJEA 3UN1A 4EOGA 2AK2A 2VUIB 1G4HA 3C5CA 3VBCA 2NV2B 1KP9A 2G36A 2WMNB 1V7ZA 2GK4A 2ZAIA 4G24A 2VPTA 4RKFA 5DDIP 5LJLA 4YJ2B 1COWA 2PVSA 4GL4A 4FP9A 1WCV1 2WMOB 1K4KA 2XD4A 1IZ0A 1EIZA 4M7WA 5IW8A 1Y8ZA 2VTKA 2IYUA 1VKRA 2OAGA 4GWLA 1DXQA 1C9YA 3ZWKA 2GPJA 3T12A 5CLLA 4CNQA 3LE8A 3MWGA 1HE2A 2HUNA 2AEMA 4DUGA 2YV5A 3JATA 4TYYA 1DGQA 2KPOA 2FW1A 1OGIA 2NIPA 2V0NA 5BNFA 2VUSA 3ZW8A 4ZI7F 2R4QA 4MKZA 2JZOA 1KMCA 4A16A 1W85A 4I55B 4LFBB 3SM9A 2GASA 3NV9A 4HNUA 1PR0A 4P4NA 4JKOA 5DM1A 5B3JC 4RPGA 1GV0A 2IYYA 5KQMA 3EN0A 3LQRA 3JR3A 4O2BB 2BTOA 1LV7A 5KNCD 1WMAA 4PCVA 4EYKA 1MW9X 3SLRA 4OBWA 4L4SA 5AM2A 1QX4A 3B1YA 3I2IA 4G67A 4CL0A 1YI0A 1IM5A 1K0FA 3BK2A 3SICE 3OOJA 3VDNB 2Q4TA 4IHJB 1SG6A 2ZRQA 3HP7A 2ZTLA 3GD7A 4KLCA 3BWXA 4NPHA 5DFAA 2L18A 2GTHA 4Z7QB 2MYTA 4R9NA 3H0CA 1W34A 2XXAA 4KXMA 1NZJA 1UZNA 1IAVA 5CFQA 4CMKA 1Z0FA 1L5NA 3GUHA 4ETWA 5JXGA 3HCWA 2PQ6A 2HLHA 4RK6A 2FWPA 4GRDA 2I2BA 3R7WA 3GRAA 2O4UX 4KFTA 4AZ3B 1BJTA 1J22A 4OHBA 1DRUA 4UJ5A 1A5BB 1JIQA 1TA0A 4B76A 2W0MA 3IAS1 1RLJA 2E48A 4HUQB 3WA6A 3MILA 2GPBA 3RE1A 4RTMA 2YIMA 1I7NA 1L7OA 1Q1ZA 3KOYA 3KZVA 4HFRA 4LDAA 4DLSA 3U6KA 4IUCS 3ILYA 4DDMA 4LE0A 3ZOKA 3SIPA 1R7RA 2RHMA 1YBFA 3KOXA 3R6LA 4R69A 1RFLA 4IAOA 1CBUA 3OA2A 1W48A 1ZK3A 5TF0A 1ODTC 5ADUS 1Z88A 1M10A 4HDNB 3PNPA 4LBZA 3AH8A 1UP6A 2J7PA 1G4AE 2C03A 4HP8A 2Q9BA 4I66A 2KSQA 2C4HA 4F5EA 3AR6A 3HXKA 1IEQA 3I5UA 1FJHA 1FSFA 2XWBF 1DRKA 4WN9A 4YXWD 1L7XA 5H83A 3VNSA 1BH2A 2WU8A 4W5QA 2BN4A 4DR7B 1P0QA 2HA7A 5FO0A 1FTNA 1UBSB 2VK8A 1CD5A 5NLLA 3DMPA 5EGNA 1SOMA 3QA9A 2JKZA 5KQRA 3I34X 4WNAA 3HWSA 3UHAA 3ZCXA 3C8ZA 2XNKA 4RQAA 3I05A 3GD5A 1MOPA 3KAJA 1D2GA 3SNKA 2F1IA 3QGMA 4BWGA 5AM3A 1FMTA 1XRMA 4Q7QA 1CTQA 4BQNA 4GKJB 1HOXA 2BLNA 3BXPA 3D4LA 3EEIA 4Q9AA 3HUTA 2IV3A 4A7PA 4RDIA 1Y98A 2FW6A 3L4SO 3WLAA 4HLQB 4UFOA 1ES9A 2QQ5A 5JARA 1I3MA 5CX1A 4YUZA 2QD2A 1MP0A 1TGYA 2ERYA 1Z7YA 4L0CA 1PW7A 1GCOA 1GZ5A 1GAEO 2H08A 2MSCB 2ZYAA 1BXGA 4M9XA 4OQZA 3VZQA 4BGUA 1UIRA 4EX7A 4KX5A 4F4HA 4OTZA 1KOFA 4PSVA 1KQNA 3GJ5A 3AF5A 3V9PA 3ICVA 5I7VA 3S68A 1VJ1A 3GGJA 3P9RA 1RRGA 1SB9A 1XZNA 2CYBA 1EB8A 1Q0LA 4GRIA 1MAVA 2BEWB 2Q8NA 2XF2A 3FW1A 4G5HA 4R54A 4GMDA 1X2BA 2NM0A 1BD4A 2WM3A 1P7YA 4PWZA 2OORA 1RC1A 5GOTA 3GZTB 5FA6A 3UY4A 5BNZA 2IU3A 3UMMA 1K8QA 3EARA 3ZBTA 3RSOA 1VQ1A 1NN0A 2PQMA 1N2XA 2V6BA 1XZMA 4GLLA 2HCJB 5BRNA 3AUUA 3SPXA 3T5DA 2EZUA 5CR9A 4WCFA 1CQWA 1LXCA 1V1RB 4WFIA 3M6XA 5HK8A 1V95A 1K2WA 4BZWA 2FLKA 1DAMA 1T9AA 4PYMA 1AURA 2F48A 4OP1A 3U3OA 5SV2A 5TXGA 3QOXA 3WLKX 3IBFA 1OLUB 4TWJA 2UUAB 1GP2A 4BB6A 4D7AA 4FNAA 1YMVA 4NPAA 1O8CA 4Z3KA 2AKAB 4I0WB 5DN9A 3BFXA 1B0ZA 3NATA 4QE3A 4R2XA 3GCZA 4ON9A 1Y8RA 1HFEL 1PZFA 4PO8A 5SICE 4MUNA 3T4EA 2FMIA 4RORA 4F84A 5LBTA 3SN6A 5IAAA 4DLRA 5C0OE 3PUWA 3FYSA 4MAFA 3O1IC 1RIIA 3OEEA 4PWYA 5ARCA 3ZXYA 1CJBA 1PR9A 3ND9A 3ZLTA 4KMOA 1NL3A 2YVUA 1P2BA 3ROFA 2LVBA 2UYCA 2AE1A 2A5GA 1MEOA 4S05A 1UJBA 2AW5A 3GZ4A 3HKCB 3IEVA 1U6KA 2J87A 2OZVA 4A1FA 2CW5A 3EGWA 4MVJI 4UULA 3VTAA 2AH5A 2RK4A 1U04A 2V6IA 2VF4X 3G5LA 4FZ5A 2QAGA 1PX2A 3WS7A 2A3NA 3M5DA 4AZ0A 2I4MA 4YDSA 2GYWA 3GQBB 2AV6A 2BCJQ 2FDRA 2P7HA 3BQNB 4N7RA 5F5LA 1CUYA 2CLIB 2GZSA 3HZZA 4KUEA 4MQUA 3CIFA 3I2GA 3DV9A 3HB4X 4OX9Y 3ESZA 2AFHB 2X1LA 5KNCA 3L7DA 3N59A 3VR4D 1ZM7A 4IQ4A 2SKCA 1WO8A 5BQ3A 2DKFA 3NFYA 1XRPA 3C3EA 3MLBA 3QU5A 2P40A 3CH6A 4I5FA 3VFDA 4P34A 2IOQA 1Y3IA 1X19A 1PCXA 2PYIA 3NJ8A 3OWOA 3D4BA 1QE5A 4CCYB 2VXOA 4EELA 4OQMA 3I1IA 1G8SA 3MUEA 2QMUA 5CA0B 2ZREA 1W6UA 3HV2A 3ISVA 5I9LA 3SZMA 1QQ5A 4CM9A 1V8BA 1C3JA 1JTVA 1NU8A 3HBJA 2WKWA 1M2EA 3SP1A 1T5IA 4ZOEA 1GFZA 1CDDA 4KFRA 2ISQA 1UBTS 4PSDA 2HJVA 4IUDS 4C4TA 3HDQA 2JZNA 5K0TA 4WASA 3B1KA 2YDYA 4GC9A 4FN4A 4RMIA 4TS1A 1SCUA 1CZOA 4ZHSA 4BWFB 1IQRA 2I4TA 4O3FA 3IVGA 4LYFA 4OL9A 4CTKA 4F9TA 5A9SA 2PSHA 5E9AA 1F5NA 1KEEB 3EH2A 4UUMA 4C7BA 1LI4A 1HLDA 3K0FB 7ADHA 3L8CA 4KUHA 3FNFA 1HL3A 1PZMA 2IXTA 1F8YA 3BWEA 1ADBA 2NZWA 4IDCA 4Z8XA 3LNCA 2WZCA 2IS4A 3KYBA 1HYEA 4ZXPA 4M0UA 1NJ6A 3ROQA 2B92A 2AEJA 3A11A 3EC1A 2CYAA 3NDJA 4QXQA 3KJNA 3TD9A 5JAHA 4KYTA 3Q11A 5KDDA 4OHMA 4UZEA 4DREA 4YUVA 4L3WA 3EFHA 5JY1A 4HS4A 1JU9A 2Z1NA 3FSRA 3INGA 4A5OA 2Y99A 3W34A 3TZEA 3O21A 1BAPA 3EVTA 3AO0B 1JHYA 1CHDA 1I2ZA 3KQUA 1IZ7A 1FU8A 3C3YA 3TCXB 5F98A 3PSHA 3K8ZA 3GLFA 1K7YA 3COPA 4CM7A 1EP1B 3LFTA 4GXTA 3QIVA 3FOZA 4HX9A 5DP2A 1QAQA 5AMXA 2R6HA 2FEXA 4INAA 3FKQA 4XZ3A 3D3QA 3RW9A 3WB0A 4M9CA 3R7DA 4DJ5X 1LPMA 5C7YA 5K5EA 5KKNB 2Q3DA 2OHXA 3ZNNA 1WXEA 2FWNA 3QU9A 4DWVA 2BEVB 1P2UA 2JHPA 3B7GA 4JI7B 2IRWA 1W0CA 1QHSA 4G4SO 5CTJA 3JU3A 2WAMA 5MGBA 1NF3A 1PVVA 5JMOA 3ZV3A 1NDHA 4IIEA 2VNIA 3PHHA 1W0JA 1OC2A 3F9RA 3MZ0A 1P19A 3AJAA 4WJKB 4BNDA 2OQRA 2WIAA 4OGLA 5ADHA 2CMDA 1N7IA 2WU0A 1PJQA 1FNCA 3AY0A 4C6RA 2BLLA 3G2PA 5B6PA 5J3JA 2X5NA 3EPJA 4ER7A 3MMPA 1HZZC 5CYOA 2Q46A 4C2BA 4KK4A 4CKZA 3KXKA 3HCEA 3QVTA 3W7BA 2YQ5A 4PZAA 1EA7A 4PC6A 4TS3A 2J6BA 4X84A 2RI6A 3DFIA 1XEAA 3IE0A 4CHTA 1KEKA 1PEKE 5A0VA 3Q6MA 4FEGA 4IBOA 1HDXA 3JSAA 4RJLA 5GONF 2RG7A 4J43A 3RVPA 2I29A 2K2WA 1NYLA 3EFBA 3PUJA 1KO4A 1N2OA 1TIPA 4U8GA 3ST7A 2VYCA 4PG6A 4D56A 4IS3A 1NJSA 4A2CA 3I6QA 1TE2A 2ZSHA 1L7DA 1KZHA 3SDZA 8AT1A 1H9CA 5KU7A 5A03A 4MV8A 3T7DA 3ZDBA 3HTXA 4HNSA 5B3KA 4NBWA 5EUBA 5FHRA 3JQAA 4A4DA 4A0HA 1TXGA 1XD2B 1OA0A 5FO1A 1H23A 5HJ2A 2RK3A 3HU3A 2C0QA 5IWAB 3GROA 3BULA 3NHAA 5KYNA 3CW8X 4LHEA 4KODA 5IJZA 4MUAA 1Z5ZA 3QYFA 1XJQA 2BFMA 4MP3A 2Y2VA 4E4YA 1J4AA 4TT3D 1D5WA 4ZVQA 3V8PA 1NXVA 1HEUA 4KXYA 5ICCA 1WEHA 2N9UA 3RTAA 1I30A 3M6VA 1VMEA 1U7PA 2EBFX 5ENDA 2EU8A 3I4LA 3WP1B 3FPBA 1QH0A 5F5NA 4DIFA 2PSDA 2V1XA 3R74A 4XARA 5B2FA 3DO8A 2GK3A 3UAVA 1MB0A 2WDPA 4OK5A 4M0MA 3R5HA 4BUCA 4P3NA 3VZCA 1LH0A 5JECA 3CVUA 1OIXA 5SZKB 1GNQA 2I4RA 3MNFA 3T5AA 2GEDA 4N6GA 3A58B 2VH2A 3D1VA 4KI7A 4RANA 1ILWA 4LNHA 4MW2A 3DC2A 2KE5A 1P0MA 5KINB 4LISA 1T1SA 2G76A 4BGDA 3GJRA 3VR3D 3GRFA 4B79A 3QEBZ 2RG1A 2ZJBA 4OF4A 5LZ7A 3L8YA 3SU8A 3G82C 4GLOA 3P2MA 3QUCA 1BXKA 1NA5A 4U2EA 4NYJR 3GRCA 3OZEA 5B7QA 5T67A 1RLIA 3DZKA 4JVOA 4WBNF 1O95C 1Y1RA 3K32A 4G63A 3QELA 2QM7A 3RBZA 5I9IA 2YXLA 2W2QA 1G7TA 1VL1A 1J7JA 5I7WA 2AK3A 3JD3A 3CF4A 2IBTA 2K7FA 3GFRA 4XWYA 3A9VA 5TLSA 2NVUA 3R7AA 4OXXA 4UZFA 4CGZA 5GINE 2W6JA 4XD7A 5JIBA 5BOSA 1KPGA 2IBSA 1ZBDA 2HMYB 4JJFA 3S1AB 3RRFA 1K86A 1Z25A 2AX4A 2HMTA 5EMLA 4YJ3A 3F6BX 1D2CA 2HO4A 5LDGA 2GMWA 3TNJA 4Y2HA 3WRYC 2HRBA 1XZFA 1KI9A 4EW1A 4GBMA 5AW6A 3SAJA 1UIMA 1UKCA 1IY9A 3ETHA 4YB8A 1XF9A 1JDBC 3PDIA 1WB9A 1XD9A 1U31A 4MW6A 1AKUA 3QU4A 2PKQP 5T64A 4ENPA 1B7GO 1PKXA 1UBFA 3U7GA 3DDUA 2V9PA 3WNVA 2J08A 4TX1A 2WG0A 3TSZA 1D09A 3DEKA 3VTKA 4B44A 1FNSA 4DPKA 2OBBA 5KNCH 1N3LA 1KI1A 4OQFA 4EJMA 1BG6A 5AFSA 1I4DD 3M4YA 4ZEOA 4FU0A 1CWUA 3DDCA 4JJ6A 3IHKA 4D2IA 3RSSA 4HMPA 5K99A 1J0BA 3NXKA 2QN6A 1HYHA 4PCLA 2ZULA 3EB9A 2HSGA 3GLKA 2WWXA 5B3LA 3USES 4WEOA 1G6HA 5HQJA 1KDZA 1OKKD 3TLXA 3VO8A 3U39A 1QE3A 3THYB 2B1GA 4UREA 4RLHA 4B3SB 1UEJA 1ICEA 2F7SA 1ZD5A 2JGJA 3KPWA 1T5OA 3CCCA 2ASEA 1F51E 2ZT5A 4LGVA 5LPNA 1UXHA 1QM5A 1F4LA 3GVHA 5J58A 3OF3A 1A69A 1TCCA 4WKPA 3UH1A 2V96A 5EXEA 3V7UA 3LT5A 1Q1QA 4QPDA 3C4VA 1UWLA 4D3YA 3OFND 3ETNA 3ADDA 5IC5A 1MZVA 3V1LA 4Q5IA 3DTNA 2VF5X 4EF5A 5HUJA 1BQ4A 1WV0A 1YJ8A 2CNDA 3LY5A 2ZIAA 4G26A 3D8UA 3O0DA 4U7FA 3TFWA 4EMSA 5AW4A 3SZLA 3GLIB 1KSJA 4TRMA 3U4QB 3QMWA 4MKFA 4QSHA 4E2YA 3V6LA 2AX3A 1HDYA 1I0ZA 1XDDA 2ZJ7A 3UH0A 1I6KA 3E03A 3RBAA 1LX6A 5KX5F 3U44B 2ZZNA 1BROA 2SECE 4BFXA 4TV8F 4JLKA 3AL3A 4RZ3A 4N41A 1JRLA 5KSYA 3PPIA 1TK9A 2YOFA 3RIHA 3T9BA 4HWOA 2Y9MB 4L02A 5SYNA 3HXLA 3IPLA 4KXWA 5JJBA 3HE3A 5JYBA 1YCHA 3PFKA 5GM2A 2PUBA 4I1UA 4RVUA 4DXHA 1PG0A 1ZDMA 1KI2A 1WXIA 2SCUB 3V1TC 3WMXA 3DTYA 1R4NA 1CJMA 1H2BA 1RKQA 3NBAA 4TTQA 1YCFA 4F3YA 2DTDA 2LKCA 4LG1A 3UHPA 1SKYB 4YCSA 2ZM5A 4HGYA 5M7EA 4JVMA 2BTQB 4BQIA 2OHFA 4RQUA 5IJXA 1SU4A 4OAOA 5LNK6 2IUTA 5KTRA 3T15A 1GL6A 2MSDB 2WU4A 3PE4A 4RHCA 1ZJ6A 4W8OA 3EPLA 4D25A 2AR0A 1JN0A 4Q4JB 4XJSA 3Q85A 2NXJA 3G02A 4HNAA 1EK5A 4QA9A 4RZXA 1WTAA 4Z86A 5K05A 1TZ2A 3D4OA 3EQ9A 2BFDA 2BHTA 3OZXA 1FRNA 2ZLBA 4OQPA 3U3KA 4I2NA 2PJRA 1J2JA 1VLZA 4G23A 4NG5A 3ESDA 4GPTA 2ODNA 4PS1A 1JT2A 3CZAA 4OXYA 4YJHB 4K1LA 4IJWA 4E5DA 2XMGA 2YY7A 3H1PA 3UK0A 2P62A 4PY2A 1EMDA 1F0YA 2FUNB 1KZ1A 2ON6A 2QY9A 2V65A 1UT6A 3H6HA 4R9SA 4RIIA 2HQBA 4YAJA 3UATA 3KKZA 5LMNB 4BNIA 3HV0A 1ZQ9A 1KH2A 4O59O 1AB6A 2WT9A 1VHDA 2YHIA 3DWFA 3GJ7A 4AQDA 4BMXA 1U80A 3DEJA 4G9BA 1CR2A 3V4VB 4CMAA 5JH7F 2ACWA 1LK7A 1ZK0A 4IRUB 5E1OA 5K1ZA 1WKCA 3NH9A 3V4ZA 3VTFA 2G40A 4C20A 5AVUA 1PFGA 2NZJA 3BT7A 3E0XA 4KQKA 3JAKB 2IX9A 3LY9A 4DCGA 3FCCA 3TL2A 2JG3A 5FTJA 4ZAWA 2EHJA 1G55A 2ZYTX 4KIUA 1E2HA 2PFKA 4P4GA 1FPQA 1QFZA 2BONA 4HBZA 3JQBC 4K6FA 1QIEA 4CM1A 5H0IA 4CT0A 3T3NA 1E89A 2EGGA 4YGXB 1FFXA 1UM9B 5D87A 3IBCA 1YZYA 2ZI5A 3HKBA 4BO3A 5AOAA 2NTJA 2X0KA 1Y9AA 2D06A 2RSLA 3NTLA 4DLBA 4EATA 2YJ5A 1T4BA 3KYDA 2ETVA 1UOEA 3RVLA 2O8CA 3L7YA 2F9FA 1RQGA 4ABTA 1OHHA 1Z12A 3O4IA 4UBMA 5A7GA 1DTWB 3RUPA 5AJXA 1U5BB 4W5NA 1P5FA 5AICA 1EWTA 1L4HA 1FVXA 2GN6A 4F72A 2E85A 4NOMA 1ZAYA 2WU1A 2C04A 1D7OA 4BNUA 4GI7A 4L75A 4L5AA 3NQ41 5FTNA 4UZSA 3CF6R 3LVFO 3DLTA 2XUHA 2GZMA 4WOCA 5ERGB 1D2RA 4BMZA 3F8SA 2XEDA 3T3GA 3QM1A 4DYHA 3Q8MA 2GJ4A 2G82A 1ZM2A 4ZOLF 1XAIA 3HVHA 2DEUA 1J0EA 1MQ8B 3AYZB 3HJGA 5DV9A 5AW9A 3IODA 2ZS8A 3LUDA 3VR4H 1SUAA 3PGA1 4LWQA 5ITZB 4ENVA 1JE1A 3DL7A 4EI2A 2ZWAA 4QTYA 4M1KA 2OD9A 1LRLA 4DNFA 4H0CA 1XAHA 4EG8A 1S3GA 5FUVA 3RF7A 5I7UA 1YDGA 2R7AA 4AN0A 3AEXA 1MTOA 1S8AA 4JI6B 1YRBA 3FNRA 4F4DA 2H18A 2CSXA 1ADFA 1UR5A 1LX7A 4LC1A 5JWHA 5A5DA 1NVVQ 1A5SB 2L0XA 2PANA 3KOZA 4KIWA 1QUEA 2GLXA 4LF9B 2FPPA 1OXKB 1XQWA 4R9RA 2VJYA 1Q1EA 2NZ2A 4X93A 4DC0A 1TEHA 2R0QC 1W19A 1UEXC 3V8NA 2YDXA 4OI2A 5A62A 4XGNA 4ZICA 1EM6A 4I5EA 1AXGA 4PF1A 5DYGA 3T7KA 3UT6A 5E6UA 2YASA 4I4LA 3H86A 3S2EA 3PYXA 2QUIA 4B7CA 3WL8A 5TGZA 1TIBA 1VOTA 3P9IA 1I01A 1E2KA 1C3LA 4I36A 4PIPA 3WQQA 3OF2A 3OE4A 1ZICA 4WXMA 4GZ5A 3G2JA 3ZGXA 3M70A 3ORYA 2ERCA 2QR3A 3BHMA 4JOSA 3BRCA 2EFJA 3DZBA 4G0QA 4FYHA 5SYAA 3ZCPA 4AUEA 1APBA 5DEOA 1II8A 1YE5A 3C1AA 1PL8A 3E22B 4NYIR 4DZTA 3FLMA 4IFEA 3UW3A 4DR3B 1WBDA 1MOZA 4BE9A 3L0SA 2EW2A 3BF8A 3GLHE 3TN7A 1EXMA 1VSTA 2LE0A 3F7MA 3SS9X 3UA3A 4CV2A 1U1FA 1YJBA 2NGRA 2BOVA 4TS4A 2Q8QA 3Q9UA 1DB3A 5JQGF 2FEPA 3KL2A 5E7JA 2QMQA 1NP3A 1G5PA 2QR5A 2XNDA 4I50F 3A3OA 4O4HA 3TECE 3FWYA 1ZFNA 2WOOA 1I4WA 2TMDA 3KB8A 3ZN2A 1L5SA 4Z49A 1M1YA 3HJFA 2XMZA 1R4MB 3PQ2A 3KT8A 4RLFA 3K0HA 4YIKA 3LPDA 1ZL0A 3I58A 1KU0A 2CLCX 3S8YA 4IEIA 4LOAA 4ZCLA 1NSTA 1XCPA 4JL6A 2W93A 3D8RA 3NHYA 4XWTA 1A4IA 3WJ2A 3EMVA 5L9AA 2RMKA 4IGKA 3UNXA 1ZG3A 4PANA 2E4WA 5JZVA 1ULHA 3ICOA 4RAOA 2ZYSA 1JEYB 1VE7A 4TQUS 1OX5A 4DLXA 4P35A 5EIXA 1T5HX 4Y0VA 5L3QB 1NVKA 1TJPB 1JWBB 3V97A 3OZBA 3B6KA 3VKVA 1K6EA 3OZFA 2A7XA 3FMIA 2Y1KA 3E5RA 3K0AA 3PDWA 2BR5A 4MS4B 4KQHA 2I9KA 2ZRAA 3IQIX 5HFNA 16PKA 2O8FA 3ZI0A 1GAWA 1WVMA 3JSXA 1T0JB 2P35A 1P7ZA 4GMKA 1P7CA 3VKWA 1V5EA 3CEMA 1N7HA 4RIGA 1T6NA 2O57A 1WKVA 2PXCA 3LGSA 4ALLA 2GN9A 2GAOA 3KQQA 1GADO 4B4WA 2V0CA 2AZDA 3NYRA 1BTOA 1V47A 3BMNA 4LZLA 5ALRA 4EG0A 1V6AA 3HG7A 1G16A 2FLVA 4FN5A 3RU7A 1F2UA 2JEOA 3RT1A 2C2WA 5CDFE 4O63O 3HXQA 3GAZA 5HKOA 2ZVDA 3JATB 3W6UA 4PZ9A 4X92A 2WYIA 1XXHE 2Y0EA 2R1TA 3KZKA 5AJWA 2J5BA 3RSFA 3P2OA 4S1TA 3ZDAA 3A06A 1KYTA 3A1CA 5DX0A 2AOUA 2YQZA 5DTRA 1CP2A 3QXJA 1DKOA 2JGEA 3PB3A 5F1PA 3N0VA 3TSWA 3ZJ4A 4N8EA 4BFYA 2W9XA 5JJLA 3S1SA 3K1TA 3IVXA 3IPAA 2IK8A 3JASA 4QZVA 2BZ0A 2GZHA 5BVHA 1FY2A 3DW3X 4W5TA 4D9IA 3SFTA 3VPHA 1VL5A 4DILA 1Z22A 1HG0A 4H16A 5AESA 1QBKC 2GK7A 5AH0A 4J29A 2JIMA 2Z9DA 4QEZA 2OGTA 3I9NA 4IRXA 1PQPA 1Y42X 2PMBA 4R83A 1OBVA 1V48A 1XZKA 4G81A 1U3FA 3WLSA 2FF5A 1OGJA 4PNEA 4L5YA 2CUNA 2P3SA 5B58C 3ABQB 1KVQA 2EBWA 2QYTA 1J8FA 2R8PA 2XUGA 4RSMA 2PKXA 2IEBA 3A0UA 2XXAB 1GG2A 1E1DA 2AG1A 2WSIA 4JB2A 3RSLA 2PGLA 4QSMA 3ZV6A 4Z9AA 2NU7A 4JLMA 3R7WB 2ESRA 3LSYA 1RBZA 1E7SA 3MCVA 4L07A 4LCEA 3WSTA 4BQEA 4M8IA 5JWRA 3L79A 4MVJM 1E79D 4E03A 4EHLA 2QPTA 4GG1A 4A91A 2XCOA 1NRWA 1N36B 1NLFA 2Z3ZA 4OHZA 4ND8A 4DBZA 4JEMA 5L4NA 1S9DA 1PNTA 2C2BA 5JFOA 3PFHA 4JD5A 3CJTA 5HKBA 3OVMA 3FB4A 4P3PA 4ZI3A 4QO7A 3JVEA 1J39A 1QFSA 3PUYA 4XDGA 5DN6A 4TLAA 2QJFA 3KZXA 3ZIDA 2JLRA 1J99A 1E5QA 3D6TB 3GPIA 3M4ZA 4BNXA 1E2IA 4Z7JA 5ICMA 3WXMA 4UQOA 1E20A 2WA1A 1C4XA 2ZB3A 4ND3A 1V5WA 2ZPTX 3FPFA 3B9PA 4WN9B 1TCUA 4NFYA 3TW4A 4G4GA 1I7DA 3VDXA 2RCYA 3NX4A 1KJ8A 3FOAA 3O3NB 4CJXA 3L8HA 4LE1A 8LDHA 3ZCQA 2W0SA 2G17A 2C0PA 2J07A 3L0BA 3DOJA 1TMKA 3EX7C 1MO6A 3ONFA 4QJBA 3H2SA 5F77A 3SBOA 4E70A 2WT4A 1LNQA 4HWKA 3LTNC 5HTOA 4RF2A 4WNAB 3W9SA 3QUQA 4D8TA 4CR6A 1P9OA 1A9QA 3IBGA 4P08A 1EK1A 1JHUA 3WYDA 1A0OA 4ZJPA 5DULA 4P4SA 4K81B 1QLWA 4XCVA 3DZDA 1MC5A 2C5FA 3BS4A 4FMCB 3JALA 3IOEA 5D3ZA 1BE6A 4U6SA 1TQ6A 4O4LF 4BB0A 2P0AA 3GA7A 2E5LB 1EP9A 4BVLA 3BUSA 3KNZA 2CEKA 1IDOA 1RCUA 2Q2WA 3BXZA 4QL3A 2W70A 5LQNA 1BXGB 3VRHA 1LDEA 3O3MB 2WVJA 1DKMA 2BJVA 2OV1A 1AUQA 2QMOA 1QH1B 4U5XA 3ZJVA 1XCMA 3N58A 1D0IA 3VPAA 4CW7A 5LCXA 1WSWA 2FZLA 4G0UA 2E37A 1XNHA 2R47A 3DA8A 2X8BA 5KEIA 4DG9A 1E5TA 1N25A 1U99A 2DTEA 3C6MA 3GRYA 3M6AA 5EHNA 3VI4B 2W4IA 1KL7A 1MOSA 2V6FA 5K0EA 5CXQA 1L4GA 1N5MA 1VPWA 3CUUA 1JP7A 4EWLA 4F5YA 3GGPA 3W2FA 5I51A 2QN7A 3ZY5A 1WDTA 2ZRMA 4XX0A 2F62A 2DTXA 2XAUA 4MMZB 4MULA 4OREX 4WCFB 5B7PA 4B6SA 5F7OA 3L8ZA 7MDHA 4P83A 2I76A 4FLFA 5FWAA 1PG5A 2Y0BA 2FZ5A 5AOVA 1ETUA 2R9VA 1B8VA 3KX2A 4PTYA 2Y1XA 1TPYA 4JYPA 1SOAA 2IY8A 3K2QA 1SVWA 3ZS9A 4A8TA 2Y9PB 4FSDA 4Z0PA 4EKDA 4WZAE 4XWWA 1KYZA 1U2QA 3ZJ5A 3S2GA 5BW4A 3HK2A 3WG9A 4OUDA 1OWLA 1JR4A 1ZRMA 3MCZA 1UC4B 4REQA 4E2FA 4MPJA 1ESCA 2YNMA 1XZQA 3CPEA 5IVHA 3FVRA 1BFKA 1CHNA 1KDRA 3BHNA 4RADA 4WD3A 5IKOA 1NSFA 1OLSB 3VH2A 1QH8A 1YIOA 4LMBA 3ESCA 3ER9A 2ZSBA 3W4JA 1PT8A 4UVGA 5CLJA 5KS2A 2VJBA 3R5XA 4CKBB 3B2EA 4MPRA 3A6GA 5AR1A 5EWMA 1Y5LA 5KTNA 1KAHA 4BBAA 4RX1A 1NYQA 4ALKA 4LBWA 2C95A 2G7ZA 2XYGA 2UUPA 4BNNA 5CFNA 4OB8A 9LDBA 721PA 1AG9A 4MPPA 3EVEA 1IWOA 1I80A 1NTOA 1IN7A 1VYVA 2ZRPA 1GZSA 4UKDA 4FFOA 2J8ZA 4M87A 4CDMA 4MLCA 4PYQA 1LVHA 1NP7A 2DWPA 5MGNA 3EDOA 4IKOA 4TKMA 3MTIA 1EH5A 4FE4A 3LPCA 4LYJA 4TGLA 4RGVA 2PLAA 4D4IA 4TYQA 3TQCA 3IEMA 1JBEA 1KQPA 4ZU1X 4MDFA 1KS2A 2XGOA 2DF8A 4OHPA 1DEHA 1W5SA 2YH2A 1PUJA 3S7ZA 4CTMA 2ZM6B 2CNKA 4ZO6A 4CMHA 3KT3A 4MR7A 1XF1A 4UUAA 1AXRA 2B99A 2YFYA 2ILTA 1NFFA 3OJLA 4IMRA 4MB6A 3VC7A 1AQYA 3ZUGA 5FUQA 4YRSA 5ENZA 1SCUB 4GE0A 2BEKA 1Z2PX 4UDYX 3I4FA 5A9SB 1BC5A 1YBMA 2EJCA 2FEWB 1GFIA 2JGIA 4N0EA 1IDN1 4FKMA 4GSKA 5C4GB 3OEHA 3W79A 3UGTA 1CKEA 1ZRNA 1PJRA 4HPWA 3D43A 3LXXA 2VT6A 3AEKB 1FFEA 4C14A 3GG9A 4NG4A 1A7UA 3QBVA 4RIHA 5F9FA 2Q07A 1CFJA 2GEJA 3KU4A 4F45A 4RVNA 3NAMA 4BX8A 1AGXA 1CY4A 4JJGA 3STVA 4QBGB 2VWGA 1MFZA 1QSGA 5FTLA 1UZLA 3LA6A 3HFGA 3L1UA 5ED0A 3SLGA 1O4VA 2I8AA 2R4UA 3BB3A 1TB4A 3RV3A 1KPHA 2PUFA 2X4IA 1GWNA 4WZAA 4N5MA 5ALVA 2F1HA 1H42A 3D7RA 3WIUA 2X4LA 2GVDC 4P8RA 2C2YA 1CP3A 1E4OA 2GZDA 2H65A 2W2OA 4DADA 1RRCA 4Y1GA 1P80A 2KLHA 4LYDA 2E89A 1EP2B 2FQXA 3T3HA 2C1EA 1U5CA 4DBLE 1ZITA 5BYAA 4H1UA 2RH8A 2B21A 4FJ2A 1RXEA 2MT9A 5A71A 3T5MA 4X7RA 4KDCA 4JENA 3WICA 1FFDA 3QPDA 2WRZA 5FOQA 1DAEA 4LTNA 4OHFA 2HSEA 4HZUA 4N76A 1GKLA 1ITZA 4OSOA 4NJEA 3D1LA 3JS5A 3UMFA 1LSJA 3AEQB 4EKGA 1IK4A 1F0NA 3D4PA 3FYDA 3IQEA 2IV2X 2BELA 3PPWA 3SQLA 4ND6A 1EBFA 3FCOA 4G9GA 4RSHA 1KK0A 3IUSA 4B4DA 3MJTA 4DV5B 1NKTA 4Q9HA 4JC8A 3QE2A 3NKLA 2EYUA 2LWIA 3FUWA 3N3BC 5ESWA 5LKRA 1UJMA 2BDTA 4IWNA 4CIBA 1N1MA 1Y4DE 2GJSA 5CUQA 1A9SA 1M67A 4MICA 3QHAA 4LJ4A 3SR4A 4UMEA 1DG3A 1Q7RA 2V9CA 3CNQS 3HSKA 4FHEA 1H0KA 4J90A 2I33A 4KPFC 3S2UA 5ES4B 5HWSA 2IH4A 2VDPB 3NG1A 3VNAA 4LVOA 3SR0A 1C4WA 4X6UA 4Q6BA 4PSAA 4U9UA 3F7OA 3CX7A 3H83A 3BN3A 1ZZGA 2VUHB 1LA2A 2V7WA 3OPNA 3USCS 1VFPA 1ZC3A 5DHRA 3VV3A 1ND5A 4JC5A 1USIA 1A77A 1VE5A 1XE3A 2H2WA 1N5DA 1C8VB 4QDOA 2F1RA 2GWHA 3PD7A 2JIQA 5B37A 4LSMA 3F5SA 1NW6A 1OFHA 4ZU3A 2XOKD 3M1YA 4F1KA 4OOEA 1MV5A 3EVBA 4GM4A 1W75A 1W6RA 1V6SA 3D81A 2B98A 3KV1A 3PX3A 4JCCA 3UB3A 3EA0A 1GPKA 2X19A 2UVDA 4QU8A 3E27A 1KJIA 3DVSX 3NC0C 4EUFA 3L46A 1DX4A 1I4EB 3GB9A 3TXYA 4KIFA 1PLJA 1JG7A 1F2VA 3CNNA 5ALNA 5HFJA 5H8WA 1A1SA 4MIKA 2F55A 4ACAA 1E0DA 1K06A 2P6NA 1QHNA 4CMIB 4N3NA 2OECA 4B3MB 3U4CA 4X63A 4P36A 4PRYA 3F1KA 4E7PA 1GUAA 3QVGA 4QDXA 3WGJA 3ZWYA 3PEYA 1DLIA 3I5MA 1F7UA 3TSOA 1NAIA 3FPSA 3PHIA 4JEUA 4K9QA 4WZBE 4D81A 4TWBA 2AKEA 2XEXA 1BH6A 1U3WA 4RS3A 2EZ9A 1SC6A 1I3KA 1VFNA 2A3RA 1KQGA 1FRQA 3CLTC 3PPYA 1BHO1 1FTWA 1YRWA 4DTCA 4KZPA 4FCCA 4KR0A 4FX2A 4OQQA 3I53A 5SZJA 3BYZA 3HHPA 1E1YA 2BKUA 4HWRA 1P2FA 2BBSA 2GRAA 1ENYA 2C3MA 3KUDA 1FFHA 4CLOA 1IATA 2A0YA 3R09A 1IU9A 2JEYA 3TIXB 4EG1A 3FKSA 3QELB 3SGLA 2YC4C 2X5XA 3T3PB 5K51A 2VDWA 2I54A 1KETA 2XZOA 4O4JA 2ZBUA 4HMOA 3KG2A 1UXGA 1OX4A 3WWDA 3B38A 2VQDA 5IC6A 1HE4A 3BJRA 2CVZA 2JJMA 1DEOA 3R3SA 4Y98A 3E9MA 2NVUB 1AHHA 4AJLA 1YZ3A 1FUKA 1EFRA 1JVSA 2I66A 2OC4A 3B9QA 2OHOA 4HGRA 1YA8A 4KO8A 5AVOA 4OYHA 1LSUA 1TF2A 2JFWA 2OZLA 3HNRA 4DOMA 1ZOSA 3FY4A 3GJ0A 5A3RA 2JBAA 3K20A 4G85A 3MB8A 4N3AA 2JLXA 4FDUA 3M5PA 4FMDB 1WG8A 3CX8A 4FLEA 5AK0A 4KXQA 3WWZA 3ZNOA 1JLRA 1GNVA 1KEZA 1UQTA 4PYLA 5KIAA 3PDIB 1BWPA 3DZCA 1YCDA 4ESOA 3ZWOA 1H2XA 5HEKA 4L50A 3J81A 4US0R 1Q7CA 2W58A 4WN3A 4BLSA 4PBSA 1A1VA 2E6UX 5C7LO 1A2OA 4KQ1A 2HO5A 5EJIA 4RF3A 3MSXA 3HRKA 3EZ2A 3KWJA 1HE8B 5I9BA 1NJ5A 4FI3C 2GZ1A 5CB0A 1QPGA 2NTVA 1CEYA 3R3XA 2I8CA 3UV3A 3NBZC 5JOQA 3WBBA 1IRXA 1R88A 1E7YA 5FFNA 1G6OA 1VKZA 1ZIYA 3ICCA 3KKQA 4NC9A 5DXJA 2JFBA 1J9GA 2OA0A 4TN1A 4WLOA 4E15A 1M2HA 1MXHA 4JOBA 5EFOA 3R9XA 2E1PA 1DAPA 1VYHA 4HGOA 4TRNA 1E0AA 4NOJA 3MFYA 3M3DA 4IV5A 4BFLA 1VLHA 2Y3IA 3REOA 5BMVB 4JT2A 3A1DA 2J6CA 3OECA 1MQSA 5HM6A 1Z56C 2IVZA 3MRSA 1HGXA 4B9AA 4XM1A 3U19A 1JJIA 1X8JA 2AMLA 2CLMB 1LGYA 1EA5A 1WZIA 3PI7A 3NUGA 4B4UA 1E2PA 1LDNA 3V4LA 1A9TA 3MHTA 2IKQA 2HPHA 4F9GA 5LMZA 3K71B 2H2FA 1N6OA 4J0IA 2I6UA 2R86A 1OX6A 1K5PA 2XTJA 3K8YA 1OFTA 2HIMA 3KZOA 4TLMB 2AMVA 3QNUA 4V39A 4L8GA 3C7DB 3BWDD 1WNFA 2P90A 3K2IA 1F4PA 4WLUA 3TLZA 1VP9A 2IBMA 4L0QA 5JO0A 4MROA 1CZRA 1I14A 4CV0A 2PX3A 1Q3KA 2Z43A 1RSZA 2FKNA 3R0XA 2ZJ2A 4GOMD 3TWOA 5A2QA 1TIKA 4R9VA 2HWYA 3SR3A 2I87A 4FIZA 2PZEA 3R0JA 3UMGA 3LPMA 4E5UA 3K70D 1YVUA 4IVPA 2GILA 3QEKA 1TTHA 1TT5A 2HQ1A 1K7XB 3NHPA 3NB0A 4E33A 6GPBA 2C58A 1IUPA 3GYBA 4X7BA 1R4NB 2J41A 5FBHA 5AUOB 2J0UA 1PR5A 1NXXA 2FW8A 5EQTA 2C1XA 3HR7A 1HLFA 4AURA 4II3A 2JAPA 4H4CA 1Q92A 2AI3A 3TJRA 1JDZA 3OOSA 3IJ5A 2BKAA 4ASUD 4R1LA 2VEDA 2BGIA 3GVXA 5DHQA 3BBLA 4AN4A 1COZA 2WFZA 1MB3A 1W0KD 3MTAA 1ML3A 1T3HA 4FC7A 1E8MA 3EDMA 4ERXA 2XMPA 4K3VA 1RIFA 1SCNE 4MRPA 1JECA 5DLEA 4C0JA 1UPTA 1K68A 3EGCA 2JATA 4GQIA 4ZI7B 2DXIA 5E9JA 3FIJA 3DDNA 3D3JA 1WIWA 4AULA 2B8WA 2GSDA 2AN3A 1JJ7A 3DMGA 4JELA 3CY6A 1AF7A 4PXYA 1IIBA 3UMVA 3DNMA 1XHEA 3PUZA 3EBLA 1FSZA 5FUWA 1K1EA 1R5NA 1AKQA 3COJA 4BJHB 1ZHOA 3PC6A 1DBPA 3MLEA 5JG7A 1J8VA 2IHJA 3P4YA 2GZRA 2YHIB 2OESA 2WYHA 3AUJB 4I99A 4BVJA 1TMOA 4BPBA 3OQHA 5JC1A 4KO3S 3DKRA 4QDJA 3SZGA 3AHIA 4YP9A 4M46A 4WFQA 1V37A 2WJAA 5LQAA 2BISA 2UZ0A 4I5GA 1M2NA 3CWZA 3NWEA 4DLLA 3TIVA 5JROA 3BMCA 3IEIA 1XCBA 1KF0A 2NADA 4XFJA 2VAMA 1JVNA 4RZIA 6YASA 4INPA 1I51A 1PR2A 1BE1A 3U56A 3C6KA 4A3SA 4YV7A 3QVWA 3WL3A 3M6WA 4QWWA 4XR4A 4RMJA 1F4VA 5EHIA 4MO9A 4CQMD 2QD5A 2PMKA 4HG2A 1FFXB 5TEWA 4B3TB 1GGVA 3V5NA 3HKBB 3RROA 1KI4A 3HADA 4N0MA 5JS2A 1YOVA 4WCDA 4TZKA 1UFQA 2XGJA 3KYDB 4BDTA 1GTG1 4X91A 4MMXB 3SM3A 2J3QA 4EBBA 1LS1A 3RVSA 4U3JA 2PDAA 3AVVA 4OU5A 5TS2A 3KFLA 3E7WA 4PLVA 4BQOA 4ER3A 1ANKA 3EXEA 1HDCA 1P3DA 3LVBA 4PPGA 1L5OA 1SCIA 4RH1A 3VYWA 3VXKA 5E1BA 4N5LA 1NWCA 1HT0A 2PS1A 2ZUEA 4ZQBA 3GIWA 2JJ8A 4MA4A 2H4JA 5ITWA 2H4WA 4MVJP 3PVSA 1HLPA 2WMDA 4D9BA 1TQ4A 2FE4A 4MITA 1ONBA 4U6QA 4YLEA 2HNKA 3M3PA 2PH7A 4JZKA 1I10A 2AN5A 1A8SA 2EKPA 3AGQA 3DLCA 3ABZA 4H3SA 1QGOA 1RI1A 4J0QA 3BEOA 3C5EA 1XPUA 2M2IA 2CNOA 4W5HA 4W63A 4UE6A 2RBKA 4I14A 5ELMA 4F0JA 4CMEA 5K3SA 5IBPA 1SKMA 3RFCA 1E5VA 1HMYA 4ZEMA 4PPQA 2XUJA 2XUKA 4U7GA 4IZOA 5DJ5A 2GNPA 3DHYA 5EKXA 4DSNA 2QL9A 3IPRA 2GFQA 3G13A 3PIRA 5D5QA 3WB9A 1UH5A 3KALA 4P3OA 1OBFO 4G1VA 1GPJA 3LCRA 2JD2A 1RAEA 3B89A 5EPEA 4PQRA 4Q93A 2VTVA 3GEIA 3JD2A 1Z37A 4L8YA 2J3LA 4QQNA 2Z6AA 2C8LA 3WLJA 3H4MA 1BE8A 4Z51A 1TZMA 1H9AA 1A4XA 1Y1TA 1S0UA 4YRLA 4MRRA 1CY1A 2ZYVX 3WYGA 5E6UB 4K6GA 2BSAA 2ZRDA 4LWZA 1BJRE 2VDLB 1AZWA 4E6PA 2ATXA 3RVJA 1UMCB 4R6XA 3S5JA 4BTLA 4CG2A 1TI7A 2CZCA 4NS4A 2C7GA 3EIXA 4UNRA 2PM8A 2GD2A 4NU6A 4AUNA 1IZ8A 2V8BA 3CH4B 4RMNA 3FYHA 2EWMA 3LNTA 3ROTA 3T9AA 3W8DA 1JZQA 5A4DA 2HQRA 2LCIA 5CNIA 5JAPA 1II8B 4MCAA 5G0VA 1WLSA 5I48A 1P1RA 3NGMA 1J49A 4IRMA 4NLLA 2B8TA 1C7IA 1OWNA 4Z54A 1FTYA 1TVEA 3G2LA 1G98A 3FDFA 3NHMA 3GP3A 4MS1A 5JATA 2XDWA 4JP2A 1BCRA 5I45A 1SC4A 2WIKA 2X5KO 3PFCA 5CDSA 1AGRA 4RVDA 2Q0SA 1F2TA 4M0PA 4BBZA 3GPCA 1JLLA 3GVIA 4XFDA 3DZHA 1M1YB 3U3JA 4R5HA 2WWHA 3CX4A 1IG3A 2VK2A 1FC0A 1JEQB 1QKJA 2CFRA 5DNWA 2J9FA 3ANTA 3R3HA 1MR3F 4JQOA 4EL5A 4U4AA 3QK7A 4YRRA 4ZYUA 4JIMA 4X1YA 3IAS6 2HN9A 1P1HA 1U8UA 4HCJA 3GLUA 2P11A 2DX7A 4MLPA 3TXXA 5IF3A 3W6ZA 5KB3A 2NSYA 3IBTA 1E9SA 2XB2A 3EGDA 4XPIA 5ITSA 3GDGA 4N0PA 4C4PA 1RZRD 4BPRA 5ILGA 5LBUA 4AF8A 4CHGA 2BTEA 3G79A 1M6YA 4PX3A 3R9WA 1P9NA 4BUZA 5JCJA 2J3IA 3K0AB 4AO7A 1JV2B 4M8NE 3ONNA 5DIZA 3NUQA 4FHFA 1EXWA 2NVWA 3WOHA 3W9UA 4JI0B 2YWXA 3B2QA 3EXFA 4IGIA 4O0LA 3HBNA 2Q5EA 3F2IA 4WY5A 4IF6A 3LDFA 5H3CA 5TY0A 3VC2A 4A9AA 4ND7A 1ZGCA 3UT5A 4LJ8A 4TSRA 4BNVA 3C5HA 2HRCA 4NCNA 4Q82A 1SA0A 4L85A 1L8OA 1ZH8A 2V6JA 3I6BA 2UVPA 2IC5A 4DE5A 2VBGA 4Z1OA 3ICEA 4JLVA 1QF7A 4AO8A 1M8KA 2A58A 1DKRA 1ODFA 4G4JA 4OLFA 4RPIA 3WKAA 4DNPA 1DX6A 1LW7A 2ZR0A 2APJA 2HY7A 3P94A 2TMYA 5EHQA 4LMAA 3SF8A 3DMTA 1BDBA 4HVTA 2R1TB 2ZAMA 1JUDA 4UATA 4TV9B 3C7KA 2JS7A 2J5XA 4MQFA 4ZQGA 4OGKA 3FDZB 2GNAA 1TL7C 2AOUB 2FPSA 1HXHA 2MSKA 2E9SA 4OHCA 3OAAD 1ZD4A 5HGJA 1CNMA 2OMKA 2Y2UA 1TC1A 1GPH1 3O6VA 4G4IA 5A3VA 4CL3A 1JG2A 3JASB 2P5SA 4J7XA 4DQDA 3VUEA 2N42A 1FNDA 1CERA 4C3UA 1KSHA 1Z2EA 1H3NA 1NQVA 1P2TA 1MIOA 2VH5R 3BG5A 3GLHB 3ZU6A 4BV3A 1LCIA 3DXXA 4LDNA 1I6LA 2G0AA 2ENUA 4B0OA 1ZP6A 1NNEA 1Q0TA 1PR4A 4HYTA 3STYA 2BEJA 4FS3A 3IDOA 4UXIA 4QOFA 4RMGA 1T2UA 2WVGA 1STOA 3JQ8A 4W9MC 2K4MA 3ZEIA 1MVOA 1Y48E 4MI6A 4PFJA 4U2DA 3NO4A 1YR1A 3DAHA 4F2PA 1EVKA 1GT6A 2YIJA 4H7KA 3WIVA 3LWNA 2DBRA 4HRXA 1YMQA 1JMKC 2NU7B 2KJQA 2NUBA 3SNHA 3TS1A 4EA9A 1QRSA 1HFJA 4ZC8A 2BMDA 3HMQA 4LQ4A 4I9FA 4HGNA 2GGSA 3RBVA 3AHCA 4OSPA 5U9CA 3JQ7A 5EZSA 5HZGA 4ND8B 1OLXA 6LDHA 2PL9A 5MN5A 3PJEA 4UCWA 3K1AA 4FYKA 4LV6A 3R4VA 4QVGA 4XXHA 1JTEA 2CK3A 5DXAA 2OCXA 1YAJA 5AKXA 2FZVA 3QX3A 2J9XB 3IR6A 3NVAA 3QV2A 1X8LA