3J80A

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
SLPSTFDLTSEDAQLLLAARVHLGAKNVQVHQEPYVYKARPDGVNVINVGKTWEKIVLAARIIAAIPNPEDVVAISSRTYGQRAVLKYAAHTGATPIAGRFTPGSFTNYITRSFKEPRLVIVTDPRSDAQAIKESSYVNIPVIALTDLDSPSEYVDVAIPCNNRGKHSIGLIWYLLAREVLRLRGALPDRTQPWAIMPDLYFYRNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00318 Ribosomal_S2 Ribosomal protein S2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 3j80A01
4NXMB 1C7RA 3KNZA 4DV1B 2X3YA 2I22A 3FKJA 2I2WA 2J6HA 1U0EA 1TZBA 2CXUA 1X9IA 4JI7B 3FXAA 1Q50A 4YY3B 1JEOA 1I94B 2WU8A 3J80A 4LF8B 4X65B 4M0DA 3JAMA 4JI0B 4JI8B 3T1YB 3EUAA 1MORA 2PUVA 1HNZB 5FLXA 1NRIA 2CVPA 3C3JA 2AMLA 4YHHB 3UJHA 4DR1B 3T1HB 1NUHA 3NBUA 2VQEB 1XNRB 3I0ZA 5IT9A 3PR3A 1MOQA 4B3SB 4S1WA 1HNWB 4X64B 1MOSA 4NXNB 3M5PA 1TK9A 3ETNA 1U0GA 3JX9A 4DV2B 2PUTA 4K0KB 1GZVA 4LFCB 1J5XA 2CXPA 3QKIA 2F4VB 3HBAA 5LMUB 2V4MA 1G98A 4DR2B 1X94A 2O2CA 4JV5B 1U0FA 4JI1B 3OTOB 1VI5A 2XHZA 4IVNA 1HNXB 4JYAB 2CB0A 4DV7B 4GKJB 2A3NA 3G68A 1HR0B 2E5FA 4LZJA 4JI3B 2ZJ4A 3HJBA 4TOIA 1VIVA 1IBLB 4DR3B 2CXTA 3TBFA 4LF5B 3TRJA 1IBKB 4B3TB 2YVAA 4X66B 1KOJA 1JXAA 1DQRA 1N34B 4AMVA 1HM5A 2VF5X 4JI2B 5BY2A 1JLHA 3Q88A 1JIQA 5BR8B 4LFBB 2CXRA 2PUWA 1WIWA 2PGIA 3LJKA 1ZZGA 4AQYB 4DR5B 3FF1A 4DV0B 2POCA 3OOJA 3BJZA 1M3SA 2UXBB 4JI6B 3CVJA 1N33B 3J81A 1XTBA 2ZM6B 4JI5B 4LF9B 1FJGB 1XNQB 4DR6B 1N8TA 1IRIA 1TZCA 4GKKB 5LL6P 2UXDB 2E5LB 4DV6B 4DUYB 1N32B 1IATA 4LF7B 4DV5B 4KHPB 2HHHB 5IWAB 1HOXA 2Q8NA 4S12A 5I01A 1B0ZA 2UUCB 4LF4B 2VQFB 3IFSA 4DUZB 2UXCB 4DR4B 5LMNB 4DV4B 2CXSA 2DF8A 1GZDA 5A2QA 1T10A 4X62B 2CXNA 1XMOB 4DR7B 4LF6B 2O2DA 4JI4B 4U6NA 2CXQA 2UU9B 2XBLA 1IBMB 1C7QA 3ODPA 4B3MB 2DECA 1X92A 3SHOA 1J5EB 4OX9B 2UUAB 3BCHA 1X9HA 1N36B 2ZJ3A 4DV3B 4EM6A 1VI6A 3J7AC 1XMQB 3FJ1A 1VIMA 4B3RB 2UUBB 2CXOA 4LFAB 2VF4X 3Q7IA
chains in the Genus database with same CATH superfamily
1UDBA 2DE0X 2QSZA 3TZCA 1VG9B 4K9KA 5ELXA 5IMBA 2JAPA 1B6GA 1QYRA 4FSDA 1E3SA 4KQJA 1S7GA 4RTLA 1WEKA 1SD1A 4E12A 3WR5A 3K94A 1J21A 2A9PA 3S27A 4AJNA 2X9VA 4ZVKA 1DELA 1CQJB 1RE0A 2I33A 3CNHA 1QVZA 4HN9A 4YRLA 4ZRDA 2X13A 3RU9A 4QZVA 1YS2X 3KZKA 3A4IA 1LLQA 2WM2A 3FYUA 4KXUA 4RKYA 3EIFA 4OH1A 4OPMA 4EB0A 3WSTA 4AZTA 1I4OA 1H4QA 1IK4A 1OFTA 1ZOOA 3RUEA 2JAUA 2ZAGA 3HB5X 1NURA 3I2GA 4HWKA 4EUSA 4WBNB 1Q3TA 4K88A 2NXEA 3AG5A 2AYZA 1F5SA 1DUVG 4NU8X 2VG8A 3BIXA 4NNOA 4BTLA 1K86A 3A6KA 3R41A 1TKBA 2PMKA 4I1YA 2G9ZA 3HL4A 2H48A 3VC2A 5JQGF 1GZVA 1J22A 4O08A 2ZUCA 3NV7A 1JYEA 2I8CA 2B94A 2XUQA 1AGPA 2VT2A 4HDSA 4EG3A 9LDBA 3RSSA 3ACBA 4AKSA 2XUOA 3VPGA 3PRYA 3Q40A 3UWDA 1I5OA 2HK8A 2MMCA 3QVVA 2XHZA 2ZETA 5TR9A 3TG8A 5A71A 1UANA 1PTKA 2R6AA 1LTKA 1WR8A 2OV8A 4IMJB 4LCBA 3GG2A 4KB5A 2RGAA 2B2NA 4ID3A 4WESA 4DARA 3D02A 2PJZA 3A9CA 3FLBA 1TTQB 3WE7A 3C97A 4JXXA 4RPJA 4XX1A 4PQFA 2WVJA 4XWOA 1Z25A 2Z5FA 2WKPA 3OH8A 3ECAA 4JITA 2B36A 2E4ZA 3G88A 3ILSA 3GBVA 4RY9A 4TYPA 2ETXA 1URPA 3BRSA 4WKOA 3AI1A 4B3TB 3FYDA 1YZTA 4FFPA 4FJ2A 2BI8A 2H17A 3OCCA 1ZESA 1GIAA 3TVTA 4MJXA 4PFKA 1NJ5A 1FLNA 4EUHA 1GYPA 1CRQA 4TTVA 4NNPA 1PWHA 2AFHA 4DEVA 3D6HA 1T5LA 1W5AA 2QR2A 2XLCA 1ZCBA 1ID1A 3OOEA 4O33A 4E22A 4F06A 3VHRA 3QPUA 2G63A 1CR4A 4KO1S 3ASUA 3O3NB 2GETA 1EFVB 4OHBA 5EE5B 5EIEA 3G2HA 4PHGA 1QP7A 3B20A 3G7SA 4M9UA 4LI3X 2W6MA 1EINA 1L7MA 3QNUA 4WERA 2MJLA 1BU5A 4HXYA 4PNPA 3GHYA 1GGJA 3GJ4A 3SN6A 5AM3A 1CG6A 2YDXA 3OSZA 3RVPA 1TMOA 4BVGA 1SN7A 1TQ2A 3SICE 3ZLUA 3HXMA 3DZ8A 4IY1A 5KJFA 3TDNA 4B2YA 4D25A 2AN3A 2XDWA 3M2TA 5AVUA 1G4UR 1SC6A 3DOIA 4HYEA 2EJBA 4WK2B 5FLYA 3CH4B 7REQB 1YE3A 3KOMA 3N59A 5IXJA 2HQOA 2WU3A 1VGRA 1JE1A 2PKCA 2Y0BA 1HLGA 2I1WA 2CSUA 1U11A 2O20A 5FTMA 4FFOA 3KTFA 1QQ5A 1MXHA 2I6TA 3Q11A 3ODPA 3T7DA 4R8RA 4MQFA 1OSNA 4ZXPA 1GLVA 4DIBA 1IBMB 2ZYIA 1AM4D 4Z3DA 5AVZA 4G5HA 1PLLA 1EUCB 1QO7A 1M1YE 2ZE5A 1HT0A 3OT1B 4B7UA 3JYHA 3RK1A 2I1VB 5JAHA 1J2UA 1T9GS 2IHKA 4A6EA 4E5NA 4BRSA 1JG6A 4QVKA 4DA7A 2OLKA 2NPIA 2Q46A 2Y1CA 1OIVA 4YECA 3LQ1A 3B3JA 3IQEA 3ZIAA 4QL3A 3IP5A 1AMUA 4CT4B 3EXG2 5E4JA 2QTBA 3B60A 2I2WA 3ELUA 4QQNA 3GP5A 3DCNA 2RCYA 2IZ5A 5BQOA 5HE8A 2MSLA 4Y2HA 4U0KA 5DULA 2AYYA 4D92A 1Y6QA 3KLMX 3PLNA 4A6XA 3OX2A 4EG5A 1E77A 4RNCA 2QW0X 1LB1B 2GPJA 5FO1A 1TM5E 1XNGA 3WK6A 1T9KA 1NPDA 2IELA 5HDQA 4ARZB 1QU2A 1WZ2A 3DWFA 2NTYC 3FB1A 1GQSA 4PFJA 3RTGA 3G8CA 4BDTA 1WCXA 3FCYA 4QHYA 1B15A 3UUFA 2QL9A 4XFJA 2I66A 2IYEA 4MCIA 2IOFA 4PHTA 4XCVA 2BEVB 3M81A 1W0KA 1I33A 1U7DA 3LD9A 3Q6IA 5EXSA 1XRMA 1LWNA 2CL7X 1CCWA 2WLTA 2FP3A 2C7OA 4MUKA 1OWNA 3D59A 2XWQA 2PD4A 3AEUB 3KOOA 4HOYA 4F45A 5ECYA 4ZHQF 4TZ0A 2ZRKA 4QXQA 4ENRA 1DDOA 5JZ9A 1B8PA 3MWDB 2J45A 2EG5A 3TW0A 4DC0A 4ETWA 3RYIA 1ECJA 4IYRA 2XMZA 1CUUA 1O96B 2W2MA 4RTNA 1IHUA 3P7MA 4HAVA 4EJFA 3FMFA 1F60A 4G86A 3ADKA 4B4UA 1L4LA 1U8FO 1Z15A 2IHTA 5TT1A 4EY6A 3ABSB 4JI3B 4P3XA 3GZ4A 4RANA 3M49A 4LJYA 4JT9A 4RSMA 1ZITA 5B7QA 4XOUA 2EGGA 2FK7A 4KDRA 4QYWA 2VSXA 1NBAA 4OSOA 5D01A 3U40A 2N0SA 2PL9A 4L4ZA 2Q3FA 4M36A 1UMCB 3OM9A 1O94A 1DJQA 2E6KA 4NZOA 3U7EB 4B3CA 4E4YA 1P44A 2YVUA 5I7EA 5KC9A 2ODAA 2XMGA 1Q19A 2J09A 3K6RA 3FVQA 2G5TA 2IUEA 3DFFA 2VWQA 3N2GA 5AD1A 5EJ6A 1DG1G 3MWYW 3C4QA 3OIFA 3W1EA 4AQYB 2GEKA 1M2HA 4K9MA 9LDTA 2ZUEA 1EFHA 3ND9A 1P0CA 4YFVA 4TSFD 3REOA 1Y4UA 4YRDA 3ZQJA 1H2BA 3A1CA 3DGFC 4OHWA 1V1JA 4DR6B 5AHWA 1ZMOA 2PYZA 4PX2A 5DEOA 3EGDA 4XH9B 2YJTD 1N7IA 1RZRA 1UPTA 4MUFA 4W5HA 3UWMA 1CJVC 3ZXIA 1E64A 2XLBA 5A9TA 4KHPB 3PC8A 5LC1A 3UK0A 5K0SA 4R31A 4XYLA 1ZW6A 3VOAA 1IXRC 1FDTA 5BWBA 5EZ6B 2E4VA 3BIJA 4WUVA 3AUJB 4B8ZA 4QXPA 2A9KA 4GMGA 1LK7A 1EUZA 4N6OA 5J63A 3ROQA 4EENA 1DKRA 1LLUA 2HGSA 1YZHA 3VH3A 1X3LA 4G0YA 3HGTA 3SVTA 2QTWB 3KM0A 3MRSA 1R74A 1LPBB 4D96A 4HKTA 5K01A 1I2CA 1UBCA 1V11A 2H2FA 3ZWVA 1PS9A 3V42A 1W4LA 3AH8A 3K8ZA 4WY5A 3EMVA 2MYUA 3A9RA 4JY7A 2F3RA 5KKAA 4RHEA 1E1NA 4JLPA 4RESA 4KSYA 1QG0A 2PRYA 3KLPX 3O3OB 1O58A 2QG9A 3GJ8A 2IUUA 1ZRMA 1F8FA 4IDEA 5KDLA 1COWD 1CS0B 3TCKA 1IHPA 3D6JA 2VJMA 3MPOA 2H7XA 4D4LA 3H2HA 3L0ZA 4E5SA 4IDBA 5FBHA 3CH7A 3FFXA 3I9NA 1G17A 3VR5D 3TGPA 4A8HA 3OG9A 2WU1A 4O2AF 1L5HA 2NZWA 3PLAE 3E70C 3HDGA 2PSEA 5CA0A 3OUUA 3DE2X 3DHWC 3GRVA 3O83A 4RJJA 1QRUA 5HF9A 1AUOA 4DB2A 4JQCA 4AKIA 1C1XA 4URUR 2EYUA 2OP1A 3MB5A 2XF8A 2WTUA 1X38A 2V4UA 4XRRA 2P5TB 5LZ8A 4NVRA 4YAFA 4B83A 1C4OA 1KYVA 3U9SA 5JDCC 1M9NA 1BGWA 1J2RA 2QTTA 4LY9A 1ODTC 3VQTA 2XGMA 4Q9IA 4GXNA 1P3DA 2ZAOA 5F5NA 4QPDA 3I3SR 4KJZA 3P20A 5ILGA 3L7JA 5P8WA 4XD7D 4FHFA 3FPHA 3HGQA 1M5RA 4YMUA 1XVUA 4ER0A 1DBIA 4LBZA 4TRNA 2HSGA 1WDMA 2RH8A 1Y1TA 2YY7A 4MA0A 3QUTA 4A6PA 5JZSA 1KDOA 5ICGA 4KN5A 3WO1A 2NZXA 4HN4B 2VYVA 4Q1CA 1PDWA 4ZCMA 4GHWA 2GJ8A 3CPHA 5DBEX 4EB6A 5KZMB 2ZRFA 5K0ZA 1YQQA 2YIDA 3DLCA 3R20A 4Q37A 3UAYA 5AM4A 4F7WA 5AHKA 1G5PA 1Q6ZA 4BNLA 1VMAA 5CAEA 4Z4HA 3CLRD 1PJ4A 5KYYA 4JYMA 1CQXA 5G0WA 1NUSA 2XZLA 3ONDA 5CM8B 4RDHA 2XD9A 3GJ0A 3O9VA 3ZZNA 3U4QA 4NMWA 3FAKA 4C29A 3AF1A 4F2PA 3HCNA 1RCUA 3BULA 4WXRA 3Q88A 3GJRA 3ZWYA 3U31A 5B58T 3SM9A 1E6MA 4BOYA 3RBAA 3HABA 1EFVA 1NQWA 1JKXA 1U7XA 2BKUA 2UVPA 3EQZA 3H17A 3ED5A 4P3KA 4CCYB 4ENUA 1T4MA 3NORA 2QRZA 3K0FA 1T4GA 4UNIA 2AEMA 3WGYA 4D41A 3UMRA 1C9KA 1FFYA 2WE7A 3TNJA 1KY2A 3IVCA 2W2LD 2ZRQA 2L19A 3T54A 2W98A 5GONA 1KH1A 3V4ZA 1TECE 5DJ5A 4R8KA 3PFWO 5T4FA 1JB9A 1SAYA 3KX2A 3DBOB 7REQA 3SQXA 4M22A 4YRPA 1HURA 2HV9A 2ABWA 2H7VA 1GEEA 2P3OA 2Z8YA 3CIOA 1OB2A 3Q9SA 4IIHA 5A2GA 1LVHA 1N2SA 3K20A 5IDYA 1FFXB 4IEFB 1DRUA 1EGMB 1T10A 3FW1A 4JLBA 3FYHA 4R6XA 2GBFA 4M7OA 2IE0A 4IVPA 4BEJA 2VH1A 1P19A 4CDNA 2VP0A 1PNVA 5AJUA 3EARA 4A0FA 1VPTA 3BD7A 3IOCA 1T2UA 1K3TA 5BSRA 1LJUA 3GPIA 4EVRA 1FS4A 5KVQA 1DIGA 2Y0CA 2M6KA 1VG1A 4OL9A 2WWGA 3M6WA 3AV3A 1VJ5A 1TM4E 3F97A 4NE9A 1DOHA 1N8NA 1ESMA 2BFEA 1E2NA 3T35A 4KIGA 1X9IA 4YDRA 4YY3B 2WM8A 1OROA 4HEQA 3CZMA 3TQIA 3O8CA 3IDQA 1KKUA 2JGDA 3A25A 3D4BA 4B44A 4EUNA 3H65A 1U90A 1VSBA 4Y6SA 1HE8B 3FTEA 1IK6A 2BKAA 3HLKA 5CH5A 3ZVMA 3CUUA 3KPUA 1X7WB 4JT4A 2XZDA 1HLFA 4UJ3A 3AP2A 1YRBA 1JTVA 2C54A 1IBCA 2JGJA 3CVWA 4QDJA 1RXUA 2G0NA 2IX9A 2ORVA 1A96A 3V8QA 3ZZ0A 1ENZA 4IINA 1JALA 1CR6A 1GITA 3PHGA 3RAPR 2C95A 4L0DA 4N03A 2JCGA 2XRZA 3IELA 3AR4A 2PBFA 3CIFA 3CTPA 4RMNA 1TK2A 3QEJA 4Y6OA 5IDWA 5KS2A 4A1FA 4AG3A 1S02A 4MLDA 4DXHA 1N25A 1VHJA 2B1JA 4DXDA 3AETA 4NFHA 4X9XA 1A9XA 4Z1MA 1Q7RA 1E79D 3F5QA 3ICEA 1FUKA 1D5WA 1T8UA 2GZRA 3L0SA 5EWJA 5THXA 3BB1A 4DWJA 8LDHA 2YYZA 3O1IC 1FDUA 1IXKA 3EDRA 3ON5A 2X42A 2QMEA 3KFLA 4PTLA 3UAOA 4BFCA 1VTKA 2HA3A 4KCGA 1CUYA 2OHOA 3WFJA 3T7KA 4X84A 1C1YA 4V0ME 3V00A 4EHFA 5KNBA 3H8SA 4U7FA 5CJPA 2VBFA 2EBUA 4K46A 1U3DA 4JVMA 2YZ7A 5CGZA 2FZLA 3U4GA 5IT4A 1AHNA 1WXGA 2QN6A 2VDNB 4FOLA 5AM1A 5TPWA 4JOBA 4KMSA 1OT5A 3W9YA 5BR7A 1Y1RA 2WICA 1WNFA 3RODA 2G8LA 2O0JA 4KLNA 1Y98A 2QB5A 1XRJA 4PZYA 3SBOA 5JC8A 4KBGA 2BE7A 1RCFA 4ALMA 1QP0A 5CVEA 3TKAA 5CDTA 4Y6GB 2J41A 4Z86A 3A6DA 1EHIA 2JFHA 1XRLA 3N2KB 2AQIA 4FONA 1VG0B 1XTJA 2ZT6A 3L4SO 3R3XA 4FBLA 4YUVA 4F04A 4AN0A 2V6IA 5CP8A 2PANA 4I55F 4I1IA 1YFJA 3EEQA 5A3QA 4KX5A 4YFYA 5T6BA 1P1KA 1XRSB 5J1SB 4BXOA 3AWDA 3IOYA 4J7AA 4MS3B 4F1KA 1R0RE 3ONWA 2ZTHA 3QTTA 4UOQA 4HSGA 1Y8RA 4FFDA 3I53A 3U7FB 2NO6A 3HBJA 4GWGA 3OTHA 1RM3A 1RXIA 2Q1SA 4B2LA 1P18A 1ZG3A 1ZJYA 1RSZA 3EZYA 3QE2A 4JC0A 5FL7D 4DPKA 3ENVA 1IATA 4C2TA 3GYBA 2BTQA 1L5OA 4MPTA 1DX4A 2CHUA 2QTZA 4LX8A 4JN6B 5KNBH 1QLWA 4IO1A 4KHZA 4RZUA 5BOVA 3ITEA 1JSCA 2WJPA 4U2GA 4YCBA 5DMHA 2WJGA 3ZY2A 1XN1A 3QE0A 3A14A 3KQWA 2XMSA 1KXJA 5DFAA 1MTOA 2JFWA 1GZ6A 2O2XA 3OZ7A 1D2AA 3WQQA 5K1ZA 2YJZA 2GILA 4OK6A 1OX4A 1YDWA 4OUKX 4P86A 4X71A 4GX0A 5HUJA 3A26A 3HKBA 4RH3A 3NO4A 3CINA 3KALA 2CXQA 1P1RA 2FPGB 3KK0A 4EF4A 3FLAA 3TZHA 1ULZA 1RWOA 2AJLI 4S2UA 4OJMX 3MQ4A 5CDFA 1OU0A 2QTGA 2BFMA 4F6CA 1BEZA 2FUCA 3VDQA 2VJMB 1T1EA 1CEXA 2PLNA 1O6FA 3ZBPA 1PLJA 1PTJC 3LOUA 2QP4A 4GEGA 4NWIA 5EIFA 5FYQA 4OIMA 1VXOA 4K8OA 3G17A 2ZG6A 4KRYA 1QPGA 4D4JA 2XGOA 2CXUA 2O14A 2OAGA 4IXMA 1GVNB 1ZN8A 3CISA 3F8WA 5JNLA 4YXWD 1JAXA 5AM2A 1LZLA 1VSUA 4CIBA 5JH7F 1Z39A 4LY3A 2I99A 4IIUA 1UKEA 4IRMA 4MVJH 4DJFC 4CGYA 1U0RA 1I80A 1L0BA 1T5BA 2Y1DA 1BE0A 3IAUA 3P5BA 3GLHE 4J7XA 3LVQE 2XT6A 4U0JA 2A0XA 1Z9BA 4TMWA 1JQDA 3M9LA 2H1IA 3IVMA 2IS6A 3EZ9A 2ECFA 4C0WA 2NO0A 4NBSA 1EJ0A 3ICVA 2ALJA 1PCXA 2BGMA 2P7HA 3WYEA 1LPAB 2CL6X 3HJGA 3D2AA 4FI3F 1NUQA 1D2EA 3IJPA 3X1YA 1Y63A 2HR1A 1OWOA 4IZIA 5FUBA 2OENG 1U0FA 3FE2A 1SR8A 5EXTA 2J31A 4HL6A 4QUBA 5HWSA 1Q1GA 2GM5A 3WGMA 5JRZA 5EUMA 1NM5C 1EEHA 2FPUA 3PIDA 1H66A 4PX3A 4P08A 1T5IA 1Y3HA 3K0BA 4KVGA 5FQOA 4RCVA 3RVQA 2G06A 3HB7A 4MA5A 1E1QD 4Z3OA 3O3MB 3KUCA 1QONA 4CUJA 1WCYA 2VF5X 5KWVA 2UVPB 2OXFA 1NU8A 2EBHX 2V6BA 1IY8A 3MIIA 3QYJA 4EEXA 3WHIA 4CUZA 4ZO4A 1NNI1 1BVUA 3P8ZA 4L4SA 2ISCA 2BFNA 3BIOA 2R00C 2FF7A 1L7QA 2AWNA 3O0TA 5CPFA 1NDHA 3PNYA 1E6UA 1SURA 1TMGE 2F17A 1GUDA 3FDZB 4FBGA 3OQPA 2OYCA 3TQQA 4NEQA 2ZS7A 4JP5A 3KU1A 3S5UA 1Q11A 3HXLA 5COBA 1HTBA 2LWIA 3N2YA 2W6OA 3E9NA 3JQFA 1NW5A 1KEUA 4CWAA 1WLSA 5TB5A 5TMPA 3FWZA 1E1CA 1GLNA 3CM0A 3ESQA 4TV8F 3DCYA 3UK1A 2J4DA 5DYNA 1H8HA 4S0ZA 3GOHA 2ENWA 4H6PA 4QOIA 3KZNA 2IEAA 5FADA 2NSDA 3A3YA 2PJDA 3PUVA 3QKUA 5KAMA 1T3HA 3S1AB 1U3TA 3K92A 1UKZA 4H3KB 4HNTA 2O1XA 2HT1A 3CNEA 2QL6A 1BXKA 4MQEB 4K6FA 3VU1A 3T4UA 2D1QA 4GOOD 4RYLA 2J9FB 2B1QA 3CGWA 3E5NA 2WUWE 1OI7A 4IOJA 1SKUA 4F3NA 4BQSA 4KFRA 3L1UA 3PFGA 4LQCA 2Q1TA 1GJRA 2FZ4A 1FVHA 3SS7X 3YASA 4EG7A 4OI2A 8MHTA 5ILOA 3O9ZA 3NWPA 3ZHBA 2M9MA 4BQFA 2B9VA 4Z4EA 1XHLA 3ZXUB 4KIWA 2VSFA 3W2FA 3KKKA 1OBHA 3JVIA 4PWYA 3KLNA 5JYBA 1AOXA 1ZGGA 3B53X 1T34A 3LAWA 3MJDA 3FKSD 4YUXA 4K40A 4YAJA 3DZCA 2REQB 3C6ZA 4UU8A 4YAOA 3JAMA 3DOOA 4QXAA 3RT9A 2MT9A 2CNOA 3DZGA 1T3GA 5A4DA 3AVOA 1M72A 3QFCA 2TS1A 2AL7A 5GPBA 5J4YA 4LDAA 2IYFA 4QHSA 4R2JA 1JEDA 3G0OA 5AFSA 3GUVA 2DYKA 1JTFA 1AA9A 3L1KA 2JCBA 3QX7A 3TXXA 3V7UA 4CKWA 3JRXA 1VQ1A 1VL0A 1HYBA 3LKVA 2E5WA 4I4CA 2ZROA 3QBDA 4L08A 4YQFA 5AW1A 1O5TA 5KYTA 4IIVA 3DHEA 3RAGA 2IIVA 4G5XA 4NBKA 1E0SA 4U7DA 1E2LA 1T3ZA 2OV2A 1GCIA 2IZ1A 3IP9A 3NLLA 2X6RA 4RE5A 4TLMB 4BO2A 3HUUA 5LIPA 4BIMA 5D87A 1YS6A 1RPTA 1EWRA 4AY6A 3LUAA 1AC5A 3NRBA 4M0FA 3T1VA 4G6ZA 2EFJA 3PYLA 1YQXA 2WUDA 4RS3A 4X85A 5E6RA 5TGZA 5HZHA 1YR8A 2H7YA 4KO8A 4KDFA 4TYNA 3QZUA 3LPNA 5C37A 5EJMA 3V7YA 3T4EA 4LJ6A 4PR3A 3GEEA 4BE9A 5EKUA 4ALJA 3LVFO 2V65A 3BQMB 1FUYB 2I4NA 1XQWA 2CE2X 2ZTSA 2OHHA 3BB3A 3G3EA 3QFFA 4PO9A 4QATA 3H0KA 4MRSA 3MCAA 1ODCA 5I51A 2RH5A 4XTCS 4ZOQI 2DSNA 1T1IA 5AK4A 1K6IA 4P7JA 2IIBA 3L8ZA 4MDEA 3R6TA 2FQWA 3DMDA 1Z75A 4RD0A 1E63A 4LJAA 2ZVJA 1CC1S 1GU7A 2ZBDA 1ZD4A 3PXGA 3LE8A 2XB9A 4HDKA 5FEUA 3AUAA 2ECKA 2XMBA 3H2KA 3JWEA 4FR0A 1XC7A 4PYOA 1C7ZA 2G25A 5FUQA 4I2NA 1JQAA 1E1RA 1K5GA 4RV5A 2W71A 4U2CA 3DE4X 5A02A 1SEPA 5BYJA 3TCXB 2Q21A 4K05A 2NUTA 4Z7QB 2IZZA 3RFUA 5IJZA 1HG1A 1UQTA 3EYAA 1KDVA 3KSBC 1CDOA 1T4CB 2I67A 1D7AA 3GF4A 2IQIA 1UDWA 1UKAA 5DP2A 5IDVA 3UT5A 2H2WA 1Z2CA 1XZCA 3DOFA 5ELLA 2RBEA 5JQGA 1YVRA 3UM9A 2BR5A 3LPCA 4GDMA 5BO5A 4B17A 4YUZA 1T2NA 4QLOA 1AUQA 2PA0A 1XI2A 4HDQB 3V3KA 5CT8A 5DMXA 3SIWA 2GO7A 5CCEA 4HWRA 5DEIA 5AUNB 4WA8A 2LDXA 4CDGA 2NO7A 2AMVA 3K0EA 3ZDCA 3IR6A 1YL5A 3GP3A 3UMYA 2FEOA 1UWVA 1V5EA 2H0RA 3DP7A 2O4UX 1KI9A 4B3MB 1AQLA 2DECA 2GB4A 5A0FA 4R6WA 3ZIUA 1SH7A 5J1TB 2PR7A 3P4XA 4FCCA 4WZBE 3ZE2B 2BDTA 1MP0A 1NE7A 4OQZA 3JAWA 4PC1A 3DE5X 4CTMA 1SC1A 1CPYA 2WZBA 5EJ4A 1RKVA 2JI9A 1JLRA 5CFQA 5JBNA 1EG2A 3FMIA 3PQ7A 4MKZA 3AIIA 2OFXA 2E4AA 2WWRA 4H6VA 2GAAA 3NHFA 4L57A 4M0MA 1GFSA 3OE7D 2AZ4A 5KNCH 4QG7A 1JA9A 3EGEA 5MN4A 2J6CA 1ISFA 2L17A 2GAFA 4I4TB 4JBLA 3K5PA 4ZGBA 1T0UA 2CUKA 1EQUA 3FZEA 4UDXX 2P65A 3A7DA 4JLUA 4X60A 3BH0A 1E98A 1JLKA 2CV2A 4UBIA 5J2TA 2WT4A 4UBMA 1YRWA 3N5KA 4C7VA 3GLSA 4YV2A 4KO4S 5H9VA 3OQMA 1EK0A 1CYDA 3OM0A 5EZ5A 3MRTA 2WIDA 3WJ1A 1NY6A 4UEQA 2JLSA 1PHRA 1CVLA 4RGQA 2ZYSA 1A71A 5F1KA 1QIEA 1Q0SA 5CMLA 1K5DA 1E32A 3ER6A 3PQEA 1LI5A 3QYAA 3RLIA 5FBVB 4UOEA 2F4VB 2EATA 3JARB 4DA4A 1QZZA 1SWVA 2G1AA 5DTQA 1XLWA 3NNDA 1NXVA 1JHYA 1E2QA 2P91A 2J3LA 2QTVA 5JNTA 1BDMA 4HNRA 3RW9A 1E3QA 4PN3A 4MWBA 4YWHA 5LUBA 1OYWA 3KEGA 1Y8QB 5CH8A 5DU2A 5E2AA 5LXTA 4YRAA 4N49A 4AO8A 1KU0A 1P1CA 1ST2A 2CSXA 3HEAA 3LPAA 3EGWA 4J2OA 3Q7TA 1G3UA 1X70A 4Q03A 4XIYA 5EUQB 4EYKA 1MC5A 4R0VA 5K6RA 3K70D 2XCIA 5EZYA 4E51A 3SZMA 4IDAA 4JH0A 2E4WA 4F1JA 2ZSFA 3F2VA 5JISA 3DE6X 5LU9A 1SIBE 1QKIA 1UWLA 2JLCA 3ZJVA 3STWA 1ZOSA 5EEHA 3QJYA 1AUVA 1BS2A 3L49A 4ZVLA 2VHZA 2VPYA 4YLEA 3IEVA 3BJZA 2XPCA 4Z3KA 4ZQHA 1XZLA 1XE3A 2ZJ2A 3UUWA 4XA8A 2I6GA 3LUHA 4MMYB 1HO3A 5LNK1 1EDOA 2W6JA 5G1NA 2QX7A 3MVEA 1NSYA 1D4FA 2Z9BA 3FPGA 3HI4A 3HU3A 4MV9A 4PRYA 1ELOA 4EGJA 4I1VA 1Y5NA 1ND5A 1ZPDA 2ZRCA 5BUSA 1JAHA 2HHJA 3OPNA 4Y9SA 3UWPA 3FMGA 4BP1A 5BR1A 1OLOA 3GAZA 4N7MA 2GD0A 1TZKA 2F8MA 1PVVA 3IAEA 1LPSA 2CLEB 3BRQA 3N6XA 3WDKA 2COKA 5CBPB 5A2QA 4DB4A 5BW6B 2FGJA 3FHTA 1UJMA 2X0NA 4IFIA 1ZH6A 1NBEA 2JIQA 3SR3A 2A7QA 5DISB 4A0SA 4LKRA 4OHYA 4D9KA 1EAYA 4E5VA 4FK8A 3MILA 4A26A 1U4NA 3R3HA 2ISSD 3NBMA 1U2EA 1QGOA 1JQJC 1EE2A 2G04A 1GNQA 3S28A 4ZI3A 3R0VA 1T9GR 3AVXA 3Q1LA 1DMSA 1K3FA 4UAUA 2X41A 4LTNA 5AKGA 4D6XA 5KSOA 1T25A 3PKJA 4DCNA 1SULA 2LIPA 1IBSA 3EGXB 3KPYA 2OM2A 2OO7A 3O84A 2G1PA 4N01A 1H4TA 2AFHE 3W4JA 1QC5A 5GP1A 4ILEA 1QQBA 1RXCA 3C3CA 1CZLA 1BFDA 3DZFA 3S2GA 3UJ7A 4PZUA 1JEOA 1XJCA 4KAAA 1KEPA 3JWIA 4JIGA 5AKEA 4C0AC 4ENQA 3AONB 4QUGA 1CJBA 4JEIA 4WN3A 2YFYA 4EI8A 4JBHA 3UBMA 4ED9A 2OECA 2C00A 4HMQA 4CU5A 4I4LA 3I8XA 4J76A 2JLBA 2ID8A 5K0EA 5ESRA 4F12A 4HAUA 4RMJA 2JZNA 2X0RA 4QBTA 4Q18A 3G6KA 3GXOA 2BM0A 1T8TA 3F5MA 3GJSA 2XYVA 5TEWA 5BVHB 3W9SA 6Q21A 2H65A 2R60A 2AQKA 2GCNA 3BE8A 2DMRA 2J0UA 3JQAA 2ET6A 3R6DA 1XZGA 2VUSA 3TD9A 3DEFA 3CV3A 1J0BA 3IV7A 1LSOA 1F48A 2OGWA 4RHCA 5KNLA 3F7TA 5FWXA 3FSJX 1KO1A 2D13A 5C5CA 3N86A 1E69A 2YXNA 3R09A 1CVRA 4OJNA 2LIVA 1JHUA 4HDNA 2XIJA 3G68A 4LMPA 4YQEA 3GMTA 5JBIA 2GPYA 4FQ7A 1KMMA 3WP0A 3OLXA 3ROGA 2GKGA 5JBQA 4OA5A 4Z4FA 2NPOA 1XAGA 4MRRA 2JIPA 3H6HA 3N6RA 3OOSA 4LQLA 3ADDA 3DV0A 1KVQA 2ONYA 3UMJA 2V74B 3ZHXA 2X7JA 4IIXA 3L4JA 1S3IA 5JXIA 4FPXA 3E3LA 2NYUA 3DTVD 4MMZB 1P81A 4KYTA 4DCCA 3GWGA 4IJMA 2IYSA 5DLYA 2IGTA 1TJ5A 4AVYA 1J1ZA 2B35A 4NP6A 4WDQA 2PVSA 4BKPA 2YZMA 1R4MA 4F92B 1JEYB 2PUBA 1OW3B 3KAQA 3O92A 4EYQA 5CIWA 2WFZA 5F73A 1HX7A 3FRJA 1N33B 1ZRNA 2QTCA 3L02A 4W9NA 1Y1LA 4M1SA 4OHOA 1KYXA 2ARKA 2RHMA 4URZR 3OQ1A 4AZVA 1QV9A 4D80A 1WB4A 2W0MA 3T5AA 1GQYA 4DCOA 5CTJA 4RU1A 4DUYB 1QFJA 1V48A 4N3AA 4OB6A 4M49A 5KHLB 5DO9A 2I6QA 3B9PA 4Q9HA 3DFMA 2KWIA 4D6PA 1YI0A 4EGSA 2IH4A 1DWQA 1NVVR 1NW3A 4KRGA 3W77A 5CFZA 2JVKA 4GRIA 2FH5B 1LD3A 3GZTB 4R3WA 4YPOA 1LU9A 5JYDA 3LX8A 4L4UA 3LSYA 4NF2A 2IYWA 2VP9A 4EHDA 1DC4A 3PCXA 5LJLA 4MEAA 2R97A 3C8HA 3F6CA 4U7TB 3TTTA 4AUEA 2FOLA 3D8HA 2EFYA 2RB4A 1FRFS 2NZVG 1XJ5A 1YJ8A 1OWMA 4J6FA 4ZQGA 5B1SA 1KPGA 3RUFA 2CXOA 2GAOA 2HSEA 2JAHA 4RJKA 1PW7A 4J4HA 4YAKA 1SK9A 2AEJA 2AOUA 2RHWA 2C7QA 2JLAA 2Q29A 1YJ5A 2SCUB 1X1RA 2QN9A 1VCHA 1L9XA 1T5SA 3LI2A 4QGAA 3KOXA 3SKYA 3T1QA 5J23A 5ALZA 3V6LA 3WIBA 1E9FA 5HF6A 2RGYA 1EGHA 4AO7A 3NTLA 2I55A 4TKVA 1E2EA 5HJ7A 3SQOA 4NLLA 4BZQA 4CGZA 1MC4A 1PWXA 5B30A 3GLIB 3RGWS 1KOFA 2YC4C 2ZIZA 1MVOA 3CEPB 1K06A 3QSGA 1SHTX 1BQ4A 2XA9A 3RVLA 5I7OA 3T1HB 4P0QB 1NDQA 1ZLYA 3D81A 3IUPA 1A4RA 1IOVA 3NUGA 2J07A 4CMKA 1QM5A 2PG3A 1G7TA 3D5EA 1TQHA 2LXNA 2MINA 4JKYA 3RTDA 3WNCA 1V4VA 5L7WA 2BV3A 2VDLB 4XQ9A 4Q3NA 4C7OB 5HQ3A 3DZBA 5I4BA 4YV0A 1JFFB 2P4QA 1NBHA 4M89A 4WESB 2AFIB 3QVGA 3K6JA 3SQMA 2PT9A 3WL7A 3W2IA 5IUKC 3WWPA 4XYMA 1U2DA 1GQRA 2QQ5A 1XU7A 1D07A 4O0MA 5CVCA 2HLPA 4D45A 2D7JA 2I2FA 2EW1A 2KYRA 2DLDA 4LX0A 5B1HA 3ZNNA 3CUYA 3GCZA 1L4YA 5DM1A 2A1TR 2ZJ7A 1L5FA 2YW9A 3M6UA 4KXWA 2HRRA 2VHJA 4CN8A 2YWCA 1GL6A 4WY2A 1PT7A 3UGQA 4ABTA 4YCLA 2F2TA 1G5RA 1T9BA 4FIZA 4O4JB 4N8EA 3CZ5A 3M5CA 4U3JA 3L8MA 2W6ID 5G4KA 2IDZA 4UMVA 1SUFA 2B4YA 3ZE9A 3PF9A 1U0NA 4FHEA 4OHXA 4UFOA 1UQRA 2R8EA 2W2NA 3LFUA 4OMUA 1QH1B 2OHGA 3C5HA 3V8PA 2DH6A 3VC3A 3GRYA 4WXYB 3RWBA 4BVHA 4BEVA 1D8AA 3DEHA 4Q3BA 1JA1A 1R50A 3C5CA 3GRKA 3CCFA 2JJ2A 4LDJA 4MEJA 2O5VA 1R5JA 2RK6A 3A4NA 3ICOA 4NZPA 4D9JA 2G9UA 2O06A 1V16B 2EF1A 1BZYA 2C31A 2KB0A 2WINI 4V0SA 3LC2O 5NLLA 3ZU5A 4MR8B 1QH8A 1CQPA 1XZQA 2B61A 2YFKA 3NDJA 3PXAA 4GFDA 4KQMA 5AJTA 3TEFA 2VDOB 4I1OA 1RAAA 1RYMA 4ZYTA 4UU0A 2BELA 3OESA 1MX3A 4MWOA 1DZ3A 3NNSA 5JCXA 1M0SA 3ZQ6A 3HP4A 3FGPA 3PPYA 5KHAA 4GEKA 3VU9A 3ITDA 5B58C 2CNNA 3M4ZA 3Q2IA 5HA5A 4DTCA 4N1AA 3M1LA 1RPNA 2N9UA 3JD4A 2JLUA 2Q3DA 1ZHFA 5BNTA 4Q7EA 1WABA 3ZH9B 4LGCA 3CBQA 3BSFA 5M2QA 4WPGA 1N6RA 3AOEC 4FZRA 3QMMA 4YDHB 1YVUA 4L22A 3GEHA 4Q7KA 4YRQA 1ZAKA 4BCDA 2C4UA 1NYQA 3ERCA 2G6TA 3TUZC 2G82A 4JJGA 1WSDA 3RIXA 3ZIAD 2F9FA 3BORA 4QT4A 1IB6A 3AUKA 2ZDQA 1R18A 1G8KA 3T3EA 3BCRA 1Y1SA 3O21A 3RRJA 4B6SA 3VZRA 5HM6A 3G8DA 1W87A 4CF6A 3EGXA 1U02A 5HKAA 5H83A 4NOMA 4HB3A 1CIJA 1B0PA 1M2WA 3USES 5GOTA 1QJCA 2GA9A 2PV7A 1MMFB 4H3VA 4TKLA 4X3OA 3O95A 1JXQA 4M0UA 1EFPB 4PGAA 3V4OA 4GZ5A 2NVWA 4QJ5A 4Y2UA 4YCJA 3F90A 2XOKA 3AOGA 3SZUA 1R8JA 1NE2A 4O25A 1ZK3A 2HF8A 3A05A 5IK2D 1R9MA 4ZZ0A 1XDZA 1AZTA 3FPSA 1KI3A 5K3FA 4CF3A 5J4VA 2YXDA 3CUTA 1QCZA 1FP4B 1KO8A 4UXHA 4WD3A 3TSYA 3MMSA 3VYTB 3BC1A 2RG1A 5FPTA 5J2TF 4KLRA 2YXEA 5JSKA 1Z47A 3IERA 2VPPA 1V8OA 3ZCXA 4DQXA 4A73A 3FA2A 4H4CA 1JHAA 2QM7A 4FNMA 4LSMA 1E3IA 1Z62A 3JQCA 1I2ZA 1WUIS 2E9SA 2ONCA 3H3XA 4IIDA 4TX1A 4BX0A 1DI0A 1TEZA 2FZWA 2K6GA 2NSJA 2UYGA 1VYTA 4B4DA 3JX9A 5H3LA 4ASUA 3BD6A 1Y6ZA 3FCCA 3GJZA 4GPD1 4C2BA 3DC2A 1W29A 1O0CA 4NCHA 4B81A 1G6KA 1Y6RA 5KTPA 4YJ2A 1EVZA 2CVFA 2ZI4A 4G0UA 3R0ZA 2H8GA 5IBRA 2ZKIA 4LYYA 5IKMA 2FLWA 4LRXA 3A4MA 4FDMA 4AMGA 1JR3D 4TN1A 2GBIA 3K15A 5G1PA 4Q3LA 4G1FA 4B6GA 1STOA 1YD7A 4BJHB 4GWKA 4DLWA 3F7OA 4FYHA 1N75A 2OQRA 3HGMA 1BMTA 1KBOA 2VTKA 1M8GA 2QMHA 2YTZA 1UMCA 2ZZKA 4OBWA 4U5QA 3VZQA 2VDUE 2PKWA 3GFOA 4QFBA 1VZ3A 3A3KA 3NWJA 5U9CA 4MV7A 4AX4A 2BBTA 3EXHA 3PFNA 1VRVA 1YTLA 2HK7A 5ARBA 4I9FA 4QDUA 3FI9A 3VC1A 5EPOA 3MUFA 2HWKA 4RA9B 1KP9A 5IC6A 5IK2A 2YRFA 2BLNA 1WMSA 2V0CA 2Y77A 1NBMD 2EKZA 3HP7A 4QJBA 4OU4A 3KR1A 3TJRA 1R0ZA 3WNZA 3O1JC 4QVGA 1G0NA 4G4JA 4CI0B 2G67A 2P2DA 2OHVA 2RHGB 2ZI9A 5IT0A 1MO5A 4ZEOA 1JWLA 3EVBA 2WFMA 1LJ8A 3A0UA 3G85A 4IIJA 3LXXA 4MCJA 1XPJA 5A7GA 3UJDA 5JR3A 3TL3A 1PG0A 1TEXA 1X13A 2WI8A 3MTGA 4HB4A 4G1MB 4GE3A 4K2HA 3L0CA 4MK4A 1O2DA 2OSBA 4Z9AA 4MQ5A 5DNDA 5AOCA 2D5LA 4ER6A 5EJ5A 3CLKA 4UHCA 2ZPTX 4OLHA 2VNKA 1HOXA 1NR5A 3B3QA 5T4BA 2ZUWA 4NMXB 4ZICA 1N2BA 1JHQA 3L7AA 3N8DA 3QEBZ 2B69A 2UXCB 4C3OB 4OG2A 4YRSA 4ENVA 1EK5A 3BXGA 1GRVA 1XUOA 2GD2A 3AETB 2O48X 4QGBA 2VWPA 5EIXA 1TKRA 1XMJA 2XNHA 1ZNQO 4IILA 3B85A 3SYLA 1GU0A 3WGQA 4BO0A 3TD2A 1KVUA 4JBWA 3KIPA 4BQNA 3ANYB 4E2YA 4XPIB 5SYAA 1BYUA 1S1CA 4FGKA 4XQGA 2MSEB 1Z0DA 3ORRA 3UJAA 5K3EA 2AKAB 1ZUWA 3OLCX 4KE8A 3V2HA 2R4TA 3KL2A 3FOCA 5HP4A 1RKXA 2YS6A 3W3AD 4LZLA 5TPWB 2XUPA 3IEKA 5GIOE 4IDOA 1C3OB 2R7KA 5KVSA 2QMZA 2QVXX 1W1UA 4M6WA 2Z95A 4J3NA 1KJJA 4EHKA 5H4GA 2HPAA 2Q5LA 4MJ3A 3V1KA 1E58A 4BECA 4GC9A 5FP0A 4ENTA 2C7PA 3ZHTA 2DR2A 1VJTA 3D3NA 2P1RA 3QU2A 4H3HB 4UULA 1LSJA 2NZJA 3P0JA 4XEHA 1C0KA 5LQRA 3WI7A 2VEDA 1JIJA 3FOEC 1WBDA 3AFHA 3PC6A 4BIIA 2O3SA 4LPKA 1U63A 1IQ0A 2W8ZA 3H5NA 1FE8A 4ZOLF 5KINB 3UJHA 4K3VA 3T3NA 1K7YA 1Z0AA 2CUZA 2XEDA 4J0HA 2NYRA 3KWFA 2O3QA 2PS3A 4JDPA 5K6TA 3H5VA 1QLHA 1ZYUA 3HVHA 3LY7A 2BZ1A 1DJOA 5ICMA 3K9CA 3D6TB 1QFXA 3P0RA 4MZXA 3EVTA 1JDSA 3I1IA 3H9QA 3U4IA 4CLOB 4DCTA 4BO6A 1EFDN 4FKMA 4TM7A 4TV9A 4YA6A 1F06A 3HUFA 4V1CA 3TECE 3X1KA 1NU6A 2W6ZA 1DDGA 3BHMA 2NU7B 1IN1A 4Q3CA 3TFOA 4JXKA 1U7UA 3OEYA 1PJSA 1YJCA 2CKDA 5ELMA 3N0XA 4C87A 4CM3A 5IABA 2B9EA 1Y3IA 3EIUA 2PKQP 1NJ6A 4MCHA 3BXXA 4YRIA 3EVAA 4MUHA 1IZZA 3O73A 4OEHA 5C4IA 4BVAA 3HJBA 2MCFA 2DHQA 2CVOA 4X3PA 5C8YB 4OFZA 4PZ0A 2HCBA 1ZDMA 4WCFC 4WCFB 3HJAA 1TM7E 1KVSA 5MGBA 3LZCA 1B0UA 2JIBA 2UAGA 3GFFA 4RFVA 5DNAA 5E95A 4EX7A 1BDBA 1BH2A 4ZTZB 3EBOA 2IU0A 2F00A 2O7SA 3JPYA 3QOFA 5HIIA 4UUQA 3SS8A 4ZJUA 5IAAA 2ZRGA 1X0XA 4Y7DA 4YB8A 1RLUA 1F7VA 3V6MA 5CLGA 3Q8XB 2QUAA 3GJ7A 1N2JA 2E49A 3PXBA 1F0KA 4QRDA 5FNVA 5HS6A 3EX7C 1ZOLA 4H7JA 5HILA 4D3YA 4L2IB 1T0HB 1CX9B 1HE3A 4MW2A 2LGJA 2CL0X 3D0OA 2ZYWX 4FX2A 3HLYA 3I6MA 1J0EA 3RSLA 3B78A 5CLLA 4UQOA 1YB1A 2VUHB 2QTAA 3LQKA 4OXRA 4BP3A 1J07A 2BFCB 3OZVA 5CYGA 1IZYA 1E9BA 1E9AA 2N42A 2R25B 4IV5A 5THQA 2PRIA 2AZTA 3HA3A 2HZBA 2XBUA 4H7HA 3S3TA 1I3CA 3E4CA 2XOXA 1YDMA 1YAJA 2GWRA 3E35A 1R5NA 1E1RD 3W05A 1LPPA 2P2NA 3JD1A 1NT2A 4UFNA 1SZJG 4MJ7A 4Y7CA 4NSNA 3VNQA 5B3LA 1E94E 3Q15C 3CLSC 5IEBA 4MIOA 3AC0A 4HZUB 1RLMA 4J3FA 1PFKA 1MJGM 2B8EA 2KQUA 3FBGA 4PY2A 4XIGS 3VH1A 3I73A 4MO2A 4BVKA 1Z3IX 4JD5A 4F0JA 1ODKA 5D8DA 2JI8A 3VZCA 1P31A 4EJ6A 2H0AA 1J70A 2MSWA 3X2EA 2O0LA 4IWNA 3ZG6A 2B3TA 3F4LA 4M55A 1UDAA 4CQMA 2Z8XA 3B6JA 1JFVA 1SC3A 3CLVA 3OEEA 2YVLA 4DWOA 1TUBB 1WP4A 2IWRA 3NMUF 1H5UA 1VL1A 1PE0A 2PFSA 3M83A 5GQSA 3WV4A 1ZCFA 3TQSA 1MKYA 3U1TA 1XRRA 2BP7B 2WF6A 5DHQA 3CZ9A 2HMAA 3JTEA 4OHFA 3DVSX 3LLUA 1MNQA 2EL9A 2Q6VA 3HXTA 3PQ3A 1OGJA 3AHGA 4MQ6A 1SXJE 3AUFA 5EPEA 3PL1A 1TCUA 4Y1RA 5LYYA 1R6DA 2HBZA 1GN9A 3K7EA 4N8SA 1FUUA 1NUTA 5LOVB 2OCBA 3JVDA 4N5LA 5ITVA 4N12A 4EHBA 3DL7A 4O3MA 4W6QA 4XUGB 1ILEA 4ESVA 3GNQA 1G59A 1HFJA 3I5AA 4TM8A 4GH5A 3TCNA 5BW8A 2H4JA 3GMDA 3HPQA 1T5OA 3LH5A 3R8FA 5GV7A 2RHCA 4HYYA 5HFNA 3ZV5A 1KYZA 1MC8A 1Q7TA 1RBYA 3GCGA 1W6RA 3SJAA 4A2WA 2GEDA 2GBGA 3KJHA 2HMVA 5C8XA 3A6PC 2JLXA 3NGXA 4R1QA 3B38A 4H7FA 4F84A 1XA4A 3EZ7A 3ZI0A 5JG7A 1NF2A 1UBSB 4PYMA 3HU1A 4AZ3B 5AW8A 1AKUA 2HJWA 1TFUA 1FLVA 1IN4A 3CVOA 4B6JA 4URXR 2BMAA 4YJ2B 1EFLA 1U1FA 2JGIA 1RXEA 3PKZA 4GR4A 4FB5A 3QELA 2CT8A 2FI1A 2ZTMA 3CNNA 2ZJ6A 4EQ6A 4HN2A 2H07A 2J46A 1AX9A 3G2OA 3ESCA 1IN6A 4IOLA 1LDMA 1SCQA 4P7FA 5EUCA 2WU4A 2KE5A 1MAAA 1EFAA 3R9KA 2Z4SA 1RAHA 2R11A 4QNMA 3VR0A 4D6YA 3AIKA 3FVTA 4S35A 3GH3A 3HJCA 5IVKA 1RLTA 3QWFA 4DILA 2I78A 1MZPA 3ZHZA 3LUGA 4CDRA 3GP8A 1L1RA 2J87A 3DXYA 4R54A 1XLUA 1RAEA 4IDFA 5CYOA 1A50B 4CIXA 1U2GA 4V3CA 4W9RA 4PYRA 1RAIA 5IXYA 3HVRA 3N8NA 4LHXA 5DM2A 3Q4GA 4RD2A 1LQUA 2P41A 3JQ8A 2B8NA 4CG3A 5JZVA 4JGGA 5L40A 2PIAA 1KO4A 3TSWA 2HSJA 2NSHA 2WF5A 2DEUA 2PKYX 5KB3A 2C04A 2YBEA 3AVPA 1PT5A 1T0JB 4BYGA 1EXWA 1Y89A 4TMXA 4XD7A 1UFKA 2HEGA 4PTZA 4PQRA 4DE5A 1U8YA 1ZL2A 2BTQB 4XWAA 1QK4A 4FLMA 4IL5A 5H9WA 1NOIA 1XMPA 3S7ZA 1P80A 1SCBA 2YN2A 3IBGA 3IL2A 1JB1A 3TW6A 2Q5JA 2IEBA 1IN8A 3VJKA 1RJEA 2C5BA 4L95C 5CG2A 2P0YA 2OMEA 1WD7A 2HREA 1N57A 2AXNA 1Q14A 3A31A 1WL8A 2FWNA 4FW9A 4GOXA 4UTRA 4BLQA 3VR6A 1EQAA 2KI5A 4IXTA 5EE1A 1P2SA 2YWEA 4KNWA 5JMPA 4BTEA 3FTPA 5HOEA 1ZIOA 1U2PA 2XWSA 2H1LA 3I83A 4KG7A 5ALJA 5IKXA 4E33A 1M6NA 4NJMB 4CL3A 1SCNE 2OBMA 5IKOA 1KDYA 4JBGA 4Q1AA 2Q0HA 4TKZA 2LKCA 5C3UA 3A9VA 3TTUA 4MR9B 3HUDA 4BLSA 1TUIA 4FEYA 5I9BA 2GZ2A 4CTNA 3CBGA 1O6BA 2HIGA 1TCVA 3KQYA 1YUMA 2XWBF 1F1JA 1R9NA 2ZJOA 5TGTA 1GT91 3UWOA 1XT6A 1HDIA 3HI6A 2JBAB 3NHRA 3VR3D 1WZEA 3EVFA 1W7AA 4RD6A 1BCRB 4IIYA 1EUDB 1L5QA 2DFDA 2R44A 2IY9A 1ODJA 4UE6A 1F2DA 4O2BA 4OK5A 1DGQA 3E82A 1DTSA 4H31A 1CD5A 1D6SA 2CZQA 3BFVA 1I13A 4C0QC 3N8IA 5JNVA 3PWSA 4JB2A 1MN6A 2PKXA 3WTBA 1DKNA 4P83A 1TZBA 2H9YA 3IR7A 3OFNA 2FKAA 3A11A 4MW7A 2FN7A 5EL0A 2IXAA 3T61A 4QOFA 4C0XA 2OGTA 4G9GA 5A3JA 2YIMA 2W00A 2XT9A 2DFLA 1XAIA 1EIWA 2GN9A 2OP0A 4JU8A 2H29A 3HSKA 4A2CA 1E2KA 3E5HA 4HTAA 4MUEA 5L45A 4HDRB 4OQMA 1JDPA 2RCNA 4J3JA 2HTFA 4MTLA 3VPSA 1UH5A 2CFTA 2RAPA 5BN3B 3GVIA 4I5GA 4TLDA 1BKYA 3PLRA 1DIOB 1CE8A 5A6VA 2ZJ5A 3H9GA 3QVLA 4EPXA 5B1YA 2ACEA 4NZMA 1VE9A 4UE3S 4M88A 1G3RA 4LOLA 2RGDA 1JBEA 1XJWA 3PDCA 4BGDA 1QP4A 1Z82A 1E1DA 4RKRA 1W25A 3JZFA 1SUCA 1VI2A 4HDMA 3W4KA 5JLJA 1RNLA 2N1BA 3QK7A 1FSGA 2JIZA 4C3UA 1Q91A 2HJRA 2YINC 5K3BA 1DRJA 1PK9A 3R9IA 2OC9A 1NM5A 3R5XA 4EO4A 2Q1XA 1SVSA 3PF8A 4HB0A 2HMWA 5IM5A 1O7JA 4QJIA 4C89A 4DM4A 2Z09A 1CUBA 4DLZA 4LHEA 2K2QB 2AE1A 1Z0JA 3HYTA 5CK4A 4YONB 3ZJYA 3R9XA 2M98A 1N1GA 3TBFA 1S2GA 4AUNA 1ZD3A 3P0EA 4XSHA 1WUJS 5GM1A 4ISCA 1HZJA 2PGLA 3EOAI 1SQ0A 3UQZA 1UBRS 2C94A 4IIFA 1G4AE 2J5BA 4I9UA 3SZLA 1IY9A 3K4PA 3OPXA 1EFKA 3CG0A 3S68A 4D9IA 2WWYA 4J0QA 1UPXA 1VYUA 1Y1QA 3DCJA 1WZNA 4EHHA 1DCTA 4EYEA 4YV7A 5KQGA 1PRYA 2AXPA 4MLPA 1UBHS 4D4HA 1E7YA 3WY9A 5GVRA 1AG9A 3L1IA 3DMHA 3OQ6A 1Z08A 2QROA 3UAXA 2BE9A 3I1FA 5EE3A 1ADJA 4X3CA 2JH8A 1DCFA 5A04A 3C87A 2D2VA 2GUWA 4KKXB 1W4AA 1RADA 2VJBA 4CEIB 5FWDA 2GZDA 1L7BA 1V1MA 4C4OA 3UJ3X 1SVOA 1OBVA 1VLZA 1U7TA 1CJMA 1Z7WA 4ZOCA 3W7AA 4PZAA 1RXVA 2O5EA 3WIVA 3H0CA 4WBNA 4DVGA 2ZIXA 3KKMA 3OE5A 1Z4KA 2GZAA 2ZIAA 1PZGA 1HV8A 1ZGAA 1QVAA 3AUYA 3G59A 3IAM6 2J9FA 3PEFA 4RZSA 2D1YA 4C5AA 2DGDA 1Q0RA 1SBQA 1VKOA 2FN4A 4CLEA 1MZVA 3H4IA 2JHGA 1NXXA 2PRZA 2CMDA 3UH0A 4FZJA 4FFLA 2B0CA 3VPBA 4YMSA 5JY6A 3KELA 1ZISA 3PUWA 2BP7A 4MDYA 3W6OA 2FSVC 4D9BA 4HLUA 3DR3A 1X9HA 4G0QA 4B3HA 3T0FA 4W5QA 3IODA 1AKWA 1BCSB 4H3SA 4DGQA 4UEWA 1O0SA 5DGXA 4DXAA 4ERXA 3Q3HA 3TIGA 2RGNC 1AE1A 1XKQA 2V8BA 3MA0A 5KSZA 3HCAA 1ZQ9A 5LOVA 3GNLA 2RK4A 1J06A 1VIAA 5CB0A 1T91A 3EXFA 1JFLA 1L5YA 3V2UA 5CFRA 2VUTA 4PRZA 3LX6A 1U04A 1Z6ZA 5AKZA 5F78A 3WWYA 1MB2A 1OZ0A 2W2VA 4LMBA 4Z9XA 4IAOA 3O4VA 4UDYX 3NM4A 1L4GA 1O97C 3ZE7A 4BNHA 1XALA 4CM1A 3LU1A 4O0LA 4YPFA 1NIJA 2CYCA 2VDJA 1FP6A 3C7AA 3HM2A 1RWNA 3HB1A 3LC7O 5K3SA 4RTRA 1OA1A 1U3CA 1LSSA 3F5DA 3HDHA 2ZRHA 1AGRA 2GRUA 1MOPA 3AGPA 4HGNA 1AQJA 4CM5A 2OOSA 1J49A 4WTOA 2C59A 3K9HA 3MC1A 1P0FA 3PA6A 4MUAA 1Q1QA 2Y6UA 3HYRA 3RFCA 5C5DA 2X7XA 5JCOC 5SZKB 2QRVA 3FNRA 4K9QA 2VS1A 3DT8A 4TMKA 1EWVA 1FYDA 2QX4A 1RJ9A 3KCNA 4PE5B 2AZXA 1UBMS 2WY2D 3U1BA 4CQNA 3IXMA 2CHGA 1FY2A 3DHYA 4CNQA 1RW4A 4IUCS 1QV6A 2QDXA 1NWHA 5ALKA 8ATCA 1HI9A 1NMSA 1GPLA 1B14A 3DDUA 2VA9A 4CTOA 2JZCA 5F1YA 4YWJA 4FBMA 1JU9A 4OVKA 1O95C 5EHZA 2GJKA 2OGSA 3RS5A 3ZLVA 2QD2A 1C9JA 1SQ6A 2QLFA 2X0JA 4PVDA 4DDHA 2E4UA 1EUCA 2OXRA 1UF9A 1Y80A 2C9YA 3GUUA 4NI5A 4PXYA 2IEDA 2Q5EA 1F38A 3FCEA 4H18A 2GD1O 3QIAA 3EFEA 3NHKA 3NETA 4ZO6A 2AEFA 3A2KA 3A9UA 3U0VA 1E9DA 1F8YA 3I37X 3TQFA 2QR5A 2G1KA 2R7AA 5AR1A 2WYVA 3QTBA 4FCWA 5FPYA 5BYKA 5C8VA 1OXTA 2PMCA 1VLVA 1X7ZA 2KM1A 4U1RA 2DERA 2IS1A 3NVAA 4XKJA 3OZCA 2NMVA 1ONOA 2Q3MA 2Q8QA 2SHKA 2A3RA 5EVCA 1H2RS 3L92A 4I50F 4CMHA 5BP7A 3BSWA 1OU4A 5JROA 1SKAA 2RHLA 1I4EB 4JP1A 2A59A 3FI0A 1T13A 4CF4A 4TV8A 5LR6A 5HW0A 1LVUA 5DWQA 3WB9A 1ATZA 4G97A 2N75A 3I62A 5ADVA 1MT0A 2V96A 1XCLA 2BVNA 1G1AA 4IHJF 3X1ZA 1UKYA 3SLRA 5HCIA 5UKDA 1K0FA 3HJUA 1KQPA 2MR6A 4ZKDA 5AIBA 1T4BA 3MNFA 2MWMA 3FTFA 1KMCA 4PAGA 2Z83A 3N3AC 1WLYA 2CW5A 5LQMA 2AF3C 3LECA 5CT5A 1ISIA 1I32A 1DAFA 1UEIA 1ORDA 5JW6A 1YIOA 2JBAA 5BSTA 1UK8A 2ZQ5A 2QBYB 2HRBA 3A1TA 3NASA 2XDYA 1BGVA 5F35A 1UJCA 1P45A 5IDXA 4W9MC 2J3MA 1R4ZA 4CFYA 4L4RA 2WUEA 2BI4A 1TE2A 4GL4A 1ZBDA 2QAGA 4PPYA 3T5BA 1Q21A 4G4SP 3QPDA 2Y0EA 4H1TA 2PBZA 1WKVA 1WXWA 2FUG1 1JXOA 1E5QA 1G5TA 1TTPB 1MVLA 4B6EA 1E2GA 3DE3X 4KPEC 4Q9JA 4GOND 1A8QA 1OBFO 4PRKA 5DNWA 2FWMX 5K8CA 4JSTA 4WAUA 4EY4A 2H5JA 1JKFA 2YNMA 2JDIA 2H1HA 1E8NA 1CLEA 1RPJA 4LN1A 1N2CB 3DKPA 3RAFC 4DIOA 5JHGB 1H6BA 2ZRBA 3BL5A 2VTEA 2Y1LA 1M7GA 2QJWA 2DWOA 2FZGA 2FZ5A 4RF2A 3ZCUA 2QLJA 1DAPA 3ENWA 4DCJA 521PA 5L7YA 5ITZA 2L82A 3UAGA 9ATCA 3O90A 4JBIA 3HFSA 3EGIA 2WEKA 3WLLA 1RZRD 4KZPA 4YALA 4HWTA 4TS1A 2Z5VA 4WZAB 2AFVA 2V97A 4AI6A 2I54A 3M6AA 1G60A 2VXCA 3IJEB 1N5DA 4I4TF 2OV6A 2WOJA 2CK3D 4MYDA 1G2QA 1VFNA 3RANA 3T1NA 2IHNA 3ZWOA 3DO6A 4L5IA 1SUDA 1AU9A 4M9XA 1W85A 4JV5B 1ZN9A 2AIRA 1AK9A 4K6MA 2Z9DA 3RTEA 1CY4A 3ONNA 2I3AA 2W6PA 4FXPA 4WOKA 3DZHA 4M8IA 3LV8A 1TUEA 3FKSA 4IZHA 2IYAA 3KQVA 4BO1A 2V7TA 3QLTA 5BN4A 6AT1A 1A04A 3IDAA 4RDIA 4NAVA 3C8UA 5TX7A 3JATB 5FQNA 1WB9A 2EG9A 3CW2A 3SE7A 1B73A 5I3ZA 1MJFA 3KCQA 1AB5A 1AN9A 1TC2A 3PNBA 3HEBA 2HRZA 3FOWA 4FNAA 1NUAA 5AIAA 1ORTA 5DLEA 5ALNA 4FIDA 4ZYLA 1ZKDA 2ZIUB 1ZGZA 3KVRA 1IXZA 1G42A 1KQ3A 5EESA 4KPFC 3OJCA 3O91A 2J3HA 2O1EA 4CMAA 1P5HA 4DLXA 1F6BA 2A9QA 3RIEA 1WXHA 1GPAA 3MT8A 1ULSA 3ESYA 2ZIVB 3B1KA 3BMNA 1JBKA 3I34X 3PK0A 4XYGA 5ESXA 4ZAYA 3SIRA 1XCPA 4JI5B 4A36A 1OPRA 4EF6A 1QIJA 2JVIA 3PNMA 1EUQA 3CKMA 3KZOA 2Q6KA 1Q0QA 1KZ7B 3JWPA 2DH5A 3RE1A 4QFCA 2VZ8A 3DMTA 4DS3A 3Q3GE 5AUOB 1D5CA 2XUIA 3CSDA 4KOEC 2EJUA 4G0NA 2C78A 1G5QA 4QOSA 3ZUGA 2XCOA 1L8XA 2GN8A 4RXMA 1OIWA 3GJ5A 4LGVA 4CZ2A 2IUSA 3ELWA 2HA0A 3BEOA 5B6IA 1X8JA 3F4KA 4RIIA 4Q7MB 3FOFC 4XJSA 3CPSA 1UP7A 4ZALA 1GGFA 3CGGA 1IPEA 2E89A 3PPVA 4LDQA 2ORED 3RS7A 3U9LA 3WNVA 1GZ4A 5KTOA 1XPOA 2FU5C 4ZO9A 2BKXA 3C3XA 3H5AA 5HQ3B 2R62A 1F8GA 1FTNA 1X1SA 1BCSA 3LT0A 5HGJA 3ZWDA 4DDKA 4EPRA 5KYNA 3ZD6A 2IYVA 4QWMA 3SYTA 3VPCA 1T6BY 2VDRB 3KOWA 2OVBA 2VCEA 3NBQA 3X1MA 1YC2A 4CYMA 4ZDJA 1DAKA 5CX4A 3TI7A 2QVCA 3UK2A 4QDKA 1EWTA 4D1YA 3EXFB 3OY7A 5FAKA 3TLJA 3RHFA 2BGNA 3CJQA 2G5PA 1L3CA 4WGGA 1T9HA 4XEUA 5ENDA 3W8DA 2ZR0A 4IKEA 4BNYA 2COEA 1GGVA 1G7RA 3CF4A 1YA4A 1Q0ZA 3T38A 1FMCA 4UUBA 3MEQA 3E8SA 4BV9A 4YJ2F 3G0IA 3COPA 1D03A 2CLOB 3CNOA 3DHNA 4D4GA 4HZGA 1W9MA 2RGEA 3FB4A 4EGFA 4FT2A 4M0DA 1BU8A 3IESA 5AESA 3T1YB 4EY3A 2P1ZA 3KUUA 4CCYA 2QWXA 2QT0A 5DI3A 2B4RO 2G09A 2EW2A 2J9GA 1RBMA 1P7WA 4YRZA 3TB6A 5K3AA 4DLKA 1FFAA 1VJ1A 3IUNA 1N8SA 3G2KA 2JANA 3G2JA 3DPSA 2J33A 3T5CA 3H4TA 4HQNA 3L9WA 4MW4A 3TPZA 2VTBB 1YR2A 1N5IA 1V8ZA 1HUQA 2EJTA 3MMZA 5GONB 5REQA 4XR9A 3WGTA 1H65A 1MNAA 2LDBA 1G2IA 3DG9A 3OC6A 5DYYA 2ID7A 1O3YA 3K30A 4K0KB 3DBVO 4DWVA 4CHTA 1FDRA 2ID4A 4P54A 3CRNA 3RS8A 3E23A 2BCEA 3NC0C 2PBRA 4J4BA 1FMTA 2A33A 3NTQA 1GTRA 4YCNA 2LR0A 2VHQA 4Z54A 2Q5FA 2ZS9A 3DQPA 1C7JA 3DEKA 5FT9A 3TZKA 1GPUA 3CLUD 1FMFA 1KJNA 3KXKA 1C29B 1G19A 3I6YA 3PI6A 2X2EA 1G7SA 5FAXA 5BSUA 3SR0A 1J8QA 5AJVB 4DNQA 4X66B 1IXSB 5K0CA 5K8UA 4JWTA 1P8AA 4C4SA 4ON9A 4P4LA 1IVYA 2TMKA 2C4KA 2PUJA 4PPFA 1GZ7A 2ONZA 3BHIA 1Z16A 4IGAA 4LY0A 4AZSA 2BLLA 2QZ4A 3H6GA 4FGWA 5FEMA 4TT3A 1XU9A 3BERA 1NBMA 2C8KA 2Q4EA 2ZYUX 3WMRA 2QRMA 1TM2A 4A27A 4AK9A 4QOJA 5I7FA 2PZAA 1GUBA 2OCAA 4JGBA 1Z4IA 3QMWA 1CDEA 4OQEA 2PT6A 3M33A 3BK7A 4LHSA 2ZANA 3BAZA 1SUEA 2EIXA 3BXFA 2JJMA 3CUKA 2WUGA 3I39X 3OU7A 4M1WA 4QJ4A 4RUKA 1E1QA 3T3HA 2NM0A 2OAQ1 1XPUA 4X24A 1DOZA 3JALB 5D86A 3QXSA 1NXOA 1YU9A 2HK6A 2QE6A 5K51A 1XNHA 2IT1A 4XOIA 1B26A 4RZHA 3WO0A 2B7BA 3WQBA 1OVMA 1PZFA 2FHSA 4CM6A 2GPTA 3GFGA 4NESA 2V0NA 3LCRA 3LDHA 4B6QA 4R05A 4ZZ1A 4P31A 5A62A 3AU9A 5K8JB 5JJKA 1C50A 4X7BA 1R5BA 1GILA 2V4ZA 3RH0A 1D0IA 3TM5A 3ZX5A 5KBYA 1DBWA 1QX3A 3LLCA 4UVEA 1GUFA 3PVSA 1SBZA 3SOPA 1KWKA 1X7HA 1UFRA 2R8ZA 3LPLA 1JW9B 2PCLA 5AOAA 4B87A 5JANA 1R12A 3H99A 1Y9AA 4FILA 4W1SA 3SX4A 3GMSA 1WX1A 5H02A 5BWMA 1NG1A 1O4VA 1T3SA 5HIKA 1ZR2A 2J7PA 3C43A 1PGPA 3D0KA 4E6PA 1EWQA 3GEGA 5CFPA 3KNZA 4JBYA 2R85A 3DZDA 2OD7A 3PEUA 1BKSB 4HB2A 5ALOA 3T5DA 2I22A 1Z5ZA 4ES6A 2QSYA 2AOWA 4L5AA 3U44A 3QNWA 1JLLA 4MUMA 4PCVA 1WUYA 1G6OA 5T4EA 3E9DA 3W2TA 1IONA 3HTXA 5JO0A 2R6CA 1OJLA 3M6LA 4QYMA 2F1OA 3WOHA 4BQOA 5BW5A 5ITZB 3EVGA 2HNAA 1A2BA 3P2OA 4CQLA 2JH9A 3PQFA 2JKYA 1ZAYA 4BPBA 2C2WA 1OVGA 4TWZA 4NV3A 2C5FA 3FUXA 4WZAA 3AM4A 4XRGA 5CFOA 4CT5A 4HNUA 3V1NA 2JJYA 3IUEA 2H63A 4PXSA 5JYEA 2WOOA 4IGEA 4MQLA 1ADGA 5KOJB 1FJXA 3IURA 3GA5A 3QUQA 3TRDA 1J7KA 3B6IA 3MYRA 4HS4A 3SYMA 4DA8A 4GYYA 2ZJ0A 1K8RA 1YHZA 3F47A 3E9ZA 3JQBA 4UC0A 1QHHA 2FMFA 4P8RA 1XA3A 3E2MA 5HTOA 1JG7A 2E82A 3E8XA 1MG0A 5HJ2A 1QFSA 1QCYA 2XQKA 1BVRA 3HYNA 3H5WA 2X8JA 4I4IA 2QRUA 4J9UE 1P9LA 3UMVA 4ZK2A 4R81A 5LQUA 4K7JA 4EPWA 3ROZA 4BPRA 3ZQ4A 5K0GA 3E1KA 4K6GA 1FRVA 1JIKA 3AB3A 3GC6A 5AO9A 4E2FA 2PWPA 2OUIA 3DSRA 2B0JA 3H1AA 3NHLA 2OYSA 3E05A 4UU7A 1X1QA 4ZVMA 3K9GA 5C5IA 2YHIA 4OLBA 1V7PC 4PZZA 4U6QA 4TVKA 3BXOA 5K09A 4TS3A 4KN6A 3K71B 4JYCA 2IDMA 3K05A 5K0FA 1S89A 4ENPA 3M1YA 2E21A 4DVJA 5EFOA 1C8KA 4Q3KA 4F96A 5DTMA 2V9ZA 1SVKA 2ZTVA 4I5IA 5BSFA 2W2KB 4TV9F 3MJCA 3D0QA 1H2WA 4Q82A 2IBTA 1PIWA 1YDHA 4H0NA 4J0KA 4KGVA 3KSAC 3R9WA 3W06A 2IYUA 3O8BA 4FKZA 1FBTA 1GO2A 3FYUC 1A4UA 1Y1KE 3FYUB 3KEOA 3DBLB 3HRKA 1XQ9A 3NTOA 4J1SA 3UW1A 3VR5A 3HFGA 1RXWA 1JHDA 2FR8A 1EXDA 4XLTA 1QH0A 1T8SA 4JEHA 4F3CA 3PPIA 1F14A 1NZFA 2DHCA 2JC3A 4EDFA 2HX1A 1XZBA 3TOXA 4C88A 2XDQA 1WY5A 2AX4A 1B3BA 1A9RA 2JFUA 2Q8PA 4YX9A 3V7NA 5F9FA 4OOEA 1HFEL 3ASYA 3AIMA 4IUBS 4L8WB 4IDCA 1BE8A 4NZZA 4RACA 3UZUA 4BDSA 4HDSB 1I7QB 4QSMA 2OG1A 2UUCB 3AJAA 4WV3A 2AGVA 4UPEA 4L7QA 1HE4A 3TTXA 3MGGA 4KUGA 2WTEA 4JCOA 1KAOA 2XTMA 4EYSA 3BCSA 4M7WA 4MW6A 5DX1A 1XV5A 3G8BA 4DGSA 2CLLB 5E3HA 2F55A 4CLOA 4PC3A 4EUEA 1NZJA 1J5PA 3DOJA 4ARAA 3RKUA 2ZQYA 3MCTA 5F5XA 4YRMA 2QJTA 3DEZA 5AKIA 3SHOA 3WP1B 2O07A 1DVRA 4IJVA 4P5PA 1C3LA 1ISRA 1H8ED 4RVCA 4WKPA 4TQUS 5IUJC 2XCTB 1LJLA 3DFZA 1W44A 2YIVX 3PL5A 1IY1A 4KVFA 3DDNA 1CZUA 1OAOA 1HYHA 2JF0A 5BV2P 3L6CA 1J0XO 5A1JA 3C3WA 1PR0A 3N5CA 1I6KA 2QR3A 4I8DA 3L7IA 4FR2A 1N3YA 3GNSA 3AEYA 3ZV3A 1WHSB 1HFWA 2NU9A 1SRRA 4TT8A 1SELA 1FL9A 4JKOA 1I51A 5FI5A 1U0EA 1ZK0A 3T3DA 1LCIA 1JPNA 1SJ9A 3H16A 3HXKA 3RSGA 1GP2A 3MUNA 2AKEA 1UFOA 2XKAA 4GLBA 1W36D 1BRMA 5FNVF 5BQPA 1VC2A 1XEXB 4L6AA 1ZD2P 4QUIA 1W4BA 2TMDA 1WA5A 3AERA 4DM7A 3P9SA 2X5XA 1CFJA 1CY8A 2CVPA 4RHYA 3WQSB 1HYEA 1H0RA 4X1IB 3MOSA 4KXFB 4ZAXA 3BRCA 3R7WA 4IX1A 3ZCQA 1KK0A 4ND1A 2EX1A 1KNXA 3G02A 1SHKA 5CFLA 4MKIA 1A77A 1NVUQ 4JT2A 4R2HA 4RMGA 1Y3DE 1T29A 1G3MA 1X8XA 2ZSDA 4C05A 2BDEA 1W93A 3SQNA 5I5GA 1T9AA 3W79A 2I4LA 4CIVA 2YZNA 2ECPA 4IBOA 2TSYB 2YHAA 1YRHA 4ZQCB 3TMKA 1E5LA 1NQAO 1IL0A 1Y6FA 1P7VA 2XUHA 2I3ZA 1E6LA 2HIHA 3AHIA 4EH1A 4JI1B 1PZEA 5H5JA 1XL0A 2QMYA 2QI9C 3NHSA 5IZ4A 3ROFA 3L40A 3GN2A 5DHSA 1E3MA 1JG2A 3TUJC 3H7AA 4V38A 1V3UA 5GWXA 2EFHB 2HNBA 3T3PB 1OLXB 1W5TA 4QOEA 3PTAA 3KTAA 5L3RA 2Y3IA 4DBVO 3QVOA 1CP2A 3MAAC 4KTVE 5HCNA 2IE8A 1HE5A 3WLNA 2UUOA 3ZN2A 3JQ6A 5DBFA 5LQCA 2DBYA 2JATA 4CMEA 4CODB 1QWSA 4KQ9A 5KNDH 2MDTA 4GZ3A 4YLGA 2BM1A 1ZCZA 2CXRA 3O3CA 2H7CA 1YDGA 4MQ4A 2ZRAA 3MLBA 4QBGB 4B46A 2F9MA 2PL3A 3BVPA 3USCS 1PJ3A 1HA3A 1B8VA 3H1TA 2UYYA 4YDSA 1M3SA 3DF9A 2DY1A 4YROA 1SUSA 4JI6B 5A1TA 4DNOA 5C7YA 2ZT8A 4A7PA 5KNDA 1ZM2A 2DHDA 1N5KA 3OURA 1N8TA 4Y2JA 3IP8A 4AX8A 1SA0B 4CLHA 5BRJA 4NEHB 2QN8A 5U1PA 1EK6A 3UXMA 4V3BA 1WY7A 2PN1A 3V8EA 1NUUA 3VHXB 5JMTA 2EC5A 2I7VA 2JGRA 3ZR4B 1ORVA 3D54D 3P52A 2J3JA 3GVPA 1E2IA 5F3WB 4KL8S 1YKFA 2QXTA 1HDXA 1DBRA 1JR3A 1E5XA 3LBHA 1J8YF 4FFBB 3CR3C 1VP9A 5F76A 1CRZA 1R8XA 5KKNB 1U8UA 4BFYA 4NBWA 3K2IA 5KQMA 5ETJA 1Q7EA 2YXPX 3MRVA 1E79A 5FRDA 1E7SA 4C0BA 2NVOA 1V71A 3KZ1E 4L3OA 5FOVA 5JRJA 3BT7A 1L6RA 2VZEA 4L72A 3VKWA 1KAGA 1N2GA 3U3JA 5EQTA 1KZGB 1U5BB 3BUSA 5I45A 5LWQA 4NV1A 2OO5A 4RBNA 1OZHA 5LLSA 4DIMA 1RC1A 2OY0A 3JS5A 4JJ6A 5FL3A 1Z2PX 2YWJA 3MD9A 5J2UB 4M6WB 1GG8A 1EDDA 1XRPA 2XD4A 4R1TA 3RAJA 3CZQA 3ZTWA 3TG2A 3U44B 1VHLA 4W4TA 4OQDA 1F2UB 1I3LA 3I2IA 3L8GA 5COQA 4NXMB 4B4WA 2BEUA 3QLUC 1VMEA 4IVQA 4OIFA 1NVBA 2OT3B 2P0AA 3L1JA 3TIFA 2ZSEA 3ZGLA 2DKNA 2FSIA 2GBCA 2MOKA 5AVWA 4GX5A 2RGBA 5ALGA 2DQYA 2OFPA 4FYIA 4LNUB 5E1MA 5E6UB 3D1LA 2C1ZA 4X6XA 4M1EA 2JZOA 1M75A 1JLSA 3IMEA 3KZVA 1DCMA 2L42A 1EWYA 4BYMA 2FFHA 2OZKA 3AVTA 3SC4A 1MORA 4KBYA 4TWIA 4X20A 4QICA 1GKYA 5LN1A 1X1EA 1ZUNB 2AC4A 3UHAA 2ZSIA 4UUOA 3L7NA 5B7GA 5C9ZA 3OHSX 2H51A 3I6IA 2WRZA 4ACBA 3THSA 3LGAA 1QHHB 3TZQA 1P73A 5EIHA 4G01B 3N70A 1U3WA 3KSZO 3ZHOA 1AKEA 2PXCA 2ZUBA 5E1BA 5K4HA 3TBKA 1K98A 1E59A 3D43A 1U8ZA 2J9YB 1ISMA 2CXPA 3N9IA 1S8AA 2G40A 5EI5A 5BSVA 5JQGB 3KKLA 2V4MA 2C5GA 2YXBA 1QO9A 2FQQA 3HA2A 4D56A 2HDWA 4EZEA 1UPUA 4IVNA 1L7NA 1YXMA 3MBOA 3VC7A 3G79A 2JRLA 2PRSA 3M9WA 4RZ3A 5IVDA 1D1TA 2XOEA 3GIWA 1QIIA 2YHIB 4EKDA 3CR8A 5GTDA 3HDJA 2QUBA 4I1SA 5E7MA 2VNAA 5DM70 2WILA 1YJQA 3O2NA 4IXDA 1IBKB 1PT8A 3I01A 2QXUA 2X8LA 1L4BA 4L6IA 5HSGA 3HO1A 4P33A 2ERYA 2EJVA 4XASA 3ETLA 4UD2A 2IFTA 1EAMA 3GLQA 3N39C 4OUDB 2CFOA 3V8NA 1ORRA 1W4RA 3I45A 4YP7A 4Z51A 3ETJA 5BV1A 5C32A 1NW4A 4FMDF 1CZKA 2Q3BA 2FR8C 3JQAD 3ZJ4A 4V39A 1KQGA 5MGNA 4WSOA 3DF7A 1UMBA 3S2UA 4AJJA 3P9RA 4H1UA 3LS2A 3ONVA 4RKFA 2AMJA 1OE0A 4QRIA 5JTTA 1ZIDA 1RDFA 3KYCB 5EHGA 1V7ZA 4Y2YA 3OTGA 3J81A 2ZTUA 5A5VA 2GCOB 4KZKA 1KY5A 1RPZA 3ANSA 1UMDA 1VA4A 3A3PA 4C4YA 2O7VA 1QHIA 4OMDA 3ZWBA 4CL0A 3I5XA 3U61B 1DX9A 4ZHSA 4YEDA 1Z5UA 4HNHA 4L8VA 1DRWA 3A4LA 4GR9A 4L51A 4TLCA 5FV4A 1D2CA 4N18A 4P7KA 4DUZB 3UC5A 3QEAZ 3GAMA 4GI2A 1P8JA 2RI0A 4FFSA 2HSZA 1MENA 4YXFA 4YQZA 1Y4AE 1Z5NA 5DWVA 3JTMA 4NV0A 4B79A 3NAQA 4Q16A 2Q41A 5TVKA 2W70A 1ZH2A 1T0IA 2VJYA 3FTDA 1AZLA 4OM8A 1TVEA 3LCVB 5T3UA 4WZBB 2GO1A 4Q6WA 1GRCA 1X92A 621PA 3SMQA 2NV0A 3TLZA 5JYCA 4OX9B 4JC8A 4MQUA 4D0RA 1HQKA 3I9FA 3ONFA 4TTRA 2VAPA 1EDEA 3BMQB 3BDAA 4QXRA 5LWHA 2Z1MA 2GI4A 1QYCA 1ZHHA 2BKVA 3FUUA 1OPXA 1Y8QA 4B40A 4LFAB 3R7FA 4PNEA 1T43A 5C2JB 3ZNQA 1HLDA 1L7PA 1O08A 2PSJA 4L0MA 4LJKA 3O94A 4PC6A 1FXSA 1UUFA 1CSEE 1XQXA 3K6KA 4X54A 1FRQA 4IX9A 1IXYA 2HK9A 1RLOA 4YLYA 1VLQA 4R5HA 4NYJQ 4LECA 4LMRA 2PJUA 5I9TA 3ZWMA 2QVZX 2YZ2A 3KUXA 2TMGA 1G21B 1GPNA 2AVNA 3KUKA 4ZOLA 4AUKA 2RB5A 5B7PA 1GFWA 4C2UA 2CJPA 4IRUB 1FVFA 3Q8WA 1YFKA 4KYVA 3D2LA 3JYOA 2DTXA 3V1TC 1G6HA 1Z68A 2AK2A 1XXHA 3RC1A 1ZSNA 4RF5A 4B6PA 3T41A 3ND5A 4BC0A 5FUVA 3T0IA 4CEIA 3FUCA 1PR2A 4RDXA 1B7GO 3ANLA 1KY3A 1ESCA 5LBIA 2YUIA 1WDKA 3OZIA 1QOQB 4Q4CA 1CFZA 3CKKA 3PX3A 3D8BA 4N0PA 1VKJA 1AKTA 1GAEO 4Q1EA 3K1ZA 1A97A 2CDBA 3AQIA 4EX6A 5JS8A 4NIMA 5JDIC 1VMDA 3O8LA 2Q4BA 3FGZA 4HH0A 1G20E 2ZWPA 3TX6A 4GVXA 3ICCA 3TNFA 5LQAA 4DV7B 1FP2A 1S9DA 2INGX 4C08A 5L9AA 5CIYA 2AR0A 5A3RA 3IKLA 4AKTA 4E03A 1JVNA 1L9KA 1OXBB 1M2NA 1U2GC 2G80A 2W2TA 1ECBA 3KXDA 3MZ0A 3QVWA 1V1RA 3UJBA 4CCWA 4JEUA 3REQA 2F48A 2UVDA 3D6FA 3GLGA 3W2GA 4FLEA 1D1QA 1FFWA 4NPCA 4GIBA 1Q5PA 5AVQA 2JGNA 2XSZA 1SVLA 4KN8A 1R10A 4C6TB 1X7WA 1V35A 4FDAA 2IV2X 1ZINA 4MP6A 1PD0A 1Z2AA 4UTZA 2CY0A 2NOAA 3W78A 3NR2A 4U9HS 2B82A 1Y5RA 4TTJA 1SA0A 4UVDA 1Q1EA 1VBKA 1PNOA 1WCWA 2FPLA 2FW9A 2HF7A 2W37A 2ZRPA 4RAOA 4UUPA 4ZVOA 1QXSA 3MQ2A 1PWZA 1W49A 3V2GA 3VHXA 2W4MA 3QWIA 1QWOA 2YWDA 2AI2A 4I2VA 4CEJA 2XITA 5KDOA 1RVV1 5FI1B 3UB4A 1PQPA 2GQ0A 3BMOA 4INOA 4NU0A 4EFLA 4ZN6A 2FE1A 3RKSA 2OILA 1PSZA 1UC4B 4LXTA 2CV1A 3R6LA 2DLCX 1K89A 4ZI7A 4E11A 4N7RA 2HC9A 2IP4A 1BO6A 2F62A 2I03A 3P2EA 1AMOA 2E1PA 2XYQA 4ZZIA 3E9MA 2J59A 2JLWA 4FINA 3V7WA 4BAUA 4GR5A 4HPJB 4POOA 1M5UA 1BRTA 3EJWA 1OF1A 1JVBA 3NHMA 1GD1O 4XTRA 3VR4H 4P36A 3MJ4A 5H7XA 3GLFE 4B80A 1P4SA 1T36B 3K3PA 3O8QA 2C4WA 4I6GA 4MLCA 4BU0A 1B76A 2Z6UA 4NHOA 1ZNYA 3GRAA 1WO8A 1IHXA 2BCJQ 2P9JA 2WJAA 4F60A 2F4NA 3SJ7A 3C1UA 2HCTA 3WL3A 4XFKA 4KQ2A 4O2BB 4DV3B 1TTHA 3L01A 5JXGA 1X7XA 2G1UA 1F9AA 2EDAA 3AINA 1O95A 3GJYA 4AP9A 2NP7A 1ZJ6A 2YRWA 4M4SA 4Y2VA 3I76A 5HM8A 1GA1A 3SOZA 3IULA 4GRDA 1REQA 4C01A 2O8DB 1RZVA 4RENA 1QAOA 5CITA 3O8RA 4NR0A 1TM1E 1KMIY 1AK1A 5L4NA 2YWHA 4RELA 4Y98A 3V8VA 2IA5A 4TMVA 1DTEA 3K31A 4TKUB 5D00A 4M8KA 2I3DA 1HC7A 3REGA 2D0PB 2OXCA