2H0RA

Structure of the yeast nicotinamidase pnc1p
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
216
structure length
216
Chain Sequence
MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISFAKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGYKTTVLLDYTRPISDDPEVINKVKEELKAHNINVVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Nicotinamidase
publication title Crystal structure of the yeast nicotinamidase Pnc1p.
pubmed doi rcsb
total genus 80
structure length 216
sequence length 216
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.5.1.19: Nicotinamidase.
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 2h0rA00
4L07A 4WH0A 1YACA 2H0RA 3HB7A 1J2RA 3IRVA 4L08A 3TXYA 4H17A 2A67A 3O92A 3OQPA 3OT4A 1X9GA 3R2JA 3O90A 2WTAA 3TG2A 3O93A 3TB4A 3V8EA 1IM5A 3MCWA 3O94A 3S2SA 3UAOA 3R77A 3LQYA 1NF8A 1ILWA 3PL1A 1XN4A 3O91A 2B34A 1NBAA 2FQ1A 3EEFA 2WT9A 3HU5A 1NF9A 1YZVA 4WGFA 3KL2A
chains in the Genus database with same CATH superfamily
2W42A 1WDKA 2AJLI 4N47A 2P4UA 4YJGB 1SRRA 4DDWA 1AQIA 3LSYA 3T5GA 4HWRA 1X1CA 5I3CA 5JVDA 2I7XA 3GMDA 4UQPA 2ADOA 4C29A 2JI8A 4N3CA 1D5WA 3FUTA 2I7VA 4OEHA 3CM0A 3TZLA 2HIGA 2LV8A 3JZMA 5C8DA 3SBEA 4GMHA 3LY8A 2CHEA 3FIUA 4I1YA 1PR0A 3C3DA 4HDQB 3F90A 1V5EA 3JARB 2YMLA 1MNQA 3DHEA 1ULAA 4LTDA 2PKYX 4ALJA 4BLTA 2B0CA 4MPPA 4NE7A 3T8YA 3T9CA 5BSMA 3HY6A 4RK4A 1CW2B 1QHGA 5JXIA 3HB4X 3KVRA 2UZ0A 1U0FA 4IV0A 2WWVD 3ASUA 1KU0A 4LNAA 3UC9A 1C29B 1R6BX 2IEZA 1UKEA 4FXOA 5WRFA 3TJMA 4J7XA 4KVAA 3V55A 2CVFA 5F2NA 3CCBA 1T3HA 3EYAA 4BL5A 4JP1A 1RYYA 1X80A 4ZOAA 1NBMD 4DEVA 1ZM4A 2OFWA 3KBBA 4ARAA 2VTBA 4MCJA 3NW9A 1DIRA 4AM8A 3EIFA 3QX7A 3RAJA 2A5LA 3LQFA 5LD2C 4IINA 4RK7A 4AX8A 1BDBA 5JZMA 4MA5A 4AG3A 1G0NA 5KKCA 3PC4A 1GPUA 3QI7A 4FDVA 5FP0A 3SSAA 2B8TA 2H2GA 5K20A 4AAYA 6YASA 1B74A 1Z08A 2C83A 3C3WA 3GZNA 4N3BA 2W2QA 4IJ5A 4PEVA 5E6RB 3ZLBA 4HLUA 3RJMA 4LK3A 3MD0A 5JDIA 4DV6B 1PT5A 2FR8C 1M2HA 4GG1A 2WPDD 2Y0CA 4S12A 1COZA 3FPSA 2NAFA 1GA4A 5AXCA 1NF3A 2P3QA 4O2BA 5IBQA 2C2HA 4Z2YA 3WLRA 5JD5A 1O97C 4ZZ0A 1ABBA 2VDJA 4MITA 2XLBA 2IZZA 2IUEA 4OTZA 4ZEMA 2QBYB 4AN0A 5D01A 4G4GA 1ATIA 1V1JA 5AVYA 2JVIA 1VG8A 3O1IC 2WSMA 4L3WA 3ZCVA 2O59A 4TVKA 1YOVA 1Q7TA 1SFRA 1Q95A 3DH0A 4LZJA 3LVFO 4G0MA 4MS3B 1IG0A 1RE1A 1EFVA 3R75A 4Q9IA 3PTLA 1MJFA 4GICA 1PNVA 2JGRA 1YHZA 4RPHA 2IVFA 1I6KA 5GV7A 2YWGA 3SMVA 4B3MB 3ZHSA 1Z6ZA 1JWAB 1ZRNA 3NRBA 3GLIA 3FYTA 1KE1A 4WTOA 1IVSA 4GGMX 1UQUA 1AUVA 2AF3C 5ALQA 4MLCA 4DB2A 1EWVA 2ZUBA 2BC9A 1HETA 3AUYA 1TTTA 5HS6A 4PPFA 1BVYF 2WIKA 3UJPA 3JQ7B 4C21A 2V0GA 1OWNA 4XYLA 3BT7A 3U9TA 3AERA 3N2NA 2HWKA 3FRIA 3D2AA 2WKWA 5BV0A 3M1IA 4QYWA 2I2BA 1V1MB 4RPGA 2DHEA 4RHXA 2BFBA 3SJZA 1FP2A 1GKUB 5AJVB 5JRJA 3QHPA 3JAWA 3RYIA 2X0EA 4C4XA 4KXUA 5IXSA 2AZDA 4DDTA 1W25A 1DNPA 2V9CA 1Z82A 1OPXA 3ILHA 4RNCA 3PUKA 2W2LA 3DAOA 4XD2A 4ZWNA 2CMGA 3NDPA 4LZOA 2NZVG 2YN4A 3KAJA 3EASA 4YAJA 2DXIA 1L7BA 2GK6A 3HK2A 4BKQA 1EBFA 2O3TA 4YK7A 1ACMA 4QDXA 3HXKA 1P0QA 3JWEA 1XMSA 3BMCA 2QN2A 3D0KA 2BEWB 3HCRA 2D1YA 1G4AE 1XXLA 3UK7A 3WTBA 3UWOA 4BFXA 1XNRB 4Y98A 1X39A 5E9AA 3JWIA 1CEXA 4UBKA 4XIFA 3O4GA 5DP2A 5GONF 3N0XA 1ODIA 3NVDA 4BP3A 2B34A 3AILA 3EIOA 4L3OA 4K88A 3PUVA 1ADGA 4RM2A 1HYGA 1CULC 1XWIA 2GK3A 3NH9A 2R3SA 2W2LD 4Q39A 4CV0A 1M7BA 2VRBA 5JC8A 5K9ZA 5CYFA 3BDAA 4WBSA 4B79A 1IEQA 3CN9A 5FL3A 2WUGA 4FUTA 3ZV4A 1JU9A 3QVGB 4W4TA 1CQIB 2RG7A 4AF8A 4X8HA 1MB4A 1NX6A 1OA1A 4AO8A 4YUYA 1T25A 4O6VA 1NN0A 3I5XA 1VIAA 1XVAA 3ZJVA 5K7SA 1BYUA 2QT9A 4OLAA 2IHYA 2Z3VA 5EIAA 4CL3A 1PU2A 4B6QA 1OJLA 4TZKA 2J9XB 3L01A 4CT0A 3Q3GE 1OD6A 4X91A 3B3FA 3NAMA 1RZRD 4EVQA 4PIMA 3MT0A 7REQB 4RGQA 3P4YA 3K5HA 3SHWA 3QUCA 1VTKA 2GKOA 2ZU6A 1ZJYA 2FUEA 3IGFA 3AK4A 3HI4A 4GM1A 4UHEA 1S7CA 3F74A 2OORA 1P39A 4L51A 4ZANA 1AMOA 1A8UA 1TEXA 3KWLA 4TVBA 1M1YB 2YL2A 3H11B 3V1KA 3GNTA 2F48A 3F96A 1HMPA 3QKSA 1GA6A 2X8LA 3QY0A 3RU2A 5B7PA 2N75A 5FUWA 3UH0A 4ZMRA 1VRVA 4YH1A 3LVBA 4TKLA 1KAOA 4FW9A 4U3JA 1JDZA 1IRXA 3E8XA 4JA0A 4NR0A 5GV8A 5DNUA 4ABTA 3PJEA 3OIGA 3OP4A 5H70A 4M0UA 2VWHA 3IEPA 3INNA 2Y66A 5BSRA 5BYBA 2Q2WA 1MXHA 1P74A 2UXBB 1MAWA 3P9XA 1S2GA 1LNQA 4IMPA 1K63A 2C2ZA 4J0CA 3O3OB 1ECJA 3EFBA 2IZ0A 5DGXA 4PZCA 4DZRA 3PTZA 1H3EA 2D5AA 5G41A 4OA8A 3ZWNA 3DZDA 1C9YA 2GPYA 3ESCA 1BH2A 4WN3A 3T3IA 1AQ6A 4NYMR 2B36A 1GPBA 3FSGA 4U2EA 4BB9A 1DAGA 1V5FA 4FHEA 4MW4A 3DXZA 3CO0S 4D98A 1LK0A 3PE6A 4JB3A 1REQB 3KWMA 5AJTA 3DFZA 5K1ZA 1DLIA 5EJ8A 2MU1A 5K0NA 5JTTA 3TFOA 1RD4A 2OAQ1 4B46A 1Y3DE 2GKGA 2RKOA 3G9TA 5IJ0A 1GU1A 4OHZA 4C4RA 2YXEA 2RKWA 3THWB 4XQCA 4D9IA 4HQRA 3V97A 2VDWA 3LZCA 5LA6F 4DM7A 1SKMA 1GFIA 3UKOA 1KTVA 3GLKA 1M5UA 1E1MA 1ODLA 1UPCA 3AR6A 4RHYA 3V4VB 4A03A 2VJBA 4CKBA 4GRAA 1RKQA 4PC2A 5A1JA 4EKNB 3IP9A 3KR2A 5GMOA 1JXQA 4LDZA 3ZH2A 1LBTA 1L5HA 2C9ZA 4EOGA 1JEYB 2AN5A 1WG8A 3QE9Y 4YYZA 3SHFA 2EGHA 5DKFA 4JUFA 3OUZA 4A0QA 2BGLA 3N05A 4YUVA 1EX7A 4M0EA 5DRTA 5KX5A 1OWLA 3WBJA 2H0AA 1QAOA 1LPBB 1SK8A 1CY8A 3BMOB 3IMKA 4I8IA 2FZKA 3L07A 5BV1A 2IL1A 2OUIA 4X85A 3QLUA 1J8VA 4LYDA 1EP2B 4LZPA 4QUAA 1Y34E 3JYQA 1NNI1 2NX2A 3HBLA 2JJ1D 4M8IA 2VHCA 4V0LA 1GKYA 2JH3A 2Q5IA 1L5KA 2ILTA 4NMMA 4RHUA 1GCOA 1SU6A 2JHGA 2J0UB 3B78A 4DC0A 1ECCA 4QARA 1QF7A 1XRMA 2WP0A 4P82A 2JRLA 4JASB 2A5GA 4LJ5A 2NWQA 2V6BA 1RBQA 2JGAA 3CR8A 3QYJA 4IKPA 3UXMA 5JMPA 1CS4C 2YZGA 4B4UA 2OBXA 1PBNA 5JEDA 2PT5A 9LDTA 4JJ4A 2B9VA 3DG9A 5JAUA 1M8KA 4HAOA 1BVRA 5HWSA 2X0FA 3B6MA 2V7BA 4F96A 4V1CA 3I04A 3MD9A 1E8NA 4X65B 4IILA 2FMKA 3TQIA 2B20A 3IS3A 3SIWA 3SBXA 1ZAKA 4Q3DA 1E9VA 3P9SA 3CH6A 4NULA 5CD9A 3WLOA 2XXBA 5K6RA 3BRQA 4PC3A 2FSSA 3NTQA 3ZEIA 2KQUA 3N2YA 4NNPA 3OQOA 3R6WA 3L1VA 1FVXA 221PA 2B5OA 2OFPA 3EOBI 2QRMA 2YASA 2ZJ2A 3M1AA 4HLQB 2YNMC 3A4LA 4JCCA 4RV5A 4PGGA 4WY2A 3VVMA 5AXAA 1K6EA 1UZUA 2BPOA 2EZUA 2HMAA 3AEKB 2BGTA 4KYIB 2FHPA 3TYXA 1JQKA 2ZIVB 3Q1KA 4HB0A 3KFVA 5IXJA 1GTZA 4WXYB 4LYEA 4ZYLA 1H5NA 4M0DA 3WFJA 5AK3A 3UC5A 4Q3AA 4Y6PA 4OXIA 1QG6A 1CV2A 3O8OB 5F2EA 3DAFA 3MYYA 4CETA 1Y4ZA 3WBFA 3ZDEA 4BNDB 2D6FA 1BA3A 4J0KA 2D0IA 4WJLA 2EX1A 4TMVA 3DZHA 4LHVA 1J20A 2DQYA 2FPGA 5E4FA 2HDWA 2DT5A 4XVHA 4KOEC 3VR0A 1TZCA 2Q5EA 1K2WA 1OQAA 3E4DA 2OBBA 1HY3A 3FI0A 3GRKA 4MV7A 1CUUA 2EZ9A 4RVHA 4FB5A 3FN4A 2P2ZA 3MS2A 1YZ3A 1WKCA 4ZA2A 4IVPA 1VSTA 4BV8A 3V7FA 3TGPA 5AQEA 5ESXA 3IURA 3CNHA 3I39X 4CLEA 1RU3A 1ULTA 1TQ8A 1JBQA 2R9VA 4ENRA 1IXKA 1N25A 4FT2A 4W5JA 3AFOA 1Q7BA 3HNRA 1F4VA 4QLOA 4R40A 4DEXA 2X8JB 2FOIA 4G25A 5T64A 4KWTA 2B1QA 3K6SB 2ZM5A 2P9JA 2BTQA 1Q1AA 1XQ1A 2FZLA 3B9BA 10MHA 3CT4A 3T5TA 4P0TA 4D8XA 3R6DA 3AJEA 1PIWA 3CMMA 2GHIA 3NRJA 4CKCA 1GTL1 3ZJUA 1O8CA 5J2TA 5DSXA 4BNXA 2IZOA 1Q0RA 3UK6A 2OWEA 4KN9S 2VI5A 1W93A 3OJCA 5GOTA 3CH5A 3QUQA 2I76A 2AQ8A 3DP9A 5IJ9A 2NSYA 4HGYA 4NMLA 2IBMA 1BJRE 1BKYA 1T2AA 4H1VA 4K28A 4FHDA 1FXUA 4N3NA 1NIJA 4KG7A 3GNLA 4FWIB 3UT5A 5ES4B 1BS9A 4G3XA 2JEOA 4EKEA 3KAKA 5EZSA 4C43A 5CU7A 4DNOA 1DC4A 1OJ7A 3A6GA 2ZZKA 3C5EA 4R9NA 4D02A 1CDZA 2IWHA 1DG3A 1NHGA 4XWYA 2V45A 2Q1XA 3DEYX 3VO9A 3PDIA 5ECGC 4UTPA 1TJPB 1S02A 1KR2A 3C3KA 3FJYA 1TE2A 2EG5A 2R11A 3Q9NA 4FYVA 4I8XA 5EXXA 1CPYA 5KOHA 1LRJA 1XEXB 2WZQA 4EB6A 1RM4A 2K7ZA 3I1JA 3IIIA 4ZI7B 3X43A 5C8XA 3K92A 1J8FA 3L7AA 1IEWA 4K1LA 1A2BA 2XXAA 1U8YA 1Y42X 2C20A 2GWRA 5AKJA 1SAYA 3G5UA 4FYWA 2DTXA 4UHFA 4M8NE 3TI7A 2G1KA 4X1OA 1U8ZA 2R751 3UNXA 1EFCA 2D8AA 1NE7A 1RWPA 4Q0MA 1O9HA 4RLSA 3UJAA 2CXHA 1ULHA 4GZ6A 2H48A 4TM7A 3KL2A 3MIIA 4P7KA 5KTSA 5CVCA 3V1NA 5CA0B 3LC0A 2GUWA 3AR8A 2D5BA 4HX5A 4E2ZA 4LQ4A 2CK3A 3DVRX 2H2AA 1V3QE 5SZIA 4DCPA 1GZ5A 1II9A 5AM2A 1V4BA 1W96A 3QWBA 1A3CA 4DLWA 1HG1A 5T4HA 4MIYA 2LPMA 5CPFA 1UK7A 5FBRB 4XDYA 3RJ5A 1U3GA 3F6EX 5LPNA 4X8MA 2QD3A 3WYGA 1D2MA 2VLBA 1MEJA 4NLLA 4R54A 3EX7C 1X7XB 3GD5A 1J0BA 3CWQA 2VQFB 4IDFA 4D0SA 1K9VF 3E58A 2H2DA 2JGEA 3AY3A 3E0QA 4EJ0A 2RK6A 4H15A 3A37A 5AP9A 1C30A 4YMSA 4AZ3B 4RABA 5FUBA 2A7XA 4M1KA 3AB7A 1CJUC 1FP6A 4D8WA 2ZI4A 4A92A 4MLDA 1T9GR 1JDTA 1U8XX 2RAPA 3ACBA 1WB5A 4NU0A 3UMYA 1V5IA 1FX0A 3BXZA 5JAHA 3R6GA 2NZJA 4I1VA 2YCBA 2A67A 3OZ7A 5TGZA 3EW9A 4BNTA 5JU6A 5DCWA 5AVQA 5AM5A 4OQYA 3SQMA 4DCTA 5LJIA 4TWBA 4GGPA 4U39A 4H3SA 5IPFA 2XD9A 5EIWA 3ND9A 3V7WA 1RI5A 2OD9A 1U8EA 2RDMA 4PPYA 1T0UA 4OHXA 4JVOA 4DLTA 1BIFA 4Z7QB 2DJ5A 3A4NA 4XASA 1G18A 1NRJB 3AR9A 4RF3A 4DNXA 2EJTA 3MTIA 4NYJR 2ZIUB 3H8JA 3JVVA 4BFYA 4FMDB 5ITVA 5CT8A 5EJ6A 3VR6A 5DCUA 4ARSA 5AM0A 1XV5A 4G9GA 2W2MA 3B1XA 3DNPA 3IIKA 2PEYA 1X87A 3RRYA 2BAGA 2ID8A 2HU5A 2I33A 2WG0A 3G9ZA 3I32A 4G1EB 4RHEA 5U1PA 2VP5A 2Z8ZA 4UFNA 3UTDA 4DM3A 3PX3A 3SZRA 1PL0A 3QG5A 4KE6A 4RX1A 3A6LA 3H97A 3KHSA 4GPBA 2G17A 3T0GA 4HWOA 5EQFA 1WXWA 3BL5A 4B0PA 2VT6A 3ECSA 4G23A 4LRXA 1OYVA 4KH0A 2OM2A 2XYHA 4C7JA 2O2SA 3IODA 4D6XA 4A27A 3AVWA 4N76A 2LCQA 1H6DA 1SC3A 4ZCQA 3G7SA 1ISGA 3MOGA 4EITA 1YH3A 5JWOA 1DB3A 1QORA 1QWOA 3LQ2A 3QKRB 4R51A 4D3XA 4BXOB 4O29A 3UHFA 1JN0A 1NW4A 3GLVA 3A4MA 3UGQA 3ZE7A 1PQWA 2VYVA 3UV7A 2BVNA 4M60A 3OTWA 1A5ZA 3BD9A 3DULA 4QECA 3CEMA 4ZVMA 5T4FA 2NZ2A 3TNDA 4MYHA 2HYIC 1YR6A 1WBBA 1H94A 4ETNA 3EEBA 4PWZA 4QG7A 1PTJA 4L7VA 5J4HA 2VK8A 4X60A 3W6ZA 1PNRA 2K87A 5H82A 4BMOB 1P77A 1XDWA 3DL0A 1K7XB 3VUEA 5IJWA 1M34B 1NFRA 1SK9A 3ZBUA 4L50A 2DFKB 2YV4A 1V47A 3E9ZA 3FH0A 3HADA 3U81A 5BOSA 3T1YB 2O19A 2H9IA 4GLLA 2I0FA 4KMRA 2Z43A 1B76A 4OXRA 4MA0A 2R87A 3KWFA 4L4ZA 4O2LA 4BZQA 4CQLB 4EYOA 3ZQKA 1UBKS 4LZWA 3EDRA 3UWPA 4MQMA 2OMKA 3HACA 4TYPA 5KIAA 2IDKA 1Z0ZA 1R2QA 1GZ4A 2FWJA 2WNIA 1GTMA 2ZR7A 1NUUA 2OR3A 3GELA 4J3NA 3KAQA 2Q4TA 3SR4A 3ZG6A 1JVBA 1SOAA 2ZWAA 3MCZA 3MJFA 3C3AA 4S35A 4B47A 5DHUA 5MF6A 2C9OA 2O8EB 3RLIA 2WAMA 2VNAA 3O03A 5U4QA 1LW7A 1Y1RA 2R8PA 4JU9A 5HK9A 1E89A 2REOA 2P9GA 4FYXA 1KVTA 1T2FA 1CCWA 1RJGA 1ZI8A 2XITA 3AM4A 3DUFA 4N9WA 2PRIA 1A97A 1ZCZA 2YY6A 3CYFA 3L5OA 1RVDA 1FRFS 4H7FA 5TDHA 1LWOA 4I9HA 2MOKA 5TVKA 1A9QA 1PLKA 4X95A 4BB5A 1YIAA 2W2KB 1KYQA 3UPDA 3WOVA 4MCIA 2HLNA 2JVJA 1A9RA 3BTVA 1X86B 1QO7A 1QS0A 4K9PA 2JATA 2ZR8A 4M1OA 4R41A 1YZKA 1HTWA 4QGGA 1TMYA 2A0YA 3DGEC 4LJKA 4V0KA 4BJ3A 2JARA 2ADMA 2HA4A 2R84A 4K6HA 1HF3A 5DISB 4CIBA 2V6IA 1F20A 4A4DA 3VKUA 4GNKA 3OQ6A 5LZ2A 1G4HA 2H4FA 4O4IF 4I6EA 5JH7F 4HDSA 1QYXA 2P27A 2FA9A 2VCHA 4PVDA 3FY4A 2O2XA 3FA2A 1Z4QA 4NQRA 3V7YA 4ARUA 2ODPA 3PNQA 1DAKA 1SHZA 2PWYA 3FDJA 3AY7A 1ZMOA 5C7IO 1XF1A 4XWTA 4CKZA 1ZXLA 3ZGZA 3IDZA 2GCOA 2CKDA 3TLZA 1JLHA 3TR6A 1S01A 1KGSA 2I66A 3BFJA 4RIGA 3AWDA 5EE9A 4D92A 4U2KA 4EPRA 3SX4A 1YULA 3RTEA 3OBIA 4LY6A 4LF6B 4HSGA 2H7CA 1ZZEA 2H4XA 1JPVA 2ODNA 3H99A 4I3HA 5AVXA 3DW1X 4L5YA 2NTJA 2ZE8A 2VUIB 5ICEA 1CYEA 2XGGA 3TXYA 1DKLA 3CMCO 5FI1B 2HBQA 2IKQA 2O3UA 1J21A 3G3EA 3HA5A 4S2EA 1D6MA 1Z8FA 3T9AA 3M6IA 3TEJA 5K3EA 3V34A 1XEAA 1WR8A 4M1MA 1TUIA 5ECDA 3TO5A 1VSQA 2PGJA 1H2RS 4HRVA 4MEJA 4KACA 5LQNA 2XOKD 2AFHA 3K5PA 2YDYA 2Q07A 4FHFA 1FYWA 1X7WA 2G4VA 3FCAA 3N7UA 4LNUA 4PY2A 1OBVA 5BQXA 1FEZA 1OXXK 1VL6A 1JSRA 1SMKA 1JEEA 1DKQA 1SOWA 1NR7A 2O1WA 1Z73A 1TCBA 1NMZA 1G2OA 1X1EA 2JA2A 1VGRA 3E9NA 4OYYA 5FDFA 3U44A 1G2IA 4ZEXA 5AJXA 4N0PA 3TN7A 4YCDA 1JWBB 4Q7QA 1P6UA 3GP8A 4REOA 4IIHA 4DCMA 1H0RA 1CRPA 2YWXA 4XCQA 2JGJA 3E9CA 2IIQA 1R0XA 4K86A 4BNVA 4CM8B 4F3NA 4LOHA 4BC0A 1UM9A 1HO3A 3UUEA 1UMCB 2FJ0A 1UINA 4KX3A 2X1MA 5K4HA 4X62B 4NPCA 3I4FA 1L8LA 2CNOA 2Z95A 2AKYA 5ALTA 1U90A 4M49A 4S3MA 4ZAZA 4JI4B 1II8B 4AWXA 5DI3B 4B80A 4Q9HA 3BCHA 3QVSA 1XKXA 2G4LA 2X2PA 1NI5A 4IJUA 1PBTA 2PUTA 5AW9A 3U56A 4QT4A 2ZUSA 2DERA 1WA5A 3C7DB 4RSMA 3L7BA 3DOHA 1B7GO 1TQ2A 2WY2D 1E0SA 3NHAA 4DBLC 5DLDA 2RJNA 2I3AA 2PU5A 4MYTA 2HPVA 2QQ5A 5B4TA 4BQQA 5C1PA 3AV3A 1QGAA 2B98A 3WWCA 3E7PA 2C57A 4IIEA 2R47A 2XQVA 3CIOA 3WJ2A 2JLYA 3WLAA 5CBKA 3ETNA 1CR6A 4XDZA 2V7WA 2H0QA 4D3ZA 3MF4A 3DLCA 1TF7A 3PGVA 1I51A 3CU5A 2I55A 1M72A 2OV1A 2REBA 4O4HA 1D2HA 4UE2A 4ZD6A 3FNRA 3ZYCA 4DLZA 4ARZB 3WL6A 4FGJA 3ET4A 4MVCA 2DHRA 3H1PA 3KJFA 1NUTA 4CLOB 1AO0A 3PJRA 3FLBA 2AF4C 1FE8A 1W0JD 1D2GA 1G8HA 4LYJA 5GP1A 2NUBA 4RTOA 4UBJA 4CKWA 3GRFA 3PUXA 1DX9A 3CG0A 4ZFNA 2M1XA 4FP9A 2FMUA 4DLSA 3E82A 3K73O 4L5AA 1ZJZA 3U3MA 2C58A 2VA8A 4TRNA 3UMMA 3RSGA 4QUDA 3B89A 4BNMA 4F1WA 3T5PA 4PN3A 3DT6A 4JNCA 3WGQA 2QTFA 1AF7A 2BFFB 3BRWA 2GTIA 1C5KA 3PZRA 2OG1A 4QFCA 4ECAA 2OAP1 1YJAA 1P3DA 4XM1A 4PAQA 3SJAA 3TBHA 5K3OA 1YL6A 1ABEA 3NUQA 4EKYA 3TW0A 3QUBA 3UAVA 2I9KA 3LGAA 3QSYA 1GZVA 1TGVA 2WKPA 2CWDA 4FJ1A 1WULS 3G8BA 3K1AB 4TRMA 3H3XA 2L19A 4RADA 1LA2A 1XPJA 2F17A 1UAGA 3FNFA 5D1HA 3WLNA 4X1IA 2WHPB 1IHYA 3C2QA 3OIFA 5E38A 4B2PA 1U9IC 1X7DA 1SXJB 4HXEB 3QOXA 4F4UA 5MGNA 1EVZA 2NO0A 3FPHA 2ONJA 1XN1A 2PZMA 5ALNA 5G40A 2ORVA 2OZEA 3HN7A 5ALJA 1BFUA 1X9GA 3WLKX 3ZHUA 3Q6IA 4ER7A 1ZNYA 4AWAA 1FSPA 1YZTA 3CH7A 1A9ZA 4GPTA 3CZ4A 2QG4A 2WNSA 1E3WA 3AV0B 3AP2A 3KLBA 1XROA 3DZJA 2YVQA 1KMCA 2IYQA 1CKEA 4RORA 1JR4A 5MFZA 4PLVA 3EODA 3S1SA 1SHTX 1T43A 2QTMA 3KQOA 3EZ7A 1S0UA 1TRHA 3DBVO 4LX8A 4B31A 5K3DA 1Z56C 4CGZA 1WUTA 2XDAA 1AQUA 1EZ1A 4JOCA 3LNCA 5GIPE 3CH4B 5FQNA 1FVFA 3BMNA 3FM9A 1XP5A 2DUMA 1L1QA 1ZMXA 1ZX1A 1XJ5A 2L17A 3BZWA 3EZ2A 1K7SN 3OVMA 1Q83A 3F6BX 3PQ2A 4DUYB 4ENQA 3STYA 4CEHB 4KN8A 5B12A 2J5KA 3R20A 5HF9A 5AVWA 1E9SA 1GNLA 1MA3A 1QIGA 1YQDA 2BEKA 2P5YA 4IDOA 5AXBA 4BNIA 5MFPA 2QTZA 4K6MA 3A6HA 1UKZA 4TV9B 2XB8A 2DC1A 3D6HA 5SYMA 2OHHA 4OU5A 1SC1A 4RHTA 3HWSA 4DMMA 2ZIXA 3NTRA 1RJDA 3B6JA 2HJGA 4OUDA 2FFBA 3I64A 4GI1A 2V97A 5FBZA 2OBFA 3T7EA 1HTBA 1NC3A 3C5WP 2Q49A 4MB2A 2P62A 4NPAA 3RFCA 1N4DA 5F5XA 4DY6A 4AIIA 4BX2A 2NN3C 2H2HA 2VHUA 3CUKA 2IV2X 1ZM2A 1J0AA 2C5GA 2BKUA 3UG6A 1PYDA 4BQFA 3NDRA 1IQ0A 5L3ZA 3DE0X 1KZ1A 1HKUA 1SCQA 1ZIXA 3ORSA 1S5PA 5C35A 1ZXBA 2FP4B 3L02A 1JPUA 4HAXA 1Z2CA 2VP0A 4AULA 4OQZA 4BMZA 5KNBD 2BMWA 1JA1A 3LVQE 4OK6A 4XQ9A 4RANA 1FBTA 4ZYZA 2CL5A 5FAXA 2A35A 1PEAA 1F6BA 1L4KA 4DSZA 1WLSA 1CDOA 1YNOA 2ET6A 1XMJA 2HPZA 2HFJA 3BD6A 3OEEA 3OPNA 3U4IA 2DVMA 3OLZA 4J2TA 4JLDA 5E7MA 4NBNA 2YHUA 1CRQA 2VHVA 4DCOA 2V59A 1IN5A 1KFCB 3CEJA 3ETJA 4MI9A 4W8GA 4MWEA 5GJCA 5ILQA 3FPGA 3B5EA 1IZ7A 5LXTF 1HK7A 4TKVA 2O5CA 4UARA 1EAYA 2ZSUA 3U0BA 2D59A 4B84A 1SBYA 4BNZA 2XMDA 3DE3X 3PPWA 4QPDA 2R8RA 1MV8A 2VO1A 3L79A 3UXEA 2JFWA 5GZ3A 4ZCMA 3B60A 3EXFA 4L78A 4AT1A 5LSAA 4PINA 1EUYA 3EMBA 3KXIA 4PG4A 1U98A 1W88A 3LCMA 1UK9A 1EFRD 3D3JA 4IH1A 3KJZA 4ZMBA 2ZWVA 3JPWA 1M83A 5D8DA 3OEED 1ENPA 3Q7SA 4DJJA 1DJOA 2YW2A 1IZ0A 1K5GA 3QLJA 1LQ2A 2ZXFA 1RLUA 2YV3A 4GYWA 3DAGA 4LWZA 5DPMA 4S1PA 3Q5DA 4M1QA 6REQB 3I62A 5EP1A 1SCNE 4Q00A 1IL0A 3TQOA 1Z8HA 4BO9A 1DQYA 3N6XA 1G8FA 2QZSA 2HCBA 5AXDA 5L3VA 4KDFA 2AD1A 1TQ4A 3E8MA 2OSBA 3ZWWA 1SXQA 4EKGA 4P2BA 4HN2A 1NA5A 5EFZA 4YRKA 1J09A 2V58A 3ON5A 4K81B 5EA2A 1VZ2A 2WD7A 3OG9A 3UN1A 3V4FA 4DIOA 3FYUA 5I7UA 4BJ5A 3C6QA 1KDOA 4KEAA 1RYBA 2D0DA 2ZYIA 2ZRNA 1AB5A 4F7DA 2ZWMA 3NGMA 2PS9A 5FJJA 1WW2A 4IDBA 3PEUA 3WB0A 1ZK2A 2Y1CA 4HQNA 2P8JA 3VOBA 2C99A 5HKOA 1MAVA 5AKHA 4YFYA 5EPOA 1NW3A 4E12A 4KWCA 2Q2NA 2ZJ3A 3NC0C 3P2YA 3T9EA 4EECA 2KLBA 4HVAA 1F3OA 1UPUA 3DDCA 4FGWA 2FPUA 3QVLA 4V0QA 1RHMA 3LQ4A 1T1IA 1GT91 3OIDA 1Z0SA 3O8LA 4CR6A 3IR6A 5IW8A 3LYUA 5JS2A 1QB8A 2ORWA 4UTNA 1PJSA 1WW3A 3ZGLA 4FGZA 4PNZA 5B1HA 5DNCA 3UAOA 1T0PA 2OENG 3EF1A 4C5AA 4JENA 2GVZC 1QH1B 1VQ1A 2ECQA 2ZDHA 2ZW9A 3UJNA 1BO6A 2YVAA 4ARBA 1E32A 1M2OA 1V2HE 1B0ZA 3IOYA 3MEQA 5EJFA 2F4VB 1J8DA 1AC5A 3CNQS 4QPPA 2NO5A 2BBSA 4O63O 3MGBA 4DRXB 3HEAA 2OB1A 3DLPX 2RHGB 1CEEA 3ZDYB 4F9EA 3SLGA 4HH0A 4R8KA 3EVDA 1AXGA 5DASA 1ULSA 2YIDA 1V7ZA 1T3SA 3A1CA 3IVXA 3W2EA 3FKSD 3W77A 4WNIA 3BD8A 5HCNA 3VO8A 4DRYA 5E1MA 4RTPA 4HFNA 1Y1LA 4YFVA 2PFKA 4PQGA 3OMXA 3FUUA 3SQNA 2OCXA 1FIUA 1XNHA 3QY9A 2V7XA 2Z09A 1CDEA 1KK3A 1I5RA 1YASA 4PBSA 2J3DA 2JFXA 3SYMA 2Z08A 2H1WA 2PUDA 1K7FB 3L77A 3F7MA 3EUAA 1MIHA 2NU6A 2EARA 3CF0A 1M8FA 3ZK7A 3C85A 4E7PA 1NZDA 2GLUA 2YFYA 3PQ6A 2A0KA 4PYKA 3SFVA 1KOGA 3IOMA 2GFHA 2O7QA 3QRWA 4JY7A 4TWIA 3ZZMA 5A5DA 4FX5A 4V2UA 1O6CA 2DQZA 2QNRA 1TRKA 5JSFA 1Z4MA 4IMJB 3AO0B 1EBUA 1EBBA 4X45A 1VCNA 4WLFA 5TE9A 2IH2A 2ZRFA 2G88A 4E2XA 1ZOSA 4QSMA 2OFOA 4R9VA 2LP4Y 3BB4A 1L4UA 3VHQA 4BO5A 3JQAA 1P4AA 3IP6A 3LDHA 1TZMA 4HWSA 2NZXA 3L8HA 3A1NA 2IHJA 1J2UA 2R62A 1C3LA 4GPEA 4IDHA 4GWGA 1NUSA 4XGNA 5B1DA 5LMUB 5CIWA 4YCCA 2GETA 3M4XA 4X6LA 1WHTA 4HADA 4IQGA 3CONA 3P20A 4ZAFA 3VZPA 2QUJA 2P9ZA 2Q5CA 3CUUA 3HGTA 2G9UA 3JWHA 4HEA6 1N6NA 4BP1A 1KYWA 3ZY3A 1Z4KA 3CX8A 1C2TA 2JK0A 4NFLA 3AM1A 3Q2KA 4ZICA 1NW8A 1LEHA 5IDYA 4M0PA 5TV2A 3R0ZA 1WBDA 5D6NA 4DDVA 3IV9A 1DRWA 1H1TA 4RKWA 1DC8A 2VA9A 3HJRA 4AZSA 3JQAD 3TG2A 3WTCA 2H2FA 2G28A 3E3LA 1E4VA 3B8HA 2QM7A 4FQ8A 4DC1A 1ITZA 1KJQA 1R6UA 4N03A 1TCUA 1QYDA 2O2JA 2C59A 3K0EA 5A5FA 4LHEA 2Z9CA 3KYJB 4I5IA 1TZ2A 1K4YA 2ZJZA 4J1TC 4E0BA 1N32B 2XMSA 1W4CA 3HGQA 3UW1A 3UK1A 3VBEA 4MRSA 1DG9A 3ED1A 4N8EA 4Q03A 5HKLA 2QJWA 1CIVA 3BTOA 2LXNA 2J0EA 3GA5A 3IUPA 5H02A 3T4UA 5A3VA 3TPFA 3PJGA 3X1KA 3E23A 1QP4A 2PUFA 1DGQA 3ZDCA 4C0LA 4G85A 5AOCA 4EP1A 2XODA 3ICEA 1L7QA 3IAS1 2WTUA 1TL7C 4B7AA 3QITA 2XV1A 4RPIA 3OJ0A 1G8MA 5BUQA 3R23A 4PX5A 2O4UX 2JDIA 4MVJH 2FEAA 3THXA 4QHYA 4B75A 2B69A 2OBNA 2XADA 1U4SA 4ZOBA 1WL8A 1EGMB 2JLZA 1WV0A 1L3IA 2KBEA 1E3MA 4JQSA 2H65A 3MSXA 2O3JA 5DTMA 3G85A 4FMDF 5H4GA 4B8WA 2G0AA 1QYVA 3AQIA 2IIPA 2OCKA 2SECE 3G9UA 3VU9B 4N01A 2ZRCA 4UXHA 2RGYA 3FTNA 1FUYB 2Z98A 3OKCA 1JLRA 3QKTA 3OZTA 5EERA 3S2ZA 1NBHA 2BI7A 4J6FA 1EVYA 2Z3WA 4EB3A 1A7KA 3AP1A 1C9MA 1E77A 3D3KA 3KYCB 4ZXFA 3IE0A 5TMDA 3WB9A 7ADHA 3TCNA 4O3MA 4O4LB 3FKJA 5FT9A 3W7BA 4CMIB 3FX2A 4EA8A 4QJ3A 3N8DA 4NVRA 2JDID 4LTNA 2FW8A 1KGDA 2YXPX 1RR6A 2FN8A 2YHIA 4MR8B 3VR4A 2OAGA 3OCJA 4I81A 1ZGHA 3SP1A 4ZGWA 1X94A 1M67A 3VHRA 1TAHA 5FPPA 3ADBA 3J7AC 4UM7A 3VXKA 2NP6A 1CHDA 2WHYA 4YWHA 2EL9A 2AJTA 1YB1A 3DDZX 1LDEA 2PKEA 4Q4HA 4U00A 2M1ZA 2FG5A 1YB5A 2ZRJA 3QXCA 4QBKA 1UDBA 3EPJA 5JS1A 1G8JA 2VN8A 2YWHA 1FQOA 2V5UA 4HFJA 2O8BA 2PIDA 4Q3EA 3LPCA 1E4EA 3CUYA 1OI3A 2E55A 2J5QA 4DR6B 4NS4A 1MQ8B 3BREA 3KE8A 1PFGA 3VR4D 2QPTA 1KSJA 3NIDB 2I1WA 2WM2A 1SY7A 1ZSNA 3EWIA 4DSNA 2CB0A 3ROQA 1LDYA 3EH2A 3D4NA 1TYAE 4RNDB 3X1MA 4BNUA 3BWXA 3I8XA 4UPEA 5IZ4A 2EQAA 5JSQA 5KYWA 1U2QA 1F2TA 1XD8A 2MWMA 4LC9A 3UCEA 1HV8A 1Y3FE 3P0EA 1S2MA 1V8OA 1TCCA 3ZU2A 5JQGA 1C3XA 3RUDA 1T5LA 1K06A 1K6IA 5LDHA 3G9QA 3CW8X 3EGEA 4RBNA 2C7OA 4WECA 3BICA 3TD9A 2HF2A 1FBNA 4YNBA 5AT1A 5SY9A 5KYNA 5CFPA 1P0MA 1II0A 2R8YA 3DBLA 4LVOA 3DKRA 5FBKA 3R3XA 3Q3CA 3Q0IA 3PP8A 1N1DA 3E7XA 1G6HA 1QVWA 3VOSA 3C39A 3L82B 3T61A 3VNUA 1PJ4A 5ICMA 3DF7A 4EBFA 3JD3A 2LRHA 5LOVB 1M3SA 3RBAA 3RRJA 4PZLA 1KKLA 5I48A 5IMSA 1ISHA 2O23A 2YYYA 5LP6A 1S3GA 4BTEA 1ML4A 1N8NA 3X2EA 3VDRA 4A5SA 4DG9A 4ND8A 1KDYA 5AVVA 1FTYA 2OZLB 3H1EA 4P5EA 1Z2EA 4MGZR 2R0QC 3GFGA 3AI3A 5KNCH 4FGSA 3WMFA 4RK5A 1LUAA 2QR5A 3D7MA 3L40A 4KQ6A 4KSYA 2G7MC 2OCBA 2K7FA 2EWVA 2ZJ0A 4JJEA 4DREA 1BWRA 2BGNA 5FL7A 2XVXA 3TOVA 2E5LB 1C3VA 4A6EA 1OZHA 1C8VB 2J3EA 2ZETA 2CNWA 4MWBA 2C92A 1P1RA 2XUIA 5BN4A 4TWZA 1DBVO 2VKTA 4IBOA 4AJ4A 2E4WA 4NNOA 3L06A 4QYMA 4Y9RA 4F04A 1GJRA 4RVFA 1UBEA 2DH5A 9ATCA 1WD5A 3ICQB 3RSCA 1H3NA 5REQB 4XFDA 4MW6A 3QA9A 4MUNA 2NZWA 3COWA 3IE1A 3PWTA 3SEQA 1P1JA 3DMDA 5ALZA 3RS5A 3S2SA 1BXRA 1R5OA 4URUR 5CBPA 2WJHA 3E9QA 4P36A 2IUSA 2EJUA 4GSYA 3TJRA 5KOJB 4O4JB 5DXJA 1TM2A 2XKJE 4W1QA 4IICA 2CNWD 5CVUA 3SSOA 4W63A 2IE0A 3EARA 4D9NA 5I4IA 1EM8B 4IX9A 5JECA 1K7YA 2QB5A 4TTSA 5F23A 2FVYA 5E3JA 5ED0A 5HIMA 1S7GA 5LZ8A 1U7DA 5A5VA 1G6OA 1JH8A 1GDHA 3DEHA 3ZWOA 3Q41A 2X86A 2AW3A 4W8OA 5KAMA 3KQMA 4IXMA 1WSDA 1SEVA 5CRIA 2YC4C 1KSHA 2CMDA 5J2UF 1S4QA 1Z5NA 4G2TA 1GQQA 2VP6A 1FUKA 3OLCX 3QE3A 1JDBC 2GCEA 1SKYB 3MQFA 3PICA 4GOLD 3ZIAD 3F4LA 3KQKA 5GZ1A 2BR4A 2Y1XA 5AM1A 4DA7A 2VPTA 2ZIFA 3KETA 1I10A 1LJUA 4ZAYA 2PNFA 3NEAA 5JNRA 3AY0A 2NTYC 3QFTA 5C7LO 3D6NB 4LF8B 3GWGA 3IUYA 2KE5A 1RZUA 3TF5A 4NV0A 2IDJA 5HBGA 1J70A 1EAMA 2YOHA 3E9EA 4HB2A 4E1AA 5JROA 1XFDA 2V0NA 1IEXA 3MMZA 2H2WA 2QY6A 1D1QA 1DEHA 2J4FA 4QJIA 4I9GA 5KPDA 4CQMB 1J5EB 1MB3A 4MA4A 3AEQA 3HFJA 4G0VA 1Y3AA 2BLLA 4R0VA 4BLWA 1GZ3A 4IWYA 3LWNA 1PT7A 4PG5A 5AR1A 2XNJA 3SQDA 3VGPA 4A0GA 4LPSA 4BKOA 4DCCA 1V96A 2EBUA 3JALA 4BPBA 3CGWA 4FGLA 5BN5B 5IJZA 1QRAA 4XE5A 4UPVA 2DWQA 3P97A 1N36B 1JIJA 2IYEA 3WI7A 4ZQHA 3ADKA 4EY7A 1SBZA 3E7WA 3K0FB 1CZLA 4RQAA 1JECA 2EKZA 3EGOA 3CC8A 1KE2A 4XTRA 4F3RA 5ARDA 1CNMA 2QGZA 2IQIA 2QZJA 1YNSA 4LFAB 4E2YA 3HYCA 3NYQA 3ZXUB 3PZBA 2XY4A 4CT5A 2CUZA 4MWOA 1TADA 5E2AA 4RZIA 3A3PA 4PQRA 1E6WA 5DYTA 2ZBGA 4IG4A 1RPAA 5K2MA 4C0BA 1A8SA 2AJBA 1WXGA 4FCTA 1Y8RB 4FWBA 2EERA 3KCNA 4LX0A 3P96A 4OX9B 1T6BY 2XVYA 4DSOA 3VJRA 2PT9A 3DBRB 4RTQA 4JLBA 2C4VA 1N6IA 3R0VA 2VZLA 3DPUA 2V7TA 3RV4A 3M4YA 3ZHVA 4CM1A 5BSTA 1E61A 4HDAA 4CMHA 1T6XA 2J67A 4IGIA 3KEGA 2RCNA 4WD3A 4EEZA 4A91A 3RPEA 3MJVA 3FUXA 3D8RA 1NIPA 3NTOA 4RVSA 3PHBE 3WKAA 4JNKA 3MTBA 4IGEA 5LMNB 1P91A 1TA9A 4M9XA 1GUAA 5LNK6 2V7PA 4R1NA 1U1IA 3I53A 4B43A 3BFXA 2LVBA 5LZ4A 3GXOA 4HAUA 4HDNA 1P75A 1QFYA 4QU0A 5C3UA 5HFNA 4AG6A 2VH2A 3VQTA 4ZHQB 1ISRA 2IPAB 1GL6A 4K3UA 1N2XA 3NORA 5BXQC 1P0CA 4AKHA 5EZQA 4WNAA 2B8EA 1NYTA 2JIBA 3CLSD 3DAYA 3HO6A 5TPWB 5C4GB 1PJQA 5CFLA 1CDDA 2H29A 4YCSA 3SR0A 1ZZGA 4XUEA 3I6BA 4YJ3A 1AJEA 1OH7A 3HL0A 1FS4A 2VDPB 4IHJB 3JQ9C 1A8QA 2GXQA 1VG9B 4FHCA 5JD3A 3GDWA 4TXLA 3X1ZA 3LTNC 3U3DA 3FZYA 3TXAA 3ORRA 1MO2A 4FE4A 1K3UB 1SOUA 1WSBA 3E03A 4JLMA 3U4CA 4E2FA 3GRPA 2QL9A 5IUKC 5IYZF 5AW7A 3KTDA 1K97A 5J1TB 2H1VA 3GH1A 1FFHA 5ICFA 2B94A 4FOSA 4NS1A 2Q2OA 4FFRA 3GLGB 4PO8A 3NOVA 1L7EA 1Q74A 3QEKA 4J16C 1EU1A 1VL1A 4YJHA 5EKTA 3HB7A 2ZJ5A 4RF2A 4RSRA 5KVSA 3VNQA 2C4HA 3RT7A 2FWAA 2IOQA 2QZZA 2AE1A 4L4YA 3VYTB 1GQOA 3PCXA 4AO6A 1JG1A 1RHRA 2QMEA 1CP3A 2CNDA 4IQ4A 2OVFA 5IAAA 4NBWA 5BWMA 1O0CA 4XJVA 1VFNA 4RDIA 1FMLA 2NADA 3IERA 2Y2UA 4PXAA 4QU8A 2XT0A 1P5RA 4O02B 3MBKA 4WACA 4XYMA 5LKAA 4NXNB 2E49A 1D1PA 2H17A 1YDEA 2Z1NA 3MTAA 4BFTA 1UBFA 1UZLA 2W2VA 2HQSA 3BZBA 4QU5A 1N1MA 2GN6A 4KI0A 3KLMX 1K68A 2IKSA 5CNJA 4B4WA 1RC1A 2WUDA 2X4IA 1O4WA 1A7UA 1ZGZA 1UIRA 2C4UA 1XD2A 3WL4A 1HEUA 1IATA 1M6EX 1AN9A 1OZ0A 3D3QA 4XIIA 2SKEA 2C5SA 2PKRA 1LPAB 1PQUA 3D31A 1U7HA 3KXLA 4Y9DA 4OATA 2JFPA 2MSLA 4ENTA 1U9CA 4L2IB 3TSCA 4FLMA 1N75A 1BRTA 1K0FA 5EJAA 1PT8A 5L6MB 1WB9A 4RQUA 2AE2A 2NAPA 3JY6A 1TO6A 4HRAA 4ZC1A 2P2GA 3VU8A 4YAIA 1XAGA 2KHZA 2RBKA 2ESRA 4F45A 5K8TA 1D7AA 4YT8A 4ZYUA 2UVDA 3D0RA 1CJTC 2J87A 2QMHA 1JH9A 3KVOA 1WCWA 1J5PA 3GHYA 2UUCB 5C5CA 2YQ4A 2GS9A 1CUCA 1VECA 3WGGA 4DLKA 1HORA 1N2IA 1JHOA 3PE3A 3QVXA 1H1LA 4OFWA 1TDJA 2XDQA 1OX4B 4K9SA 3IKTA 2VTBB 2PUHA 3HUFA 2CUNA 3DYIA 3K1JA 5F3RA 2FW9A 1PK8A 5JMWA 2IOYA 2NU9A 1I4DD 4KO8A 3KDAA 3KLNA 4Q1FA 1IBRA 4QXAA 2RONA 3GZNB 4IS3A 1YWGO 2B21A 2FY8A 4Q1VA 2FDXA 3B51X 1D2CA 2ISSD 3MELA 4A0HA 1DPGA 4EGJA 4DUGD 3LUDA 3WYCA 5FH9A 2V98A 4D8UA 2AKAB 5KYXA 4E14A 1B15A 3LQYA 4RY0A 1K27A 1FQWA 5K2OA 1EHYA 2H7XA 2CJXA 2QMUA 3Q3IA 1EEXB 1XCPA 1QNLA 2VP4A 4P31A 4PTZA 3I58A 5CTAA 2O0KA 3UHJA 4C7BA 5H80A 1NYQA 1E6CA 3SK0A 4HAYA 4EO4A 2AXEA 5DFAA 3L7NA 2VATA 4EM6A 3KQNA 4RVUA 1X1AA 1YOVB 4I4TF 2W2OA 3FG9A 4MPJA 4CPDA 3PPIA 4Z53A 3ETCA 3O82A 1S2NA 2B4RO 2EOAA 2GEUA 2OZKA 4K7JA 4G24A 2YUIA 4LDQA 2X9VA 1EWYA 2A9KA 1DWUA 4M21A 4EPWA 2OQIA 1QRSA 1NQOA 4MV6A 4G9BA 1M2KA 3E6AA 5HFJA 5L7WA 4F84A 1DINA 4QLBA 3RVMA 5I4BA 5AVTA 1V6CA 4B74A 4GSKA 4YJ2A 1GUDA 3M3HA 3NHSA 1F60A 5DHTA 4QRHA 3REGA 4C89A 4URVR 3GLIB 4W9MC 4DC9A 2EW1A 3H9JA 3OZRA 1RRCA 1VPEA 2PQ0A 3CKMA 3IVRA 4HMQA 3P9YA 1NDHA 1PFQA 1HMYA 1F9EA 4IIUA 3AFMA 3V42A 3IQWA 1WE2A 1Y5RA 4XPIA 1EH5A 1U1EA 1S2OA 1IVYA 2CKMA 4UUAA 4Q02A 4Z1MA 2GOYA 4FE7A 2OPBA 3NC1C 5LR6A 5HUJA 1TEHA 4I50F 5FBQB 5FLYA 1EVKA 1N5RA 3FOWA 3L8EA 5ES3A 2LZ0A 3ORFA 3AJRA 4PRYA 3EGDA 4MKFA 1DQSA 3RHTA 3JAWB 3ICVA 1JE1A 3WWPA 5BUSA 3ZWDA 2GZHA 3SE0A 3HYSA 1M1YE 2WQ7A 2V5VA 5ADVA 1TKRA 1X7HA 3HABA 1LLUA 4B3CA 2UAGA 4JI6B 4M53A 4AUNA 2O7SA 4TGLA 2YYZA 5G0TA 1V71A 4MUBA 2XWSA 2VOEA 3W04A 1RIIA 1P7ZA 3G17A 4Z1MD 1JGTA 3AGQA 2HMVA 3DL2A 1BZYA 1OTXA 3MWDA 4CDGA 4BRWA 1ESCA 5EXDA 4CYMA 3SWWA 3HJHA 3BMCB 3GUHA 1C3OA 3LDAA 4M1EA 4FKZA 2NTVA 5ALEA 4ZVPA 3STXA 5C9ZA 1Z5OA 3DT8A 3R3UA 4G5GA 1EIZA 3BH6A 2GBFA 5CHYA 3RH0A 3KSBC 1DQPA 5E6SA 2VJPA 2QTNA 1ONPA 2OHFA 4H31A 1V41E 4TROA 3I42A 2MSKA 1A5BB 4ZT3A 3M89A 4MYCA 3WP1B 3K7EA 5KYUA 2O7VA 3CLVA 4J0GA 3R5JA 2BCJQ 1K3TA 2YOGA 1HDOA 4QX6A 4NEHB 2GJ8A 2WSYB 4KDRA 1TK3A 5HRAA 2OZVA 2NTEA 2O48X 4WLOA 4HWTA 1Z6YA 4O25A 1FS6A 3QBDA 4F1JA 3PK0A 3T3HA 1J49A 1JPNA 1ML3A 4MRMA 4ZCTA 1CE8B 1YJCA 4YQEA 2PSFA 1TVCA 3QTTA 3EZFA 1FYDA 3MXTA 1Q2XA 4EI7A 4E08A 3M0EA 4MRPA 1Q0LA 1ZITA 3OQNA 4JR0A 3MUEA 2H1OA 3LPDA 1CUIA 3DOEA 1BYIA 2D1RA 2PGLA 4IRUB 3LP6A 5GINE 3AOEC 4BFCA 1O95A 1TVKA 3O4VA 2HT6A 5I9IA 1E60A 2G07A 4RYLA 1T8UA 1R3UA 4PZDA 5HUHA 1OFHA 1POWA 3I6ZA 4G0WA 3E70C 1YCFA 3PDJA 4LMBA 1LNZA 2VHTA 5G0SA 3FDFA 4Y1EA 5GONA 1WBJB 4HDCA 2Y99A 2ZJ1A 4UULA 4KXXA 2GFQA 3OIWA 3KSMA 2VTEA 3C43A 1VG0B 4DMUB 5ICSA 5IT0A 1P5JA 2CFCA 4L5JA 4Q16A 5EZYA 3HR7A 2HM7A 4JR2A 1RWKA 1YZFA 3CRQA 2HSJA 4GPD1 5KREA 4MW1A 4YRFA 2ACKA 3B20A 3UCXA 2AS0A 4BNFA 4C14A 1JMYA 4ERNA 3EDMA 5CLFA 8OHMA 5F3WB 3H87A 1BWPA 2HCFA 2RHOA 3D59A 1CY0A 4QQ8A 5KYVA 2FZGA 4OHOA 3TTTA 1GAQA 4UTXA 3L6DA 1XHFA 2ZTVA 3BIJA 5LZ7A 4C05A 1W5BA 4HNQA 1KP2A 2REXB 3LHFA 4G81A 5T4BA 5IH3A 4LJ9A 1XCBA 4TMYA 4N3GA 3L6CA 3D6FA 4YJKA 1AT1A 3DKVA 1OR8A 2H2IA 2QRGA 3L1UA 1M1ZA 4J3FA 2OQRA 4H17A 1P7CA 4WA8A 1B23P 3OSZA 4HB4A 1L5SA 1P2UA 1L5WA 3DE4X 2B78A 2R8BA 1JHPA 2WNHA 1WMAA 3UBMA 4QNNA 3BK2A 3KC2A 3G23A 1QCYA 5EMKA 1SVLA 5CLGA 2J9ZB 3F6SA 2WWRA 2R1TB 2F00A 2Y1DA 2Y4NA 2HWWA 1GHTA 4LEIA 2ZJAA 4I5EA 2G71A 2QG6A 3DHWC 1P60A 3TFQA 5IJ0B 1N2ZA 1P0PA 2GBGA 1YCGA 2O2ZA 1E59A 3C7CB 2VDWB 5KTOA 3PPVA 1G59A 3OTGA 4PLGA 1TKAA 1RYNA 1ZQ9A 1LWNA 2WHQA 4CKBB 2GD1O 4INAA 4HGQA 4LJ7A 3IHKA 1QRDA 1AA9A 2YVKA 4BECA 1L5HB 3I01M 1W4BA 1SXGA 4OAQA 2BBWA 3QBVA 4L5CA 5ALGA 3UJ3X 2A9JA 4HLNA 3W3AA 3SHOA 4C0KA 1NXQA 2XQFA 4YV7A 4RMGA 3IEKA 4NBKA 3TDKA 3K6JA 1JAHA 5CYGA 5L95A 5P21A 2WB2A 3I09A 3PRHA 4QFMA 3TRDA 1PHRA 4IF6A 1O5IA 3X1DA 4MULA 4W9NC 3D4OA 2AVNA 4ZARA 1JL3A 2XB6A 1XVVA 3G7NA 4FOOA 2V7VA 3AF5A 2D13A 3GRZA 2GTPA 3KT6A 3GQBA 4HR7A 2FPPA 2VQDA 2XQJA 4LI3X 5CXQA 4LISA 1VJ1A 2JZCA 3EDQA 5J5CA 2IHTA 3KPVA 1RKBA 1HDXA 4JBHA 2J3IA 3P2MA 2R65A 5LC1A 1T26A 4P9NA 4FJ0A 3YASA 1KMHA 3EDOA 3ZW9A 2H4YA 4F8EA 3L7CA 2V8BA 3BGWA 3FMVA 3A06A 3MPUA 1KY4A 2HQBA 1KAEA 2HTFA 1EE9A 3K09C 4IEFB 4RA9B 2WLTA 3S5JA 4EHAA 4UFPA 1OB2A 3VI3B 1MGPA 4E07A 3QX8A 4OUKX 2Z4TA 5EVJA 5JXJA 2VDLB 4LOAA 1G8SA 4LRUA 4OREX 5DM1A 2DHQA 1H4VB 3PGMA 3VPBA 2PUCA 4TKUB 5JBIA 4X8OA 5LA6A 5BW4A 5KSOA 2FDCA 3WKBA 1PFKA 2J1LA 4MR9A 4CZ2A 1WVGA 3HCWA 4KVGA 1ILWA 4A8JC 2QTLA 1T4MA 1KZHA 2G1PA 4O0MA 3SIRA 2ZT5A 5FOQA 3URKA 1YTLA 2WFLA 4RAOA 4US2R 2XIJA 1T1RA 3ENZA 2Q2QA 2YIMA 4L9SA 2BGWA 3EZ9A 3RC3A 1TQ6A 3HKBB 4ZDIA 1H5QA 4Y2GA 1U02A 2VJYA 2XCOA 4RA6B 3A4TA 1AXEA 3EWAA 2JAHA 1MQ9A 4J7AA 4F86A 1RLIA 5M7EA 2C7PA 5LLTA 3DEKA 1RAGA 4OGGA 5KDDA 3CT6A 1CZRA 2WJ4A 2GLTA 5FOVA 2HOQA 4MUAA 1FW6A 3QW2A 1FPQA 2V1UA 4CTJA 4G67A 4NCAA 2GTHA 2IF0A 3FWYA 3RYCA 4DTCA 1TLLA 2X8BA 2NU7B 3KFLA 1RJ9B 1V25A 4U7FA 3T0FA 2HJRA 3E2MA 4ONEA 1GPJA 1DBWA 3PFFA 4IFEA 2GJSA 4J4TA 5ALMA 3GGJA 4LCBA 4UCQA 4DLLA 3QJGA 3THYB 4WOCA 4WXPA 1LPMA 3VR6H 4YT2A 3DKKA 3PFBA 1UDCA 3EFHA 5ILGA 3W9UA 1G8AA 3V5NA 2X15A 2BMEA 3DFUA 3I5AA 3B36A 3UZUA 2DR0A 1ONBA 3AL2A 4H6WA 3VVBA 4AS3A 4D99A 4DLVA 4DMCA 1OKKD 3KE9A 3MILA 4F92B 1ODCA 1T8YA 2G9ZA 1KI2A 4A82A 1THMA 1ZR4A 1TO2E 3PXUA 2RI6A 4MGYR 4O4JF 3VPSA 1PZFA 3CPJB 4IJ6A 4NPHA 3DMHA 5ALHA 4HATA 1R88A 3RUCA 4IWXA 3RUAA 4C2AA 2BTQB 3NOOA 2P9YA 5CG1A 1RI2A 3CFYA 5BQ3A 2WYIA 5EJ4A 2H54A 3ZZNA 1NP6A 3BGIA 2DEUA 2P79A 4JL6A 1E18A 1FNDA 1ZN7A 4CKCB 4EQZA 1L1RA 4YAGA 3ZZ1A 3DYBA 1V11A 3G0CA 3F67A 1MJ5A 4Q9DA 5EVCA 1QAMA 2WU8A 4LRQA 1JKIA 5IJ9B 5JZ9A 3N86A 3H5VA 5LLSA 1N77A 1W35A 4CR7A 3TL3A 3M5CA 3L05A 3VC2A 3MMPA 5A7GA 1E9BA 4C0SA 5DHRA 1PJ3A 1YL7A 2XZLA 2EFEB 4GXRA 3OP1A 3T9FA 4KPEC 3UA3A 4DW8A 3D02A 2HBRA 1KHTA 4PFQA 1JR6A 2P4SA 5IG2A 5KX5B 7MDHA 1I32A 1PKXA 2I91A 1SURA 1Z28A 1D6NA 4LSMA 4EB6B 4KGZA 1OHHA 2EFHB 3AR7A 1NVDA 2EKPA 2V4UA 5BVGA 4PO3X 3ISVA 5L45A 2JGKA 4IKOA 1QGDA 1YZQA 3ETLA 3OZWA 4YA6A 2ORIA 1TVEA 2RJ3A 1E5TA 1G6Q1 3ENQA 1DTWA 3OZSA 2Z9BA 3LHKA 2Q5FA 2X3UA 2G77B 1IQRA 4Q05A 4NONA 3OF5A 3Q3HA 3L0IB 3U3RA 1PSWA 1OF1A 2Y0BA 3EBLA 4H1WA 5DRYA 3ANMA 3SNKA 4D74A 2PZGA 2EVWX 4ED9A 1MTZA 1NXTA 2VVTA 1DPFA 1UJ4A 4AIRA 7ABPA 2GM9A 5IVDA 1JHZA 1YL5A 2FQWA 3K4PA 2F3PA 4Z5XA 4UM9D 4PC6A 5TF0A 3WDKA 2VP9A 3RC9A 5L4SA 3ND5A 2PMKA 2O8DA 2EKLA 4GC5A 4KWEA 4Z4QA 3W5JA 1F17A 2J0VA 4GPAA 4RC9A 4XGIA 5B58C 2Z1DA 4UVGA 4F3TA 4ISCA 1FZTA 1UMDB 1RAEA 3O6VA 5G0VA 3GQVA 1YRLA 5FR1A 5JZOA 5K6AC 3NHWA 4NAUA 3NPAA 1XYYA 2W43A 1LLQA 3GZJA 4JWKA 2UYHA 5DT2A 1N1EA 4YMWA 5ECYA 2NSHA 1Z75A 3TXXA 5E4TA 4HC4A 1Z6QA 1M34E 1Z16A 4JP3A 3GOHA 4YRDA 5DTIA 4AJPA 4CKEA 4DWVA 1FX0B 7MHTA 1PZGA 3EXIA 3LD9A 4K9RA 2BZGA 3FUCA 3PNKA 4XCVA 3PKZA 5FFFA 5TJHA 1E6LA 2G8NA 4PNEA 3EVCA 2X0RA 3QIAA 2R96A 2JI4A 2XB9A 3L1KA 4FMPA 4IIFA 2IS2A 4EHJA 1K3FA 1M2VB 4P34A 4RIIA 1BOOA 3A1EA 5GIOE 2ZRKA 1WQ1R 2HU7A 4WLUA 2GBLC 3PR3A 1QOZA 4KHPB 3DEFA 2WTMA 2ZJFA 2Q5JA 4WKOA 1OREA 2ZDGA 1D4ZA 3CKYA 1GARA 2WF7A 4OAPA 2ZAIA 3T7IA 5DHQA 1I4OA 1ECFA 4WL0A 3C87A 4AJOA 1DEOA 1TZKA 5K3FB 1E4OA 4WINA 4F46A 4P4SA 3N76A 5I4CA 1KTIA 4NU5A 3AVXA 2QW0X 5A6SB 2FEMA 2FMFA 2QJRA 5AKKA 1CZKA 3T1VA 3PYMA 3ZQ4A 1PS0A 4IS2A 1TM7E 1FFXA 2NVOA 1M7GA 3VAZA 4HXGA 4LUCA 3TLJA 4V03A 2RHMA 3NRCA 3VO1A 4BVFA 2BIFA 1N5DA 1K0UA 2XAAA 1SU7A 3W7AA 2GXSA 5KAPA 5JPCA 3JU3A 4LS3A 2I87A 2YJ6A 3PF8A 4C4PA 1HKHA 1I6LA 3K71B 4NH4A 3R7NA 1QHNA 2C2XA 4MCAA 3LLUA 4P4GA 5AI4A 5DEOA 2JAWA 2PX8A 1BX3A 3DEZA 1DQNA 3GJQA 3JWPA 1RBMA 1FLNA 1RYEA 3C48A 4RH1A 4UMEA 1CJVC 3GF4A 2BD0A 4AJNA 4BVKA 3VPGA 4R3NA 4FBLA 4XDHA 4UNIA 4URZR 1UT6A 3WK5A 1NAHA 3HH8A 3PQ8A 4AMZA 3I2GA 4CE6A 2BW0A 1T2CA 1W49A 2N0SA 3FMGA 1KPGA 1L5NA 3RU3A 5BOSB 1QBKC 1NMSA 3WYFA 1W36D 2RHBA 1JBEA 3EVFA 5CNIA 3EGVA 3WYDA 2DTEA 1A4UA 3M70A 5AESA 2EDAA 1EWKA 1EJ0A 3E2PA 3PHCA 2V4ZA 2QIPA 4R84A 3SHQA 1KJJA 4ECEA 3I6IA 3CVWA 3LH5A 1LTHR 4NY1A 2Q6IA 4OFXA 1TUBB 3L4EA 3OZIA 1OC2A 5J9FA 5K8LA 1ZVJA 4KO1S 4YAUA 3WGJA 6LDHA 4XRGA 2FZ5A 3FBWA 4U2DA 2J30A 1OT5A 5CFZA 5HF6A 5AKXA 2XR1A 5AK6A 2ZTLA 2ZT6A 5EP2A 4B3BA 3ZYZA 8ABPA 1T5OA 4S0XA 3TUZC 4JELA 2V7QD 1XA0A 3DUFB 2C8LA 1W5TA 4PC7A 2C5LA 4RPKA 4YP9A 3DC7A 3SS8A 4H60A 1M76A 2YRFA 1AKNA 1R7RA 2H11A 1TLTA 3I8SA 4JKOA 1AUPA 3DMGA 1P4GA 3Q2IA 2FV8A 1Z68A 3O93A 3VV2A 1QIEA 3EUEA 4EENA 4HAZA 5CB8A 1QS0B 5KYKA 4ER5A 1N2CE 3DBIA 1AB6A 4IXWA 3LM8A 3T1QA 4E5NA 1W29A 3DHVA 1CZOA 2AMJA 5LYJA 2NNWB 5CH3A 3SHTA 3IX7A 2EW8A 2FWPA 4MSUA 4G2NA 4AZTA 1L7AA 3N8NA 4L75A 1L4NA 2QV7A 1H8EA 1CEYA 5B57C 4D1YA 2SNIE 1CFJA 1DIGA 2BT4A 2IEAA 1ZGBA 1ZWLA 3GJSA 3NEJA 4UOQA 3VR1A 1XTRA 1U7ZA 4ZP1A 5ECWA 3BWVA 3K9LA 4R2MA 4KQWA 3T9DA 4HUTA 2GCOB 4WFJA 4BKPA 5ESRA 1E2BA 1T29A 2D00A 1QHHB 3SQWA 4LBZA 3KK0A 2BKVA 2GAJA 4Q19A 1K7EB 4XGKA 5JI2E 5A0TA 4DV0B 3T35A 3QEJA 4H7IA 4BMNA 5HGXA 3EE6A 4E5VA 2QZ4A 3CZRA 4MEAA 4N54A 3OHMA 1UJMA 3AKDA 2VT7A 1JDBB 1U7PA 2Z5FA 2ZBDA 1WOMA 3G59A 3HQ4O 5TS3A 1KDTA 3JARA 1ARZA 1T9CA 3QK7A 3ZI7A 1DC7A 1CSEE 1JVNA 2WIGA 4XM2A 4I66A 5HM6A 4CMEC 4GVXA 5PNTA 3RKSA 1JQBA 1G2QA 3KEMA 2B3TA 1SH7A 1QFZA 1UKBA 5TT0A 2ES4A 3F98A 4BTVA 2AFHB 5AK5A 1F2VA 4I19A 2AEFA 4HDRB 1YB6A 1L7DA 4Q21A 5E3IA 3EGCA 4A0RA 5EZ6B 4ZYYA 1ADCA 1QHEA 5DNAA 3OA0A 1D2EA 1FU7A 2HAEA 3C5CA 2GEBA 2PUWA 5EL0A 3RIXA 4YCNA 1MZVA 3OM1A 2G04A 1JFVA 2I65A 2OB2A 2Q9AA 4TV8F 5JCOA 3SYNA 4JH0A 4BV2A 3ADDA 4O4IA 4L16A 4JT2A 3G8YA 4HXFB 5D7BA 5E0OA 3UHOA 1N34B 3UQZA 1U3TA 3ICPA 1U1GA 3LCCA 4B3SB 3ER8A 5DCLA 5JWHA 4TVSA 4C0HA 4KJXA 2DYKA 4R6WA 5CJPA 1KWGA 1UM9B 3DAHA 1SVOA 1P2FA 2AJDA 2EF1A 4NKRA 3I5MA 4HGZA 1XLWA 3MB8A 2WJJA 1TGYA 2H59A 2JZOA 1RFLA 1VIMA 1S4MA 4XA8A 2IXBA 3LUFA 1Q3TA 4AW9A 4FBMA 5HZGA 5JZSA 3Q6MA 1FF9A 1QVRA 4RJJA 4ZO6A 2XCLA 2WWHA 4AJ2A 5DYNA 4ZVSA 2G8LA 4RJKA 2E89A 1F2DA 2GBCA 4LE0A 4MMYB 5CVDA 2RD2A 5IEBA 5EXEA 4BFUA 2IY7A 5B64A 2Q21A 4CIXA 5DGDA 5IUJC 5BV8A 3R0JA 4L73A 3OX1A 4L9AA 4QASA 2W6OA 5F1PA 5JS8A 2PIAA 3K05A 1ISPA 1WB6A 4JJAA 4ZKDA 5C7OO 3U6KA 2EIXA 3ER9A 1AK2A 3A0UA 3V48A 1C0KA 3WGIA 1QIIA 3K1ZA 4RS4A 5FPQA 5B4UA 2V7EA 4W7SA 4XRRA 1N6PA 4IVNA 4XYEA 3WRXC 1CF9A 1Y48E 4DAOA 1Z74A 1QGYA 2IITA 5B36A 3TRFA 1JT2A 1PW5A 5BWOA 1YIDA 3V8MA 1S6YA 2PO5A 5M3BA 1CJCA 3D1VA 1U7UA 3T4EA 4C7OB 4AJJA 3SIPA 1E0AA 1EXNA 4B83A 3HLTA 1V16A 3OESA 5FBHA 5EJGA 5EE0A 3VZBA 1BDJA 2OORC 3NHFA 4UBMA 3IDQA 1TNDA 3HRIA 3SI7A 1DAPA 5EYPB 3UMCA 5CD1A 1NXPA 1K6XA 1KPHA 3OWOA 4PYJA 1AUQA 1V1MA 2PH1A 2VXCA 3L6EA 3Q3VA 1DDGA 1JR2A 4L27A 3V9AA 4P7BA 2BGGA 2QSJA 3M6LA 1A7AA 2RHHA 5FOUA 5DBGA 3VYVA 4MQFB 7YASA 3HEBA 3N53A 3TPCA 3VYUB 4A8PA 2XA1A 3ZU3A 3U09A 1ZD4A 2HF8A 3TI9A 3IPXA 5B4VA 3Q4GA 5JHGB 2OBMA 5H68A 1CY1A 1OYOA 4K8RB 4R2WA 5CGQB 3NWOA 5D5HA 3QBJA 4GKAA 4OHRA 5E6UB 3PFKA 1QYCA 3IXLA 3OQMA 3BX1A 1UODA 3DCNA 4N0MA 2AOUB 4NMXB 5T5QA 1YS1X 1G21E 3LX8A 2CHGA 3HE3A 1M10A 3TE6A 1NF8A 3JQQA 3D1JA 1I2ZA 2F62A 2LDBA 3QXSA 3NI2A 2ZSDA 2QMQA 1DKUA 2XUQA 3Q8WA 5G0UA 5LQSA 3TM5A 3U4QB 1XNQB 3BJEA 2YJGA 4NOMA 3RS3A 2WJZB 4IDGA 3PT9A 5LJLA 3W6OA 3FYCA 2DQKA 2I4NA 5J23A 3RAFC 1XG5A 4GX0A 2FETA 4E32A 4LGMA 2GD2A 1E3WB 3MWFA 3NDJA 1OT3A 1Y3BE 4ARIA 3GLSA 3SKYA 9MHTA 4GKKB 4J9VA 3LUKA 4F4IA 2PS1A 1EVQA 2Q9UA 4ATNA 4ENVA 4YBRA 2WA1A 1FDOA 1CQIA 2HSDA 2PZAA 3WGTA 1O08A 1YU9A 3MA0A 3G2JA 4JQYA 2PH7A 1I1HA 2C4WA 4K9LA 3WK4A 3FE2A 1L7NA 1Y80A 4W99A 4LF5B 2ATCA 4UJ5A 3QWFA 4FZVA 1NF2A 4N49A 4PQEA 2J3MA 4BLRA 3WHIA 3GCDA 5JO0A 1JKXA 3BMNB 4PLTA 3KRTA 1QQAA 2RKBA 1Y8ZA 3PC6A 1FMCA 3P1JA 3PC3A 5ALIA 4PPQA 2O06A 1YQQA 2H1FA 3SSNA 2BJHA 3AR2A 4G5SA 4ZPJA 1FP1D 1DHRA 3AKYA 3RNLA 3WSWA 3TWOA 5DO9A 3DOCA 4G65A 4X1YA 4F93B 1JDSA 2ZUVA 1DIBA 1Q12A 1G55A 4D3FA 4DAEA 2PGOA 4IUCS 2AVDA 4OUDB 1QRTA 3GOQA 4TYQA 3TPZA 2CD9A 1VYTA 3ZXIA 4F4FA 4ZCRA 4YXFA 1C4WA 1M1YA 2HEGA 2YYSA 3LXMA 4KXVA 3RWMB 4EA9A 1I2BA 4BB6A 3PQEA 2P9CA 4PANA 4L4XA 4V3BA 4IZIA 3TBFA 4CIVA 1LY1A 1TQHA 1U0HC 1YI8A 3GMTA 4ZODA 4M22A 1WETA 3AP3A 3DTNA 5L8VA 1XA4A 1ID1A 1TM5E 2IGBA 2IS4A 4D56A 1R0KA 4CCSA 2FN4A 2C96A 2NVUA 4AJEA 3N0RA 4AS1A 1H2HA 1U2RA 1T9HA 4Y9SA 3S29A 2ZVQX 1MC1A 1W2WB 3O92A 4LKOA 3VOAA 1QTNA 1NQXA 1T1GA 3LAWA 3IKVA 1JLLB 2QD1A 3H2KA 3TIXB 1QV7A 3NEPX 4NENA 5AUNB 5K99A 2ZWIA 3F4BA 2FU5C 1LGYA 5KJEA 4Q5IA 1B6TA 2H1CA 2O3SA 2JANA 3CG4A 1T8WA 3KEQA 4QJBA 3S2FA 3SQXA 3WE7A 3B6EA 2HLHA 4RULA 1USKA 3RSLA 1LJLA 2FPRA 2XZTA 5DSZA 5EGSA 2AGVA 2PY6A 4TKVB 2QRJA 3TZ6A 1ND6A 3HDQA 3U13A 2BFCB 2M6LA 5B3JC 2NUTA 2XCTB 3HHPA 3ZDAA 4EY3A 4GKJB 1P6QA 1RPTA 3M8KA 1KZ4A 5FTLA 3SJ7A 2H06A 3CBGA 4JUIA 3JW8A 2FN7A 1WZEA 3UJDA 5IKPA 3WSTA 4V1CI 1PZNA 1DCMA 1U0BB 3Q8KA 3RYHA 3LWDA 3QKIA 2ZQ5A 3QIVA 3URMA 4EUSA 2GRJA 4DLYA 1UP4A 3KQLA 3THWA 1KZ6A 4RVOA 2VR1A 4TS3A 2IYXA 1PN3A 1U3FA 3R76A 3NM4A 4H1TA 1QO0D 3LS2A 3VTKA 3E5HA 1DJQA 3RV3A 3WGYA 4PRZA 5FTKA 3RS9A 5DYYA 1BHJA 4YAFA 1FFBA 2VAVA 1PR1A 4DWOA 2G67A 3HU5A 3PRJA 1JEYA 2A5FA 4Z7OB 4IUBS 3FPFA 4LGYA 4ND6A 3ASZA 4NOKA 3X1JA 5CGZA 5ADHA 4EHKA 3KD2A 4XLTA 3DLBA 4V02A 3GT0A 2ZVJA 2F7SA 3FYUB 2XE6A 4LIPD 2JLAA 1P4JA 2X4DA 4MW2A 2PYDA 4KR9A 1F06A 3O8DA 1FPMA 3BMOA 1UQRA 1RT9A 1A1SA 4Q9AA 4RTSA 1TKBA 5LXTA 1FDRA 1GGVA 1QP8A 1Z0KA 1ND5A 6GPBA 4D4LA 4IJVA 4TTQA 4QE3A 5A9RA 4NWIA 3ZDFA 2NPIA 3O8BA 1QTIA 5J5VA 2J0UA 3GAFA 5IKMA 1Y81A 3PXCX 1LCIA 2ODTX 4FYMA 2RGWA 3OTQA 1GSIA 2JBAA 4PAGA 3WS7A 3RWBA 1P62B 4JU8A 2PA0A 3SJCA 3WMWA 2AG0A 4B85A 4EBBA 3PEWA 1NT2A 1KMNA 1WZCA 1XXHE 2IIVA 2QVZX 3PENA 4IUDS 4NABA 3TRIA 2AC2A 2VYCA 5C1BA 4DYHA 5LP1A 1ZA2A 1DRVA 1XU4A 1PUIA 5C5DA 1AUXA 4M38A 4ZVKA 3UMVA 4QG3A 3LGSA 1E2DA 3P9QA 5JYCA 2HK9A 2PE5A 1Z47A 1ST2A 5KQMA 2XCUA 2ZB3A 3F8TA 3LBHA 3DDUA 4AF6A 4ZVUA 3EYWA 3FCXA 1M8PA 1QTRA 4JA2A 2GJ9A 3BG5A 3IQZA 2G63A 1W8IA 4BVEA 3HJAA 3X44A 4ZIRA 3ICWA 3RSSA 4DMFA 3HXQA 3VR4H 4DA4A 4JUAA 2H00A 2OXFA 1OZGA 4QQKA 4BX3A 2QZPA 3CX4A 3FCSB 1D1SA 1PX2A 1GGHA 1JALA 4G01B 3ZHBA 5EEGA 3A9RA 3IJ5A 3AEKA 4UXIA 4MKRA 5EIBD 3K0KA 2BFEB 4R5MA 4EUNA 3BIXA 1DJPA 5FI0B 2P77A 1Q1GA 1EFPB 1PR6A 3RVRA 2F9FA 4HMOA 4YASA 5KU7A 2WQZA 3AONB 2IYVA 3KOOA 3KQWA 4RJ2A 3O8OA 2Q5QA 2RGCA 2R4QA 4Q3BA 2FSIA 3D3EA 4MJXA 2FW7A 4OH7A 4DVGA 4XI9A 1DQRA 3NM6B 2YUTA 4XVRA 3LLMA 1H2BA 2O50A 2KX7A 3CZQA 5HCIA 4JBGA 2FPOA 3CA8A 2VSXA 3AHDA 4LOIA 4K2HA 4WEOA 4RS3A 3ZDZB 1YJBA 2D5IA 4ARVA 1V9CA 3U19A 5TMBA 1NQTA 4M1SA 3T06B 4D3DA 3BWMA 4P1ZA 3DXFA 3A04A 1OGYA 3OUUA 4FFNA 4S04A 3EUWA 4FFPA 3IOBA 7AT1A 1TJ5A 3TVTA 2Y1FA 1TW3A 3JQAB 4GPZA 5KKNB 3O8RA 1VB5A 1SUBA 3TIVA 4JBNA 1VDZA 2PL5A 2CMKA 1E1KA 3I4LA 1MRZA 1OUMA 2VNSA 3OPXA 1XOIA 4EFKA 3TK1A 2X58A 1IY9A 1WHTB 4BKUA 4QTZA 1KJZA 3D6MA 3NHZA 1QWSA 4FSDA 2P90A 3EVZA 1FLDA 2UVPA 2NZUG 4MW9A 2PX4A 4NQZA 3I9KA 5AOVA 3TUJC 1TZBA 2ZS7A 5A4AA 4JLPA 1ELOA 2BUCA 4MGEA 5KUTA 3C3EA 4DF3A 5HZKA 3IAS6 4WXHA 4XQ0A 1M7HA 4G37A 3G0GA 5DM70 1E7MA 2Z6VA 3D4PA 5KQRA 1JQEA 3KT8A 4L6IA 5FOSA 2E6UX 4F2DA 3R9XB 2CDNA 2TMDA 4JODA 1P9RA 1W1IA 3ESAA 4RMIA 2PZJA 4WRRA 1ZDMA 3ZXSA 3GUCA 4WA7A 1UBMS 3DS8A 2IHKA 1E62A 2OEPA 5GJVC 4KIJA 2R5NA 4XM0A 5AKLA 2YZKA 1N6HA 3FWZA 2HIAA 1XEXA 4PWYA 2F55A 1JYEA 1VA5A 3GBPA 4FN5A 3UANA 2ZRQA 4PGHA 2G5PA 1DO8A 3NP9A 3C0KA 1L8AA 3FFWA 3PU6A 5FB3A 4HBGA 4EJSA 2XUPA 1U7WA 3DCJA 1B8OA 1JSXA 5ED4A 1TW2A 3BSWA 3HPQA 3KEFA 4FHGA 3X2SA 5AQ1A 4PPNA 4UU1A 2C5BA 5GQSA 5E6RA 5HKAA 4QZVA 4JYBA 1RYFA 1SIUA 2R1VA 1EPUA 4B2LA 1K86A 1HOTA 5CA0A 2I6SA 3L4BC 2WAOA 3E27A 2VTDA 5EG5A 2YXBA 3SXUB 3FNBA 1ZBDA 4WLEA 4FR0A 3B7WA 1OVMA 4NATA 1RRPA 4A2QA 1JA0A 1YQXA 1PTJC 3GUVA 4EF5A 1RM5A 1AGXA 1QRRA 3LXXA 2H08A 3LUHA 1WCYA 2O54A 2VG8A 3O4HA 1MVLA 3DV2A 4PSVA 4FN4A 4KPGA 4QATA 4K8OA 3UH1A 2YHIB 3EMDA 3NC4A 4ZJZA 2Q0HA 4AZ3A 2C0CA 2OCAA 2BH9A 2HJVA 1NGSA 3DMNA 4J07A 5ERYA 1WD7A 3IR5A 4DPLA 1TT5B 4UU7A 3ZDRA 1XPUA 2C7GA 2AA3A 1QYIA 3A3NA 2WHEA 3D2CA 3N28A 2FUKA 3LT4A 1I4EB 2J0SA 3D2LA 3VH2A 1NDQA 1H5UA 4D44A 2B1IA 2D7CA 5E9WA 2B6NA 4BU1A 3O5AA 1XFAA 4CT4B 4NBSA 1HFEL 5K01A 1G9TA 1X0VA 3EJWA 2OV4A 3R77A 5H5JA 3BL8A 3S70A 3WRYC 5C53B 3TLMA 1E4EB 1KS9A 1RNLA 4GWLA 1PGJA 4TXHA 3TNLA 3M3DA 1V3TA 2GF2A 1O54A 4TSFD 2BGRA 3EEFA 2Q3MA 4FK8A 3W8DA 3Q9UA 3NBFA 2KBFA 4DM4A 3P9PA 1SHUX 4DJFC 3RADC 1YACA 3PR2B 2WA2A 2W6QA 4GT1A 2JC3A 2B2CA 4HNTA 1F2TB 3VPXA 3R8XA 4BEVA 4A8JB 3OCWA 3IVCA 3ESDA 4J49A 3GPDG 1J56A 2I3BA 3OLQA 2D1SA 5HJ2A 2O57A 1H05A 1LSUA 2HGZA 3DD1A 4F5WA 1USWA 3M6UA 1P3JA 1CLUA 3F3SA 2IYUA 1ZHFA 2P35A 5TPZA 3ILVA 1W52X 1O4VA 5H9VA 3DBLB 4ON9A 4RTNA 1Z6GA 2EJVA 3G0HA 3RUPA 2ZYHA 5EJMA 3ROPA 3ZE1B 2WTXA 3VHLB 1JTVA 4ZT2A 3WZLA 1CY4A 5FA6A 4YMGA 3OU6A 4CDNA 1Y4DE 4GYJA 1CUHA 1O94A 4DT1B 2MMCA 1QC5A 2WKQA 3IT2A 3KELA 4FFOA 5AW8A 1COWA 3HHEA 4I0WB 4KFTA 4MR7A 1BMDA 2I5PO 1ZC4A 5FCDA 5KHOC 1HLGA 1XHEA 3E9DA 4RXMA 4URWR 2XA2A 1SN7A 2W11A 3EG5A 2J48A 4I46A 3PX2A 1O6GA 1OXBB 1WSAA 2O5VA 3IKLA 5AOAA 3NHLA 4DDHA 4N7BA 4ROSA 4D4MA 1HE5A 2OK8A 5TPZD 4Z9YA 3UJ6A 2AJCA 4UDOA 1W6RA 4X5OA 3UY4A 1B26A 4IW3B 3RRMA 3BXPA 3EQ6A 2QNBA 1UKAA 3PHHA 2ZCJA 5F1KA 4CL2A 1MD9A 4EFLA 2XRFA 3VNBA 1GILA 2DMRA 1DC5A 1LBEA 1M34A 2RGUA 2UZIR 4FPXA 4UOZA 3QXXA 1O94D 1MDBA 2WHRA 3H5TA 3IRUA 3KALA 1Z6XA 3ZW7A 3NWJA 2WICA 3N07A 1COWD 1SBQA 3R5SA 4G63A 4EKIA 4NZMA 3F2VA 5A3SA 4CW7A 3CVUA 1B41A 4CQLA 1J4AA 2W90A 2Y9PB 4HH1A 3WZ2A 3DTVD 3R7LA 4EUHA 3VH4A 2P2LA 2XNDD 3SIXA 2J6HA 4NFSA 3F6YA 5JDCC 2PLRA 4BO2A 2GDZA 2QA5A 4WZBE 5K4AA 4QPCA 1BXRB 1L9XA 3IB3A 5CBPB 5HZMA 6PFKA 1F1JA 1VZ3A 5CAEB 2WEKA 4GEKA 4JOBA 2QLLA 3WYAA 1I3LA 2BHSA 5KVQA 2PR2A 2O8EA 2XTNA 2XYVA 2PXHA 5CFOA 2CJFA 5EUQB 1QONA 1U6KA 3G0DA 3V7UA 1XEWY 3AKCA 5DDIP 4LZAA 3GU3A 2NYUA 2MSEB 5HTOA 2CDCA 3C4JA 5EQDA 2DTDA 2KM1A 3QP9A 2D2EA 1YV9A 2EYUA 1JF8A 2PHZA 4QQFA 1SJ9A 4XQEA 2QXTA 3G8DA 4CF3A 2FR0A 1JVSA 2CVHA 2W2PA 2OK7A 2F90A 2G72A 3VFDA 4C5BA 2I4OA 2GDJA 1YQ9A 4NCBA 4QVKA 4RYDA 5G3ZA 4ZJUA 4HF7A 5TT1A 4AZWA 1GAWA 1BMFA 2QX8A 1DV1A 1R9NA 2R4TA 1ZYUA 4D4HA 3ECAA 4BXOA 1BQEA 1CG6A 1YGYA 4EG0A 1ZRSA 3SNHA 3NX4A 4MRAA 5IT9A 4FFVA 1E0KA 1E2FA 3BJMA 4KE9A 5CXXA 4AY6A 4W5NA 1EQ2A 1F6WA 1TUGA 4MUYA 2YJTD 3OAAA 1TM3E 2ID9A 2RH4A 2I54A 3I30X 3N70A 3O83A 3ZTYA 1OAOA 3ZD6A 1A9YA 5C52B 3FTCA 4BBPA 4YRPA 1SELA 2C94A 1U0TA 1MENA 5EUMA 1ZUNA 2R1UA 3IP7A 1TYEB 3P9NA 4DNPA 5FTWA 3MUNA 1Q7GA 3FD8A 1KRWA 3NBAA 1BE0A 2OMEA 4W8HA 1JEJA 3COYA 2BMDA 1DSSG 3OOWA 2Q27A 2HW8A 2V3CC 4PTYA 1O9BA 4UTOA 1PQPA 4W6ZA 5AVUA 4L72A 2IC5A 3MAGA 3AVVA 4Z0NA 2CGEA 1SBIA 3CTMA 4GAEA 3JQPA 3PQCA 3UFBA 4OBWA 5J2UA 1SWVA 3VKFA 421PA 4AKTA 3I0NA 4TUYF 3LLVA 4I08A 4TYYA 1DCFA 3G8AA 4O59O 5CDTA 3MXOA 1PEKE 1QCDA 2GJ4A 1MT0A 2ZPAA 2CV0A 2I8LA 4F9TA 1J0CA 1PKEA 3ER6A 3R0XA 3OD1A 3Q8LA 3RDPA 3T95A 1VHWA 3GW8A 1BD4A 1GA1A 1U9ZA 1JEOA 1F3LA 4FE3A 1P33A 5E4JA 2CUTA 3LBIA 3L7OA