3Q3GE

Crystal structure of a-domain in complex with antibody
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
189
structure length
189
Chain Sequence
DSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/cell adhesion
molecule keywords Antibody Light Chain
publication title Stable Coordination of the Inhibitory Ca2+ Ion at the Metal Ion-Dependent Adhesion Site in Integrin CD11b/CD18 by an Antibody-Derived Ligand Aspartate: Implications for Integrin Regulation and Structure-Based Drug Design.
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 189
sequence length 189
chains with identical sequence G, I, L
ec nomenclature
pdb deposition date 2010-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3q3gE00
1TYEB 3EOAI 4CNBA 3K6SA 4MMYB 3E2MA 3EGXA 4F1KA 4PN7A 3ZDXB 1FE8A 1XDGA 1MQ9A 1JEYB 4CN9A 2NUTA 5HDBB 5HJ2A 4WFQA 3VI3B 3TXAA 4Z7QB 3PPWA 2XWJI 5E6RB 3M6FA 3V4PB 1PT6A 1JLMA 3HI6A 1DGQA 3ZE2B 4NEHB 5E6SA 5LN1A 1RRKA 2IUEA 1FNSA 3FCUB 3IBSA 4BJ3A 5KYYB 4M76B 1V7PC 2I91A 5KYUB 3EFOB 2ADFA 2NUPA 2ODPA 1IDN1 3EGXB 1AOXA 1IDOA 4IHKA 1Q0PA 4NENB 1ZONA 2QTVA 2VDMB 4IXDA 1JEQB 1N3YA 4WK0B 3K72B 3TVYA 1UEXC 5KYWA 3EG9B 3F74A 5E6UA 1MF7A 4IGIA 1LFAA 1MHPA 3IJEB 1PCXA 4C2AA 3Q3GE 5BV8A 3EH1A 2WINI 5E6SB 2WW8A 3EGDB 1CK4A 4WK2B 3BN3A 1U8CB 3EH2A 3GXBA 1BHO1 1QC5A 1T6BY 2NUPB 3ZDYB 3ZDZB 1N9ZA 1YVRA 2XGGA 3TW0A 1ZOOA 2M32A 3QA3E 3K6SB 3HXQA 3PPYA 4G1EB 1M2VA 1BHQ1 3NIGB 1PD0A 3BQNB 3N2NA 4HQLA 4HQFA 1MQAA 4UM8B 5E6UB 3PPVA 1IJBA 5HGJA 1SQ0A 1U0OC 4HQKA 3K71B 2B2XA 1T0PA 2VDKB 2NUTB 1M10A 4XW2A 3ZQKA 1JEYA 1QCYA 4DMUB 2XWBF 2VDQB 1SHUX 3ZE1B 3ZE0B 1PD1A 5KYNA 1ATZA 3EOBI 3NIFB 1L5GB 4WJKB 4WK4B 5KYXA 1YVPA 2O7NA 2X5NA 1AUQA 5KYYA 1NA5A 3FCSB 1MJNA 1CQPA 1DZIA 1M2OA 5KYUA 1OAKA 4FX5A 3RAGA 1MQ8B 5KYWB 4JDUA 4G1MB 1XDDA 4HQNA 1M1XB 4NENA 3T3MB 1IJKA 1JEQA 3BQMB 3TCXB 2VDOB 3NIDB 3EG9A 4O02B 3HXOA 4MMZB 3VI4B 2VDPB 4Z7NB 2I6QA 3F78A 5KYXB 1AO3A 2VDLB 1QC5B 1RS0A 4C2BA 3EGDA 4CN8A 2ICAA 5E6RA 4UM9B 2ODQA 2VDRB 4UM9D 1JV2B 5ES4B 1SHTX 1RTKA 4F1JA 4MMXB 2NVOA 2VC2B 2I6SA 1M1UA 3PPXA 1ZOPA 1RD4A 3T3PB 1U0NA 3V4VB 1M2VB 1XUOA 2VDNB 3EFOA 4HQOA 4C29A 4A0QA 4Z7OB
chains in the Genus database with same CATH superfamily
1B41A 1RAIA 1SOUA 3IMKA 1KFCB 1TYZA 4JA0A 1E0AA 3MTDA 1AHHA 3H99A 3R0XA 3OLZA 1FMFA 2XEXA 2AR7A 1UPBA 1XYGA 1Z5GA 5D2CA 1QLHA 1Z12A 4QU0A 5FLYA 3UMJA 3LP8A 5LIPA 4KQXA 3IR5A 2IEYA 1NF3A 2JH3A 1I3KA 5CYFA 4RFSA 4ZKEA 2II6A 4F85A 3IOEA 3SQLA 1ZR2A 5FWDA 1VL0A 1Y9JA 2DHDA 2WZDA 3FNFA 5CIWA 2W2MA 2FA9A 3SYLA 2JH9A 4QELA 3WLNA 3B8HA 1TM1E 4C06A 1NJFA 1LVGA 1TZBA 1RPTA 3M2TA 5JATA 1W6UA 4H3VA 3BFVA 1JPJA 3HDGA 1R88A 2XDYA 4BMOB 4GLOA 3L06A 4R1LA 4TV9F 4GC9A 3PTLA 4QGGA 2B8NA 3TGPA 4J4HA 2WR8A 1SKAA 1FDTA 1KZ6A 2O7RA 2OMKA 2IF2A 4LNHA 1HEYA 4BCCA 1KEVA 3JQAD 4K9DA 3USZA 2GBPA 3HKDB 4TMFA 4YRMA 3ZG6A 2A0FA 4CRWB 2HA2A 3KLBA 2EZTA 1XTQA 3BH6A 4NOKA 4JLAA 4TXJA 3VYTB 3UCXA 4R2HA 3LHDA 1QFZA 2QQGA 1GZSA 4F0JA 1CRZA 4EA9A 1SC1A 4QD3A 1Y8QA 1AQ6A 3BHJA 4Q3KA 1JU3A 1PI3A 3IPYA 3N75A 1A9TA 4CTNA 1XEXA 2B21A 2HCFA 1S3IA 5LQDA 5KOJB 3OCVA 1IN7A 1E1RA 2HU8A 1ADJA 5JHGB 2M9MA 3E84A 3H4MA 3KLNA 4AUNA 3HB0A 3QYAA 1HPLA 3GHHA 5KUTA 5FI5A 4F2DA 3I1FA 5B64A 1SR8A 4LOIA 3A9TA 4FYHA 4RQBA 4K40A 3H75A 3KU4A 1QJCA 2WU3A 2XXBA 1LSSA 3EY9A 4AO6A 4EL5A 2ZSAA 4BGDA 5L4SA 1YFLA 2V1UA 2BP7A 3JQBA 4AJ1A 4ECEA 2P40A 2A1UB 1A5TA 2WIJA 1SNYA 1ZRNA 1T4GA 4X00A 3V2IA 1TO1E 1XKTA 1EVJA 3AR5A 3R6DA 4PINA 4PYIA 3K8YA 3BHIA 4UCXA 2PL3A 4MGKR 3G5TA 3ONFA 3BCRA 4KXNA 1HDCA 1E3WB 1SG0A 3KOWA 1PEAA 4PBTA 4YT8A 1ECLA 3QBVA 3RC7A 1SCUA 4MQEB 2P3OA 5HHTA 3AGPA 2IXFA 5ALKA 1THZA 2XOKA 4IDPA 3IDQA 4NZZA 4RD1A 1MB0A 4HXFB 3PR3A 4I8IA 4NENA 4TSFD 4JI2B 3RRYA 2GWHA 3R0JA 4CM8A 2FZLA 2HRQA 1IH8A 2PEYA 5CT4A 2JZOA 2XITA 4GXRA 1QCCA 2KSQA 2J9YB 3CG0A 4UU1A 1Z4JA 5K0ZA 5A4FS 3I64A 3DL2A 3GP8A 4OJMX 3THRA 4C7XA 5C8YB 1Z37A 4QYWA 4ER7A 1OAOC 3K2EA 2H4YA 5I7AA 4X3OA 4OHWA 1TM3E 2XA2A 4FT4A 1NMQA 3SBEA 1JTFA 4NJOA 1MB4A 1CHNA 1JV2B 1Y8RA 4C6RA 3U49A 1V11A 3E8SA 2CNOA 2UAGA 1L2TA 2HPZA 3A9CA 2ZYSA 3WKCA 4EY7A 3ASYA 1TMGE 3L7JA 4L27A 3WE7A 1I4EB 2WWXA 2BC9A 1K3UB 1PX0A 2PR7A 2PGNA 4WEQA 1YRBA 2VDWB 3ETHA 2BFWA 2VYVA 4PN7A 4XCQA 1VBNA 5JJIA 2H18A 5KWEA 1W36D 3HDQA 2WG2A 1U7PA 4ZOLB 2NZVG 1LWNA 1G7SA 2YASA 2P3LA 3GELA 4KDCA 5G0UA 4BEBA 5KZMB 5J40A 1CJVC 2GCOA 4HX9A 2H2WA 1WXGA 5HE9A 1ZNYA 3G6WA 3P1JA 3QVKA 1ZRHA 1I2ZA 4DIMA 4EKYA 4OHBA 1L7PA 2J5BA 2CV2A 1P33A 1P7VA 2OV2A 3B52X 5IJ0B 5K4AA 4X62B 3SQDA 4YC7A 1L8QA 3HKEB 4F91B 5I6DA 1QO7A 5IWAB 2D5CA 1FIUA 3MJCA 2Y05A 3VVCA 2Q4EA 4CR6A 1QGUA 4H0NA 1R4AA 3AEQB 1AQYA 1EFRD 3WAGA 1X7ZB 3M4NA 3VNAA 5IMBA 1OIVA 5KNDH 3PGA1 3CBQA 3N87A 5ALWA 5IM4F 3AIKA 2IPAB 4IOMA 4CDGA 1DTWA 2WWYA 1OD6A 1ZNXA 3M4ZA 4P34A 5EQJB 2J0EA 3W5SA 4JJAA 3ZE7A 4AZ3B 2I66A 3OF2A 1XEFA 1T6BY 2ZPTX 2RBGA 2H08A 2FMUA 2PYDA 5J2UF 2BGWA 2JAHA 3RIEA 1F0KA 1ID1A 4Q03A 2DVMA 1PGJA 3HO6A 1D5WA 3KOXA 4J0EA 2MTBA 5EJ5A 1U0EA 4GBMA 1IEXA 4Q0MA 5GPBA 1US8B 1BFKA 4ZAVA 1XLTC 3RFFA 3QVXA 2JZCA 3EC7A 1KMCA 4OB7A 4ETIA 2FR0A 2ADMA 2PKQP 1Y7TA 4KP7A 1B76A 2JRCA 1SKBA 3GJ0A 4RF4A 2QRVB 2VZLA 2CL6X 3IB3A 5DNAA 3D5QA 4WECA 5D7BA 3WNDA 2FAXA 3JWEA 4UMVA 2GB4A 4GWLA 2J45A 2VXCA 3SQMA 1Y9EA 1QHNA 1A2KC 3UA4A 3KIPA 4FC7A 3K0EA 3IESA 4ALIA 3M49A 1JG3A 1M2KA 4FSHA 3ZHBA 4LF7B 3DZBA 2I3DA 1RKQA 1KZHA 2WSSA 4I4TB 3SFTA 4L57A 1C4KA 5DTIA 3VYWA 2MYNA 1M33A 2ZB7A 2V65A 4Q82A 2ON6A 3N2IA 1REQB 1G21B 2LVBA 2X86A 1G291 4FVTA 4GX5A 3GGSA 5H3LA 3V34A 4YYZA 3VH4A 2PX3A 1O6GA 2PZKA 4OM8A 1SG9A 1FVHA 1YQXA 2ZYHA 3T3MB 2PGAA 3A6KA 1LFDB 4IINA 1Z15A 4ND3A 3RKRA 1QP7A 1JPVA 4HRXA 3X1KA 5LOVB 1XEWY 3HG7A 1GAJA 3DWFA 3PC3A 4BN4A 3BBPA 4AJHA 2AZ4A 4R0VA 1P0MA 3H97A 2ZVQX 3O9VA 4OXIA 4P4SB 4DRXA 4OD0A 621PA 4LC1A 1EJ2A 4D6XA 3WDKA 5ALXA 2PUDA 4J3NA 1XCLA 3ZZUA 2FFJA 5J1SB 4W6QA 3SPXA 3JZMA 7ABPA 1K63A 1TEHA 3AHEA 2C4WA 3FHJA 3IQXA 5CNMA 5FWAA 3TDMA 4DSOA 3OE5A 1I0ZA 4HGOA 1UZAA 3WKAA 4YPOA 5IMSA 1ABBA 2DZDA 3NALA 3N1UA 2QZZA 2QSYA 2B4KA 3A0RB 4GYKA 4MRAA 5K1ZA 3CX3A 1NJ5A 2C99A 3DBHA 3UMGA 5KOHB 1XDGA 4BBJA 4UVDA 2AOUB 4QTZA 3WK5A 4XWOA 1RXVA 4DBLE 1M8FA 1PS9A 5EE3A 2EBUA 1E5VA 3V8MA 2FW9A 4NTZA 5EE0A 4MI6A 3CX4A 3OQJA 4GR4A 3ZCSA 4IZ6A 1XRNA 1OJ7A 4HLQB 1E1QD 4Z9FA 5K20A 2VS1A 2BGRA 1IBKB 1CE8B 4OQDA 5ESWA 5HNKA 4ICIA 2P6RA 3AWIA 2ISCA 4DIOA 4QJ4A 2C7BA 1GDTA 2QRUA 5C81A 4P4UA 4IUCS 4AY4A 4DG8A 1JWAB 3CUSA 3PFKA 3OBBA 2XZTA 5ERYA 3ANXA 2EKDA 3QVGB 1A9XB 1EKXA 1TX4B 3VH3A 2TS1A 4EG7A 1RZVA 5LZ4A 5CJPA 4LZZA 4YMSA 4PFSA 4PYJA 4YCSA 5TMPA 1I2MA 1CULC 1OBOA 3ROFA 5E6SB 5BQOA 3NMUF 2XGMA 2GJ8A 4GI7A 2ZG6A 1B23P 2NV0A 3GFRA 4I36A 3CXUA 4Z53A 3SJUA 3TZKA 2XE4A 3GY0A 2QTNA 1GSOA 5A2QA 5T4BA 3OUTA 4X8LA 1N4AA 1NW8A 1OLUB 1Q0RA 3IQDB 4Y1RB 3S5UA 4ZEWA 4BX9A 3DGEC 2V45A 4C4OA 4B2IA 2JGFA 2V7WA 3LM8A 1J9ZA 4BFYA 4K26A 1QH9A 1DIBA 1OE0A 5CT5A 2JI9A 5DISB 2QRLA 2QYSA 4LISA 3K0CC 4MQEA 4RX1A 3AYXB 1IY1A 1KDOA 4FNAA 1I4WA 1ODJA 4HRYA 4PAQA 1RMTA 5LWHA 2JGEA 3HN7A 1SBTA 3V46A 1X9GA 1YNOA 4UCQA 4DCUA 4DUGD 5JCPA 1ZMTA 3E5NA 2NQTA 4DXAA 5IF9A 5KYNA 3PGMA 3LBIA 3IH5A 2QE6A 2P90A 4XVHA 2PUEA 2UV8A 1JIKA 1RVV1 2BW0A 2ZPUA 4PLFA 5CJ2A 4E0BA 2WJ6A 5E4FA 1QWSA 2FVXA 1FTGA 1XV5A 2C2KA 3RRMA 4KVAA 1DZIA 1F2TB 2P41A 1YHZA 2PFKA 1IM8A 1N5LA 3BB3A 4PZUA 4URFA 1D7OA 1T8SA 3FTNA 4FDVA 5AM4A 2A4KA 3P96A 1OV6A 1E2LA 2Q07A 3ND7A 3ZXIA 5F3WB 2HHLA 3FNQA 5JZMA 1RYMA 3U80A 1DTEA 3U3JA 4Q5IA 1WXFA 4MXDA 5CH5A 3NEJA 3QA9A 3WQRA 4BNNA 3ETEA 2JBAA 4ER0A 3C48A 4ME6A 2IHBA 2CEKA 1JMYA 4F5EA 3DVRX 1ZWLA 1T8TA 1EWKA 2VDLB 3ONDA 1PL8A 4OQEA 3G2QA 4Y6QA 2OSVA 2P0EA 1SXJC 4FFLA 5K03A 5H9VA 1QZXA 3IAFA 1YI8A 4NCNA 1NVWQ 1GY8A 2VTEA 3H42B 1M1UA 5DVZA 2ZZKA 4JKIA 1XNGA 3PTZA 1QFMA 2A0WA 4RGYA 5JNVA 2PNJA 3CH6A 4D1YA 3P97A 3QBTA 4OQ4A 2E4WA 1R6DA 2QQFA 2IUYA 4Q7MB 1PYDA 2OZKA 4N5DA 3HKEA 5KVQA 4DMHA 5SYMA 1UMBB 1WA5A 3PFBA 4EHDA 1MT0A 2H2GA 4OP1A 4AK9A 2G1AA 1T1RA 1B6TA 3A28A 4QUIA 4X7PA 3Q3EA 3GC6A 4EEXA 1GG8A 3AEQA 5H83A 4CKWA 4QIHA 3PUJA 1X7ZA 3B78A 3L07A 3DFKA 1TU3A 1MAHA 1U28C 2QTMA 4EHAA 4OATA 2AXQA 1PT6A 4CUJA 4KR3A 4M38A 1PRYA 3JAMA 2FEXA 3CZCA 3KNZA 4N5NA 3WKBA 1K8ZB 3IVCA 2WWHA 2VJMB 3F6BX 3NZEA 4CTMA 2Y1KA 4IOKA 4AZ3A 1UP7A 3QU5A 4WFJA 3P0RA 1LPBB 1HYQA 1N2IA 5FCDA 2DXIA 4CIXA 1JAZA 4NV1A 1N8NA 1ESMA 1Z0IA 4H3SA 4R2IA 3PGLA 4X61A 4AN4A 4IXDA 3TFQA 4J4BA 1JEQB 1Z08A 2WIBA 2YHIA 3LOUA 2D1TA 5ER9A 1RXUA 4BZWA 3DM5A 4KOEC 3S99A 1M8PA 4HF7A 3GGPA 5FADA 3U6BA 1P4JA 3LPMA 2R2GA 3M8KA 1E20A 3A6FA 3QLUA 5AP9A 2X41A 3WLSA 4TM7A 5IK2A 1C80A 2FMTA 3G0DA 5FQNA 3W8RA 1F5SA 1H1LB 4WAUA 3VSAA 3TI7A 5BNIA 1ZD8A 5BWCA 3HCRA 4KR2A 4ZO4A 4ACBA 4GX1A 1QGAA 4PNEA 1DG3A 3O38A 2YV5A 1XCBA 4YWJA 5FUMA 3H65A 3L05A 4V1CI 5CDFE 3NHJA 1TZCA 1I8TA 2KBEA 1VJGA 3TLCA 4R16A 4RF3A 4G0NA 4I4TA 4J75A 4TYWA 3KT0A 5T4HA 2X76A 4HWPA 5KPJA 1AHPA 2QLLA 4X92A 4NEGA 5JTTA 1GZ7A 5CCXA 1RRVA 4AECA 1CEEA 1G21A 3TZEA 2ZI4A 3QKSB 1U11A 3CSUA 4CM9A 5CXUA 2FFRA 1T2CA 1YS1X 1XQ1A 3F7NA 4PN3A 4TV8B 1GAEO 3G89A 3RUDA 1XB2A 2O05A 2OFOA 2AJ8A 4K7JA 4YI3A 3TX2A 2D6FA 3VU3A 1SBQA 3VSEA 3ZDDA 3ZX5A 2LKCA 3GLHA 1HTTA 1VMKA 2V7TA 5EIHA 2Q49A 5DNCA 4ZOAA 5DCUA 4N41A 2A5LA 2BR5A 2IV7A 3N0XA 3Q5EA 4UJ3A 5HS4A 3DTVB 3NDPA 3EXEA 4CIVA 2Q7DA 1QF7A 4LRUA 4FGUA 4F96A 3LUDA 5FTJA 1T36A 4MWTA 1NQWA 1QO0D 4A2CA 3UCFA 1PS8A 3W8NA 2JFVA 2O2DA 1UBJS 4FZ5A 5AJUA 4E11A 3NIWA 1DJQA 3DL0A 1GUBA 3PI7A 3RAJA 1XALA 1F3OA 3T1TA 4DA0A 3LUJA 1W36C 3KJQA 2P8SA 4K6FA 4C1BA 3VI4B 3BG5A 5A3QA 2GEVA 2COKA 2AOUA 1PZXA 1AMOA 1DC8A 2YYYA 4RPIA 1XXHA 5EWMA 1O87A 1YBAA 5DM0A 2ECFA 1RHMA 4MJ3A 1MLDA 1HI9A 2ORWA 1HMYA 3OKFA 5AI8A 3D8TA 5ILGA 3U17A 3IMCA 1U1IA 5IC6A 1JJIA 3IELA 2ODNA 5FA6A 1CE8A 2HIGA 4Q9IA 1CERA 2GEFA 2GYUA 3SZRA 4L9AA 4HNTA 1ZKMA 4BJ1A 1TEZA 1PYGA 3D4OA 3K1ZA 2BR3A 2P4SA 1LK7A 1S9DA 3MBIA 2F17A 2WJGA 4FLEA 3K6SA 3S2YA 4R8VA 2IVFA 3OTIA 3ZD8A 2Q21A 1IWOA 1FP2A 4PQFA 2FQXA 3NH9A 3QVGA 4FYIA 8LDHA 1A9XA 4N5LA 2QTAA 5EINA 1GFIA 3N58A 3VYVA 2EFCB 1JFVA 1SRQA 5AXCA 4H1WA 1H2ZA 3HI6A 4ZXFA 3OTQA 1TGYA 2ZPAA 5E6SA 3C1UA 1EGQA 3TW6A 1BYUA 3K09A 2N0SA 3D2LA 4ITVA 2ZLBA 3RBZA 4XOIA 4GPZA 2ADFA 4IR7A 3DE1X 3BCUA 1P3JA 4JENA 1K66A 4FWTA 3A1CA 1Q21A 2I54A 2X3YA 4OL0A 5C4MA 2QW8A 2P9JA 1Y3DE 4LJ7A 4D8UA 2EL7A 1T5IA 2I5PO 4M1QA 4BGUA 2HSGA 3O0DA 4BX8A 3M6XA 4PQYA 5HJ5A 1NXVA 3ADDA 4HN4B 4YMVA 4OAOA 4XIGS 1O1YA 1Z4OA 2EOAA 1Z2PX 1K7EB 5BV8A 1JB9A 4DDHA 4KC0A 2G0AA 4IIJF 2WW8A 3DONA 3EF3A 1U80A 2Q1TA 4G4SP 4ZCMA 2XUOA 4ZDWA 3L7LA 2UYHA 2GARA 2PH5A 3IR7A 3PRJA 5AKHA 2O0HA 2QT1A 1VE7A 2G9RA 5DGXA 2VQFB 4YWHA 3B60A 3RTCA 2ZUSA 1TUGA 5DRYA 3B5IA 5L6LB 2BEWB 4Q9NA 2J9RA 2I2WA 2IWRA 4DJEC 2QMZA 2IUUA 4KAXA 5H70A 4DN6A 2D3WA 1A0OA 2WNSA 4UFNA 121PA 3ZGXA 2D2XA 4JWTA 3C3MA 3QA3E 4FGWA 1A77A 2VQDA 3R0QA 2QN3A 3ECAA 4Y18A 1VIYA 5AKZA 1ZD5A 1VCNA 2HMTA 2CEAA 3FBGA 5HKBA 4DBLC 5D5HA 3P4XA 1QNFA 4HJRA 5BQFA 2AN3A 1VBKA 2I6GA 2XMSA 3CZ5A 2O54A 1ZY2A 1CTQA 1NNEA 2R87A 4KBFA 5AICA 3W4KA 2IYWA 1XJ0A 1JR2A 5AKKA 3HN2A 4C0HA 4TL7A 1MEJA 2VEOA 4REOA 3ER9A 2VSYA 3KKKA 2ZBUA 1R74A 2IYAA 1CQXA 3G0IA 1J90A 4ZZIA 2GF9A 3ZWWA 4ZC1A 4KUGA 3K5WA 3U3RA 3N3BC 4RSGA 3OQMA 2OO3A 1D2GA 3DSRA 1WD5A 3KKOA 5LCXA 3R77A 4KO8A 1KYYA 4M54A 4O3FA 1L5NA 2BI7A 3U7IA 4BB5A 5MDHA 3UV6A 2V5VA 3IV7A 1NQOA 2V4ZA 4LRTB 5EZYB 1KJZA 2HZBA 3UK1A 3X1ZA 5HS6A 4YJFB 1X39A 2GX6A 4JCOA 3DVLA 1PAUA 3S8YA 3FBTA 3FMGA 4TMYA 5MGNA 5AW9A 2Y0CA 3G23A 1TTTA 3QOXA 1NPYA 2ANBA 1LDMA 1NTRA 3BL6A 4H1VA 2MSKA 5GINE 4LJRA 3SAJA 1C3EA 1U7XA 3AXTA 3TD2A 1I6WA 1TK2A 3KKQA 4OHOA 3T5MA 4N0MA 4V0SA 3TM4A 5G02A 1DWUA 1M83A 4YMWA 5B1DA 3DO6A 2VLBA 1ZCJA 1BQEA 2VJMA 3D2BA 2QLBA 3JVEA 3MSCA 5DLDA 3V8NA 4CL8A 5F64A 1PFKA 2Z2YA 3K8ZA 4G41A 2ZIGA 2JS7A 5J4KA 2ASVA 3IV6A 4MDHA 4Y7DA 4UPEA 3CLSD 5EFOA 1SCJA 2WD9A 4BLSA 1T6YA 5K8IA 4ZV9A 3IQEA 1KMIY 4NV0A 1U2GC 5HX7A 3P71T 4WCFC 1STOA 2IU4A 2PBZA 1YI1A 3EVGA 2HRRA 1IG3A 5F12A 2H7VA 3LTNC 1BE1A 4ISBA 4WMLA 2A9KA 1JP7A 4EBFA 3SZGA 4D4KA 3CVYA 4LFBB 2QW0X 1SQFA 4YUAA 3PWTA 3QU2A 2H1VA 1Y1LA 3HA7A 1RQPA 2WZCA 4EJ2A 4E22A 4P7GA 4UEKA 5LU8A 3BIXA 3ESXA 5FA5A 1XWFA 3ZUPA 5BN1A 4AF7A 2C3UA 3A9UA 4JV5B 4DL9A 1RAGA 1JR3D 1JNYA 3LCVB 3G0CA 1DUIA 4B3HA 1ZDMA 4DG9A 1EK5A 1N6HA 1Z9BA 2ZAYA 4I99A 4RMGA 3KWFA 1AO0A 3B13B 1RWNA 2W42A 4DR2B 1HYEA 1T9GS 3QVTA 4HKTA 5A0VA 1E8NA 3SR0A 1LPPA 4MWEA 1EXWA 2PRKA 4MKIA 1P1BA 1S5PA 1YK1A 3WMRA 1PR0A 1KEWA 4TQ9A 3T7TA 1G1AA 4CHTA 2HSDA 2D7JA 4Z54A 2IP2A 2B3DA 4Z9BA 3I9OA 5IVKA 1QXSA 3OHPA 1VLZA 4KE7A 4Q4HB 1OFIA 1DEKA 3DTVA 4LX0A 1G2OA 1Y6QA 1L4GA 4D4GA 4F1WA 3I4LA 3BMXA 1QONA 4TXHA 4BX0A 2W4MA 5K6AA 3OLYA 1EVYA 3EGWA 2XD9A 4D79A 5F1OA 1V6AA 1OWMA 3G49A 5B7PA 1FTNA 1RWXA 1XK7A 2DUMA 1Q84A 2HK7A 1GRCA 1O4WA 2R8BA 1XL0A 3FX2A 1HNXB 4BRWA 1QIHA 1UKCA 2W90A 1U7ZA 3H2SA 2BFCA 4KTVE 3SJAA 1VRCA 4YJHB 5AOBA 5LP6B 2RHRA 3C5EA 4XD7D 5KSPA 4CZ2A 4G37A 4KZPA 2XY4A 1XHEA 1XTKA 3VYSB 5IDQA 4LMRA 4U7FA 2O7NA 3NAQA 1IEWA 1HDEA 1IPEA 1NDUA 2XTNA 1AN0A 2QORA 2XVYA 3DOJA 5G4KA 3V8BA 4ENTA 4YAFA 2F1IA 1MUUA 1JFRA 1OI7A 2DQSA 2FRVA 2R5WA 4RVDA 5A02A 2WB2A 1X7WA 4MYSA 3S68A 3BXFA 4C7JA 1HZZC 1P9LA 2F64A 2PX5A 4BFXA 4C4AA 2FI1A 4TLLB 4ZICA 2B1JA 4R6WA 1ST3A 5JH7F 3FYUB 3CISA 1RRFA 3OTHA 1QS0B 3PZBA 4C7MA 3P0EA 1MIOB 2I29A 3ONWA 5AVRA 3NM6B 1Y8CA 5E38A 1NJSA 4AJEA 1ZBQA 3KJNA 1Y34E 5F1PA 1T2NA 3S2SA 4V39A 2Y0EA 1WB9A 2WIAA 3O4JA 1A8UA 3FDZB 4I9GA 4EEZA 5ALDA 1RKBA 1WHTA 3DAHA 1G60A 1V9LA 3MTJA 3T0GA 1RTKA 1NC1A 3SIPA 1N2OA 2I9PA 2ZR9A 3I3OA 5CW2A 4BNGA 3GNSA 5IJ9B 2NP6A 3RM3A 1GLVA 1X7YA 1CQZA 5JANA 1CX9B 1UK9A 2BZ0A 3PQ6A 1RQLA 1Y82A 2WD7B 3NM4A 2H5IA 3ZZNA 4BFLA 2OO5A 3O95A 5CA0F 1OWPA 3K4HA 3NHAA 4M99A 4JYBA 2QP4A 2Q7OE 4EQ6B 1WP9A 3DPSA 2XDAA 3HDVA 5LUAA 1YB7A 1WZUA 2BTOA 2ADOA 1OZFA 1W59A 2BGTA 3ZEIA 2EKZA 1G2PA 2FZEA 4C6TB 1ZD2P 1KOJA 5EWJA 1LGYA 2D1FA 3TGLA 1ZGGA 4G56A 5L7TA 4QSHA 4HGRA 1DIGA 3K94A 4MX8A 3QWAA 1VOTA 4TTJA 5L3ZA 4ZMSA 3KLOA 3I6BA 3OPNA 1R15A 5ESDA 5E1OA 2BEWA 3H7AA 1ODSA 3EGCA 1AKQA 3JS5A 5HFJA 1JXAA 1KYWA 4RK6A 5B1IA 3ZWDA 5A9RA 3MJFA 1DB3A 1RI4A 3CT4A 5B4VA 5KSYA 1K8RA 3CLRC 1B3RA 3AM3A 2FETA 3QMPA 3DOOA 2G67A 3RVDA 4C6SA 3W7AA 4DSTA 3EMVA 1XD9A 3INYA 3MMXA 4IXTA 4DYHA 1YQQA 1RZRD 4LF5B 1SCBA 4I9NA 2DLCX 3AYZB 2RK3A 4MQ5A 1H9BA 4NAHA 1R6XA 5E7QA 1XVLA 3DDZX 3VO1A 2XWPA 4BPRA 2YOGA 4LV5B 4CGYA 4GOMD 1D6NA 6YASA 1GLGA 4RVOA 4M1WA 1KAQA 3ETLA 3G9QA 3RUPA 1TZ2A 4BU0A 4I55B 5JADA 3WI7A 3L6UA 1WZIA 1EP2B 2YXNA 4EQZA 4G25A 4UZSA 4V02A 4RPGA 4HY3A 4MKXA 2F4VB 2JLVA 4PFQA 2WYUA 4GMFA 4US1R 3AFMA 4QPPA 2HSZA 1EFHA 3PIRA 4N0DA 4NLLA 4WKGA 1FFSA 5E6UB 1EVZA 4H7PA 4L9WA 4YV7A 3SQXA 1U3VA 3AEXA 3PG5A 4PR3A 1GU0A 2B2XA 1VIVA 2VJYA 4Q1EA 4R2LA 1KAHA 4WZ6A 4OQPA 2JAPA 3FNEA 4CM7A 1MGPA 4DA8A 4TTSA 2P9TA 5EZYA 2V03A 3UW3A 4BASA 1ZAKA 2EEPA 2DPXA 2IYVA 5BSMA 4O4LB 3MLEA 2WWIA 4KSCA 3DW3X 3HYCA 1WX1A 3K3PA 2QNBA 2XMCA 4FK8A 4A5OA 2N1BA 4RH1A 3KTAA 3OJ0A 3GJZA 2JBWA 1OGYA 5KYYA 1WCIB 2Q6KA 4Q34A 3KQKA 1DQRA 5FULA 4KH0A 3DHWC 3CGWA 1Y8AA 4BNDB 1RM0A 3T1OA 3BKWA 4Z1OA 5MGBA 1M1XB 1TNDA 5KDDA 5L3VA 4A8JB 4BTLA 4A73A 2HMAA 3R6WA 2WJHA 3LC2O 2CJWB 1KRXA 2B5OA 1H05A 1G7CA 1V1MB 3GRPA 2VDPB 1YRYE 4O4HA 3ZTWA 2MDTA 1PQUA 3CF4G 3DP7A 4C2BA 1A98A 1Q7TA 4M21A 3ZXYA 2Y68A 1R8JA 3NHMA 3V8QA 2EFYA 3U44A 1MV5A 4PZAA 3WLTA 4D3XA 4F1JA 4KITB 4F9TA 4P0PB 1EVEA 3RYFB 1QHIA 1Z7BA 1NBMD 3EIQA 2JFNA 3O1JC 1UJ4A 2YTZA 3OC6A 3W1EA 1S89A 4UNNA 4B2YA 1VCHA 4F9FA 1V37A 1W5EA 3MPOA 3N0VA 1PTJA 4PU0A 2JGRA 1AKYA 2XLBA 3BK2A 4Z7OB 5JR3A 1YQGA 4YR9A 5AUNB 3JQBC 4GE0A 3W2EA 2W98A 2VUHB 2Y4OA 3I52A 1TA4A 2FF7A 3H2GA 2ZBDA 2AHRA 3KZOA 4KAFA 3HZRA 3IEVA 3W5DA 3QKIA 5HDBB 2OY0A 5IM5A 4BVJA 5HCNA 1WHSA 4YRIA 4G5RA 2VWQA 2A30A 4NR0A 1KZGB 2H7YA 4ZGWA 5I4BA 2BGKA 4L5YA 3WAJA 1RQRA 2PHZA 1GO2A 4BJ3A 4BEWA 1KPIA 2WU4A 4OQYA 2H29A 1ZESA 5LYJF 3VAYA 2BH2A 4DY6A 1S3GA 3FHTA 1MO2A 4JC5A 4A2PA 1GQYA 4Y6OA 2ZCVA 1I3NA 1T1GA 2O7QA 2YBEA 1JDBB 5D3MA 1Q1GA 1XC7A 1VJDA 2C2MA 2GHRA 4GLFA 4ITUA 3I2HA 3VPCA 4ZJZA 2WK1A 2JFQA 4RJKA 5EMJA 2JIZD 2R7LA 4FM9A 1MQSA 3L8DA 3L1UA 2C8LA 3N3AC 1RYYA 1EX7A 2FSIA 2A0YA 2BZ1A 3L1IA 3VR0A 1YU9A 3K5PA 1F2UA 3JYOA 1AUXA 2Q4DA 2NACA 3EH2A 3GCDA 5JISA 4ZJPA 5LP6A 4PM4A 4F4CA 2X5KO 5HKKA 1U0RA 3GVPA 3MGBA 2CSUA 1OXUA 4O3MA 1G21E 2R1ZA 1BGWA 2BI4A 1YZQA 4LRSB 1I36A 3U4DA 2VN8A 1OJLA 4HWRA 1MFPA 1IBRA 4FMCF 4IOLA 4P4LA 1MC4A 4L1KA 2G76A 5FD8A 3HM2A 2EJUA 4BGEA 2OK8A 2AOVA 2RHLA 3VPAA 3HYNA 3AKEA 3AUTA 1Z22A 4QUJA 5L4NA 3G5MA 3FYUA 3AEZA 5AW2A 1Z45A 5J4VA 5JBNA 1ZJ6A 3G7SA 3BULA 4OBWA 4X24A 1MIOA 2CLEB 3ASUA 1AMUA 3BKXA 1NX6A 3C4JA 1O5OA 4BO5A 5ITZB 5EZQA 3BILA 2E18A 2MSNA 4MLPA 4L74A 1C3XA 3CEHA 3FDZA 3B9QA 3ENVA 2GSWA 2MYUA 3P9PA 1DKQA 4ZAGA 5GIPE 3KWJA 1QOZA 3FAZA 3TZ6A 4R71A 3HUDA 2WLSA 5BRNA 1JJVA 2XTAA 1Z0SA 3QPDA 5IJ9A 3V4RA 4LY3A 1OXSC 5LZ9A 2JCXA 2Y6UA 1Q12A 2IEIA 3KOZA 3VBEA 2A9VA 1YIAA 5LQRA 5ALEA 2IXTA 3Q10A 1TCAA 3GJTA 4Z1MD 4XRRA 2MR5A 3AT1A 2HREA 1QVZA 2HIMA 2Y67A 3VR1A 4DPMA 5CH8A 3MCAA 4QLBA 1GM5A 2PGLA 1FMLA 2VTBB 1YE5A 3MD9A 3W6UA 3LBYA 2R6ZA 4J3FA 1P19A 4QWWA 4GU5A 5HBGA 5LSAA 3IPXA 2AMVA 4LMAA 4UDYX 4E1BA 1SMKA 3DR3A 1NZFA 1A5ZA 4YJ3F 3ZHOA 3GK3A 3E15A 2B30A 4RZHA 4I6JA 8GPBA 3EIOA 4EG0A 5DI3B 5FI1B 2JGJA 3M3HA 2MINB 5DRTA 1OA0A 1X70A 1R0LA 3GCXA 3F73A 2OCKA 1SRRA 4ZEOA 1X86B 4D9BA 1KU0A 2QAGB 3D0QA 3F1LA 4JC4A 5FOWA 5DLEA 1X14A 3OM9A 4QXAA 2QRZA 4G8DA 3UMBA 3S81A 1NC3A 1L5VA 1F2DA 1FUKA 3FZEA 4R7ZA 4HGZA 1WSBA 3HFSA 1WS6A 3AY6A 1WMFA 1J8VA 1SVSA 3ZK7A 1T2AA 1E7QA 3GFQA 3INGA 4RYDA 3U5ZB 2QTTA 3AI7A 4FDLA 2P79A 3RKUA 2WTNA 4H1TA 4I55A 1C4WA 1T0JB 3HDTA 2ODPA 4EF4A 2F2TA 2W6OA 5G0TA 3W1WA 7AT1A 3EQ8A 4Q19A 5CVCA 4WUTA 3DLAA 2VDMB 3T8YA 3WGTA 5MN4A 3PGJA 4MGYR 2GAAA 2ETXA 2ZBFA 4LW8A 5ALOA 2WT8A 2JI7A 4D6PA 5E6UA 5K3BA 1E2FA 1ESDA 3L43A 3OSZA 4O2BF 4TYQA 5GVSA 4B3RB 2WA2A 1VE9A 4JI1B 4FD3A 1A4IA 3RKSA 5JNLA 2HLDD 4E31A 3UUFA 1MOZA 2F8TA 2I8AA 2O8DA 4QA9A 4MHTA 1HLPA 3D1LA 4YP9A 1ZK0A 2VNJA 3CX6A 4JT9A 4O4LA 4BDTA 3PXAA 4WFKA 3SJCA 3ZDZB 5JHHB 2UYGA 4F8YA 2OCYC 1FZTA 3RS2A 2AZXA 1L5HA 2QVLA 2IPNA 4B2PA 5JXHA 5C18A 3VJLA 2OHJA 5CBPA 1L8AA 1ONOA 3H86A 4I19A 5K3EA 3GG9A 1OLXB 3GRUA 3LZDA 3FTFA 1WCIA 3C3EA 1M1YA 3LSTA 5KTOA 1PV1A 3DV9A 1FBNA 3D6JA 3P9XA 4JSYA 3HJAA 1N9KA 2NO1A 1GV1A 4P7JA 3RJZA 1U63A 5FQOA 2CWDA 1TKRA 2AQ8A 4QGHA 2GKOA 4A8JA 2Y1EA 3C6BA 5KQRA 3O90A 1I2DA 1WXEA 4XQ9A 5AW1A 2CJWA 2W2LA 1ZUWA 1V1MA 3BZWA 1AZWA 1WWKA 3MCUA 3FMVA 4OJKA 4KSBA 2ZE5A 5DK4A 3HY3A 1VCMA 4U6QA 3HL0A 4M9CA 3E61A 1T1IA 4UD6A 3R8CA 1KEEA 2OZLB 3Q3HA 1ZK3A 5CFMA 3RYFA 5JEDA 3NYQA 4MUBA 5FPPA 4DDWA 2KLHA 1V6SA 3QFFA 4OAPA 2C59A 1NXTA 1ORVA 5EPOA 1GCGA 1C29B 3SVTA 1QZUA 4UMDA 4B3GA 2E37A 1U5AA 1SVOA 3BQMB 1G3RA 3BMOA 2WJ3A 1U9ZA 2MSWA 4LIPD 4RZ3A 4MB0A 3WWCA 4KWCA 4EGQA 3ZD7A 4DV0B 1NJ2A 2W2OA 1J33A 1DHRA 2DLDA 4OK5A 3OPYB 5K3SA 4US2R 3NBAA 1RIIA 3NVAA 4B73A 2X13A 4ZDKA 1Y9DA 4LHYA 1UFKA 1D4ZA 2XNHA 4PC7A 1XZQA 2D00A 4NPAA 4ZYVA 3K7EA 2O3TA 1XN4A 3EEFA 3FWPA 1ZN7A 1NULA 3VBCA 4E46A 1G63A 1RJGA 2OFXA 1S02A 4OQLA 4CKYA 2H17A 4BAZA 2AOTB 1BQ3A 3NBUA 5BR8B 1GNLA 2GN4A 3MRVA 3P2IA 1QG0A 4PF1A 2OAEA 5T67A 4HVAA 2VRCA 4K9OA 2R85A 3ZPXA 4CM4A 4YPVA 5KNBA 2GAFA 1CF9A 3HA5A 3KQUA 3OU6A 2ZTSA 4ND1A 3AJAA 2NU8B 5CT8A 1B43A 5AVSA 2FEOA 4OSOA 4DQDA 2CZQA 2YV1A 3AI2A 3W7BA 1I7DA 1YBHA 3QUBA 5FEUA 2HDWA 5SV2A 1I1OA 3AY3A 3N2LA 2JVKA 4XWTA 2A3NA 2WHQA 4FNGA 4OQXA 4CLRB 1ZUD1 2EDCA 4XKJA 2G5TA 3D8BA 4E21A 2F1KA 2NU7B 3OP4A 2B78A 4AVYA 1V7CA 3T9AA 2QMHA 4LRYA 1XZJA 4IQ8A 3IXLA 4G0VA 5JRZA 1EIWA 4B3TB 2HWKA 3MWKA 3LPCA 4OKSA 2GHIA 2V7GA 4WBNB 4PLTA 4CUKA 1GPYA 1OREA 1U8FO 1B8VA 2B2NA 2BT4A 3FWHA 5TE9A 3ZWBA 4DUPA 3LC7O 3UGQA 1ICIA 2WM9B 5FBZA 2P7IA 2IT1A 4ZI7B 4HNVA 3GA0A 1W4ZA 1WB5A 3DEKA 2O2XA 2AYZA 4KNVA 4MV6A 5GOTA 1LF0A 4C89A 3MUNA 2BELA 5B7NA 5HRCA 1T2VA 1A96A 2F6RA 2GN2A 2V7VA 2IYXA 4M1YA 4ZMBA 3VKHA 4KGZA 3HXPA 1Q6YA 1VFPA 1GYPA 3CRRA 4EK9A 4M37A 3L2OB 1PG2A 1G5RA 4G5XA 5FO1A 2PZJA 2YYAA 1V25A 2Z9CA 3BWMA 3E0XA 3I5UA 5I3ZA 3EMBA 4BFUA 4U2BA 3IJ5A 3N2NA 2O59A 5IVIA 1OKKA 4JB8A 1Z6YA 4KN8A 5L8VA 1RZUA 1BHSA 2VP4A 3LAWA 1ECFA 2X77A 5F51A 4PZPA 3G59A 2FMXA 3AIMA 3A6DA 3TFWA 2HUNA 4EPVA 2GNAA 2HXYA 3F6SA 3UUWA 2F59A 1TQ8A 4LQ4A 1WABA 1J24A 2CDRA 4JASB 2Y6VA 4N39A 1I13A 3GPLA 2VDJA 3RBAA 2LIPA 4G9BA 1KPGA 4FT2A 4GKKB 1FYDA 1P4HA 2YW2A 1SC6A 4B6SA 5C5IA 5JD5A 1U7HA 3QU7A 2VPXA 1JIQA 2A9FA 1C9NA 3AFNA 4EUFA 2RHJA 3GLSA 1IY2A 4B8WA 2RH9B 4D8TA 5EXDA 1FJXA 1GPMA 2H1HA 1Z5PA 5G4LA 4PPFA 3QLUC 3AW9A 1E1NA 1UT6A 1KDRA 2YY5A 3IHWA 2OV8A 4G3XA 4S3MA 3AL3A 4JJKA 3HSSA 1P2BA 4UNSA 4DM3A 5DI3A 1UDAA 4F6CA 3DMPA 1U6IA 3AR4A 4QQRA 2X0JA 5IXSA 2G77B 3FOFC 2Y1XA 3EHDA 2PUTA 3RS5A 1B2LA 2QAGA 3FPFA 2OBYA 4MPJA 1DXHA 1F8XA 2X8AA 4MVJM 1J1ZA 2PGXA 2R84A 1M6VB 1MH9A 2HSEA 2OCBA 3TNFA 4FCVA 5IW8A 2FSFA 2CLHB 3HCDA 3ZV3A 4DMRA 1P60A 3L9WA 4Y2PA 5EERA 3FVTA 3T3PB 4WLEA 4R9SA 3IQWA 2V74B 3ZVLA 1Z47A 4GMDA 2FPMA 3SE7A 4GOKA 1XTJA 1S9HA 4J9UE 2P6UA 4TXMA 4G2TA 1UPUA 3NHFA 3DE5X 1FU8A 2ARKA 4ARUA 4UXIA 3CVUA 4INZA 4RUKA 1RM4A 3N86A 3M4JA 4N3GA 2AMJA 3ROKA 3UUGA 2C78A 2EX1A 3R75A 4E1VA 1P5FA 2H9YA 2DERA 5PGMA 2B4AA 5EMKA 4ZU1X 4EW3A 1EQUA 4UTNA 5B12A 2CK3D 3L8HA 1SKYB 1P29A 4LK3A 3EQ2A 4D3SA 1MW9X 4QTUB 2GCPA 3GJ4A 2Q0QA 3HWRA 3DE3X 5FR1A 2DUNA 3ABOB 1QH1B 5LQNA 1Z7WA 5HQ3B 4GVPA 2C5BA 4URZR 2ZJ6A 1VIAA 3NVMB 4OYRA 3ER8A 2P2NA 1BCSA 1G9SA 4LOJA 1XG5A 3B5JA 3MMNA 3O0TA 4INOA 4NZOA 3T9BA 1OLXA 3ZU2A 4LWOA 3L8MA 3AV0B 3FWNA 1ZJ4A 821PA 2RGUA 3PNOA 3I0MA 4I4LA 2PH3A 1DDIA 4WL0A 4JUAA 1XTRA 4TWJA 5GMOA 2BDEA 5IP5A 4NXMB 3OPQA 4YQZA 3FB1A 1ULUA 3SQOA 3T3DA 2C04A 2CZGA 1R3DA 5IYZF 2C3MA 1T3GA 4V2IA 1FUEA 2RDMA 1ZCZA 4R1TA 1I4DD 4XGKA 1YXMA 3VH2A 3ESYA 1ZI6A 2L42A 3DLPX 3H5OA 3P2YA 4NKRA 4TKLA 1KJYA 2I55A 1XOIA 2ZIZA 3I04A 1PSZA 1R0SA 1YQTA 4LZAA 2WQ7A 1JLRA 2B0CA 4ZVTA 3N53A 4F4HA 5TT0A 4C78A 5U9CA 2CNNA 3I01M 4HSGA 3FYCA 1K5HA 5CMLA 1JR6A 4MS1B 2OZLA 3O7MA 2ZI6A 5CDGA 4FFDA 5LA6B 3I73A 4FILA 3ICCA 1UPFA 3QXJA 4JAVC 4Y2SA 3ERCA 1N2EA 3SCZA 4WX2B 3GHYA 5EESA 3WYEA 3K09C 4K3VA 1FXWA 3CE9A 3NI2A 1V3UA 1QSGA 5IVHA 3N6RA 2WIFA 1MJGM 2CVZA 2X22A 1SN7A 2XVAA 3E9RA 4ZRNA 3PBKA 3QOFA 3WGJA 2E4XA 3V80A 2I3AA 1JR4A 3D4PA 1CIJA 1NVKA 3EVFA 5ALPA 1FFWA 3TAUA 3OPYA 2P6NA 1D2RA 2QLJA 4LZOA 1CY2A 3E18A 4RWEA 3UT6A 3E3AA 3T3NA 2O06A 5IPFA 1NOIA 3C85A 5JIBA 3THYB 4DIFA 4RNDB 4QATA 4YI5A 1V0JA 1MORA 4CF5A 4EY4A 3DMNA 3N6VA 3LP5A 5ADVA 4QU5A 4CG3A 2D4HA 2Q1SA 1R1DA 1PFVA 4CFZA 4QXQA 5K0TA 3QFCA 4P0QB 2FJPA 4IGEA 4QDTA 3V2GA 1OYOA 2CKMA 2O3JA 3KYDB 4ZCLA 1YJBA 5L3RA 3W5UA 3X1DA 2ZW9A 4G5FA 4XLZA 4U4AA 1HURA 3JALB 4IJ5A 1H23A 2FHSA 2OBLA 2QT0A 3QELB 3C6QA 3IIMA 5CJJA 5EXEA 4QVIA 1XSEA 5L95A 3QYFA 5TQ2A 2Q29A 2H7CA 5IHPA 1IRIA 1UBGA 2A8YA 1L5ZA 1RBMA 3H0KA 2P68A 1AM4D 4CLRA 2YZ2A 3OMWA 3IP9A 4IQ0A 5CFPA 2DBVO 4BVAA 2HQSA 2X8WA 2NU7A 4Q9LA 5ALSA 3ECCA 4XB1A 1CUXA 2O6LA 2PRIA 4WGGA 2XT9A 1IBLB 3IXMA 2IYLD 5DI9A 5KCMA 2ZQ5A 3ZZTA 1C2YA 4OA8A 4CI9A 3IVXA 3U19A 1EX1A 3LECA 3ZE8A 16PKA 1V45E 2V5AA 2VUTA 3EAGA 3TLJA 2QM0A 1MN6A 4WBNA 5K05A 4K2AA 5B3LA 4RESA 1IMOA 1W1WA 2PJZA 3GL9A 3OLCX 4B9EA 3HVRA 1FFYA 2P2CA 1R00A 3OLXA 5BN4B 4ZI7A 3AUYA 2N46A 2TMKA 5CFRA 2D8AA 1PGNA 2O2YA 4XI9A 1VJ5A 3W90A 3MJHA 4DLSA 2D1RA 4DCTA 3PX2A 4Q9KA 1F1BA 3EZLA 4FE7A 3TBHA 4O0LA 1MFZA 2BZGA 1OFHA 4Y9DA 3EDOA 4ZREA 4LGVA 3MUEA 2SBTA 4F4FA 2IYZA 4HPWA 2PL5A 1DQZA 4JP2A 1DBIA 4LUCA 1A69A 1H1DA 1U4OA 3QKUA 4XARA 4AY3A 4L6CA 3TVYA 5FTKA 1AB5A 1OZ0A 4HPXB 4RDIA 4CCAA 4D9HA 2GPNA 3PSAA 1J99A 4GS5A 2XUGA 1EJ0A 4ZDIA 4IJ6A 4QEZA 3RU2A 5ICEA 4F3YA 1EWQA 1RBQA 2QROA 1R4MA 3B12A 3SMQA 4EFDA 2QE7D 1P9WA 4I5FA 4EG8A 2UKDA 3DT9A 3QTTA 3NHSA 3KWMA 1FEZA 1JEOA 1WB6A 1XMSA 2O2IA 3RC1A 4IH4A 1BA3A 1Z2OX 1IG0A 3PQFA 4EG6A 1KMQA 4JQSA 4ZYLA 2NO0A 1EWVA 1HRKA 3O3MB 3PHLA 4KGXA 4S04A 1HBJA 1ODLA 2PWZA 1LX7A 3AY0A 2YWDA 1BA2A 2XWSA 2QRMA 4RE5A 3WRYA 3FB4A 1ACMA 3ANMA 2AJBA 1NAHA 3A2NA 1AB6A 2H1OA 1HSOA 2R3SA 1N1GA 1EDOA 3UFXA 1FMTA 4JBGA 3ZJVA 4YP7A 5JJLA 1KQ3A 2YUIA 5LMCA 4K03A 1HDIA 3N0RA 2GFIA 5E4JA 1YJQA 3GLGB 3WYBA 4IDNA 2C83A 4RABA 5FUVA 5ALZA 1XNQB 2QSZA 3TQOA 4PTYA 4FMPA 3STTA 4M87A 5TVKA 4XFJA 2X9QA 3M6LA 1XT6A 2EX4A 3VNBA 3MT8A 4Q4JA 5HUQA 4UUOA 4H17A 2JK0A 4WK4B 4IUDS 4G5HA 4E03A 1B8PA 1W0JA 1TU4A 3HXLA 1XZ8A 1T9DA 3RVQA 2PZFA 3A6ZA 2B4YA 1BEUB 2WQZA 5DULA 4D6YA 3QP9A 4R41A 4KWIA 4KR6A 1EI9A 4II2A 1R4ZA 1K3FA 3B20A 3F9CA 5BOVA 3ZDBA 1A1SA 1LPOA 4IXWA 2XGOA 3VVBA 4II7A 4TKVB 5TR9A 3VAAA 5HF5A 1V6CA 5ERXA 1AK2A 4H27A 1ZCFA 5D1HA 4OX9Y 1B0ZA 2Q3HA 4Q9JA 4BXOA 4KHPB 3OIFA 3DA8A 4RV4A 3FCXA 2CV1A 3KC2A 1AUOA 1RS0A 2F9MA 2ONCA 2AFHB 3DF7A 3QV2A 4B35A 4J0JA 2ICAA 1OBCA 1NBIA 2W6JD 2Y9MB 3HJNA 1NRIA 3TKLA 1GTSA 2OXTA 2EL9A 4I4CA 5EZ5A 3QF4B 5BSTA 3TS1A 4FGJA 5IABA 4EFMA 2NU6B 5C1BA 1XTPA 2WAYA 5K6AC 2D7CA 3KP1A 2OOKA 4NZMA 1IUOA 4RS3A 1B42A 1COWD 4IDBA 1TOAA 3T3EA 4BNXA 2XBMA 4TT3A 3E53A 1QH1A 4GBED 5HQ3A 3T3GA 4L5IA 4Q6WA 1K5GA 3IUPA 5DGCA 2YNMD 4HDQB 3FUVA 4BZQA 5CB0A 1IRXA 1ZXXA 2YIVX 3OPVA 5EPUA 2HAEA 4UEWA 3NQ41 1GR0A 2G4CA 3R4CA 2J3QA 4MV0A 3UKDA 2BHNA 4EJ6A 3WGZA 5JVDA 3A6JA 4I1SA 2Q2OA 5B6PA 2BHRA 3GV0A 3BCHA 1L5FA 1G4AE 1VP9A 4WXEA 1ENYA 4ZVUA 3T52A 1U3DA 1X8KA 1YOBA 4NZYA 4AZTA 4C5AA 3T4PA 4Z4HA 2BSQA 3TSZA 3PEWA 1Z63A 2MSEB 5FWYB 2VUUA 1ZZGA 1BE6A 3AU8A 5DZSA 5LYYA 2NUAB 2H1IA 4MP8A 4Q3OA 3BK1A 3FPAA 4QOGA 1GRVA 3I42A 1OROA 2RAPA 4M1EA 4NONA 3RAEC 5CAEB 4YRCA 1Z06A 3F1KA 4G5OA 4MS1A 3AV3A 1RWQA 3C3PA 5DSXA 1XEAA 1FX0A 2FN4A 3INTA 2VF7A 4DQXA 3L4JA 1NYTA 1YT5A 2F48A 2ZR7A 3EMKA 3K1YA 3MC1A 4GIBA 3ICEA 1H2FA 2HWWA 3PXDA 4JBWA 4MVWA 4DLBA 5A6SA 1XF1A 3DFIA 2CFRA 2X4DA 2R0QC 3PK0A 3LW8A 4GSKA 4IX1A 4MINA 1EYZA 2ORIA 3GFVA 4ZFNA 5EQFA 4C01A 2OO5C 1YR3A 2FEKA 2JLXA 1A9PA 1M1YE 5E2BA 3GZ4A 4CQLB 3UJ6A 3W9BA 4LOKA 4L3OA 2ZJ2A 3NWPA 4JNCA 1IXZA 4QUAA 5CPFA 4D5EA 5SZKB 4L76A 1UJBA 3F7TA 3R6LA 1ZWKA 3I45A 1E79D 4DV6B 2YXPX 1R8QA 1YAJA 2I7TA 2VPYA 5KQGA 1NXQA 2GXUA 4XD2A 4ALNA 1H0RA 4YRZA 1NONA 4K46A 2CLKB 4NZNA 2GO1A 3K8OE 2QN6A 3CYFA 5K6RA 1RE0A 4D3YA 1CUZA 3M3PA 1Z88A 1TRKA 3HCCA 3RQSA 1MU0A 4MLCA 2BPOA 1U2DA 1BJKA 1EVLA 2Y1CA 3QELA 4TMTA 4AJ9A 4FX2A 3AF3A 5C1IA 4B8YA 1LTQA 1LW7A 2OBBA 3EIWA 4FI3C 4GKBA 4B5LA 2CJPA 2WFLA 4D3DA 2XKKA 1HKUA 2YL2A 1KVUA 2BAGA 2BMDA 1ZUIA 4LJ9A 4UARA 3BF8A 4CETA 2HY7A 5AW4A 2YBDA 2X40A 4B79A 4BNIA 1QF6A 1TF2A 1IN5A 3KVNA 4KQMA 1EFPA 3NNSA 1V2HE 2ZYVX 5EHIA 3HFJA 2XYGA 4ZARA 2QUHA 4QWMA 5LZ5A 2GBIA 3GEEA 5JSFA 1WKCA 2FWPA 3MCTA 1ZHFA 3OLQA 2BCEA 4X1KB 5BN4A 3TL3A 3UAZA 2E49A 4KMOA 3W3AD 1V8FA 3R40A 2VSQA 3FJYA 4MZXA 1WU8A 1H2XA 3FNBA 4CMIB 3ZTTA 2PLRA 1UOPA 4TRJA 3HACA 5HIAA 4ZTBA 4CNBA 3NUZA 5TVGA 1LLUA 5D3ZA 2W6NA 1F6BA 4YCCA 3EPJA 2JHPA 3H9GA 3U0VA 4MR7B 5LQCA 3ZY2A 1ONSA 3IEPA 2I4TA 4B0OA 4EHKA 1KGSA 2A5DA 1LLCA 4MUKA 3U0BA 4EF5A 3HZOA 4YR7A 1R0ZA 4DR5B 4C7OB 4P58A 5ILOA 3ZYCA 1AKRA 2JFYA 2JGAA 1L7RA 2XEDA 3CPJB 3NC4A 2QVXX 4P2BA 5TPWB 4C20A 2B99A 2Q3CA 2XSZD 1QAMA 2XT0A 1IVNA 1IHUA 2ZT5A 3D3EA 4FKMA 2IOYA 1YZKA 4MWSA 1WXWA 2OGWA 2ZRKA 5IH7A 4FR2A 2W6ID 3BGSA 1ZL0A 2ZTVA 3F49S 2Z3VA 1R4NB 4EKDA 1E89A 1K6JA 3D3NA 1NATA 2C7OA 1E4EB 2ZDHA 2R4QA 3KVYA 4GQAA 4C0BA 2F9LA 1VPLA 4MUJA 4A9AA 3NCTA 4B75A 1CIVA 5DGHA 5A4KA 5BR4A 3KJGA 4DR3B 3P26A 4JT4A 4KYUA 2VWGA 1JQDA 3L8EA 2QM8A 5F76A 1C0LA 1XP8A 3MWDB 4E5UA 2CV0A 1MG0A 1QE5A 3D7NA 3EGDB 4MV7A 5DHAA 3VKWA 2FJUA 5C4GB 4TMZA 3WHKA 3NR2A 3WK4A 3GLGA 1VPTA 2NIPA 4H7JA 1PTJC 5ED4A 3VO9A 1VKZA 4FLMA 3EYAA 2XXJA 4P82A 5DNEA 4R1SA 5JQGB 2H4JA 3ZVKA 3C15C 3FYTA 1ZIYA 3EIXA 3I9LA 4W1PA 5BYJA 2SHKA 4KDRA 4MA5A 4QGFA 1ZINA 3G8YA 1RRCA 5KNCA 3M89A 1EFLA 2PYZA 2Z3WA 2ZSUA 2GJSA 3PPYA 2WSLA 3PJFA 4YAKA 3D6VA 2O3UA 2ODEA 3II6X 2YVAA 4NG5A 2JLUA 2Y2VA 1A7JA 4HWGA 2I2XB 4ML3A 4RCYA 2H4WA 3GFOA 4V0KA 3UKJA 1A27A 2C3PA 1T5TA 5CCEA 3L0CA 4AYXA 1JEYA 3AVOA 4DB4A 1KKLA 2BFPA 4GXQA 4ZVVA 4G4JA 5G2OA 1BD4A 2QGFA 3LW7A 1P0CA 4HPJB 3ZDRA 1JFFB 4U0JA 4A82A 1H85A 3LQ1A 4ZOLF 2AFHA 4WOPA 5CBKA 1TJPB 1H42A 2E6UX 3ETCA 4LVNA 4MWZA 4QTXA 5KMGB 2ZI7A 3QF4A 1K68A 3RJMA 3WIVA 4MWBA 4D4JA 2NU6A 3LXMA 2ZJ0A 4RF2A 1RPAA 1B1CA 1UINA 1XCMA 4NOLA 4BMZA 5COAA 4XDHA 2J9ZB 1F1JA 4QYSA 1QANA 1CP3A 4ZGGA 1KI6A 4EGSA 2JJ8A 3R5SA 4Z4CA 4EI8A 4JJ4A 5JFTA 2YFQA 3G2LA 1JQAA 4B81A 5LXTB 4KR7A 1BIFA 2LIVA 2H0RA 5LP6C 2HZ7A 4DY4A 3HM9A 3THOA 4N8SA 1I5EA 3V4SA 4DV2B 4ZHSA 1PHRA 1J1UA 3EVEA 2GVZC 2PT6A 2X9VA 2XNKA 4FHEA 4C4PA 5JYEA 2PUAA 4QU8A 4M8SA 2EJWA 2Z6AA 2XGJA 3IAS1 2NPOA 3QHAA 3PKJA 3ZCUA 2AS0A 4IDEA 1EM6A 3KFXA 2VDNB 3AETB 2R5FA 1MX3A 3LQ2A 4IMJB 2GXSA 3ZWMA 1OI2A 2IZ6A 4UKDA 3RUFA 3VC2A 1P1KA 2C9CA 3FYUC 5GONB 3FI0A 4IUYA 4FDTA 3HWSA 2C0PA 3TSOA 3ZDXB 3GLUA 2Q27A 2W58A 2ROQA 5K0JA 3IOCA 1H2BA 3HBMA 2H8GA 3KZCA 3H5WA 3FN4A 1NLFA 3U4AA 5BMVA 2VBFA 2ZJBA 4C0LA 1O6ZA 3X1WA 4D99A 4DWOA 3PDIA 3FFAA 1DU4A 2RHCA 3PPWA 3JQAA 3ONNA 5K0LA 1CIPA 3LVQE 3MWEB 2AEMA 1Y6RA 4WFIA 4RPKA 4DCPA 4FFBA 3RQIA 1T34A 2QTCA 3EARA 5KVVA 3AVXA 4A15A 1Y3AA 3H2HA 1A82A 3PXBA 1QGED 4U00A 5CVDA 3IJRA 5JPIA 2GTHA 2IU0A 2ZAMA 4PCUA 4TMKA 4WBSA 3E6AA 3T9FA 4ZO8A 1FJ2A 5EE9A 2RBKA 3WJAA 4GOOD 4NMXB 4MTLA 4XJVA 2RAUA 2OOSA 4P84A 5LM3A 5HRUA 1B8NA 1I2CA 2EF1A 1G8SA 1GCIA 3BWEA 2ET6A 3AF6A 2XMGA 4BTEA 4RAQA 3FKQA 4OBXA 4DTIA 1BVHA 1ICEA 2FEWB 4UMEA 2IFTA 2WFMA 1GCAA 2O7VA 4ZEXA 3M82A 4HWTA 2QOEA 4K9SA 1D5CA 3EVCA 4MQMA 3WGNA 4GVLA 2BN4A 2BFMA 3D4NA 1VDZA 3JASB 2K87A 2G5PA 3FWYA 3BE8A 2GERA 4BLQA 2RKBA 4POAA 2CB0A 5LOVF 1RCUA 4CQJA 1Q6ZA 3KPWA 3QEMB 4HS4A 4TVOA 1UBOS 5AMXA 2I1QA 4GDMA 4L28A 1NBEA 1YR6A 5FOQA 3D0KA 2O5CA 1HDOA 2AZMA 4N3AA 1UDXA 3FDFA 4TMVA 4Q9DA 3WIEA 4WZBA 4B6RA 1QAQA 2FU5C 3JQ9A 2XBUA 1TAHA 3BXEA 1C0IA 1HEIA 1XA3A 3OMXA 4TVSA 3QX3A 3FUTA 4TSFA 2HNKA 4INAA 4R2JA 3BGVA 3BMQB 4XCVA 2QMEA 3ENQA 3BIJA 1SC4A 5K0FA 3V3TA 1QLJA 1YL6A 3B70A 3VYRB 3WL7A 1JBQA 4J07A 4MHOA 3SEAA 4JI7B 2CD7A 3GIDA 2XOXA 1Y6JA 2GZ2A 5KU7A 1E6MA 2AZTA 1CUYA 4GBGA 3TAXA 2NYUA 3TRJA 2LNDA 3FCOA 4PO9A 1NXOA 5G1NA 1UOOA 2VHQA 1D07A 1G5HA 2OQ2A 4JP8A 4QNMA 4X1KA 2XA9A 4UVIA 3GWGA 2OP1A 1QGDA 1LA2A 4CG1A 4K0KB 3H2ZA 2C8JA 2OECA 2PR2A 1U2TA 1RU3A 3P7MA 3VJKA 1Z2EA 3L92A 5DM4A 1N36B 1E9VA 2Y0PA 3ILHA 1P77A 2YC4C 2FUG6 5I5EA 1JJ7A 1I7QB 2DWUA 1U1GA 4I1OA 1RACA 2I03A 1U1EA 1TD1A 1ODKA 4IFTA 4UULA 3UW1A 3IKTA 3NASA 4KQJA 5E9JA 4Q9AA 3BJIC 2NSHA 4TVBA 1V5IA 3BA6A 1NL3A 3BRSA 2GN8A 2KWIA 3ENKA 4JVMA 5ANRB 5TPWA 1ZJ5A 3CRMA 3GEMA 4IWXA 4P4GA 1I5RA 2HCBA 2V54A 2Z1MA 4DXHA 4UUPA 3WB9A 1VL1A 1JW9B 3QVSA 4MI1A 4A8JC 4BBZA 4BUJA 3I32A 2C8KA 1QWOA 3IT0A 2JHFA 5FPHA 3EYWA 4D9NA 4GSYA 4RJTA 1E4EA 3EE6A 1N6OA 4BFWA 5FWXB 4ZQBA 4C3UA 4E2XA 1EFRA 4RJIA 5HJ2A 3T7DA 5TARA 3TR0A 4QG3A 5JOQA 4XOUA 5EUQB 1DXOA 2XMRA 4FYMA 3W6NA 4BKOA 1Y8ZA 5A0TA 1E2HA 5JO9A 1JB1A 5I7OA 1QORA 5EHZA 1CDDA 3MWDA 4O4JB 2WYVA 5AVZA 1RM5A 4GP7A 4YDRA 1KXJA 4RKRA 1D2AA 4RVHA 4CT5A 3A1NA 1YRHA 3WLPA 4ANFA 2BMVA 4NK5A 3UHAA 4MGIR 1FYFA 3GJ3A 4HVCA 1J6UA 3PQCA 2OGUA 4UNQA 2CXSA 3AHFA 4GPIB 4I9FA 1VLQA 4URWR 3RO7A 4DJAA 1N78A 4M1TA 3RYIB 2QRHA 2GBFA 3HJHA 4H59A 4EI2A 1LVHA 4DPKA 4KKVA 4AT1A 1UDRA 2P1ZA 5D86A 5EIWA 3DXZA 1WG8A 2ZETA 4FOLA 4B6PA 3RREA 2PZBA 2HK8A 3K8QA 1MC1A 4DUZB 1YL7A 1ZMXA 3CN9A 5AHWA 2A9RA 3Q9NA 2IDJA 3F3KA 4RMIA 4TUYB 3OJEA 2C77A 1MB2A 1GQFA 4X54A 2HRDA 1B6SA 3ZGLA 1JDBC 3GAFA 1UJ5A 4QYIB 1EEXB 3CRW1 1CVLA 2PWPA 1LK0A 4P32A 5B3AA 3C87A 4C6HA 4HDMB 2X19A 3BTOA 3OCUA 2UZ3A 3PE6A 1EEHA 4KXYA 3Q40A 4J7AA 5KX5A 2CXHA 3KZXA 1USUA 4EH1A 3UB3A 1N7IA 4FFSA 2W5UA 2P9EA 3U26A 4OI1A 1E3EA 5LXTA 2LGJA 3KOMA 1GRQA 2CVFA 3BWCA 3ORFA 4BHTA 5KJFA 4DSZA 4P3OA 1P4SA 4UXHA 4PHGA 4G4GA 1JKIA 1XCJA 3HPRA 3L8FA 4X20B 1YA6A 3FBWA 4Q24A 3WQQA 3TF5A 1NSTA 4DR4B 4GNRA 1OAKA 1CR4A 4YDSA 3TI9A 2OXIA 4MYRA 5DGDA 4BWVA 4YRNA 3GCZA 4FBLA 2BBOA 5HUHA 4RZUA 3CM0A 3GLIA 1W47A 4D8VA 3G8DA 3NHWA 1M6EX 3AKYA 4PAWA 3EAFA 4CCWA 5FPKA 3WWYA 5JVDF 5J2TA 3OTOB 3FCAA 5GONA 1Q16A 4JD5A 1BKDR 4NZPA 3LP6A 1FPMA 3CWZA 4QDOA 5F4ZA 3IE1A 1MXFA 3NVKI 2RGXA 1OBFO 4BO1A 4KPYA 4OB8A 5TS3A 1GUAA 1SK9A 4FE3A 3TRHA 1Q91A 5THXA 1VIMA 1GARA 2ACVA 3RRNA 1EJ6A 5BW8A 3H4TA 3KZVA 5BRJA 3EPRA 4GGPA 1SKYE 3QEJA 1C1XB 4AY5A 4ZEMA 4B17A 1FNMA 5I4IA 3JQEA 3MWEA 1AXEA 3VHQA 1JMKC 2J3DA 4PLZA 3OE7A 2VPIA 1DC6A 3OQ6A 1SU7A 2WILA 4RXMA 2PMEA 1HLGA 1E1QA 1HDZA 4D92A 5C51B 3HKBB 1M6NA 1NMZA 5DYTA 2W00A 1PL7A 3R7BA 3EZFA 3QEOA 2PK3A 5TJHA 1P7PA 2Q1YA 4WDRA 1MOQA 1VDMA 3FGNA 4KN9S 4RCZA 4MMYB 5AJHA 1PZEA 2DTDA 3PJDA 3UYLA 1NR5A 3HNPA 3CZMA 2VHXA 4WIAA 3K30A 3VNQA 1LLFA 1T3TA 4JLSA 4D3ZA 4FQ7A 3I30X 7YASA 1CG6A 2JFWA 2JAOA 3ESDA 3AM1A 1YKFA 5HJ7A 3T12A 3A3PA 3BJRA 1ZH8A 5TJ9A 4PSAA 2NTVA 3R74A 4L5AA 3ZY5A 2WHPA 4HN2A 4WW0A 5AW3A 4L0DA 2XJ4A 2X0DA 3ESCA 1GGHA 1Z6ZA 1H0HA 2PQMA 4TV8F 4H0CA 5WRFA 5JV5A 4TV9A 4HDKA 5FKJA 1AQIA 2VUSA 1UT8A 3HR4A 4XWYA 4LC9A 2IPOA 1R27A 3HB1A 2WPNA 1KK1A 2C7GA 3AW8A 3JV7A 2YXDA 1WO8A 2ZKIA 1F6WA 1T3ZA 3VHXB 2NTEA 2I4OA 1MX5A 1AHNA 3DR5A 4AUKA 2F43A 3FSGD 2DJ5A 1EFCA 4D4HA 3PDCA 1NVTA 1U8AA 3AZQA 1QCDA 2ZI9A 4TQAA 2QAGC 2J3LA 3QUQA 3TZHA 5CDTA 3EDCA 3I6IA 4GSLA 3UB4A 3DBLB 1W5FA 2IIPA 3RUEA 1CR0A 3X1MA 4LVCA 1U81A 3O1LA 2HQ1A 4H16A 4L3WA 3ZU3A 5FL7D 1WOMA 2C9BA 3OY2A 4MB2A 2RGBA 2A7XA 4DUGA 1W88B 3PGKA 1T9KA 2IGBA 4R83A 4HZGA 1ORHA 4L95C 4IYRA 1MP0A 1QBGA 1QB8A 2HLPA 4YRFA 4HXYA 4RV9A 5JSYA 3R8XA 2W2KB 1TKBA 4N4AA 4K6MA 4OOEA 3T7JA 1QDEA 4AJLA 4HQKA 3ZHZA 5AUPB 4ZOEA 3LRTA 1Z5NA 2CC2A 1CHDA 3PXCX 2XD4A 3WGKA 2NU9A 4PLHA 5BT9A 2FWMX 2ZJAA 3WL6A 5B7GA 4D97A 6PFKA 1ZCAA 3T1VA 3W1VA 3RSLA 2VNAA 2VQSA 3IUQA 3PRKE 2JANA 3T54A 1SXQA 3ZWYA 3JZDA 4J1QA 3UPTA 1ZMRA 1PS0A 1OZGA 1SZCA 3HYRA 1PUIA 2WOOA 2O20A 3CW2A 3GDHA 3CF2A 4FD2A 1PT9A 3BJZA 4MAFA 4QQ8A 2JARA 4KQFA 4Y2QA 3TK1A 4FFRA 1CB7A 1YB2A 1ODTC 4UASA 1QHXA 4U6NA 3RVBA 3VPFA 5KVCA 5JXIA 1KAMA 1N2BA 1ECBA 2QX9A 3SY8A 5COBA 2LE0A 2JJ2D 3CUEF 4LOAA 4WXHA 2OKGA 4L8LA 5FWXA 3AJDA 2CUTA 4OXXA 1NJ8A 2R65A 4KRYA 3KOOA 5E3IA 1K6IA 3H4IA 5KKAA 3V32A 4NYMR 1YRWA 5ERGB 2DULA 4LWPA 1AKTA 3PNMA 3I23A 4BRSA 4L78A 1II0A 4P86A 4QNNA 1ZOPA 2OD2A 4D9JA 3L6RA 3CO5A 1XPOA 4NBKA 5A9TA 2HF7A 4UU8A 1N75A 3VZRA 2XTJA 1LD3A 4R98A 3EOAI 1Q14A 1TI7A 2X1LA 4PS1A 1VP3A 4P92A 4HGQA 4ZT3A 3S2FA 4AY6A 5EJ4A 4Q1VA 1I2BA 2OD7A 5DX0A 5ICMA 5JSZB 1DX6A 4XM0A 5JU6A 2VOJA 2AFVA 4MUNA 5CD1A 5BNFA 4JXJA 4BFTA 2XYVA 2Z2XA 1KIFA 4RORA 1L5YA 2H51A 3JU3A 2ZM6B 1HE1C 4WNAA 2PMBA 1UXHA 2C29D 3GP5A 4CNQA 1BX0A 1CR1A 1R0BA 5H9WA 3VR5D 2H2HA 2HXSA 1OT5A 4M86A 4OXNA 3TQQA 2JAQA 5IBRA 1QTQA 4C7KA 1XTZA 4OHMA 3FF4A 4Y6RA 1AOXA 1ATIA 1XROA 2RHOA 3FOZA 3AERB 3DFMA 2PBRA 3DVSX 1BYIA 5IM4A 3WDSA 1WUJS 4HDMA 4X6UA 2ZRLA 3W2TA 4AYTA 3FUWA 3DHVA 4UU0A 1XX6A 1ZFNA 1JJFA 2AMLA 1XPUA 1ZG3A 2RH4A 1JZQA 1C7JA 3ZS9A 3LO8A 5BY2A 3GLGE 5H16A 1VL6A 3EISA 4CV3A 1JEEA 1PNOA 5IARA 4E5MA 3NHPA 3UGJA 3OQPA 2P9GA 5J2UA 4GRIA 5B5SA 1W73A 4PWZA 3GT4A 4JX9A 1NWCA 4NL4H 4IX9A 2E7ZA 4PNPA 2ZWOA 1NUHA 2WV9A 3VC3A 3G0HA 4R3NA 3L79A 3ODGA 4X20A 1CKEA 3BE5A 3RNLA 4BPBA 2M32A 1YR9A 1ZVKA 1HK7A 1NI3A 4M7OA 4YFVA 2EGHA 1MTZA 3VOAA 3LFTA 4JR0A 1E64A 4BO0A 1ZXBA 1MQAA 1XJCA 1DOHA 1EHIA 1UBRS 2Y3IA 5AYVA 2CW5A 1GL3A 1HE8B 1QO0A 2JIOA 4MV4A 2PY6A 3R9KA 4LXXA 3KR1A 3KEFA 1E0KA 4G9EA 4P31A 1PDVA 2IZ5A 2AI3A 1O08A 2ODBA 4QODA 5MFPA 3DAFA 3VH1A 3ZIDA 4POOA 4L2IB 3DEZA 1J23A 2AFHE 4NOJA 4Z6KA 2C2OA 3T9DA 3IT3A 1ZOLA 3BSWA 5GJCA 1PWYE 4R9RA 1NG1A 1TVKA 2J4DA 1OVMA 1FB5A 2PRYA 1C1XA 4JH0A 4UE3S 1TTPB 3HWWA 4AUMA 4NXNB 1NN5A 1K6XA 2C84A 2XBLA 2XCOA 2IUSA 4RK4A 3KKEA 1ORTA 3WIBA 4PLYA 1H8HD 1WXIA 4OBBA 4RFLA 4MV1A 4RXTA 4L50A 1WW8A 4MS3B 4YNBA 2OD9A 2OAQ1 1N3LA 4H7EA 5DU2A 4E7OA 3TCXB 1EP9A 2DKOA 4XIYA 4LG1A 2XODA 2A3RA 2Z8YM 4NQZA 2JPDA 1DBVO 1HTBA 1BNCA 2QR3A 3DLCA 4HEA6 2QVYX 4PANA 1RJ9B 3OURA 3WK9A 4DJDC 1S0UA 3EQ7A 4EO9A 3NKFA 4N82A 3CZ4A 3AF1A 2E5FA 3A7EA 2ZIXB 5GP1A 4K81B 3E1SA 1YCFA 4P22A 4CV0A 4MI9A 1E77A 5FBRB 5J23A 3WRYC 1H6DA 5B3JA 3ZVNA 3QI2A 3RADC 1XPJA 1SHJA 4F9EA 4W9MC 2SICE 4O59O 3DUFB 3RROA 1AKUA 1Q0QA 1T13A 4BFCA 2FDRA 2I67A 1J07A 3RYHA 3TMKA 1PE0A 4JLMA 1C7FA 4RDCA 5HW0A 4YRKA 5JDIA 1UPTA 3PZRA 2GPTA 2QJRA 4IMRA 2I6FA 1IQ0A 2RGEA 3IAM6 4JEMA 4B7XA 3SSNA 2J0SA 4LWQA 2XLCA 3VHXA 4C04A 3C14C 9MHTA 1ARZA 1MQ9A 3NAZA 1LI5A 4FPXA 4JOQA 3RLFA 4P08A 1R5OA 4YX9A 1DQPA 4IO1A 3HUEA 4YACA 5CX1A 5C34B 2ZYDA 3AP2A 3DBLA 5FPTA 2P2ZA 4JGBA 2DHRA 3H1PA 4CEJA 3QOWA 3RIHA 1KK3A 4K87A 3CX7A 1AGXA 2Z5LA 2JLYA 2I9KA 4OB6A 2EQ5A 3OEED 1UL1X 1V1JA 2KW5A 3ICWA 1U9CA 3BL5A 3Q6MA 4R68A 5FWNA 1TJYA 2E5WA 2Q5EA 4S2EA 1XWWA 2AN1A 4Z4FA 4AM8A 3STXA 1L5SA 5DM70 3I6YA 3N0WA 1TIBA 1VM6A 2XKJE 1N2HA 4O25A 3PHBE 4JU8A 1UWKA 4IIXA 3EG9B 1NVVR 3VPDA 1QU3A 3CA8A 1IL0A 3F8TA 3P2KA 4X1IB 4RO0A 5AHRA 5CYPA 2Q5QA 3WNZA 2I78A 4E88A 4RTMA 3GFGA 5TGTA 1L4UA 5FUYA 1KFKB 2PFSA 4PCAA 5L40A 1H6AA 1WULS 1YB5A 2G70A 4Q6BA 3SBOA 4XLLA 4WK2B 3LRXA 1E58A 3DT8A 3OCZA 1X0VA 3TLXA 3C7TA 1NXWA 1E6LA 1VYTA 1XNHA 5ICFA 2RGCA 2R5NA 4E07A 3MWGA 3WFIA 1R2QA 1T5LA 5A71A 2FZCA 2VHCA 3IUEA 1K8QA 2EBWA 4L4YA 3FYSA 3HB7A 5IUNC 4OI2A 3NIGB 1VJTA 4B6EA 1R0WA 3PB3A 5DPMA 4JQOA 1XU4A 3C8ZA 1RC8A 1KH3A 4MAMA 4F4DA 3A4NA 1MAVA 1OILA 2XV1A 4HFRA 4JLBA 4E6EA 1P6QA 2OZVA 1MX1A 2D5IA 2QLFA 2Z98A 1PT7A 1SHUX 1ZGZA 4MULA 3A25A 2JGDB 1I0IA 4JITA 4OLAA 4OY3A 5JUWA 5AM0A 1XLWA 1OU4A 3STYA 3VNRA 2H5EA 3TECE 5H82A 4HG2A 3Q7SA 2CMGA 2O8BB 3DCJA 2WNIA 1MJNA 4Y67A 3PWKA 2CL5A 4FX5A 3H9UA 1JKFA 1Z4KA 5L7WA 2XUFA 2Q6IA 3PDJA 4UAVA 2CLFB 2V7PA 4DNXA 4DKJA 7MDHA 3P2EA 1AJEA 5GJWC 3EBOA 3UG6A 1FSSA 2F3SA 4V0MA 4X8OA 5TEWA 3QPVA 2YR0A 3WLIA 1IQUA 2P9YA 3GRCA 3OQVA 1QMPA 4KK3A 1CEXA 3IL2A 1OYYA 1PGPA 2FNAA 4R2MA 3PR1A 2GBCA 4QXOA 4OHZA 1NJ6A 3OCCA 4K86A 3R7LA 5U4XA 2DBZA 5FOXA 4MQ6A 3QJYA 3LPAA 1YZUA 3HKCB 3ZCRA 3F5MA 3W5IA 3F2IA 3EGOA 5BN3B 1RPZA 1LQTA 4M0PA 3W5HA 4ER6A 3IKMB 2CCJA 1RRMA 4E94A 1G0NA 5GM1A 1RJFA 1GZDA 4RD6A 2E6KA 3P9SA 1YR7A 4MV5A 1EK1A 5CYGA 1BE0A 1BW9A 3DZHA 1VSUA 4KIFA 2Z04A 4EUEA 3PJRA 1E9SA 1JR3A 2IGTA 1DBSA 3FCCA 4UHCA 3AERA 3W6OA 1Z6XA 1EZ4A 5AJZA 4DCCA 2P6PA 3OESA 2A0XA 3L4EA 2A35A 4HH0A 4RENA 1J0DA 1JQBA 3BXGA 3CWQA 5ESXA 4ZJUA 1U2DC 1DQNA 1HT0A 1JSLA 2B20A 4RK1A 2JEYA 1AC5A 3UF0A 2HGZA 2OXEA 4WTOA 1T25A 3DQQA 3EXFA 1CEYA 5ECDA 1N0HA 1RAHA 4QOEA 3ZZ1A 1JAIA 2HV9A 2IY7A 2AE1A 2PX2A 1JHRA 1C0KA 1H1TA 3IURA 3S1SA 4ARZA 2K5UA 3FUUA 1G20A 4NU0A 3T1NA 3WBBA 1NG9A 5HDQA 3A6EA 2G1JA 4PZCA 4AZ0A 1F8UA 4B0PA 2XVZA 4B40A 1YKSA 4BTVA 5GZ6A 4DWVA 5CVTA 5JJBA 2IHUA 4M1KA 5FT9A 4X60A 4V1CB 5HYVA 1XVIA 2J09A 2GKSA 3AJ9A 3T06B 1VI5A 3UUEA 1E3LA 1UEXC 3QLVA 2OYRA 2MSCB 4YV2A 1Q15A 2XYRA 2D0OB 2GJKA 2ISSD 2C97A 2N42A 3DMTA 3ILSA 4RXUA 4KIGA 3M2PA 5IJAA 3SKYA 5BNZA 5CD9A 1ZA2A 4ARSA 2FRXA 3U4QA 4JU9A 3GZTB 4DMKA 5B6JA 4U9IS 2PLWA 2IYUA 1HXHA 3OZGA 5CM8B 3TR6A 1JRLA 1VXRA 2JD2A 2EV9A 1PWZA 2J0VA 1XF9A 2BE7A 3K0BA 2P2YA 1IBSA 4J6EA 3EXHB 4XD7A 3V4FA 4BZZA 2HGSA 3UT5A 1RXIA 3CX8A 3AF4A 4BFZA 3GT3A 4DQ0A 5J5AA 4GPTA 1OCEA 4G8BA 3NUGA 1KDYA 4JL5A 1LV7A 4YCMA 2YHSA 3ZU4A 2AGVA 2G07A 3M7IA 1YSCA 2J6BA 4FQ8A 4KFUA 3A4YA 2Q3FA 5HGJA 5A03A 5LLTA 4JUIA 3PJGA 3N2GA 4MS3A 1DQSA 1OU0A 5KHLB 1E3JA 1GGEA 4NCBA 2GPAA 2WDZA 1VI6A 2LR0A 5AJWA 5KTSA 1H4SA 1ZU5A 3RRBA 3HL4A 5DX8A 5LNK6 3WK7A 1DCTA 3E1KA 1GDHA 3E58A 3R3YA 1KF0A 3S7TA 4JVSB 4CEHB 2QG6A 1V4NA 1XFDA 1KYVA 1RJ9A 2AG1A 1TRHA 1Z4QA 3Q1KA 4ND6A 1E6WA 4ZOCA 2V6GA 2CXOA 4BC0A 5HVNA 3ANLA 5K99A 2ZIXA 2EGGA 3JQCA 3EY4A 4YIKA 3GLIE 2REXB 3DE2X 1A9SA 2VT7A 5IH3A 2WSBA 3D5TA 3MGAA 2Y77A 3HV0A 1QYVA 1KOLA 1EUDB 1IVSA 2NVWA 2ZIUB 2PS1A 4UQPA 3EEBA 3HY4A 4L15A 5D51S 5CDYA 1KO4A 3PF9A 3I5AA 5LMZA 3Q9LA 3ND6A 1L1RA 2J4FA 2Z83A 3AHHA 1QGYA 4D3FA 5C35A 4QJ3A 2FK7A 3V00A 1J1IA 3T5AA 1TAGA 3T5TA 2FSUA 4L0QA 4E4YA 1RYFA 5JBIA 3T41A 4GEGA 4NPHA 4Y9TA 3A2MA 3DHYA 2VL7A 2B7LA 2HIAA 3HVJA 2E9SA 4CKBA 2AFIA 1R9JA 2Y93A 1SXJD 1XU9A 3ZC3A 1LQUA 5CXXA 2VTVA 1X1TA 4X1OA 1OLSA 3GA5A 4XDGA 2ZM5A 5IAGA 3R3UA 1E1MA 4J0FA 3VR4D 4D0LB 5L4LA 3FPBA 3VVLA 4F46A 1Q2XA 1Z13A 3DTYA 3N74A 3C2QA 4DDKA 2GTIA 4LAFA 1PWEA 1CT9A 1H9AA 1MOSA 3Q87B 1KQPA 5C8ZA 3TLAA 1GPKA 5K4HA 4NS4A 4WFQA 1Y4SA 3N70A 3PWSA 2HL6A 2RBEA 3NHLA 4EHLA 3D7SA 5K9ZA 4WBXC 1SBCA 1ZGJA 2C58A 3AHIA 4X1IA 4CL3A 3GJQA 5AVXA 4MVJP 1RZRA 2WE7A 4D0NA 1DGQA 4Y2YA 1KFJB 4KQCA 2DSTA 1QYDA 5BYAA 3O2QB 2RGWA 2YZNA 4BQIA 1BDJA 5CA0B 3PQ5A 1TMKA 4MUGA 4OH1A 5LBTA 4B8ZA 3FRIA 4CDRA 4XQEA 2JGKA 1VZ3A 3HWX1 4RVCA 1JSXA 4A0SA 3NHUA 2RGRA 1WY5A 1T2DA 4HWSA 2ZB2A 3UO8B 2BMJA 1JXMA 1KZ9A 2GEKA 1VRWA 4IIJA 3HRKA 1PR9A 1CNMA 2BGNA 4DC1A 4DM7A 1WJGA 2R79A 3D9QX 4IGIA 4GL2A 2J5KA 1WLSA 4R8LA 4DCJA 3ZJ5A 1JA0A 3CLTD 5TC4A 2H1WA 4QQNA 3WL5A 2PNFA 4YCNA 1FYWA 2KX7A 3T35A 1SC3A 3ZHUA 2Q7XA 4B84A 2ONKA 4LBYA 4N6GA 4AIRA 5CFQA 2JGDA 1X77A 3RHTA 5H02A 4BVBA 1IJEA 3QOYA 4M0LA 4MIKA 3F71A 4YMTA 2O8BA 2EKQA 4RELA 1G16A 3RD5A 1S2DA 4ZN6A 5L3QB 4KOAA 4MWCA 1PJ8A 1RKUA 1EXMA <