4KWIA

The crystal structure of angucycline c-6 ketoreductase lanv with bound nadp and 11-deoxy-6-oxylandomycinone
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
252
structure length
252
Chain Sequence
GNLTGKTALVTGASRGIGRAIAEKLGYAGALVAVHYATGADAAAEVAESIEKDGGRAFTVKAELGVPGDVDVLFEGLERGLKERTGATDLDILVNNAGVMAMGAPEEVTPEMFDRMMAVNAKAPFFIVQRALSVMPDGGRIINVSSGLTRVASPDQVTYGMSKGALEQIALHFSRHLGSRRITVNSVAPGSTDNGSALFQIPEVRETLSQLSTFGEVAEPAAIADVVAFLASEDARWITGAFIDASGGTLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reductase homolog
publication title Structural and functional analysis of angucycline C-6 ketoreductase LanV involved in landomycin biosynthesis.
pubmed doi rcsb
source organism Streptomyces cyanogenus
molecule tags Oxidoreductase/antibiotic
total genus 89
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4kwiA00
1BTOA 2C7GA 4B4VA 3TDKA 4YT8A 4R4JA 2A4KA 2O7QA 1Y8QA 2Y05A 3ONEA 3O8QA 2CDCA 4RL6A 4IMPA 4ALNA 4IQ0A 1NXQA 3LLVA 5JCJD 4J2HA 2JAHA 5CAEA 5KVVA 3AOGA 3H65A 3KM0A 4KTVE 4NPCA 5DF1A 1I2ZA 3B1KA 4BNZA 3P19A 2A9FA 3UFXA 1AXEA 5A5EA 1Z7EA 1ONOA 2ET6A 1Y6JA 3W8EA 1HYHA 2CD9A 1VKOA 1NYTA 1ZFNA 3OP4A 4RF4A 5KWEA 5KKCA 1QG6A 3ZDFA 1DJNA 2PZMA 1ZMTA 4MVJG 3TPCA 2DVMA 1HKUA 4M86A 3DQPA 4Y98A 4PLVA 1P0CA 4BGUA 4INAA 1M67A 4E4YA 2VRBA 4W82A 3NTQA 3S8MA 2VZ8A 5CDYA 4A73A 1I33A 1SZJG 3ON5A 1ULUA 2YV3A 3K31A 2VRCD 1K89A 4GMFA 2DC1A 1E77A 1N7HA 4Q3BA 1GTMA 1R0SA 4MIOA 3RQSA 3ST7A 1KETA 2QZZA 1M66A 3BYZA 3E9MA 1X15A 3OQ1A 4OM8A 4XRRA 3ZWAA 4R41A 3TOXA 1GYPA 3SC4A 3EDMA 2P5UA 3MJ4A 3DBVO 5CEJA 1U8FO 5KIAA 2PGDA 4JJFA 4DYDA 3FSRA 4R68A 5ENDA 1I01A 1RYDA 3GLQA 4HXYA 1GPJA 5I7EA 3S2GA 1PZHA 2HQ1A 4A10A 1H5QA 2GN6A 1EUDA 3H9UA 3JD3A 5EPOA 5G4LA 1BXGA 4MKXA 4PRKA 1B8PA 5LC1A 1Y1PA 1E3SA 2HJRA 3GHHA 2VHYA 2PH3A 2VWPA 1ZK3A 4IDAA 4L4SA 1L1FA 3DHYA 3VZRA 2UAGA 3W4IA 1D3AA 5G0VA 3RC9A 1FDSA 3VKVA 4DYVA 1SBYA 3ZNPA 3QJ5A 4AJ4A 1R0LA 1Z7BA 5T64A 1FF9A 3LF1A 2D5CA 1MG5A 5EIOA 4FGSA 1X13A 1MLDA 3DOJA 3WGGA 5C37A 2VHZA 4B4WA 3UW3A 1ID1A 4FFNA 3DZKA 3GNQA 1YE3A 1I2BA 4BO1A 2G1UA 3CEAA 3IP3A 3OQBA 5EN4A 5DBFA 4OKIA 2DUUA 4DGSA 1ZIDA 1GL3A 3ZV5A 2C5AA 3WS7A 3WR5A 1J49A 1EQUA 2C2YA 3JQFC 1NPYA 3KSDO 4CLOB 4FB5A 2BH9A 1V0JA 3JD2A 3PQDA 3BTSA 4FPXA 4CM5A 3VDQA 4WCFC 1U28A 3L6DA 4FJ2A 1BWSA 2ZTVA 3I83A 4MP8A 3UCFA 4BMVA 4WOJA 4GX5A 3BMQA 5B37A 3NEPX 1TT5A 4ZQFA 3IJRA 4IUYA 5U4QA 1Y7TA 4CR8A 1HYEA 4YRDA 2IZ1A 5K6AA 1BVRA 2NACA 4PIVA 1GCOA 2RCYA 1LDYA 3LC2O 4IS2A 3WMXA 1IZ0A 1HRDA 4YCAA 4YVFA 4D41A 3DZBA 2EGHA 3JQ7A 1DRUA 5JAMA 3KETA 3QWHA 3UGKA 1HZZA 1V8BA 1GQYA 1H0KA 1PL6A 2AMFA 1PGJA 2GYYA 3AY7A 3OQ6A 3NYWA 3GR6A 3QW2A 4I5FA 5F5NA 4DLBA 4XB2A 3LK7A 3S2FA 1CJCA 1FK8A 4GBJA 2VZ0A 3ZWXA 3JQAB 3GA0A 2E6UX 2E82A 5BT9A 3W4JA 4C4OA 3ZZNA 1JWAB 5JCXA 3AUUA 3U3XA 2O3UA 5JAZA 5JYEA 1K2WA 2Q49A 1VM6A 1A9ZA 2ZB3A 4U6SA 4XCVA 3WFIA 3I9LA 2VWHA 1EFLA 1K6JA 1MXFA 1UDBA 2Q1TA 2ZCUA 3V5NA 4AJJA 4B4OA 5JDIC 3AJRA 2Y0DA 3GK3A 2X0IA 4Y9DA 4JIGA 4XYEA 3BTUA 1A7KA 2FOIA 1ZO8A 2X4GA 4B7XA 1C1XA 2X23A 1NNUA 5B4UA 2EP7A 2H9IA 4TVOA 2B5WA 4LRTB 4NJMB 1O89A 2BHLA 3QVOA 3QQPA 3P2YA 1T4BA 2BGMA 2X5KO 5JS6A 4OXYA 3JQ8B 3RC2A 3TFOA 3ONDA 4XJSA 1K6IA 4B3HA 5DZSA 2R00C 2QZ9A 5JO0A 1KVUA 3D4NA 3PZRA 4R1NA 3G0OA 2QYSA 2UV8A 5HS6A 1NBOA 3ANMA 3PI7A 2X9NA 1E6UA 3AW9A 3GG9A 3KEQA 2JCYA 4HFJA 5JO9A 5TNXA 4RDHA 2VOJA 5AXBA 1YH3A 2FSVA 2X9GA 1UZLA 3T7EA 3ZU3A 3VHRA 3RJ9A 1X7GA 5JE8A 4GX2A 2GCGA 1I3LA 4BGIA 2B37A 4XYLA 4RJTA 4FC6A 4K28A 4P8RA 1EZ4A 2RIRA 4CLDA 1YVEI 1ZVMA 1NP3A 2OP1A 1AXGA 1E3JA 3IOYA 4EW6A 4BNGA 3KVOA 1VJ1A 1F17A 1ZJYA 4NG5A 3FNHA 3DHEA 1Y8RA 1JA9A 5TT1A 3RSHA 1LQTA 1JW9B 3DZFA 3UOGA 4XA8A 1BG6A 4QTZA 3WIDA 1QLJA 5BNFA 3GGGA 3ADPA 1LDBA 4XDYA 8ADHA 1XIVA 3G1UA 1O95A 4DC0A 3LSYA 3CMMA 1JAYA 3IP1A 2QRLA 4BNYA 1XG5A 3KEOA 1XA0A 2J3IA 3STHA 3JQ6A 1QV6A 5IDXA 5I7FA 2PD3A 1CYDA 3FPCA 3JYOA 2FY8A 3BHMA 3W6ZA 3I6QA 3ITDA 2Y1EA 5HS4A 1LC3A 2CF5A 1WPQA 3K92A 3F47A 5T8KC 2HCTA 5A4DA 1E3IA 4BO3A 1ZXLA 1P74A 4MP3A 1NTOA 2DBVO 2LDBA 1BVUA 1HL3A 4BO8A 1DEHA 2W2KB 1MGOA 1H94A 2QRJA 4J7UA 1O0SA 1V9LA 4QO7A 5IFLA 3LZ6A 2X6TA 4DPLA 1C1DA 4CQMB 4ND1A 3N74A 1I24A 4CM1A 3RU7A 1TT7A 3AY3A 1VE9A 1HDXA 1XKQA 1YL5A 3DC2A 5ES3A 1SPXA 3PJDA 4CQLB 2P4QA 4D0RA 3TWOA 1F8FA 4J1NA 4TROA 1FDTA 2P68A 3D5TA 2Q2VA 3QVWA 4MKRA 5L45A 4E2XA 1E1MA 4JBIA 3KV3O 5IXYA 3WMWA 1IPFA 4Y6PA 3U9LA 3CSDA 2QG4A 4ALKA 1DIRA 5JPIA 2I6TA 4BNNA 1TXGA 3IKTA 5B4VA 4Y6SA 4N5LA 3FBTA 4YQZA 3H2SA 3F1KA 1X7HA 1RKXA 3NGLA 1UAYA 4JP2A 3A14A 2DUWA 1U3VA 3EMKA 2WD7B 3PGXA 4YB8A 2NVUA 2O3SA 4BIIA 2VQ3A 3IAHA 2BFPA 3B20A 2WYWA 3RUIA 1HE5A 2PD6A 1SC6A 4R5MA 2OFPA 3DO5A 3A06A 2CUKA 3RUFA 4ZA2A 1LDNA 1X0XA 1QLHA 2RBEA 3NGXA 3PLNA 3Q6IA 4DC1A 1E3EA 1KY5A 4YT2A 4NZ9A 4YAGA 4L8VA 4HBGA 5JMPA 4BV9A 3E18A 3Q3CA 2WJPA 2PGJA 4QFCA 1ENPA 3WWZA 3CE6A 3HG7A 4EUFA 3CIFA 1IHXA 1V6AA 1J0XO 4TMFA 1NWHA 4OQZA 3QWBA 4OIMA 4IQGA 1R12A 1GADO 3QHAA 3WYEA 4JQCA 3IKVA 5GZ1A 1L7EA 3M2PA 2ZYDA 3QRWA 3VTFA 2NLOA 3SXPA 3ROQA 1XU7A 2EJVA 3GEMA 3JD1A 4DBZA 3OIGA 3E6AA 4E2YA 4M54A 3KBOA 4CMGA 2IYPA 4NBWA 5CP8A 4E5MA 3ZHYA 1DC5A 1EK6A 2HK8A 1Q7GA 2NV6A 2Z1MA 3ENKA 1U3WA 4GWKA 3TN7A 4IDGA 4UVHA 5ADHA 1O8CA 4BO5A 1KYQA 1UJMA 2RH4A 3BAZA 1IE3A 3F46A 4Z3DA 3K9QO 1GV1A 1UP6A 3M1AA 4MDHA 7ADHA 4PZDA 5FYDA 2Q1UA 2AG8A 2F1KA 2AG5A 4LRSB 4ND2A 2GN4A 4E2WA 2YQ5A 3VPFA 4AVYA 3UAGA 4D7AA 4CUZA 3KYCA 3H3FA 3VKUA 4UUPA 1JDJA 3EVTA 3D7LA 4RDIA 1RJWA 3I4CA 5AXCA 1QRRA 3W8DA 1YONA 4NHEA 4LVCA 1DHTA 2Z95A 1OI7A 4WKGA 3HDJA 2AEFA 4NI5A 3PFWO 1AHHA 3G79A 1OFGA 4ZHSA 4GVXA 1LSUA 2OUIA 3S55A 4HNGA 3EW7A 3QY9A 5BSEA 1AHIA 1UP4A 5DBIA 4K6CA 1HEUA 3GY0A 1QORA 4ZQBA 5ILOA 1YB5A 3Q1LA 1DDOA 1EE2A 3TRIA 4BUCA 2UYYA 4IJKA 1O94A 4HV4A 5C7OO 1AE1A 3FR7A 3RJ5A 5L7WA 1C0IA 4LISA 4NQZA 1UDAA 1PJBA 1LNQA 1T2CA 1U3TA 4M89A 3ZNQA 1MC5A 3PHJA 3V2UA 4CMIA 3GFGA 4NIMA 4JX8A 3PIIA 3DZHA 3VZSA 2C54A 1B8UA 2OP0A 4NH4A 5K9ZA 4GLOA 4TVBA 1LEHA 4O5OA 3IC5A 4RF2A 2W2LA 4D3FA 4NNJA 3C1OA 3QIVA 5TJHA 5FEUA 1FXSA 1JKFA 1NQTA 4YJFB 3MTJA 1S7CA 2PKQP 3OEYA 4J16A 1E3WB 3F4LA 1Z45A 3PZBA 4R16A 4YJHB 4DPKA 3PJGA 4J7CA 5L53A 5EINA 4MJLA 4O6VA 4W6ZA 1GUZA 4HY3A 3NDIA 5L4NA 2NSDA 3FNFA 2IZ0A 3Q0EA 4P4GA 2FR1A 5LDHA 4FGWA 2NU9A 4Q3AA 4Z9FA 2I5PO 1KEWA 2PZKA 1NVTA 3ABIA 2B83A 3WNVA 3TZQA 2EKPA 4A26A 1X0VA 3RCBA 4FOSA 2X0RA 2YDXA 1DXYA 1YOVB 1LLUA 3RROA 4BO7A 1PSDA 3V1TC 1LRLA 3GHYA 3ZWYA 2XPCA 3GVHA 1PJCA 2I67A 3X2FA 3JD0A 1WVGA 1PX0A 3C24A 5F1OA 3PYMA 3U0BA 4Y6RA 3EHEA 5K6AC 4CM9D 3KOUA 3JQGB 2CF6A 1ZEMA 1PJTA 5TX7A 4MVJA 2FZWA 1DIAA 4IIUA 5CFZA 1CETA 2E49A 2VT3A 3ZWVA 3GFBA 5ER9A 1LC0A 1NVGA 3GAZA 4HWKA 3VPXA 1XU9A 2C29D 4D42A 2C2XA 2CVOA 2QIOA 4BNKA 4MVJF 3UUWA 4E21A 4JBHA 3EYWA 4ITUA 4BOYA 4GAEA 2JD0A 3X2EA 2BI8A 2OORA 4UAGA 1RWBA 1WNTA 1EBUA 4HADA 3JQBC 5C7IO 4AJ2A 1U3UA 1WDLA 4NU5A 1LRJA 4RZHA 4PCVA 3JQAA 4ND5A 5FI5A 3KZVA 1UXHA 4CMAA 4BNXA 5CDSA 3G49A 5EJ2A 1T24A 2ZJ1A 1HDYA 3U4CA 3WLFA 3DTTA 2VNSA 3TL2A 4ALJA 1IOLA 3I4FA 4G65A 2PK3A 1MB4A 3NT2A 4Q9NA 4XB1A 4CR7A 3NRCA 3VVBA 3OEWA 4AJOA 1B2LA 3AFMA 3AY6A 1YRLA 1X1EA 1D4FA 1W73A 3WQSB 4MVJE 2W4QA 1DO8A 1QYVA 1I8TA 1R0KA 3NT4A 3U4HA 2J8ZA 3CH6A 3PGJA 5GZ6A 1O6ZA 2C82A 2NTVA 3F5SA 3C7CB 3L6OO 1CF2O 4NJMA 1OC4A 2PGLA 2WDZA 1GQQA 4PLYA 5KOIA 5G2OA 3SLGA 3PWKA 4PG8A 4RPLA 4R69A 4GGOA 1LTHR 5CG2A 3HB4X 2GZ3A 4GSLA 1B16A 4IJWA 3LC7O 1ZNQO 1HF3A 1E1KA 1B3BA 4B7UA 2JKVA 4QUKA 3LU1A 4I5EA 3R0IA 1CEQA 1D7OA 4NFYA 2IXBA 2ZK7A 2OZPA 3ZGYA 4J1QA 4Q3NA 4WCFB 2UVDA 3FI9A 2AEJA 3I52A 1RM4A 3S1LA 5JBIA 3OECA 2HKIA 4IDBA 4I08A 5FWNA 4TZTA 4BNLA 1LJ8A 2GNAA 4XGNA 4XRGA 2ZQZA 5AXAA 2DFDA 3GVXA 4CLRB 2EW2A 3VH2A 4MIYA 3OH8A 3K5PA 1GY8A 1UXGA 1A71A 3GG2A 3HDHA 4QECA 2J5RA 4ROSA 4KP7A 3E48A 4ALLA 1YB1A 4KDEA 1IPEA 2P2SA 5T57A 4CM6A 9LDTA 4JJIA 2BMAA 3FWZA 2Q99A 5IDWA 3A28A 1HE4A 4WPGA 2OBNA 3DDNA 2VNAA 2E37A 4XIYA 3W6UA 4CM4B 3WICA 1P1FA 4C7JA 1Q2XA 1X14A 4CMHA 2XF8A 5KCZA 1JVSA 3SLKA 4CM7A 4D44A 3PFFA 5DDIP 4AJNA 3E5MA 4B7CA 1M2WA 3GGPA 1P1KA 1P31A 2YHUA 4OXNA 2VWGA 4FJ1A 3GNTA 5BSHA 2Q50A 4B3JA 4JLWA 2CFCA 4LVUA 3PHLA 4M8SA 2C7VA 3LF2A 5GZ3A 4IZHA 3OJFA 4W7IA 4ZQEA 3H9GA 5A06A 1KVTA 5JSFA 4QO8A 1H6BA 1JWBB 4J1SA 2NU6A 1NR7A 4ND3A 3NAQA 2JL1A 2HK7A 3Q9NA 2B36A 3ZV3A 1NHWA 4BO6A 2W2KA 3I1JA 4MVJI 5F5LA 3WB9A 4WASA 1PZGA 4L4RA 5A9RA 5CEFA 1DB3A 5CDGA 4HFRA 2AE1A 3NUGA 1PGNA 5AQ1A 1W0CA 3DOOA 1N5DA 1LLDA 4ZRNA 3WQQA 4CQMA 4XIJA 4J6FA 4DQXA 1XWFA 4XYMA 1Q1NA 3FCOA 3DFZA 4CQLA 3GN1A 4WECA 2Q4EA 2CY0A 3ZU2A 1ZK0A 1ZBQA 4L4XA 1Q0LA 1E6EA 5THKA 1UXKA 1UXIA 1WMAA 3C8MA 2VUUA 4RVHA 5K0ZA 1Z74A 5IDYA 4XQCA 5LDGA 4TKLA 1ZXBA 2W8ZA 4BNWA 5JDCA 4A5OA 3P5SA 3OJEA 1KVQA 1EVIA 1H2BA 4DLAA 1GDHA 1HWYA 3TJRA 4FDAA 4ZRMA 1WAMA 1IZ9A 1ZSYA 2Y99A 2BLLA 5A9TA 5JLAA 5J23A 5JMWA 2IEDA 3D0OA 4FFPA 1ZSNA 5ENVA 5TQVA 3SVTA 2HJSA 2WD7A 4XWYA 2IDZA 3L9XA 1J4AA 3SC6A 4BO4A 1JQBA 4E31A 4QFDA 5DULA 1B0AA 3ZNOA 5IZCA 1VL8A 1C3VA 2ZB7A 4OHUA 2PLAA 4BQRA 3L0DA 1P44A 3E9QA 2IXAA 1ZK1A 4ZD6A 4CV3A 3TQHA 2JD1A 1VRWA 3CMCO 3DXFA 3OM9A 4FIZA 3HUDA 2I9PA 3C7DB 3VAZA 1DIGA 1QR6A 4A2CA 2HDHA 2Q3EA 3VTZA 5CDUA 3ROKA 1JKIA 3PEFA 1ZUD1 4D46A 5JNLA 2VUSA 4E6PA 4Q39A 1ZSVA 4WLOA 3WTBA 3JD4A 4WLFA 3ANLA 1QSGA 1OMOA 2Q1SA 4Z6KA 1U7TA 4D45A 2YJZA 4LMRA 1NFQA 4TRNA 5TGDA 3V2GA 3PWZA 4BB6A 1ZK2A 1GR0A 4D3SA 1UH5A 3ONFA 4R1TA 4YR9A 1GZ3A 1UDCA 1YBAA 4GVLA 4ZU3A 4P4LA 1RPNA 4KMSA 1HDOA 3H2ZA 3WGTA 1PIWA 2BELA 1KY4A 3WG9A 4PRLA 1SOVA 1A72A 4PVDA 4WLNA 5G0SA 5CG1A 2I3GA 1ZW1A 2Y0CA 4WNIA 4RVSA 4B8WA 4FOOA 4RQUA 4LCJA 1EFKA 1JN0A 3NJ4A 4XDZA 3VH4A 3EC7A 4FS3A 4QEDA 4YJGB 5L40A 4XX0A 3MTGA 4NK5A 3IQDB 2OL4A 1EK5A 2ZJ0A 4R1SA 2BI7A 1TA4A 5A1TA 1BW9B 4UEOA 5H81A 3ZU4A 1EVJA 4BNTA 1V35A 3VH3A 1YDWA 1ARZA 4WCDA 3KYDB 1ENZA 1I10A 2WSBA 3AI1A 2GO1A 1PL7A 2YY7A 3GQVA 2OXIA 1Y5RA 4IM7A 3GDGA 4XKJA 1WMBA 3P7MA 4OSPA 2G82A 1A5ZA 3HZZA 1QKIA 4NFSA 5MDHA 4L0QA 4CODB 2PA3A 2HO5A 4IJVA 3EVNA 4E5PA 1BRMA 5DCWA 2I65A 4KZPA 4R9SA 4DIOA 3WGYA 4TRMA 3KLPX 2A94A 3FWNA 5CDTA 4R9RA 3Q9UA 3BMNB 1VJ0A 3QP9A 3K8ZA 2P91A 3AM3A 3HJAA 4U8GA 3I3OA 1TLTA 1U2GA 2BGLA 3ETDA 3ITKA 3Q2KA 3DMTC 3H9JA 5U1PA 5JYDA 4Q3CA 4MVJH 2WMDA 4J0FA 4XQEA 1W8DA 2G0TA 3PDUA 1SCUA 4Z3KA 2DBRA 2RAFA 2CDBA 1DRWA 3B70A 4W9NC 2D1YA 4RVUA 1UAGA 4F3YA 2PNFA 3QVSA 4YJFA 2CVZA 2X8LA 3UCXA 1ISHA 4UEKA 4C7KA 4BNHA 3G3EA 2VYNA 1P3DA 2RHRA 4YJHA 1I32A 4NU6A 3T4XA 3ZHBA 4BNUA 1PGQA 2GPTA 1Y8QB 5BR7A 2VHXA 3MEQA 3S2IA 1E3LA 4BS9A 3ZW9A 4B4UA 4KUGA 2NQTA 1UZNA 3N58A 2IZZA 4Y67A 1OBFO 4O63O 4YA6A 3NDJA 5CHEA 4N54A 1HYGA 2Y0EA 1A4UA 4XQGA 4MP6A 4BKOA 5L4LA 4FFMA 2VYVA 4PLFA 5I7VA 5KJCA 4TSKA 1N8KA 3HN2A 1DC4A 4QXMA 1TEHA 3RUEA 2YV2A 2XOXA 3VPHA 1C0LA 1A27A 1ZJZA 3ZWOA 1LXCA 1DSSG 3OSUA 5H83A 2WE7A 3W4KA 3AOEC 1PQUA 2EV9A 2QQ5A 2X1HA 3B1FA 1QMGA 3F1LA 4XGKA 4FSHA 2ZQYA 2JCXA 2O7SA 1SEVA 2EWMA 3AUAA 3GVPA 1YGYA 4J4BA 4CPDA 4DWVA 3K96A 5HWSA 1PJ2A 3COSA 4OYRA 4BO9A 1EVYA 1BDBA 3OMLA 4FFRA 3WFJA 1ISMA 3GRKA 2A35A 3DBHA 3OF2A 1E5LA 3ICCA 4A27A 3H3JA 1NPTO 2ZATA 1PGPA 5IG2A 1YQDA 3OA2A 4ILKA 5EQDA 1P1IA 4BMNA 4EYEA 1KS9A 2DU8A 2IYOA 1PS9A 4MVJP 3H5RA 4Z0PA 2DFVA 3PWSA 2NVBA 2V65A 1UP7A 1T26A 3I6IA 3NTOA 3WGZA 5F3RA 3PYXA 3FD8A 1EDOA 1BXZA 2J5QA 5B1YA 4PG5A 3HFSA 1O5IA 2EP5A 3QWFA 2DTDA 1Q7CA 4U0KA 3JQ9C 2VHVA 4PFJA 4Z0TA 4FFOA 1VL6A 4KDFA 1T1RA 1CDOA 2Z1NA 3GPIA 1W6UA 2Q2WA 1U9JA 1JU9A 3RKRA 3UKOA 5G4KB 2NU8A 5JCJA 4F6LA 3TF5A 1DC6A 1DOHA 5B4TA 2O3JA 3DBLB 1PEDA 4UVDA 2P9EA 2NTNA 4LK3A 3QWAA 2ZB8A 5DCUA 5L4SA 1DAOA 4OOEA 2AE2A 2WD8A 1LDMA 4YDRA 4YRBA 1MV8A 4HUJA 3WSWA 2IE0A 3FBGA 4ZVVA 3UF0A 2YYYA 4XD2A 4OKNA 4BVAA 4F6CA 4FQ8A 2PD4A 6LDHA 2VWQA 1S6YA 3PP8A 1FDVA 1SO8A 2CZCA 1LBEA 4CLHA 2Q4BA 2HRZA 3FTPA 3MJCA 4ALMA 3GDOA 4DL9A 4KWIA 5JAQA 4XQ9A 3ZHZA 1HZJA 4JN6B 4YAIA 1LRKA 1DAPA 4E30A 4WCFA 2VRCA 2ZIZA 3ZWBA 4B3IA 5I8WA 3WSVA 4IY1A 1KBZA 3RAJA 2PV7A 4OQYA 4RV9A 3OJLA 3JQ7B 4EJMA 4DMMA 1HDRA 2HSDA 1U8XX 1MFZA 4DIFA 1IB6A 2I66A 4RGBA 3RUCA 3WYCA 1N1EA 4CLRA 4NBTA 1R4MB 3B1JA 1PZFA 4PN3A 4RO0A 4UUOA 4W99A 4AJEA 2BD0A 4YXFA 1V3UA 4L76A 2FMUA 4PZEA 3ZI0A 2VCYA 4EJ0A 1G0OA 4I9NA 2ZYGA 5CEEA 3ZW8A 2VTDA 3GMSA 3ULKA 1B3RA 1U5CA 4UUNA 1U5AA 3DAGA 2FPPA 4BNMA 5TC4A 2GZ2A 2X58A 1U7HA 3LT4A 3JYNA 5I7SA 1E0DA 3JQEA 2O48X 4CM4A 1V3TA 4HKTA 5KJ1A 1F06A 5L95A 4A7PA 2YHIB 3VZPA 4EUEA 3NDRA 2YW9A 4O1MA 1YJ8A 3CXRA 1ULSA 2JD2A 4JCOA 1KEUA 5A9SB 3A1NA 4WJZA 1FMCA 3HHPA 1HDZA 2VHWA 3G17A 3R1IA 2Y93A 2IODA 2HAEA 3W8FA 3WWYA 5KNLA 1Y5MA 3VC7A 1GCUA 4H3VA 3RUDA 3PTZA 1DLIA 2XXBA 3PVZA 1E6WA 4EBFA 4CMEA 4P38A 2GSDA 4I1IA 2HMUA 1JTVA 3AUTA 4YJDA 4XR4A 3OA0A 2JHFA 1UZMA 5EERA 4XYBA 2X0NA 5C7LO 3FF4A 3QE3A 3L77A 3CZMA 3ETGA 4CJXA 1HLPA 2ZTLA 5TIIA 3PRJA 1YKFA 1SB9A 4U0JA 1OOEA 3BHJA 2O4UX 3R6DA 3OICA 3WJ7A 3BZUA 1E7QA 2QHXA 2AQKA 2BKAA 1QV7A 2DBQA 1ZCJA 1B26A 4BNFA 2R00A 4IINA 4ZN6A 1JLLA 5GMOA 4U6QA 4U7WA 1YL7A 3IS3A 3JYPA 3K73O 4AJHA 2FPGA 3IIEA 3RBZA 1WXDA 4G81A 1FJHA 4XJTA 3PQFA 2Y1DA 5A5FA 3GPDG 5JAIA 1Q0HA 1N1GA 1WP4A 1A9YA 5T6BA 5AVOA 1I3MA 2FSSA 5TF4A 5BSGA 1MX3A 4L9RA 1GYRA 4TZKA 4I5GA 3GN2A 3LVFO 4WLVA 3PLRA 4J4HA 4IDEA 1SMKA 1XR3A 2CSUA 2ZCVA 3D3WB 1IUKA 1WDMA 2AQ8A 4A03A 2X0JA 1ADFA 3E1KA 3ICPA 4XEHA 4WEOA 4AJPA 1LSSA 4CR6A 4DBVO 5EESA 4K26A 3FR8A 1DFIA 1HSZA 3I9JA 3C1AA 3K2BA 4WGGA 1DIHA 1Y9EA 4CLOA 3HWRA 4JXKA 4CV1A 1MP0A 1PQWA 1VL0A 2FHSA 2PTGA 1PS8A 4UEJA 4UULA 4DXHA 3GF4A 2B35A 3AM4A 3NX4A 5TS3A 1NQAO 2GASA 4IXTA 4RPJA 1HSOA 2EHDA 3ZCXA 1NHGA 3F4BA 4KTTE 1F12A 4J49A 1SB8A 4CLXA 2VTEA 5U9CA 4HX5A 3ZNNA 3IUSA 1Q0QA 3V8BA 5JY1A 1ADCA 1GEEA 3KB6A 3KRTA 1NX6A 1YJQA 3W1VA 5F21A 3AU9A 2NNLD 3BA1A 1F0YA 3NJ8A 4TWRA 5T8KA 3UH1A 4RZIA 1EEHA 3GRPA 4I9HA 4I8XA 2I3AA 4S3MA 3LDHA 3QV1A 3BIOA 2VYND 3AK4A 2WEKA 3JSAA 2RH8A 3LQFA 1YL6A 2DTEA 1BHSA 1HETA 4J9VA 3KXDA 3RIHA 4IMRA 1VI2A 2WM3A 4TRJA 1XEAA 1N92A 4X54A 4EGFA 1ZKMA 1R16A 5KTKA 4EITA 2C07A 2C59A 1LLCA 2IEBA 3U09A 1HT0A 3UN1A 1NQ5A 2B0JA 4OJNA 3FPLA 3L07A 3PDJA 1LQUA 3BHIA 3I23A 4YJGA 5ER6A 3JTMA 3WDSA 1PWZA 4J2OA 2X9VA 3U49A 3GGOA 3MJVA 2NU7A 2HU2A 2UUOA 2GUGA 1BW9A 1C0KA 1LLQA 4R3NA 4R54A 5A3JA 1IHYA 1YQXA 4K1LA 1I36A 4IDFA 4E5KA 4F46A 2DLDA 3KYDA 4HNHA 2PKQO 4R3WA 1GZ4A 1NFFA 4BHTA 1KEVA 4YAEA 5COBA 3JQ8A 4BKUA 1I2CA 2PKRA 5L3ZA 4LSWA 1HE2A 5EMHA 1QP8A 5ITWA 4OSOA 2HLPA 4I5DA 2JHGA 5HM8A 2X5OA 4E13A 7MDHA 1LA2A 1WZEA 1EMDA 3I9OA 4M49A 1NAHA 5A04A 4RF5A 1U2DA 4NFHA 1PTJA 4BKRA 1QYXA 1GEGA 2GF2A 4UUMA 2O3QA 4GH5A 4R01A 3BMNA 2A92A 1H2HA 2NADA 1OC2A 1MA0A 3QWIA 4K6FA 3SJUA 3DWFA 4CUJA 2Y68A 4H7PA 2DAPA 3O9ZA 1KC3A 4D79A 5G0UA 4JP3A 4YAJA 1CERA 3ETEA 5IZ4A 1DHRA 3RFTA 3DONA 1WZIA 3LT1A 3VZQA 4MKZA 5COAA 3OJ0A 5I9LA 1I3NA 3HFGA 1PZEA 1P77A 5H82A 1O9BA 2V6MA 3M1LA 5ICMA 1MC4A 3ZWCA 4BNJA 2C5EA 4IDDA 5IF3A 1ENOA 3PPIA 1ISGA 1ONNA 2BFMA 3WTCA 3L4BA 1HE3A 4TQGA 4E32A 3R3SA 2JCVA 2Q1WA 4W4TA 2HUNA 4DVJA 1XLTA 4AJKA 4CM8B 2WYVA 3CTMA 3D1LA 1ADBA 2GR9A 3H5NA 2P5YA 5A03A 3GVCA 1G0NA 1QYWA 3NKLA 2DT5A 2C20A 1PU2A 2NVWA 3C85A 3FTNA 3GZ4A 2WWRA 4GQAA 4AJ1A 4DPMA 3KYCB 3RI3A 1MXHA 2CDAA 1YXMA 1B8VA 4HFMA 2FR0A 4CV2A 4IIVA 3EK2A 1Q7BA 3GOHA 4WLEA 3PXXA 4BNIA 2ZYAA 4FJ0A 1PJ3A 4PLZA 2NQ8A 2VOEA 5DOVA 1PS0A 1IYZA 4LN1A 3DBRB 4NBVA 3RC1A 3GEGA 3OETA 4RVFA 1H6CA 3TL3A 4Z9YA 4PLTA 1JAXA 2J3JA 5DP2A 1FDUA 1RYEA 2R6JA 1GUFA 2B4RO 2JAPA 4J90A 3IL2A 4YQYA 3RD5A 4IS3A 1D8AA 4NMHA 2YFHA 3B6ZA 3H8VA 2X22A 4AG3A 3INRA 5HA5A 4E33A 4YACA 4PG4A 4UVGA 1FDWA 4WUVA 3NV9A 4RLHA 4XR9A 4CMIB 5DCYA 3P2OA 2Z5LA 3RUAA 2I99A 3E8XA 5CPFA 3BMOB 4YYZA 3RFVA 2D4AA 1D1SA 2R2GA 2H5LA 1N9GB 3HQ4O 2FN7A 4FFLA 4Q3DA 2AEMA 4QX6A 4ND4A 1R15A 4M87A 3RC7A 5EQFA 4D0SA 4OH1A 4PGFA 3WBBA 1ZZEA 2EKQA 3WGIA 2ILTA 4GWGA 5JW6A 2FRDA 2V6GA 3RU9A 3F3SA 4J7XA 5F1KA 1GU7A 2QRKA 3JYLA 5TT0A 3KSUA 2O3RA 1P1RA 3H7AA 5HBRA 1XYGA 4GL4A 4ESOA 1QYDA 3WGOA 1T2DA 1BDMA 1NM5A 1DC3A 2JFHA 5G4KA 3WGHA 4XYGA 3IMFA 2D59A 4BKPA 3DBLA 3VH1A 5DN9A 3INGA 1XELA 3PHIA 3I9NA 4IBOA 1BXKA 3H9QA 4IXWA 3QVXA 4NBUA 4DREA 5ICSA 4BGEA 3MJTA 4ONEA 3F9IA 9LDBA 4CMCA 3UICA 1VLLA 2POQX 3TZCA 4E5YA 3JQCA 5IAAA 3MCVA 3NT5A 4GKVA 1VSVA 2D3TA 1HTBA 3H4VA 4IPTA 5G0WA 5KVSA 4E5NA 1C0PA 1N7GA 1GPDG 2W2LD 3GH3A 1EDZA 3KSZO 1M6WA 3L6EA 1LI4A 4YTEA 3TFQA 3UXYA 1ENYA 1SAYA 1K6XA 2GZ1A 3C1TA 5ILGA 4BV8A 1LX6A 3SEFA 3WIEA 5JFOA 1E1NA 1LU9A 2P9GA 4UVIA 3WBFA 2Q45A 2V7PA 3LYLA 1BSVA 1ISIA 1NFRA 2GD1O 3AFNA 1ISJA 3ENNA 1R4NB 3ZV6A 5TLSA 4GI2A 4DQVA 5IN5A 4BQPA 4DMLA 3RBVA 5BNTA 1W4ZA 2Q2QA 3L9WA 3VDRA 4II2A 3K30A 2Y67A 1R4MA 1CQJA 1YO6A 1MG0A 4N18A 1I30A 5HRUA 4YPOA 2YFQA 2QX7A 1NWCA 1Y81A 4Q3EA 4PLCA 5L7TA 5IXSA 4FBGA 2HMSA 4BO0A 3RVDA 3GVIA 3LLSA 5DP1A 5DNAA 5IDQA 3L4SO 4URFA 1K3TA 2FPIA 4DLLA 4RPHA 1T25A 3JQBA 1KERA 2AHRA 4B79A 4R51A 2EF1A 1P9LA 3VVCA 4K9DA 2X7HA 3GUCA 4CUKA 5A05A 2YHIA 1ZH8A 3BMCB 1LUAA 5I9NA 3H5AA 1IL0A 2J3HA 4GPD1 2AQHA 2P9CA 2CVQA 3FNGA 3DMYA 4FR5A 3U4IA 4RVGA 5A9SA 1Y9AA 3ASVA 4CMEC 3PJEA 1SOWA 2GN8A 4MVJD 3G1TA 3ADOA 3EUWA 5FFFA 3D4OA 4R1UA 5FI3A 3VPSA 4PLPA 5CPBA 2O2YA 1R37A 1PJSA 4O59O 1WW8A 2AA3A 4TRRA 1DRVA 5JXWA 3KYBA 3WXBA 3VOSA 3E03A 4CL8A 3GNSA 4KUHA 3HADA 4RLSA 1PJLA 3H6KA 1PL8A 4A0SA 4JBGA 1WWKA 1CWUA 2ZKLA 2LDXA 4S1VA 2OBYA 3DEYX 4YBZA 5DBGA 4JGBA 5C5IA 1C14A 2FR8A 3KUXA 2NWQA 3GZNB 1I0ZA 1GV0A 4GX1A 1LSJA 5JC1A 3JQAD 3MJEA 4U5QA 4R5HA 1T2EA 3JV7A 4ZICA 3U5TA 2HK9A 3HE3A 4CM9A 3D5QA 2DQ4A 1E3WA 4ID9A 4W7HA 2H1SA 3KTDA 1GZ6A 4RF3A 5BSFA 3WOHA 3ZU5A 4QQRA 4PLHA 3T4EA 1EUCA 3JCZA 3O8QB 4FC7A 1KIFA 4E2ZA 3CINA 3PYLA 4TKMA 1H93A 3NTRA 4AL4A 1GUYA 4EZBA 4PG6A 5C3MA 4PLWA 2FP4A 3MOGA 4XGIA 3INTA 5KJEA 1HXHA 2OOSA 8LDHA 1K0UA 4OAQA 1DPGA 5AYVA 2GLXA 3DFUA 3LT2A 1IY8A 3D3WA 3EGOA 3JYQA 1E7RA 2AQIA 4MOWA 1YOVA 1PGOA 2EG9A 2Y1CA 1TVEA 4G2NA 3T7CA 1GFSA 3OBBA 1V3VA 5I9MA 4CMBA 4ZQGA 1XSEA 3GMDA 3EY4A 3WQRA 3PQEA 1X7DA 1TB4A 1R66A 3A4VA 1N2SA 3TOZA 1PJ4A 1NQOA 2EEZA 2F00A 3ZWWA 1EE9A 3JQGA 5F1PA 4J9UE 3K6JA 4MPDA 4WK6A 4D3DA 3BXXA 4PVCA 2HRBA 1DJQA 3SX2A 4F45A 1SNYA 2PZLA 3DHNA 4NK4A 3MWEB 3IUPA 2Y1FA 4L74A 2DPHA 4M1QA 4E0BA 4CV0A 4IGEA 3UHAA 1EBFA 4CMKA 3WGQA 4CL3A 1EVZA 3AI3A 1H9BA 2QYTA 1YWGO 2ZTMA 4YWJA 5COQA 5DOZA 1Z6ZA 2D2IA 4FD3A 2X5JO 2BFOA 1P0FA 5TRTA 4BGVA 4J4TA 1M75A 2DBZA 2O3TA 2GGSA 1BXGB 4YAKA 1Z82A 1LDGA 1MFPA 4L73A 3CPSA 4IZIA 2AW5A 5FF9A 5L51A 3ZWNA 2QW8A 5HTOA 4RVDA 3QA9A 5L7YA 2BRUA 4BO2A 4PZCA 4AFNA 1Z73A 1T2FA 2PY6A 3D4PA 3WJAA 3RUHA 4IJUA 3KLMX 4P4NA 1XDWA 1F14A 1D1TA 2UUPA 4RPGA 3D3EA 3DZJA 4WOKA 1TI7A 4E3ZA 1WDKA 4KQWA 1VSUA 2D0IA 3F5QA 2I76A 3AM5A 5T67A 3ROPA 3MOIA 2GDZA 3E9NA 3I9KA 4UREA 2XXJA 3O38A 4ZQHA 5G0TA 1YQGA 2EJWA 4XZ3A 5ITVA 3I5MA 5B12A 2AXQA 5GY7A 2O4CA 4H15A 1XGKA 3FNEA 1J5PA 2OHXA 4RORA 1LDEA 3EAGA 3H9EO 2BF7A 3TZ6A 4CQMD 1GQ2A 1YB4A 3AU8A 1OAAA 3HN7A 4GKBA 3PHHA 1HLDA 4FN4A 3JQFA 1L7DA 3BMQB 1TT5B 3CUKA 1AN9A 3HDQA 4MVJM 1NR1A 3PK0A 2YV1A 3TNLA 3ZV4A 3RFXA 1E5QA 3ASUA 1YS4A 3MJSA 2DPGA 3MZ0A 4OOFA 5BQFA 4IQ8A 5KKAA 4J1TA 2EKLA 1H6AA 1G1AA 3QVTA 2BGKA 3M2TA 1YBMA 1E1LA 4EEZA 1ONPA 3ORFA 4I9UA 1NAIA 2C0CA 3L4BC 2JJYA 1EQ2A 4GMGA 1CQIA 3ROMA 2G17A 1KC1A 3ANNA 1VPDA 1AGNA 2G5CA 5KJ6A 4QT0A 3UVEA 1JVBA 2B5VA 4Z0HO 3WLEA 1JKJA 3GEDA 2EGGA 2H6EA 5JC8A 3IDSA 3QLJA 4CM8A 3Q11A 1RM3A 1Z75A 4EI2A 3RWBA 5IN4A 5T5QA 2PR2A 4FW8A 4ZJUA 3K2EA 4YT4A 4MO2A 2B4TO 1CRWG 4YEDA 4DUPA 2Y66A 3DL2A 2P4HX 1E7MA 1P45A 1PWXA 4AJLA 3DZGA 1XQ6A 5AXDA 1I3KA 1UR5A 2WTBA 4FCCA 3RBXA 5JDIA 4NBRA 3V1YA 1C1XB 3JQDA 4GLLA 3HB5X 2BFAA 2J5KA 3DAPA 1J6UA 3HDYA 3QSGA 1ISFA 2ZTUA 1WLYA 1EUZA 3DBRA 2Y1OA 3SJ7A 1K5HA 2D8AA 5L9AA 3GT0A 2HMTA 1NPDA 1T2AA 4OXKA 1LSOA 4ALIA 5JY6A 4OL9A 3KHUA 1GYQA 5TSDA 1H9AA 3U62A 1HDCA 4D43A 2JFGA 4GSKA 4AICA 2NTJA 2OO5A 3KO8A 4WEQA 3DTYA 1VJTA 2IRWA 5KVCA 4O0LA 1YDEA 3IJPA 3BTOA 4UVEA 2J6IA 5JDCC 5THQA 3EZLA 5BNIA 1H6DA 4LW8A 2CMDA 3ZHXA 4WNCA 2ZB4A 1NASA 3U4DA 2E4AA 1T4DA 3FN4A 4MINA 2WYUA 2W98A 3DZIA 1AUPA 4PG7A 5A3VA 3BMOA 4Y8VA 2H63A 5EL0A 4WE3A 2WE8A 1N9GA 2EERA 4H16A 1SEPA 4CMJA 2XAAA 3CKYA 3DMTA 4KWHA 1B7GO 1M76A 1G6KA 1YBVA 3GAFA 1Y8RB 3TSCA 1KOLA 5IZCC 1XHLA 4EJ6A 1DFHA 1E7YA 4IGFA 4W9NA 2FWMX 4NR0A 2RHCA 3DB2A 4QSMA 2PZJA 2D5AA 4N7RA 2OGUA 1ZMOA 2HMWA 3V1UA 2B4QA 4GX0A 3C3XA 3BTVA 2PWZA 3O03A 4JNKA 3SBOA 5AOVA 4L75A 3V2HA 4IDCA 5KJFA 3GDFA 3ZH2A 3D64A 3F6YA 2CNBA 4E12A 4JJGA 1PQPA 4Z9XA 3FRJA 1E7SA 1R6DA 4KUEA 3AUSA 1M6HA 4DTIA 2Y1GA 2J3KA 4J0EA 2DM6A 3C7AA 1E92A 3CZRA 4J91A 5I8ZA 3ZN2A 2TMDA 3PIDA 3EZYA 2X86A 3M6IA 4DRYA 2VZ9A 1QXSA 5DT9A 4RCVA 1OZAA 3O26A 4PLGA 1RM0A 3LC1O 2HMVA 4NJOA 1PR3A 2EXXA 2G76A 2JFFA 3RKUA 3WX0A 4YT5A 5IJZA 3TZKA 1C1DB 1T1SA 2GN9A 2O23A 4DQUA 1P33A 3AOEA 4BMSA 4BL5A 4KQXA 1P1JA 3MWDB 4CLEA 1ADGA 1BGVA 4LGVA 1CIVA 3A9WA 3DBHB 1R4NA 3RASA 4YRAA 5A02A 3OFSA 2DTXA 3E82A 3WYBA 1U1IA 4LCEA 1BMDA 2YZ7A 4AJIA 4II3A 1NVMB 1XCBA 1GAEO 5TJ9A 1DLJA 4DA9A 3OIDA 4M55A 3VPGA 1UUFA 1X1TA 1ML3A 2EIHA 2FZEA 2VN8A 2W90A 1VC2A 1HDGO 2YUTA 3DOCA 1UXJA 5KVQA 2VYVD 2EW8A 4JROA 4BNVA 2UDPA 3O4RA 1DIBA 4ZGWA 3Q2IA 1GD1O 1ORRA 3WNQA 4EUHA 1RM5A 2GERA 6ADHA 3LT0A 4B8ZA 2NVUB 3DR3A 3E5RA 4J3FA 1KEPA 4G5HA 4RPKA 3BMCA 1I5RA 3TZHA 1IULA 2PFGA 4LSMA 4N5NA 4DIBA 1DFGA 2O50A 1MUUA 4HFNA 2V6BA 1E7WA 2DKNA 1U4OA 3FHLA 2NUAA 2VUTA 3OJOA 3PJFA 4NDNE 4N5MA 2OMEA 3JQ9A 4CM3A 4EEXA 2YDYA 3OIFA 3S2EA 3N7UA 3ZWPA 4GGPA 4OGWA 3I9MA 4BB5A 3GC6A 1PR9A 4JK3A 4OMUA 2V6FA 2NM0A 4J43A 1ZEJA 4P22A 1F8GA 2TMGA 3GUYA 5MGBA 4OO3A 3UCEA 1DBVO 2SCUA 4WLUA 1XQ1A 5LCXA 1B14A 2E48A 3HNPA 2PH5A 3AI2A 2O2SA 2GRAA 3AWDA 4MIEA 2B69A 4HP8A 2YQ4A 1U4SA 3GZNA 1B15A 4RQTA 1KVRA 1KVSA 1A7AA 1ZK4A 2Q46A 2VT2A 4LMPA 1A4IA 4BKQA 1PJQA 3DAFA 3PHGA 1P1HA 1QYCA 3R3JA 4KOAA 3ZWMA 1VKNA 3OHSX 4EDFA 3HSKA
chains in the Genus database with same CATH superfamily
1JALA 1SU8A 2C7GA 1Z33A 4BIMA 3L02A 4TV8B 2C2WA 4B3BA 5B1SA 1UK9A 2F9FA 3A04A 4CIBA 3FVWA 1NG1A 1X1DA 3OTGA 1YQWA 3G59A 4IQ0A 4UE2A 4WL0A 4AS3A 5JCOC 2A0WA 4V24A 5DNEA 3T3DA 4BTEA 4HAVA 1FP7A 1CUVA 3L93A 3AOGA 1G18A 4LYFA 1I2ZA 1Y7PA 1TJPB 2PSFA 3B1KA 4XM0A 2XJ4A 2GJAA 4AO8A 4YV2A 1L3CA 1CY2A 5I01A 3RVMA 1Z7EA 1KZ4A 1Y1TA 2ET6A 3DLTA 5KKNB 4K5QA 4IG9A 2D5BA 1GZ5A 5BN5A 4RF4A 5LVAA 5KWEA 2NZVG 1QG6A 4P36A 4IDQA 4MQ4A 4MVJG 3IP6A 1AKMA 1Q1QA 1Z5GA 2EFYA 3I2GA 4M53A 4A8PA 1SBIA 2GVDC 2R84A 1ZM7A 4IOKA 4RSGA 4Y98A 5E6RB 4ZC1A 5TY0A 2H4XA 4INAA 3N07A 4E4YA 2R6R1 2VRBA 4W82A 2WKWA 3NTQA 5GJVC 3E9CA 2VZ8A 3S8MA 4N48A 3Q40A 1I33A 1E2KA 1KL7A 2O5VA 4PO9A 2ZR9A 3LO8A 4H7DA 4XWAA 3FSGD 1UMCA 1S3IA 5FADA 4JLSA 1N7HA 3RQSA 1GTMA 3ONVA 4LY9A 4O0MA 1KE2A 4GPBA 2WVJA 2B1RA 5EIBC 2IXEA 1H3NA 5HYVA 3MRTA 2X14A 4B3FX 4C2TA 4F2PA 4Q7KA 3GAAA 3OQMA 1A8QA 1UBUS 4C04A 2VJPA 3OHMA 5F7XA 3M6AA 4HYQA 4MUJA 2PUGA 5TQ0B 4BMXA 3EDMA 3PXBA 3TR0A 5LQNA 3P52A 1HYBA 1QQ5A 2CNLA 2P5UA 4L95C 2OCLA 4DZTA 2GF0A 3DBVO 3VO9A 1N5JA 3IVGA 4DYDA 1XRPA 4TKZA 3U60B 4DSTA 2ID4A 1I01A 4HXYA 3TQCA 5K4AA 1UJ4A 2OK7A 3OTOB 2HQ1A 1TK3A 1OFTA 2ADMA 1T5TA 2F9LA 1VHLA 2JJ1D 2WSYB 4DIKA 1XROA 1YD7A 1B0UA 4JJAA 5G4LA 3P2EA 3SX4A 4ZV9A 4LWQA 2Y92A 4PRKA 1B8PA 4KWTA 3AM1A 5I51A 1S02A 3ZYCA 1E3SA 3FYUB 2V9PA 5JJBA 5AKXA 3GHHA 4BECA 3Q6MA 2VWPA 1ZK3A 1CUJA 3GMTA 4RQBA 2YJGA 3BXZA 4LVOA 1HK7A 2XKBA 3RC9A 4Y9SA 3MCWA 1Q17A 3VKVA 1U0NA 2CE2X 1SBYA 3WRWA 5CB4B 5BV1A 3EIQA 4YJ3B 5HE8A 4TLMB 3T1QA 1FF9A 3VZBA 1UMKA 3LF1A 1Z63A 2CNWD 1DU4A 2RKWA 2PRIA 3J7TA 3WGGA 3ADCA 1WM1A 1MVLA 3PEUA 2CMHA 1KFCB 1KTIA 2ZM6B 1ID1A 3HZHA 4FFNA 4V3CA 2FH5B 5JSUA 2VQEB 3GNQA 3MNFA 1I2BA 5F9FA 3HJUA 2GQ0A 2MIIA 3LZCA 2VDOB 1GL3A 3SXUB 3SGLA 3MJRA 4HG2A 1XQ9A 2JVIA 5LYJA 3S70A 3VNAA 3WR5A 3ZOZA 2NZWA 1SHUX 4GPIB 1J49A 1ILEA 3ZH9B 5TV2A 4RE6A 1HQCA 1HH4A 4ZOCA 1L4BA 2F48A 1Z7WA 4FJ2A 5FNVF 1GKKA 3S5JA 1KZ1A 5AFSA 1Z4KA 5EP3A 4WOJA 1ORWA 3EGDA 5EZYA 4R9UC 1YVRA 3FKJA 4IUYA 4ZQFA 1X94A 3SSNA 3THWB 4U1RA 1AUOA 4UDYX 1KZ6A 2WKQA 2IZ1A 3KSMA 4YRDA 1ISSA 2NACA 4PIVA 4TTRA 1GCOA 2C57A 1LDYA 3H87A 4M38A 5EWMA 3KC2A 3TBKA 3V1KA 4AXXA 4P1ZA 1HRDA 4YCAA 3A05A 2CUNA 2HK6A 1DRUA 2O2EA 3A7DA 4D8YA 5ALVA 3L5OA 2GM9A 2MYNA 2R60A 4FCTA 4HTFA 5FYQA 2XI4A 1Z07A 2JHPA 1JFTA 1ESDA 3C3EA 5LBIA 4EG4A 1VPWA 2OZEA 3NYWA 3QW2A 1NUSA 3ZDCA 2ZE6A 4WOBA 3LK7A 5CURA 2I6XA 4GBJA 4FNGA 4RHXA 5BSWA 2CDNA 3QUAA 2D7CA 2E6UX 2RJOA 5C81A 4AMGA 5CFOA 5DYGA 1V5WA 3FVVA 4U2DA 4FCVA 3U9SA 3WLOA 3ZZNA 4C4OA 4PN7A 3I8SA 3R3WA 4XW2A 3ZCRA 5JYEA 1K2WA 4XCVA 2HDNB 1N2BA 1ZNYA 4MRRA 2C4TA 2VSNA 2VWHA 1EFLA 2HF7A 3PE4A 4N4AA 1K6JA 1MXFA 4UTNA 3V5NA 4KR3A 5FQOA 3AJRA 2BHTA 4OJMX 2NO5A 2QMZA 2X0IA 1NBMA 1SUSA 3KJHA 1I4TD 2R6ZA 4JELA 4WOPA 1T5IA 2JGIA 1TVCA 1WXEA 3JAKA 3AKDA 4KAXA 4MW6A 3F98A 5BVHA 2FOIA 3ROGA 3GLRA 4CNBA 1FFGA 4YUZA 4JT9A 4B7XA 5FLYA 4DBZA 3T8YA 4HL6A 5IARA 1MD9A 4M1TA 1NNUA 2PANA 5B4UA 5JD3A 1SXIA 4DLWA 4DSAA 4TVOA 4KH1A 3DEJA 1LI7A 4DV1B 1W96A 3IEMA 3B9BA 5JAUA 2VP4A 3A1UA 2BGMA 2ZANA 1BEEA 2OO5C 3H4IA 3JQ8B 2D8MA 2IPLA 3ONDA 4JHLA 1H2AS 4EABA 1R6XA 4MVXA 1J8YF 5DHPA 2EG5A 2Z4SA 2C1EA 2JGJA 1X7YA 4DM3A 2VUHB 2R00C 3PXUA 3LCCA 2PZ8A 3D3QA 4XGQA 3WRXA 2E5FA 4QOSA 3V1NA 5DX0A 1QB8A 1IXYA 1SCQA 3ETCA 2CV0A 3PI7A 3NP9A 5JO9A 1A95A 1E6UA 3BD8A 4WNAA 3MAGA 5TNXA 3K0CC 3IPYA 4RTQA 2A33A 3ZU3A 2X9GA 1UZLA 2PUTA 3MPOA 3WXMA 4JP1A 2PR7A 4M7PA 2JPDA 2Q0SA 5JE8A 4GX2A 3RJ9A 2IV2X 821PA 2P2LA 4NV1A 3OCZA 2WF5A 4QJ4A 4C4YA 2JIPA 1H1LB 4F97A 2DWOA 2ZSDA 4XYLA 3BK7A 4JS0A 1Z5UA 3HB7A 4FC6A 5F12A 2RGRA 5C3UA 4KREA 5KAMA 2B0CA 4ZDWA 3VR2A 3PV0A 1NNI1 3MT8A 4BE4A 1ZVMA 1PP4A 1JQDA 4ZVOA 2CJWB 2XAUA 4BNGA 3H17A 4CKZA 2HDWA 2YVLA 1OX4B 5DTEA 3EODA 3IQGX 3M5PA 1JW9B 1NBIA 2G4LA 3HKEB 5FORA 2UZ1A 1TYBE 3LA6A 3T61A 2GPAA 3R0JA 2J31A 3DLBA 4JI3B 3UB2A 4FIDA 1DBQA 2C9OA 3P45A 3ADPA 3CSSA 5ISMA 5TPWA 2C9DA 1N9KA 4XDYA 1PAUA 1LZLA 2OHJA 2WZQA 3LHDA 1U2PA 3IP1A 4ZQIA 2QRLA 1XG5A 3RSCA 4W1RA 3DF9A 3KFLA 1XA0A 1D03A 3OFNA 4LF9B 3STHA 3JQ6A 4Q34A 3IAFA 4PQFA 1TUGA 4QU5A 4DN6A 3C97A 3NVAA 3FPHA 4PRZA 1AGPA 3EMVA 1NI4B 4NNPA 1XVUA 1D6NA 3FFWA 3NOOA 3Q8XB 1T4CA 5ELLA 5AR1A 4N47A 3TH5A 4EGAA 1P8JA 1A9XA 1FEZA 2L17A 4W6QA 5HCNA 1E3IA 4YNBA 1D0SA 4A1FA 2XOKD 3RVPA 1F6WA 4GOJA 2LDBA 2NG1A 3WK5A 4JZKA 3UAXA 1BA2A 1DEHA 1OV4A 2ZI5A 1Z13A 4KBGA 4ZEMA 2XCTB 2A7XA 3EUFA 3VR1A 2QRJA 1JEYA 3BRWD 1O0SA 1V9LA 2HHAA 1GILA 3C3MA 3SKVA 4I2VA 3Q9LA 1JHOA 2XQJA 1T91A 3UB3A 1C1DA 1H2EA 6REQA 2GKOA 4ND1A 1KY3A 2ZG6A 5BWCA 3IB3A 1S1CA 1OBVA 2FEWB 2PVPA 4E94A 1VE9A 2OB2A 3DC2A 4D0RA 1AH2A 1JIQA 4CQLB 1VI5A 2P4QA 2ZWIA 3CKKA 1E4VA 4JA0A 4MW1A 4TROA 1P80A 4ETIA 3D5TA 3HWWA 4P3YA 1SG0A 3HYNA 4D74A 4E09A 4MKRA 4TXMA 3DDCA 3T6KA 2XIQA 4R1QA 1II9A 2H3HA 2OVFA 3CRQA 4FUQA 4OB7A 5GONA 5IXYA 3U9LA 3NC4A 3X1WA 3NMUF 1I14A 1J23A 1AF7A 2OQRA 3NYIA 5HJ7A 2Z58A 1XRLA 3IBFA 4HH0A 3WDKA 2WK1A 1DBRA 1KSGA 4R8KA 3HWX1 1GNTA 1TO2E 2YN4A 2SKCA 5DM60 3FBTA 4OJQA 5K6TA 4EAQA 3MRVA 4D92A 4PR3A 1X7HA 2FSFA 2V7TA 3X44A 2VJAA 3QEMA 1UAYA 2H7XA 4Q4JB 3WB0A 1PG5A 5JALA 1MRSA 1U3VA 2BEJA 1KRWA 2J33A 4G0XA 2Q0HA 3K4PA 3PENA 4NL4H 4MPJA 2NVUA 3KAKA 2ZJZA 5A7FA 2HIAA 4E70A 4ZZ3A 4DR2B 2E87A 1P39A 3GH1A 4GM1A 4R5MA 4TTAA 1M0SA 1COZA 1ONSA 4HQOA 3URMA 2O8CB 5E2IA 5IAEA 4BAUA 4RV4A 2JHAA 5B30A 1VBNA 4QOIA 1N2CE 3CH4B 3NGXA 4QUBA 4UAUA 4OXXA 5ICEA 5BRJA 4TTJA 1XPRA 4BQOA 2ODTX 4ZC8A 5J40A 2G06A 3WWOA 3A2NA 1TAQA 1FJXA 2JI7A 4DB2A 4OL0A 2WJPA 4QFCA 1BX1A 1ENPA 2XUIA 3T94A 3WWZA 2FN8A 3UIEA 2ZQ5A 3HG7A 3KLOA 2ZRHA 1I2DA 2ZS9A 3CIFA 3MT9A 4H9GA 5FTWA 1CF4A 4KIJA 4I50F 1Z16A 5EUCA 3QWBA 5BO5A 4A91A 1GADO 1G8MA 4L6AA 1L7EA 2I29A 2NO1A 3KOYA 3GA7A 3AP2A 3E9ZA 1XU7A 2EJVA 4WXRA 3VAAA 3JD1A 2ZS7A 3UUFA 1TYEB 3E6AA 4RHCA 3BB4A 4CG1A 4E2YA 1GNVA 2IYPA 5LMCA 3OKAA 3ZDDA 3DXYA 4XASA 2JAWA 4LYDA 3WK4A 3NM5A 2PT6A 1YRBA 2QY9A 3JALA 4L72A 2R8EA 3ELDA 4OHBA 4PZ9A 3W34A 4D81A 4UNRA 2COUA 4ZYXA 2Z1MA 5JSZA 4V0NA 1E0KA 2GESA 4G09A 1DBWA 3TN7A 2P1ZA 4IFIA 1TM2A 3KLBA 1P2SA 1NOIA 1RW4A 2XWSA 4DQ0A 1QO0A 1IE3A 1C9EA 4GR5A 3TRFA 1TW2A 3FTEA 2MU1A 4Z3DA 3K9QO 1UP6A 4MDHA 4Q15A 3VAYA 1IXKA 1DX9A 2FW1A 2BMFA 3EGWA 4LRSB 1QRDA 1U7PA 2BMVA 4ND2A 3QEOA 4AWXA 3VPFA 2OBFA 5EJ9A 3KYCA 1M6NA 2CKMA 4JASB 3AXTA 4US1R 4V0QA 5F1YA 3VKUA 4UUPA 1AKUA 5K3BA 5A2QA 1JIVA 3GJ0A 2H11A 1SQ0A 4LXIA 1X1CA 2G71A 1OYWA 3I6BA 4P7JA 3T3HA 5G3YA 1NVBA 3AO0B 1OR8A 2FNAA 1RT9A 2UKDA 4HGPA 3JAWB 4LVCA 1ORDA 2CHGA 4WT7A 2LKDA 3CCFA 4FWTA 1VIAA 1G6HA 5D7NA 1XMVA 4BMPB 4Y2YA 1EHCA 2VHCA 2IU0A 5AVVA 4LOLA 4AB1A 3K9CA 4TZ0A 3H2HA 5FAXA 4JD5A 2O2XA 1YTUA 4HNGA 1KK1A 4MUEA 3TMKA 3EFEA 1Q0UA 1TEXA 4P34A 2GM3A 2IITA 3EUAA 4X9XA 4Z1MD 4AM8A 3O90A 4N0MA 3SU8A 5KDDA 3TG8A 1SUIA 4DV0B 2AG0A 3DD5A 2K4MA 3TSAA 3UJDA 3Q1LA 4OPMA 1D2CA 5HNKA 2FAXA 2ZXUA 4FQ5A 3TRIA 2C2MA 4BUCA 2QLBA 4C0HA 2GPWA 1QIIA 3OX1A 3IUNA 1SUWA 2G9RA 2VBFA 4RFLA 3RJ5A 3SPXA 5L7WA 1C0IA 3BE6A 2P2DA 4LISA 4NQZA 2R85A 4QDUA 3MELA 4MI1A 1U80A 2NSHA 4KFSA 3ZNQA 1GGFA 3MERA 2JH8A 4I6EA 4CF7A 3PHJA 3V2UA 3GEIA 2C5FA 4BFWA 5LWQA 4MAFA 4RKFA 3WA7A 2W9XA 3PIIA 3DZHA 3EXIA 3VZSA 1C7ZA 3DT6A 4B9EA 5IU6A 2Z6VA 1L8QA 1SCUB 4TVBA 2UZIR 3WSTA 3PDWA 1LEHA 4LSZA 3U16A 2R1ZA 3GCXA 3IC5A 3C3BA 4C5AA 4CRWB 5KCMA 4HS4A 5KDOA 5TJHA 1FXSA 1ZR2A 1NQTA 3EBOA 3L8FA 4YCSA 2W6ZA 1RDFA 5JQGF 2XY4A 2OGZA 3QE0A 3V46A 4R16A 3A70A 2P6RA 1U0HC 3QX8A 4HNTA 1JIXA 4HQFA 3NCHA 1YC2A 1SWVA 1ADYA 2HPVA 4MJLA 1L4MA 1N2IA 1AKVA 2BSAA 4O6VA 1NW3A 2ISCA 3NDIA 4X3OA 2YRWA 1CB7A 5AM3A 5L4NA 2NSDA 2IZ0A 1XXHE 1GFIA 5LDHA 3UGJA 2ZIUB 4FKMA 3V4ZA 4LGMA 4JUCA 2OWEA 2XTAA 2J0UB 4HMPA 4Q3AA 3I2JA 1EFVB 4A8TA 4BFVA 3G9UA 4DWOA 1SXPA 3RJZA 4Q37A 2B83A 5BW6B 4N7JA 4CGYA 4A26A 5KDLA 1D0IA 1Q3KA 4IFBA 2BE7A 3RCBA 1DXYA 1K8XB 1LLUA 2PWPA 2QOEA 4UNNA 4Y2QA 1TK9A 1VA5A 1X7ZA 1Z5WA 4HDRA 1E9RA 3QFCA 2XOEA 4D8TA 1G16A 3ZWYA 2QB5A 3GVHA 3RS4A 1I5EA 2I67A 1KU6A 1HT3A 1RAFA 2AS0A 2E9SA 2PWYA 4QAQA 1WVGA 3LX5A 5LA6A 3VSAA 3LV8A 1C7IA 3E81A 3HY3A 3NAZA 3PYMA 5JT1A 3EHEA 3IQXA 4KBYA 1NVVR 5GIPE 2CLCX 4IX9A 1ZEMA 5CX1B 4S05A 4NZOA 1B43A 1IAVA 3BGVA 3N8HA 5DFAA 3B7WA 3EXG1 4MVJA 3QVMA 5TX7A 1L5NA 2O8EB 5F7OA 5K1ZA 1TADA 3ZDYB 1VP3A 1H5NA 2AF4C 3B9QA 4ZDIA 5CFZA 3T3MB 4TMZA 2WUFA 3WDMA 4DSOA 3GFBA 5EJ6A 5DNDA 1N0UA 1KMHA 1IM8A 3B1YA 1YZGA 3VPXA 1XU9A 4G25A 3UC9A 1TJNA 4DLRA 2XMCA 1H3EA 5KTPA 3EVBA 4ITUA 4HGOA 4HGYA 3U7GA 2BI8A 3ZDZB 3QK7A 2BEVA 3IURA 1KR5A 2QW1A 1RWBA 3KD3A 2PX8A 2RGNC 2WYOA 3JQBC 1COWD 3RK0A 3KJGA 1U3UA 4AJ2A 1XJQA 1WEKA 4JR2A 1Y6QA 3SWWA 3AINA 4PCVA 3TSYA 2XUJA 2PAAA 1EDDA 2V4MA 3KZVA 2DHRA 3L1JA 1L5KA 2QF7A 3C8UA 3VBCA 3G49A 1HDYA 3GGDA 4LHSA 3A1SA 1UF9A 1ZWLA 1MB4A 1XA3A 1ZISA 2UYHA 4LBWA 4OY3A 4XB1A 4BYMA 1V8DA 2HQBA 4Z7NB 1OJ7A 2FN3A 1S1MA 4G8DA 1GPWB 3OEWA 4UBOA 4WV3A 3VVBA 4AJOA 2WFLA 3AY6A 1YRLA 3ZY5A 3BWMA 2KM1A 4KLZA 3O7MA 1ESZA 4S0XA 5CBKA 1BKYA 3KAJA 5EXTA 2W4QA 3FXAA 4GBGA 4BLTA 2L18A 4UU7A 4ARIA 4AK9A 2EZ8A 2IUSA 1L4UA 1K97A 4FR2A 4D82A 4FDLA 3OOSA 3C8HA 4JLKA 2J8ZA 5D85A 2PO5A 3PGJA 4I2NA 3OZSA 2WJJA 5BWNA 2HLNA 5AO9A 4DUYB 1O6ZA 2NTVA 3GNLA 2AV6A 2I6GA 1U0EA 3B6MA 3C7CB 3F5SA 3GJXC 3JARA 2ODQA 2WU8A 4KYUA 4OHCA 4D4JA 3TRJA 3A1WA 3F7OA 2PGLA 1ZHOA 2V3VA 1GQQA 4PLYA 4AC9A 3UOWA 3OU7A 3K15A 5G2OA 1CJSA 3PWKA 2D0OB 3SLGA 1US8B 4DEVA 4GGOA 2GTPA 2D1TA 5KYYB 5IEBA 3TRDA 4D4HA 4D0GA 4C06A 1H0HA 3LC7O 3RYCA 2GNPA 3H84A 3Q8WA 3A9TA 1HF3A 4DCGA 2FSVC 4ATNA 5I6DA 3CH7A 4IIEA 1FS6A 1D4AA 2JKVA 4RMGA 4QUKA 2XYRA 4WESB 4NFYA 1CEQA 4ZOLF 4PFSA 3OU6A 2OZPA 5KYWB 1CUAA 3ZGYA 2FE1A 4LQLA 4I1UA 1TCBA 4CEJA 4WCFB 1FLAA 2YN2A 3V00A 4CT5A 2UVDA 1T0PA 1VMKA 3OQHA 2AEJA 3F73A 1RM4A 2J4CA 1QF9A 2QS9A 1JYSA 3QYFA 3OIUA 4KE9A 3UQYS 3VHQA 5ELXA 3I2HA 4JU9A 5B6JA 2HKIA 4F2DA 1KMIY 4I08A 3S7ZA 3U6KA 2VJLA 1MJGM 1JHAA 2RG7A 1E3TA 2IC5A 3GVXA 4KXFB 3JU3A 2EW2A 3VH2A 2GN2A 3E7FA 2WIJA 3HDHA 4O4JA 1D7AA 4ROSA 4M99A 4CIDA 1Y6GA 2P2SA 2VP2A 5GOTA 1B73A 4CM6A 3EXAA 1Q0RA 2OBMA 4WZAB 2R7LA 4JNCA 4TSFA 1V7CA 3WNCA 3WLLA 4JLAA 4IQFA 3SBEA 5A6SA 3DDNA 2XR1A 2X0KA 4XIYA 3EISA 3CEMA 4WZBB 1TZ2A 1ZI9A 1X14A 5C9ZA 1D6SA 2FMKA 5J47A 4HAOA 3RT1A 3SQXA 1YJ5A 4FTWA 2QLFA 4I4IA 2BM8A 5KCZA 4FYHA 4LMAA 2ZRCA 3IDZA 4DXDA 2R7MA 3EZ9A 1G9SA 1M2WA 3E1SA 1E4EB 2P5SA 5D3MB 3DAYA 1DO0A 1P31A 1YS7A 3FB4A 1FW6A 2VWGA 1OWOA 3VA7A 4AN4A 4FHGA 3WLAA 5BSHA 1K4YA 2OPHA 1NLZA 3JR7A 5KHAA 2XUKA 2GJKA 2C7VA 3W6OA 2BFWA 1HI9A 3OJFA 4QICA 4ZQEA 3S2UA 1I6WA 2DT8A 1PHRA 3DOEA 1KVTA 3KZOA 4EENA 3MWEA 5FH9A 2HEGA 1JDZA 2ZYSA 4QO8A 1U0SY 3ABQB 4C5BA 1G98A 2QUJA 1JWBB 4KI7A 1W5SA 2IYLD 2IU6A 4ZEWA 3DVAB 4AF6A 4YALA 3REQA 5CDHA 2B36A 1YQQA 4Y1FA 4BO6A 5HKKD 2BR4A 1G21A 1PZGA 4L4RA 5CEFA 2VKQA 1N7JA 3NUGA 3PNYA 3RW9A 1PGNA 1ZBDA 3ICWA 1FQJA 3ANXA 4G5OA 3DOOA 4JKOA 1XQVA 1XF9A 1JDBB 1JXMA 5AM5A 4CF6A 4TYNA 1EFPA 3OURA 1XWFA 4XYMA 4DQXA 2IEZA 4BFLA 1M1YB 1E2LA 3C8DA 3FCOA 4GI7A 3V2IA 1JLLB 3KWLA 4D4LA 1W85A 1IQ0A 2W7TA 3DUFB 1P6UA 2X40A 3IVRA 1HPLA 1Q0LA 2BE9A 4KJXA 1H8HD 3CPEA 4DF3A 1XL1A 2RD2A 3R24A 5JWOA 2XWJI 2W71A 4IILA 2PRSA 3JATB 4FGUA 1USKA 1IN1A 3HUTA 2GFHA 4L7VA 3TIVA 3RO7A 2X3FA 1ZXBA 2W8ZA 4HAYA 3B89A 3BFVA 1N33B 3E7PA 4FT4A 3O6VA 3WY9A 1L8OA 1CJKC 1H2BA 1DKQA 4N3AA 3TJRA 1TIBA 4WZ6A 3T7KA 4ZRMA 2XJ9A 1EVQA 1CYEA 3KZCA 4EMBA 4B33A 5TVKA 2EX1A 3HR4A 4Y2GA 3WADA 5BWBA 5D01A 5ENVA 2HJSA 4EBBA 1OV6A 1R50A 5EE5B 4B0PA 4I1VA 2WSLA 1C80A 1YRAA 2NXWA 3FZEA 2O52A 4KW7A 2FKNA 4QFDA 1JB9A 1DV1A 4M9SA 5AIAA 5DULA 5FNVA 3ZNOA 4C7MA 2ZIFA 2F59A 1B1AA 1KFEB 1YU6A 2R7KA 3W78A 4BQRA 1P44A 2BFEA 3X1JA 4QDXA 3USZA 2XRZA 1NVFA 1NT4A 2Z2KA 3HLKA 3G6WA 4KCGA 3OZDA 4FFDA 3TYXA 1VRWA 2SHKA 1IBKB 1CD5A 1EDEA 3DLIA 4FIZA 2VXBA 1MABB 4NC9A 4CU2A 5AW3A 2OC9A 1T8TA 2PL5A 4U5XA 1QR6A 3VTZA 2IS6A 4TPKA 1JHPA 3CQ9A 3MINA 4L51A 1ZRNA 4D46A 3NHJA 1DWPA 1M8GA 2EFEB 4D6XA 1V2HE 2QLNA 4AKEA 3DWGA 2HJVA 4OQ4A 4IUCS 2AX3A 4WLOA 3WTBA 4D8VA 2AFIA 1S4MA 3JD4A 4MV9A 5A5DA 4WLFA 2B92A 3ANLA 4GRAA 1OMOA 2Q1SA 4Z6KA 3MHTA 2NP7A 4BZQA 3OAAA 5TGDA 2YXDA 1CFJA 3PWZA 3N9IA 2GDJA 4GRIA 4IEIA 3L0OA 5SYMA 1JG2A 3LNCA 4GVLA 4P4TA 4NKRA 5EE3A 3T3EA 2VL7A 4ZYLA 1RPNA 4E7PA 1HDOA 2DH6A 3H2ZA 4GOKA 5LOVF 1PIWA 2BELA 2ZRPA 1I4WA 1KY4A 4L5JA 2OXEA 4MR8B 4HZGA 4PVDA 4RVNA 3LQQA 2ZYUX 1BFDA 5G0SA 1ZW1A 5CG1A 2Y0CA 4WNIA 4B3TB 3PEVA 3FHTA 4O2BB 4INZA 4JGIA 2VHJA 1BE1A 5T4BA 1MJ5A 1S5PA 1N3YA 1JN0A 1KO4A 3TTYA 1FCJA 5SYAA 5H3HA 1M34B 3ZGXA 2C2KA 1KU0A 1BAPA 3JTEA 1Y9DA 1NJ2A 2SICE 4IXDA 4QEDA 2DUJA 4W8HA 3N0VA 3JVUA 3DW1X 4TV9F 4F2WA 4XFKA 2PYZA 1K2VN 3IQDB 3HPQA 3DS8A 4PC2A 3BFXA 3IIMA 3QUQA 1G41A 5LZ9A 4GP6A 1WXGA 2NU7B 1EQAA 2ZJ0A 4YK7A 2BI7A 2AR9A 3PNLA 1BW9B 3FOFC 4MJ7A 3TQRA 5H81A 3ZU4A 2PVCA 1OI3A 4BNTA 5BUSA 1YDWA 5K3CA 3KYDB 2GTHA 4FSDA 3MAJA 2ZRKA 3VU9A 4COOA 2WSBA 1XTBA 2XITA 1AQ6A 2XE6A 4US2R 4UDOA 1Y5RA 2FZLA 5LXTB 1UFQA 1Y4UA 1TOAA 3GDGA 5I3ZA 5ARCA 4JENA 2G72A 1J97A 1K5PA 2G82A 1A5ZA 3HZZA 2VDQB 2PA3A 3PNSA 5H3LA 3ZJTA 3SE0A 3IKLA 1GTZA 2PSEA 3AX6A 2J0EA 1KO7A 5KAPA 3EVNA 4N5IX 3OQPA 1BRMA 1OLUA 5DCWA 4N8EA 1GGMA 2XZOA 1MAUA 2Q8PA 4KZPA 5K0SA 3WK8A 1HUQA 5FI1B 3LYHA 4LY6A 4DIOA 3WGYA 3WNBA 3DTVB 2X41A 1QTRA 2FEPA 4XFDA 5L3RA 3S2YA 2SCUB 5JD4A 3I73A 1RJGA 5DLDA 3AM3A 2QN9A 4ZCSA 3I3OA 1TLTA 3CGGA 3KQWA 4ARZB 5LQMA 1JA1A 1WUJS 4ZCRA 3WWDA 3ITKA 3Q2KA 5C52B 4ZTZB 1G3MA 1MGPA 1DBIA 4ND6A 1EWRA 4Q4AA 5CM9C 2Z5FA 3AIOA 1T6ZA 1T5OA 3B7PA 5U1PA 4Q3CA 3V55A 4J0FA 2FZGA 1W8DA 4D9JA 2G0TA 2JK0A 3PDUA 4W5NA 1KAGA 4Z3KA 3K9BA 1Z2DA 2CDBA 1PF7E 4FB4A 3E5HA 4WK2B 1UAGA 3SVZA 1U8YA 1SU4A 2C8JA 1DQSA 3N70A 3HA7A 1ISHA 4UEKA 2M98A 3UHOA 4C7KA 1X1RA 4DJFC 1P3DA 3T1HB 2RHRA 1I32A 2AN5A 4GKJB 3UJAA 3ZHBA 4AF8A 1E61A 3HCNA 4ZREA 1PGQA 4BNUA 1XI2A 5BR7A 1OX5A 3MEQA 2MTBA 3S2IA 3VUEA 3P8ZA 2WOJA 2NQTA 1UZNA 3D31A 3QKRB 3M6WA 2IZZA 3QPDA 4Q3KA 5ALWA 3EF1A 5DU2A 3UBMA 1OBFO 4LJ4A 5HVNA 3U4MA 2H5JA 3NDJA 3ZEIA 4N54A 4I8IA 1VE7A 2NO9A 2Y27A 4F1WA 4G0NA 4M36A 4XQGA 4MAAA 1E94E 4BKOA 4FFMA 1W1WA 3CLTD 3EQ7A 4I3GA 4QYIA 1GIAA 3RS0A 4DCUA 3QBTA 1N8KA 4NV0A 1ZONA 3W79A 4RFSA 1FVOA 2FQXA 3GJTA 3ITNA 4K9QA 4AZTA 2EIXA 3LUFA 3WWPA 3HKCB 1C0LA 2Z8YA 3TJMA 1SM4A 1LXCA 3QVUA 4Q1FA 2TS1A 3IHKA 3DEIA 2J48A 2EV9A 3B60A 2XNSA 4OJYA 4MYTA 3TTVA 2QROA 3F1LA 4EARA 4MTCA 4FSHA 5FBZA 4HN4B 3UO8B 3GRVA 4QNMA 1BFUA 1H3FA 1CZUA 3IE2A 2E55A 4OI4A 2C9YA 3GLFB 3LY7A 3B6EA 2VJMA 4QXPA 3AUAA 4TL9A 3F90A 1G291 5JOQA 4J4BA 4B3GA 3K96A 5HWSA 2D3WA 2OENG 3OX3A 4OYRA 4BLOA 2AI2A 2QP4A 3JWHA 3PR3A 1LS6A 3C1UA 4XWGA 4BZZA 1UODA 3DZ8A 2O1WA 4H17A 1S8OA 1FTWA 1M5RA 5CX4A 1F3LA 1K1EA 3ICCA 1L1EA 3FUWA 3H3JA 4PCAA 3ID6C 4A27A 1NPTO 1VL5A 1PGPA 4BFUA 1ZCZA 4L5CA 5CW1A 3VSBA 4L16A 2DULA 1EIZA 1NJ5A 1Z35A 4BMNA 5KSOA 2BCGY 5CYFA 4O2AB 4C78A 2DU8A 3H5RA 4M0UA 2DFVA 2PLRA 4OUDA 2P69A 3PWSA 1CT9A 1TCCA 3R5SA 4F4DA 5HJ5A 1XWWA 5ANRB 3O8NA 2R79A 2AZTA 4MO9A 3VR6A 4ZHQA 1YJCA 2V45A 3BM5A 3KAQA 3I28A 5LKRA 1FSSA 2BEWB 3GPBA 5IKPA 4UTPA 4FHEA 1EDOA 4TQ9A 5D00A 1G63A 4QDJA 2CXQA 4Y2XA 3SC2B 2EP5A 5EWJA 2XVYA 5BORA 1UCFA 2ATIA 3NV7A 2HXGA 4NZZA 4PFJA 2VHVA 2OPBA 3GI1A 1QHHB 4PZPA 4RJ2A 3C41J 5TARA 1SFRA 4EHNA 5JH7A 3AVXA 2I4IA 3PD0A 5GP1A 2PQ0A 5CD1A 1J39A 1VA4A 4H35A 4KGXA 4DA6A 1CDOA 1RKBA 2IXDA 3TI9A 4LOIA 1GSIA 2JFYA 2JIDA 3DLAA 2NU8A 3O8LA 1FSZA 3CLTC 1DOHA 4U7FA 4BAZA 4WNYA 4E08A 1BOOA 3KSAC 3DBLB 5IC6A 2B9VA 3W5CA 2P9EA 2RG1A 3P32A 2Q5CA 3BQNB 2BFNA 5AKHA 1Z12A 4YRPA 2PE5A 1FSPA 1C3EA 1V25A 1ZY2A 3GLUA 4JI5B 4YDRA 5EZQA 1QIMA 1UBTS 1L7NA 2JARA 3AR2A 3OWOA 3IUQA 3PHCA 4PBRA 3TEJA 4DW8A 3NPAA 1Z6QA 1LFAA 3DPIA 3E7WA 4QYSA 3UF0A 6LDHA 1JX6A 1UIMA 3KOMA 4MGKR 3WWEA 4EPVA 5ALSA 4PHHA 4QOJA 5GQSA 4ZWNA 5I9TA 1LBEA 2BAGA 3E3MA 3R9WA 2JIQA 2Q4BA 1W46A 1M2HA 4KWIA 3F74A 3T9EA 3GDHA 3H11B 1HZJA 3ZHZA 2ICAA 3FMGA 1LRKA 4YAIA 3TCXB 4E30A 3EDOA 1YAHA 1E4OA 1JAZA 2R751 2VRCA 3KJIA 2C3YA 3R7AA 4C2AA 4CCYA 1Z25A 4BWGA 3K0HA 4PZLA 1UM9B 3JPWA 5FHRA 4JU8A 5JNUA 5CLQA 4I3HA 2JBHA 2I9KA 1JXOA 1EP2B 4NCNA 2J67A 2O8CA 3BB1A 3TRKA 4M7WA 5AW7A 1EXDA 2HSDA 1U8XX 4ZO9A 1EVEA 1IB6A 2I66A 3WYCA 4C7OB 3AR5A 4C0BA 3B1JA 4ZVNA 4LFCB 1Z2OX 2DUMA 3F4KA 4G4GA 2JS7A 4RO0A 2BD0A 4W99A 4PN3A 1C8BA 2P6OA 1V96A 3BSWA 4PZEA 3UYKA 4YRTA 2VCYA 3MGKA 1CX9B 2L42A 3JWGA 3ZW8A 2VTDA 3ULKA 1U5CA 2D1QA 1J20A 4OVKA 5EQJB 1U5AA 3TQTA 1MH1A 2Y1LA 4A8JA 2FPPA 5TC4A 4EW2A 2CV1A 2GZ2A 4K6KA 1W36D 1TKCA 2X58A 1U7HA 1FNNA 3LT4A 3JYNA 5I7SA 3DYBA 1VP9A 2IHTA 3JQEA 4CM4A 4DEYA 3O8CA 2EL7A 4RCYA 1RHMA 2XH8A 5EOVA 5TPZD 1JHXA 1P7WA 1S8FA 5BQXA 5L95A 1OWNA 1Z0UA 3A6KA 4O1MA 5BOSA 1W5AA 5FIUA 4X00A 3AJAA 3LPCA 5EHGA 1ULSA 2JD2A 1K8ZB 2JI8A 3EXHB 4CIYA 3UY4A 1HDZA 2VHWA 1WQ4A 4BRWA 3A25A 3M81A 1L4HA 4R2KA 1Y5MA 1GCUA 2Z9CA 2JAOA 3A26A 4H3VA 3RUDA 3EWNA 3W8RA 2GEFA 2QMUA 4EBFA 4Y6LA 2DF8A 5HPYB 2ZW9A 3SP1A 2BFFA 1MTOA 2HMUA 1BS2A 1JTVA 4YJDA 4XR4A 2AYZA 2EKDA 5ALIA 1J25A 1JPNA 1UMDA 2P6UA 3ER6A 2IEGA 5C4IA 3IRUA 4GBED 4H08A 1OILA 1ZLYA 3QE3A 4C3ZA 1P9NA 1EVLA 4XSGA 2H2IA 2UXDB 2ZUUA 1DUIA 3LWDA 4B0OA 4CJXA 3U44B 3W90A 3RVJA 1E58A 1HLPA 2EJUA 2QZJA 3ABZA 1A76A 4ZI7B 1ZI8A 1IZ7A 2FE4A 1NNSA 4RM3A 3NXSA 1SB9A 4O4IF 5JQGA 1E9CA 3NBKA 1TC1A 1F6BA 5IYZF 4H7EA 2M32A 5E8JA 4DCSA 3UOGA 4DMCA 2BKAA 1ZCJA 3IQIX 3OUTA 4UHHA 1BU8A 3CVJA 3ZQUA 4IINA 5DWVA 5AWFC 3TVTA 2FFBA 5GMOA 3BGIA 3LQYA 2V7QA 4XJVA 4JWTA 16PKA 3IS3A 5CVTA 3V9AA 3DMFA 2CN1A 5BN4A 1O77A 2A5JA 4GMDA 4XJTA 3OZWA 3SS9X 1LF5A 1XDGA 2Y1DA 3NTUA 3ROXA 2C1XA 4F6RB 3S27A 5JYBA 1J9EA 1GL7A 1NRXA 1M0WA 1WP4A 1C3JA 1CRZA 4H1UA 2ZJ6A 5T6BA 2AWNA 4EP1A 1XDDA 1TGYA 3KNZA 1GYRA 3MBIA 2CHEA 1FZQA 4XARA 3LVFO 1KAHA 1W36C 1TPYA 3PLRA 3P96A 4XVHA 4IDEA 3RRFA 2ZCVA 3D3WB 4K2HA 8GPBA 1QPZA 1JQKA 4A03A 5BMVF 2O6LA 3PF9A 3V97A 4CR6A 1QZXA 2Z98A 3KJXA 1G3IA 2IYVA 3G82C 1KI7A 1DFIA 4KGDA 1M2GA 2WLTA 1HT1E 2DHQA 3I9JA 5JV5A 4UCWA 2ZRIA 4CLOA 3T3OA 1KBOA 1JLRA 3TNYA 1GKUB 1HLGA 2GBCA 4B3SB 3MMNA 1MP0A 2CNOA 1I4EB 2FHSA 1KR2A 2VPYA 3ESZA 3IKJA 4UULA 3GF4A 3BG5A 3AM4A 1OZGA 3D7RA 3FNRA 2ZSFA 5FXMA 4RPJA 2VPQA 2J6CA 3OJWA 4OBBA 1HSOA 2IELA 5TS3A 5MN5A 5FBHA 3OE7D 2H7CA 3PFCA 4G07A 4IL5A 2OSVA 3UMJA 4JGGA 2VTEA 5LZ4A 3C6QA 2DB3A 1U1GA 4LCBA 3IUSA 3NEJA 1QFSA 3V8BA 1IRIA 4EAAA 1ADCA 1HZZC 4US0R 3BKWA 1GEEA 2ZYIA 4MRPA 4LY3A 3VR0A 3W1VA 4IKOA 5E1OA 1YZNA 2NNLD 1E2FA 4IOMA 3NJ8A 1J8MF 1MU0A 3RBAA 5BN3A 1I9GA 3UPTA 2B20A 2EKBA 2EZUA 2NUBA 2F55A 2ZZMA 1XZ8A 1CXZA 4I8XA 4OQPA 2C0PA 4R2HA 1EGMB 3P9KA 1ACLA 1K4KA 1PBTA 2QDXA 4Y30A 1PLJA 3QV1A 5HQ3B 4GYKA 3AK4A 1MQSA 3WKBA 1X9IA 3K4QA 3JSAA 2RH8A 4ITVA 2HDOA 3T4UA 4FU0A 2GZHA 1WCYA 2OCPA 5L8VA 1BHSA 1HETA 4J9VA 4OGFA 1Q3TA 3ESYA 2BGJA 1VI2A 2WM3A 2H29A 4TRJA 2YXNA 4RTLA 4J0IA 1ZKMA 3QMMA 3Q3IA 4PZYA 2GM4A 2C61A 1MZVA 2MR5A 1L7RA 3S6JA 5KNCD 1JSZA 4ABTA 2VPIA 2XGGA 4F72A 2QNRA 1QAOA 1R9JA 3FCAA 4I1YA 5LR6A 4KMOA 3T1YB 4MTLA 2CBXA 3OVMA 1F1BA 1LQUA 1WF6A 2QG9A 4YJGA 3EEOA 3JTMA 3W9YA 2YWFA 4EX7A 1PWZA 2M9MA 3DB1A 4BBZA 2P62A 5E6UB 2X9VA 4JYPA 5B3AA 3MJVA 3THXB 1CR1A 2HU2A 2UUOA 1DAHA 3OWHA 2Z8XA 3ONNA 4ND8B 1LLQA 4S04A 2D7DA 5DBEX 2GSWA 1UJCA 4R54A 5A3JA 1YQXA 1ZW6A 4E5KA 2JVKA 4F46A 2I91A 2AUTA 3IPXA 1R8XA 4YV1A 1CP3A 2IHUA 2XNDD 5UKDA 2PX4A 4M21A 2PN1A 1W88A 4R3WA 3HC7A 3K9LA 1XD8A 4YRRA 4ZOLA 1NV9A 1Q50A