4KWIA

The crystal structure of angucycline c-6 ketoreductase lanv with bound nadp and 11-deoxy-6-oxylandomycinone
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
252
structure length
252
Chain Sequence
GNLTGKTALVTGASRGIGRAIAEKLGYAGALVAVHYATGADAAAEVAESIEKDGGRAFTVKAELGVPGDVDVLFEGLERGLKERTGATDLDILVNNAGVMAMGAPEEVTPEMFDRMMAVNAKAPFFIVQRALSVMPDGGRIINVSSGLTRVASPDQVTYGMSKGALEQIALHFSRHLGSRRITVNSVAPGSTDNGSALFQIPEVRETLSQLSTFGEVAEPAAIADVVAFLASEDARWITGAFIDASGGTLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/antibiotic
molecule keywords Reductase homolog
publication title Structural and functional analysis of angucycline C-6 ketoreductase LanV involved in landomycin biosynthesis.
pubmed doi rcsb
source organism Streptomyces cyanogenus
total genus 89
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4kwiA00
2FZEA 4E13A 3GGPA 3H9GA 4IIUA 5L9AA 4RQUA 4EJ6A 5B4UA 1NQ5A 5U4QA 4WLEA 3D0OA 1JWAB 3P2YA 1PL7A 3DAGA 3Q9UA 5T5QA 1E6EA 2BFAA 1RYDA 2X5OA 3GT0A 3LT0A 3PVZA 2NADA 4R41A 1RJWA 3ONFA 4DPLA 4ZHSA 4OSOA 3F1LA 2Q49A 3DB2A 4PG5A 3WWYA 1DRVA 3HFSA 4RGBA 2IRWA 2V6BA 5CAEA 2CDBA 4MDHA 3NJ8A 4HFNA 3LDHA 1UR5A 4RVDA 5KTKA 1BG6A 1VRWA 3H9EO 2UYYA 4UEOA 3OMLA 2C29D 1M6HA 4J43A 3GMDA 2JHGA 1EQUA 2PA3A 3Q3CA 4Q3NA 1X0VA 4I5EA 1N1EA 4R9SA 4TQGA 2LDXA 4Y6RA 1E1NA 2Q45A 4R5HA 3K9QO 4Q3BA 2X7HA 5JBIA 1HE3A 1MXHA 1P44A 1H6CA 4MVJI 3RROA 4R4JA 4KP7A 1E1MA 1GZ6A 4RPLA 2PY6A 4DIFA 5EQFA 2OMEA 4GBJA 1BW9B 4ZICA 5ILOA 4CM8B 3LSYA 1DO8A 2UUOA 5I7SA 3MTJA 5TIIA 1TT5A 4RVGA 2FPIA 2BRUA 3ADOA 4L4XA 1QKIA 1UH5A 4J1TA 5HTOA 1ZEMA 2I3AA 1OI7A 3ZWOA 2Y66A 3PYLA 4FPXA 4ND4A 4Z9FA 4D43A 4XB1A 2HK7A 3MTGA 3T7CA 4BNXA 1SCUA 3DWFA 3ETEA 1CJCA 3MJTA 3JYPA 2FHSA 1DFGA 1U3UA 4UEKA 2PLAA 3JYOA 4LRTB 3V1TC 4DIOA 2HK9A 2DUWA 2DTXA 1EK6A 2NWQA 1DRUA 3DQPA 1YVEI 1EEHA 4CV2A 4QSMA 3RUAA 1KVSA 1ZMOA 2BHLA 1PSDA 4RJTA 5GMOA 2GCGA 3WNQA 1SAYA 3PWZA 4XJSA 5HA5A 1ENOA 4R51A 4OKIA 3GPDG 1A4IA 2VZ0A 3A14A 2EEZA 4D3FA 3H65A 3IUSA 2O3UA 2BD0A 5C3MA 4GX0A 1HSZA 1VKNA 3UAGA 1P0CA 3GR6A 4BKQA 3ZWYA 3QVSA 2Q4BA 2B5WA 2YQ5A 2Y1EA 4M1QA 4PGFA 2CF5A 2PGLA 1DHTA 1KIFA 1EUZA 1UDCA 1NWHA 3WWZA 3ENKA 4FFMA 5IXSA 4RV9A 4LVCA 5FEUA 4IIVA 1TXGA 3QVOA 4AJEA 4WLUA 3U4DA 4BNKA 4YB8A 1OAAA 3DMTC 2CDCA 1OZAA 3VZSA 1YO6A 5T67A 1MC4A 4DC1A 4GQAA 3UF0A 4DVJA 4YJHB 5B37A 3Q2KA 3EDMA 2CSUA 5ILGA 4WLFA 4CV3A 1EVJA 5AXCA 2JAHA 3KSZO 3PYXA 3PQEA 3V2HA 4YAKA 4Q3DA 3U5TA 4MVJE 1QYCA 1XQ6A 2Y0DA 1HDRA 5LDGA 2O4UX 4WLNA 3OIGA 5KJ6A 2WM3A 4AJHA 1FF9A 1K6IA 4K28A 1LDBA 4Q3AA 4ZVVA 4CQLB 3O9ZA 3V8BA 3MJEA 2DC1A 2Q2VA 3PHLA 2X4GA 4G2NA 3IQDB 4OXNA 3ROPA 1X1EA 2OFPA 3KYCA 5EINA 1CIVA 1ISJA 1PJCA 1LDNA 1UXGA 4DQXA 5JCXA 3NT4A 4JGBA 4CMBA 2Y93A 2ZYGA 4TKMA 2HU2A 4A10A 8ADHA 2Y1OA 3BZUA 4CMHA 1YS4A 1NPTO 1PJBA 4CM5A 1WDKA 4JP3A 1CRWG 3PZBA 4ROSA 4W9NC 1LJ8A 3ZHBA 2DTEA 2D59A 1NXQA 2YYYA 4BO0A 3WBFA 1HWYA 3MJ4A 4YWJA 3GRPA 2NNLD 3HN7A 4I1IA 4Y8VA 5BNTA 4IQ8A 3F5SA 3RFTA 2C5EA 3OQ6A 4NNJA 1M6WA 2HDHA 1A9YA 1ZBQA 3HB5X 4NZ9A 3RSHA 4XQGA 4OYRA 3OHSX 3WIDA 2VHYA 4ND1A 4FC7A 4CMKA 1DJQA 4QX6A 3M1LA 1H2HA 4IDFA 1ZK1A 4WEOA 3ORFA 4UVIA 4GL4A 4AJ2A 4PRKA 4BNNA 1MV8A 3WIEA 1F06A 4D44A 1LA2A 2WD8A 3ZV3A 2O3TA 2BI7A 3L4BC 1TT7A 4CQMB 2A94A 1R0SA 1DAOA 3R3SA 4PN3A 3S2FA 4ZJUA 4GSKA 3VDQA 3RASA 3WG9A 5CG1A 2QRJA 4ALNA 5U9CA 3GFGA 1EK5A 3O8QB 2Y67A 1WMBA 1YL6A 2PD4A 2X9NA 3GMSA 4XDZA 4DL9A 4B7XA 3C1TA 3GNSA 1FDTA 1Y1PA 2JCVA 3BHMA 4BV8A 4BGIA 2GRAA 4O63O 4AG3A 1YQGA 3S55A 4IQ0A 5L7YA 2Y0EA 3QVTA 5IG2A 2O23A 4DLLA 4YXFA 2V7PA 4E5KA 4E21A 1Y5RA 2PH3A 4DC0A 3GNQA 3B20A 4XR4A 4RL6A 2X0IA 3PLRA 5L53A 4MVJF 5A9SB 1ZZEA 1TEHA 2QIOA 4EYEA 2PZLA 5KJ1A 4R16A 5CDUA 2O3QA 3EAGA 1IPFA 4BNMA 1KY5A 3JQAB 3W8EA 1K2WA 1PGNA 4FFLA 3PJDA 1N2SA 5COQA 2YZ7A 4BKPA 5GZ3A 1FDUA 1ZCJA 2NU7A 3JQ6A 2DM6A 1KOLA 4RDHA 5F1PA 4CMJA 4L74A 3FBTA 1YJ8A 2Q4EA 3EGOA 3QSGA 5G0SA 4FFPA 1ZK2A 3IKTA 3GZNB 3B6ZA 4XD2A 5CPBA 1EFKA 3PFFA 5COBA 4CM4B 3ETDA 2WJPA 2FPPA 1U7HA 1PL8A 4YJFA 2FY8A 1UAYA 1HYHA 1IHXA 2Y1DA 3IS3A 4LRSB 3DHYA 3K30A 1U8XX 2JCXA 1NM5A 4BNJA 3TQHA 2J3IA 4OQZA 2RBEA 1D4FA 5EQDA 4JQCA 4BV9A 1R0LA 4XGIA 2F1KA 4IPTA 2UAGA 1I10A 5ADHA 2BH9A 4XZ3A 1ADGA 3U49A 3UN1A 4RVUA 3NGLA 1LUAA 1LDMA 3NT5A 5CDYA 1GQQA 3GK3A 1XDWA 2JFGA 3H2ZA 2G1UA 4XQCA 4F3YA 3BAZA 2NU9A 1T26A 3ONDA 5C5IA 1GV0A 1PL6A 1LQTA 1GYQA 3PP8A 2HCTA 1IZ9A 2XF8A 4DLAA 2O7SA 1ZO8A 3FN4A 2B37A 4J6FA 1D1TA 3RJ5A 4H3VA 4TSKA 2JD2A 3BMCA 1I2ZA 5F1KA 4Q3CA 5U1PA 1T4BA 4FCCA 1Q0LA 4OOEA 1LSUA 3TZCA 2X8LA 3DBLA 5DOZA 4MVJH 5C7OO 1O5IA 2Z1NA 4YT2A 4XGKA 2YV3A 3GEMA 4IMRA 4JJIA 3HJAA 3RJ9A 2VTDA 3BMQA 3V2UA 2JHFA 1FMCA 2QZZA 1KYQA 3SX2A 1T25A 2HJSA 1T2EA 4JLWA 1DHRA 1P1FA 3GNTA 5JYDA 1Y6JA 4E2WA 4YRBA 5A1TA 1O6ZA 4PG7A 3MJCA 2PD3A 5JC8A 2VCYA 1Z7EA 5GZ6A 2FZWA 1X7DA 2PWZA 3AWDA 3ZU4A 2AE2A 1V3TA 2R6JA 2VHXA 4FJ1A 3QJ5A 3AUUA 2VT2A 2J3HA 5TJ9A 3GDFA 4P4NA 4AJLA 4F45A 4ZRMA 2NSDA 4K1LA 3F1KA 4Z3DA 1FXSA 4PZEA 3M2TA 4DQVA 3DONA 1NQTA 4HFRA 4A03A 4QQRA 1E7QA 1W8DA 3KO8A 5HS6A 1B26A 1X14A 9LDBA 3AI2A 2EW8A 3I9NA 4YAIA 1IE3A 3RUHA 5IFLA 3AI1A 1E6UA 1NHGA 3CZMA 3RUDA 3WGHA 3S2GA 1O95A 4L75A 2RIRA 3ETGA 4EZBA 1QG6A 2HRZA 4ND5A 3NTOA 5A02A 1V8BA 3QE3A 1Q0HA 1N92A 4E12A 2AG5A 5B1YA 5L3ZA 3PWSA 1HDOA 3K92A 5THQA 1Y8RB 2G5CA 2OOSA 3OETA 2ZIZA 5G0WA 4L9RA 3QWFA 1X7GA 2P4QA 2YQ4A 5DNAA 1K0UA 2EGGA 3KLPX 3INRA 1PZFA 3F4BA 3DBHA 2EKQA 1DIGA 3QWBA 2BFMA 2SCUA 2J3KA 2R00C 4BKOA 4UEJA 2Q2QA 1CYDA 1AUPA 2P2SA 4D79A 4F6LA 3JCZA 2DFDA 2O2YA 3ZNNA 1R12A 4YR9A 3WMWA 3K6JA 4BL5A 1V0JA 2FSVA 3GPIA 3R1IA 4EJ0A 1I5RA 1R66A 3RFXA 1T4DA 2ILTA 1HSOA 1B15A 3I9LA 3JQ8A 3ZV5A 4LCEA 3U3XA 4K26A 1P74A 4CV1A 2IEBA 1GAEO 3I9KA 5I8ZA 4J2OA 3ICCA 4WEQA 4KWHA 1I2BA 2GD1O 1E7MA 1GD1O 1Q7BA 2J3JA 3E5MA 5CG2A 1W4ZA 1VPDA 4K6CA 3PEFA 3P2OA 2NTNA 3JQCA 2WE7A 1A5ZA 2YFQA 5DCWA 3D3WB 1LI4A 3W4KA 1AGNA 3KUXA 4PG8A 5COAA 3DOOA 1KC3A 4BNHA 1PGOA 2AQIA 2AXQA 2PGDA 5F5LA 1ADBA 1E3WB 3JQFC 3P5SA 1Y7TA 3GHYA 3QLJA 5KKAA 4NH4A 4Z9XA 4B7UA 4BMNA 5DZSA 4E4YA 2GN6A 1ZK0A 2NV6A 1L1FA 5TLSA 1HDXA 5IN4A 3LC1O 1H6DA 2BLLA 1JW9B 2OL4A 3VH1A 1SNYA 3D4OA 4FFNA 1BDMA 2IODA 4IUYA 5JPIA 1NASA 4JBHA 1W0CA 2VWHA 1SB8A 4IJUA 4IDAA 2PV7A 2EKPA 4R1UA 4XQEA 4BKUA 1SOVA 3IAHA 5DCYA 1DLJA 5EIOA 5A3VA 3TSCA 1LU9A 1ORRA 4PVDA 4WGGA 3RCBA 3OICA 2VHWA 4TVOA 3K73O 1AXEA 3K2BA 5BT9A 4EEZA 1F14A 3FWNA 1DIHA 3JQEA 1CWUA 3NX4A 2NTVA 3IJPA 3TOZA 3PZRA 3I23A 3WGGA 2W2KB 3PQFA 2W8ZA 3B70A 1L7EA 2AEJA 3PWKA 4D7AA 3U4IA 2P9CA 2V6GA 4YAJA 2DBRA 3V2GA 5B4VA 3M1AA 1QSGA 4YRAA 2OORA 4B4OA 3RKRA 1D3AA 2CZCA 2BGMA 1KC1A 1JVSA 2C20A 4FSHA 1T1SA 1U3WA 4NBWA 3L07A 2DBVO 3KB6A 3O4RA 2YDYA 4RPJA 1TI7A 2FP4A 4UREA 4NG5A 5JDCC 4W7HA 2B5VA 2ZTLA 3S2EA 4CLRB 3IDSA 4B4VA 2NVUB 4J3FA 1HKUA 3ZWVA 5IDWA 3DO5A 1DC3A 4HNHA 5DBIA 4QXMA 3TL3A 1IULA 4X54A 4E2ZA 3AY7A 2ET6A 1V9LA 3JYLA 1ML3A 5JDIA 4RPKA 3WQRA 4PLYA 2VQ3A 2P5UA 4TRMA 2PH5A 2GLXA 1DDOA 3WGZA 3W4IA 4J4TA 3CIFA 1HDCA 1NVMB 1PZEA 4O59O 3CZRA 3DBRA 3R3JA 3WGTA 1R4NB 4BO3A 4WNIA 2YV2A 3GOHA 3FR7A 1NX6A 4UUMA 3EYWA 4ZQFA 1GY8A 2BI8A 2WDZA 3C7AA 1MX3A 3TWOA 4H15A 3GEGA 4S3MA 3JD3A 4NBUA 1O0SA 4WKGA 3WR5A 4IGFA 1RKXA 3MJVA 4CMIA 3N58A 2E6UX 2YFHA 3WGYA 3GC6A 1PWXA 4JN6B 4B4WA 3ROMA 1SOWA 3GGGA 2JCYA 1EDOA 3CSDA 1GCOA 5JC1A 2VHZA 1Q2XA 3ZU2A 1YBAA 3JQ7A 1LNQA 2W2LD 1FJHA 2VRBA 4XEHA 1AN9A 4KUEA 5TSDA 2C2XA 3ROQA 3RWBA 3WJ7A 1I0ZA 4E5NA 2AHRA 3GAFA 1XKQA 3GF4A 4HNGA 4AVYA 1KEUA 2GNAA 1E77A 2X58A 3OH8A 2NQ8A 5JSFA 2X0NA 2HAEA 4XWYA 4I9NA 5JY1A 1NWCA 2C0CA 3L77A 4GI2A 4RF5A 2PGJA 1VL6A 4CMGA 3GVIA 1MG5A 2BKAA 1W73A 4NJMB 3WNVA 3ANMA 1LRJA 4DPMA 4BNGA 3PGJA 1HF3A 4ZD6A 3K31A 3NYWA 1B0AA 3ZWCA 3ZU3A 1GEEA 1EE2A 3L6DA 1C0KA 3W1VA 4BO5A 2WYUA 1N7GA 4WCFA 3VZRA 3KM0A 3B1KA 3BA1A 3E1KA 1L7DA 4ONEA 4R01A 4RF3A 3FNGA 4XYMA 1NNUA 4IDBA 4HKTA 2VN8A 1J49A 4KMSA 1E3LA 1F8GA 1YL5A 1R0KA 3H5NA 4L4RA 1R4MA 4CUJA 1EBUA 1YDEA 2O7QA 4KUGA 1I3KA 3QQPA 4HP8A 4JJFA 4A26A 3A1NA 5CEEA 1HLDA 2NQTA 4PLTA 3JQDA 4G65A 4JBGA 2Y1FA 4PIVA 1H9BA 3CPSA 4W99A 4Y6PA 1YBVA 4A2CA 5A06A 1G1AA 2IYPA 4GH5A 4BO7A 3HDJA 3ULKA 4CR8A 5L4LA 1I32A 2J6IA 2YY7A 5DBFA 3S2IA 2V6MA 5TNXA 1OBFO 5DP2A 4R54A 1BVRA 1JKIA 1X7HA 3ITKA 3DXFA 5KVSA 4I9UA 2J5KA 1Z6ZA 1ZVMA 2PD6A 2PNFA 2QYTA 2WD7A 3CXRA 5JY6A 4XYEA 4FFOA 4M49A 3E5RA 3KHUA 3U9LA 4EJMA 1NR7A 2Q50A 3KYBA 1HZJA 1T2AA 1ZXLA 2ZCUA 3LF1A 2VUUA 1IB6A 1WW8A 1XU7A 2VUTA 4NDNE 1AE1A 4A7PA 3I6IA 1GPDG 5ICMA 3CKYA 2DLDA 4WCFC 2BELA 4YTEA 3RD5A 3SJUA 2VWQA 1GZ4A 2GN8A 1H0KA 2QQ5A 1HDGO 3E9MA 3EHEA 4HADA 4GWGA 2CVQA 3O03A 1EDZA 1HE2A 1ISFA 1BXGA 4L76A 4JIGA 3JD1A 1K89A 2EF1A 4CMAA 3BHJA 1XWFA 3CEAA 1UZMA 4C7KA 1YKFA 4JROA 3UVEA 3DMTA 4NBRA 3VH4A 1PS9A 2IE0A 4IS3A 3Q0EA 3U4HA 5T64A 5IAAA 3RUEA 3DOCA 3GGOA 3PRJA 1C3VA 1BXZA 3C7DB 4MVJP 3WYBA 1T1RA 4OMUA 1JKJA 1E7RA 4YVFA 4CUKA 1MP0A 2DTDA 3EW7A 3X2FA 4J16A 4Z0HO 3MOGA 4P22A 2O4CA 3W6UA 3F5QA 4TRNA 1XGKA 1QP8A 1XEAA 3G49A 1MC5A 1AHHA 2OP1A 3NUGA 1QMGA 3IL2A 3ST7A 3C24A 5IZ4A 4CM9A 1NR1A 1OFGA 2G0TA 3I1JA 1WDMA 3C8MA 4FGWA 1HE5A 4LMPA 2IEDA 2GYYA 1QRRA 3IUPA 4MIOA 2G76A 4MIEA 3AU8A 3VPHA 4B3IA 5L4SA 1NFRA 4NI5A 3RI3A 1Y5MA 2DPHA 2B4TO 5AXAA 3VHRA 3AOEC 3QW2A 3FTPA 1ENPA 4YBZA 3AW9A 2XAAA 4YJDA 1O8CA 3AY3A 4AJKA 2DUUA 3SEFA 2WYVA 4IDCA 4W9NA 4E5MA 4NHEA 3COSA 2GZ3A 4IGEA 1S6YA 1ZW1A 3GFBA 4YAEA 4GKVA 4DA9A 5L40A 1FDWA 1UUFA 4TRJA 1IZ0A 3M6IA 4U0JA 5H83A 3WLEA 3AK4A 3KLMX 1WPQA 2Q2WA 3Q9NA 2WSBA 1QV6A 1C1XB 4XYGA 1K6JA 4OL9A 2ZTMA 3QIVA 3RUCA 3ZHZA 5KJEA 4ZQHA 3LT2A 3KV3O 3GG2A 2X23A 3QP9A 1CEQA 2C54A 2HUNA 2NVWA 4TWRA 1YQXA 5HM8A 4A27A 4D41A 3WMXA 6LDHA 3KYCB 3EC7A 5TX7A 4BB6A 4CR6A 5IN5A 1QR6A 2B83A 2PTGA 1XG5A 3KYDB 1EFLA 3TRIA 5JFOA 1PZHA 3ICPA 3ZZNA 3L4BA 1NHWA 4NFHA 1PWZA 5JMWA 4EUFA 4NJOA 4DYVA 1YOVA 3NJ4A 1F0YA 1CDOA 3JQBC 2W2LA 3VVBA 5MDHA 3E6AA 1LXCA 1X0XA 4YA6A 5TT1A 3MJSA 4BNZA 2X0JA 4O0LA 4QO8A 4CQLA 1VI2A 3ITDA 3L9XA 3ZWWA 1ADFA 5JYEA 2AE1A 2JJYA 5F3RA 4J49A 1D8AA 2RH4A 1HZZA 3KRTA 1DLIA 2X6TA 4Y67A 1GTMA 1GPJA 4JK3A 4CUZA 1IYZA 2CVZA 3Q2IA 4RF2A 3ZV4A 3GDOA 3C3XA 4P8RA 5FF9A 4L0QA 4J1SA 5A5FA 1ZMTA 1XR3A 2DT5A 3DZJA 4WCDA 2C07A 3NDIA 5BSFA 1H5QA 3MEQA 5FFFA 1MA0A 1DSSG 1OC4A 4FJ2A 1KVTA 3LLVA 1B14A 5FI3A 3GVHA 2B69A 3JD2A 4D3SA 4DLBA 3H9JA 4LGVA 3UXYA 3A4VA 3EMKA 3D4PA 1HL3A 2D5CA 2ZTVA 3OJOA 5TQVA 4GKBA 4J0EA 3WJAA 4J4BA 2FN7A 1JN0A 1OMOA 2HMUA 4QO7A 5CPFA 5EESA 4B4UA 3IKVA 4PLCA 5A05A 1R15A 4LK3A 2PFGA 4IBOA 1BMDA 3OEWA 1NAHA 3E48A 4L8VA 1VL8A 2WWRA 4OXYA 4W82A 2JD1A 1G0NA 1BDBA 3A9WA 1U5CA 3KEQA 4Y98A 3LLSA 4MKZA 3DDNA 4BO2A 4CQMA 1UP7A 2Q99A 2VOJA 4J4HA 4NBTA 2UDPA 1SEPA 4B7CA 1MXFA 2FR8A 4HX5A 4ALLA 5A9RA 4DGSA 1GYPA 2VYVA 3F6YA 3FNEA 3WGQA 3JD4A 4CODB 2GO1A 4NQZA 5BNFA 2NLOA 4D46A 2I99A 3ZNQA 2C82A 5DT9A 4F6CA 1QYVA 4QEDA 2D1YA 3WLFA 2BF7A 3H3JA 2BFOA 5JAZA 3JTMA 3SJ7A 4WOJA 4RVHA 3MWEB 4Q9NA 2EP5A 1XLTA 5ENVA 3VAZA 5BQFA 3FHLA 2ZYDA 1ZXBA 2HMWA 2FR1A 3V1UA 4YJFB 1EVYA 3I9MA 4ZGWA 5A9SA 4CR7A 2X1HA 4AJ4A 3TN7A 4A0SA 6ADHA 1LLDA 3FR8A 1ZIDA 1LRKA 2B35A 1B3BA 1E7YA 2XXBA 2JKVA 2HMTA 3FBGA 2PKQO 4G81A 1MB4A 3OQ1A 4MJLA 1B8PA 3PJGA 2I9PA 1PTJA 3FTNA 3EVNA 2EJWA 3ZN2A 4N18A 5DCUA 3LT4A 1U3TA 1X15A 5G4KB 4EI2A 3WGIA 3ZNOA 4HXYA 4WJZA 3WGOA 4BO8A 3VPSA 2H6EA 4OSPA 2PK3A 1U4OA 3HDQA 1SPXA 4IJVA 3G1UA 2RH8A 3FNHA 4RDIA 3RU9A 4BGVA 4OQYA 3DBLB 3HDHA 4BS9A 3RUIA 3WB9A 4K9DA 2UUPA 4N5LA 4Z0PA 1JLLA 1KETA 1UXJA 1BTOA 1QORA 2DBQA 5L51A 2D8AA 1JQBA 4NFYA 3HDYA 3QVXA 3H2SA 4D45A 4QUKA 2V65A 5C7LO 5J23A 1PZGA 1PU2A 2YJZA 3I83A 1U8FO 5CDTA 3IOYA 2RCYA 3TF5A 4RZIA 1EUDA 1I3MA 3IP1A 4YACA 5IDQA 2H63A 4CM1A 2R00A 2PZKA 4CLHA 1RWBA 3C85A 1U28A 2EXXA 1LQUA 3WTCA 1M76A 4WK6A 1H6AA 1XU9A 4NFSA 4Z9YA 5DOVA 5FWNA 1K5HA 1GL3A 5KVQA 1GR0A 1A72A 4O6VA 1ZKMA 5EMHA 2P9EA 1R37A 5GZ1A 2J8ZA 4NR0A 3VTFA 5TJHA 2DVMA 3ZI0A 3CE6A 3NDJA 3CUKA 1O89A 3I4FA 3KOUA 4TVBA 3DTYA 4YT5A 2XXJA 4BHTA 1A7KA 4R3NA 2HLPA 3TL2A 3D5TA 3H9QA 3K96A 4KDFA 4LISA 1NQOA 1E3IA 3TFQA 2E37A 2HKIA 1QLHA 4TRRA 1DJNA 4D0RA 5JW6A 2I66A 2YHIB 4II2A 3HNPA 1U1IA 3OSUA 1MG0A 4RVSA 3FWZA 3JQFA 1KY4A 3E9NA 5DULA 4DQUA 3BTOA 1HE4A 4GLLA 1D7OA 1ISIA 2BFPA 5IDYA 1J4AA 4D3DA 1ZH8A 4MPDA 4NPCA 1SBYA 3DZHA 4RVFA 1C0LA 5GY7A 3S8MA 4KWIA 4GLOA 3ZWMA 4JX8A 2VWGA 1ONNA 1CQJA 4R69A 2J5QA 2O2SA 1JVBA 4CMEC 1QYXA 4II3A 4ITUA 1LLUA 1Y8QA 1YB1A 2FMUA 4AJPA 1I3NA 1BRMA 3ZWBA 3PGXA 2EJVA 2ZKLA 3DOJA 2GZ1A 3PIIA 2GPTA 5IZCC 3DBVO 4XRRA 3WTBA 1KBZA 2B4RO 1I24A 2QW8A 3PXXA 2QX7A 3INTA 1BSVA 3ZV6A 3OM9A 1VJTA 3GVXA 1HEUA 3ZNPA 1YH3A 3INGA 3GUYA 2HO5A 5TF4A 1DFHA 2CVOA 3GVPA 3DR3A 2O3JA 1E1LA 2OO5A 3OIFA 1KEPA 5JLAA 4BQRA 4KQXA 5AYVA 1H93A 3AI3A 4OKNA 3Q1LA 3U0BA 4J1NA 5JDCA 2W98A 4WPGA 3T4EA 3IMFA 4NU6A 4O5OA 4ZQEA 5KIAA 2O50A 4BB5A 3ASVA 3ENNA 3D3WA 4BQPA 4W6ZA 4MP3A 5KJCA 5A4DA 3ZDFA 1GU7A 4CM7A 4P38A 5A04A 3UCXA 1GQ2A 2YV1A 3VPFA 1OOEA 4I08A 1NBOA 2P91A 3LF2A 4FQ8A 3HFGA 1HDZA 1VLLA 2BGKA 4IDDA 2WE8A 2ZCVA 5I7FA 4DIBA 3I5MA 4N54A 3I52A 3AU9A 1ZUD1 3ABIA 3GQVA 3HG7A 3BHIA 3L0DA 3PQDA 1PQWA 2X5JO 4HFJA 4CM9D 4E31A 1P1IA 2P68A 3DZGA 1LLQA 4ND3A 4UVGA 1NFQA 3AM4A 2EGHA 4YJGA 5K6AC 2VRCA 1HXHA 2A4KA 1JU9A 4R68A 4RPHA 3VKVA 4AJOA 3PHGA 1WP4A 5KOIA 5G2OA 1VC2A 3EY4A 4BO9A 5L7TA 3MZ0A 3OFSA 4JCOA 4DWVA 1E0DA 1UP4A 3VOSA 4CMCA 2GASA 3PIDA 1NAIA 4ALJA 4MVJA 3JQGB 3C1OA 2VOEA 1V3UA 4ALKA 2X5KO 3ZWXA 1DFIA 3L4SO 3O38A 4YQYA 4CLOA 2IXBA 3DBRB 3W8FA 2GN4A 3GY0A 3PHJA 3D3EA 2NACA 5F1OA 4ZU3A 4YYZA 3JD0A 3LU1A 3ASUA 2ZYAA 5HRUA 4FS3A 2Y99A 4E32A 3BMNA 2I67A 5KKCA 2Z95A 1HETA 4ND2A 5AOVA 4CMIB 3AFMA 1N9GA 2VYNA 3DC2A 4YDRA 1SZJG 2IZ0A 3VH2A 3IIEA 1WZEA 1J0XO 1RYEA 2VUSA 1XHLA 4UVHA 4A5OA 4M87A 5JAMA 1YONA 4EITA 2AG8A 1IPEA 3AOGA 4MVJM 2AQ8A 3WSWA 1KVUA 3JQ7B 4U0KA 1HRDA 5G4LA 2I76A 3LC7O 5EN4A 4M54A 2IZZA 2DFVA 5F21A 3STHA 2ZB4A 4AJIA 5CP8A 3NT2A 4W4TA 1ADCA 3PFWO 4E6PA 3OBBA 1BHSA 1XA0A 2ZATA 2HRBA 4WASA 4JJGA 1LEHA 2B36A 1A9ZA 1T2FA 2VWPA 2C59A 3ROKA 1U2DA 4PLZA 1YWGO 4XX0A 5L95A 3RIHA 5I7EA 5ES3A 5TT0A 2O48X 1C1DB 3KBOA 4PZDA 2QRKA 1HDYA 4PZCA 2CNBA 3BMOA 2HQ1A 1KVQA 4CPDA 4Z0TA 2WMDA 4RQTA 2F00A 3K5PA 1M2WA 1IL0A 3HHPA 5T8KC 5DN9A 3WSVA 4D42A 1WAMA 2EIHA 1LC3A 3NKLA 2BGLA 4FIZA 2XPCA 2AEMA 3G1TA 3GDGA 3GA0A 1O9BA 3U09A 3I6QA 4QECA 3WFIA 4MP6A 3GHHA 1C0IA 3VPGA 1PJTA 1DXYA 4DUPA 3U4CA 3OQBA 4R3WA 3G17A 4PG6A 2GERA 1XYGA 4EUEA 4C4OA 4QFDA 4DRYA 1R4MB 3UH1A 4EW6A 3RQSA 3RU7A 3KXDA 3OEYA 3TDKA 5IJZA 3CH6A 3HE3A 2V6FA 1QYWA 5HS4A 3SXPA 1GUYA 3BTVA 3B1JA 1I36A 4PFJA 4BVAA 4FGSA 5CDSA 3X2EA 4B79A 4KZPA 4FOOA 4MP8A 4QT0A 2PKRA 2W4QA 1E5LA 2D3TA 1P1RA 2CDAA 4ZQBA 4BNWA 3NTRA 3L6EA 4BO4A 3A06A 2D0IA 3NEPX 4ESOA 1DEHA 3K8ZA 4CQMD 5K9ZA 4BNUA 1B8VA 2WD7B 3BXXA 3G3EA 2AEFA 2LDBA 3VC7A 3V5NA 2O3RA 3QWAA 2VYVD 1VM6A 3PHIA 1A7AA 2I6TA 1NYTA 4GVXA 2HSDA 3WICA 5AVOA 3F4LA 3GN2A 3T4XA 2GDZA 1F8FA 5A9TA 3JV7A 4RPGA 4YQZA 4CLEA 3S1LA 2DKNA 5JCJA 2EWMA 4KUHA 4IQGA 1FK8A 3E9QA 4IJWA 3JSAA 2PZMA 4KQWA 1CQIA 4FD3A 1PJSA 4WE3A 1ENZA 4CL8A 1BXGB 1ZK4A 5CDGA 2VZ9A 1TT5B 4J9UE 1B2LA 2G17A 3UCEA 3PK0A 2DPGA 2HJRA 2QZ9A 3F46A 1SC6A 3HN2A 3AOEA 3JQAD 4OIMA 5ER9A 5KVCA 3UICA 4LSWA 4RO0A 4R9RA 4WLVA 4URFA 5CEJA 4CL3A 4GMFA 1Z7BA 1WDLA 4NK4A 4HBGA 4BO1A 3DAFA 4R1TA 2QHXA 1DIBA 2D2IA 4CLDA 1KVRA 4M89A 4FFRA 1BXKA 3P7MA 4DMLA 4DYDA 1E3SA 1PQUA 4QFCA 4UUNA 2UVDA 1BW9A 5EPOA 1EVIA 2ZK7A 4CM8A 1YE3A 2Y0CA 4RLSA 3QHAA 2RHCA 5LC1A 3AUSA 4H16A 1UXKA 1QLJA 2OUIA 4R1NA 1TLTA 4JP2A 4AJJA 1JKFA 1PEDA 1DRWA 4P4LA 1XIVA 4FDAA 1XQ1A 4E2YA 1OC2A 2RAFA 4FOSA 1E92A 3BYZA 1T24A 4E5YA 4ZA2A 3UHAA 4A73A 4PLVA 3KSDO 1VJ1A 1JDJA 1LDYA 2X86A 3E03A 3PI7A 1P45A 3ZCXA 3JQBA 1YGYA 2JL1A 4U8GA 5BSGA 2GUGA 3N7UA 3ZW9A 2Y68A 1TA4A 4OXKA 4DPKA 3GRKA 1U3VA 1GUZA 1ISGA 1A71A 1K6XA 2VNSA 1DOHA 1I3LA 1EVZA 2IYOA 1N1GA 4UVDA 3WQQA 5C37A 1RM5A 5EL0A 1C14A 4TZKA 2HK8A 2JD0A 3GZ4A 3KSUA 3NV9A 1GUFA 2Z5LA 3R0IA 3PDUA 4J2HA 4WUVA 3PPIA 3PTZA 2E49A 5FYDA 1UJMA 2D4AA 3MOIA 1J5PA 3WBBA 1LSJA 1PQPA 3QWHA 4IMPA 4G5HA 4IZHA 4XB2A 4MINA 4EUHA 1ULUA 2HMVA 3FPLA 3NGXA 4YJHA 3DL2A 3T7EA 1LLCA 1EBFA 1IUKA 2C5AA 4LVUA 4GAEA 4B3JA 5A3JA 3W4JA 1WNTA 2P9GA 2E48A 2POQX 4YT4A 3AUAA 3DFUA 1YOVB 3ON5A 1C1XA 3H3FA 3VZQA 4XRGA 3JQ9A 4NK5A 5CHEA 4WECA 2ZJ0A 1YB4A 2CF6A 5H82A 3SBOA 1LX6A 1ID1A 1UZLA 3CINA 4UVEA 4BNYA 4YAGA 4M86A 3FNFA 5TRTA 1M67A 3Q6IA 3PJFA 2D5AA 4ID9A 1Z75A 4H7PA 1ONOA 3EZLA 3VZPA 3ZW8A 3RC2A 3OA0A 4P4GA 3M2PA 1ZSNA 3IC5A 1RPNA 1KS9A 4HWKA 5BNIA 3JYQA 2GR9A 4IXWA 4EBFA 3DZIA 3RKUA 1Z74A 1IOLA 1YXMA 1EMDA 3KYDA 1VE9A 2FOIA 3GH3A 4EEXA 2OBYA 4IDEA 1A4UA 3SLGA 4OGWA 1PJ4A 4RF4A 1E5QA 4BGEA 1DB3A 4B8WA 4YT8A 4XYLA 1Y81A 4R5MA 3NRCA 4TMFA 2AMFA 4LN1A 5ITWA 3DZBA 1ONPA 2Y1GA 3FD8A 1IY8A 4YPOA 1EUCA 4GX2A 2ZB3A 5I9MA 4ZQGA 4BKRA 4F46A 1P31A 5JO9A 4KDEA 2YW9A 4N5MA 3HZZA 3LZ6A 1VL0A 4BNVA 1RM0A 1CERA 4ALIA 1GEGA 5HWSA 1R16A 2WYWA 2R2GA 3RBXA 1C0PA 3JQ9C 2C2YA 2E4AA 5AXDA 1UXHA 2EHDA 4J90A 4AFNA 2W90A 3H5RA 4ILKA 1ULSA 3R6DA 4R1SA 4LCJA 4BNTA 2FR0A 3W6ZA 2EV9A 1X13A 4PRLA 3ONEA 4UUPA 1TB4A 3QV1A 5JO0A 1HYGA 3SC4A 5THKA 3L6OO 2TMGA 4MIYA 1P1HA 3WFJA 2ZB7A 4LMRA 3RBZA 3GLQA 5I7VA 3F47A 1QV7A 5HBRA 4DTIA 2EW2A 3DFZA 3NDRA 3I3OA 5H81A 2J5RA 3L9WA 3N74A 3ZGYA 3IP3A 3QA9A 4GX5A 3PLNA 4PLWA 3ZHXA 3ZWAA 2OXIA 4Q39A 3UW3A 3QVWA 9LDTA 1DIRA 3GVCA 3K2EA 3KVOA 3O8QA 4JXKA 2NVBA 4B3HA 3TZKA 4FW8A 3PHHA 4CJXA 1P33A 5G0UA 1B8UA 1GCUA 2O3SA 1ZSYA 3LK7A 1UXIA 1E7SA 4GGOA 1XSEA 5ER6A 4RORA 4ALMA 1R6DA 2IXAA 2A9FA 5L7WA 2Q1UA 5EERA 4XDYA 5JMPA 4EGFA 2PZJA 2VRCD 5DBGA 1PJ3A 3AFNA 3I4CA 3RFVA 4BO6A 1V3VA 5JS6A 5A03A 3TNLA 2OBNA 2PKQP 3D4NA 3JQAA 4QTZA 2WEKA 2GN9A 1RM3A 2VT3A 2NU8A 1MFZA 3CTMA 1SEVA 3WYCA 4YCAA 4MVJD 4U7WA 2IDZA 2I65A 2JFFA 2ZTUA 4Y6SA 1TVEA 4DREA 3OJFA 2EG9A 3VDRA 5BSEA 4KOAA 1H94A 5I8WA 3GZNA 3ZH2A 1G0OA 5F5NA 8LDHA 1Z82A 3C7CB 1O94A 1NP3A 2CMDA 3PDJA 3WS7A 3SVTA 1PR3A 4CM4A 2YUTA 2OP0A 4XQ9A 2VNAA 3VTZA 5KJFA 1WWKA 2NUAA 2HMSA 3OJ0A 4TKLA 5JAQA 5JXWA 1M75A 1KERA 1J6UA 3BMCB 4OO3A 4BGUA 3B1FA 1VKOA 3H7AA 4JNKA 4OM8A 4FB5A 1K3TA 1WVGA 2VYND 1D1SA 1XCBA 3TJRA 4MO2A 3BMQB 5EJ2A 3VPXA 1ZFNA 1Q7GA 3F9IA 3LYLA 4W7IA 3HWRA 1I8TA 5G4KA 4D0SA 1ZSVA 1GFSA 3TZHA 4YEDA 3KEOA 3I9OA 4BMSA 1IHYA 4J9VA 1I33A 1P0FA 4J7UA 2C7VA 1PGPA 3H4VA 3OJLA 3UOGA 3PYMA 1MUUA 3TZ6A 4AL4A 1H9AA 4AJNA 4BNFA 5AXBA 4FJ0A 1B3RA 5A5EA 5ICSA 1G6KA 2GZ2A 5ENDA 1AHIA 4CMEA 5IXYA 1NPYA 1XELA 4FC6A 3A28A 3HUDA 1ISMA 3QWIA 1I2CA 3UGKA 1DBVO 3D1LA 3KZVA 3RC9A 2XOXA 1YQDA 3LVFO 3E82A 4PG4A 1U4SA 4S1VA 2Q1SA 4RLHA 3WQSB 3D64A 5G0VA 5IZCA 2Q1TA 3OP4A 4XJTA 4IDGA 4HY3A 3DTTA 4GX1A 5DP1A 4UAGA 7ADHA 3HADA 1AXGA 4DBZA 2IZ1A 1EE9A 4U6SA 4DMMA 1LTHR 5CEFA 1E1KA 1MLDA 4KTTE 1ISHA 1WLYA 4J0FA 2NU6A 3LQFA 1UDBA 2AQKA 4M55A 4I5FA 4RCVA 3WDSA 3BIOA 2VTEA 5TGDA 4IZIA 1U9JA 1PS8A 2CUKA 3DBHB 4I5DA 4Y9DA 1GADO 2Q46A 3GAZA 4I5GA 4NMHA 5KCZA 1GQYA 4Z6KA 1GDHA 4UUOA 1Y9AA 4LSMA 1PR9A 1UDAA 5T57A 1Y8QB 2CY0A 4GWKA 3LC2O 1YJQA 3H6KA 5C7IO 2YHIA 1Y8RA 2B0JA 1PJLA 1LDGA 3DMYA 3JQ8B 1PIWA 4BNIA 3EK2A 1U2GA 3ZWPA 1HTBA 7MDHA 4N7RA 4I9HA 4PLGA 4INAA 1DC5A 1P1KA 2CFCA 5KVVA 1A27A 1SB9A 2A92A 4BIIA 1DC4A 4WLOA 3AUTA 4MKRA 1KEWA 3W8DA 5I9LA 1LSOA 4E0BA 4L73A 5JCJD 2VZ8A 3VH3A 4GPD1 1PJQA 4U6QA 1E7WA 4IJKA 1YDWA 1ZK3A 5K0ZA 3TFOA 1BWSA 4E5PA 2H1SA 1GV1A 1GZ3A 1DAPA 2YDXA 3RC1A 5K6AA 5I9NA 1EQ2A 4JBIA 4OH1A 4B8ZA 3DHNA 3WXBA 1X1TA 1DPGA 4TROA 2ZJ1A 1ZJYA 2OZPA 3TOXA 4EDFA 5KNLA 2FPGA 3ADPA 3IJRA 2AQHA 3EZYA 1ARZA 1LBEA 1N7HA 1UZNA 2Z1MA 3EUWA 4PVCA 3QY9A 1H2BA 4BNLA 1W6UA 2WTBA 4NU5A 3TPCA 3FPCA 2PR2A 1SO8A 5T6BA 2P5YA 3PJEA 3RUFA 1ENYA 1E3WA 2Q1WA 3NTQA 1GYRA 2B4QA 3SC6A 1DC6A 2FWMX 4K6FA 4MVJG 1WMAA 4UULA 2ZQZA 3E18A 1V35A 1T2CA 3H5AA 4DXHA 3EVTA 1PX0A 4PLHA 4WOKA 1T2DA 1P1JA 3DAPA 3I9JA 4GGPA 3RC7A 3WOHA 3GN1A 3DZKA 4IY1A 2OHXA 4N5NA 3Q11A 1S7CA 2VHVA 1N8KA 3CMCO 4AICA 3DHEA 1BGVA 3G0OA 1H6BA 4GSLA 3D5QA 1VSUA 1LDEA 1UP6A 3BTUA 5ITVA 2C7GA 4PLFA 1QXSA 2EKLA 1MFPA 4IXTA 5JE8A 2A35A 1Z45A 2Y1CA 4BUCA 5JNLA 1JA9A 4ZRNA 4XA8A 2I5PO 1Q1NA 4YJGB 1E3EA 5AQ1A 2H5LA 3HQ4O 4J7CA 4XR9A 1P77A 1E6WA 3O26A 2ZB8A 1V6AA 2NTJA 3ZWNA 4BMVA 1KEVA 3MCVA 5MGBA 1NFFA 4J1QA 2W2KA 5TC4A 2AW5A 1Z73A 2JAPA 4PCVA 5G0TA 4Z3KA 3H8VA 3D7LA 3AM3A 3RAJA 4XYBA 4O1MA 1LC0A 4CM3A 1LSSA 1JTVA 2E82A 4GMGA 3WYEA 3VVCA 4NBVA 3FSRA 4FBGA 1Q0QA 4Q3EA 5KWEA 4CLOB 1YRLA 2P4HX 2Y05A 4BOYA 4YRDA 1VJ0A 3C1AA 4XIJA 3OIDA 4CV0A 1NQAO 4MKXA 1M66A 3WX0A 1RM4A 3AY6A 4E33A 2G82A 4CLRA 3AM5A 1LRLA 3UUWA 2X0RA 2NVUA 2H9IA 3FF4A 1P3DA 3BMNB 1F12A 4DBVO 2BMAA 3RBVA 1B7GO 3KTDA 5T8KA 2ZQYA 3F3SA 1N9GB 3DZFA 3VKUA 1YB5A 2X22A 4OAQA 2QYSA 1I01A 1JWBB 2GSDA 3UKOA 1BVUA 1YBMA 1I30A 3JQGA 2AA3A 4L4SA 2X9GA 1P9LA 1E3JA 2NM0A 2DAPA 1DIAA 2I3GA 4LW8A 1CF2O 2TMDA 4OOFA 1R4NA 4E30A 5IF3A 1PGJA 1Y9EA 2DQ4A 5IDXA 4HUJA 4IS2A 2UV8A 4XIYA 2FSSA 3UCFA 3ZHYA 1WXDA 1ZJZA 5BSHA 1PS0A 1UAGA 2GF2A 5L4NA 4GVLA 2DU8A 5LDHA 4HV4A 2CD9A 2Q3EA 3JYNA 5DF1A 3CMMA 3HB4X 1ZNQO 1QYDA 2DBZA 3NAQA 2EERA 4M8SA 1U7TA 4MOWA 2EP7A 2FRDA 2GGSA 3MWDB 1NTOA 3BMOB 3FI9A 4PLPA 4E3ZA 1FDVA 4IINA 2JFHA 1HT0A 1F17A 5CFZA 1HYEA 3FRJA 4FN4A 3OECA 5JAIA 4RZHA 5DDIP 3GG9A 3BTSA 3TZQA 2RHRA 5LCXA 4XKJA 4OHUA 1WZIA 3P19A 1VSVA 4HFMA 5JDIC 1U5AA 1NVTA 5L45A 4NIMA 4J91A 4FR5A 3OA2A 1PGQA 1ZEJA 3GEDA 1EZ4A 4TZTA 1MGOA 2QRLA 4WCFB 3LT1A 1YL7A 3RVDA 5B4TA 4U5QA 3H9UA 3ZU5A 3ANNA 4KTVE 2QG4A 4CM6A 4J7XA 1JAXA 4E2XA 1C1DA 1NPDA 5TS3A 3G79A 1NVGA 3UFXA 5BR7A 1FDSA 4AJ1A 4WNCA 4XGNA 5FI5A 3DEYX 3ANLA 3OF2A 4NJMA 1JAYA 1PJ2A 4XCVA 3SLKA 2X9VA 2YHUA 4C7JA 3FCOA 1Q7CA 3OJEA 4IM7A 3QRWA 3U62A 1SMKA 3E8XA 3HSKA 3V1YA 1HLPA 1B16A 4ZN6A 4OJNA 4CLXA 1N5DA 1CETA 2OGUA 4I8XA 5B12A 3KETA 3GUCA 3AJRA
chains in the Genus database with same CATH superfamily
4HDCA 2CFTA 2HI0A 3RIGA 4M8IA 2FJPA 4LRUA 2VXCA 3DV0A 2ZEJA 1NQ5A 5K3FB 1M2OA 2XLCA 2XYRA 4ZCPA 3ZGNA 3ZCRA 3P2YA 1PL7A 3JZFA 3ICQB 2JRLA 3L8EA 5FBWB 5C5CA 1HA3A 1OLXB 4TT8A 4WERA 4R41A 1RYDA 3RYHB 4DPLA 3AHGA 1K4KA 4KH1A 4PBSA 2VJDA 3ZW7A 4PFSA 2OCBA 2R6AA 2PL3A 1ZHHA 1DRVA 3KS9A 3QBDA 4RGBA 5JS1A 2YJGA 5AW6A 4I1PA 3OWOA 2BGGA 4OBEA 1KYTA 4RMGA 4YP6A 1PG2A 4ZOCA 1VE6A 1X92A 4MHTA 3BUSA 4AX8A 4ZVOA 5JRJA 5JWHA 2WT9A 3EG9B 5FPQA 2C29D 1M6HA 1OVMA 4A6EA 2JHGA 2QX8A 2CMHA 3KEMA 1ZWKA 3Q3CA 3L5OA 4DEYA 4Q3NA 2PBZA 4F5DA 1FLVA 4I5EA 2BFDA 3A11A 4B6PA 1WUKS 4R9SA 4RAQA 2HH9A 2Z8YA 2YXPX 4MI9A 1KZHA 1E1NA 3ENWA 1W581 2XR1A 4PAWA 1O58A 1PNVA 2VNIA 2WKPA 3TIGA 1H6CA 4JXJA 4HDKA 4NU8X 2ZRGA 4R4JA 3PUVA 2IYQA 2RONA 3DE2X 4KP7A 1GZ6A 3KL4A 2IY7A 3EDCA 3P9SA 5JR3A 2PY6A 3FE2A 3NIBA 1QVWA 1TF5A 1BW9B 3LDFA 4ZICA 4L07A 4CM8B 3TOSA 1PWEA 5AK5A 1BE1A 2UUOA 1LS1A 1GA6A 4WIAA 3OC6A 1TT5A 5TIIA 1F6BA 2BRUA 5DNEA 4D0NA 5BR1A 2VDLB 5LSAA 4RTKA 3EVDA 4J1TA 5TGTA 1TUIA 1QQ6A 4I8IA 1KO1A 2BFBA 2REOA 4J0JA 5ALUA 1A8QA 1MEOA 1OI7A 1W75A 2ORYA 4ND4A 1IOZA 2ECKA 4FPXA 5DLQC 4Z9FA 3RS8A 3TLCA 4BNXA 3VNQA 2EX0A 4D43A 2O8CA 5FJJA 5D85A 1E4EA 3L40A 3GJ3A 3IVMA 2OKGA 5JFTA 1AKQA 1TZJA 1U3UA 3LBIA 2IS6A 4K0KB 1U81A 5BXQC 1XCGB 1SXJA 2QSZA 2PGXA 5D1NA 1RXIA 5GGYA 4K46A 3SZRA 5J9FA 3B52X 4TTSA 5IM4F 1SZDA 2OE2A 4CV2A 3E2IA 4JKOA 4IG9A 1ZMOA 3VR3A 5LP6F 4IIGA 2DKOA 2UYCA 4HDRB 3WNQA 1L5WA 1DE0A 4UUQA 3KE9A 3PWZA 1CQZA 4Q82A 1ENOA 5HA5A 1Y4UA 4R51A 4F6RA 4FB4A 3PT5A 1NLZA 2QE7A 3F8SA 5ERXA 1KY3A 1VZ2A 1ZD5A 1ORTA 3E3NA 3R5FA 1EPUA 4J3JA 2BD0A 5C3MA 1JDBB 1HSZA 3IHKA 3UAGA 2HA3A 3SN6A 3GR6A 2O8BA 3P9ZA 1M8PA 1SUIA 2ZB2A 4Y2RA 3SP1A 2H54A 1UQRA 1SXHA 3TCKA 3TQOA 2Y1EA 1Y3CE 1E8MA 2H2GA 1WKVA 3RT7A 3LHDA 4A9AA 2PGLA 1DHTA 4LSGA 1KIFA 1KZ1A 3EXIB 1NWHA 4GFDA 5D01A 4RTOA 3ENKA 2DB3A 5IXSA 4QM6A 5YASA 3OT4A 4LVCA 1EKXA 1ZJJA 3X1YA 2AVNA 1N2XA 1XRSB 4WLUA 1QRAA 4WVLA 4YB8A 2QBYB 3HBAA 1YO6A 2FEPA 4V0NA 2I0FA 4PY2A 1Y9ZA 5T67A 4BV3A 4KQ2A 4YREA 3AEXA 4DVJA 4YJHB 4TS1A 1KXJA 2JK1A 2XB6A 2OK7A 4HGNA 5ALEA 2G04A 4OYHA 4QGAA 1PFYA 1GFWA 2LPMA 1N2CE 2DYKA 5ILGA 2FWBA 2G70A 4JFAA 4KOEC 2PS3A 2YYSA 4WN9A 3ZKWB 2JAHA 4NXMB 1TL7C 1U80A 3ESZA 2O5EA 3V2HA 3F6EX 4YRNA 2QQFA 5E7MA 2Y0DA 1HDRA 2QORA 3EIXA 5LDGA 2PUJA 5FR1A 4E46A 3K9WA 4WLNA 4YV1A 2X7XA 2WU0A 1FF9A 4C0JA 1RFGE 1JRLA 1NT2A 4ZVVA 5SV2A 3V8BA 1S1MA 1KEKA 2V7TA 3R7BA 5I48A 4YY3B 5JMOA 2XEDA 1XVVA 3PHLA 1RHKA 2X4GA 4QUHA 3IQDB 4YFVA 5DSZA 1X1EA 1XRQA 5AVKA 1W0KA 2OFPA 3KYCA 1CIVA 1PAUA 4KR3A 1C9NA 1NXTA 1W34A 3MT8A 3H0CA 1UXGA 2YC2C 4R1LA 4IO1A 3NT4A 3S2YA 2H8GA 1BU5A 1ZD4A 3G9ZA 4IGIA 1DAGA 4JGBA 1RWMA 3P0RA 3OKFA 4F4UA 4I9FA 1J5EB 4EL5A 2ZYGA 3JVUA 4RH0A 4A10A 3G59A 2VJOA 3WP0A 4CMHA 3OX3A 3JWJA 4MS3B 4PZ9A 5EJIA 5F35A 4B2IA 4JP5A 1D7AA 3FWKA 1CRWG 4ROSA 5FR2A 2CC2A 5KAMA 3ZHBA 4C2BA 1XQXA 2O2HA 3AL3A 4OQLA 4EVRA 3KLOA 4O4HB 1NY6A 1U04A 4MDFA 3HN7A 4IR7A 2XLBA 2FXVA 3M6UA 3UMCA 1T1JA 3IAFA 1QGDA 3ND6A 3QNUA 2OAQ1 3JSXA 5ALTA 4IQ8A 3F5SA 3FRIA 2V1UA 1FFXB 1OAKA 4ROTA 2HDHA 3Q9SA 2IHYA 1RWOA 1Z9BA 2AK3A 4JP8A 2F1JA 5CCEA 1QGED 5IVPA 3GLIA 3WIDA 3U61B 3CRMA 3ZJ4A 3ROTA 1KMHA 4LYYA 4CMKA 4EAQA 3EXEA 3M1LA 3IP8A 4B3RB 3N8KA 2P9TA 2PL9A 2MJLA 1XK7A 4IDFA 2YXNA 4BVJA 5C32A 1YULA 4AJ2A 2ZJ4A 4PRKA 4W1SA 4HAVA 2Z5GA 1M33A 2KHZA 1L9XA 4RXMA 1DMSA 2WD8A 3G5UA 4G1UC 4DNPA 1Z0DA 1PR4A 5EMMA 3DVAB 3S5JA 3LKDA 2G9ZA 4BUJA 3L4BC 1AK1A 4JC0A 1J5XA 2ZRCA 4YAFA 5EWJB 3ER6A 3S2FA 3STUA 2DFTA 3X1JA 5IUKC 4XUCA 1V8ZA 4KQCA 3L7KA 1BJKA 1Y8CA 5DASA 1GRCA 3HWWA 1F1BA 1U3FA 3USZA 2FRXA 3GFGA 1EK5A 3UMVA 2HMAA 2Y67A 2X6RA 1YQ9A 4XVUA 5DGCA 1I2MA 3U37A 1EAYA 4FILA 3MRTA 1VZ3A 1K8QA 2BEVA 4I2VA 4L72A 2GRAA 2W6MA 3OQNA 1W0JA 1CCWA 4LY0A 4WHMA 3L7AA 3E9CA 4N9QA 1AIPA 4IQ0A 3TKLA 1E9SA 1WEKA 3A2NA 3TLZA 3QXGA 3MERA 4CI9A 2J7PD 2P62A 4M38A 1Z35A 2NO6A 2V7PA 3E3AA 3P9QA 4PX3A 3S5UA 2JG3A 2OYSA 2IW3A 2EFDB 2PXXA 3GNQA 3IUMA 4J8PA 2Y4NA 3B20A 4XR4A 4QVIA 2X0IA 5A9SB 5C7YA 1TEHA 1J8VA 3HU2A 4MA5A 4AZ3B 2PSHA 4TQUS 4BAUA 2PZLA 3WC4A 4D74A 4ZKDA 3N86A 3DP7A 3WB2A 5JCXA 1PEKE 2O3QA 3JQAB 5H4HA 2O20A 5J63A 5KNBH 4X71A 4L28A 3EUAA 5BQ5A 2AEEA 1YT5A 1QIKA 1TZMA 2NU7A 4TXJA 2OD7A 3CRRA 1JLKA 2AX4A 1SUBA 4CMJA 4UNRA 2XTAA 4L74A 3FBTA 3EGOA 3FYUB 3QSGA 4OLAA 4HNUA 1XCJA 1B23P 2NYRA 3IKTA 2GA8A 3KB2A 5CPBA 3PFFA 3NKVA 5ALOA 3T0GA 3ND9A 3HS3A 5E38A 3FWYA 4CM4B 1WM1A 4WCVA 5KNCD 1QPZA 4ZC8A 3AERA 1UAYA 1SQ5A 3FPBA 2Y1DA 3IS3A 1JJIA 4LRSB 2ACWA 3V8PA 1Y8AA 1ULBA 2FCRA 5NULA 1YA6A 1JG6A 1DOAA 4UBOA 2V97A 3GEBA 5FP0A 2FGKA 1AA6A 4RELA 5EQDA 4BV9A 1R0LA 4M6WA 1MR3F 2XIQA 2HSZA 1VL5A 1AB5A 1OWNA 4QGGA 5JYBA 2I29A 1EVKA 4RVUA 2IDJA 1BCSB 1M8FA 2CEAA 2QL9A 1LDMA 4HLNA 1GQQA 2BBOA 3C16C 1GKUB 3KOWA 5K1ZA 2ZP1A 3H2ZA 3WWPA 4RKQA 1JJBA 4XQCA 3J81A 3BAZA 3D2BA 4LYDA 2NU9A 2P8SA 2ZR9A 4KFUA 1PL6A 1WMDA 2IT1A 4BXOB 3IMCA 1IZ9A 4KREA 4NCHA 1BROA 4LF9B 3W2FA 4XCQA 2YVUA 5EHGA 4LJYA 5I8PA 4YP9A 2B37A 3JQPA 2H1HA 3RJ5A 4H3VA 3BMCA 1I2ZA 3ET5A 4GECA 4KGDA 5F1KA 2WUGA 1T4BA 2OM6A 3CNQS 4Q1BA 1Z7YA 3TZCA 4PSVA 3UB3A 1P80A 2VDMB 4JJ6A 4OBWA 3EIOA 5DOZA 5FJIA 2QMZA 4AY3A 1Y89A 2Z1NA 4I8DA 4LHYA 2HC9A 1VOTA 2IZ6A 4JBWA 2XRYA 4YDSA 5HFNA 3RJ9A 4B76A 4UM7A 2IIVA 4IKOA 4UUAA 1IVNA 3FLAA 5JG7A 1THMA 3V2UA 5LP6B 4F21A 3RTAA 2A0UA 2QZZA 1NIJA 1WMSA 2B1RA 4HK4A 4M76B 4GKJB 1M34B 1DHRA 3GNTA 4II7A 1QGUA 4IJ5A 4OP3A 4JKIA 2XODA 5JYDA 1YJBA 1NBAA 4E2WA 1ANKA 3MJCA 3Q40A 4H7KA 3SK0A 1OR8A 3D1VA 4IAOA 1RLTA 3TB6A 4C04A 2VCYA 1XNHA 3IB3A 4GYYA 2J0UA 1X7DA 2X5NA 4L95C 1NDHA 3IO3A 1AY0A 2VHXA 4AZVA 4FJ1A 2XWJI 1CVIA 4LOKA 4JVMA 4NG4A 4PTYA 1FU7A 5CNIA 5JI2E 3NC0C 3LGSA 2PGOA 1VXRA 3DWEX 4UU8A 4U1RA 3WLRA 3CM0A 4EEKA 1UBNA 3GDFA 3OU2A 4F7DA 4S04A 4RM3A 4F45A 4M1ZA 4N01A 2B78A 2OXCA 3SQLA 4ZRMA 2QQ0A 4JQSA 1M7HA 3EMBA 3ZS9A 1JPUA 2Q3JA 1J23A 1FXSA 2A2ZA 4AWAA 3M2TA 1UJNA 3DONA 3L0YA 4HFRA 5EWLB 4QQRA 1W8DA 2AJDA 2PLRA 3F71A 2WABA 4IX9A 4XWGA 4Z0NA 5LZ4A 2EW8A 2IYVA 4YAIA 3IH5A 3KYJB 3RR2A 4E88A 4IHAA 3VV3A 4OI4A 2AZXA 1E6UA 4IHQA 1NHGA 1CNEA 2IH2A 5FQNA 1CTQA 2AR9A 1R0CA 1PT6A 2ZIXB 4K88A 1CQJB 1HDIA 4RV4A 4EZBA 2HRZA 4ND5A 5A02A 3DDHA 3OF5A 3QE3A 1N92A 1DAFA 1XZPA 2CVPA 2OV2A 3C8HA 4FT2A 3H2BA 3ZC3A 3VHLB 4K7JA 4B8YA 4HLDA 4EL0A 3GLHA 2EBHX 1EDEA 3EIWA 3HGQA 4K9KA 5FA5A 5G0WA 2G9RA 4GG1A 3HM9A 3WNZA 1BX0A 2ES4A 5IT4A 1K0UA 3KLPX 4YRMA 1PVOA 4CF6A 1ELOA 3INRA 3BL6A 3F4BA 3L8CA 3PS9A 5LZ7A 3V4FA 1U0LA 2YX1A 5K45A 2B34A 2A0XA 3DBHA 2RFLA 1DIGA 3QWBA 2CHFA 1IJBA 1P5HA 2ZCJA 3KB1A 1HG1A 4IIHA 4UEJA 2FPSA 1AUPA 3MCAA 4ND6A 2R1ZA 3G89A 1U11A 2PVCA 1XEFA 3E9DA 4IG4A 3ONNA 2Z30A 4P0PB 4BL5A 3OEEA 2H9AA 3R1IA 4N48A 3SF8B 1I5RA 9ABPA 2VA9A 1Q12A 4UXIA 1EBBA 1W85A 2GKOA 2B1JA 3RFXA 3PNPA 3ZJ5A 2C96A 5KMGA 2MINA 3HKEA 2VP2A 1B6TA 1HSOA 3QYFA 5CTAA 2EW1A 5JJIA 2WU4A 2WIBA 1PR6A 3FDZA 3QLUA 4OATA 4QYIA 3U3XA 3T3OA 1REQB 1HGXA 3K20A 1T8RA 4JJ7A 5I8ZA 5DM60 1UEJA 3CT6A 4J2OA 2CXQA 2WLTA 4LZNA 1WEHA 3R3YA 4RHTA 1E7MA 2J3JA 2FDCA 1GPWB 1W4ZA 1CUWA 3K9NA 4XM1A 5KWJA 4E07A 2XE7A 4K6CA 3GJ6A 4EYGA 1VP3A 1Y3AA 3GRZA 1A5ZA 3PNBA 4OLJA 1US8B 4DXAA 1LI4A 3W4KA 1XAJA 4NE7A 3LY5A 4S35A 3WJAA 5JBNA 1PGOA 2AXQA 3D8UA 1Y42X 2PGDA 2C92A 2RGYA 1MJ5A 4HH1A 5TPWA 2VJQA 3TINA 1RKBA 4X1OA 4NH4A 4E4YA 4R3UC 5EHQA 2C77A 2FF5A 1K8ZB 4C2UA 5BYBA 1YRBA 4NNOA 1PKEA 2DWQA 3PD7A 2E0IA 3Q0IA 1JW9B 2WTMA 3CVOA 1V1RA 4CVNA 3K6SA 3LNCA 1FBTA 4LNAA 3PGKA 3ZBQA 4MQFB 3V2IA 3K1JA 2WDPA 2HQOA 1T8UA 2EKPA 4R1UA 3UK6A 1SOVA 4BU0A 2BLNA 1CIJA 4LQLA 3T3GA 4OQQA 2UVPA 3OWHA 1LU9A 3CX6A 1C3OA 3FUTA 1XXHA 2WIGA 5EZSA 4YC7A 3T7IA 3HVRA 4RPCA 2EKZA 2PJDA 2ZJFA 5AKZA 3B6KA 4QAJA 3L8MA 1ZP6A 2A1TS 2JGLA 4QELA 3TSWA 4CNBA 1CRQA 1F14A 1DIHA 1RQRA 1MB3A 3QLUC 3NX4A 3DTVA 2AOUA 4YLYA 1NUQA 3L8YA 2P3LA 1CUAA 3TOZA 3I23A 2AVDA 2PX4A 2PZAA 3GARA 1FU8A 3PWKA 4D7AA 4M60A 3U4IA 2DBRA 4ZZ2A 1OX6A 2EL9A 4BC0A 4GIBA 5B4VA 2O0MA 2X3UA 2JKZA 1ID8A 1ATZA 3UB2A 5KQGA 1QSGA 2XGSA 1WY5A 2R4TA 5DYYA 1T0HB 2CZCA 3HNRA 2BGMA 4D4LA 4G4SP 4FSHA 1T1SA 3VUEA 1M0SA 5ADVA 3LAWA 4FGKA 4B46A 1USKA 2YDYA 3GLKA 4HEHA 4QRHA 2OZLB 4NEGA 1JHAA 1X1AA 3J7AC 2AFVA 1OZHA 4OGGA 1NJ6A 4R8VA 3U81A 1G41A 1G21A 1OTYA 5JDCC 4W7HA 3SYMA 5FUMA 2B5VA 4UDXX 1ZA1A 4CLRB 3IDSA 2RHLA 2POCA 2WAYA 5FL7D 1HKUA 4BQFA 1XK6A 3N05A 1U63A 2IHJA 2Q4OA 1XYVA 4E14A 1V16B 1OV6A 3EQ6A 4HS4A 3K0FA 3FAZA 1G4AE 3AY7A 2IYRA 2ET6A 3IT1A 3R76A 3FAKA 1V9LA 2PZGA 1XYYA 2GPSA 3L1UA 3WQRA 1IMJA 1XTPA 2VYFA 5G02A 1FFCA 1KH2A 3MRXA 4NYMR 4B32A 8ABPA 2WF5A 3O8NA 5ICFA 4N8SA 1CUJA 3QMVA 4I50A 1E2KA 5AM4A 4J4TA 4Q15A 3M3DA 4C7XA 4MZDA 1CFZA 1NVMB 3LH5A 2H51A 1JBKA 1HOXA 4KYIB 5EYPB 3FCUB 2F43A 1NX6A 5IKPA 3KX2A 2AYXA 3EYWA 4A8JA 5EE9A 2A9KA 4NCAA 1CB0A 4B3DA 5KOHB 4V38A 1F2UB 4NPAA 3C7AA 1I0LA 3EXFB 4JU9A 1J1ZA 4BRWA 5BN3A 3ODGA 3ZWDA 1T8WA 4H15A 4GMXA 3GEGA 3M9WA 2A84A 4S3MA 4Y2PA 2PKYX 3GW8A 4QC2A 3WR5A 1GHTA 3MJVA 4ZVUA 5B2EA 4CMIA 5DTEA 1VGQA 2H4YA 5LMCA 3LCMA 3D7SA 5DI9A 4BC1A 4B6EA 3GC6A 4DLXA 4YRJA 5KQMA 1USVA 4TYYA 1J2JA 1NR5A 4TLDA 3O7WA 1TYDE 4DWJA 1NQXA 1QHHB 5LMUB 1LY1A 2O57A 4R0MA 2JGKA 1P91A 2OSBA 1GCOA 2VHZA 3ZU2A 1AZSC 3JQ7A 4ZO6A 1W2GA 2QDXA 1FP2A 1J9GA 1AN9A 2IXDA 2C2XA 3DM9B 2QTCA 4JLJA 3WJ7A 1I0ZA 2QZJA 3DVRX 2AHRA 3DOUA 3GAFA 5D6OA 4EHIA 5FD8A 4PWYA 3ABQB 4GMKA 3RS4A 4B09A 4KXVA 2Q9UA 4DA8A 3QE2A 2YXDA 3OVMA 2QMOA 4W1RA 2JLXA 1DQPA 5C8YA 2X0NA 1C4WA 1G3MA 1GPYA 2DR2A 1XVLA 2ODBA 3MVEA 1NWCA 4RF5A 4WZAE 1V26A 5EWMA 3G5AA 3TECE 4YNBA 4KODA 4AMZA 3SOZA 4U7TB 4UBLA 5H3LA 2OB2A 3CJQA 4NJMB 1Z6XA 3WNVA 4ZAVA 3DFMA 1E2BA 4EYOA 1NZJA 3D2CA 1E2IA 4QU8A 3I62A 3EWIA 3FYSA 3K31A 4IXDA 2PJRA 1SCQA 3LHFA 3R7DA 1J1IA 3ZU3A 2JFZA 1FTSA 5B58T 3CLHA 2YHAA 1I7PA 3HGTA 16PKA 4WK0B 3ESAA 5FORA 5T4FA 3VZRA 5FX2A 2NVOA 3NALA 4WRRA 1J1UA 3E1KA 1BC5A 2H1VA 4XYMA 1OJLA 4M99A 4IDBA 4QODA 2XBMA 2DH5A 1EWKA 4KMSA 4ATNA 4C4TA 2D2XA 1TAUA 3AJDA 3GELA 3IAUA 5E8JA 3GU3A 1J42A 1RQXA 1TECE 1FX0A 2QL6A 1LTKA 3I6BA 1DXOA 3HBFA 2HF7A 1NBMD 2GEBA 1UJ6A 3P1JA 4M88A 3OTQA 3IHLA 4N0MA 1M2OB 1V7QA 2B8WA 2XIJA 1XAGA 4HP8A 2B99A 4R8KA 4A26A 2RHHA 3A1NA 3BWDD 4WY8A 3EZ9A 2ZRNA 2J7KA 2YIMA 5B7GA 4DV7B 1ACJA 1R27A 2Y1FA 4L4UA 4PIVA 1JU3A 2UVQA 1YQEA 2DFKB 1U2DC 4GH5A 5GJCA 2YY7A 3UXEA 5BQXA 2LGJA 3EDOA 1CQIB 3KR1A 4IJQA 5K0EA 4D8TA 5DP2A 4R54A 2R44A 1POWA 1X7HA 5KVSA 4CTMA 1XVAA 2PD6A 1F5SA 1Z6ZA 2QYTA 1OTXA 2R8BA 2WD7A 5FXMA 2HT6A 5MN4A 1ZWLA 4EJMA 3RYCA 1FCJA 1NR7A 2H57A 1KI4A 4A0RA 4YPFA 2HPHA 3O0TA 4BJ6A 1WVIA 1HZJA 5TMEA 4Z9AA 3G2NA 4C5CA 1ZXLA 2ZCUA 1J39A 2VUUA 2C7QA 1WW8A 4KBFA 9GPBA 5JAHA 1JA0A 3FKQA 4W9RA 4A7PA 1FQJA 3JALB 3EZ2A 1CUBA 4UJ5A 1ZIXA 4Z4GA 4F2WA 2GJ8A 5F3DA 4LOLA 3KJEA 4HDKB 5LQKA 1RLMA 3LO8A 2DUMA 2GN8A 2OZKA 2VWQA 4LDJA 1FNMA 2FW0A 4LI0A 4OXIA 2VI5A 5JZBA 3TTSA 2PT7A 1QTIA 3U1VA 1B0PA 4MAFA 4RIFA 3OM1A 1AQJA 2VLBA 4OQXA 1WPXA 2VDQB 4DIDA 4RTSA 1I6LA 3SFTA 1F9EA 2B9EA 2JJ1A 1XZKA 3GLRA 5C3UA 4FWIB 2VYQA 2W4MA 3L0CA 1GPH1 2BFBB 4CMAA 5ISMA 5FQOA 4OGFA 2O8CB 1UZMA 2W6JA 1C81A 1NZFA 3VTAA 4C7KA 5JXIA 4NBRA 3RVQA 4XWAA 3VH4A 4EGAA 4K87A 3Q3IA 4HNVA 1F9AA 2QN9A 2WJIA 4IMIB 1O6CA 1UADA 3U4HA 1WDWB 4KFTA 3WLQA 5IAAA 1NW7A 2PT9A 3D4BA 1GKYA 2WZDA 1EGHA 4JSYA 3W9YA 4BWVA 1R0ZA 2F8MA 2H4ZA 4AKSA 4XGQA 3C7DB 4G1CA 3ZHOA 4DDMA 4F3RA 1KI1A 1M0TA 1E7RA 4YVFA 2BMEA 4OI1A 1FNDA 2DTDA 8ATCA 3AM1A 3KQQA 3I28A 3E53A 4J16A 4Z0HO 3OZIA 1Z16A 2IZOA 3R3VA 4P22A 4R0NA 3F5QA 2P41A 1V47A 5CDGA 3TQIA 4F8EA 1G20E 4M9CA 4KXQA 4Y2HA 3G49A 1MC5A 1AHHA 4PIMA 5FPHA 3BWVA 1FFBA 4LHVA 1SIOA 4WFIA 2XB8A 4YI5A 2IHKA 3AETB 3C24A 2YWJA 2O8BB 4JSRA 1NR1A 1SU8A 3NCHA 3KT3A 2H17A 1KFBB 3ITEA 4AF6A 2BGJA 2M32A 2WZBA 4LMPA 2IPXA 2V55B 3OCUA 2P0AA 1WETA 2WHPA 3DAYA 3VPHA 4H1WA 2VDWA 1XN4A 1JAZA 4UAUA 4QNNA 3HP1A 5DRTA 3SXUB 4M9ZA 1P9WA 3F5DA 3NATA 4YBZA 4DDUA 5BVGA 1O0BA 4YJDA 4QBFA 3QM1A 3SEFA 1ZXXA 2GCNA 4WNAA 2FXIA 1C41A 4ZO4A 4IDCA 3SNHA 1E2DA 2CWDA 1J0DA 1IG0A 1ZOIA 2OV1A 3COSA 3MS4A 3EXG2 3HEBA 1UPCA 4V0ME 1IH8A 1LZKA 3KR0A 1CR1A 1QH8A 4TRJA 1LGYA 1NQWA 1IZ0A 3M6IA 5H83A 4DDVA 1E5DA 1R4ZA 2A5JA 1WPQA 1RWXA 2JFUA 1J0EA 2WSBA 2WVJA 3LUCA 4PHTA 1S2IA 1C1XB 3UGTA 2J46A 4XYGA 4PS0A 3KD2A 1K6JA 2LCIA 4Y2YA 3ZE7A 2REQA 3C4JA 2D5BA 5H80A 3KSRA 4QTUB 4PSUA 2IP2A 4TM8A 5B64A 1G8PA 2ZAYA 1SELA 1NP6A 2HIHA 5TQ2A 3SC2B 2HUNA 2NVWA 5TV2A 3PUZA 1MC8A 2A59A 5HM8A 3BCUA 3Q7SA 3ZTTA 2WTAA 5BV2P 4Y2QA 1A0OA 4D41A 3WMXA 4JENA 1AVTA 1L5NA 1KI6A 3KYCB 4CR6A 6LDHA 1KQPA 1U4NA 2V6JA 3O95A 2Q5HA 4INOA 1DCTA 5DEIA 4WOPA 4Y1RA 1P73A 1G9TA 1IUPA 3VNSA 3ICEA 3ZZNA 4YMSA 5A2QA 1NHWA 4LMBA 4TWJA 1WHSA 4M0PA 4NJOA 1H65A 4FHFA 3RJMA 1CDOA 3QVVA 5JJLA 2GZRA 4WQMA 2H1IA 5FWXA 3HJFA 1LXCA 1OBVA 4WGFA 3B8EA 4YA6A 1X70A 4KPUA 4C22A 1AH2A 1QFJA 3R44A 1QHNA 4O0LA 3ITDA 5FA8A 1EUCB 4ZREA 4AF8A 5E6SA 2G4VA 2GYWA 4RFSB 1KH3A 4ZYUA 2EDCA 3LX4A 1Z36A 2GD6A 2PLWA 2JJYA 2YWDA 3CPEA 5CFOA 1LW7A 1NBWB 2X2EA 5CLHA 5F3RA 4YFYA 2YVQA 2XMDA 3ABSB 4X93A 3E2MA 3T6KA 4L5YA 2AF4C 3KRTA 3GFQA 2BDUA 1NLMA 1E2UA 1XEWY 1OGIA 2AFHE 3NUZA 4Y67A 3GLIB 2JIPA 4RZSA 1GPJA 1HEIA 3KD3A 3EXEB 4JK3A 3TJMA 5DHSA 2CVZA 3Q2IA 3ZV4A 3FMFA 1F3OA 1XQVA 3NEJA 1VECA 4AUEA 1JMYA 2OAP1 3HEMA 2GXAA 4P8RA 1PJRA 4F4IA 1QRUA 3EGWA 4GEKA 2FSIA 1SQSA 3IODA 1W1IA 1PR1A 5HKKD 3I5AA 5C81A 3CNOA 1IEWA 4CW7A 1E79A 3C3KA 3EGEA 3MEQA 2GT1A 5CM9C 5FFFA 3V7UA 1YMQA 1CHDA 2IV3A 1B14A 1B76A 3BH0A 1VLMA 4KJZA 3KWMA 5KSPA 3I53A 1EXVA 2MSLA 3OHPA 4LGVA 4BJ3A 4XD7D 2YINC 1HL3A 2ZTVA 2DBYA 3NBYC 5HCIA 3AG6A 1E9CA 1L3BA 1Y6FA 4ME6A 1MTOA 2WWGA 3IKVA 4PLCA 3WLLA 1RJ9A 3OSZA 2IEIA 2ZFUA 3L6UA 4FCWA 4A23A 1J2UA 2BEVB 4FMBB 4O25A 1R15A 4LK3A 2E5WA 5EPUA 5IU6A 3EHDA 2K6GA 3N2KA 3PU6A 4S1WA 3VU3A 1P2BA 1NAHA 1FFAA 2PUVA 1OTHA 4KXUA 1NXSA 3M70A 1BDBA 1CDEA 4Y98A 2DETA 4GP7A 2FLKA 3DDNA 4I4TA 4NBTA 1CJTC 1XMPA 5JJ5A 3T8YA 5LZ9A 1XDZA 3SX4A 3QVGA 4HX5A 1TU3A 3V1NA 3R0ZA 3DQZA 1TRHA 2JS7A 2NV0A 4DGSA 3WB1A 4ZC1A 1NI5A 2VYVA 3EWNA 3I8XA 1AKRA 4LE1A 3QMMA 3ERCA 3WGQA 3JD4A 2D06A 4ABTA 3D7MA 5BNFA 3U3DA 5J2UF 2NLOA 3GRUA 4YRFA 2HBQA 3KWFA 3V4LA 5DT9A 5J47A 3UC9A 4PSAA 4KFSA 4FINA 4R7TA 1N4AA 2A14A 1FA9A 4QEDA 1YR9A 2A6PA 3B5EA 5ALDA 2Z56A 1YI8A 4M7PA 4YCLA 4HNRA 3VHQA 4XGRA 3I9V6 5K3AA 4RVHA 2OFOA 3I72A 2OXEA 1E0AA 5K3EA 3EFOA 3RS2A 4G07A 3T12A 2QTBA 4MGHA 1EVYA 4P3XA 3V1UA 2XNCA 2UUBB 6Q21A 5J4KA 2GLUA 2G06A 3LPMA 2XVAA 4LJ4A 4QSHA 3UA4A 4DB4A 1VPWA 3CB4A 3I2FA 4I50F 4AJ4A 4CR7A 1OZ0A 2VPZA 3EE6A 3H2HA 2WUVA 3FR8A 3QQ5A 3CLSC 5TE9A 1LRKA 2ZXUA 1YFZA 3P20A 2B4AA 5C5EA 1O0CA 3GMIA 2JKVA 2OUKA 3LRPA 3C3MA 1TU4A 5BYAA 5CCBA 2PKQO 3M5CA 4OHBA 4G81A 1IB0A 1AMOA 1J0AA 4I6JA 1GGMA 3OQ1A 3VVLA 5BV7A 5K2MA 2I9PA 2WA1A 3MWGA 3U7JA 4UOZA 3FTNA 1M8GA 2VH1A 2WHXA 3E05A 4IGAA 2NU9B 2G9UA 4UTNA 5G4KB 4EI2A 1ZRMA 3TXAA 4LYEA 1PYDA 2J4DA 5K0BA 5C0OE 1T4CA 2H9YA 5IS2A 3O2SB 4Q7JB 2Q1XA 1ZZGA 2H6EA 3LFTA 4JIMA 4OSPA 1U4OA 4N8EA 1BX1A 3VVMA 4P4TA 4ZVNA 4RDIA 3S28A 2EP8A 4R2IA 4G1MB 1DKNA 2AXNA 3H4IA 4BS9A 4LYHA 4UATA 5DN6D 3WB9A 4YQFA 3ZCVA 1UMBA 4N5LA 1JLLA 3A6PC 1UXJA 3ADDA 4G89A 4JB0A 2PQ0A 4RXTA 3WKCA 4MV1A 1A2BA 5DWVA 1K3UB 2HBZA 3EMDA 3ZY2A 1UBLS 1PV1A 1C2TA 5C8YF 1G5PA 1VCOA 5AUPB 4KXMA 2YOFA 1W36B 2H92A 1U8FO 3IOYA 4F8JA 3EEBA 3TF5A 4GEGA 4RZIA 2VUHB 3DT9A 3DLTA 4HZGA 2PZKA 5KYUA 1YR2A 1SOUA 3UKDA 1KP2A 2WM8A 5HZMA 4UDYX 1E2QA 2MR5A 3DYBA 5KI6A 2Z3VA 1M76A 1H6AA 2PX8A 2NU6B 2DY0A 1T15A 4P36A 3KTAA 2BL4A 4HVAA 5HR5A 2QNIA 1GL3A 4I1UA 4Q1EA 1PDOA 5E4TA 3FPHA 1CIPA 3NI2A 1IXZA 1P6QA 1R37A 2P9EA 4I6GA 4PZAA 4A91A 4CE6A 2IBSA 3VTFA 1M1YE 1IN7A 2FJUA 2P2CA 2DVMA 4M37A 1UK7A 4RJ2A 2HDNB 1OKKD 2OAGA 2PH1A 3E7DA 3NDJA 4TVBA 4JXZA 3DTYA 4GNRA 5GM1A 3UJHA 1OFHA 2XZTA 2RARA 3P4XA 5E3HA 5TB5A 4KFRA 2YS7A 1I7DA 1NVEA 5EP2A 1T10A 2O2XA 2OCKA 3L3BA 3ZD9A 1E3IA 1E94E 2E37A 3IOEA 1GVHA 1CS0A 1L4NA 4FSDA 4MULA 3ZK7A 1QLHA 3DOFA 1DJNA 2ADFA 2H52A 4CG1A 3OM0A 4R05A 3OSUA 3T7JA 2P0EA 3CNEA 3FWZA 3RSCA 4R8SA 4TTVA 3JQFA 2C3YA 3UAXA 4C21A 3ROGA 5KX5A 5GIOE 2CMFA 3RYIA 1S01A 1OH6A 3Q7EA 2J9YB 1D7OA 4QGHA 2OXTA 3AFOA 3KK0A 4P32A 4FHGA 5EJEA 5KTSA 3JZMA 3V8NA 2C8VA 4RK5A 4P7BA 4A15A 4D3DA 1ZH8A 2JGJA 4NPCA 2B7BA 2IVZA 3ADBA 4KWIA 2WPNA 1P7PA 1VLJA 3IAM6 4RK6A 5ERYA 1ONNA 4BFUA 3EOAI 2XA9A 1KSFX 2MSEB 2Z2JA 2O2SA 1QYXA 3EEOA 3CLKA 1HEYA 2WF7A 2QUZA 3OZGA 1HG0A 3GFOA 4Q4JA 4YJ3A 1LLUA 5ABPA 5KMGB 3HKEB 1NV9A 2FMUA 4AJPA 1I3NA 2B4YA 1G7CA 3OQIA 4GMHA 2HTEA 4JJ8A 2PWYA 2ZRIA 4LDRA 4JI6B 4D57A 4Q7QA 3PGXA 1R18A 5BWBA 2GZ1A 3PIIA 3IAM1 2IBMA 5CK4A 1JLSA 4Q7EA 4I2NA 4YUXA 5K4GA 5JPCA 4JHXA 1CSEE 2YXLA 3H2GA 1I24A 2MSKA 3PPXA 3PXXA 2OHHA 1XV5A 2B2CA 3OEHA 2FPGB 3ZV6A 3LWDA 4BFTA 3UG6A 2IYEA 4G5GA 3OM9A 4P34A 2WP8J 1NKSA 3PRHA 3ZNPA 2XYQA 4DABA 2MOKA 5TF4A 5TPWB 4WK2B 1YFJA 3WLSA 1LK5A 5A6SA 4DEVA 1QC5A 3K2QA 5DO9A 3MMNA 1E1LA 2EZUA 2Q1YA 3OIFA 3Q3VA 3WRVA 4BQRA 5IT9A 3VAYA 3BQMB 5AYVA 3AI3A 5HCNA 4S1TA 3Q1LA 4X0EA 3U0BA 2R60A 1EG7A 1V1RB 4JP1A 3K6SB 4RMNA 1L8OA 2CLFB 3CRNA 2JIMA 1HLFA 4YRKA 2FFJA 3WZ2A 4O5OA 2KJQA 2REBA 3L79A 2NP6A 4BMOB 4KE9A 1E1RD 2CXHA 1E3QA 2UVPB 1UODA 1C3LA 1RJDA 2V5VA 1C50A 4RW0A 2XCRB 5BP7A 5CVVA 5ALNA 1XXHB 4L6CA 1R88A 3EGXA 2D62A 4BQPA 5JECA 1EFHA 4KXYA 2I7DA 4CM7A 1J07A 1Z26A 2HDWA 1XCLA 3UCXA 2N0SA 1GQ2A 2YV1A 3DTVB 4FZRA 2DERA 3EA0A 4MVWA 2C4TA 2L42A 2QPAA 1NI4A 1S2NA 1VLLA 3MC1A 4KAXA 4KR7A 2Q4TA 1TK2A 3F6RA 5DGDA 2XSZA 2ZCVA 3GLGA 5I7FA 2CV1A 4DIBA 2PUBA 4N54A 2JH3A 3SDZA 3R4CA 4WKOA 4YQEA 3V80A 4GZMA 4TMWA 4D3YA 2ARKA 2MSCB 4WL0A 2ATEA 3AU9A 5IC5A 2QUJA 3L82B 1DOZA 3FWPA 1CEEA 3UNXA 5FL3A 3OQPA 1H0HA 1E0KA 1RBYA 2LCQA 2X5JO 2ZZMA 4CM9D 4JVNA 4PRYA 2HCFA 2ILVA 3N6VA 7ABPA 1CX9B 1G21B 5J2UB 4MGIR 2HADA 1YIAA 1AB6A 1WNFA 4B34A 1NFQA 3AM4A 4EB6B 2M2IA 4F5YA 5IBRA 1W48A 5K6AC 2VRCA 2A4KA 1FDIA 4UFNA 2F9LA 3MTBA 4AZSA 3VSEA 4IIJA 4ZEMA 5DM2A 5L8VA 4D9BA 1H2RS 4IWXA 4WJKB 4U7HA 4H3KB 3WRXC 4RWZA 5G2OA 2QTNA 1VC2A 4DMRA 4BO9A 3N39C 1UKBA 3RYCB 3S7ZA 2XVMA 1E0DA 4CMCA 2GASA 2IUSA 2W2XA 4OHKA 4D9HA 2W0SA 5FHRA 3PG5A 5LIPA 1G5TA 2VOEA 3B82A 1V3UA 3HLYA 4I50B 2Z57A 1JSZA 4QEZA 4YQYA 2P69A 5DMHA 3WI7A 3GRYA 2N46A 3KVRA 4AG5A 4EHDA 4LF8B 2RK4A 1TM3E 4YYZA 5KYTA 5GGXA 1NVBA 2F43B 2EVWX 2ZJZA 4YJKA 2XAUA 3W7BA 4E94A 1KR5A 5IWAB 3EQZA 1HC7A 1JFTA 3LU1A 1G5RA 4D4JA 1M2KA 4DV5B 4Z51A 1N33B 5BN3B 1RCTE 2DQKA 2BISA 3BMNA 1WIWA 2CXTA 2P2NA 1HETA 2EFGA 1JDUA 3LWNA 4KNVA 4ND2A 2VPQA 1PF7E 5F4BA 3RK0A 4CMIB 4YDRA 4PQYA 1YI0A 1SZJG 5F2NA 1WZEA 1WG8A 3OIVA 3DCNA 1PQ4A 1Z17A 4AC9A 1Z7GA 2E5FA 2ZPAA 3E8MA 2CD7A 2WU8A 4UVHA 1RRKA 2ODNA 2PRJA 3UUFA 4JITA 2H1RA 5IANA 3HWX1 1TFUA 3A1VA 1S9HA 3DPUA 4G9EA 4KIJA 4L5BA 4CKZA 4DJTA 1U9CA 3DGFC 4LHZA 4Q4DA 3FJOA 3JQ7B 4U0KA 1GXSA 1H1LA 2Y4OA 3IAEA 2WF6A 3PKIA 4KIUA 3UOWA 2NO5A 3LC7O 4OMFG 1GPKA 4MDEA 3OPMA 4YROA 2DG2A 4RYLA 4HNSA 4AJIA 3UK7A 1IQPA 5CP8A 5AVTA 1ADCA 3PFWO 3AEKA 3MA0A 3UGQA 1P8AA 4QUIA 1XA0A 3N8HA 2XECA 2DWUA 2HRBA 3JZDA 1Y1TA 4J76A 4LOAA 4WADA 2B36A 1T2FA 1TMYA 5C8YB 2C59A 2WJZB 3O3MB 2P9JA 5AVUA 1W4RA 3S29A 5SICE 2NUPA 5AJYA 5I7EA 3IOBA 5F9HA 1K98A 2ZYTX 4TWAA 3KV1A 2W6QA 1PEYA 2CXUA 3COWA 4GQIA 3KZKA 4EG4A 2QRKA 5EWMB 1HDYA 1PUJA 3MWDA 4PZCA 5GOTA 4RA9A 1HBJA 4Z0TA 4M9QA 4RQTA 2F00A 5AHOA 2XMCA 1M2WA 3KZOA 3HHPA 2AG1A 4H2DA 1VKZA 2QRUA 5T8KC 4KSCA