4KWIA

The crystal structure of angucycline c-6 ketoreductase lanv with bound nadp and 11-deoxy-6-oxylandomycinone
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
252
structure length
252
Chain Sequence
GNLTGKTALVTGASRGIGRAIAEKLGYAGALVAVHYATGADAAAEVAESIEKDGGRAFTVKAELGVPGDVDVLFEGLERGLKERTGATDLDILVNNAGVMAMGAPEEVTPEMFDRMMAVNAKAPFFIVQRALSVMPDGGRIINVSSGLTRVASPDQVTYGMSKGALEQIALHFSRHLGSRRITVNSVAPGSTDNGSALFQIPEVRETLSQLSTFGEVAEPAAIADVVAFLASEDARWITGAFIDASGGTLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of angucycline C-6 ketoreductase LanV involved in landomycin biosynthesis.
pubmed doi rcsb
source organism Streptomyces cyanogenus
molecule tags Oxidoreductase/antibiotic
molecule keywords Reductase homolog
total genus 89
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4kwiA00
1E7MA 1V6AA 3O38A 4J90A 3GC6A 3WGZA 4ZN6A 4OOFA 1ORRA 4QX6A 2C7GA 2X6TA 3G1TA 1WZIA 2V6MA 2X9VA 1UH5A 1B26A 1AN9A 2I65A 3ICPA 3WGQA 4AG3A 5K6AC 1KEVA 3JQBA 1AGNA 2O23A 2O50A 1PGJA 5A9SB 1VSVA 4OHUA 3GA0A 3AM4A 5IDYA 1UAGA 4E31A 5LC1A 3ICCA 1NR7A 4W7IA 3HADA 5A06A 1I30A 2P5UA 4R51A 4FS3A 5CFZA 4PLFA 3ZV3A 4LCEA 1A71A 2YZ7A 4XIYA 4P8RA 3MJTA 1HSZA 4IMRA 3TZ6A 2BFPA 1EK5A 3EY4A 1BXGA 3DAGA 3GGOA 3D5TA 4QEDA 3VPGA 1DIGA 1M76A 2Q1WA 4AVYA 4CLHA 4HV4A 3KEQA 2JAPA 4M1QA 2VZ9A 2VWQA 4GPD1 4WK6A 3WYCA 4CUZA 5JCJA 4BNTA 3DZFA 5EERA 1PZHA 3RC2A 1PWXA 4ZVVA 2VRBA 1E77A 1BWSA 5F21A 4UVEA 1P1HA 3HG7A 3TWOA 2X0NA 4FR5A 4AJ2A 2JJYA 1R4MB 4ND1A 1CETA 4FD3A 2AEMA 1AXGA 1Y7TA 2DTEA 3M1AA 3Q2KA 1IZ9A 3NTRA 2AQ8A 4DQXA 3GHYA 3L77A 5CG1A 1B8UA 3BHJA 2O7QA 2FR1A 4G5HA 4JN6B 5TT1A 1JKIA 5THKA 3QLJA 2CFCA 1SEVA 3ZNNA 3DHEA 2PTGA 3ROMA 4BNYA 1CERA 3IQDB 1UAYA 3ANNA 4EJMA 3U4HA 4MVJF 3U9LA 1DJNA 3ROKA 1F8FA 3EVNA 3NGLA 4ND4A 4TRMA 1ZK3A 2GYYA 2DT5A 3TL2A 1GL3A 1QKIA 3HB4X 3H9EO 1PEDA 3PWSA 1DIAA 3RUHA 3PZBA 1PL8A 3K8ZA 4O1MA 2UV8A 4HFRA 1O5IA 5I9NA 3OHSX 4Q3DA 3F46A 5H82A 3H7AA 4IJUA 3LC1O 1ENYA 4CR6A 3ASUA 4EZBA 1J49A 1H6AA 3E9QA 3GFBA 1U7TA 2PD6A 3GAZA 2TMGA 4XQ9A 1QLHA 4WEOA 3A06A 4MIYA 1LSJA 4IM7A 3PFWO 4RGBA 2Q45A 1SCUA 3EZYA 3DBHB 2A35A 3G1UA 3VH3A 1QV6A 1YL7A 3K96A 1DEHA 1H2BA 3PDUA 3ONEA 2V7PA 3DO5A 4PZCA 3JQ8B 4N5LA 4CMIB 4IQGA 3JD1A 4J2HA 3B20A 2PH5A 3OIGA 3JQAB 2Y1OA 3JQ7A 3G3EA 3AI3A 1GQQA 4RF4A 1XEAA 2J3KA 4BIIA 2Q1TA 3RUEA 2G0TA 2NTVA 5BNIA 1KVQA 2I76A 1OMOA 1I36A 2J3IA 1BW9A 3ITDA 1GCOA 2GZ3A 4GVXA 3OSUA 2O3UA 2CNBA 1Z74A 2GCGA 1HT0A 1YB5A 2OHXA 2W2KB 4IS2A 3OMLA 4NZ9A 5A3VA 4B4WA 3PGJA 2CF6A 1X14A 3GOHA 4OM8A 3K30A 1H6DA 4ESOA 2Q4BA 2C0CA 2BLLA 2I9PA 3CIFA 4IPTA 5JAIA 3M1LA 5J23A 4CMBA 4OH1A 4ZRNA 1PJQA 4HY3A 4AJ4A 1P44A 1D1SA 1KYQA 3QHAA 3ZHXA 3TN7A 4CM9D 1N92A 1H5QA 1GCUA 5C7IO 2NVBA 1T2AA 1UZMA 1L1FA 1Q7GA 5A4DA 4OQYA 3A28A 3OQ1A 4GVLA 4Y8VA 2O48X 2AHRA 3HWRA 5I9LA 4YJDA 1C3VA 3E48A 3RCBA 4YJHB 4J43A 2AG8A 3LF1A 3E5MA 3EUWA 3U0BA 4NFHA 5EMHA 5JC1A 1GUFA 3LT1A 4IBOA 2VWHA 3RD5A 2HK7A 4Y6PA 4DYVA 4BNIA 3GMSA 1QYCA 2VYND 4ALMA 4B3IA 2HJRA 3TQHA 1TLTA 2JAHA 3FWNA 4N5MA 2EW2A 1AXEA 4IZHA 4CLXA 1A5ZA 1DAOA 3ZW9A 1QLJA 3V2GA 4BQPA 1UXJA 3O26A 3QWAA 1ISIA 3B6ZA 4KQWA 4ND2A 1PTJA 3NYWA 7ADHA 3AU8A 4UUMA 1HZZA 3GZ4A 4UAGA 2WJPA 4BOYA 4XIJA 5JW6A 2OP1A 4XYMA 2QRJA 1I10A 6LDHA 1PZFA 4OKIA 1H9BA 2RH8A 2GRAA 4IMPA 4NFYA 2R2GA 3I9NA 3K92A 1LRKA 3PJEA 2B37A 1GV1A 4NU6A 5BSEA 1S6YA 1T26A 1V3TA 1C1DB 5L3ZA 1T2DA 4IJKA 4ZRMA 5KVVA 1X7GA 1R4NB 3ENKA 3L4SO 1Z7EA 2ZB3A 1YDEA 4N5NA 4E21A 5BSHA 3Q2IA 1MXFA 2POQX 3GR6A 1NYTA 1I2CA 4YVFA 1M6HA 3SLKA 1QYVA 4DBZA 1TA4A 2E6UX 2W4QA 1UDCA 4NPCA 4DGSA 3M6IA 3E5RA 4NMHA 1B3RA 2PZLA 1XU7A 2PD4A 4JNKA 1WLYA 4BNZA 2X0IA 5T5QA 3H8VA 3DOOA 1T24A 4PRKA 2NU8A 3RBVA 4Z6KA 2NNLD 4HFJA 3RUFA 1GPJA 4DL9A 2RHRA 4MIOA 4RVFA 1MGOA 1GTMA 4XCVA 3K2EA 2NU6A 3JYNA 1EQ2A 1EFLA 2Y0DA 4ID9A 1E1LA 4KQXA 3V5NA 4PG6A 4UEJA 4FOSA 4RQTA 5CEJA 1YOVB 2ZTVA 4FQ8A 3AUTA 1AHIA 1GR0A 2B83A 3NGXA 4J2OA 4CQLB 4D3DA 1YBVA 3IIEA 3QVOA 4MVJE 4AJJA 3QJ5A 1R16A 4KTTE 3UXYA 3GNTA 4MP8A 4ALLA 3IOYA 3S8MA 1PQUA 4W4TA 2Q2WA 3N7UA 4LCJA 5CHEA 4CLOB 5L9AA 5A9TA 2EGHA 3FNGA 3G79A 4UVGA 3F5SA 3LT4A 1K6IA 2ZB8A 3WFIA 1JLLA 1SC6A 4BO1A 1NFQA 4NBWA 5TJ9A 3VPHA 3ZWMA 1P45A 2NQ8A 1N9GB 2D5AA 1UXHA 2CD9A 3EK2A 4O59O 2HCTA 4DPLA 2WMDA 1IHYA 4OMUA 4JQCA 1CQIA 4XGKA 1C1XA 3WSWA 1HE5A 4BNMA 2EP5A 2Y1DA 4I8XA 3FTNA 2WM3A 1IY8A 3AY3A 3BZUA 4RDIA 1O6ZA 4GH5A 3ORFA 2PH3A 2Q1SA 3NDRA 4DPMA 2VTDA 5CDGA 3AY7A 1NWCA 2I67A 3KYCA 1JKFA 3OETA 3F5QA 5IDXA 5JDIA 2PY6A 3KSZO 1NP3A 2O3RA 2GPTA 3MJSA 3FN4A 1GQYA 4PZEA 2E49A 2R00C 1GAEO 5C37A 3BMQA 1O89A 4J7XA 2ZQZA 4O5OA 3HB5X 4ALKA 4JP3A 1PS8A 3HNPA 3TZKA 4BQRA 1P3DA 1HL3A 4FFMA 1Q1NA 1J6UA 4HFMA 3ZWPA 2Y0CA 1LLUA 4GQAA 2ET6A 4NR0A 1P31A 1WXDA 2O2SA 2EKQA 1A9ZA 2CVQA 2Q50A 1Q0QA 3KLPX 4CM5A 1UJMA 2D59A 4A73A 4RJTA 4HWKA 4R5MA 2R00A 2E4AA 4RQUA 4NBUA 3ZH2A 2B36A 1SZJG 3F3SA 4E13A 3AWDA 1DDOA 2B4RO 2VNAA 1N2SA 2QRKA 5DF1A 3UICA 2W2KA 3BMOA 3GVPA 3WB9A 4IDBA 2AMFA 4IDDA 1JKJA 4RORA 2ZIZA 3CTMA 2G82A 1O95A 4BO2A 5KNLA 1C1DA 1EQUA 1YVEI 1D4FA 4GLOA 4II2A 4WOKA 2A9FA 4WNCA 3WMWA 4R1NA 4ALIA 1DAPA 2X7HA 2C59A 1H94A 4CLRB 3MOGA 1ZO8A 2JCVA 3GHHA 3KHUA 4W82A 4FJ1A 3GZNA 3V2HA 1YQXA 3RUDA 2ZYDA 1N9GA 3LLSA 5IG2A 4WUVA 4INAA 3WMXA 1B14A 1ZSVA 1MX3A 2VYVA 2RCYA 3FNHA 1PL6A 1U7HA 4ZGWA 4R3NA 2W8ZA 3PVZA 3JTMA 2EG9A 1MXHA 1ZKMA 4YYZA 3ZZNA 2IODA 1I3LA 3L6OO 3ENNA 4P4LA 3SVTA 3LC2O 4J0FA 1QSGA 3JD3A 1GYPA 3VZSA 2FSVA 4Z0TA 2WYUA 1DC4A 1LSOA 2PGJA 1YH3A 3DFUA 4XR9A 1PR3A 3LK7A 5CDYA 1H2HA 3VZRA 1MC4A 4LISA 4BNUA 2RAFA 5KVSA 5A02A 8ADHA 5HRUA 4A27A 5KCZA 3DZHA 4YWJA 5EJ2A 3VAZA 1FDTA 1U8XX 3H4VA 1V35A 4AJIA 3OQBA 3RFXA 3MEQA 5TX7A 1C0PA 2BH9A 1JWAB 1YB4A 2FOIA 2PNFA 3LC7O 3OFSA 3OEYA 2GZ1A 1VL8A 9LDTA 3NJ8A 3Q9UA 2HAEA 4CMCA 4ZICA 4LGVA 3MJ4A 3OIDA 2C5EA 1QV7A 1RKXA 1UP4A 2ZATA 4FFNA 4FW8A 4FJ0A 5T57A 4I5EA 3RUIA 2EXXA 2HUNA 3FPLA 2TMDA 4CM3A 5DBIA 1UXKA 2HK8A 3WOHA 1YJQA 2VHZA 1W6UA 4R5HA 2YHIB 3BMCB 4OKNA 1NX6A 5JNLA 1HRDA 1A4UA 1A9YA 3ZCXA 5L7YA 4JJGA 4J0EA 4LRSB 4CV3A 4OSPA 5JAZA 1KEUA 3AM3A 1OAAA 1NFRA 2NACA 3IP1A 3H5RA 1HE3A 4YT2A 4P4GA 2I6TA 4K1LA 4GAEA 4YJHA 1OI7A 4CR7A 4GMGA 4J7CA 1WNTA 2HJSA 1B8PA 1E1MA 2VQ3A 4F45A 3DBLB 1PL7A 1GYRA 4JP2A 3SJ7A 3NEPX 3ONDA 3MJEA 4I9HA 3U4DA 3TOZA 3NT5A 3SXPA 2RH4A 1Q7CA 5TF4A 1AUPA 4QTZA 5AYVA 3WGTA 2ZTLA 4B4VA 3QW2A 3PEFA 3IJRA 3ANMA 3UAGA 5L95A 1GV0A 2HMTA 3DAFA 2CSUA 4MVJH 1HE4A 3UN1A 2NVWA 2F1KA 1LDYA 2GN8A 4L73A 5DULA 4CMHA 2X9NA 2HSDA 4J4HA 1P1RA 1NWHA 4AJHA 3KOUA 3K5PA 2B5WA 3RKUA 1XDWA 2D2IA 1C1XB 4WCFC 3AJRA 5TJHA 3JQ6A 1PJSA 3V1YA 4FDAA 1Z75A 4ND5A 1DO8A 1SAYA 4IQ0A 1ZK1A 4RZHA 3SX2A 5F5LA 4FFOA 3ZNQA 9LDBA 3DZGA 1RM0A 1P0CA 1ZK2A 4DXHA 4XQGA 1PGNA 1N5DA 2Y68A 3JSAA 4R16A 4E2ZA 3ZWCA 4B7XA 3O03A 3PQDA 5JMWA 2X86A 1B0AA 2QW8A 5L53A 5FF9A 4BUCA 3NT4A 4E12A 1EFKA 4J9UE 4R68A 1SOVA 2X0JA 3QP9A 4Q39A 5JBIA 3JYPA 2YHIA 3BMCA 3QVSA 3PWKA 3SLGA 1HETA 4ZQBA 4YT4A 3FBTA 1U3WA 1KC3A 4IY1A 1H6CA 3FTPA 3FRJA 4MO2A 4PN3A 3VTZA 4W9NA 3I4CA 1ADFA 4JLWA 4LRTB 2EKPA 1GFSA 1LDGA 4YJGB 5KVQA 3KXDA 2VT3A 2Q99A 1OC4A 1E6WA 2Z1NA 3OJLA 5COBA 5U9CA 3IL2A 3NV9A 2OBNA 4L75A 2NLOA 3DZJA 1LJ8A 1EEHA 2I99A 3FD8A 4DUPA 1XELA 4YQZA 3N74A 1T2EA 4CR8A 4CLEA 1C0IA 1VJ0A 3EDMA 5C7OO 4PG5A 1HDRA 1A27A 4WLUA 2Y1FA 3JD2A 3W8FA 2BKAA 2HQ1A 1D1TA 3U4CA 1WMAA 2P4HX 4L4XA 3INRA 1ZK4A 1BMDA 1CEQA 3C8MA 3JD0A 4IDFA 3JYLA 3PHGA 1ZEJA 2BFAA 4MVJA 3MWEB 1ARZA 4Z9XA 3LVFO 2X22A 4PRLA 5I7VA 4BNNA 1OC2A 3PJGA 4RVUA 2D0IA 2ILTA 4EGFA 5ICSA 3PLRA 4BKOA 4H16A 3DL2A 4PLGA 1NQAO 4AL4A 5JCXA 2HMUA 4YAEA 3NRCA 1YQGA 3AFNA 3WR5A 1W4ZA 2Q49A 4CL3A 1G1AA 1Q2XA 1DB3A 1JAXA 1V0JA 1RWBA 1VPDA 2GERA 3RC1A 2Q2QA 5DCYA 1HDOA 3ADPA 4W99A 2H63A 5KIAA 1TT7A 3L9XA 1VI2A 5JPIA 4FB5A 5IZCC 1BGVA 2EP7A 3A14A 5G4KA 1MA0A 4D0RA 3NKLA 4MP6A 3AOEC 2FN7A 1EDOA 3H2SA 1EZ4A 5HM8A 5T67A 2GDZA 3P2OA 1BSVA 2CY0A 2V65A 3KUXA 5FYDA 3UCXA 4KUEA 1UZNA 1E3IA 3RQSA 2Y1GA 3TL3A 1WDMA 3WDSA 1F17A 3WGHA 1NVTA 3D3WB 4NG5A 4XB2A 1AE1A 2CZCA 2LDBA 2GN9A 4B4OA 3EZLA 4IDCA 3KSUA 3ZWBA 3NDJA 1Y8QA 5GZ1A 2EIHA 3E9NA 4D7AA 3JQBC 4NDNE 5BSFA 1U9JA 3GH3A 4YEDA 2AQHA 1N1GA 2GR9A 1FJHA 1RM3A 3WICA 1BTOA 2HDHA 1NHWA 2QYTA 1U2DA 1LLDA 1LDNA 3H3JA 3VKVA 4XRRA 4RL6A 3RASA 2AG5A 1ONPA 3STHA 5I9MA 3HDHA 3KYDA 4EUHA 4AJNA 2VWPA 4RCVA 2W90A 1IB6A 1NPDA 4NU5A 2G5CA 1UZLA 3L07A 3NJ4A 4YR9A 4JBGA 4M89A 1E3WA 1U3UA 3PJDA 1IHXA 3HHPA 3S55A 1D8AA 4PG4A 1VSUA 3DONA 1EUDA 3DZKA 3GN1A 3C1AA 4H3VA 4R54A 4CMIA 1BG6A 1I2BA 2WSBA 1F0YA 2ZK7A 4KUHA 1YB1A 5G0SA 1CYDA 3SC4A 5IFLA 3C1TA 3Q9NA 4YCAA 3B1JA 3IKVA 1NXQA 4RVHA 2EF1A 2O3TA 1U1IA 4U0JA 3UHAA 4ZQEA 1PSDA 1KBZA 1P9LA 3AUUA 4YXFA 4IINA 1M75A 1VJTA 4CM4B 2IZZA 3I9MA 4AJ1A 1P77A 2GD1O 4LSMA 1ZCJA 1KETA 2E48A 3HFSA 4TMFA 1XG5A 4U5QA 1UXIA 3RWBA 5KJ6A 1TI7A 3PK0A 1PIWA 5CDSA 4ILKA 1N7HA 3VHRA 2B35A 4BO3A 1PS0A 2BI8A 1DRVA 3QQPA 3R6DA 1LDEA 5H83A 3W4JA 4E2XA 3HQ4O 1HLPA 4E2WA 1BW9B 3GLQA 4RF5A 4I9UA 4AJLA 4B79A 2B4TO 4GI2A 4JXKA 3OA2A 3H2ZA 2V6GA 3UOGA 1QYWA 4CV1A 1FXSA 1IL0A 2Y05A 4DYDA 2VHXA 2FR0A 1GPDG 2PZMA 3KLMX 4M87A 2NUAA 1I24A 4OL9A 2CDAA 3HZZA 3B1FA 3W8EA 3ZV6A 2P5YA 1MP0A 2JL1A 1Q0LA 3X2FA 1VLLA 5JDCA 1BRMA 4G2NA 2B69A 3F9IA 4QO8A 5TT0A 1LXCA 3VVBA 3DBHA 1NASA 4I5FA 5K9ZA 3S2EA 3I9LA 4HKTA 4KOAA 4OQZA 1DFGA 3WQRA 4L76A 3VDRA 4MKZA 1T4BA 4RVDA 5U4QA 4BNGA 3P2YA 5A04A 4D45A 1GADO 2GSDA 4R3WA 3RU9A 2P68A 4YB8A 3K73O 3RAJA 3F4LA 5IDWA 4FSHA 2C82A 2J5KA 1E5QA 1W73A 3GY0A 4UEKA 1C0KA 3OJ0A 4EEXA 3I1JA 1YOVA 1TVEA 4XYLA 3AI2A 3C7CB 1SBYA 2FRDA 5DCUA 2QHXA 1DJQA 3KO8A 1PJCA 4KZPA 4EDFA 3DTTA 3A9WA 1B7GO 3LZ6A 1U4OA 2WEKA 3GAFA 3I9JA 2VN8A 3RSHA 4GL4A 3DBRA 2J5QA 1VKNA 1DIRA 1Z45A 4JJFA 3TF5A 5FI3A 3UH1A 3ZU2A 1VKOA 2GASA 1U3TA 3IS3A 5ITWA 3GPDG 4PLYA 1MG5A 3WFJA 4BNWA 5FWNA 1K89A 1LSSA 1XGKA 1Y8QB 2P4QA 2PK3A 2OXIA 1LU9A 4RLHA 2X23A 1Y5MA 3LT0A 2EW8A 4BO5A 4E5MA 3O8QA 4PG8A 3LYLA 4F6CA 3RVDA 1R4NA 2ZB4A 3MJVA 3LLVA 2X4GA 2IEBA 2I3GA 3WYEA 3SJUA 5MDHA 4B4UA 4J7UA 1YJ8A 1OFGA 1PGPA 2E37A 1PZGA 2NU9A 2D4AA 4ROSA 1ISJA 3UCEA 5K0ZA 2GGSA 1CJCA 3CMCO 2W2LA 1PJTA 3U3XA 5DOVA 5JCJD 1OBFO 3MTGA 1U8FO 3BMQB 1ZBQA 3KEOA 5EINA 4PIVA 3WYBA 1EUZA 1HTBA 4IIVA 2BGKA 4XWYA 3WXBA 4TSKA 1H9AA 1E7YA 3D0OA 2VHWA 2YYYA 4W6ZA 4CV2A 4P22A 4Z3DA 1OZAA 4FGWA 4B7UA 3GG9A 2J8ZA 3GDFA 2XXBA 4F6LA 4EJ0A 3KV3O 1QYDA 4Q9NA 4AJOA 1XA0A 3D64A 4YRDA 4OAQA 4U7WA 2IDZA 1EE9A 4MJLA 3ZHBA 2PA3A 3OEWA 1DFHA 4GBJA 3PLNA 4Y6SA 5G0VA 3VPXA 4ALNA 4CQMD 2Q2VA 5C3MA 3TFOA 4NJOA 1NFFA 4HADA 3OF2A 1ULUA 4BGUA 3I9KA 1DFIA 3RFTA 4NJMB 2LDXA 4MVJD 2PWZA 5L45A 5JSFA 1DC6A 1ZMTA 5JYDA 3VH1A 5U1PA 1HSOA 4TVBA 1NNUA 4E33A 2H1SA 1CWUA 3O4RA 4ZD6A 4BNKA 2DTDA 5KWEA 4WJZA 1UP6A 1EMDA 1IOLA 2NQTA 3GN2A 5HTOA 2VRCD 3QVTA 1DHTA 1ENZA 3UCFA 1OOEA 3WGGA 1IUKA 3ETEA 5KJEA 4JGBA 1G0NA 3GZNB 4EBFA 1BXGB 5G0TA 1K6JA 1SNYA 5FI5A 3TJRA 5G0UA 5A9SA 4NBTA 3NX4A 3QWFA 4WECA 3W4KA 5IZ4A 2Y1EA 3WNVA 3S1LA 1QXSA 4TKMA 3L4BC 3L9WA 1XQ1A 4BB5A 1MG0A 2WE8A 3S2IA 5KJCA 2YFQA 3VZQA 4FGSA 1MB4A 3COSA 4FBGA 3BTSA 1XQ6A 3EGOA 4YT5A 4CJXA 4RPLA 3DDNA 3VDQA 2R6JA 2YHUA 1ENOA 4WGGA 2Y93A 2DFDA 3D3WA 1EVYA 2YV3A 2CMDA 4BO0A 3L4BA 2HO5A 4DC0A 2NV6A 2EJVA 4TZKA 2GUGA 2CVZA 1T1SA 3W6UA 3I3OA 4YQYA 1JN0A 4CV0A 4LSWA 1BDMA 1I3KA 1EBUA 4CPDA 4TWRA 4N18A 4E6PA 4E4YA 1KC1A 3R3SA 1J0XO 4IQ8A 4J6FA 2W98A 4TRRA 1ADBA 1MV8A 2NADA 4BO6A 1ADCA 1KY4A 1U28A 4NI5A 1E3SA 1I01A 4JCOA 2Y67A 1BVUA 3KBOA 4R4JA 4BNLA 3RI3A 5F1KA 5ILOA 3OM9A 1WWKA 3DC2A 3MWDB 3WIEA 2B5VA 3NTQA 2GF2A 4BGVA 5ES3A 1GQ2A 4RF3A 3H5AA 4GMFA 1DC3A 3H9GA 3ZWVA 2PKQP 5EL0A 1GEEA 4BMNA 3ST7A 4JBHA 1ONNA 3GDGA 3LU1A 4BKUA 3SEFA 4RF2A 4CM7A 1ZEMA 1XWFA 2F00A 3LSYA 4K6FA 3SBOA 4UREA 2AEJA 4URFA 4IJVA 4QUKA 3U49A 4ALJA 5KTKA 4M54A 1EE2A 4WLVA 3TZCA 4KUGA 3P5SA 3GUCA 4K28A 1YRLA 3ZHYA 4BNFA 3ZGYA 2G17A 2JHGA 3Q11A 1EVJA 1A7KA 4M86A 4PLPA 2G76A 3WTBA 1CRWG 5MGBA 3BMOB 4YBZA 4NK4A 5KJ1A 2IEDA 1F14A 3BMNB 2DUWA 2ZCUA 1E1NA 1GUYA 3W8DA 3E82A 1E3EA 2OUIA 5ENVA 4RPKA 1LA2A 1P0FA 3INGA 2DUUA 2EERA 4E0BA 3JYOA 3Q1LA 5AXBA 4CODB 2BFOA 2EV9A 3BHMA 1ISMA 1WZEA 3QA9A 1Z6ZA 3IKTA 5L40A 4MINA 2YFHA 3V8BA 3GK3A 4MVJP 4HNHA 1HLDA 1PU2A 5DDIP 2BI7A 1HEUA 4MDHA 4UULA 4MP3A 2DBQA 1N7GA 1DOHA 4AFNA 4MKRA 5LCXA 4TRJA 3P19A 2PZKA 1V3UA 1GYQA 3JQ9C 3EMKA 4UVIA 4PZDA 1Y8RB 4AJPA 1U3VA 1TT5B 3ROPA 4LVUA 2CVOA 1Y81A 5B37A 4I1IA 1R15A 3FCOA 3GGPA 5G4KB 2AQIA 4ZU3A 5L51A 2NTNA 4BV8A 4BO4A 1QG6A 4HFNA 3WQSB 2H5LA 3CZRA 4CL8A 5A3JA 1VE9A 4YJGA 3CKYA 4IDEA 4YJFA 4FFRA 4D3FA 1UDBA 3WBBA 3AOGA 4O6VA 5JO9A 1NM5A 2X58A 3GVXA 2HMVA 4A26A 3ZWAA 1L7DA 4J3FA 3CINA 1I5RA 2DVMA 3VH2A 4AJEA 1ML3A 1QP8A 1LLCA 2OO5A 3HDQA 3I5MA 4GX5A 3W4IA 4CM8A 4CQMB 4Z0HO 3WIDA 5JDCC 1Q0HA 4H7PA 4DIBA 1T4DA 2D5CA 3F1KA 2IYPA 3ZHZA 3CXRA 2BMAA 5CAEA 5HWSA 3BXXA 2Z95A 1NPYA 3QWBA 1LDBA 4JJIA 4R1TA 5BSGA 4TQGA 3K6JA 2YQ5A 1ZVMA 4E5YA 1T25A 1FDVA 3V1TC 2FZEA 1YXMA 3UGKA 5DBFA 4HXYA 4BGIA 4ONEA 3FPCA 1GZ3A 3DMTA 5EPOA 1LNQA 4TZTA 2P91A 4IZIA 1KEWA 3DBLA 3K2BA 3T4XA 3AUAA 4FCCA 2YUTA 5CDTA 4MKXA 5JC8A 2VZ0A 4CMKA 4OXNA 4E30A 3K9QO 4ZA2A 2JCYA 4Z3KA 3BHIA 3ZN2A 4B8WA 1ZMOA 3DHYA 4IXWA 1E0DA 1HYEA 4FN4A 2JFHA 5T8KA 4GKBA 4LVCA 4XX0A 3JYQA 4XYGA 1ZSYA 4DIOA 3JQFA 3H65A 4OXYA 4BV9A 3PWZA 1TXGA 4NNJA 2A94A 1I2ZA 4N54A 2PD3A 3U09A 4YRBA 5B1YA 1DPGA 1U4SA 3VC7A 5KKAA 4D43A 4JX8A 1MFZA 2WD7A 2OP0A 5TRTA 4QO7A 2FSSA 2QZ9A 1PJ3A 3E18A 2NVUB 3ZV4A 5LDHA 1QR6A 2QZZA 3ETGA 3TZQA 4R9SA 2HMWA 4L0QA 3MZ0A 4YTEA 4OGWA 5GZ3A 3E8XA 3AI1A 2IXAA 4HX5A 4B3HA 2EJWA 4GWGA 4R9RA 2BGMA 2FMUA 4EUEA 3ETDA 2EGGA 2YY7A 3JQGA 5T64A 5JY1A 1MFPA 3ASVA 4EI2A 4DRYA 1ZJZA 3ZW8A 1NR1A 3ZI0A 1NAIA 3GMDA 3LT2A 5IXSA 2GZ2A 2O3JA 1BVRA 4FFPA 4D3SA 3G49A 4YDRA 1ZH8A 3WJAA 2XAAA 3WG9A 1U2GA 3D4PA 1QYXA 5T6BA 5G0WA 1E3WB 4L8VA 3WLEA 3WGOA 5A03A 4FC6A 1V8BA 4UVHA 2QIOA 1NVMB 5B12A 3GDOA 1LQUA 2Y1CA 4YPOA 3R1IA 1EUCA 2O2YA 4LW8A 3PP8A 4UEOA 5COAA 3GT0A 3UF0A 4U6QA 2PKRA 2VT2A 1P1JA 5ADHA 3ZWYA 2RHCA 1SPXA 4UUOA 2X1HA 3DHNA 4OSOA 5ITVA 2AE1A 4ZHSA 1ZJYA 5CPFA 1JTVA 1ZUD1 1MC5A 1E7SA 3H9QA 3I6QA 3NT2A 4P4NA 5ENDA 4DLAA 5IXYA 2ZYGA 4TKLA 2IZ1A 1LX6A 4NHEA 4EJ6A 3AOEA 3BMNA 1YGYA 2ZKLA 4S3MA 1MLDA 1RYEA 3QWIA 2D8AA 2DKNA 4GX0A 2VHYA 1QRRA 3L6DA 2OMEA 1E7RA 4EW6A 5A5EA 5IZCA 1O9BA 4DA9A 3DOJA 5F3RA 1YBMA 4KWHA 3C85A 5EQFA 1B3BA 3CH6A 4XYEA 1LBEA 4DQUA 3EVTA 1EVIA 3FWZA 4Q3EA 4WKGA 1E7WA 3TRIA 1BXKA 1YL6A 3GGGA 4Q3AA 1QORA 2VUUA 5TIIA 2ZJ0A 4LK3A 5ER9A 4DC1A 4DLLA 2A4KA 2X5OA 1RM5A 4RVSA 2VCYA 4QQRA 3PPIA 4CMEC 1K2WA 1HDGO 5HS4A 4A7PA 2BHLA 4DTIA 1F06A 2BELA 4YA6A 4EEZA 5DP1A 1VM6A 4QFCA 5DOZA 3OECA 1DSSG 4FIZA 5TC4A 4XJSA 1BHSA 2AXQA 2H9IA 3AU9A 1J5PA 5I7SA 2VOJA 4CLRA 4CQLA 1HDCA 4J4BA 1WDLA 3ZU5A 4YRAA 4R1UA 1VL0A 4QSMA 2DTXA 2I3AA 4FFLA 5LDGA 5JY6A 1KVRA 1VC2A 4DREA 5IN4A 1RPNA 4S1VA 1I33A 4UVDA 3UVEA 4WOJA 2V6FA 1KOLA 1G6KA 3T4EA 2ZJ1A 1LDMA 1FMCA 3QE3A 2HRBA 4IXTA 3BTUA 1IPFA 3QSGA 4PLHA 5F1OA 1B8VA 3PHLA 2FPPA 3ITKA 4PVDA 1A7AA 1E6UA 4W9NC 4WASA 5BR7A 2JFFA 4QXMA 3WGIA 3GNQA 2WWRA 3FF4A 1NHGA 1VRWA 3DEYX 4CMEA 1H0KA 1PJLA 1QMGA 1B2LA 2Q46A 1C0LA 3B1KA 5GMOA 2NVUA 2AQKA 4PLTA 2XPCA 4RPHA 1EK6A 3Q6IA 2VNSA 4Y9DA 2O4CA 4NH4A 4DVJA 2DU8A 5FFFA 1C14A 4F3YA 2J3HA 4C7JA 4BNXA 4E5PA 1B15A 3PI7A 2IYOA 4CM1A 3HFGA 3Q3CA 3UW3A 2XXJA 3WBFA 1KVSA 2EKLA 2Y66A 5A5FA 1T2FA 3AUSA 1LEHA 5JXWA 1NBOA 3QY9A 3I23A 1AHHA 1I3MA 3EYWA 3QVWA 1KERA 5JFOA 2C07A 4E2YA 2O7SA 4WCFA 4BMVA 1KVTA 2HKIA 1XR3A 3GEMA 2AA3A 2YW9A 3S2FA 5BNFA 3GEGA 1DRWA 3HUDA 2Y0EA 3K31A 4XKJA 3KYBA 1LTHR 2PGLA 4DWVA 1FDWA 3NUGA 3RUAA 5TGDA 2VZ8A 2WYVA 1L7EA 2YQ4A 1Z82A 3M2TA 2YDXA 2CF5A 4Q3BA 4E32A 2CDBA 3ANLA 4BO8A 4XGIA 4GSLA 1GEGA 1XIVA 3W1VA 3D4OA 2OZPA 1KY5A 3ZU3A 5AXDA 5ICMA 3IUPA 4WLFA 1PGOA 3WS7A 4O0LA 3AY6A 1O8CA 3D3EA 3EHEA 5CEFA 1KVUA 2C2YA 3WLFA 5AQ1A 2XF8A 1DLJA 3DXFA 3GVCA 3I6IA 4KP7A 4J4TA 4BB6A 3Q0EA 4YAKA 4L4SA 4LMRA 4RPGA 5IF3A 4L9RA 4MIEA 1JW9B 3IDSA 4II3A 1GDHA 4Z9FA 2DBRA 5JE8A 5THQA 2YV2A 4DPKA 4EUFA 4UUNA 1GD1O 5L7TA 3IP3A 4GX1A 1NPTO 2GO1A 3WTCA 3L6EA 1EVZA 4A5OA 2OBYA 3QVXA 2RBEA 1O94A 4D79A 4OXKA 4IJWA 2VRCA 3GVIA 3VVCA 1Q7BA 4QT0A 3DBVO 1YL5A 5DN9A 1A72A 3AK4A 3ULKA 3JQFC 3O9ZA 4XB1A 3MCVA 2X9GA 5T8KC 1F12A 2J3JA 1E5LA 1IE3A 3BIOA 2PKQO 4YAGA 1JVBA 1U5AA 1K5HA 4CLDA 5JYEA 2VYVD 4KDFA 1PS9A 2Z5LA 4U6SA 5DZSA 3OQ6A 1NVGA 3PHHA 1HKUA 4MPDA 3BTVA 2DBVO 2Y99A 3UUWA 2HRZA 5A05A 2X5JO 1LRLA 3CPSA 3IAHA 4D44A 5HS6A 1E1KA 5KKCA 4RDHA 3DB2A 3CMMA 2VUTA 2SCUA 1ZW1A 3C7AA 3DMTC 4C4OA 1X0VA 4J16A 1P74A 1PJ4A 4WE3A 2OORA 2PZJA 2HK9A 1EBFA 1UR5A 3PHJA 2CDCA 4PVCA 3PQEA 4J1SA 2C5AA 3MOIA 3JQAA 3VOSA 1X1TA 2OFPA 5L7WA 1GUZA 3I83A 5DBGA 4TVOA 4IDAA 3DOCA 3KVOA 2IZ0A 5CP8A 4JBIA 4N7RA 4XQEA 1LLQA 1JAYA 5TS3A 3RJ5A 3SC6A 4BMSA 1T2CA 5A9RA 2Z1MA 3N58A 4MVJI 3GFGA 4A0SA 3ZU4A 3E1KA 4F46A 3AW9A 4WLNA 3JQGB 3GG2A 1Z73A 1P1FA 4YAIA 3CUKA 5L4LA 2ZQYA 3RC9A 1NQOA 3B70A 3INTA 4MVJG 1LUAA 1I3NA 2BFMA 2YJZA 3HN7A 1R0KA 1XSEA 3RJ9A 2BD0A 4WCFB 1T1RA 1FDUA 2C7VA 3VPSA 4GGOA 3WX0A 4BS9A 3VH4A 4K26A 3PIDA 1NAHA 5AXCA 4UUPA 4DBVO 3C7DB 3C24A 5CPBA 3PHIA 4BHTA 2J5RA 1VJ1A 4XD2A 4XJTA 5B4UA 4I08A 3KSDO 1IPEA 2ZCVA 3EAGA 3ON5A 2VHVA 4WEQA 1P33A 2DBZA 2VWGA 3NAQA 5I7EA 1S7CA 1CF2O 2GNAA 3JQEA 1DLIA 1O0SA 1J4AA 3JQ7B 4M8SA 1R0SA 4D46A 5BNTA 2FP4A 1DBVO 2VOEA 1LC0A 2IRWA 3JQ9A 3QV1A 4KDEA 4E5NA 1FF9A 3KETA 3ABIA 2WYWA 1XKQA 3GQVA 1JU9A 3WQQA 2B4QA 1ZFNA 3HDYA 4DIFA 5HBRA 3OBBA 1W8DA 5EQDA 3NDIA 4YJFB 3T7CA 4FOOA 2PFGA 1ZXLA 3F47A 3GUYA 1CQJA 2BF7A 3JCZA 2FHSA 5JAQA 4A2CA 4ZQGA 3EC7A 3KTDA 1X7DA 4Y67A 1GY8A 3IJPA 3PJFA 1EDZA 2PV7A 2UUOA 3AM5A 2NM0A 3LQFA 3RC7A 5HA5A 5B4TA 5IJZA 5TNXA 5JDIC 4MVJM 1WP4A 3D7LA 4J1TA 5EIOA 1ENPA 4YAJA 1M2WA 3TSCA 1RM4A 3U5TA 3TPCA 4ZQFA 1K3TA 3DZIA 4M55A 2QRLA 2D3TA 4W7HA 1KS9A 1YBAA 2WDZA 4CM9A 1ISGA 4AJKA 4J1QA 3U4IA 3VZPA 2JFGA 5TSDA 3RUCA 5I8WA 3CZMA 1H6BA 2JHFA 2UYYA 3ZWWA 3NTOA 3LF2A 3FNFA 2O4UX 2NU7A 3JQ8A 3GVHA 4HUJA 1P1IA 3E6AA 5ILGA 3E03A 5GZ6A 2UUPA 2NWQA 4QFDA 3UKOA 3D5QA 2DLDA 1E3LA 2O3SA 4L74A 4PLZA 3S2GA 1WPQA 2W2LD 3DZBA 1UUFA 1BXZA 3RROA 5CEEA 2VUSA 4HNGA 4RO0A 3H9UA 2WD8A 1SEPA 4D41A 1N1EA 4ZJUA 4CMAA 5COQA 1UP7A 4GGPA 1E3JA 3WGYA 3PYMA 1PZEA 4Z0PA 4U8GA 1W0CA 5FEUA 4WCDA 3TZHA 5F5NA 3ZDFA 4IDGA 3E9MA 4O63O 4GWKA 3FHLA 2P9GA 3GRKA 2DC1A 1HXHA 1JDJA 3D1LA 1JA9A 1UXGA 1WAMA 1ZIDA 3JQCA 3WWYA 4DQVA 5TQVA 4RZIA 1PQWA 1X0XA 1X7HA 4L4RA 4JK3A 3PYLA 4Q3CA 1Y9EA 2BRUA 3VKUA 1CIVA 4RLSA 4B8ZA 4C7KA 2GLXA 3GF4A 5KVCA 1KEPA 2IXBA 4DLBA 2C54A 4YACA 3BTOA 1WW8A 3VTFA 1IULA 3ZWOA 4AICA 4BNHA 4CM8B 3KYDB 2EEZA 4GLLA 1DHRA 1PJ2A 1WVGA 4BGEA 1Y1PA 3RIHA 2D1YA 3DMYA 3ADOA 2FY8A 3HSKA 1TB4A 2QX7A 3C3XA 4BL5A 3L0DA 4BNVA 1F8GA 1HE2A 4PG7A 2IE0A 4K6CA 1HWYA 3CEAA 4J1NA 1M67A 3GPIA 3ONFA 5EESA 2ZTMA 3PTZA 4A03A 3DTYA 1NTOA 2UVDA 5CDUA 3PDJA 4J49A 3D4NA 4B3JA 1Z7BA 4NQZA 2P9EA 2OGUA 2Q4EA 1DC5A 4ITUA 3I4FA 3MJCA 4KTVE 5C5IA 2QQ5A 4I9NA 5AXAA 1A4IA 3R3JA 3P7MA 5F1PA 4G65A 2E82A 1Y5RA 2A92A 4XYBA 1FK8A 2O3QA 1ZZEA 2GN4A 4OYRA 4CM4A 2EHDA 4WLEA 2HU2A 1ADGA 4XDYA 3TNLA 3TOXA 3WSVA 5TLSA 1YO6A 1ZXBA 4Y6RA 3C1OA 2FPGA 1DIHA 3MTJA 1K0UA 1R12A 5KJFA 2Q3EA 1UDAA 2JD2A 3RBXA 4KMSA 3GEDA 4ZQHA 1PX0A 1YE3A 2ZTUA 1D3AA 3AFMA 4K9DA 3OP4A 1YQDA 1SB9A 3ZV5A 2FR8A 4HBGA 1E92A 2JCXA 1E6EA 2FWMX 5DT9A 1SO8A 4LMPA 3IC5A 2FPIA 2NSDA 1DRUA 4LN1A 1R0LA 3H3FA 4RPJA 2V6BA 3RBZA 4FPXA 1SMKA 3R0IA 3HN2A 5I8ZA 2Q1UA 2I5PO 3V2UA 5JLAA 1ZNQO 4BKPA 2ZYAA 2JD1A 4R01A 3ZNOA 2UDPA 1YWGO 4TRNA 1XCBA 1U5CA 3OA0A 1TT5A 1K6XA 2YDYA 3G0OA 3IUSA 1DIBA 1Y8RA 1SOWA 2HMSA 2DPHA 3I52A 3HJAA 4XA8A 5G4LA 4XRGA 3WNQA 2XOXA 5L4NA 2WTBA 1ISHA 3OIFA 4PLVA 2C2XA 1FDSA 1V9LA 2AW5A 2I66A 3HDJA 4PCVA 1ZSNA 1XU9A 2VTEA 4J91A 3T7EA 4DMLA 4BO7A 4P38A 4CUJA 2OOSA 1PQPA 2P2SA 1HYGA 5B4VA 3OJFA 1VL6A 1P1KA 4IGEA 1B16A 1CDOA 2AE2A 1YKFA 3PIIA 3DQPA 1X15A 1RJWA 2C20A 1R4MA 1N8KA 3OJEA 5BQFA 1PR9A 2WD7B 3CSDA 2G1UA 1YONA 5JMPA 5DP2A 1ID1A 1R66A 4CQMA 3FR8A 1MUUA 2JD0A 4OOEA 5DNAA 4EYEA 3OICA 2DPGA 4I5DA 2QYSA 4XGNA 1NQ5A 5ER6A 3KB6A 4PLCA 1JQBA 1PGQA 2HLPA 4IUYA 4J9VA 3ZNPA 3DBRB 4CM6A 3F4BA 3PXXA 1GU7A 4XEHA 4DMMA 3IMFA 1LSUA 1HZJA 1ULSA 3DAPA 3JQDA 1V3VA 4Z9YA 3TDKA 4BKQA 1X1EA 4E3ZA 4XQCA 3KYCB 2QG4A 2P9CA 1IYZA 1JWBB 4FC7A 4A10A 1R6DA 4RVGA 1HDZA 3GRPA 4Y98A 1LRJA 4D0SA 2PLAA 3TFQA 3HE3A 3RU7A 2YV1A 3ROQA 4JIGA 1XHLA 3BA1A 3F1LA 3JD4A 4FJ2A 3ZWNA 3G17A 5JAMA 2PR2A 3PRJA 4QECA 3M2PA 3GNSA 4IGFA 3QWHA 4OIMA 1SB8A 3F6YA 3OJOA 3EW7A 1RYDA 3WJ7A 4I5GA 2WE7A 1HDYA 2B0JA 4WLOA 1I8TA 4EITA 2VYNA 4BVAA 4MOWA 4GX2A 1JVSA 7MDHA 4XR4A 5JO0A 3FNEA 2BGLA 1HDXA 5A1TA 5L4SA 5GY7A 1PWZA 4HP8A 3JQAD 5BT9A 5DCWA 4XDZA 1HYHA 1TEHA 3RFVA 1D7OA 4PLWA 4GSKA 4IS3A 1XLTA 1YS4A 2GN6A 4GKVA 4TROA 5I7FA 3LDHA 5IDQA 3BYZA 1LI4A 3QRWA 3A4VA 1LQTA 4JROA 4OO3A 1R37A 3DR3A 4R41A 1GZ6A 4PFJA 3O8QB 4H15A 4X54A 4CUKA 4Q3NA 3W6ZA 1G0OA 1GZ4A 1ONOA 2JKVA 4D42A 2X8LA 3KZVA 4RV9A 2EWMA 1PJBA 3PYXA 4NJMA 1DXYA 1M66A 4CMGA 2CUKA 3A1NA 2DQ4A 4NK5A 4XZ3A 2X0RA 3DFZA 3ZWXA 1BDBA 3BAZA 1XYGA 1ZK0A 3PQFA 2PGDA 3FI9A 5AVOA 1ISFA 1M6WA 1NQTA 2NTJA 5K6AA 4WNIA 5G2OA 2DM6A 2J6IA 5IN5A 4YT8A 1E7QA 4KWIA 3PFFA 4OJNA 2RIRA 5C7LO 3I9OA 4G81A 5KOIA 3PZRA 4IIUA 3H9JA 3KRTA 6ADHA 5CG2A 3FSRA 4ND3A 4BO9A 3CE6A 4B7CA 3JV7A 1I32A 4U0KA 2DAPA 1WDKA 3DWFA 4NBRA 4CMJA 3V1UA 1H93A 1KIFA 3PGXA 3UFXA 1IZ0A 3H5NA 3H6KA 3FR7A 4BKRA 1WMBA 1Y9AA 2AEFA 2X5KO 3QIVA 5EN4A 2UAGA 3OH8A 3VPFA 5JS6A 4M49A 1I0ZA 3RKRA 4R1SA 3KM0A 5IAAA 1X13A 2H6EA 1LC3A 1Y6JA 1YDWA 4NBVA 2OL4A 4BNJA 4NIMA 2FZWA 3WWZA 3U62A 5AOVA 4PGFA 4WPGA 4NFSA 2C29D 4R69A 8LDHA 3X2EA 4E5KA 3FBGA 2ZB7A 5H81A 1HF3A 2DFVA 4CLOA
chains in the Genus database with same CATH superfamily
1V6AA 2H2HA 3TRHA 3ZKWB 4J90A 3GC6A 1QF6A 2VP6A 2CXRA 1ORRA 3UJ3X 3T4UA 3HY4A 3KBBA 1OXBB 3THSA 4GL2A 1A9XA 1B26A 2W5UA 1T8RA 3DV9A 1W6RA 3JR3A 1T0UA 2IXTA 3EMBA 4PZLA 5LP1A 1FTYA 2KLBA 5K6AC 3ICPA 4PCAA 1EFRD 5A3SA 3VKHA 3JQBA 1C29B 2O23A 3C4JA 3W5VA 2NQ2C 1N7JA 4KX3A 3GA0A 2ACWA 3UC5A 3EA0A 4W7IA 1MX5A 5A06A 4Z5XA 1MO5A 3CF0A 3EZ7A 3U4GA 1PFYA 1V5EA 5KCMA 4NEHB 5GP1A 2OCXA 4LCEA 5AW5A 1MO2A 3ZIUA 3C3CA 4XIYA 4ESHA 3FGOA 3H5IA 3MJTA 5ALNA 1BDHA 5KQPA 1U8ZA 4RM3A 3NBMA 1YD7A 3DAGA 1UKCA 4KJXA 2BFBB 4QEDA 3VPGA 1BU8A 1SY7A 3LYAA 3SU8A 1J06A 1MB9A 1QO7A 1DARA 1V3QE 1WABA 2DPMA 2OV3A 2P4SA 2PA0A 3KEQA 2VZ9A 3O21A 4UNQA 3WYCA 4DJDC 2HFKA 3BD7A 3I1YA 4IXMA 3DZFA 4CUZA 1PZHA 3UO8B 5DMHA 1OPXA 3IPXA 4KBGA 2XUHA 2P3LA 2BW0A 5A5DA 5F21A 2QM7A 3V42A 2A1TS 1P1HA 3NASA 4OHPA 3KVRA 5TGZA 1XLTC 4AYWA 1NVVQ 2JJYA 1R4MB 1Q14A 3D2LA 4HDSA 2C8KA 4FD3A 2AEMA 4QVKA 2DTEA 3MINB 4DCOA 1EVKA 1M33A 3HJBA 1C4XA 1UBLS 1KMQA 1A82A 1H2XA 1G41A 1U8YA 2QX8A 3U7GA 2MSDB 3L8FA 3QLJA 1IBCA 4HDRA 3QITA 4QUIA 1E2BA 3SXUB 4JYCA 1SEVA 3GA7A 4E4TA 3ANNA 4EJMA 1VMEA 1V25A 3GJ8A 3U4HA 2YVQA 3STXA 4CIWA 2RG7A 4H1WA 3BPSA 4ND4A 3I2GA 3O3CA 1ZK3A 3FYHA 4TRMA 3SQOA 3H8SA 3B1YA 3H9EO 3TR5A 3ZE7A 4RVNA 3PWSA 1DIAA 3GNLA 4A91A 3FCXA 2HYDA 3THWB 4B3DA 1XUOA 3E1GA 2AWNA 5DFAA 2V9PA 1O5IA 2MYPA 4GYKA 4DDMA 1F2VA 5FORA 3OHSX 4GI1A 5I9NA 4UCWA 3SF8B 2OUKA 2PVSA 2PPLA 2QVXX 3AF5A 2C1XA 4UXIA 1YJAA 2WWTA 2ZIUB 2G63A 1J49A 3ASUA 1H6AA 2ZJ2A 1RJDA 3QLUA 4MGIR 2AJLI 3S68A 2QENA 4Y6GB 1VGRA 4G8JA 2WQ7A 1RWPA 5BURA 2Z4TA 3DF9A 1H1DA 2TMGA 3OT5A 4AXXA 4XQ9A 2A5FA 1RSZA 4MIYA 2O1WA 5CYGA 1UEIA 1RE1A 5HZKA 3EZYA 2WSMA 3VH3A 2I7XA 3N70A 1QV6A 1YL7A 3FH0A 3MT0A 1G6Q1 1HNWB 4GI3A 1ZOOA 1DEHA 4O2RA 3KJIA 4F84A 2GHQA 2BP7A 3V6LA 3DO5A 4KN6A 3IAAA 1TZBA 1RC8A 3K6SB 1QP7A 4DBLC 5CYOA 1NF2A 3B20A 3MWGA 4IJQA 5K0JA 2XOKA 5EMMA 1N0IA 1TZCA 2Y1OA 4KWEA 4HI0E 4LE1A 1Y6ZA 4Y9UA 3AI3A 3IQWA 4RF4A 1ZLXA 2R6ZA 3CF6R 4DLPA 4HHEA 1QDUA 4NJEA 4RHTA 3ZDEA 3FKQA 4LBZA 4PBSA 3MJHA 4L7QA 1P2SA 1Z5UA 2JZOA 3QX3A 5GONB 2J3IA 4MARA 3X3HA 3ITDA 2H2GA 2O3UA 3SHFA 2X2FA 2CNBA 1Z74A 3G6WA 2OT3B 3T5PA 1N6KA 3I4LA 4IS2A 1Z0SA 1Z4IA 1K66A 4B4WA 1L9KA 5JECA 2VBIA 3NYRA 4OHKA 1X14A 3GOHA 5CA0B 2H7VA 4MICA 3G2IA 1WU7A 4ZOLF 5AOAA 1Z47A 4IPTA 4MI6A 3DE2X 5A4MS 4W9RA 4DQDA 1FU4A 4YK7A 5KTSA 2CL0X 1YVDA 2HTEA 3OC6A 2NNWB 3OOYA 5JQGA 3HXQA 3OI7A 4E70A 4TVSA 1TTTA 3CH7A 3PPXA 2FN4A 5M04A 1F0PA 1WY7A 3PQ6A 2GETA 4CM9D 3A2MA 3FY4A 1N2CA 5C7IO 2E85A 4HCJA 2FPLA 1PV4A 1T2AA 3F6SA 5D5QA 2OV1A 3WKCA 1Q7GA 1G8JA 3W5UA 3A28A 4KLCA 3IAUA 3ZI4A 3R5TA 4L72A 5HIIA 1G21B 3EOBI 2HRRA 4YJDA 5B2FA 4EA6A 4YJHB 4D9GA 4R2XA 4R8LA 3BIXA 3LF1A 3TIIA 3HP7A 2IU3A 4CKYA 2CKDA 2VHQA 4G24A 1EJ0A 4IBOA 3RD5A 2WICA 4DYVA 3K4QA 4EFMA 2C3OA 3GJ0A 4Y9TA 2FZ5A 1ZJ5A 4AZTA 1T5OA 1UJBA 3GMTA 5JI3E 5LIPA 1CB0A 2P90A 4LXTA 1GTVA 1TLTA 2C9YA 2GPAA 1EP9A 3BDIA 5FWXA 1LFAA 2FMFA 3IMEA 4MAAA 1PT5A 2H0AA 3D6VA 3O26A 4MAFA 4HH1A 5ALTA 1ISIA 5KYVA 1MOZA 3REQA 1SKBA 4EARA 4KEAA 3NYWA 2X4LA 4CCAA 7ADHA 3AKZA 5HIJA 2Q4TA 4OF4A 1MDFA 4XYMA 1L7AA 1V96A 2QRJA 4CKXA 4C6HA 1PZFA 1A8IA 3ZKWA 3NXSA 2GXQA 2RH8A 3PEWA 5CJJA 4LYAA 2PO5A 4RS4A 4X3CA 3D8SA 4Q66C 3I9NA 3KU1A 1LRKA 3NHRA 4HAZA 4HT3B 4YRKA 5BN3B 1AK2A 3K0CC 3Q7RA 2G5TA 1QB8A 2RI1A 2VSXA 4OYYA 4QHYA 4MTLA 2EQBA 3FFAA 4C0SA 4HQ0A 5L3ZA 2QT0A 1NZJA 3AV0B 3QQ5A 1C50A 1R4NB 1X1CA 4ZVQA 4YH1A 2MINB 5GJVC 3HH8A 16PKA 2POQX 3KJZA 3GR6A 1NYTA 3LPLA 5FUXA 3TLGA 1I2CA 2C2WA 5BW5A 1RAIA 2IC5A 3A36A 4HLNA 3IUNA 1EXMA 1QYVA 4DBZA 5D3ZA 2E6UX 2BJVA 2HFJA 1STOA 2XA2A 5IABA 2WU4A 4NMHA 4KBYA 1ULHA 2PZLA 2ILVA 2CLMB 2X0IA 3CRW1 5T5QA 5AW4A 1JEYA 3W5AA 1N5RA 3EXFB 1AVTA 5DEOA 3H8VA 4DCCA 1K63A 4CGZA 1JL3A 2XYPA 3IQGX 3RAEC 4QPNA 1FMTA 1GPJA 4DL9A 1ML4A 4MIOA 1MGOA 1S5PA 3E22B 1GTMA 5TQJA 3K2EA 2NU6A 2QN9A 3OQJA 4O2AB 1PJ8A 4PG6A 3VSCA 4CIVA 3JWEA 3OQPA 3V48A 4C5BA 1AHIA 4S1WA 3ZCQA 1XVAA 3NGXA 1EKXA 4J2OA 4MUIA 1U2RA 4LI0A 5J1TB 1AGXA 4CQLB 5KWIA 2W6CX 1I3CA 1RRMA 4MVJE 2FOXA 3N0TA 3QJ5A 2IE8A 2ZIXA 3GNTA 3IQFA 4MP8A 5U4XA 3BE8A 3T7KA 1PQUA 3ZY2A 4W4TA 1DAGA 5EPEA 3VKGA 4FUTA 1N25A 3N7UA 3SXUA 1R2QA 3BEOA 4ARSA 5JAPA 2FFAA 2QLFA 3HU1A 4REOA 2J30A 3D6HA 3W1EA 3W8RA 5J4LA 5L9AA 1Q0RA 3VHXA 3ZJVA 2YCLA 3FNGA 4ZDJA 4DR1B 3AY0A 3AHDA 3F5SA 4MPPA 4MRNA 4GP7A 3FTEA 2HN9A 3M9WA 5I7RA 2GBLA 3U56A 3X1XA 4BJ3A 3KQLA 2J0SA 4O4IA 3BE5A 4IGAA 3M89A 1NFQA 4LJ6A 1N9ZA 4MYTA 4QE3A 2QX4A 3ZWMA 4URXR 2D5AA 1AKRA 2CD9A 3R3XA 4FLFA 1E2EA 2HCTA 1Z28A 1IHYA 1H4QA 4LZZA 3NGMA 1UWLA 2G6BA 2Y76A 2V3VA 3KB2A 1JBEA 1OX6A 2WQZA 3SPXA 4D9MA 3K4PA 4DV5B 3AHEA 4B81A 2WM3A 1K6MA 3EQ2A 4M9QA 3AY3A 3BZUA 1RYYA 1O6ZA 1YZTA 2J45A 2PH3A 3FDFA 3NDRA 3NOOA 3H7IA 2HWUA 2QE6A 4GZ3A 4NV0A 4R2JA 2HOQA 3KYCA 4UW9A 2C3YA 3F5QA 4CIDA 2D54A 4CXMA 1NJ8A 5IKMA 5K0FA 4YO7A 2IHNA 1ZHHA 2GPTA 2O3RA 2CXSA 3MJSA 4KQJA 1JG2A 2AHOA 4PZEA 3RS9A 1VE5A 3PR2B 3K0AB 4IHQA 3EVCA 3FFBA 4QJ5A 2F1IA 4BBPA 4ZYZA 2WTAA 3D02A 3QXCA 2XVMA 2ZQZA 3TLKA 3VO8A 3NBYC 4JP3A 3O8BA 4QAJA 1PBNA 3HP1A 4BQRA 1JDVA 1P3DA 5IYZB 4L9WA 4EW3A 3KOOA 3H5WA 2Y0CA 4N7BA 3LBAA 4OBXA 4ZOCA 5B1DA 3ZWPA 4OQMA 2ET6A 2X42A 1P31A 4S1TA 2R97A 4AAYA 2EKQA 3K9BA 2VG8A 2E4WA 2CVQA 2YNMA 2GILA 1L5NA 2EFHB 2Q50A 3U1TA 4EF5A 4BFVA 1UJMA 4EHNA 1EB9A 3AEXA 1WOYA 4FX2A 4RJTA 1T36A 4Z2YA 3TW8A 4R5MA 3TJZA 2ZJ7A 4MV4A 3JRWA 3HEBA 1YMUA 1XRMA 1MAVA 2VJMB 2GLUA 4QBKA 4JT9A 2GNPA 3TOVA 4U7HA 5KHOC 1BVYF 1T8SA 5EJGA 5FV4A 1N7IA 1DDOA 4NP6A 2W2KA 3GVPA 2PS9A 4DHWA 1IPHA 5ALVA 1B8NA 3MRXA 2IWRA 3U26A 4IDBA 4R8KA 3FOAA 4EHFA 2OZLB 2AMFA 3U9SA 1DKOA 2R1ZA 2ZIZA 5JVDF 5FD8A 3HB1A 4ZANA 5KNLA 1C1DA 3AVPA 2Q3HA 2RI6A 1O94D 2FF5A 1W35A 1NI3A 2JPDA 4GLOA 2NUPB 3ORSA 2A9FA 2X0EA 4JR0A 4BQOA 2OFXA 3AB3A 4RAQA 4R8MA 3D7RA 1M2VB 4CLRB 2A9QA 5JJLA 2WHPB 2P75A 2JCVA 2DR0A 3AHIA 3MOGA 4AKEA 4FB4A 3IVXA 1XROA 3A27A 3RFUA 3GZNA 1A95A 1V16B 2JFWA 3AP1A 3R9WA 1N8TA 3U37A 1O7JA 3RUDA 2ZYDA 1N9GA 2KPOA 2DGDA 3LLSA 3OLVA 5IG2A 5FHQA 1X9IA 3GJQA 1XJWA 4AQYB 4NU0A 1HH4A 4LV5B 3CVJA 4A16A 1JIIA 1ZKDA 2FLVA 4MMYB 3UJ6A 3NBQA 1G21A 1SU6A 3V3KA 4A0GA 5M34A 5A0TA 1NV8A 3S99A 1ZKMA 2IODA 4HMQA 1OJ7A 3BJEA 1ORTA 1DOZA 4QPPA 4NV1A 3TTUA 2ZU0C 3D7NA 1G291 4F7WA 2QD5A 2JCSA 1CPYA 3WMFA 3C6MA 1QS0B 2YASA 2LE0A 4PWZA 2X2PA 2WYUA 1LSOA 4LTMA 4C76A 1OZHA 1A5SB 1C7FA 1K7EB 2PGJA 3DFUA 3VNSA 5CDYA 2F3QA 1H2HA 1VYTA 3G7NA 3MC1A 4IX9A 3VZRA 1II0A 4BNUA 1IBLB 2J4DA 3ZV7A 2IF0A 5KVSA 3BG5A 4CIBA 4K9QA 2BR4A 4AULA 1KU0A 2PUCA 2XUQA 1FDTA 3IESA 4EUKA 1U8XX 3CRNA 1G59A 2P9FA 3RFXA 4KMOA 1G16A 3TPFA 2L19A 1FSGA 2DFLA 1GNQA 2G72A 3BL6A 3LCMA 4GPEA 5TX7A 1C0PA 2BH9A 3ZDZB 4D0NA 5BP7A 2QG9A 1Z7GA 3GJTA 4LDQA 3CF2A 3CUYA 3GD7A 1RI1A 3BUSA 3GO4A 4MO9A 5JT1A 3HDGA 4CMCA 4Q00A 2MWMA 1XNHA 2OV6A 3N8HA 4LGVA 2GEJA 1WETA 3MJ4A 2ZT5A 3OIDA 1QV7A 4KSYA 5IJ0A 2X2EA 4LBWA 2EXXA 1XE3A 1AA9A 3SX0A 4WNAA 2TMDA 1YU9A 5LP6B 1AKYA 4OQPA 2XB4A 2HK8A 3A7EA 4OVKA 1I6KA 2C98A 2Z8YA 4HX2A 4KU4A 5CVTA 3PDIA 5C8DA 5KOHA 3R7WA 1J90A 1EGQA 4XFDA 1A4UA 3HKBB 3MT7A 1V7CA 4FFBB 4I46A 1OAOA 1JHUA 2RGEA 2ZYRA 3EULA 3KAQA 1DKPA 1JECA 1HZZC 4J0EA 4JJGA 4MV5A 4NZYA 2EFYA 4OSPA 4KHZA 3SCZA 3JXEA 1KEUA 3C41J 3J80A 1Y4DE 4GZLA 4YJ2A 2NACA 4IOJA 5HIAA 1S8OA 3DFMA 4P4GA 4XFKA 4WOCA 4DHEA 4TWZA 4UCQA 3WDKA 5KU7A 1M2NA 3T1HB 4D9FA 4DTCA 3PNKA 4GAEA 4MYHA 4YJHA 3VC1A 5A4AA 4H31A 4NBLA 5CXSA 2CEKA 5DNEA 1FPQA 2IZ7A 3ZDDA 2F9MA 1B8PA 1S2MA 1Y1QA 2GK7A 2Z6UA 3DBLB 3H11B 1N5LA 1IOWA 1PL7A 2W6PA 4JP2A 4K05A 2PZFA 3UK2A 1T3TA 3D6JA 4OB6A 4BBJA 1ESMA 3HKCB 4I1VA 4NF2A 5A4FS 5FTLA 3HKDB 3GJ7A 3U39A 5FWXB 4AY4A 4I9HA 1J99A 3U4DA 3FCSB 4M88A 1L0BA 3EH1A 1GTL1 2I87A 2Q8QA 4DZTA 3VUEA 1COZA 3TJRA 3E2PA 3WHKA 4WBNF 3I30X 4RK4A 3WGTA 4RY8A 3WKDA 3M83A 4TTQA 4B4VA 3S8YA 1PAUA 3UT0A 1MC1A 4IAOA 2VTVA 1NL3A 1P61B 3ANMA 4TMXA 1CUBA 3DAFA 1UPBA 2CSUA 1XZQA 3BZWA 1DV2A 3FGNA 4JQOA 4MVJH 3UN1A 3DOUA 4L73A 5DULA 4ZYTA 2HSDA 3PUKA 4J4HA 3QVLA 2K4MA 1TIPA 4BWFB 4G1FA 2B5WA 2O0KA 1L7VC 3NHPA 2Y4OA 2G67A 1C1XB 1E60A 3OURA 4NY1A 4WCFC 3WP1B 1CYEA 1KEKA 3GP8A 1CJUC 5LYJB 1ZNXA 1SVIA 4H7HA 2ZREA 2R85A 1Z75A 3PRHA 4ND5A 1JIJA 4ZQIA 1OXMA 4L0CA 3W78A 4IQ0A 1HKHA 2PZBA 3LP8A 3SX2A 1NW5A 1KARA 2F8MA 5KTTA 1ZK2A 3TI7A 3ZLJA 4XQGA 4PINA 3G5TA 3TLCA 1EFUA 1L5OA 4G5XA 3O03A 4B7XA 2IOHA 2VXOA 2OXEA 2HRDA 4TYPA 2R6AA 4F9EA 1DJMA 2QW8A 3UPUA 5FF9A 2ECKA 3RTGA 5FNVB 3EASA 5HUQA 1ZUNA 1LJUA 5E7MA 1EFKA 2F90A 3W7AA 5I51A 5JBIA 5IVIA 1KORA 2YHIA 3QI7A 3RIEA 3MLAA 4RULA 2N1BA 4ZQBA 3GARA 9ATCA 1TVMA 1DTWA 1KC3A 3M3PA 3TM4A 2XQVA 1WW2A 3W3AH 3SVLA 1BVHA 1UFKA 5C34B 3I4CA 3DMDA 3RTEA 4BUJA 1R6AA 5AI4A 5IBPA 1XTKA 3M81A 3I2KA 4X63A 5K20A 2Z9DA 4UEQA 4YJGB 5JZSA 4RJLA 1FY2A 5EG5A 3OJLA 1E6WA 1U98A 1QC5A 1XVIA 2AFIA 2ID9A 4NSNA 4Y2YA 5COBA 2OXCA 3VO1A 4B45A 3IL2A 2NLOA 1UIMA 1U3CA 5I01A 2PRZA 3OZTA 4ZJZA 3AZOA 1GJRA 3G0GA 1XTBA 2I99A 1KL7A 3PDWA 4WL0A 1A97A 1XELA 3SR0A 4DUPA 1EA5A 5FBWB 4GZMA 1UBGA 1ATIA 1T2EA 4WXEA 3V4SA 4WCVA 4CR8A 5A3RA 1Z3CA 1NLMA 5JD5A 4MB2A 2XQJA 3CCCA 1CQJB 1QVZA 4R84A 1G6HA 1HDRA 1L5SA 1D1TA 1VGVA 2P4HX 3HA3A 4L4XA 5CH8A 2YY5A 3K70D 3DM5A 1P29A 2G3YA 2JLBA 3B48A 3JD0A 3ZY6A 3L7MA 3AR4A 3JYLA 3PHGA 2CNDA 1T4CB 2BFAA 3V4ZA 4MVJA 1M5TA 1AQLA 1A9PA 4PRLA 3ZX5A 1Y8ZA 3H13A 2IKQA 3S1SA 3CZPA 2B8WA 1VG0B 4HNAA 1JPJA 1WMDA 4Y1RA 1T6ZA 3FJYA 3PJGA 3VDXA 1R7RA 3W1WA 3JPWA 5KTOA 4X62B 2Q0HA 1N32B 2ILTA 4EGFA 5ICSA 3GEPA 3PLRA 2O8FB 2G5GX 1JG6A 1GTZA 1QHIA 4OFBA 1CZRA 2JFUA 2RHBA 3ITNA 3M6UA 3VR0A 4DNPA 3X1MA 4HLCA 4ARBA 3MWYW 3H5LA 5JS8A 2ZDQA 1GCGA 1YQGA 4QULA 3SSMA 4D25A 3AFNA 2XUFA 1ILWA 1CVLA 1MPXA 4PC7A 1W4ZA 1YCFA 4TTPA 1ULZA 3WR5A 2J6HA 1G1AA 1OLXA 2Y6VA 1G17A 4RHCA 1SHLA 4K87A 1YASA 2PWBA 4PQFA 3SQDA 4EPXA 4F2PA 1GGJA 4W99A 1CUDA 1Q92A 1IRIA 2H63A 3L9XA 2BFEB 5EIEA 4ZKEA 5JH7B 4S2UA 1BGVA 4TLLB 1UT5A 2GAIA 1FCJA 1MA0A 3WZMA 5EKDA 1FX0A 3BSYA 4WN9A 3QFCA 3OJXA 3ONVA 4MP6A 5FIUA 4ER6A 2FN7A 3CZQA 3H2SA 4UBOA 4BVEA 4H6PA 5AVUA 2FFQA 2GDZA 3V4OA 1BSVA 3N2LA 2V65A 1MH1A 2HJVA 3ICQB 5JFTA 3KUXA 1P5RA 5KNDH 3D1JA 1TYBE 2HWYA 3R6TA 4FKBA 5DHQA 1AMNA 3NPMA 1KI7A 1MZVA 1FUIA 3RQSA 2VFAA 1M1NA 4QNMA 2UZ3A 1XF1A 4RU1A 4X66B 3S29A 3WDSA 1F17A 2X77A 5KTRA 3KD2A 3D3WB 3Q6MA 4AN4A 4XB2A 4WERA 3D4LA 2LDBA 4DSNA 1KOGA 1TKCA 4RHYA 3L8CA 1G8KA 1KQPA 2WVAA 3LXXA 3VX4A 4ABYA 3LY9A 4QEKA 8ATCA 2DLNA 2EIHA 3IQXA 3P26A 1U9JA 3GH3A 4QJ4A 1RE0A 4YEDA 3U7EB 2P79A 4X20A 2VDRB 4JQSA 5DPMA 2GR9A 1FJHA 4Z2AA 2IEGA 4QVIA 4CKBB 1IQRA 5G02A 3TAHA 2FU5C 1NHWA 4LYHA 2QYTA 1UK6A 5CT5A 2GPBA 1LLDA 3QUSA 2OCDA 1NW8A 4HMOA 4TGLA 4TLBA 3VKVA 5BMVF 4RL6A 5C1OA 4Q9KA 1U7WA 2J59A 1ONPA 1VPTA 2Q0SA 5I9MA 4IOKA 1Z06A 3HYSA 1FLAA 3STHA 5AVTA 4B6QA 4OG2A 1NPDA 3V1KA 1UZLA 2IHBA 2SICE 3FZEA 5CW2A 5G1OA 1IHPA 4JBGA 3UGTA 1BCSA 1QTIA 3BL5A 5FLEX 4G4GA 4YHBA 3DCIA 3IX7A 1TQ8A 1U3UA 5JJIA 1YQEA 2XWJI 3PFHA 3PX2A 4KYUA 2AG6A 2UXDB 1D8AA 1GUAA 1OZFA 2Z04A 4RK0A 4Z1OA 1P72A 1EUDA 4CKWA 3HMQA 1JIUA 3WRVA 4C2BA 4RSMA 2VSQA 4H4CA 3EZXA 4H3VA 2ZAGA 4CMIA 2PJRA 4PX9A 1DQYA 1I2BA 1F0YA 1Y0BA 4LQCA 5G0SA 2OD7A 4YCAA 2JBAA 5A4JA 4EL5A 2EF1A 1L1QA 1Q22A 2O3TA 2YRWA 1PSDA 5KEIA 1JQ5A 1JSXA 1KBZA 2QLLA 4YXFA 3N59A 4NXNB 4QYMA 2A3RA 3IR5A 5DI3A 3GT3A 4W9MC 2IZZA 2V97A 4UBJA 3RADC 1JR3A 4KDRA 1CUYA 2GD1O 3TOSA 2Q5JA 1ZCJA 1KETA 3JWGA 5HF9A 3SD7A 4DUZB 3BF8A 3L7KA 1SU8A 5EYPA 1JEQA 4CHTA 5AMXA 2QLBA 2E18A 4MI9A 5KJ6A 4RLFA 5FYQA 1AS3A 3OFKA 1CC1S 3IP5A 3P9IA 4XCQA 1LV7A 4BO3A 1PS0A 2ISCA 1KYVA 1GKKA 4YCJA 3QQPA 3T5AA 5H83A 1UQTA 1T5LA 4E2XA 1M9NA 1V1RA 2XEDA 4L4UA 4OGGA 5JCPA 1GNPA 4ARIA 1HLPA 2HBZA 3FKSA 3G2LA 4UBLA 1NX9A 4X85A 2DX7A 4RF5A 3RJZA 4EB3A 4I9UA 1GPNA 4AJLA 4B79A 3K09A 4L4YA 4GI2A 5LXTF 2XD4A 2FWIA 1K7YA 3E35A 3OA2A 1X77A 1XDDA 2Y1KA 2Q2NA 3GCWA 2O5RA 1QYWA 4PFSA 4UUQA 4X91A 1IL0A 2Y05A 1BWRA 4XLTA 1QG0A 3PGVA 3Q5GA 4JHLA 4KE8A 1GPDG 2FWAA 1NJSA 1K8ZB 2NUAA 3L1HA 5EE0A 1T9KA 3ZYZA 4BP3A 9MHTA 2QL7A 2CDAA 1TJ5A 4QQ8A 4ZVOA 2NSJA 2H92A 2AG0A 4C4SA 2WKQA 1NUUA 2B69A 5TT0A 3HO6A 4XWKA 4WZBE 4X5OA 1NASA 2QN3A 3DDSA 3S2EA 3T95A 2ANBA 1GNTA 3LX5A 4LXYA 5EJ7A 1N33B 1D5WA 3VDRA 5DT2A 5BORA 3BSWA 4MKZA 1Z6QA 2EL9A 2DUMA 1M54A 4U9IS 2FMTA 1X1RA 3P2YA 1UPCA 5LA6B 3ZJ4A 1F1JA 1VJGA 3PQ5A 3RU9A 3DJYA 1L4HA 4TUYF 5EXEA 5FPQA 4YB8A 3K73O 3RAJA 3F4LA 5KYUA 4H1TA 5EJ5A 2C82A 5GTDA 1HT2E 1FFXA 3FG9A 3KX2A 3NORA 3GY0A 1Y1RA 4UEKA 1ACLA 3OJ0A 3I1JA 3QOYA 3TM5A 3LUPA 5IJ9A 4GYJA 1SUFA 5E7JA 3LIPA 1D2GA 1SUWA 1X1DA 3LG2A 4DABA 4R6XA 2ECFA 5DCUA 3REOA 5A6SA 1LVHA 4HJXA 1DJQA 4LC9A 4EDFA 5LLDA 2E5FA 1G3QA 1U4OA 1ZH0A 2A0UA 1OXVA 1VE1A 2QVBA 2WEKA 3N5CA 3NIFB 4FKMA 4V3CA 3FVVA 4WACA 4ARUA 5LNK1 2IYAA 5K8IA 4FM9A 2VN8A 3RSHA 2Q5EA 3P45A 2QVCA 3DLTA 1BN7A 3OZSA 3CRZA 1IEXA 3TVDA 4B2YA 1E79A 3QOFA 2GLTA 2O57A 2ZEJA 2E1RA 1DIRA 2MMCA 4JJFA 4HUTA 2PYDA 3I6YA 1VKOA 2GASA 4JI5B 2F8TA 4FHGA 5ITWA 3GPDG 4PLYA 3MILA 1L4BA 3H8JA 3OT1B 4YUYA 4BFWA 3TKYA 1QCZA 3U4QA 1XGKA 1Y8QB 1XNJA 2PK3A 3QW4B 3KQYA 2OXIA 1UMCA 3BCHA 3LT0A 1IQUA 3OCCA 1DEKA 4BO5A 3O8QA 2IFTA 1F0NA 4PG8A 1OF1A 3WKEA 2ADMA 3VAYA 3GT7A 3QX8A 1NSTA 3D8BA 4Q9DA 5C8VA 1U65A 3IT2A 2E87A 4KITB 4DS3A 1OFGA 1H8ED 1WQ1R 3ILHA 3OOWA 1VLVA 4N12A 1DCKA 4ROSA 5KSPA 1N2JA 3DWGA 6GPBA 1ISJA 4CIAA 2JLYA 3EGEA 2GGSA 3U3OA 1WA5A 4L6AA 3T9AA 4CVNA 3H0CA 3TRJA 2CLEB 4B85A 3CF4A 3D2AA 1WUKS 3KEOA 3HO1A 5EINA 2XQFA 1EUZA 1U2PA 2AK3A 1B1CA 1OXSC 2BGKA 3F96A 3HCPA 3RT1A 3WXBA 4URWR 1H9AA 3ZYCA 1FTGA 1XEFA 3DPSA 5F12A 3D0OA 4D74A 2V3CC 4F86A 4MB0A 2H48A 4MRVA 1VCHA 4P7KA 4W6ZA 3DKVA 2FV8A 5TQ0A 4EJSA 5AKIA 4EABA 1H69A 1L5FA 3ISVA 3CRMA 1KK2A 3DUWA 2DKFA 1E61A 1OZAA 2ZE8A 1HNNA 1PQYA 1Z3IX 4EKGA 4XWWA 2P0YA 2GXUA 5AHXA 4OAPA 1QFJA 1WJGA 4GF5A 1U8EA 1QYDA 5JZBA 5CIYA 2V0NA 4YRDA 4OAQA 3P4XA 2KE5A 4UD6A 5F64A 5FNZA 2IWHA 2R87A 3GLGB 5E9JA 4E7OA 2FEWB 3JZFA 3PUIA 4NABA 4UE2A 4X94A 4YPVA 5G0VA 2EWVA 2JLXA 2GEKA 2KBFA 1P2UA 2H06A 4QPDA 3CY6A 3D6AA 5DX0A 2F43B 4CQMD 2Q2VA 5BPHA 3IBGA 4EYGA 5C3MA 2ZBFA 4LGYA 4P35A 4IG9A 1NFFA 3IB6A 2D1FA 3RUPA 4HADA 3TRKA 1V1MB 3CKKA 1ONBA 1FFEA 3OF2A 3RSGA 1DFIA 2OCGA 4I3FA 1N3LA 3WHLA 5FQOA 4HF7A 3R9IA 2LDXA 2AFHA 4AY6A 4K9NA 2R4QA 4M9RA 3M33A 3DSRA 3Q3VA 3PJRA 3OKFA 4ZP1A 1EBBA 2AOTB 3EVGA 5REQA 4E33A 1CWUA 3K35A 3ZDYB 3GW8A 2DTDA 4FHDA 4G1VA 3S1AA 4FHFA 4C29A 2Q2OA 4P6VF 2NQTA 2VRCD 1JA1A 1MV5A 1PYDA 2X14A 5KYYB 3LS2A 4AMVA 2ORWA 1OOEA 1J8VA 1NATA 2D2FA 3A6DA 3BGOS 3ETEA 4R98A 4TMKA 5BN4A 1WZCA 5F2OA 3QKWA 1BE0A 2MT9A 2ZM6B 1D04A 4NWIA 3IVGA 5TY0A 3V55A 4D8XA 2NT4A 5JH7A 1OGIA 3QMWA 5LNK6 1KMIY 2XCUA 3DL0A 1MB3A 2X8JA 4QXQA 4KAFA 2ZSUA 4I50B 3NX4A 1E2GA 3DDWA 3W3ZB 3WNVA 3OKPA 1LBIA 1QXSA 3E5HA 4L0MA 3L4BC 1XQ1A 2XWSA 3BB1A 3NVMB 4BLPA 1SIOA 1BJTA 4DV4B 5KJCA 5E9QA 1HEIA 5G3YA 1KQOA 1WKBA 1Y7IA 2CYCA 2R7LA 3COSA 3OPYI 4DV2B 4D98A 4YT5A 2C9MA 1GQRA 1XXHA 2WFLA 3A2LA 3OPYB 3DDNA 4TQAA 5AKKA 3PFBA 1A4RA 1XCMA 1VMAA 5MHTA 2R6JA 1BS9A 1NR5A 2WZQA 2YHUA 3R7SA 4I4NA 5CXXA 2A88A 3KQVA 2YJ6A 4MLZA 1TM7E 1ZGAA 3D3WA 3W04A 4UU8A 3NH6A 5E0OA 3TTYA 3NTXA 4BO0A 5DHUA 3W05A 3MW8A 1KS2A 3OESA 1EG2A 1SGWA 4RS3A 5SZHB 2ASVA 4MPJA 4UFNA 4QUEA 4YASA 4HYTA 2H8KA 1J0AA 3IP8A 5JARA 2DOKA 1VTKA 2EZTA 2GUGA 3OX1A 2HCBA 4LYJA 1T1SA 4QQFA 4N7JA 2PXCA 3QGMA 3W6UA 4LSWA 1FDRA 3VR5D 4P80A 4HJRA 1MHPA 2OHHA 1KK3A 1VXOA 4E6PA 2E2WA 1KC1A 5AKLA 4YJ3A 2V7BA 4IQ8A 4MVXA 1IAQA 4I55F 1WX1A 2WUWE 2X3UA 2BRUC 4HEHA 1VYVA 2XX3A 3MAAC 4AQ7A 2NADA 3HP4A 3THYA 1ADCA 1KY4A 2PS1A 1I01A 4EQ6A 3LZCA 1I7NA 5CT4A 3B2NA 3BWXA 2H1VA 3IAFA 3OEED 1GZUA 4P3YA 2W83A 4DZRA 5EZSA 1EK0A 2PU5A 3M34A 4F72A 2YYAA 1Y7PA 3RIGA 1TM4E 5ECYA 4BGVA 2GF2A 1T5DX 4M0UA 3V9PA 3H5AA 4GMFA 1L7OA 1SZCA 2JIDA 3ZWVA 3IE1A 2AJBA 3WL4A 3OTOB 3ZVKA 4P0TA 4BMNA 3T06B 2JI6A 2YJ5A 3F98A 2Z5VA 1J23A 3FYUA 1ABFA 3ND9A 2P4UA 4C4ZA 4MW1A 5EWLA 3SHVA 1DGQA 3LV8A 2AIRA 4D9KA 3FPAA 2QQGA 2FEXA 2WNIA 4O4HA 1CTQA 4NBNA 1V8PA 5DXFA 1WXHA 2O8VA 2YWJA 2V0CA 3SBOA 2R7NA 4TXHA 5B1IA 4ESEA 2Q4OA 1NN5A 3GFRA 4DEVA 3LVRE 1HUQA 4QUKA 3ZGZA 4ALJA 5KTKA 3RLIA 4BFZA 5YASA 1NYRA 4WLVA 4EKNB 3PI6A 3D4BA 4G0OA 4ENUA 1I4LD 1N5IA 3LOUA 4KUGA 1E1RD 3KKQA 3A1UA 1YRLA 1OTXA 4MUEA 1NY6A 4K46A 4O4LA 2BR5A 3RDPA 1ZN8A 2ODNA 1T6YA 2JHGA 2ZANA 3EGDA 4WA7A 1B93A 3Q11A 1EVJA 4Y0VA 5JSYA 3SBXA 4AP5A 5CNMA 3BMOB 5AWFC 2VF2A 3FMGA 2XUIA 1IRXA 1J09A 3TNYA 5AW1A 2CT8A 1X39A 3COYA 1FSSA 3DLCA 1E3DA 1E3EA 1Q95A 2IUTA 2Y92A 1SUDA 4E94A 3BWDD 3HCOA 4MUBA 3MCWA 4ZIRA 3H1TA 1W52X 4MUGA 7MHTA 1E2FA 3PR1A 1WM1A 5EOVA 1F2TA 1UBSB 2GHRA 4E0BA 1E2LA 4J1TC 3C39A 5AXBA 3ZGXA 4PXSA 4CODB 3FSJX 1I4EB 1NDUA 1QQ6A 2IEAA 2RGYA 4RE6A 1J5EB 4L8WB 1ISMA 1WZEA 3BIJA 3SF8A 4EFKA 1KYXA 4OU4A 4AX8A 1ZC4A 3HGTA 5L40A 5DM2A 3QLVC 3LO8A 4HNHA 4MVJP 1HLDA 1U8TA 1H2FA 2BI7A 2HT6A 4Q3OA 4TKUB 5E3IA 3ZJUA 1NVKA 1UJ5A 5BVHB 5KREA 4MP3A 4YLGA 2XQIA 3TXAA 5B7NA 4AFNA 1N4DA 1FMLA 3IVMA 2VJLA 5IWAB 2CLHB 2R751 3OLCX 1IN7A 1V3UA 4JMPA 4LY6A 3CSUA 5ESDA 3EMKA 4AMYA 1KO5A 1DAHA 4FFVA 1PZMA 4QWMA 3C5EA 4DN6A 1Y8RB 3LDGA 3VFDA 5ALKA 5K0EA 1U3VA 2FZ4A 2YZNA 2WZBA 1YHNA 1ZVJA 3CKLA 3K1AA 4OSEA 3ROPA 3KUUA 3AKDA 2JCBA 4LSGA 3O82A 2CVOA 1Y81A 4FNGA 2MDTA 4I1IA 4KN9S 4X9XA 5J47A 5G4KB 3VM6A 1KF0A 2AQIA 3EOZA 4IX1A 4ZU3A 4BV8A 3WFZA 2PBRA 1ND6A 3PXUA 4HFNA 3UUGA 5IUJC 1V6SA 1YNOA 3CZRA 4F0JA 2ZYUX 3JX9A 1TYZA 2IOQA 2VPPA 3N3AC 1QHXA 4O2BA 2XCTB 4XM0A 3WBBA 3D2BA 1MRZA 3LGXA 3REQB 4A4DA 4BQQA 4D82A 3VOTA 2QPLA 2F8SA 1GNSA 5P8WA 3GVXA 5F23A 1W5SA 3M6MD 4OJYA 1GG2A 1FJ2A 3BBLA 3AUFA 3JATB 4BASA 2XZLA 3BKWA 1BKDR 4KXMA 2P5SA 2DVMA 4L5YA 4MUMA 1L5ZA 4ZI3A 1QP8A 5DISB 3WL5A 2OYSA 1Z4NA 4RIHA 4KOEC 3ESZA 5CLIA 3M6FA 4XSGA 4JFRA 4ARAA 2GTIA 2ZUVA 3PTAA 4LTDA 1Z15A 5B7PA 3CLRD 3F74A 3Q3EA 3X1KA 2BHNA 4QRHA 5JQWA 4CJXA 3AUKA 1T4DA 2QJWA 1TF2A 4XH9B 3EARA 3F1KA 1WEKA 1GPBA 4C0LA 5EEGA 4LKOA 2BMAA 1XMOB 5JSQA 3IT3A 4N5DA 4O4JA 2MINA 2AOTA 2OVFA 4FMPA 4PR3A 1EFRA 5REQB 3ZXUB 1L5KA 3H86A 2YQ5A 3VNRA 1WV0A 2WP8J 4EW2A 3UGKA 3OZCA 2XVZA 2H52A 1WXFA 3N53A 5EJFA 1IZ8A 4AT1A 4BGIA 5IT9A 4B46A 2NZUG 1FP4B 2J1LA 4QD3A 5CVVA 1T5IA 1KEWA 3QFHA 4DJFC 2LBPA 3OCYA 2QPTA 3TEJA 4FCCA 1T13A 3FGZA 2ZETA 3LPCA 3O93A 1XK6A 3UXEA 2G07A 2J4FA 3GLVA 2GUWA 2YJTD 2VZ0A 3DNMA 4A6PA 4CMKA 3PEEA 1RRFA 1PNOA 4MYSA 1I6MA 1N6OA 1VXRA 1ECBA 3A3KA 1G55A 3EDRA 1N77A 3TVYA 3ZZ0A 4LDPA 4V0OA 5AW9A 3VYUB 4B8WA 1RXWA 1G2IA 1E0DA 2WM2A 4ON9A 3ZCTA 3O6VA 5LQDA 4LVCA 1I9GA 1W1UA 3JYQA 4XYGA 2I2CA 2FPGB 4GOND 4DIOA 3C5WP 3JQFA 3QE9Y 4DT1A 4ZTUB 1IIRA 3PWZA 1TXGA 1XTUA 3GYBA 4NNJA 4GFDA 1UBHS 1Z35A 1JJ7A 2A5GA 4EWLA 4YRSA 1U4SA 1C7RA 4P4UA 5KKAA 4JX8A 3RE1A 4BAUA 4ZDIA 1P62B 5KNBA 3M6LA 4FNAA 1E9SA 4Y3UA 1U2QA 4J3JA 1Z2DA 1W2HA 2G1KA 1O94C 4YJ3F 3IOBA 2OP0A 1BNCA 4QO7A 3UWSA 1PJ3A 2NVUB 5BOVA 4Q7QA 5LDHA 1CDEA 4EG3A 4JBNA 2QZZA 3Q1KA 5C1PA 3ETGA 2Z9CA 3CIOA 1B42A 3VNVA 8MHTA 3Q3IA 1UFQA 1CFJA 2XUJA 4B3MB 1NI5A 1NU6A 4YTEA 5C53B 1YA6A 5GZ3A 4CEJB 1L2TA 1QOPB 2CCGA 4FYXA 4TTRA 1GG8A 1NNLA 3ETDA 3I92A 3OPNA 3S1AB 3AERA 2YY7A 3JQGA 3VYWA 4W5TA 3BHNA 2QTCA 1MFPA 3ASVA 1D7AA 4EI2A 4IHJF 1ZJZA 1U0RA 3ZW8A 1NR1A 3AIMA 1NJ1A 1NAIA 4O1IA 3T0IA 5HIMA 1PHRA 4DR2B 1RDFA 2DP4E 3PVSA 4FFPA 5I4KA 5CFLA 4TYQA 4UOZA 3WG9A 4K7JA 4QDOA 1J42A 3D4PA 2HHHB 2SECE 1FMJA 4OQ4A 4HRVA 2I3ZA 1E3WB 1W4R