4KWIA

The crystal structure of angucycline c-6 ketoreductase lanv with bound nadp and 11-deoxy-6-oxylandomycinone
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
252
structure length
252
Chain Sequence
GNLTGKTALVTGASRGIGRAIAEKLGYAGALVAVHYATGADAAAEVAESIEKDGGRAFTVKAELGVPGDVDVLFEGLERGLKERTGATDLDILVNNAGVMAMGAPEEVTPEMFDRMMAVNAKAPFFIVQRALSVMPDGGRIINVSSGLTRVASPDQVTYGMSKGALEQIALHFSRHLGSRRITVNSVAPGSTDNGSALFQIPEVRETLSQLSTFGEVAEPAAIADVVAFLASEDARWITGAFIDASGGTLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reductase homolog
publication title Structural and functional analysis of angucycline C-6 ketoreductase LanV involved in landomycin biosynthesis.
pubmed doi rcsb
source organism Streptomyces cyanogenus
molecule tags Oxidoreductase/antibiotic
total genus 89
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4kwiA00
1XEAA 4ROSA 4HADA 3RKUA 4OH1A 1A4IA 2B5VA 1PEDA 3AK4A 3SX2A 5KOIA 4RF5A 3QJ5A 3FRJA 4IPTA 2V65A 3X2EA 4FJ0A 2NQTA 2VHZA 1V6AA 3ANLA 3H9UA 1D1TA 3DBLB 4P22A 1NPDA 3HFGA 3HDHA 1E3WA 1JDJA 1GQ2A 1GY8A 1NYTA 3SC4A 5JYEA 1HKUA 3IUPA 1HDZA 2I66A 4PRKA 3GLQA 3BAZA 1N5DA 3BTUA 1FDWA 3U5TA 1MGOA 4U7WA 2D59A 5JY1A 2AHRA 1I8TA 3IMFA 7MDHA 2GCGA 3UH1A 5AYVA 1UXIA 2X1HA 1HT0A 4GMFA 1UAYA 1LC0A 4FN4A 2Q2VA 4BO6A 3AI2A 4AJIA 3JYQA 3M2PA 2O4UX 3F3SA 5THKA 4ALKA 1ISHA 2GZ1A 1WZEA 4CM3A 1PR3A 4J49A 1ARZA 4Q3CA 3L4SO 5HTOA 4W9NC 3R6DA 5KJ6A 4DBVO 2YHUA 1VSUA 2OOSA 5I9MA 3PI7A 1Q2XA 1C0IA 1WNTA 3TZCA 3EY4A 2FZWA 2BGLA 4GI2A 1M6HA 2V6FA 2NU8A 3DZHA 4Q3BA 2GRAA 4YAGA 3ETEA 2PK3A 3GPDG 5JAMA 3U4CA 4A10A 1VJ0A 5HBRA 2OUIA 4PGFA 2IZ1A 1Z74A 2PGDA 3IKTA 2GO1A 5T8KC 2OP1A 2GDZA 5JBIA 3GDGA 4ALIA 1KIFA 4L9RA 4XGNA 2D8AA 4DIBA 2OFPA 5A05A 1ML3A 5C7LO 1HE2A 1N1EA 1ZJYA 4B3JA 3QA9A 4MINA 5K0ZA 4CMJA 2NQ8A 3WBBA 3OH8A 4B8WA 3LT1A 1GUYA 4OO3A 5FEUA 1X7GA 4XCVA 2Q2WA 1RKXA 1M66A 3PJDA 2VUUA 3OIFA 4XQGA 4NR0A 3HUDA 1KEVA 5KIAA 4DVJA 4B7CA 3GT0A 3OQ1A 2P5YA 4CQLA 4XR4A 2O50A 4D3DA 4RPLA 3OJFA 2I3GA 3DAGA 3JD2A 5CPFA 1PJ4A 3UFXA 4J4TA 5CAEA 1B0AA 2Q99A 3H5NA 1UP7A 2WE8A 3M2TA 1X1EA 5EMHA 1BVRA 1I5RA 4MVJG 4D0SA 4RPKA 3V5NA 4CODB 1NNUA 3PWZA 3PHHA 1DOHA 5GZ1A 2CDAA 4NDNE 2O23A 2HKIA 3T4EA 5JMWA 2WMDA 3PDJA 1A72A 2G76A 4EITA 2QIOA 3K2EA 4EEXA 1CJCA 3W4JA 2X0JA 1A27A 2G17A 5JY6A 3QWHA 4I1IA 1WWKA 4OOFA 4BNTA 2YV1A 1BXGA 1VPDA 2J3KA 4R1NA 2VYND 5KKAA 4UEOA 4AICA 3P19A 2BGMA 4TRMA 3KSDO 3PGJA 3GUCA 4EJ0A 2NNLD 1A71A 3GZNB 2A4KA 2HK7A 2NTVA 4LGVA 4AJ1A 1R37A 1YKFA 1ZXBA 3M1LA 2AG5A 1LI4A 2VHVA 4R54A 2ZB8A 1NHWA 1LLUA 1YGYA 1E7SA 3I9NA 1LXCA 3ZU5A 3H5RA 5COBA 3TQHA 1WDMA 3PXXA 5ER6A 2DFVA 3H2SA 1E0DA 4B7UA 2ZYDA 1R4NA 1BMDA 4NBWA 3GDOA 1QMGA 4I08A 4I9UA 4D42A 1HDOA 2GD1O 3LF2A 2NU7A 5A1TA 3AY6A 4I9HA 3RJ5A 1I32A 1NPTO 4S1VA 4HWKA 4W7IA 3WLEA 4OSPA 5AXBA 5JDCA 4Z6KA 4Q3EA 5IZ4A 4IBOA 3OICA 4PRLA 1YOVA 4XKJA 4CLHA 1J4AA 4LK3A 5CDTA 1DAOA 1AXGA 1MP0A 2OBYA 1DIAA 1R16A 2CDBA 1Z45A 2QX7A 2RBEA 3FNHA 3WGQA 1DPGA 3V2GA 1PTJA 3FBTA 3Q2IA 5KVQA 1H2BA 3RBXA 2EKLA 1MB4A 3L4BC 4R5MA 5DBGA 1PS0A 2WYUA 1WLYA 2WD8A 3RU7A 4XQCA 2DUUA 5KJEA 2Q1UA 1V3UA 2O3SA 1EMDA 2PD3A 2BRUA 5DBFA 4K6FA 1OOEA 4BGEA 4HBGA 1Y8QA 3PYLA 3EZYA 4LCJA 1XDWA 4C4OA 4CM4A 1F06A 2PGLA 3B20A 3STHA 5A04A 2VZ8A 2LDBA 1NQTA 3PP8A 3AOEC 1TT5B 2H6EA 3I9LA 3IAHA 3OSUA 3K8ZA 2Y1GA 4WCFA 1CDOA 4XZ3A 5AOVA 3GOHA 3DBVO 1J6UA 4QUKA 2NTJA 4GVLA 2VHWA 2EJWA 4LSWA 1DHTA 3K2BA 2AA3A 1U3TA 1IUKA 1Q0LA 5KJCA 3D64A 4PLGA 4NFHA 3BMCB 4TROA 3HDQA 4FSHA 4BNIA 5IJZA 2ZB3A 4WLFA 3AI3A 1YS4A 4QQRA 1AGNA 3LF1A 3O03A 1J0XO 4PLHA 1YXMA 1X0VA 3RC9A 1BTOA 2HQ1A 3VZSA 5JDIA 4NHEA 1DC3A 4PLFA 3L9WA 3NJ4A 1P9LA 4GX2A 3WGHA 4YPOA 2GN8A 1ONNA 3DHNA 2HAEA 2ZCUA 2JKVA 4H7PA 3DOOA 2VRBA 1PZFA 1YVEI 1JKJA 3Q9UA 4CQMA 3AUSA 3NJ8A 1O5IA 5KTKA 2CVZA 2R2GA 2VQ3A 4FOSA 3CH6A 1NQOA 2RIRA 2VT2A 3PHIA 2ZB4A 3AW9A 4IZHA 2WJPA 1UAGA 1GL3A 4JN6B 1LSSA 2EGHA 4MVJF 4WEOA 1RYEA 3AJRA 2VNSA 3JQGA 2VOJA 4YT5A 3DMYA 3R1IA 1LRKA 1NVTA 1O8CA 4WECA 5HWSA 3V1TC 1Z6ZA 2RH4A 4D46A 1YBMA 3I6IA 3PVZA 1D4FA 1UP4A 5EERA 3RWBA 3WTCA 3RIHA 3GAFA 4RJTA 4B7XA 5T6BA 1G1AA 2HO5A 2OP0A 4INAA 1HYHA 5JS6A 1GAEO 1P1JA 4RF2A 3P2YA 5CEEA 5JPIA 2GZ2A 1NR1A 2HJRA 1D1SA 3F9IA 4U5QA 5L3ZA 3KHUA 4U0KA 1SCUA 3HQ4O 1XKQA 1QV6A 4E2YA 1P1IA 1YH3A 3QWFA 4MKZA 1LU9A 1JN0A 4C7KA 3I4FA 4WPGA 2Z1MA 4XR9A 1PQWA 5T64A 2FSSA 2O4CA 3AM3A 3GRKA 2C59A 1HSOA 3BXXA 4L74A 1YB4A 3DB2A 4CL8A 2NVUA 4UREA 3GVPA 4NBRA 1Q7BA 3ICPA 5BSGA 2VYNA 3T4XA 1DB3A 5ADHA 1LX6A 1PSDA 4CM5A 3UAGA 4MP6A 1XR3A 1O95A 5IDWA 3AU8A 5IXSA 4FOOA 1T1SA 1DIRA 3PJFA 1LRJA 5KJ1A 1N1GA 3UCFA 2J5QA 3FHLA 5A9SB 1HSZA 3BTOA 3U0BA 4J9UE 1BHSA 1F14A 1E7MA 1Q7GA 1LDYA 4YJGA 4YRAA 4O6VA 1TA4A 4CUJA 4DXHA 3ZWVA 4E5MA 4BHTA 5CEFA 4W99A 5TNXA 1NVGA 4BNWA 4BUCA 1HZJA 2Q1SA 4YBZA 2VWHA 1SAYA 5HM8A 3FWNA 4DLAA 2PLAA 5DP1A 3K31A 1H6DA 5KVVA 1P31A 4CMKA 3RBZA 1LLDA 4RQUA 3LQFA 4A73A 2J3HA 4W6ZA 3ASVA 1B8PA 4FQ8A 3ZNOA 5ITWA 3JQ8A 2QYSA 2DBVO 3AOGA 3NGLA 5DCUA 1O0SA 2PY6A 1S7CA 2JAPA 4XGIA 2YDYA 3DBHA 4HNHA 4CMEA 1QG6A 4NNJA 1T1RA 4DMLA 3NUGA 2B83A 3L6DA 3HSKA 4R1TA 3ROPA 1L1FA 2GZ3A 3KYCA 2A9FA 3ZH2A 3L6EA 4M49A 4JP2A 5BNIA 3QIVA 1GV1A 1YL7A 1DO8A 4AJNA 4IS2A 1WDLA 3ROKA 5DP2A 3RUIA 1UJMA 3ENKA 2C2XA 4UUMA 4ZRMA 3NDJA 3TOZA 3M1AA 2I67A 4JLWA 4AL4A 3NAQA 3ITDA 3H9JA 4KMSA 4P8RA 4OJNA 4B4UA 3JQ7A 3PHLA 2HSDA 1QV7A 3I1JA 2Q4EA 2YDXA 2NVWA 3F6YA 1EBFA 4XYLA 5C3MA 2FPGA 2UAGA 4KUHA 2HUNA 2FWMX 3GF4A 1R4MA 4AJ4A 3QE3A 5A3VA 5LDGA 5COAA 3U4DA 4R3NA 1KVUA 5JC8A 4OGWA 3BMOB 4M1QA 3WJ7A 1NX6A 3DZIA 1EK5A 1GADO 3DZGA 4IY1A 4AJLA 4BO0A 3OJEA 5B4UA 2QQ5A 2Y0CA 4XRRA 3T7EA 3V1YA 2F00A 4OXNA 1Y1PA 2EG9A 5GZ3A 4WLVA 4XRGA 3JD1A 3LDHA 3NX4A 3JQFC 4CLRB 4YRBA 1PWXA 5I9NA 5TX7A 1PGOA 2WE7A 5EL0A 4UVHA 5JCJD 3UF0A 5DN9A 1E3IA 2W2LD 3JYPA 4MIEA 1T4DA 3RUCA 4J1TA 3KYDB 3I23A 3JCZA 1UH5A 3I9MA 2CVOA 4KDFA 3VPHA 4TWRA 3ZV6A 3Q11A 4PG7A 5TJHA 3SLGA 2CD9A 3RQSA 2EHDA 3NDIA 2JHFA 3U9LA 3PTZA 3BA1A 4CUKA 2B37A 2C29D 3WGGA 3DDNA 4CMGA 1EUZA 3N74A 1E1LA 3OEWA 4I5EA 3EC7A 3K9QO 3MTGA 1F8FA 1LDBA 2ZKLA 1L7DA 1DAPA 1RM0A 1AE1A 2W8ZA 3ZNPA 4CV2A 5C7OO 5KVSA 1U7HA 4OKNA 5C5IA 4WJZA 1YB1A 2ILTA 1YBVA 3GEDA 3IP3A 3F1LA 4NI5A 5DOVA 1LC3A 3UN1A 1DFGA 1ZH8A 5THQA 4CM6A 1DFIA 1GUZA 4XB2A 3HADA 3OECA 4KOAA 3HDYA 4YAEA 3AUTA 2E82A 4CR8A 1UXGA 1PJTA 3N58A 4K1LA 2V6BA 3QVXA 1ZK2A 3A28A 3RCBA 2IXAA 4KP7A 4HFNA 3W8EA 4Q9NA 5CFZA 4TVOA 1BRMA 1KEPA 1MUUA 4NPCA 1UR5A 4J4BA 4PG8A 1PIWA 3TZKA 1C0PA 4K28A 4BMSA 1OBFO 1JTVA 5F21A 3RFXA 3F5QA 1P33A 3IIEA 3GY0A 4JGBA 2Q3EA 4CMBA 1B7GO 5TQVA 3GNTA 2ZK7A 4J0FA 5DBIA 2V6MA 4BNKA 2WM3A 2JD1A 3FD8A 3KLMX 4MVJI 4ZU3A 1ADCA 4DQXA 1XHLA 3E6AA 3FR7A 3GH3A 1NVMB 5HS4A 3VKUA 3AU9A 4PLPA 1HRDA 5JNLA 1EVZA 4TQGA 3WGTA 3WGZA 1YQDA 1VKNA 1XU7A 4Q3DA 4J43A 4M86A 3JYLA 1G0NA 1NFFA 2Z1NA 2NADA 3O38A 3PK0A 2O7SA 5JMPA 1CRWG 1J49A 2CUKA 4RO0A 2B35A 3Q0EA 3GMSA 4TVBA 4WK6A 3U49A 3HN2A 3NV9A 2C20A 1WPQA 3Q9NA 3DZBA 4ALMA 1LDGA 3JQ9A 4MIOA 1KC1A 1OFGA 2CMDA 4E33A 4QX6A 4IJVA 1I36A 4YT4A 4XD2A 4EUFA 2DQ4A 2J6IA 5CDUA 2AG8A 3WQQA 1ULSA 5IXYA 2DLDA 1E1KA 4HV4A 1EZ4A 2SCUA 3EK2A 2IZ0A 1SZJG 2JAHA 1S6YA 3ZWMA 3IOYA 4WLNA 3WGYA 4RLHA 1HYGA 2VN8A 1LRLA 2WSBA 4URFA 1IULA 5AXDA 5FI5A 1E3EA 4BNVA 2AQ8A 3O9ZA 3TZQA 2UUOA 1U8XX 3UHAA 4EJ6A 4U6SA 3GVCA 1GEEA 5ENVA 1DJQA 3NT2A 2AXQA 2J5KA 3WJAA 4ONEA 3G1TA 3G1UA 1W0CA 2FP4A 2TMGA 4RVUA 2C7GA 4FC7A 1XU9A 4ZQHA 1EDOA 1PGNA 4ND3A 1QRRA 3OEYA 5ENDA 3EYWA 3WYBA 1DXYA 1IHXA 3ETDA 3RUDA 3HB5X 1ENZA 4G81A 4DTIA 1V8BA 2H9IA 4NJOA 3KETA 4OL9A 3ZHBA 3TJRA 3ZW8A 4ALNA 3BMQA 3P2OA 4A0SA 3TNLA 3FNEA 4DMMA 4ZJUA 3RASA 1LEHA 2W90A 4R51A 3I6QA 5CDSA 3DTTA 4GMGA 1QYVA 3A4VA 1SEVA 4UVIA 3GPIA 2Y1CA 4NG5A 5JDIC 4MPDA 3OIDA 1MFPA 2Y68A 4B4WA 5L7WA 2PH3A 5EQFA 1H6CA 1CETA 2W98A 2VWPA 2GASA 2POQX 1OI7A 3KM0A 3SVTA 1V35A 2YUTA 5J23A 3PLNA 5JCJA 3ZU3A 5K6AC 1I2ZA 4IDGA 3ZWYA 2EP7A 3FR8A 1M76A 4GBJA 4LW8A 2W2LA 2Y67A 3E18A 4DREA 1EQ2A 1Y6JA 5I8WA 1GZ6A 1UUFA 4QO7A 2IODA 4GLOA 3G49A 4MIYA 3GN1A 5L4LA 3DBRA 5IAAA 5C37A 5U1PA 1VI2A 4GKBA 2DPGA 1JKFA 1D7OA 2EJVA 3CINA 1IL0A 1PX0A 5KKCA 3OETA 4EW6A 3RC2A 5A4DA 2PD6A 4DQUA 1T2AA 2IYPA 3E5MA 3KEOA 4RPJA 3ONDA 2YYYA 3JQAA 4JK3A 4QO8A 2PFGA 1KVSA 1T2FA 1VM6A 1Z7BA 1Q1NA 2ZTLA 1H6BA 4BO8A 2GN9A 1M75A 9LDTA 3IQDB 3ZI0A 1R12A 3JQBA 4O5OA 4J2HA 2HCTA 1YDWA 2XPCA 4MJLA 1GR0A 4BO7A 1GV0A 3ETGA 3FWZA 1A9ZA 1K6JA 2Q50A 3RUHA 2J3IA 4BNXA 2CSUA 5I7EA 4W82A 3R3JA 5F1OA 1G0OA 2O48X 3TZHA 4DLBA 4WOKA 3MJTA 3EW7A 5LC1A 1Q7CA 1O6ZA 3DC2A 1SEPA 1B2LA 3PPIA 4K9DA 3GDFA 2BI8A 4TRRA 4HKTA 3CTMA 3FNGA 3GEGA 3FTNA 3IC5A 1A7AA 2X7HA 3BTSA 3E8XA 5A9RA 4Z0PA 4D0RA 3WOHA 3INTA 3OJ0A 3BZUA 4M87A 4Q3NA 3UCEA 1P1RA 1ZNQO 1GZ4A 2O2SA 3KVOA 4AJOA 1LQTA 1NAHA 4FW8A 3W4KA 4AFNA 2B4QA 2AEJA 2X4GA 3DBLA 3E9QA 4MVJP 4NBUA 1F12A 2X5JO 4II2A 4OM8A 3MJEA 4Z9FA 1LTHR 5G2OA 3D5TA 3HE3A 3KO8A 2O7QA 4OXYA 1SC6A 1PS8A 2BF7A 1TXGA 3HB4X 4MVJH 8LDHA 4Y8VA 4PLCA 2YHIB 4NU6A 5DDIP 3GFBA 4ZQGA 4DL9A 3UXYA 5A5EA 1JQBA 3GQVA 4IDDA 4CR6A 1V3TA 1BXGB 2D0IA 1A4UA 1GFSA 2VZ9A 2A94A 2WYWA 1JA9A 1HDXA 1E1MA 4R41A 1N7GA 1LNQA 1ZCJA 4AJJA 1K6XA 1NFQA 2B5WA 5JXWA 1FDSA 4FFLA 4JIGA 4MP3A 3RD5A 3PIIA 3BHMA 4WNCA 3GK3A 4YR9A 4PLVA 3AM5A 1JKIA 1PQPA 3ONEA 4HUJA 2RAFA 2X9VA 1NM5A 4IIUA 1R4NB 2DM6A 1MXHA 1EVYA 2VHXA 3NT5A 1WXDA 3PYMA 4O1MA 3TF5A 3PFWO 4WE3A 3TZ6A 2P2SA 1PJSA 2J8ZA 3OQBA 4PVCA 1MV8A 2Y0EA 1EQUA 1PQUA 5BNTA 5FFFA 2PH5A 3MCVA 3RJ9A 3H3FA 1BXKA 3PLRA 2Y93A 5AQ1A 3CXRA 2QW8A 5TSDA 4YDRA 3LC1O 4XDZA 3RU9A 3EAGA 4HP8A 3D3WB 1PJQA 4Q3AA 2GPTA 2EIHA 4A03A 4E5PA 1L7EA 2X6TA 5JAIA 3QWBA 4TRNA 1VE9A 3WWYA 3C7AA 4LN1A 2I99A 1Y8QB 3E1KA 4I5DA 3ZHZA 2CF6A 4BIIA 4CM4B 3NKLA 4XDYA 1P1FA 3ZN2A 4NQZA 5JAQA 1GCUA 2PZJA 4OSOA 1QYCA 4RVSA 3S2IA 4OQZA 2IYOA 1ZZEA 4FD3A 5TC4A 5G4KB 1A9YA 1BVUA 5G0SA 2UUPA 1E7YA 3AWDA 4H3VA 5IFLA 1SOVA 1ZEMA 4R1UA 1E6UA 3Q2KA 1MC5A 3OBBA 1NP3A 3QVSA 1YBAA 1CF2O 5TLSA 4OKIA 3CMCO 2QZ9A 3CPSA 3O8QB 1E3LA 4GKVA 1KOLA 1ORRA 4NMHA 5JLAA 3LVFO 3WYCA 1DC4A 4DYDA 1O9BA 3OJLA 5JSFA 3DFZA 5CDYA 1K6IA 1LSOA 3OHSX 4MOWA 3GC6A 4F3YA 4Y9DA 3BYZA 3C7DB 1GPJA 3L77A 4NFSA 5AVOA 4YCAA 1K0UA 3CZRA 3GZNA 4UUNA 3H2ZA 5JYDA 3QVOA 4CQMB 2HDHA 2YQ5A 2EF1A 4GX5A 4NBTA 4IJKA 4TKMA 5TRTA 5G0VA 2YW9A 3V2HA 3HG7A 1ADBA 4ID9A 3KZVA 1VLLA 3ZCXA 4D43A 3WTBA 1EK6A 3L07A 3PQFA 1FDUA 3MJSA 3ITKA 3PQEA 1DIHA 2R00A 5CHEA 1EFKA 4W4TA 3VKVA 1ZK3A 3JQGB 3W8DA 1DC5A 5F5LA 2FPPA 2WD7A 4UVDA 2DFDA 2ZJ0A 4DWVA 3PHJA 3RC7A 4N5LA 3RUFA 1PL8A 3SXPA 1E7RA 2Y05A 3C8MA 1NQ5A 1GUFA 2GGSA 3NEPX 4BNYA 1QYDA 1Y5MA 4G5HA 4FFRA 4XIJA 3VZPA 4MO2A 2Q2QA 4JQCA 1ZW1A 5L53A 4N18A 1JW9B 5A5FA 3D4OA 2NM0A 3U3XA 2GLXA 1H5QA 3ONFA 4NJMB 4FGWA 2QHXA 2Q49A 2RH8A 3GHYA 2X5OA 1KEWA 2FY8A 1R6DA 3JYNA 3ZNNA 3QW2A 3FNFA 3VH1A 1U2DA 1DSSG 4GX0A 5DCWA 2FSVA 1TT5A 4Z3DA 3DEYX 3FF4A 3WGOA 5FF9A 3VZQA 2JCVA 1N9GA 5U9CA 1DRWA 3CKYA 4OAQA 2EERA 4ZRNA 4EI2A 4XWYA 3ADPA 4YAJA 5CDGA 1ULUA 3DL2A 3VH2A 1YRLA 4ZGWA 1IZ9A 1UZMA 3BMCA 1LSJA 1DBVO 3WXBA 2DBQA 5G0UA 2YV3A 1U7TA 4MVJD 4CMIA 4BMVA 4RQTA 4GH5A 3MTJA 4R9SA 4UEKA 1C14A 2R6JA 1UDAA 3VH4A 3C1AA 1X1TA 4BNZA 5FYDA 1OMOA 4CMAA 1P74A 4I8XA 4CJXA 2EKQA 3ZW9A 5FWNA 3CIFA 3EVTA 2FZEA 4ZN6A 1MFZA 1FJHA 1FXSA 2I6TA 3S55A 4W7HA 5EPOA 1SB9A 1T25A 3UVEA 1WMBA 2Z95A 2C82A 4FFOA 4RZIA 4WEQA 3JQ6A 4WLEA 1JVSA 3DZJA 4D79A 2D5CA 2OO5A 3B70A 3DFUA 1CERA 1TVEA 4JP3A 4E5YA 4M8SA 1CYDA 1I30A 2V6GA 3DBHB 5L45A 5GMOA 4LSMA 2PWZA 3K30A 1YL6A 4FS3A 4FJ1A 4JJGA 3DAFA 3WGIA 2H63A 4MVJM 3PZRA 3GG9A 4IJUA 4ZQEA 2OBNA 4E5KA 3VC7A 1XLTA 4GGOA 5IZCC 2P9EA 5A9TA 4CLXA 4MKRA 4M54A 3SC6A 2VWGA 1BDBA 4O0LA 5CP8A 5JCXA 4Z3KA 3WS7A 1JWBB 1ZSYA 4N5NA 4DPMA 3LU1A 4KTVE 2P5UA 3ZWXA 3H6KA 4DRYA 4AG3A 2B4TO 4E12A 4ILKA 3JQCA 4GAEA 4IS3A 2VUSA 4NH4A 4WCDA 3QRWA 3OM9A 3JQ7B 4D45A 2NU6A 4YJHA 4Q39A 4RGBA 3BHIA 4E31A 4EUHA 3F4LA 4CMHA 2HK9A 1U28A 3TOXA 4XB1A 2DBRA 2ZCVA 4IDEA 5F1KA 1EVJA 4J7XA 4IDFA 3G17A 4CUZA 3WSWA 4JBGA 4GLLA 2RHCA 3ZV4A 1R4MB 3BMNA 4M55A 3RVDA 1QSGA 1H9BA 1P1KA 3WDSA 2NV6A 5JO9A 1K2WA 4UAGA 4LRTB 3PWKA 2QRLA 3TL3A 2JD0A 4IQ8A 9LDBA 3V1UA 4DIFA 5HRUA 1ZIDA 3Q6IA 2X58A 3S2GA 4BV8A 3PDUA 1Y9AA 1P45A 4B3IA 1A5ZA 3IL2A 2QZZA 5KCZA 1H9AA 5ICMA 4R16A 4PVDA 2PR2A 4HNGA 1B8UA 2JHGA 1T24A 3I9OA 2FR1A 2BELA 4BO5A 1UP6A 1Z73A 1ZSVA 1IY8A 1HETA 3PFFA 4ND5A 4YRDA 4YAIA 3JQBC 3UCXA 1HTBA 1KETA 5F3RA 2X8LA 3W1VA 4H16A 1LDMA 5KJFA 4YB8A 3PJGA 1B14A 3ST7A 4KQWA 4BNLA 2ZJ1A 1UZLA 3GUYA 2Y1EA 2BH9A 1NXQA 2XXBA 2O2YA 3ORFA 3RSHA 3OJOA 3UOGA 1ZUD1 5DOZA 3WIDA 1PZGA 4ZHSA 1UXJA 1EFLA 4E5NA 3LSYA 2HMUA 2JFHA 4L75A 4DPKA 4ND4A 4MDHA 1I0ZA 2I3AA 4YXFA 3VTFA 4N7RA 5IN5A 1QYXA 2EEZA 4J9VA 4BKQA 4FFPA 2JFGA 4NIMA 4XQ9A 3DWFA 1EUDA 2E49A 4B4VA 2IEDA 4YJFB 5BNFA 1HZZA 4A2CA 1EE9A 1Q0HA 3VOSA 2IEBA 4YJDA 5L51A 3D7LA 5L4SA 2X23A 2BKAA 4YQYA 2A35A 4KDEA 4NU5A 1YQGA 4ZVVA 5EN4A 1ENPA 2X86A 1BW9B 1B8VA 3CZMA 2Q45A 3ZZNA 5G4LA 3QQPA 2F1KA 4B4OA 4F6CA 1SO8A 1Y8RB 1X13A 4F45A 3WYEA 2HJSA 4II3A 1ONPA 1CEQA 4YWJA 1B16A 3IUSA 4MVJA 5GZ6A 2CY0A 2RCYA 3AOEA 4AJEA 4U6QA 1T4BA 1TI7A 3LT4A 4E13A 3RUEA 1LQUA 4GGPA 1DDOA 3B1FA 4GL4A 3AUAA 2GF2A 3GGOA 1P0FA 2VTDA 2OHXA 2AQHA 4FBGA 2DKNA 3KSZO 5A06A 3IKVA 4QFDA 1N7HA 2XXJA 4PLYA 3GNSA 4RPHA 5I9LA 5A3JA 5CEJA 4CLRA 1U3VA 3DOCA 4EUEA 2VOEA 5T67A 3A1NA 5JFOA 4F46A 3L9XA 4J7UA 4L4XA 3VVCA 2Y0DA 5I7VA 3JD4A 1ENOA 1YL5A 3KSUA 1H2HA 3NDRA 4E2WA 1SB8A 4XYBA 1DLIA 1F0YA 1PJCA 1WDKA 3KYDA 4L8VA 1W4ZA 4PZDA 4RVHA 2PZLA 4CLOB 2BMAA 2PZMA 4ESOA 4DUPA 3KYBA 2CDCA 1JLLA 4GWKA 4R4JA 4BNHA 1GYPA 3DZFA 1CQIA 1LLQA 2B4RO 3A06A 4P4NA 1G6KA 1R0LA 1AXEA 4E2XA 3C24A 2FR0A 4CM8A 2OXIA 1F8GA 4XGKA 3I9KA 3JD3A 2D5AA 1U3UA 1U5CA 4A5OA 5BSFA 1V0JA 3H5AA 4FCCA 4WLUA 5IDYA 3TRIA 3WFJA 2D3TA 3G3EA 3OQ6A 5L9AA 2EWMA 4R68A 4QFCA 5JDCC 3OP4A 4TMFA 4DQVA 4PZEA 2BI7A 2W2KB 4BO1A 1C1DA 4IQGA 1R0SA 2X5KO 5KVCA 5TT1A 4CV0A 2E48A 4I5FA 5AXCA 1DIBA 1JVBA 4FJ2A 4PG4A 4LMRA 1PJBA 2AQIA 4E30A 1DRUA 3JSAA 4FB5A 3FCOA 4J6FA 1GDHA 4BQPA 2HRBA 4N5MA 3ZHYA 2CF5A 4BGUA 1T2EA 1NFRA 2DAPA 2E6UX 4LCEA 3WMWA 5BSHA 2AE2A 4WCFC 4JROA 2YQ4A 5T57A 4D7AA 3HHPA 1UXHA 2G0TA 3LYLA 4GPD1 3EMKA 3KXDA 2EKPA 3VH3A 1CIVA 1ZK0A 1GPDG 5B12A 1E3WB 2VCYA 4WKGA 3DMTA 2EW8A 3OFSA 5H81A 4L0QA 2H1SA 4LISA 4NBVA 2G82A 4KUEA 4PG6A 3EZLA 1PJLA 4C7JA 1E3SA 3LC7O 4CV1A 3MOGA 2NACA 3VTZA 4MVJE 5KNLA 5K9ZA 1I01A 2PNFA 4BKRA 4DA9A 2UYYA 3HNPA 3WNQA 1D3AA 1GYQA 3JYOA 5JE8A 5ITVA 5EJ2A 5B4TA 3NTRA 3JQAB 4L76A 1TB4A 2ZTUA 1U1IA 4J3FA 2ZTVA 3DZKA 1T26A 1U2GA 4UEJA 1BDMA 1NAIA 1M6WA 2NVBA 4XEHA 4GWGA 5TJ9A 4RPGA 2YV2A 1M2WA 3NTQA 4LVCA 1KVRA 1U8FO 3LLSA 2ZTMA 2O3TA 1YQXA 4F6LA 2NWQA 4OHUA 2IXBA 2BHLA 1VL0A 4DIOA 3FTPA 4J1SA 3E82A 1WP4A 1C0KA 2VRCD 4ND1A 3SEFA 2C54A 4BL5A 1HLPA 3PRJA 4YEDA 1HLDA 1PR9A 1YONA 2DBZA 2CZCA 2XAAA 4M89A 4IDCA 4WASA 5KWEA 1F17A 1QYWA 1SPXA 2IRWA 1W73A 1I2BA 1HE5A 3MJ4A 2HMWA 3E9MA 4IGFA 5F5NA 4D41A 3ZWWA 4IQ0A 3K92A 1BSVA 1NBOA 3JD0A 5H82A 1DEHA 1MLDA 3KRTA 3ULKA 2OMEA 3NGXA 2YFHA 3X2FA 2O3UA 2ZYGA 3VPXA 4ZQBA 3I3OA 3D0OA 3WG9A 2ZQZA 5H83A 1XQ1A 1U3WA 3GR6A 3WSVA 5I7FA 1HDGO 3VVBA 1B26A 2CFCA 2EXXA 1KEUA 3LLVA 2DTDA 4J1QA 3KTDA 4UULA 5ICSA 3FSRA 5JO0A 1ADGA 3I52A 3ZU2A 4B3HA 1C1XA 1P44A 2C07A 1O94A 3EHEA 4GSLA 4CMCA 1XGKA 2ET6A 1NASA 1UDCA 2P9CA 3LZ6A 3AY3A 1KC3A 2OL4A 4GVXA 3WFIA 3AI1A 1PJ2A 3WQSB 3KUXA 4KUGA 3E5RA 5EINA 3PWSA 3ZWCA 2I9PA 5DULA 4CQLB 4PLTA 4JX8A 4Y6RA 1WMAA 1GD1O 3ROQA 3UICA 1PS9A 4YYZA 4K6CA 1V9LA 4FPXA 3WB9A 4PIVA 4RF4A 2E37A 3U09A 3RFTA 2QRKA 4O63O 2ZATA 4G65A 4U0JA 4E4YA 1TEHA 3G0OA 4IGEA 4MKXA 1GQYA 1FDTA 3NYWA 4J4HA 1ISMA 3RKRA 5ILGA 3HZZA 4PZCA 3B6ZA 1UXKA 3D4PA 1AHIA 4R69A 3WWZA 5CG1A 5IG2A 3H7AA 1JAYA 5EIOA 3JQFA 4CM1A 2IZZA 1PZHA 3BTVA 5DF1A 1WAMA 3INRA 4H15A 4OMUA 5GY7A 4DYVA 4J0EA 3ASUA 1VC2A 3RI3A 1YDEA 3WNVA 1QXSA 1YB5A 2JD2A 4CQMD 1KVQA 1WVGA 2WWRA 4IXTA 1W6UA 3WBFA 1NHGA 5HS6A 1HDRA 1YO6A 1IPFA 2P4HX 3GEMA 3GMDA 4DPLA 4BO4A 3RC1A 4R5HA 1I33A 4AJKA 2PA3A 4WOJA 2HK8A 1PZEA 4E3ZA 1CQJA 5AXAA 4CMEC 1HWYA 2NU9A 1HYEA 3DHEA 4OOEA 3FN4A 3D5QA 2EV9A 2AEMA 1QLHA 4RL6A 2VZ0A 4HFJA 1QLJA 1C0LA 1TT7A 3PQDA 2UV8A 2GUGA 1ZFNA 1SMKA 4D3SA 3H65A 1WZIA 3SLKA 2I76A 3C1OA 1H6AA 1DJNA 2Q46A 3DHYA 3PZBA 1NPYA 2DPHA 1YOVB 1E7QA 4JCOA 1KBZA 1E6WA 3BHJA 5ILOA 1EE2A 4PLWA 3H4VA 5L7TA 3E9NA 3LC2O 3MWEB 3TWOA 5MGBA 4A7PA 3C1TA 1P3DA 1NR7A 5LCXA 2YHIA 2PD4A 2OGUA 5COQA 4BGVA 4WUVA 3PGXA 5DCYA 1X0XA 5FI3A 1KS9A 1NQAO 3Q1LA 3MJCA 1ISGA 4AJ2A 3C3XA 4BKOA 4IJWA 2I5PO 2ZYAA 1Y7TA 4G2NA 4AJHA 4QSMA 5B4VA 2DC1A 2Z5LA 2E4AA 1PL6A 5HA5A 5TT0A 4WCFB 4RZHA 2C0CA 1ZO8A 4XA8A 2VTEA 4QT0A 3SBOA 4E6PA 5L95A 1U4OA 2O3JA 1Z75A 3K96A 2J3JA 4L73A 1I24A 4BO2A 1MX3A 3NT4A 1JAXA 2X22A 3VPFA 1E7WA 5MDHA 3N7UA 4Z0HO 1H0KA 1FK8A 1KYQA 1ZBQA 2AEFA 4YT8A 3ZWNA 2DVMA 4TZKA 5CPBA 5JAZA 3ANNA 3E48A 2VRCA 2HMVA 5TIIA 1ZMTA 5BQFA 1N92A 3CE6A 4S3MA 1FMCA 2WD7B 4RVGA 1P1HA 3VDRA 4BVAA 4BKUA 4KZPA 4J1NA 4PLZA 5TS3A 2G5CA 3H9EO 2Q4BA 5JC1A 3FPCA 2FR8A 3MWDB 3RUAA 4EBFA 4HFRA 3WICA 4Y6SA 3WMXA 1ID1A 2VYVD 3DR3A 4FC6A 1ONOA 3U4HA 3OMLA 3QV1A 4XX0A 3LK7A 3D3WA 1Q0QA 2FOIA 3QWAA 4R01A 3UKOA 5L4NA 4D3FA 4J91A 2P4QA 3IDSA 2BGKA 1P77A 5A03A 4XJSA 4ALJA 4XYMA 5IF3A 1PWZA 3P5SA 5EESA 4ZQFA 3F4BA 1KERA 3WIEA 1B15A 2O3RA 3UUWA 4IXWA 1LSUA 3FPLA 1N8KA 3G79A 5L7YA 3KLPX 2WDZA 1YJQA 3HDJA 4J16A 1HE4A 3WQRA 3ZWPA 1DC6A 1N9GB 3QWIA 4TSKA 5G4KA 1IYZA 2PKQO 4NK5A 5L40A 4CLEA 2D2IA 1DFHA 3C85A 3DOJA 4ALLA 2D1YA 1MG5A 2A92A 3R3SA 1NTOA 1FF9A 2GYYA 3R0IA 4E2ZA 2HU2A 1XYGA 1XSEA 3O8QA 3VZRA 4OYRA 1B3RA 2B0JA 1XG5A 1QORA 4ZA2A 4AJPA 4NK4A 1X14A 1YJ8A 3DXFA 3PHGA 4I9NA 4BNJA 4N54A 3HWRA 4CMIB 4BOYA 2QRJA 1SOWA 1XIVA 3OA2A 6LDHA 4KTTE 4Y67A 2AMFA 4HY3A 2VNAA 1DRVA 3GAZA 3IJRA 4BMNA 2PZKA 3B1JA 4JXKA 3CSDA 4QXMA 2NVUB 4UVEA 1HXHA 3QVTA 1N2SA 5K6AA 3ZHXA 3ZDFA 1ZKMA 3FBGA 8ADHA 1GYRA 3S1LA 1I3NA 2NSDA 3RBVA 1VL6A 3NTOA 1KY5A 1PGQA 2JJYA 1EVIA 3ANMA 3F46A 5G0WA 1VKOA 2ZQYA 4BKPA 3DONA 1EDZA 1C3VA 1K3TA 3JQ9C 5DT9A 1AN9A 2IDZA 1HL3A 2HLPA 2Y99A 4A27A 2YJZA 3TPCA 4E0BA 4YJGB 4HX5A 4BV9A 2GSDA 1ADFA 1RWBA 3EGOA 5BR7A 1E5LA 3GNQA 3UGKA 1EUCA 3VAZA 1VL8A 1XCBA 3M6IA 3S2FA 5I7SA 2X9GA 3TDKA 3TFQA 2JL1A 2P9GA 4XJTA 3GHHA 3TL2A 3INGA 3RFVA 4IIVA 2WYVA 1ZSNA 1ISIA 4DC0A 4E32A 4JJFA 1OAAA 4YT2A 4RDIA 3JQ8B 4W9NA 3VDQA 3PJEA 4YJHB 2P91A 4R3WA 3VHRA 3ZGYA 2C5AA 3O4RA 4OIMA 1ZJZA 4Z9XA 1GQQA 1Y81A 3T7CA 4NJMA 4UVGA 4IM7A 2Y66A 2PKQP 1ISFA 1ENYA 3F1KA 4ZD6A 3BMNB 2CNBA 4NFYA 4EZBA 4RVDA 5EQDA 3KYCB 1VSVA 3DMTC 3I4CA 4KWIA 3AFNA 1RM4A 1I2CA 3B1KA 2QYTA 4LMPA 1IB6A 3KB6A 5T8KA 2X0RA 4X54A 3S2EA 4JBHA 5T5QA 5A02A 4QEDA 3JV7A 2DU8A 1K89A 2D4AA 3MZ0A 5BSEA 4ND2A 4CM9D 3AM4A 3A14A 4P4LA 2VUTA 2BLLA 1BWSA 4IMRA 2J5RA 2NUAA 4I5GA 4RVFA 4RV9A 3K5PA 1I3MA 1JU9A 2XOXA 4PCVA 5JW6A 5B37A 5G0TA 3CMMA 4ZICA 1DHRA 1RYDA 2BFOA 1E3JA 4YVFA 1PGPA 2YFQA 3VPGA 5C7IO 3RAJA 4XYGA 4Z0TA 2P68A 2DT5A 3K73O 2EW2A 4OQYA 2BFPA 4YACA 1IE3A 2IE0A 3WX0A 3E03A 2B69A 1I3KA 3OA0A 4XQEA 4BO3A 1T2DA 3KEQA 1U9JA 3GVIA 2VYVA 3Q3CA 4J7CA 4FIZA 4CM7A 1ZXLA 4GX1A 2PGJA 4AVYA 4FFMA 3GGGA 4JJIA 5F1PA 1BG6A 3H8VA 4BO9A 1MG0A 4BGIA 3QP9A 4HFMA 3U4IA 5A9SA 2GN6A 3EUWA 2Y1OA 3I83A 2OZPA 2C7VA 2WTBA 1MC4A 4CPDA 4KQXA 1PL7A 1GZ3A 4GQAA 3DO5A 3ABIA 1VJTA 4KWHA 1U5AA 2GR9A 3ZNQA 3D3EA 3GRPA 3OIGA 3ZV5A 4BNFA 1KY4A 3F47A 1RJWA 4IDAA 4BNGA 1I3LA 3L0DA 2EGGA 3DTYA 4XYEA 4BNNA 3ZWBA 1X7HA 1Y5RA 2YZ7A 3W8FA 1R66A 2FHSA 2QG4A 4XIYA 3PEFA 4QTZA 3RROA 5U4QA 4DBZA 4IMPA 4K26A 4P4GA 1TLTA 4B8ZA 1W8DA 5TGDA 2ZIZA 4FDAA 3DAPA 4TRJA 2C5EA 4YAKA 4BNMA 2Q1TA 3CEAA 3GVXA 1HEUA 1GTMA 3IP1A 3A9WA 2WEKA 4CV3A 4WGGA 2FRDA 3S8MA 1DIGA 4EGFA 1SNYA 1HDYA 1GU7A 2VHYA 1EBUA 1UZNA 3JQDA 4P38A 1ZK4A 1Z7EA 1OC2A 4GSKA 1PU2A 4MP8A 6ADHA 4CL3A 4RCVA 1D8AA 2RHRA 1LA2A 3PIDA 3I5MA 4EDFA 1M67A 2DTXA 3KV3O 1IPEA 1XQ6A 3L6OO 1WW8A 4PFJA 1T2CA 3L4BA 2C2YA 1I10A 3ZV3A 4CR7A 2PV7A 1AHHA 4QECA 4J90A 3V2UA 3C7CB 1E5QA 4B79A 3GZ4A 5BT9A 2BFAA 4BS9A 4JBIA 4Y98A 3AY7A 5IDXA 1H93A 2NTNA 3P7MA 2ZB7A 1V3VA 4IINA 1MA0A 4NZ9A 1BXZA 3QSGA 4PN3A 1J5PA 4BNUA 4YA6A 3U62A 3ENNA 3GN2A 1XA0A 1ZVMA 4PG5A 3AFMA 4HXYA 4EJMA 3BMOA 1QP8A 3JQEA 4CM8B 1ZMOA 3D4NA 4DLLA 1ZEJA 1H94A 2YY7A 3JQAD 1E77A 4IUYA 3GGPA 3UW3A 3PYXA 3GVHA 1E92A 2VWQA 3V8BA 4DC1A 1EEHA 4OXKA 3D1LA 3SJ7A 2B36A 2CVQA 3ZWOA 2X9NA 3TFOA 4YQZA 4YTEA 1QKIA 3BIOA 3GFGA 1MXFA 3EVNA 1AUPA 1IHYA 2Y1FA 1C1DB 4FFNA 3WLFA 3I9JA 4IZIA 3IJPA 1CWUA 2GNAA 2W4QA 1QR6A 4WNIA 3MJVA 5IN4A 2OORA 4TKLA 5DZSA 1YWGO 2G1UA 3ZWAA 2HMSA 5ES3A 3K6JA 2UDPA 3W6ZA 4YJFA 4A26A 3W6UA 3QVWA 4D44A 3NRCA 3OF2A 2DUWA 1U4SA 3W4IA 3ADOA 1UDBA 1IOLA 2PTGA 1PGJA 3HJAA 1BW9A 4FGSA 1Z82A 4RLSA 2FPIA 3AUUA 1LUAA 3WR5A 5ER9A 1Y8RA 4CM9A 1VJ1A 1RM5A 1R0KA 4LVUA 4RORA 4EYEA 3QHAA 3HFSA 3KBOA 1XWFA 2JCYA 4J2OA 4RDHA 4UUOA 4UUPA 2DTEA 2JCXA 4Y6PA 1VRWA 4Z9YA 1X15A 1HE3A 2X0IA 4WLOA 2VT3A 3BMQB 1LLCA 3H9QA 4U8GA 5DNAA 2AE1A 3MEQA 1A7KA 1BGVA 4O59O 3O26A 5I8ZA 4CLDA 1HF3A 4ITUA 5TF4A 1NWCA 5LDHA 2GN4A 3H9GA 3TSCA 2H5LA 3QLJA 1Y9EA 3ZU4A 4BB6A 1LDNA 2TMDA 2NLOA 4JNKA 1NWHA 5CG2A 1JWAB 2FN7A 1ISJA 1E6EA 4R1SA 3ROMA 1P0CA 2HRZA 4DGSA 3ON5A 5IDQA 5B1YA 3VPSA 4BB5A 4CLOA 1ZK1A 2JFFA 3GA0A 2BFMA 3KOUA 3TN7A 4FR5A 3LT0A 1SBYA 2PKRA 2EP5A 2Y1DA 3DBRB 3FI9A 1X7DA 3GG2A 3JTMA 2LDXA 1PJ3A 3LT2A 4R9RA 2R00C 3HN7A 2HMTA 3ICCA 1GEGA 1IZ0A 2I65A 2FMUA 2X0NA 3QY9A 1OZAA 1YE3A 4IDBA 4TZTA 4EEZA 7ADHA 2BD0A 4BQRA 1LJ8A 3IS3A 4L4SA 1E1NA 1KVTA 3DQPA 4E21A 5IZCA 1FDVA 2V7PA 1RPNA 1RM3A 2W2KA 3EDMA 1OC4A 1GCOA 3COSA 1B3BA 1LDEA 2GERA 4LRSB 1LBEA 1XELA 4RF3A 2Q1WA 1DLJA 1HDCA 3H3JA 1O89A 1K5HA 1R15A 3CUKA 4L4RA 3MOIA 3SJUA 1C1XB 2AQKA 3F5SA 2AW5A 2O3QA 2XF8A 2UVDA
chains in the Genus database with same CATH superfamily
1WQ1R 3GUHA 1JB9A 1XEAA 3TTTA 4DSUA 1U2DC 1BD3A 4JENA 3O82A 1V1RB 4HADA 5EFOA 4OH1A 1A4IA 3FSJX 3IR5A 3DHWC 1PEDA 3SX2A 3PCXA 3TR6A 4N76A 4GOND 3CWCA 4YO7A 1ZN7A 2O57A 5ERXA 1V47A 2NSHA 1XVIA 1NI5A 1XRRA 2JGNA 2BYTA 2H51A 2C5HA 3DBLB 4IEEA 2R86A 2G7MC 4MUEA 1NPDA 5ALMA 3SR4A 4RTRA 3HFGA 1E3WA 1XFAA 2WPDA 2D54A 3SC4A 1RMYA 3BC1A 3IUPA 3S2ZA 4C4SA 2QTVB 5JEEA 3V34A 2P9ZA 1VKZA 3RK1A 3E4DA 1E5DA 2LCFA 3KQMA 5DNYB 1QQ7A 2WIDA 4RZSA 1JH9A 4BAZA 2AHRA 4EGCB 1Q1AA 1CEXA 2QSZA 5DM60 2BDEA 5K0CA 3DCYA 4BFLA 4CTJA 3H2JA 1ZJWA 1EEXB 1KI6B 1UXIA 1YAHA 1HT0A 2ID4A 1UAYA 2XGGA 3OX2A 4GMFA 4EG5A 4BO6A 1TYBE 3AI2A 4AJIA 4O4JF 1W25A 4IJQA 4ZT7A 1ZAYA 4ALKA 5H59A 5IK2D 2B1QA 2GZ1A 5E1DA 1WZEA 3CEHA 2CV1A 2N75A 3L7MA 2IOQA 3H0EA 3HRIA 4XXHA 2AI3A 1ARZA 2GM3A 4PSUA 2GM4A 3W3AH 3VBEA 4DUGD 4NJEA 3R6DA 5LKRA 4JB3A 2CHQA 1ZOIA 3MGGA 5F7XA 5I9MA 5EFZA 3X1ZA 4O2RA 2ZJ5A 2VQSA 4QA9A 1VG9B 4TYNA 2BGLA 2NU8A 3DDSA 4FEGA 4D8WA 1HNWB 4Q3BA 2GRAA 4QRIA 4DUYB 4GKKB 3CRNA 5JSZA 2XXAB 4IRXA 3GPDG 2QRGA 1GUDA 2V7VA 4PZPA 3TUJC 1GKUB 1ST2A 1Q3TA 1SUCA 2FSIA 2RKBA 3GJ0A 4PGFA 4Y9UA 4GFDA 4ZO6A 4ZOCA 4EG7A 1NDHA 2BZGA 2IPXA 4KMOA 5T8KC 2OP1A 2ZI9A 4Q1AA 2IUSA 1XQWA 4MCJA 2J32A 4NC9A 3KD3A 4G56A 2HA6A 4ZAWA 3O4IA 1P8JA 4OQPA 4ENRA 1QJ4A 1L7XA 5DV9A 3R76A 5KNDA 2E0IA 1E4OA 3ORYA 3QZUA 4JJ6A 4XGNA 5EKDA 3FYCA 3U44A 4PGMA 4YHBA 3CVUA 2G25A 3QK7A 4MW6A 1HE2A 2H1WA 1BGXT 2AX3A 2EFJA 4B3JA 1NATA 1XK6A 2Q5OA 4K6GA 3SF8B 4BPRA 1G6HA 1N2CB 3OH8A 1LBIA 4OHVA 4RH0A 1QU2A 4KMRA 3R0JA 5CHYA 4WOPA 3TQTA 2CE7A 4IKOA 1UC5B 2NXEA 2WG1A 3EFBA 2H31A 4QUDA 4XCVA 4DC9A 2Q2WA 4ZVRA 1M66A 1C9JA 3L8HA 3OT1A 3EG9A 4ASUD 4UTXA 4XW2A 5JI2E 1MHTA 1XF1A 1D9XA 4C3ZA 4DIUA 5ICEA 3GT0A 2BFDB 4QVGA 2P5YA 4QC2A 1REQB 4XR4A 1R00A 2I3GA 2IDMA 3DAGA 1QGOA 2DR3A 2V7EA 3Q3HA 4G07A 4MGZR 1FL9A 1RD4A 1WUKS 5CAEA 3H5NA 1KJQA 5I7WA 3K9WA 1XX6A 4D0SA 5P8WA 1I5RA 2RGYA 2OCLA 1TVMA 4MVJG 5DTQA 1SCQA 3VUFA 4RPKA 2QUIA 4R8SA 3GLHE 5JVDF 1NNUA 2BKUA 2F90A 3F3KA 3PHHA 3PWZA 1R0XA 2O23A 3T4EA 4FGUA 4A4DA 2VNHA 2A0WA 1A72A 1QHNA 2XWBF 5FUXA 1I7SB 5AKHA 1Z5OA 5KYGA 1P6XA 2X0JA 2ZM6B 1FZQA 5JY6A 4KX5A 3JALB 1GG9A 4I1IA 3IVXA 3LUPA 4B6SA 5FL3A 1WMEA 1NX9A 4MEBA 4IEIA 4OF4A 3KU1A 1VPDA 3AUFA 3EXEB 1NVFA 1G98A 2VYND 3K9NA 3OEEA 4TWJA 2HV9A 3FYUC 4KK4A 5KKAA 3UATA 3P19A 4TRMA 3KSDO 5GONA 1G2PA 2HLDA 2IPOA 2R8OA 2NNLD 3K8QA 1K92A 2WWTA 3PI6A 2Q7DA 3RS0A 1A71A 3GZNB 2A4KA 2XRYA 4LGVA 4ZMRA 1V7PC 3K35A 1NT4A 1YKFA 4QQ8A 4BYGA 3HYTA 4KACA 3PE3A 2BFCB 2VHVA 4GE3A 1G5TA 3N8GA 3CCFA 2XITA 1HFJA 1RR6A 4O8CA 2VC2B 4WK2B 2QUKA 1FNCA 1QIMA 1IB0A 4BMDA 5BN3B 3ZU5A 2F4NA 3H5RA 2NZJA 4RMJA 5GM1A 1WDMA 4MAAA 5ER6A 5EUQB 4PZZA 2Q4RA 4P4TA 5DN6D 4Z1OA 1W19A 3R8CA 1E79A 2B4YA 4GBED 3FMPB 3OU6A 3G0HA 1O5OA 3L05A 1QMGA 2ZSKA 3AHFA 1AUQA 1DKPA 1HDOA 2WM8A 4ZOLF 2GD1O 3LF2A 3REFA 5GVSA 1MRSA 1RHUA 1KHTA 5SV2A 3SD7A 4OLFA 4ZO9A 1NPTO 1IEQA 4S1VA 4GSYA 4F4UA 4JVNA 2ZBFA 2HWWA 4IIYA 2RJOA 4KQHA 2RGNC 3CVOA 2QP9X 2HA3A 3OP1A 4OSPA 3I6BA 3RADC 4XVRA 4NECA 4IBOA 3L7IA 3OICA 4JJ4A 3AUKA 4XKJA 4KQMA 3EGXA 4WFQA 1QK5A 4LK3A 1V4NA 1NNLA 2HA5A 2OBYA 4WLEA 4WN9A 5JWOA 1DIAA 2CDBA 1EE1A 3NM6B 3F7TA 1A9XA 3V2GA 2C3YA 2P6UA 5KVQA 1GNLA 1H2BA 1Z34A 2BFEA 1K63A 2C5FA 4KRXA 4HYTA 3RBXA 1YC2A 2VPWA 3RS9A 4DTCA 1KFBB 3HXTA 1WLYA 2WD8A 3RU7A 5JJLA 4NBSA 4RYLA 1HT3A 2IH5A 1ODIA 1PWYE 2CLHB 3D7NA 2XNCA 4MIKA 2FLKA 2A59A 2FVXA 4HWOA 4PQGA 1IOWA 2AOTB 3DM9B 4BQOA 5F52A 4QOEA 1XDWA 4C4OA 2PX8A 2QRMA 3IA7A 1Z5PA 1H0SA 4PCUA 4B32A 2H3EA 3A3KA 3F8WA 5CIQA 4WH0A 4CL0A 1TMYA 1EI9A 5A04A 2AKEA 1QCYA 4KH1A 3KPUA 3SX4A 3N39C 1Z6AA 2Y1GA 5EHNA 2HIMA 1DXOA 3R7LA 3FHCB 4GVLA 3HP1A 2JGIA 5IVHA 5CYGA 1KSGA 1AZWA 3EIXA 1N3YA 1V16B 3K2BA 4FSXA 1U3TA 2W2XA 2JS7A 2UZ3A 3Q7RA 2AKYA 1VLVA 1Y5LA 3UJHA 1EP3B 2R8BA 1ZU5A 2ZBUA 2WJHA 3KJFA 4WMLA 4BJ3A 4PLGA 1RKQA 1P73A 3BMCB 4NFHA 1DAMA 2P3OA 1KSJA 5IJZA 2C2OA 2C4NA 4BTEA 4RAQA 2NUTB 1MJGM 1X7XB 1EDBA 3A04A 3CG0A 4QDXA 1AGNA 4HQRA 4CKBA 3ENWA 1J0XO 3O3NB 1WUJS 1SCIA 2NP6A 4CI0B 1AKYA 2AB0A 4IYJA 3RC9A 4X94A 4DEVA 2HF9A 4LRQA 4DIEA 4CIXA 5FOVA 1UC9A 1W96A 5JDIA 1H4SA 4NYJR 1OBVA 3U2QA 3L9WA 2UZ4A 1P9LA 2PL3A 3Q41A 1IK6A 3KTAB 5CXXA 2QTHA 3UBMA 3UHFA 4D9IA 2ZCUA 2F9MA 4CEIB 3EH2A 2O06A 1BC5A 1TECE 1FYEA 2VRBA 4DLYA 1RZUA 4EA8A 4O2AF 1UBLS 4DRZA 1FUIA 3LA6A 4RY2A 3AUSA 5I4IA 4ZAVA 4GECA 4U3JB 1MN6A 2CVZA 2R2GA 3T15A 4MHTA 5LQRA 1N1DA 4Q4AB 1L4YA 2IPAB 4LY6A 3WVNA 1AQYA 1XA3A 1BX0A 1GT6A 4IZHA 3KP1A 4BB0A 4RVNA 1GL3A 2BUAA 4HDMB 4TYWA 4A36A 1IQUA 1P81A 1LSSA 3DSRA 1GTG1 5FQOA 1JKXA 3QF7A 1IXZA 4FOPA 4L1KA 5FXMA 3SYKA 1E8NA 5AKZA 1VECA 3EIHA 4YT5A 2FZCA 4ASUA 1LX7A 1LRKA 3C3DA 1OU4A 1NVTA 3R1IA 4G0UA 4WECA 5F73A 2I1WA 4B9AA 3ZCTA 1H5UA 5CDHA 2QY9A 3Q7TA 1TK2A 1GTRA 3OZSA 2BTEA 2X14A 1UP4A 4LUCA 4TPKA 5EERA 3GCGA 1OB2A 3WTCA 3IVCA 2R1TA 2XSZD 1EX7A 5IRCD 1QPZA 4G0NA 4NZZA 1SUDA 4INAA 1SKQA 2G0AA 5IJXA 4ZFNA 2DB3A 1JEDA 5CEEA 2QSYA 3P2YA 4Y6OA 2P2YA 5IMBA 3B8EA 1P5FA 5F7ZA 5L3ZA 1ZVJA 3MWFA 1Z7YA 3HJUA 4EHIA 4LHXA 4URHA 2OAEA 4TLDA 2O07A 2GYUA 1TZJA 3B1XA 4MUGA 3RSLA 2GF0A 4GI1A 2ABWA 2PS1A 2JBWA 2YMMA 5D8DA 2J4DA 3EFEA 4WPGA 4XR9A 2PRKA 1PQWA 3UUGA 4FX2A 5TEVA 2JFUA 3AM3A 3LTNC 1TYEB 2C59A 3CVVA 1HSOA 3BXXA 3ISTA 5DYGA 2VHTA 5HTKA 4BDSA 4UREA 3H1TA 2JEZA 2JLAA 1Q12A 4NBRA 3ET4A 2DETA 3L6BA 2VYNA 1RLTA 3MBOA 3ANSA 4GOJA 1DB3A 4HK4A 2GJKA 4FKBA 3L7NA 1PSDA 1AF4A 5DX0A 4S04A 3IAM6 2ZM5A 4J0DA 1ULAA 2R65A 3UTCA 4A92A 4EZIA 5DXJA 721PA 2X42A 4QLBA 5IXSA 5J2TB 1RWMA 2G72A 3PJFA 1LRJA 4LE2A 4US2R 3E9ZA 2PX4A 1YQQA 1BRTA 2J5QA 1MPXA 2G09A 1HSZA 3FHLA 4N7MA 4ZC1A 1NLFA 5HBGA 2XUZA 2C58A 3CLTD 3N0XA 4INJA 2N46A 1LDYA 4YRAA 5FA8A 1KDPA 3VMFA 1TA4A 4DXHA 4RTQA 3ZWVA 5CEFA 3QV2A 2JB9A 3QYAA 2EZ8A 4W99A 2GEFA 2VTKA 2NO5A 2RGDA 1T9ZA 1B74A 2V4ZA 5DH9A 3FYUB 3WGVA 2P6MA 1YS2X 4BUCA 1HZJA 2Q1SA 1H3EA 2AIRA 4N4AA 3DCIA 1U31A 1Y7LA 3LYHA 4N0EA 3TW8A 2A9QA 3N8KA 4M8NE 3K31A 1H6DA 3C7KA 3LWZA 4RQUA 3N7TA 3RQIA 3LCMA 5IM5A 2VXBA 2YUIA 2GPSA 1B8PA 3ASVA 2B20A 2WICA 1W4LA 1JIJA 3BGVA 4FQ8A 2K2WA 4JC8A 4C2BA 4WKNA 4EPWA 2YOHA 5DCUA 5HFNA 3UJBA 4NX2A 4TVSA 2JAPA 1OLUB 4IWNA 4NZNA 3R6WA 3L0ZA 2KHZA 4TZ0A 2FB9A 4LC0A 1RYHA 3DFMA 4KLCA 5C5CA 1RAIA 4HQ0A 4MUIA 1V25A 5TMDA 1T1RA 2ZRLA 1SUPA 2QAGC 2O2JA 4OX9B 5L3SB 4ZOQI 3EIOA 2B83A 5BNWA 4P36A 1NJFA 4EOGA 3WJ1A 1MJGA 5LDDC 1LWOA 1E69A 5G1OA 4AU1A 3ORRA 3AB7A 1PFGA 2H11A 3AESA 1H42A 4M49A 4EUKA 3QIVA 1QB8A 3X1DA 3L0YA 4AJNA 1M10A 2VDPB 3PGVA 2LE0A 3IHLA 1JEEA 2WJVA 4YN3A 4KXQA 4QXAA 1O5TA 2XYHA 3HA2A 1S96A 3TOCA 4LKRA 4CBVA 1M0EA 2B78A 1X77A 3CH4B 3TOZA 2GFQA 1J5EB 4EKEA 4C6SA 1UEJA 3E4CA 5L8VA 1O94C 4ENTA 2HJGA 3ITDA 2PSEA 2Z5VA 3NGMA 2GSWA 4GUAA 4OJNA 3JPWA 4IL5A 1WV0A 5H3HA 4FQ5A 1L4EA 4AQDA 1W4AA 2YMLA 3AC0A 2FNAA 3C3MA 3H5LA 4EYQA 4DIKA 3DZ8A 2WRZA 2H1OA 1NUAA 4RD2A 5IBCA 1V1MA 1WX1A 3B3GA 3FMOB 4S2UA 3LCJA 3U3KA 3EEIA 4ZT2A 4DABA 3T06B 4EHNA 2IIBA 1R4MA 2GTIA 3A6DA 5A3VA 4AJ4A 5COAA 3O75A 3TQSA 1KVUA 2WKRA 2BFWA 1CY8A 1T8UA 3BMOB 1NX6A 3DZIA 3NHYA 2BEWA 3QFFA 4AJLA 4AKSA 1YASA 4KB5A 4XRRA 4HVAA 1A8HA 3JS5A 2W6QA 5J5VA 1J8MF 4KYVA 2GAFA 2PJUA 4Q03A 1Y1PA 3OPYI 4BN5A 3DKVA 1JWLA 4R0VA 1S8NA 1TQDA 4KQJA 3WLNA 4EB8A 1IDOA 4LHZA 4OJKA 1WQ3A 4XRGA 1DJMA 3Q87B 1E2PA 4FKMA 4OUKX 2F8LA 3LVQE 5CBKA 4CLRB 4L3OA 4MUYA 4D74A 4EKNB 1JBQA 1Z2OX 1HL7A 1UFRA 5TX7A 1PJAA 5AKYA 3G68A 2IZ7A 5HDBB 1ZDMA 5DN9A 1X7YA 4ARUA 4DCMA 1NW3A 3KYDB 4EKYA 3JCZA 3I9MA 2CVOA 3DE5X 3IRUA 3N0WA 1NVBA 1RRMA 3NZEA 4HQ6A 2QT1A 2QB5A 2ZI3A 4MCIA 4PG7A 5TJHA 3U39A 4B3XA 4C4XA 4QJ3A 1HDEA 3NRBA 3AEKA 4L57A 1RKBA 4GXQA 4OAOA 2Y0BA 3IILA 2ZOSA 1GQFA 3S40A 4DCCA 4R1LA 5IH3A 1DC7A 2VBCA 3U9LA 3WL4A 3DJYA 2XBUA 2I4TA 621PA 4ZI5A 2F43B 3WZMA 1CDZA 4CUKA 3UJDA 2CK3A 4TWBA 2I7TA 2B37A 3UAVA 4EECA 2Q5JA 3BPSA 4PANA 3C5EA 4X85A 1FZTA 5CNIA 1JI0A 1KQ3A 5DSXA 5KX5B 3R7AA 2XOKA 3OEWA 4GMHA 2KSQA 1TAUA 4AY4A 2IYRA 1F8FA 1LDBA 1MABA 4LDPA 4CV2A 1AE1A 1HGXA 3ZQ6A 5C5IA 1UAAA 1RZRA 1M2NA 2RGWA 1U65A 1ULHA 3EARA 3GEDA 4JLAA 4NARA 4P5PA 2ZS7A 3FXAA 2LBPA 2J08A 3VSDA 4DV6B 1PHPA 2FEOA 1G8FA 4P7FA 1ZH8A 1UPFA 2WYIA 2N42A 4XB2A 4HPJB 5LP6B 3ZWKA 2I6XA 4W1RA 5FBLB 1KJ8A 5ECWA 1I14A 3DV0A 3I92A 1T5DX 3A6JA 2VK4A 1CQPA 3CZ5A 4EP1A 2FMFA 2V6BA 3LIPA 4W1QA 2IH4A 3FOWA 4HFNA 2RGRA 1SC1A 2REBA 4D8VA 1D5WA 2RKOA 4Q9NA 1JZSA 4TVOA 2CJFA 2EZ4A 3N70A 4J4BA 4NPCA 1TU0A 1AN0A 2PLFA 3A25A 1PIWA 3TZKA 2ZZMA 2Z04A 1C0PA 3O3OB 5JAOA 4K28A 5JI3E 4TLMB 3UGJA 1JTVA 1VBFA 2DY1A 3AB8A 1IN4A 3F5QA 4LNUA 4JGBA 4CMBA 3CG4A 2WBLC 3T7SA 3QEOA 5DLDA 3F8SA 1CZNA 3GNTA 5J2UA 3L7CA 1G4AE 4GI3A 4J0FA 4TKUA 5DBIA 4MVJI 1U1EA 2I8LA 3IDQA 4UJ3A 1O6GA 4EQ6A 3HS3A 4DQXA 1XHLA 4ZGBA 4AZ3B 2VDWB 3QF4B 1P9NA 4TQGA 1NJ8A 1C7QA 3GLTA 3WGZA 3ZOKA 2ONCA 1MO4A 4Q3DA 3SVLA 2ZSDA 1J8YF 3GFPA 4KNYA 2IYFA 3AIOA 4J43A 4M86A 2VATA 1NFFA 2R6CA 2Z1NA 2NADA 2ENUA 3O38A 4ZOEA 4ZVKA 3P45A 1T8TA 4A0FA 4OGGA 5D3MA 1TD9A 1CRWG 4C30A 1J49A 5K8VA 2B35A 5EIBD 4PGAA 4TVBA 1OBCA 2E89A 1XAGA 3HN2A 2XWPA 1MT0A 2AMJA 2C20A 2V54A 3EEQA 3NANA 3PD0A 3JQ9A 3P8ZA 3PDIB 4C21A 2XMBA 4IJVA 3D59A 3C16C 4KLRA 3SEZA 4EUFA 1UJCA 3EPPA 2DLDA 1TTPB 1E1KA 5KCMA 4HV4A 3EK2A 2IZ0A 1SZJG 4D97A 1FFCA 4BMYA 3T7AA 3BRSA 1HEYA 3IOYA 4WLNA 3WGLA 6CHYA 2F1RA 1A5TA 1HYGA 5KTRA 3R6TA 3I6YA 2NO4A 1E3EA 5AJHA 4HGOA 5T4FA 3OPMA 2BOVA 3GL9A 4RHEA 4C3UA 4C04A 5K4HA 4PC7A 3L02A 4U6SA 3GVCA 4OL0A 2Q0XA 3DKRA 1U0JA 2RI6A 4TL8A 4B74A 4MS1A 3K16A 4ONEA 3GYBA 4E1AA 3G1UA 1R6BX 2FP4A 4YK7A 1FDIA 1XAHA 5E6UA 2BMWA 2XGSA 1EDOA 3OEYA 1GNTA 4LHVA 5EMMA 3AVVA 1FS4A 1NXTA 1UPTA 2QAGB 1DMRA 2ONKA 3LHSA 3VYWA 4G81A 1ZBDA 1V8BA 2H9IA 4NJOA 5BY2A 3KETA 4QBFA 2VAWA 5CX1A 2FPRA 2GEJA 1NNSA 3ZHBA 3ZW8A 3KKKA 4ALNA 3BMQA 2E1RA 3NTUA 1Z7GA 2QXTA 4ZJUA 1DTEA 5CB0A 2W90A 3KXLA 4MKGA 3BVPA 3W2EA 2AOWA 3S99A 4YCSA 5HZMA 3ZHTA 1Q95A 1TF7A 2QRHA 3FOAA 5B53A 4FZVA 1KRWA 1F38A 2YIMA 3ANYB 4Q4LA 5DTJA 2O8EB 1VFPA 3DDCA 4M2LA 3AL2A 1RWQA 2JH9A 1SGWA 1OFTA 1RHRA 1V5WA 3AT1A 3K0AA 4G63A 3WXMA 2R6DA 4HWGA 2OG2A 3OIDA 4RADA 4BBAA 2Y68A 1X1CA 4B4WA 5L7WA 4W5WA 2JLYA 1MZPA 3LHFA 1HURA 1T5BA 1CETA 2J45A 2YWDA 5AJTA 1VRVA 2GASA 1LPPA 3I2FA 1M34B 2BAGA 4W8HA 2RAVA 1QF9A 3SVTA 1V35A 1KOFA 3PGMA 5K6AC 1YIDA 2P67A 3ZWYA 2XNSA 1NN0A 3QUBA 3OURA 3G89A 1DCFA 3NWEA 3RTAA 5LXTA 3ROFA 3E3MA 1GZ6A 4QO7A 4D56A 4LF7B 4EA7A 2IODA 2WOOA 2JIBA 3ILHA 4K6MA 4WZAB 5EMKA 4BDTA 5IAAA 4QU0A 4B33A 5JPDA 1VI2A 4GKBA 1II9A 4FR0A 3SSMA 2HWYA 3TJZA 4M38A 3WQHA 3CINA 4CKZA 1PX0A 3L6RA 5IAJA 2H0AA 1EFAA 3ADKA 3TKYA 4F5ZA 1ULZA 2JGMA 3G0GA 5A4DA 5CVJA 3GROA 2ECOA 2OHVA 3KEOA 4RPJA 1FUYB 1NMXA 2QY6A 3COVA 3DOEA 4LF9B 4H35A 3OIVA 3QPAA 3GLGB 2NO6A 3GJ3A 2QBYA 1VM6A 1XD9A 3GCXA 1O97C 2WF6A 3PIRA 4S35A 4REQB 2GN9A 1M75A 1E9RA 9LDTA 2YQZA 2ZJOA 3KJNA 5KKNB 1BFKA 3VR2D 1E2IA 4EHFA 3JQBA 2P9QA 4V0ME 2XPCA 1D2EA 4MJLA 4TV9F 2OCYC 3EWAA 5IW8A 2PGIA 3EXIA 3T94A 4EY6A 4CTMA 4BNXA 2Q9BA 2J3IA 5KO2A 4Z4FA 4WUTA 5I7EA 1F7VA 4U1RA 4W82A 2LV8A 4Q0MA 5AVXA 1E6CA 1G0OA 1TRHA 5JJCA 2WZDA 5ARBA 3BXZA 4OXQA 1L5NA 3L2OB 2CLMB 3NTLA 2OLKA 2J7KA 3NWOA 2NU9B 3EW7A 4D92A 1A9TA 3NHUA 1N5LA 3PPIA 2VJLA 2JK0A 3GDFA 1VSTA 2DFPA 3OFKA 3AUJB 3EDRA 1J2EA 2XT9A 2P0EA 1V43A 1WEHA 3DA8A 1D2CA 4HAWA 3RK4A 3OD1A 3RVSA 1S3GA 1TEXA 2V9PA 4NS4A 3INTA 4M87A 3E22B 1SOUA 4HI0E 4KN6A 4C1NA 1EHIA 3T8YA 3PFHA 3KVOA 3WAKA 1LBTA 2WWWA 1JIXA 2XYQA 2B8TA 1Q14A 3HKCB 5TMBA 1GKKA 4WY2A 1KJ9A 3PSHA 5B36A 2HRDA 2CC2A 3T5GA 4PIMA 3PQ2A 3HACA 5DX1A 1ZMRA 5G2OA 3KO8A 2GEUA 1F0PA 2O7QA 4HGQA 1YQUA 4OXYA 3V1KA 4R1OA 3RVLA 5EIFA 2B1JA 4Y8VA 4N3CA 5B5SA 5EXEA 1UBFA 3EASA 4NU6A 3MS4A 3Q7SA 4P34A 4B5KA 221PA 5DYNA 5A5EA 1TDJA 4Q9LA 1RT9A 3P0JA 4I99A 2WJ3A 1WCWA 3WP1B 1A4UA 1GFSA 3EQ8A 4YV1A 4ZHQA 3H1GA 1Y89A 4DSNA 5EHXA 3LQKA 2J3QA 3W78A 2QNBA 5DGTA 2QQEA 4AS1A 1E1MA 3ZQUA 1XZGA 3MMNA 1ZC4A 2OO7A 1UBUS 1LNQA 1ORHA 3V8QA 4AJJA 4NWIA 3OQOA 1UBKS 3E35A 4FFLA 3RD5A 1Y8ZA 3Q6NA 4WNCA 5BQXA 2XRMA 2E55A 4FZ5A 4RY8A 1BS2A 3REQA 1GRRA 5FD8A 4YR9A 4PLVA 3AM5A 3OTHA 3JASA 1U0RA 3ONEA 4OD0A 4HG2A 5DISB 4YWHA 3NP9A 4CU2A 1RBQA 1UPUA 4NY1A 1NM5A 3K8YA 4PYQA 3K94A 4IIUA 4D80A 1X42A 3BN3A 3QMVA 4FBLA 4WACA 1M6VB 2PN1A 4WWHA 1EVKA 3AVPA 5EMLA 3SS8A 4ER3A 3O2JA 3EBOA 1ZGCA 3K8OE 3KB8A 4L07A 1KGDA 1KA9H 4NTZA 3W5CA 4WZZA 1XN1A 5IJ9A 3PFWO 4WE3A 1FCJA 3A7DA 4D3ZA 1B6TA 1TC2A 1WU7A 2GB4A 2I6SA 2J8ZA 2JGAA 3HDVA 3CISA 3OQBA 1N2OA 4DBLE 3HCOA 2FCAA 3VVMA 5FFNA 1XZFA 3LY7A 3NAMA 3CRVA 5K20A 5AQ1A 4GRAA 4DNFA 4ZVTA 2I2XB 4AROA 1BQEA 1GG8A 1RP1A 3U17A 2QW8A 4YDRA 3SBXA 2VHJA 1AC5A 1CE8A 1ZOOA 4S1TA 1U5BA 3RU9A 5GTDA 5HQ3B 3EAGA 2P9JA 2ZXUA 4HS4A 1FFBA 4Q3AA 4RZ3A 2FTKE 4COOA 2XQIA 1UDRA 4QDJA 4A03A 4F2PA 4YONB 1XU4A 1ORVA 2C2GA 2OZKA 3GCDA 1IONA 1RHQA 3TS1A 4PM4A 3NS7A 3MQFA 1G5IA 2CF6A 4HDSB 3ZN2A 1QAMA 4FMBB 3TMKA 5JAQA 3W7VA 3KWFA 1E9DA 1M74A 4RC9A 3JWGA 2F62A 1MJNA 4MPJA 3K4PA 4EF4A 2EFDB 3G2OA 2AR7A 2IYLD 4OQZA 1K4MA 3SSOA 1ZZEA 4C5BA 1Y1LA 4RLQA 3UV6A 4QNMA 1EFUA 1QKJA 4YQFA 3M7IA 2YS6A 1OJLA 2V03A 4QAQA 4YJ2B 2IV2X 5G0SA 1E94E 2UUPA 1RLMA 2VNKA 3UMGA 2QOEA 4DAOA 1K3FA 5IFLA 1UCFA 3G9TA 1E6UA 4R1UA 3Q2KA 4MS4B 1SQ0A 1YBAA 5TLSA 3HA7A 1IVNA 5J2TF 1TF5A 5SY6A 1I80A 1PP4A 5CD1A 2RGUA 1E3LA 3A6GA 5IFKA 2B9EA 1I13A 4P84A 3TTYA 4ZEWA 4NMHA 5JLAA 4N0PA 3WYCA 4D6YA 1DC4A 3O90A 3UANA 4DYDA 4IMIB 3L7LA 1CF9A 1DINA 1O9BA 4K3UA 4M99A 5KU7A 4JEUA 5JSFA 1I7PA 4WNAA 1GQSA 5ELMA 5CA1A 5DM2A 3OHSX 1Y3FE 1SVOA 2P9HA 3BL5A 4LXXA 4F3YA 5BQOA 4LF4B 2R9VA 3D6TB 3C7DB 3FPFA 4J0JA 3L77A 4Y9DA 4BJ6A 3RODA 2Q7XA 1L7VC 3HLYA 3MC1A 3KQYA 3DT8A 4P93A 2MYTA 3GLUA 4QNRA 5JH7B 1CEEA 2GEDA 4CQMB 2HDHA 4M9QA 2EF1A 3B6MA 2WPNA 4PFSA 3AVTA 3LO5A 4INZA 4FONA 4DHEA 3U1VA 3HG7A 4PR3A 3ZS8A 1ADBA 2GEKA 2IWHA 3KQQA 3KPWA 5FLEX 2Q6LA 3SQOA 2QU7A 1FDUA 3CLVA 4BWGA 2GEVA 4BP9A 1Q16A 2J6HA 2FUKA 4ILEA 4X1KB 5CHEA 1DS6A 2XB4A 1EFKA 1BCRA 1XB2A 4P3PA 4HO1X 4D26A 2AJTA 4ZI7B 3ORQA 5E7JA 1YA8A 2HU8A 3NCTA 3UA3A 5CM9C 1YS6A 2ZAGA 4C0LA 2ZJ0A 3LTEA 3V4ZA 1IBKB 4ZVQA 5DB4A 3CT6A 3A3NA 4FK8A 3C8MA 4PGGA 3F7OA 5AM4A 3VU0A 4EM6A 2QRVB 3UAYA 2VHEA 1FSFA 2FMIA 3FMIA 1Y5MA 3IQXA 4FFRA 4MW5A 5D3ZA 4DJDC 1INLA 1UM9B 1JMVA 2WF9A 4V0RA 5K0NA 4M7PA 3R9KA 3RS8A 4CDRA 3PF8A 2HPHA 2OYCA 1YUNA 5AW4A 2HX1A 4KR7A 3T4UA 3L92A 1BEEA 4V0OA 2BJHA 4MQFA 5A5FA 5HVNA 1C2YA 1UKEA 4JVLA 2NYUA 3NETA 1T9AA 2GLXA 1H5QA 4IUCS 4NJMB 1IN7A 3OAAD 4FFBB 4J03A 2AC7A 4U7TB 1EJBA 2QHXA 4N5HX 2Q49A 2PX0A 1GT91 3WK8A 3OCCA 3OTOB 3QY0A 2QT9A 3OPQA 4NMLA 1BXRB 2FY8A 4JODA 4R6XA 3RVOA 3ZE8A 2O59A 1ZL0A 3QW2A 4JZKA 1JKMA 3FNFA 3VH1A 3LJKA 4XSHA 1DSSG 2QJTA 4JI8B 4GX0A 1P2UA 4JITA 3HUTA 3P2KA 2G08A 4ZI3A 3COYA 3OUZA 4ZAGA 2JFXA 4TV8B 3VZQA 3UQZA 1N9GA 4BZXA 2B9VA 5IVIA 2AG0A 3ZBPA 1NIPA 1OV4A 3CKYA 3H84A 3OKCA 1PK9A 5ALEA 4XWYA 1FVFA 3ADPA 2DH6A 1T4GA 1OX4A 2HR1A 1K98A 2LR0A 4JBYA 3DL2A 4D4KA 4B85A 2I2FA 3PEYA 4J3JA 4ZGWA 4J2TA 1UZMA 5KOHB 5ESRA 4LBWA 2AFRA 4L5YA 1ZESA 3F74A 4W6QA 4JJEA 2NUAB 1P9WA 1GLGA 2DBQA 2WMOB 5G0UA 5HIMA 5BW8A 2ZBRA 2OD2A 2YV3A 1U7TA 1HT2E 1J70A 1ZA2A 3G2KA 3O7WA 4JD5A 2EX4A 4MVJD 1RJDA 3A2NA 3GD5A 3AP2A 2HOQA 3KD2A 4ZJYA 2YRWA 2XB6A 3C1AA 4TKZA 1Z4LA 1P74A 4WKCA 4CJXA 4CG0A 5BURA 1V2HE 1ZM9A 4ZN6A 4UU7A 1NXXA 1FUUA 4LEIA 1QJCA 1WZNA 2SHKA 2PKWA 4QGSA 2Z95A 1W1UA 5HXAA 1JHPA 1P19A 4RXTA 1JVSA 3DZJA 2ID8A 2J46A 3E8SA 1W49A 2YXDA 4JLPA 1WPRA 1XZCA 2OO5A 5LWHA 1L5QA 4P0QB 1U3FA 4K86A 1TVEA 4LY9A 1O3YA 4M8SA 4B47A 2VQ6A 1JXMA 5L45A 4NDZA 1OLSA 2NZ2A 2HV8A 3K5HA 4JJGA 5FUWA 4ZDIA 3DDUA 3EQ6A 3CKMA 1QF7A 4U02A 3WGIA 3D3QA 3BE6A 4MVJM 2BM9A 3SKXA 2WJYA 5J3JA 5LD2C 1XP8A 4TTVA 2D4HA 3HDGA 3VC7A 5J58A 2I4LA 1EHCA 1CS4C 1N0WA 4H1HA 2ZLBA 3X1XA 4DXAA 4LPKA 1UKCA 1YDGA 2JGDB 1NLZA 4XWTA 1OV6A 3FVTA 5I7UA 1VMKA 2VZLA 5LP6F 4LJ4A 1U8AA 3E2PA 4M54A 4MKRA 5DM70 1LVHA 3G5UA 4O0LA 5CP8A 5HIKA 3LH5A 4DV7B 4F6RB 4MMYB 2POCA 1WULS 4DVGA 3MLEA 2BM1A 2P5UA 4KTVE 1HA3A 1G60A 2V59A 4LWPA 2H4JA 1YZLA 5IVDA 421PA 4LYGA 4IS3A 4NH4A 4KXLA 3QRWA 4WCDA 3QUSA 2DG2A 1JRLA 4MUXA 5FV7A 4E31A 5LJIA 3QE9Y 2IKSA 2Q3BA 2HK9A 1L5LA 4CMHA 5L6LB 2R6AA 2HDNB 2W00A 4IDEA 4P98A 2D2FA 1EVJA 4TYQA 4XB1A 4DCOA 4BJ5A 2XNJA 3NHSA 4BE4A 3U16A 3BXEA 1E0AA 2PVSA 3BRWD 2AXPA 3ND8A 3OIWA 4JBGA 4OHCA 4V0LA 2G07A 4Y2XA 5KYUA 5C34B 2RHCA 5A7GA 3VU3A 4AT1A 4C88A 4X62B 4LGYA 5I7OA 3BMNA 3PPWA 4M55A 1Y1SA 5LLTA 1QH9A 2FPXA 2PMEA 3WDSA 4EELA 4UAGA 3I73A 1E1QD 3PWKA 3R4VA 3T7IA 1JR2A 2FPKA 5DYYA 2WDPA 3PL5A 3PR3A 1O54A 1AT1A 4IQ8A 2HEIA 2QJFA 3V1UA 1B93A 5JYCA 4RULA 4Q4HB 3DE3X 1JR3D 1ZIDA 3ZE0B 1X8XA 3AZOA 4JIMA 1Y9AA 2XCOA 2Q9UA 3IL2A 2V7UA 3NXSA 5K8UA 3THWA 1H9AA 1WMSA 2VEOA 5J59A 1EVLA 2PR2A 5AI5A 2JCGA 2JHGA 1EG7A 3T0FA 1T24A 3ZKWB 4QHTA 1GTL1 3Q98A 2YXLA 3M4NA 3R3WA 1QIGA 5C80A 2JIQA 3TLKA 2BELA 4XARA 4B7AA 2Y6UA 2LP4Y 2VNIA 4ZVOA 3OZAA 3ZGLA 1EUQA 1Z16A 1CK4A 1YK1A 1HETA 1NUPA 3HYLA 5G02A 3D0KA 2H54A 4RA9B 4YAIA 3KIPA 3UCXA 4R31A 5SZJA 3DDOA 1HTBA 4YAWA 3CRQA 2GCOA 1LDMA 1YZTA 9ATCA 3QE4A 4OFWA 2O1XA 5ALFA 4ZTUB 1B14A 2FX5A 2IY7A 1FY2A 3I30X 1TJPB 4DLKA 2VJMA 2DUJA 3RYTC 3M3HA 3MINA 1VLMA 2H1VA 2PL9A 2BH9A 2Y1EA 1U1FA 5H3LA 1W88A 3GQBB 2ONZA 5TB5A 4EPTA 5IT4A 1MNAA 5CYFA 2JLZA 2XXBA 4NCNA 4JYCA 3DC7A 3UOGA 4Y1RA 1MD9A 3NBZC 4KZKA 5DOZA 4BBJA 3SEAA 2AOUB 3KCNA 1TTHA 3H9CA 4GPZA 4HLNA 2G1KA 3SF0A 5EJIA 1EFLA 5M34A 2CN1A 3D54D 4L75A 2VPPA 4LTDA 3MCTA 4IEFB 4MV8A 4ND4A 5ERGB 4MDHA 3PEVA 4R2IA 5GGXA 4UEQA 3AV0B 3TLYA 2C98A 4F60A 1ZIYA 2FWJA 3OAAA 3LOUA 1QYXA 4G2TA 4MAMA 1JHAA 5I3ZA 4HB3A 4MRRA 2V0GA 5K0JA 3RRBA 5IHPA 4JT4A 1XD2A 3UWKA 3GFQA 5MGNA 4NIMA 2GAOA 5BN4A 5LOVA 4HL6A 1G9SA 3ACCA 3QXGA 2X15A 4DMCA 4A2CA 1JEQB 1QF6A 4EHAA 1Q0HA 3RYCA 3ZVKA 5AUNB 5J4KA 2QW0X 3Q3VA 4AKTA 4YV2A 1HC7A 1RYNA 3D7LA 5A4FS 5L51A 2X23A 2BKAA 4GD3Q 1IOZA 3ZDDA 1YZKA 1JH8A 2A35A 1YQGA 2OEPA 4KDEA 4MYTA 1BN6A 4RTLA 4OKSA 1A2OA 2QS9A 1RHMA 4JL6A 3S44A 3AKEA 1M73E 4PRYA 4BQQA 5JECA 4ZMSA 4BNKA 1X13A 3Q3EA 1RJ9A 3RSSA 2HJSA 4YJ3B 2CUZA 3UIEA 2GWRA 3OU7A 5CCXA 5ELXA 4BLRA 1Z6PA 4B3GA 2OILA 2W93A 2G8LA 2GWHA 2YC2C 3I3SR 4QBIA 4MVJA 1L7OA 2XMZA 4RK1A 1XTVA 5GZ6A 4AZ0B 1OTXA 1W0KD 1Z6YA 2OB2A 1YAJA 3AHCA 5K03A 3ZE9A 1EK2A 1QIJA 1CZKA 1GP2A 1MAUA 2H52A 1K7EB 2X19A 3KDAA 3QVKA 1DDOA 2CFTA 3NKFA 2P6NA 4DMUB 5HMLA 2K5UA 3CS3A 3GGOA 1ID8A 2VTDA 1NJ5A 2OHXA 4JT2A 2AQHA 3FROA 5DCLA 4CDNA 2JRLA 4QFDA 5ALRA 4L85A 1GA4A 1DBSA 4OHFA 1JIKA 2QLJA 3EHDA 4K03A 1LPSA 1J7KA 4PZ0A 4RPHA 1Y3DE 5CEJA 2Z8YM 1Z5ZA 1OTHA 3DOCA 4I50A 3KR1A 3P9XA 1AV7A 2ID9A 4F46A 1CY1A 3AONB 4J7UA 2YJ4A 1DAEA 1QK4A 5E4TA 3R9IA 3RC3A 3VZCA 2W6ID 4JWTA 2SCUB 4QOSA 2FKAA 1H2HA 3EXAA 3LC0A 3NDRA 4UFNA 5D7BA 1H66A 3MXTA 3EOZA 4XYBA 4FDTA 5M04A 1KI7A 2XBLA 2PZLA 3MW8A 3RRYA 3V3TA 2PZMA 4ND6A 1N0HA 4O4IB 5J5CA 4DUPA 4ESOA 2B4KA 1UBTS 2C94A 3IOMA 4JP8A 3KYBA 3JWJA 4XLZA 1C7ZA 3H2KA 4EFLA 1L5FA 7AT1A 1W35A 3HUEA 1LLQA 2C5SA 3M6FA 1ZG3A 1UM8A 1G6KA 4RELA 5IC5A 4E2XA 4D6XA 1ESCA 4WAUA 3TIGA 3DVQX 4AP6A 5BRAA 4IVQA 1S3IA 2XVXA 2D5AA 4P86A 2P4EA 1U5CA 2PM8A 5E2IA 5BSFA 4LRUA 3UV3A 2XTZA 3L04A 5EXDA 3M5PA 4I0WB 3WFJA 2V45A 3AXSA 2B94A 1UT5A 3STYA 5CCEA 5L9AA 3TVYA 1G3QA 2BISA 2EWMA 3GBPA 3SOZA 3FAKA 3C70A 2AT1A 5A62A 2MYUA 1RYYA 2D62A 2IYEA 5FWXA 4BO1A 1DQZA 2XYGA 4FNOA 3ND5A 1L8AA 4IVNA 4QYMA 4QXRA