4HUJA

Crystal structure of a hypothetical protein sma0349 from sinorhizobium meliloti
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
204
structure length
204
Chain Sequence
NLYFQSMTTYAIIGAGAIGSALAERFTAAQIPAIIANSRGPASLSSVTDRFGASVKAVELKDALQADVVILAVPYDSIADIVTQVSDWGGQIVVDASNAIDFPAFKPRDLGGRLSTEIVSELVPGAKVVKAFNTLPAAVLAADPDKGTGSRVLFLSGNHSDANRQVAELISSLGFAPVDLGTLAASGPIQQFGRPLVALNLLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein SMa0349 from Sinorhizobium meliloti
rcsb
source organism Sinorhizobium meliloti
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 56
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4hujA00
1HDXA 5KOIA 3ZV3A 2DQ4A 3K2BA 1W73A 2OP0A 5A05A 3OECA 1DFGA 1PX0A 4BKQA 3FD8A 2BMAA 1B3BA 1OBFO 3DZKA 3KSDO 1CYDA 1B8UA 4UVEA 3VC7A 3RAJA 3NTRA 3ICPA 1OAAA 1KS9A 1C0IA 5GZ1A 4GSKA 1PR9A 4EEXA 4J4HA 1P45A 1CF2O 1EFLA 1J4AA 3C7AA 3FI9A 3UAGA 5J23A 3RVDA 4BGIA 4RVFA 3NDRA 3BMNB 3H5RA 4TKMA 2X8LA 2VNSA 4TRRA 3RFTA 5CDYA 2AE2A 2PTGA 3D3WB 3PWSA 4OXNA 1GZ6A 3WSVA 1YOVA 4D0SA 3WIDA 4CUZA 1XELA 3ADOA 6LDHA 1K3TA 1TT7A 4YJDA 2R6JA 1X1EA 3NGXA 2YHUA 5I9MA 2VUSA 1Z7BA 4AJHA 5JLAA 1A71A 5THQA 4R16A 4YTEA 4GBJA 2YV3A 3NDIA 3FF4A 4M89A 4YVFA 3WWZA 3GQVA 4J0EA 5U1PA 2I3GA 3LU1A 1CEQA 3ZWWA 3V2UA 1EK5A 4IIUA 2YY7A 1FXSA 4ND4A 2VYND 4TKLA 4LRSB 3NJ4A 4YEDA 3KB6A 4OM8A 3I4FA 4HX5A 3MOGA 5JDIA 1Y5MA 5TQVA 1NVMB 2GZ3A 3OH8A 4JNKA 2EJVA 2I65A 3AUSA 4FCCA 2EWMA 3OBBA 1I0ZA 2PZLA 4JGBA 2EKPA 4PLVA 9LDBA 3ITDA 1DO8A 3CEAA 1GTMA 4XEHA 1B8PA 3Q9UA 1KVSA 4OYRA 4CR6A 4WLEA 1KBZA 1GD1O 2FR0A 4AJIA 4H7PA 5CAEA 1WP4A 1HLPA 1P1JA 4JN6B 4J1SA 1E7YA 2JD0A 4AJOA 4AICA 4TZTA 4CM9D 2O3TA 4WCFC 1WLYA 1VKOA 3AM4A 1T1SA 4F45A 2B83A 2O3SA 1LTHR 1U7HA 5TNXA 1HETA 2E48A 3T4EA 3UW3A 1E3LA 3W6UA 1N5DA 3IP1A 1FDTA 4TRJA 4TQGA 2PGJA 1Z82A 3DR3A 1R12A 3IS3A 3GOHA 5T64A 4CLOA 2LDBA 2GLXA 3C1TA 3ZWYA 1DHRA 3PLNA 1YQGA 1D1SA 3I9MA 3GGOA 4K6CA 1GPJA 4P38A 2P9GA 1H5QA 1IZ0A 1ZH8A 3KVOA 2JFFA 1DLJA 3B1FA 2IZZA 1Z6ZA 4IXWA 1EUDA 1PS0A 4ID9A 3E82A 4OHUA 5AXBA 5KTKA 4WUVA 1I3NA 2NADA 5DCUA 4YBZA 2CDCA 4PG5A 1JKFA 3JQBA 5IDXA 1MP0A 4D46A 4J0FA 3VPXA 1T2FA 3BMOB 1TVEA 2HQ1A 4XZ3A 1DJQA 5FI5A 2BELA 2Z1NA 3RUAA 2O2SA 1HE5A 4BO1A 3WGTA 3BHJA 2VRCD 1XGKA 5EJ2A 1U28A 3N7UA 3GR6A 4EYEA 4QO7A 2HDHA 2G0TA 4Z0TA 1UDBA 1BRMA 2GO1A 1GFSA 2R2GA 2UUOA 2EKQA 4II3A 2VTEA 2DTXA 2Q46A 2C82A 3ZNQA 4OIMA 3W4KA 1TI7A 5ILGA 5L53A 3ORFA 3HNPA 3H6KA 4IZHA 3UFXA 1TA4A 4E30A 4BMVA 2PNFA 3DHNA 3F1KA 5TRTA 1LBEA 2Y0DA 3NDJA 1HDYA 3HADA 3K92A 4RVUA 1LUAA 3VZPA 5IDQA 5JMPA 4KTTE 4CODB 4R69A 3WG9A 2O4UX 3ZWMA 4R1NA 5EMHA 2IEBA 1DIBA 1PJTA 3EUWA 5IXSA 2O3UA 3L6EA 1H9BA 5JBIA 1ZVMA 1Y8RA 4EBFA 4DL9A 5G4LA 3PP8A 4AL4A 4BB6A 1E1MA 5JMWA 2GUGA 2BGMA 3VH1A 1D1TA 2D2IA 4IDGA 4RJTA 3D3WA 4NPCA 3LSYA 2JKVA 1EQ2A 2HMWA 3CPSA 1BXKA 3RUDA 3NTQA 1ZXBA 3RCBA 4XYMA 1JQBA 4ND3A 4EEZA 2BRUA 2P9EA 4EDFA 4PRKA 3ZH2A 1HKUA 1PJLA 2YFHA 4J91A 3PXXA 4XD2A 2BFMA 3IP3A 5T5QA 3TSCA 3CMMA 1E3WA 3I9OA 1T26A 4U6SA 1PGQA 3KYBA 4FJ1A 1ISMA 5CPBA 3HB5X 3QV1A 2Q4BA 3GFGA 5LCXA 5KJ6A 1O9BA 1E6EA 1V6AA 3B1JA 1IPFA 4XWYA 1F12A 3DZBA 2Y1EA 3E8XA 3HB4X 4AJ4A 3DBVO 1H6BA 1E7RA 1M2WA 4DQVA 5JAQA 3KV3O 4L8VA 4CV0A 4CLRA 2Q1TA 4Y8VA 2VYVA 3DBHA 4MIEA 1PGNA 3GNSA 3HDHA 3CMCO 2YQ5A 2YZ7A 2Y1GA 2C7VA 1VSVA 2ZQZA 1SEPA 2E4AA 4I9NA 4IMPA 1VPDA 1B8VA 2PA3A 4QO8A 4AJ1A 1R37A 2BI7A 2H9IA 3U4DA 4E6PA 4WOJA 2UYYA 1XHLA 4OMUA 1KVRA 1N92A 2IODA 5DBIA 1D7OA 1EK6A 1HYHA 4J1TA 2EEZA 5FYDA 4EJMA 5JNLA 1T2DA 2C29D 3DBLA 2GRAA 2DTEA 3P5SA 1B14A 3HSKA 1E0DA 2B0JA 1C1XB 4Y67A 4KUEA 1LI4A 2HU2A 2OL4A 4UUNA 2X0IA 4CLEA 2P91A 2JJYA 3FR7A 4TMFA 3AUAA 1DFHA 3G1UA 1O89A 1ISFA 4AJNA 4R1UA 4MPDA 3PPIA 3U4CA 4CUJA 3VVBA 4GKVA 4BO7A 3QVWA 4HFMA 4BL5A 1X7GA 4ZN6A 3H5AA 1LDYA 1E1KA 2P5YA 3GNQA 2VHXA 4E0BA 3W1VA 1ZW1A 3LT4A 4CMIA 1A27A 3ROKA 4J9UE 1TEHA 1MXFA 1N7HA 2CVOA 4NZ9A 3NT2A 3F5SA 1LLCA 2PD6A 4W6ZA 2GERA 3WGOA 4UVIA 2VT2A 3OIFA 4OAQA 1QG6A 4ND5A 3ROPA 5BR7A 5IZ4A 4QECA 1J0XO 2OHXA 5AOVA 1PZEA 8ADHA 1CIVA 1SCUA 4BVAA 1DC3A 1Q1NA 5BSHA 1JVBA 5ADHA 4XR9A 3KETA 3KLMX 2ZKLA 3D0OA 1ULUA 4BNNA 5JAZA 3IUPA 5JDCC 2O3JA 1ZMTA 3OETA 3R1IA 2X0JA 4RQTA 5HA5A 3SC4A 5JO9A 1DXYA 3CH6A 4WLOA 2OOSA 3OHSX 2VZ9A 1F06A 3GZNA 5BNTA 5FWNA 1IB6A 4PVDA 4E5KA 1LLUA 4UEOA 1UXKA 1PU2A 2ZATA 2O48X 3A1NA 2CY0A 1VL0A 4KUHA 1LDMA 2WE7A 3TN7A 2PH5A 1PWXA 1ZFNA 4YPOA 5I9LA 4NK4A 2IZ0A 5JDIC 4BNTA 2DM6A 3PYXA 3QA9A 3FR8A 3RUHA 3W8FA 3HG7A 5JW6A 2QX7A 1LA2A 4MDHA 1NWCA 4BO2A 1EBUA 4XYLA 2FPGA 5ENVA 3S2IA 1OC2A 3WFJA 4E2WA 1G1AA 2BKAA 1N7GA 4Q9NA 2NVUB 1EUZA 4F6LA 1HF3A 3AI2A 1I24A 3FWNA 4ZD6A 1NPYA 3GAZA 2FP4A 3JQEA 3PJEA 3QLJA 4JBIA 4E4YA 3DEYX 3HFGA 5IZCA 1I10A 4BKOA 2NLOA 3O03A 2H1SA 1QKIA 1GL3A 1U7TA 1VC2A 1RYEA 2CVZA 3GVHA 5DT9A 1LC0A 1S6YA 5EIOA 2Q1SA 1PQPA 5B1YA 4KZPA 1HXHA 4P4NA 3FTPA 2NTNA 3OJLA 2JHFA 4I5EA 4JX8A 3TOXA 4JP3A 4WNCA 5HTOA 1IY8A 1LX6A 4I9UA 1H93A 3GFBA 3ZWAA 3OF2A 1HL3A 4ZJUA 4HADA 3VKUA 3F9IA 2IEDA 4YJFA 1L1FA 2VOEA 1AHHA 1ZSYA 2UV8A 2WSBA 5B37A 4BKPA 1ADGA 5KJEA 1P74A 4CL8A 1X7HA 4K9DA 4LISA 4BO6A 4M1QA 5BSEA 1HRDA 2AQHA 3WBFA 2C5EA 4L9RA 1PGPA 3ENNA 3HFSA 5CDTA 3I1JA 3E5RA 4PLCA 1KEVA 3LVFO 3AY7A 1EMDA 4J1QA 1SAYA 4EJ0A 3TOZA 3DOCA 3K6JA 4INAA 1XQ1A 4DPLA 2WD7B 3PK0A 2FPIA 2NVWA 3CZMA 4YQZA 2VHVA 1W6UA 3AY6A 1M67A 2RH4A 2X5KO 2CDBA 5AVOA 1WW8A 3UCXA 1ONNA 1EDZA 3V1UA 4YYZA 5L7WA 2ZCUA 3SXPA 2W2KA 3RROA 1V35A 4FB5A 2I6TA 3WYBA 1UP7A 2VWQA 1C0LA 2D5AA 3EMKA 1UXGA 3OMLA 1Y9EA 3WX0A 5I7FA 2YDXA 2J3IA 3O4RA 1JWAB 2IXAA 3ANLA 4LMRA 3JD1A 4BKRA 3JQ8A 2X9NA 3VVCA 3MTJA 1ENYA 1DC6A 1IULA 1NXQA 1P0CA 5C37A 5HM8A 3E48A 4PZCA 4RDHA 4IDAA 1UH5A 1HE2A 3AFMA 4QUKA 3RUFA 2DFVA 3CTMA 3Q3CA 4CLOB 5TJHA 3ZNOA 4WPGA 4YAIA 1IZ9A 1P1FA 1LRJA 1WMAA 4J1NA 3WXBA 3AM3A 1PZFA 3UOGA 3CINA 4L75A 4XYGA 4GPD1 1UR5A 4JJIA 2V6GA 3V5NA 3WTCA 4AJLA 3UHAA 3Q6IA 4O6VA 4FQ8A 3ABIA 4RL6A 1ISHA 2CVQA 4DMLA 4O5OA 3RBVA 1QXSA 4F46A 4P4LA 4PG6A 2R00A 3KSZO 4CM5A 3GMDA 3ASUA 3I83A 2IXBA 3GHHA 3GN2A 2ZB8A 4IJKA 1E7WA 4PVCA 2CUKA 4FJ0A 5IDWA 3ZWBA 1Q0HA 3PLRA 3GY0A 3PJGA 3H5NA 3LT2A 1Y8QB 3D4OA 5C3MA 3U09A 2X86A 2DT5A 5CPFA 4MJLA 5EINA 1ENZA 3U9LA 1MX3A 1V0JA 4A0SA 4KWHA 3JQAB 3DAGA 4LGVA 1PZHA 2BFAA 3RSHA 3D5QA 3RC9A 4CLXA 5TLSA 1NQOA 3WJ7A 3I9NA 5DP2A 3MZ0A 1UDCA 3ETDA 3HUDA 2GGSA 2XXJA 1ARZA 5TJ9A 5IAAA 5JS6A 3TQHA 2FWMX 3N58A 4CMEA 4E12A 3UCEA 5A9RA 4ALMA 4YAKA 3QP9A 4FGWA 4W7HA 4KTVE 5EN4A 4ITUA 1NHGA 4NH4A 5EESA 4ZRNA 4WLNA 1R0LA 1F8GA 1U3VA 2AQ8A 1NQ5A 1MUUA 2Y67A 1QYWA 5F5NA 3E1KA 5EQFA 1P1HA 5L4NA 3PJFA 3NJ8A 2Y05A 3OA0A 2EG9A 1P3DA 2ET6A 1HWYA 2RIRA 4BNFA 2ZTUA 4FR5A 3EC7A 1GR0A 4II2A 1TLTA 4IQ0A 3ZV5A 2PZKA 2DBZA 2SCUA 1K6IA 3I3OA 4LMPA 2YV2A 1HDGO 4XIJA 2ZYAA 1T24A 4FFOA 4BMNA 4P8RA 4K6FA 2B5WA 2D0IA 5CP8A 3IAHA 3BTSA 4GAEA 1R0KA 2FR1A 4JK3A 1X0XA 1A4UA 4WCFA 4IIVA 3IQDB 5BT9A 1PQWA 4OGWA 1KOLA 4RF3A 3NV9A 3WICA 2FHSA 2CMDA 4PG4A 2Y1CA 3JYNA 3LZ6A 1ULSA 2OBYA 2Q3EA 1LDEA 3PI7A 2EP5A 3TL3A 1K5HA 1HSOA 4XYBA 1LLDA 3EHEA 3RUEA 1MXHA 1FJHA 2VUUA 1RM5A 2V6MA 5DOVA 5B12A 5BNFA 2NU7A 3JQCA 4BNHA 4EUEA 2HUNA 1PJ4A 1T2AA 1YONA 3K73O 4NIMA 1YH3A 4GX1A 2AXQA 1PIWA 2YW9A 4A73A 4NNJA 2DLDA 4WOKA 1YS4A 3DXFA 4LVUA 3UN1A 2DAPA 3GH3A 4O59O 3V1YA 5JY6A 3UVEA 4YRBA 1H94A 1KEWA 1X13A 2A92A 1CRWG 4PLTA 5T8KC 3INGA 3ST7A 4L73A 3KEOA 1QMGA 2EXXA 2AMFA 5ICMA 3S2GA 3O38A 4FJ2A 1JKJA 1WZEA 4DC1A 1HE4A 5KKCA 3H9JA 1KERA 1RJWA 4WASA 4MVJE 4W4TA 3IDSA 3PFWO 1YXMA 3TZHA 2YHIB 4KMSA 4Q39A 4R5MA 3ROMA 3OQ6A 2VCYA 3RBZA 2GR9A 1NBOA 4RPGA 5HWSA 5JCXA 5I7VA 4EZBA 4LW8A 3JSAA 3MWEB 2NSDA 3CZRA 1HDRA 3C3XA 3I9KA 3JYLA 4P22A 4B8ZA 4MIOA 3WWYA 1C0PA 3HDQA 1DHTA 2J6IA 3BTUA 1SC6A 2GNAA 1DRWA 3LC2O 4ALLA 5A4DA 1CETA 5C7OO 1E7SA 4IZIA 3KEQA 2FMUA 3F1LA 3U0BA 1VKNA 4Y6RA 1L7EA 3T7CA 1QORA 4NBUA 3L6DA 4NU5A 3M6IA 2Y1OA 1GCOA 3MJSA 3F4BA 1N1EA 4CMHA 5ILOA 4R41A 2H63A 3U62A 3B20A 4JBHA 3D7LA 4WEOA 3D5TA 4HNGA 4DRYA 4PN3A 4YAEA 1P44A 1PL7A 4UULA 1ZNQO 4XRGA 1YL5A 3PQDA 5G0WA 2B4QA 4TWRA 1BXZA 4QX6A 4UVGA 4BO0A 3DZIA 4U7WA 1PR3A 3OA2A 4M87A 3TRIA 3ZWCA 1X15A 2ZJ0A 3OQ1A 4GWKA 2E82A 2G1UA 5TX7A 5ES3A 1HTBA 4FPXA 1HDCA 1YB1A 3Q2KA 4IJVA 3RI3A 5MDHA 4F6CA 1YBAA 3C8MA 1A4IA 5KWEA 4BGVA 1PJCA 5DZSA 5I8WA 2IZ1A 4QEDA 2Y1DA 3PVZA 5THKA 4JIGA 4RVHA 3NRCA 1R0SA 3A06A 2OORA 4YT8A 2TMDA 4IDFA 2P9CA 8LDHA 3ANNA 4J9VA 4BV9A 3SEFA 4EI2A 3WYEA 3H3JA 4MIYA 4PLWA 5JXWA 2NU6A 2J5QA 1WPQA 1XYGA 4XCVA 3AI3A 3GT0A 5KVCA 5BSFA 2I9PA 3H7AA 1H6DA 4YWJA 4CLHA 4GSLA 4RVDA 5L3ZA 1DC4A 1MLDA 3GK3A 1EEHA 1E5LA 1GQ2A 4B4UA 3HDYA 4M54A 4PFJA 3GPIA 3SBOA 2V6FA 3JQFC 3UCFA 1WMBA 2I67A 3CXRA 3CSDA 1Y8QA 4H3VA 4NFSA 3NYWA 6ADHA 1LSSA 3ETGA 4IPTA 5BQFA 4XB2A 1J5PA 4WE3A 3JQAA 1WDKA 2AW5A 2WE8A 1N2SA 1UAYA 1QYCA 3BMNA 3PYLA 3BMCA 3BYZA 4KDEA 2P68A 2WWRA 3KYDA 4RF4A 4E5NA 3TFOA 2HJRA 4CMKA 3JQFA 3A28A 4GL4A 1DDOA 3P19A 5GY7A 3DQPA 5T67A 4PG7A 2QRLA 2C54A 4CMAA 1HEUA 2DKNA 1GU7A 2JCYA 2CSUA 4RV9A 4LSMA 2R00C 4R51A 1Q0LA 4DBZA 1N8KA 5C5IA 1PS9A 2I66A 1ZKMA 2C7GA 2OUIA 2QYSA 5F1PA 3EK2A 4MP8A 1M6HA 5EPOA 3OP4A 3RKRA 3LLSA 2ZYGA 4CM4B 1BVUA 2O2YA 2DUWA 1M75A 1GCUA 1XLTA 1YDWA 2FR8A 3AM5A 2EGGA 3LC7O 4RVSA 4E33A 4IQ8A 2NU8A 4MP3A 4GMFA 1GQQA 1I8TA 2BGKA 1LDNA 1BDMA 5JDCA 3M2TA 4YJGA 2ZK7A 1PEDA 1KYQA 5K0ZA 3SJUA 4OH1A 1VL8A 3A9WA 3UF0A 1OOEA 2A35A 1K6XA 3UH1A 3JTMA 4HFNA 3C24A 1I3MA 1LRLA 3BMCB 4DQUA 2P4HX 2DU8A 3E9MA 3GRPA 4D3FA 3WQSB 1KEPA 3F3SA 2WJPA 3GRKA 1SB9A 5KJCA 2CFCA 1P1KA 4L4XA 2FN7A 4RLHA 3FBGA 3H9EO 1YQXA 3Q2IA 2P2SA 4TSKA 4AFNA 3JV7A 1SB8A 4HKTA 1S7CA 3PHIA 9LDTA 1Y9AA 2DFDA 1C1DA 1DIHA 1AGNA 2IYOA 2O7QA 4CPDA 4YJHA 1FK8A 4CM4A 4ALNA 4D3SA 4WCDA 4L74A 2B4TO 3EW7A 4J6FA 3GMSA 4R3WA 4WJZA 3GVIA 3ZHBA 4DUPA 2QRJA 3PEFA 4ALIA 4B79A 4NBWA 2AQKA 3GGPA 3H9GA 3UKOA 1YBVA 4LSWA 3F5QA 2Q50A 2QW8A 1NVGA 1VLLA 1XSEA 2GN9A 4M86A 2HMTA 1NX6A 5JSFA 5DDIP 1KY5A 1WDLA 1IL0A 2GZ2A 1YE3A 2ZTVA 3L4SO 5CEEA 1P33A 2B37A 2V65A 4FOOA 3O9ZA 4DLLA 1A72A 2Y0EA 3ONEA 2C5AA 3SC6A 5HRUA 3PYMA 3JYPA 4YJGB 4OL9A 1UXJA 4DYVA 2JAPA 3MOIA 1JDJA 3OICA 4C7KA 3PGXA 5ER6A 2AG8A 3L9WA 1FMCA 4L4RA 1PJ3A 1HYEA 4DIBA 3H9QA 4YRDA 1U1IA 5A9SB 5JC8A 1K0UA 1KIFA 3NEPX 3S8MA 1ZK2A 4BO9A 4BNJA 4PLPA 3MJTA 1VJ1A 2D8AA 4GGOA 1A5ZA 3A4VA 4G65A 3OM9A 5U4QA 4UUOA 3ZWOA 1V9LA 1VJ0A 2LDXA 4R5HA 1HDZA 2J3JA 4XQEA 3AU8A 4L4SA 3JQGB 2E37A 4NBVA 3HDJA 2VYVD 3DMYA 3GEDA 3H2ZA 3FRJA 4LK3A 4J90A 4NK5A 3RU9A 2NV6A 4X54A 4ONEA 1GV1A 4QQRA 4JJGA 3JYOA 4WKGA 2AG5A 2WM3A 1XQ6A 1NASA 3WGYA 5DCYA 3BA1A 1E6UA 3IKTA 5TSDA 4G2NA 4CM3A 2GASA 3D4NA 4NU6A 4U5QA 1Z45A 1XEAA 1BW9A 1NP3A 2D59A 4UREA 2ZTLA 4CMJA 3K2EA 3DFZA 4TZKA 5AXAA 1M66A 1DRVA 1I30A 4BNVA 5CDGA 5GZ6A 4YCAA 2X0RA 1U5CA 4DA9A 2HRBA 3AJRA 1HT0A 1D3AA 2FPPA 4I5DA 1VSUA 3IOYA 1AHIA 1L7DA 3MJEA 3S1LA 5G0UA 1I32A 2V7PA 4DIFA 5L7TA 4BNZA 3PWKA 5TS3A 1ENOA 1ADBA 3R0IA 4FW8A 3TFQA 3WMXA 3GNTA 4FFRA 1I5RA 1GV0A 4GX0A 3EVTA 5T8KA 3KXDA 4EUHA 4HXYA 5FF9A 1QP8A 1YB4A 1ZEMA 3ENKA 4N5NA 4RF5A 3L0DA 1K2WA 1SOWA 4PZEA 5G0SA 4Y9DA 4BHTA 2PGDA 1EBFA 5COQA 4EUFA 3P2OA 3R3JA 3FCOA 2OMEA 3V2HA 4B3IA 2YUTA 1I33A 1U3UA 3B6ZA 3CIFA 3K9QO 1RWBA 3ZCXA 3AK4A 3DC2A 1MV8A 3BAZA 1XU7A 3WQRA 2PZMA 1MC5A 3QVTA 4J7XA 1X1TA 4FSHA 4E2YA 3LF2A 3WS7A 3LYLA 3OIDA 1GQYA 4U0JA 4L76A 5A3JA 5MGBA 5IN4A 4U6QA 1UJMA 2B36A 2JAHA 3DZHA 4PLYA 1YJQA 2RBEA 5L45A 3V1TC 2CZCA 1JN0A 4IXTA 3EYWA 3WFIA 2PLAA 1B15A 1LJ8A 2VYNA 2PY6A 5G4KA 1DB3A 4BQPA 1GPDG 2RAFA 2UAGA 3RC1A 1IUKA 4NJMA 2ZYDA 1XIVA 4MOWA 2I3AA 4BS9A 4GWGA 3WDSA 4YAGA 4IGFA 5EQDA 4QXMA 1SPXA 4XJTA 2VWGA 3DZGA 4Z0HO 4R3NA 4MVJF 1T4DA 5K6AC 5L95A 3H3FA 4IS3A 1D8AA 1SO8A 1ZK1A 3DHEA 5I7SA 5EERA 4QTZA 3WBBA 4DGSA 4E5MA 1XU9A 2CD9A 1P1RA 2D3TA 4IDDA 4J7UA 7ADHA 4OKIA 3QVOA 1ZIDA 1MG0A 1Q0QA 2E49A 5IZCC 5KJ1A 2Q49A 3MTGA 4YT5A 2PD3A 3HJAA 3HN2A 4E2ZA 3AU9A 4CM6A 4XGKA 4R1TA 3OQBA 4XQ9A 1MFPA 2VT3A 1J6UA 4B4WA 4H15A 1O5IA 1V3UA 3L4BC 4KP7A 4MVJI 3VDQA 4B7CA 3RFVA 1QYVA 4B8WA 4CM1A 2HLPA 3LDHA 4NDNE 1EVJA 1I36A 3E9NA 3FSRA 5IFLA 2BLLA 3DO5A 4LVCA 1YL6A 5A03A 2HSDA 4YXFA 1DAOA 1ML3A 1UP6A 2AE1A 5TF4A 3ZWPA 1Y6JA 3M1AA 4R54A 3ZWNA 4ALJA 3OJOA 4N54A 2GYYA 1ZSVA 4H16A 4BQRA 2EW8A 4DQXA 2Y1FA 2VZ8A 4IDBA 4OXYA 4EW6A 2PZJA 2X5OA 3Q9NA 1LSJA 2A4KA 4R9RA 1YBMA 2QRKA 4GQAA 2NWQA 1HLDA 2EHDA 1JKIA 4DLBA 3IMFA 3ON5A 4IUYA 2C2XA 4P4GA 1TB4A 1U8FO 3HN7A 3IKVA 1Z74A 2C2YA 1GADO 2PKRA 4JBGA 2BFPA 2OO5A 3QWFA 4N7RA 2Q2VA 1CQIA 5ENDA 2BD0A 1PJQA 4BNMA 2W8ZA 5F1OA 1O0SA 5A3VA 3JQ8B 4RGBA 4CV2A 2Y99A 4Z9XA 3GUYA 3DBRA 4XQGA 5CEJA 2NACA 4IINA 5A1TA 1HZJA 3KLPX 1U8XX 2C0CA 4RDIA 1ZJYA 2F00A 2VHYA 4MINA 1W4ZA 4BOYA 3PQFA 1JWBB 2BFOA 3BIOA 1YB5A 5L9AA 4CQMD 3G17A 3PIDA 4GVXA 1E3JA 1T2EA 1KVQA 3ZU3A 4AJJA 1ONOA 5L51A 2PR2A 4EGFA 1YGYA 1WVGA 2GSDA 4JCOA 1BMDA 1PQUA 1YJ8A 4BNGA 4PLFA 2X1HA 3HZZA 3T7EA 3FNHA 2DC1A 2VNAA 2FZEA 2GF2A 3ROQA 1GYPA 3DWFA 3JQ9C 5B4UA 3JQ7A 1QV6A 4QT0A 3ZV6A 2PH3A 2Y68A 4CLDA 1FDSA 5IJZA 2A94A 3ONDA 2XF8A 4W9NC 3H2SA 2PFGA 4YA6A 2ZCVA 2OP1A 3EVNA 4E5PA 1NFQA 3IL2A 3BMQB 4BNKA 1O8CA 4BO3A 1YQDA 2HKIA 4AG3A 1H6CA 2VZ0A 1O94A 1MGOA 2ILTA 4Y98A 3H9UA 2XOXA 3UICA 3MCVA 4B4VA 1I3KA 3QWHA 3TNLA 5KNLA 3FPCA 4C7JA 3DB2A 4CJXA 1SZJG 5ITWA 1SBYA 1LDGA 2W2LA 2YYYA 1U2DA 3QY9A 4DTIA 4XGIA 2VOJA 2D4AA 2HMSA 3C1OA 3C7CB 4D45A 1AXEA 5IF3A 4J2OA 5A5EA 3JD2A 3X2FA 4O1MA 3K30A 1LLQA 1QYXA 2QZ9A 3BZUA 1SMKA 5KKAA 3EGOA 1W8DA 4IJUA 3GPDG 1YRLA 3GN1A 4W82A 3VHRA 3JD0A 2D1YA 2D5CA 1KVUA 4XB1A 5JYDA 1M6WA 1NAIA 4W99A 2VQ3A 4AJ2A 4E31A 1C1DB 2UDPA 4WLFA 1ZO8A 3OJ0A 2FSSA 5DBGA 1ZK3A 5GMOA 2DPGA 3RKUA 3G49A 3TZCA 4WGGA 4I08A 3CUKA 2HK8A 3WMWA 3ZHZA 1ONPA 2X9VA 3U49A 4ROSA 3DBHB 1ID1A 1R16A 1VE9A 3U4IA 4MKXA 4E3ZA 1UDAA 1WWKA 4F3YA 4HWKA 1VM6A 3KO8A 1ZUD1 3ZNNA 3D64A 5ITVA 4FOSA 2WEKA 2BGLA 2Z95A 3ZWVA 3RUCA 1MG5A 5T57A 3OJEA 1U9JA 1Y8RB 1A9ZA 2CDAA 5I7EA 5C7LO 2A9FA 3KSUA 3VOSA 3TZQA 1UP4A 3F47A 4ZGWA 4JROA 1B26A 1YO6A 2DBQA 3KM0A 3KYDB 5A02A 4NFHA 3VPFA 4BO8A 4NQZA 1E3WB 3DTYA 3I23A 1Q7CA 1SNYA 2O50A 1B2LA 3E6AA 2GD1O 4PCVA 2X58A 2YFQA 4MVJA 4D7AA 1BWSA 4NI5A 2AEJA 4RPLA 4XA8A 2X6TA 2VN8A 4TVOA 1LU9A 1BXGA 1R4MB 3PFFA 4MKRA 4BKUA 1OC4A 4I5GA 5JY1A 4PLGA 3WNVA 4D41A 1BG6A 3ZHYA 4RO0A 1BDBA 4YJHB 5LC1A 1Z75A 1ORRA 3U4HA 4URFA 1UXHA 2DBRA 1PJ2A 3UXYA 2C59A 2UUPA 4LRTB 5JCJD 3DAFA 3NT5A 4WECA 1U5AA 4XKJA 5AQ1A 3EY4A 3ULKA 5COAA 1BHSA 3DMTC 1EE2A 3JQDA 3O8QB 4JP2A 1IYZA 1QR6A 3BXXA 4CV3A 3PJDA 1HSZA 1EQUA 1E7MA 1YOVB 2JHGA 1RPNA 4BO5A 1F0YA 5JPIA 1Y7TA 1Q2XA 3X2EA 4OKNA 4L0QA 3JQ7B 5A5FA 3MJVA 4ZQFA 5CEFA 4IY1A 2G76A 5IDYA 2HAEA 5BNIA 2G82A 3GZNB 4Q3DA 3BHIA 3DFUA 1U4SA 3FWZA 1RM4A 1X0VA 4GH5A 2QQ5A 4AJPA 1PJSA 5A9SA 1LXCA 1XWFA 2NVUA 4QFCA 1I2ZA 3RU7A 4ZU3A 3MJCA 2BHLA 3KYCA 1MC4A 1DPGA 1V3VA 3VPSA 1M76A 2DUUA 3ANMA 4U0KA 3FPLA 2VTDA 3PQEA 2WDZA 4JLWA 4Z9FA 4D79A 3TF5A 1AE1A 1ZCJA 3I52A 2I99A 4BV8A 3EAGA 2PWZA 4UUPA 1W0CA 4EITA 3PHGA 3V8BA 1OI7A 3JQ9A 4CQLA 1CQJA 1E5QA 1RM3A 3JQGA 3O8QA 2X22A 2GDZA 3RC7A 3RWBA 3ETEA 4G5HA 4M55A 4QSMA 4ZRMA 1PSDA 2IYPA 3IJRA 3INRA 1F8FA 4ND2A 4PLHA 3ZU2A 3V2GA 1DBVO 4NMHA 2PD4A 3VH2A 1UZMA 4DC0A 1JVSA 1A9YA 1GEGA 1GAEO 1NVTA 4GI2A 3KHUA 3WLEA 1GY8A 3B1KA 3AY3A 1PS8A 3NX4A 1QLHA 3LK7A 3H65A 5U9CA 4CUKA 4YRAA 3LF1A 2H6EA 3AW9A 1ISGA 4BGUA 2PGLA 4OSPA 4YDRA 4FFLA 5K6AA 1H2HA 3D1LA 3HQ4O 2AEMA 3BTOA 4Z3DA 1Z73A 5LDHA 1LSOA 2NU9A 4A27A 1B16A 1T1RA 2VUTA 2GPTA 1LQTA 5AXDA 1IE3A 4RZHA 5A06A 1H2BA 1Y81A 2JFGA 1HZZA 4I8XA 1NR7A 3IIEA 3I6QA 4D44A 3UUWA 2RH8A 3LQFA 3W6ZA 2VHWA 2VHZA 1BXGB 2HMUA 3EZYA 1ZMOA 3W4IA 4RCVA 4YAJA 1CERA 1GZ3A 5KVQA 1K6JA 3CKYA 3OSUA 1JAXA 5T6BA 5AXCA 2QZZA 1V8BA 4CR8A 1SOVA 1E1LA 2QIOA 1ISJA 2WD7A 5L4LA 2CF5A 4CMBA 5A04A 4GX2A 3I9LA 2X5JO 1UXIA 4U8GA 4D3DA 2B5VA 3QJ5A 4R01A 3RJ9A 3KBOA 3VZSA 3PDJA 1LDBA 4I5FA 4WLUA 4FC7A 3QE3A 3PWZA 3KTDA 4CMGA 4CM8A 3PZBA 3L9XA 4XDYA 2V6BA 3DONA 5TGDA 2VRBA 1PGJA 1TXGA 2HJSA 3H8VA 3NKLA 5CG1A 3I5MA 5DCWA 3JQ6A 3G3EA 4G81A 2YQ4A 3VH4A 2J3HA 3OIGA 3ZDFA 3RJ5A 4CMCA 4KUGA 5TIIA 5H83A 2C20A 5KCZA 2QHXA 4OQYA 1EUCA 1DEHA 1EZ4A 4GKBA 3FHLA 5JAIA 1NWHA 1V3TA 2W90A 1D4FA 3VH3A 1BSVA 3WJAA 4B3HA 5L4SA 1XCBA 2Y66A 3BTVA 4BMSA 4E21A 1N9GB 1GYQA 4Z6KA 1G0OA 2H5LA 2QG4A 3KYCB 1DAPA 1E3IA 4UEKA 3O26A 4CL3A 2OXIA 3VTZA 1VRWA 2AHRA 2HRZA 2JCXA 3NAQA 4FFNA 5IXYA 5JYEA 5JC1A 5G0VA 3GZ4A 3F4LA 3WGHA 3CE6A 1NHWA 5H82A 5KIAA 1R4NA 2JL1A 1C3VA 5FI3A 3VZRA 3WNQA 1VJTA 1YVEI 4FBGA 5DULA 3L4BA 3P2YA 2VRCA 4IM7A 1I2CA 5DBFA 3AOGA 3WGQA 3RASA 4RORA 2X4GA 4XYEA 3Q11A 3DMTA 2VWHA 3QHAA 3DL2A 2DTDA 1N1GA 2GN4A 4DIOA 3TJRA 5EL0A 2AQIA 3L77A 4LCEA 4W7IA 3DOJA 2WMDA 4R4JA 4KOAA 4CQLB 1YKFA 3HHPA 4FIZA 4NFYA 4HY3A 5ICSA 3WTBA 4RPJA 1GUZA 1GDHA 2Q4EA 3KZVA 4XRRA 3GA0A 2Y0CA 7MDHA 4XQCA 3ZI0A 3QSGA 1E1NA 3M1LA 2X7HA 3QWAA 4YR9A 2GCGA 4WNIA 4Z3KA 4XR4A 1PZGA 1U2GA 3OJFA 1U3TA 3Q0EA 1K89A 3LC1O 2NM0A 3MJ4A 3ICCA 5F5LA 4Q3NA 5JCJA 4K26A 4JXKA 1DOHA 3KOUA 3EDMA 4RLSA 5GZ3A 1E3EA 4DYDA 1U4OA 2WYVA 3ASVA 4UAGA 2BH9A 2ZB4A 3IC5A 4DMMA 3ZWXA 4ILKA 3K31A 5G4KB 2IE0A 2C07A 4K28A 4HV4A 3WSWA 2WTBA 3JQAD 5DP1A 4RF2A 3LLVA 4RPKA 4WLVA 4OOFA 1GUFA 2Q2QA 4PGFA 3DAPA 4ZQBA 4GVLA 4BNLA 3H4VA 5CDSA 2PK3A 3ZGYA 4CM8B 2FSVA 1XG5A 2Q1UA 2PKQO 4O0LA 3S55A 3S2EA 3GF4A 3I6IA 1VI2A 1Y1PA 4FC6A 1YL7A 1OFGA 1VL6A 1BVRA 3ZW9A 4IDEA 4W9NA 4DWVA 2P4QA 1H9AA 4FN4A 3GVCA 3AWDA 3VZQA 3WB9A 2EW2A 4E2XA 4MVJH 3NGLA 4CLRB 4XX0A 2XAAA 3JYQA 2O3QA 3GHYA 3JD4A 4FGSA 1B0AA 2Z1MA 1I3LA 2W2KB 4BNUA 4KDFA 1HDOA 3STHA 4O63O 3PHLA 1EVZA 3P7MA 1IPEA 1F14A 1DIGA 1QYDA 1RM0A 3F46A 1O95A 2YHIA 4MVJD 1NFRA 4HUJA 1IHYA 1GUYA 2NQ8A 4ALKA 1WDMA 4CQMA 5DOZA 1LRKA 4UEJA 3B70A 4DXHA 3FNFA 1DIRA 2PKQP 2YJZA 3PTZA 4IQGA 3DBLB 2HO5A 3WGGA 1F17A 2B35A 4PG8A 2CF6A 3GG2A 2IRWA 3ADPA 4HFRA 4ZQHA 1N9GA 1IOLA 5TC4A 4J3FA 1UUFA 2DPHA 5G2OA 4PIVA 3VPGA 3INTA 4LCJA 3ZV4A 1NTOA 3R3SA 3C85A 3WGIA 1EDOA 1XR3A 4OSOA 1JLLA 1XA0A 1FDUA 4Q3CA 2GZ1A 1B7GO 4S1VA 3GG9A 5FEUA 1E6WA 5AYVA 2XXBA 2CNBA 4J49A 1KY4A 5JE8A 1ADCA 1G0NA 2JD2A 1KEUA 3RBXA 2JCVA 2Q45A 1WXDA 1C14A 3PHHA 5K9ZA 4YT2A 5KVSA 3OFSA 3SVTA 2DVMA 2I5PO 4B4OA 2OGUA 1HYGA 2GN8A 1T2CA 2E6UX 3HE3A 3QRWA 2X0NA 1QLJA 2PV7A 3HWRA 3R6DA 5JAMA 2ZIZA 2X9GA 3IUSA 5HBRA 2OFPA 1FDVA 2J5KA 4KQWA 3MEQA 1PWZA 4GGPA 5F21A 4BNIA 4GX5A 4M49A 1NAHA 1G6KA 4HFJA 4Z0PA 4CM7A 3F6YA 1R15A 3E18A 3K96A 2QYTA 3NTOA 3SLGA 1OMOA 3AOEC 3AUTA 2EIHA 3QVSA 4NG5A 3RUIA 1ADFA 4MVJP 3E9QA 1T4BA 2ZB3A 4DREA 4OO3A 3BMQA 2GN6A 5BSGA 1DRUA 4Q3EA 4UVHA 5DNAA 2DBVO 5HS6A 1FF9A 3ZU5A 5L40A 1DSSG 3GDGA 2FZWA 3PIIA 4R1SA 3ZZNA 4E5YA 2Q2WA 2YV1A 4HNHA 4TRMA 1P0FA 3ITKA 2VWPA 4B3JA 3ONFA 4D42A 1QSGA 3LT1A 1BTOA 1ZBQA 3DHYA 3QW2A 1PL6A 4PRLA 2HMVA 5G0TA 5A9TA 4J7CA 3K8ZA 1A7AA 1EE9A 1R66A 4IGEA 4HBGA 2O4CA 3QWIA 2AEFA 4E32A 4WEQA 2W2LD 3DOOA 4MVJG 4Q3AA 3AI1A 4TVBA 2IDZA 1GZ4A 4NBTA 2G5CA 4BB5A 1MFZA 4GMGA 2W98A 1ZJZA 3DTTA 3C1AA 3OEYA 2ZJ1A 1H6AA 1UAGA 4IS2A 4KWIA 1O6ZA 4BNYA 1NPDA 5B4TA 3S2FA 2EF1A 1NFFA 1DJNA 1P9LA 3TWOA 1E7QA 1TT5A 4D43A 4XIYA 3MWDB 3D4PA 5IN5A 3WGZA 2EJWA 4JQCA 4Z9YA 4B7UA 1ZSNA 3ZU4A 4YJFB 2RCYA 4RPHA 4AVYA 4CV1A 3WOHA 4ZHSA 2X23A 3RD5A 3TZ6A 3L07A 4A2CA 3TDKA 4A5OA 5JFOA 3LT0A 2B4RO 2HK7A 2NVBA 3KUXA 3DZFA 2B69A 1H0KA 4JJFA 2FRDA 4IMRA 2POQX 1OZAA 3DBRB 4J43A 4CQMB 3WIEA 3FNEA 2OZPA 1AXGA 3UGKA 4BIIA 3NT4A 1JA9A 2WD8A 4NHEA 1IHXA 4FD3A 4IJWA 3AOEA 5KVVA 4UUMA 4M8SA 4BGEA 3T4XA 2O23A 5I9NA 5B4VA 1I01A 4J4TA 3GVPA 1EVYA 4FDAA 3TL2A 1E92A 2BF7A 4DPKA 5ER9A 2JFHA 1ZZEA 4NBRA 3JD3A 1PGOA 1E3SA 1Y5RA 2Q99A 2EV9A 1R4MA 3BHMA 2AA3A 2ZB7A 3PGJA 4R68A 5CDUA 3L6OO 3JCZA 3VTFA 4OQZA 4ZVVA 3AUUA 2J8ZA 5DN9A 5F1KA 4CMIB 1CWUA 1XKQA 5JO0A 4BNXA 2XPCA 1ZXLA 2Z5LA 3D3EA 1YDEA 3GLQA 4OOEA 1GEEA 1U3WA 2Y93A 1I2BA 3GVXA 4XDZA 3ZNPA 4WK6A 4A03A 1Z7EA 2YDYA 4WCFB 3RC2A 1P77A 4N5MA 1JU9A 4A26A 3QQPA 2EP7A 1C1XA 2P5UA 1J49A 3SLKA 5L7YA 1PJBA 1X14A 3TPCA 1JTVA 5LDGA 2ZQYA 1R6DA 4YT4A 1LEHA 1XDWA 3KRTA 4I1IA 3COSA 4GLOA 3DDNA 3RQSA 3IJPA 4MKZA 4PLZA 4J2HA 5KJFA 4A10A 1CJCA 1WAMA 3PZRA 4GLLA 2FOIA 1FDWA 1LC3A 4CMEC 1NQTA 3NUGA 3OEWA 4ZA2A 4MP6A 4TROA 4QFDA 2NNLD 2J5RA 3GC6A 1QRRA 4I9HA 1Q7BA 3GDOA 1WNTA 3ZHXA 3QIVA 4J16A 4ZQGA 3W8EA 4MVJM 3VAZA 4AJEA 2TMGA 3ZN2A 1BGVA 3Q1LA 2NTVA 1NNUA 4RVGA 2Q1WA 1ZK0A 1MB4A 5TT0A 1EVIA 4K1LA 3PHJA 4YACA 5FFFA 4Y6PA 3WR5A 1BW9B 1ENPA 5CHEA 1KETA 1QV7A 3DZJA 4DVJA 1KC3A 3QWBA 4Y6SA 2RHCA 3BMOA 2WYUA 3G0OA 4PZDA 3W8DA 1JW9B 3GAFA 1ZEJA 4EJ6A 3K5PA 3FTNA 3PDUA 4RQUA 3EZLA 3VKVA 1UZNA 1LSUA 3E5MA 1NR1A 1SEVA 4N5LA 4UVDA 1C0KA 3A14A 3TZKA 4DBVO 3FBTA 1DFIA 4D0RA 4CM9A 2NQTA 2I76A 1ISIA 4ESOA 4OJNA 4E13A 4B7XA 1R4NB 3JQBC 4IBOA 1T25A 3AFNA 1TT5B 2ZTMA 4R9SA 1WZIA 2WYWA 4Q3BA 4YQYA 4A7PA 4CR7A 4NJOA 3QVXA 4NR0A 3U5TA 4XJSA 3WQQA 2HK9A 2EGHA 1YWGO 3SX2A 3GEMA 4MO2A 2UVDA 5H81A 1PTJA 2OBNA 3WYCA 1DIAA 4ZQEA 4BUCA 2O3RA 2F1KA 4J4BA 5COBA 1E77A 2EERA 1P31A 3FN4A 4ZICA 1RKXA 3G79A 1A7KA 4ND1A 1NYTA 5I8ZA 3G1TA 1PL8A 3I4CA 4S3MA 1CDOA 3E03A 2NTJA 3I9JA 3M2PA 4KQXA 1ZK4A 4TRNA 4XGNA 4N18A 2HCTA 2W4QA 1NPTO 3C7DB 2J3KA 3W4JA 4AJKA 1AUPA 3ZW8A 4BNWA 2RHRA 4BO4A 1DC5A 1NQAO 1DLIA 1P1IA 1MA0A 1NM5A 4IDCA 3FNGA 5IG2A 1HE3A 3GUCA 4C4OA 1B3RA 3WLFA 4RZIA 3PRJA 5TT1A 1UZLA 4FS3A 3RFXA 1LQUA 3GGGA 4HP8A 1KC1A 5CG2A 1GYRA 3U3XA 3VPHA 1RYDA 1JAYA 1AN9A 2NUAA 4OXKA 5F3RA 2EKLA 4YB8A 1EFKA 4FFMA 2FY8A 3VDRA 1X7DA 2JD1A 3GDFA 5HS4A 4DLAA 3GEGA 4NJMB 2G17A 3N74A 1Q7GA 2O7SA 2BI8A 4LN1A 3RIHA 5CFZA 5C7IO 4DPMA 1KVTA 5DF1A 1LNQA 3SJ7A 4FFPA
chains in the Genus database with same CATH superfamily
1N0WA 5FNVF 2E85A 3TSWA 2F3PA 3ZV3A 2CBZA 2DQ4A 3K2BA 1V7PC 1SKQA 3PC4A 3WDKA 4WXRA 4UTRA 1EU1A 1EP3B 4G09A 4MYCA 4N3NA 3RFUA 3FD8A 3PEWA 3IQGX 4LC1A 3MC1A 1ZH4A 1VGRA 3KSDO 1CYDA 1B8UA 3W3ZB 2VTBA 4ID3A 5AW5A 3ICPA 3E4DA 2R65A 4NVRA 4Z8XA 4JJ7A 1DBIA 1F2DA 4J4HA 1K8QA 2W0MA 3HJGA 4LNUA 3P9QA 3UAGA 3I6ZA 10MHA 4BGIA 2BONA 3H5RA 3N05A 2IHUA 4WIAA 4JHXA 2X8LA 4A8JB 3RFTA 2JG3A 1T5TA 1ATZA 3F6BX 3HVIA 2AE2A 2VKTA 3MRTA 3QTBA 2X0FA 2QJOA 3W8NA 3WL4A 2PTGA 3HU3A 2C4WA 5EMKA 3D3WB 2ZJFA 4OXNA 5IX8A 2DPYA 1GZ6A 3R5FA 4N39A 3RYFB 4E5VA 1L3BA 2PUWA 2V45A 2Y76A 3L0BA 4LGCA 5AUNB 5BVHA 1E2MA 3ENVA 4NS1A 4QDZA 1Z63A 1X94A 3ADOA 3QYPA 4BLTA 1LS1A 2ZRKA 4G25A 4X7BA 2EJTA 2RG7A 5ERYA 4FTWA 4EFNA 4QUDA 5IT4A 1TIKA 1JSLA 4EHBA 5AOBA 4O3MA 4RD3A 3K5WA 2JJQA 1AVTA 4BE4A 3G8CA 2V4MA 4NBKA 4R16A 1TAQA 4X8HA 4M89A 3WWZA 2ICAA 4TYQA 4U7TB 2I3GA 1AK2A 1CEQA 2ZIXB 2PJUA 1WB6A 2Q1YA 2QZPA 3THRA 2XSZD 4RWZA 3ZK7A 2AMJA 3D9QX 4LRSB 1XRPA 4OBWA 4C4TA 4N76A 3T0FA 2AK2A 1F2UA 3FSEA 4LWZA 4WFJA 1G3IA 4YNBA 3U13A 2Y6UA 3LBNA 1NVMB 2GZ3A 1VSTA 3OH8A 4YUWA 3B9RA 2ZYTX 1N2EA 3O93A 4MCHA 2QLJA 4Q1VA 2EWMA 4MCIA 3RREA 1DUIA 5DLEA 3SSMA 4CKCA 4K0KB 5D5HA 2E1RA 9LDBA 2EJCA 3D6HA 4Z7OB 1P1CA 2AFRA 4XEHA 4P3PA 1A04A 1W49A 1MO2A 2EHJA 5REQA 2QTVB 3Q8WA 5IAEA 3A05A 2VPXA 1QAQA 1V1RB 3E2PA 4H7PA 4RLQA 3RYIB 3UB4A 3RTCA 5CAEA 1WP4A 1QS0A 1SVOA 2KE5A 4ACAA 1HLPA 5JXIA 3U7FB 4RA9A 1P1JA 3G2MA 1OHHA 4WQMA 4HWPA 4JN6B 2CFSA 3PXUA 4OG2A 4Q05A 3DMPA 5TQ0A 4CM9D 1GRRA 2JFXA 2J4DA 4EHKA 2Z43A 1DQZA 4IOJA 1PW5A 2QUKA 3PQ3A 3B38A 3W6UA 3T4EA 3J7TA 3QX3A 4MXDA 1N5MA 1NXWA 4UNIA 5T64A 3B53X 3GOHA 4FW9A 4YQFA 2BEKA 3EGXA 3PXGA 1ZR4A 4JP8A 1ZN8A 1EUYA 1Q0TA 2Y4NA 4CEJB 1R50A 3GD7A 5B6PA 3EPJA 3DT9A 2IZZA 3L7IA 4D4IA 5AXBA 1N8TA 3KKPA 3K53A 1QGUB 4R1QA 1AN0A 1W93A 4DKXA 1Y6RA 1COWA 1L5RA 1TMYA 2QNRA 1F6DA 3K15A 3SFTA 9ABPA 4O4HA 3I04M 5CCDA 2M98A 3HBNA 3ZWQA 2CWWA 4D46A 4B3JA 2GXQA 2H4XA 1TVEA 2HQ1A 4XZ3A 2VXYA 1B6GA 4YRLA 1DJQA 3FDFA 1XD8A 4ZC1A 1IC6A 2X14A 1SJ9A 2F9FA 1QH1B 2BELA 3FF1A 1XJQA 4O4JF 3UC9A 4PYQA 2O8DA 2HPZA 5EUBA 3WGTA 4L08A 2LBPA 2JLCA 4H6WA 4DLYA 3TZBA 3GLIB 3A6FA 3QHQA 2VRCD 4C6TA 5FPSA 1X1DA 2PKYX 4HXEB 1W4AA 3IFSA 3VO2A 4CU5A 4CKEA 1OBHA 3FYUA 4UBNA 1OKKA 4LDAA 4OA8A 3IE2A 4Z0TA 1BRMA 1FYFA 2GO1A 1GFSA 1FSSA 3JARA 4TWJA 4WNYA 1YUMA 4FONA 5KX5A 2WTEA 3EVCA 5FUBA 2Q46A 2VNHA 2C82A 3ZNQA 4E4RA 3FI0A 1EP9A 1KOFA 1NSFA 1KWGA 1X7YB 3OCJA 1Q7RA 4KXWA 5EKSA 4LHWA 5CYPA 1TA4A 2FDRA 5LOVF 3F5DA 4BMVA 1NY5A 2PNFA 1M2KA 4KQ9A 5CNJA 4Z4EA 3U17A 3LRPA 3NDJA 4YFYA 2WD9A 3BWCA 1NG1A 4GMDA 2R6GA 4HPJB 4KTTE 1JIUA 3E7FA 3KK0A 1VHQA 4G63A 3ZWMA 2B6HA 4WDQA 1SBTA 4C2BA 1DIBA 1HV8A 5JSHA 4O3FA 1HGXA 1U5BA 1WV0A 2O3UA 5JBIA 2WVGA 1Y8RA 4LWPA 2ODAA 5G4LA 2IUEA 4BB6A 3CWQA 4YDHB 3RVBA 3AEUB 3G68A 2QD3A 1Q11A 4IDGA 4PZLA 1QG4A 1VJGA 2PMCA 2J0EA 3LSYA 4Q3OA 5CVJA 1KDRA 3AF6A 3CPSA 1N2HA 5KBYA 2PS1A 2EAUA 1IHUA 2QL7A 2E2WA 4DLVA 1RYNA 2ZAOA 3T3OA 1XJ0A 2FZVA 2PANA 2XNCA 3B2NA 4GOLD 3EXEA 4XYMA 3UB3A 4EDFA 1M8PA 3G2KA 3UJ8A 3WE7A 3K9WA 4EI8A 1HKUA 4W1QA 1OWMA 3WGJA 4DW8A 2BFMA 5T5QA 4YCLA 1N6PA 4M9ZA 1GKLA 1Y48E 4U6SA 3S2UA 2FJPA 4FWTA 2FPMA 3QV1A 1XA3A 4X3OA 2HD4A 3THOA 5KJ6A 4BEVA 1GG5A 1BFDA 2FRVA 4RAOA 3TW0A 1RPTA 2R1UA 4F2PA 4XWYA 1UEIA 2P78A 3BT7A 4AJ4A 3E7DA 1FFWA 4FHEA 3CXUA 5ALVA 4DCUA 3GFTA 3KV3O 1SUBA 4LRWA 2LRHA 5K8UA 1IQUA 4C29A 4LZPA 2Q5QA 1PGNA 1Z12A 4V03A 5KYNA 2D06A 5AJXA 4FYKA 1JSRA 4GICA 4HQLA 1SCJA 4R2IA 2ZQZA 3N8DA 4H4DA 4NV0A 1N5KA 2GBIA 2VA9A 1GLGA 5BO5A 3V48A 4ARSA 4HEJA 3ZIAA 4AJ1A 4EHDA 3HV2A 3ZQKA 2BI7A 1QM5A 2HBYA 2H9IA 4HAZA 1ZOOA 1YRAA 1QRTA 3R5SA 4GO1A 1N6RA 4OMUA 5BV2P 4BRZA 4BWGA 4EKNB 3H84A 1EK6A 3DNPA 4BUZA 3F67A 3Q8LA 3ZW7A 4J1TA 1JFRA 1ESEA 1EFHA 2FE1A 3OOSA 5FPHA 1OYOA 3MWKA 1OFHA 3NIBA 5YASA 2DTEA 1WLSA 1B14A 1JKXA 4L0DA 3QV2A 4LDRA 2XQGA 4BC0A 4DAOA 3ZVMA 3OTHA 4Y67A 4KUEA 1LI4A 4N9QA 4NRDA 4Z2YA 3VDNB 2FZGA 4G89A 4LXGA 1O0CA 2CV1A 2PWBA 4XIFA 1M74A 1BH6A 3PXEA 3AUAA 1DFHA 1SHLA 3G1UA 2YVKA 5J40A 3AYXB 4TMKA 1BMQA 1RAIA 2QUIA 2ZR7A 2ZS7A 3U4CA 2X1LA 2YCLA 1L5FA 4FYHA 4RHTA 4TWAA 2X2FA 3DBOB 1U3GA 2REQA 1I2AA 4HFMA 5ECGC 4BL5A 3U4QA 3AR5A 1E1KA 4L6IA 3MBIA 1QGZA 2HBRA 5EE5B 1LW7A 1FVFA 3FM9A 3W1VA 4ZJZA 1W59A 1A27A 4E08A 4ITRC 3PUIA 1TEHA 3M8KA 1JHAA 1GZ7A 4L4ZA 1PTJC 5CIQA 3FPSA 1LBSA 1N7HA 1YRQA 5F64A 3NT2A 5CFLA 4FI3C 4IVQA 3DWGA 1LLCA 3Q10A 4W6ZA 2KSQA 4DSOA 1Q20A 4RA6B 3OIFA 3IHKA 3OUTA 1C9YA 1Z07A 1QG6A 5IJ0A 2FK8A 3ROPA 1A2QA 2O8BA 4QECA 3UJNA 5LQUA 8ADHA 3RAFC 5ABPA 2QPOA 3O3NB 4GE0A 5HW0A 1QIHA 2Q5LA 1D03A 2VEOA 1QB8A 4NOKA 1NW3A 3ND5A 2Q3BA 3TJZA 2D0OB 1SCUA 1WBBA 3ROZA 4RFLA 4IDPA 1DC3A 1M6EX 3BSYA 3S7ZA 5ADHA 4XR9A 2WJGA 1J21A 3KLMX 3DUWA 3K0AA 4GZ3A 1UKAA 4KIWA 3VVLA 1JV2B 5JAZA 4AS3A 1NDHA 5JDCC 2K7FA 4OBBA 1KZ4A 2GFIA 5FNVB 1BKYA 2E4WA 3R1IA 4RQTA 1X74A 3DEIA 5JO9A 1DXYA 2H65A 4I1OA 5LP6B 3U7QA 4QA9A 3EYAA 1VBNA 4BLPA 2FGKA 1DTWB 2RGWA 2Q7XA 3HGQA 3VRHA 2ZE7A 4PVDA 4UEOA 4G07A 1PU2A 1VB3A 2ZATA 4Y0AA 2CY0A 2UVQA 3PDIA 4KO4S 1ECFA 4Q34A 4RFSA 3HVRA 1SQGA 4UM8B 1PWXA 5CD9A 7REQB 5JDIC 4IJ6A 2IL1A 3VR2D 2V0CA 1MOSA 1PG5A 3QA9A 4BNTA 2G88A 3CRVA 4CIDA 4ZI7F 4RXUA 2XWQA 3ZY6A 2WJAA 3QEKA 1LFDB 4MB6A 2GNOA 3UXMA 5CBKA 3EFBA 4EI7A 1SWVA 3U2QA 1Y1KE 1EBUA 4JP1A 5ADUS 4OIFA 2IH4A 1J20A 1X9IA 1G1AA 1UMKA 2BMJA 2CN1A 1HF3A 3OESA 1E5VA 4KKVA 1E1RA 1UK7A 4HR7A 1I3OA 5D1NA 5J4YA 3PJEA 2RMKA 4L2IB 3GDWA 4E4YA 1G16A 1YS6A 4XWGA 5LMNB 1FQOA 2JBWA 5DHRA 3FJ1A 4QGGA 2V54A 3CUSA 1PFKA 2YWXA 3CLTD 2H1SA 2GX6A 4ARVA 1WRBA 2GBGA 4HDNB 3ZDBA 4X93A 1L5LA 2CVZA 3E0QA 2IEAA 5E7JA 3V4FA 3AL0C 4IO0A 4BY9E 5DV9A 1A8UA 3IDZA 3VNSA 1H5UA 2ODBA 4MWBA 4E5DA 3W78A 1WMDA 2HJGA 2ZBGA 3ITNA 2Z1DA 4P4NA 4WZAE 3TW8B 3LP6A 2FW0A 3OQPA 5E1BA 1OU0A 2J3MA 4JEUA 5AKKA 3OJLA 1OZGA 2AC4A 4XASA 2Z98A 4I5EA 3LPLA 1XZGA 3M5WA 3W5VA 4ZVOA 1Z7WA 3EF3A 1GCGA 3DYVA 1ADJA 4I2NA 1EP1B 3MD9A 2P6UA 2IEDA 4MGKR 4YJFA 4YMTA 2PX6A 4TM7A 4EPVA 5FHRA 1HFKA 2WSBA 3VQTA 1WB9A 4FBLA 1Z39A 5KJEA 1VYTA 1FP4A 5HIAA 4DDMA 3LPNA 1KJ8A 2JI4A 3LUPA 4MLDA 4Y1GA 8ABPA 1HRDA 1NC3A 2AQHA 3GPLA 4ZTUB 4L9RA 3HKEB 4K9LA 1VHDA 1JZSA 3KVYA 3FLEA 3WWOA 4EHFA 4ZHQA 3PNOA 1O4WA 4LY3A 2OBLA 1XZHA 2V4UA 4GP6A 4F3KA 4RTRA 4JB2A 2O6HA 2XI4A 3G9UA 2HRDA 4RADA 3UHPA 3TOZA 3K6SB 2Q7OE 1VG8A 2PFKA 4TYPA 1SQ5A 3IAEA 3O8LA 1LJLA 1OAOC 2FPIA 4JSRA 2VHVA 5KNBD 2BMVA 4NEGA 1M1ZA 1NJ1A 3UCXA 3ZQJA 1EDZA 4G26A 4G4GA 4B43A 2QG9A 1PFUA 2HF2A 5TPWB 3W0LB 1TW2A 3CC8A 4LYYA 5H4HA 4OK6A 1R1DA 3HWSA 1S1MA 2V3VA 5J58A 3RROA 4FZVA 1MENA 3KR1A 3BDAA 1X9HA 1ZMRA 4G1EB 4WVLA 3WX0A 3WYBA 4BFLA 2D5AA 3QPVA 4FB5A 1PQ4A 3O2JA 4LQ4A 5JZSA 3GGSA 2YDXA 3CURA 2ZWOA 4BYGA 4X71A 3AF1A 1WNFA 5ALGA 4LMRA 4BKRA 4BQOA 1UJ5A 4LNAA 3ZYCA 3JQ8A 5CFRA 3R7SA 1DC6A 2O7NA 1P0CA 3MAAC 5HDQA 2VO1A 1E1YA 1DADA 2IITA 4DJEC 2IZ7A 3L7BA 3HXOA 2FZ4A 2F7SA 4RDHA 2V7WA 1HE2A 3DUFA 3PXBA 2RB5A 4OHCA 3PG5A 2P3LA 3C3DA 1RYFA 1HC7A 2XTNA 4G0NA 1EX9A 1RDFA 4JYPA 4S1WA 5TJHA 2R1TB 1AU9A 2ZWVA 1OXMA 2WSMA 1IZ9A 2QM0A 1NLUA 3A9SA 2J87A 5ES4B 3WXBA 1QFMA 4RHFA 1DT3A 5AM5A 3M34A 1ZCAA 3MUOA 4L75A 4PANA 4QXQA 1E79D 3LX6A 4GPD1 1GAXA 3QVJA 3WTCA 2W0SA 2X4IA 4H1UA 3E2IA 4AJLA 3UATA 4M9XA 4FQ8A 3ABIA 2ID8A 1LPPA 2Q3JA 1ISHA 1OUMA 5DGHA 4PYMA 3T7RA 1KYTA 3RBVA 1YTLA 4F46A 4P4LA 3LQQA 4QOJA 3UAWA 2J3EA 2CXHA 4JGIA 3VI3B 2YMLA 3N07A 4HB3A 4AO6A 1JEOA 2ID7A 2ZUCA 3ASUA 3M83A 3GN2A 2JA1A 2ZB8A 4DIKA 2V1UA 1NIJA 1S8NA 1ZNYA 1KARA 4KBFA 4PVCA 1MEEA 1ICIA 1QGED 1CZLA 1A5TA 1TU3A 2X0KA 2Z2IA 1TZMA 4X84A 5E0OA 4FJ0A 3ZWBA 1Q0HA 2D1SA 4MDFA 2VYQA 1C9EA 2UVPA 3T9AA 3A2KA 2EZUA 4FYJA 3SS9X 1G3UA 3O92A 2DH6A 4MAFA 1Y8QB 3QF7A 4LOLA 5BRNA 2I03A 2QVCA 4FE4A 5C3MA 2VSNA 1U7UA 5EINA 3D4LA 3QXSA 4GPZA 4ENVA 2G80A 4RJ2A 1FTSA 5LZ2A 3ZS9A 5D3MA 1OXUA 1JECA 1UOPA 4MA4A 1YR3A 4ESVA 1NBMA 3PT9A 3EH1A 1YRWA 1P0PA 3SSOA 4JJ6A 4D8XA 3A7DA 5DP2A 1T6BY 3H11B 3HUDA 2GGSA 3NO4A 5EMLA 4DMKA 1W0JD 2HWUA 5IAAA 1XZJA 3TQHA 2FWMX 1QG2A 3N58A 4RKYA 4CMEA 4QUEA 2A30A 1XJCA 1Z5ZA 4E12A 1AX9A 3CSUA 4FGWA 4W7HA 5EN4A 3VR2A 5CLQA 5LXTA 1FCJA 1G18A 1NHGA 1WKBA 4HF7A 4K9KA 3T5DA 2I1VB 2CVFA 3OF5A 4MQEB 4WLNA 1R0LA 2QLBA 2ZBDA 4RLFA 1NVXQ 5HK8A 2WKSA 1HM5A 5LL6P 2IEZA 3F96A 1X38A 3WO0A 5L4NA 3IVXA 3GLFA 4FUQA 3BRCA 3GO4A 2ID9A 3EC7A 3ZE2B 4II2A 1TLTA 1CXZA 1NUHA 2YW2A 3MG9A 4IQ0A 1DINA 4EMSA 3B85A 2WZQA 5DCLA 5DB4A 3E8SA 1E5TA 2VNKA 1RVDA 1IHDA 2ECFA 3HXMA 3ZI4A 1HDGO 2W5UA 2ZYAA 3A1SA 4C2AA 3WHPA 4FYYA 3KE8A 4TYNA 2OAP1 1G5PA 4LFAB 1Z8FA 3I45A 1DP4A 3KKQA 2D1FA 3BTSA 5K0FA 1HQKA 4P35A 1WPXA 4MV0A 1X0XA 1JG1A 1H2RS 3HCDA 3NOVA 1S2IA 1WS6A 1E18A 2EFJA 3ZY4A 2GCIA 4HWSA 2CLDX 4MW1A 3CJTA 2Y1CA 1Y8CA 4PCUA 3H87A 4AXBA 5KS2A 1XEXA 3GZJA 1HT1E 4O08A 1QAMA 4KXMA 1HSOA 5KU1A 1FQKA 1GNVA 1M1YE 4JX9A 3RUEA 4KVAA 3HO8A 2RGAA 4ZCIA 1JNYA 1KEEA 3QOYA 3GJZA 5D3MB 2V6MA 5HRAA 2ZKIA 2RGCA 3L8HA 4YPFA 1SC4A 2IYFA 2OFWA 1IPHA 3K73O 4MUEA 5E1DA 3TNDA 1YH3A 1RLOA 5FXMA 3K70B 1PIWA 4JR2A 1SZPA 2C8JA 4A73A 1XRNA 4DDHA 1XN1A 3DZ8A 2NN3C 2XBLA 5KWVA 4OUDB 4MYHA 1COWD 2JLRA 2FPIB 1QVWA 1DCMA 1U0LA 2FFBA 3GH3A 4D57A 3VMMA 2X9QA 1DO2A 3A6HA 4DWOA 1X80A 1BNCA 1E9SA 1KEWA 3NBMA 4KWTA 3TLAA 4D9JA 4EY5A 3RVLA 3NALA 2ZEJA 5T8KC 1RSZA 5F35A 4MW9A 4UARA 2BTQB 4BWVA 1UZAA 4Y1RA 3GFOA 4CGYA 1FUUA 2EXXA 2P40A 1XDGA 4K40A 3PD1A 2XGJA 5AKYA 1PV4A 1W5SA 3O38A 3OX2A 2QZSA 4RIHA 2FZCA 4FJ2A 5DNUA 5KKCA 1A2BA 3EIHA 5ADVA 4WWHA 4MVJE 1IZ7A 4QDTA 1Z2AA 2IYXA 3M5CA 5BR4A 3KKNA 5C4MA 3EZ2A 1KGDA 3RFFA 4QGSA 1ZVJA 3KG2A 3ODGA 1WTCA 3OQ6A 2JIRA 3P96A 4BX9A 2VPQA 4LXHA 4RPGA 4ZARA 5HWSA 5J2UA 2IH5A 4W8GA 2B1RA 3VR5D 4EZBA 4LW8A 1XVLA 1G5RA 1SHZA 1TUGA 1WE2A 3ESYA 1QVRA 2AN5A 2QAGC 3HS3A 1P75A 3MWEB 5CM9C 3M5DA 3LTNC 1BEEA 3I9KA 4RKFA 4EQZA 1VLHA 2XQFA 3GRUA 4MIOA 4QOFA 3BRQA 1L8OA 1J8DA 1FRFS 2ZRBA 3UPDA 1U0NA 4X3CA 3BTUA 5CIWA 3LC2O 4OP1A 3W06A 4MPPA 5C7OO 1L5HB 1KIMA 1E7SA 2Q9UA 3PPWA 3KEQA 3USCS 1X2EA 2YUIA 1YULA 2NU7B 2ZANA 3F1LA 1NRIA 4OGGA 3SU8A 2JAUA 5B7QA 3S27A 4ER3A 1UFVA 4HMOA 1E2IA 1L7EA 4Y6RA 1VLMA 3BOSA 3M6IA 1YZTA 1GCOA 2HCRA 2WU0A 3PQ4A 4NEQA 4PX2A 1Z5PA 1N1EA 3RS4A 5ILOA 1XDSA 3O74A 1TYEB 2H63A 2R8XA 4AYXA 3GYGA 1OPRA 1VHTA 2C57A 2ESRA 2YIVX 3B20A 3I2YX 4WEOA 2RI1A 3RC8A 2FFAA 4AKTA 4RXTA 5B1DA 4DRYA 2CW5A 5FUQA 4H3HB 4M4SA 4NAHA 2Q41A 1UINA 5HQJA 5KNDH 3UGJA 2B4QA 1P60A 1YR1A 2IBMA 1QO7A 4B6FA 5HF5A 3TRFA 1K3UB 4W8OA 4YV0A 2CXRA 1PR3A 4M87A 1SXIA 4U7WA 3ZDAA 1DOZA 1ZI9A 3LUCA 4I4IA 5I5GA 3ZDQA 5JS1A 2WNHA 1GFWA 2H08A 2SHKA 2X15A 2XDAA 5IT0A 3EWAA 2YJ4A 1PV2A 3FLAA 2R87A 3LKZA 1OX5A 4QT4A 4M37A 1T0JB 3Q2KA 1N77A 2SKCA 1FFHA 3ND8A 1HBJA 3QG5A 4LKRA 5MDHA 2Q4RA 1S4QA 3ZK8A 5LXTB 1C30B 1YBAA 4PZYA 3TUZC 1IK4A 3OEHA 4BGVA 1KBOA 3DOHA 1SZDA 2OO7A 2WDPA 5AOAA 3ZHSA 2I7XA 1DAIA 3PVZA 4QEDA 2XYHA 2FPSA 1Q1QA 4C0QC 4D0GA 2HXGA 1FFYA 1FSPA 2QM8A 2BFNA 2JI7A 2OORA 4GXQA 4IDFA 4N0PA 3JTEA 4AIRA 1OLXA 4U7DA 2NZVG 2HBQA 3TMYA 1M2EA 2O6LA 2IVFA 1TAHA 1FFAA 4OHBA 3EGIA 2J5QA 5E6UA 5EZQA 1XYGA 4XCVA 1JI3A 3QMMA 1SXJB 4F84A 5KVCA 5BSFA 5L3QA 3EXAA 4QVKA 1QPZA 4OA5A 3UMMA 1YR9A 2HA6A 3ZHUA 5JMOA 4P82A 5L3ZA 5KMGA 1GQ2A 2ATXA 3UGQA 1YZLA 1YCDA 2UYOA 2ZWPA 3GEHA 4ZEMA 1Q1BA 1O08A 4ERXA 3EXG1 2HLDD 4M54A 2FUNB 3SBOA 3IE1A 3UCFA 2IXTA 3CXRA 3HJCA 3EPPA 3SBEA 1YKGA 1E20A 4WCVA 3T5TA 4ANFA 1MX1A 4XVUA 1HI9A 2XNHA 4WE3A 4Q9IA 1V16A 1C1YA 5D5PA 1YU6A 3RAGA 3U0VA 2CNLA 4FYXA 3EXIB 4XLLA 2CFTA 4PHCA 3PSHA 4HGOA 2P68A 2WWRA 1PT7A 4GGMX 2XA9A 5DM70 3OEED 1F60A 2HJRA 3JQFA 1YIDA 2WUGA 4IG4A 2CLIB 3E3AA 2F3RA 5T67A 4AO7A 5E3JA 1IBLB 3FIJA 1CD5A 2DWCA 2QRLA 3OAAA 3C6KA 3NNDA 5FNVA 1GU7A 2JCYA 4TXJA 3NETA 1X1AA 2BYTA 3PQ7A 1JU4A 4HTAA 2OUIA 2QYSA 5F1PA 2TECE 1JQDA 3EE6A 3N0VA 3EK2A 3O7MA 4MP8A 4P93A 4IF4A 2IOHA 3OP4A 5EPOA 3LLSA 1U8ZA 2ZYGA 3TL6A 3UBMA 4QPNA 2JAOA 2O2YA 1R9NA 4ZHQB 2IUSA 5EE9A 4FVTA 2PM8A 3HV0A 3K3PA 4RAQA 3WLAA 3D81A 4EARA 5MHTA 2FR8A 1XP5A 2XWPA 2WUDA 4EGSA 4RVSA 2DJIA 3DE2X 1U1FA 1LTQA 2W37A 1TQHA 4LOHA 2Q5JA 3CPHA 3OPNA 3PB3A 1L4KA 4CG3A 1QHFA 1LDNA 1BDMA 3A36A 1RKQA 1VGVA 3EPRA 3KZMA 3LMKA 4GLFA 4RX1A 4QU5A 3K1TA 2WIAA 4CF7A 2PT6A 3B2QA 5ELLA 3EA0A 4K3VA 3GBSA 4F4UA 1NMZA 2I78A 5CH8A 2WHEA 4OH1A 3SJUA 1IY2A 4F3NA 2WTNA 3A9WA 2GF9A 2CHEA 1OOEA 3EXHC 3QLUC 4LJ7A 3JTMA 3UH1A 4UPVA 1CZHA 3C24A 3KYJB 3L8ZA 1G2OA 5H02A 4DMGA 3AKZA 3BDIA 1LRLA 4PSUA 4A0HA 4BLOA 1GTL1 3E9MA 2DU8A 4D98A 4TX1A 5CB4F 1T8PA 1KEPA 1Z2PX 4QYMA 3IUQA 4FT4A 2WJPA 4P32A 5A4IS 5BUSA 3FKQA 1ZG3A 2ZJAA 5K0TA 3TQRA 2VDJA 5HUHA 3N2YA 1RR6A 4I55A 5FAKA 3FBGA 2FEPA 2OFFA 4XM2A 1OBOA 3Q2IA 2P2SA 2IWRA 2IEGA 1O9GA 4P0PB 1S7GA 4AFNA 1MVOA 1TAGA 2QUAA 5DTRA 5A7GA 4FEAA 1L9KA 1Z0IA 2ZR8A 3F8TA 1DIHA 1JFFB 1VMIA 2IYOA 5IJAA 2F3SA 3EIEA 4AO8A 4DFDA 1TGYA 4RY0A 5CR9A 3UMYA 2B4TO 3D6JA 1GUBA 1A8HA 1XCMA 3EW7A 3GMSA 4GZ6A 3GRRA 4J6FA 4KSCA 3B6JA 4WJZA 3T52A 1JDVA 3PEFA 4CRWB 1G64A 3QUBA 2WTMA 4NBWA 4KU4A 2AQKA 5IS2A 1Y3BE 2BEVB 3CUUA 2WWGA 4LSWA 3LP8A 2VK4A 3NCHA 3L7LA 1MTZA 1R5OA 3BF7A 4R1LA 3GP8A 1PR5A 1XSEA 5G1NA 5DNEA 1AGXA 5JS2A 1NX6A 1Z33A 3V8VA 1Z4NA 4ZQCB 2GAJA 1WDLA 3NUQA 2GZ2A 3L4SO 3CPEA 2V65A 1E1CA 2WICA 1GTJ1 3O9ZA 2FMFA 3I30X 2REBA 3GIDA 3GJXC 4Y9TA 3SC6A 3SHFA 4OPMA 3STUA 2W6CX 4XB6B 3WRXA 4CTKA 4C22A 2A0UA 3PYMA 3KOWA 4OL9A 3EQ6A 4XE5A 4JQOA 5CHYA 2ODWA 4LJ6A 5BPHA 4WKOA 3UZUA 2UUCB 3WV5A 1R0RE 1J1IA 2YVUA 4V0RA 1JDJA 1ZQ9A 2DKOA 2JFBA 1W85B 3DJFA 3T94A 4C04A 3PGXA 3CV3A 5ER6A 2AG8A 2YV5A 2FWJA 3HJUA 4QXRA 4L4RA 2LVBA 1VHLA 1XL1A 4C6TB 1UJCA 3U1VA 3QF4B 1YAHA 3O84A 4YRDA 3ZQ6A 1U1IA 3HBJA 5JC8A 4GL2A 3D8BA 4YJ2F 3NASA 4BO9A 4E1VA 3BZWA 4NCHA 4Z2AA 5JNTA 4QM7A 3NQ41 5JSZB 3C0KA 4DV1B 5K0NA 4JVOA 1TEZA 3WB1A 3AY0A 3A4VA 1T0PA 4G0OA 4G65A 1JLHA 1ODKA 2I3BA 3X1JA 4GR9A 4ETWA 3AB8A 4L9WA 4ZMRA 2RAVA 1TMKA 4Z9BA 3ZWOA 1UCFA 1USIA 4S1NA 3FHOA 3FPEA 4AKHA 3HA5A 4O2RA 1XFDA 3TUIC 3KJEA 3U4QB 4L4SA 2C84A 1E9DA 4XEUA 2VT6A 5BW4A 3HKBB 1OZFA 3TD9A 2F4VB 2E5LB 3M3PA 3HDJA 1F0KA 2BI4A 4DT1B 2X3UA 4WBXC 3FRJA 3TIFA 4X54A 5CX1A 1HEYA 4JJGA 2ZG6A 3CKKA 2ZSJA 4PSCA 2VPIA 3KWMA 5ERGB 5FBKA 5DCYA 1YC5A 3BA1A 3F3YA 3M82A 4C07A 3UHFA 4NXMB 1XROA 4LV5B 1XFAA 1XO1A 1HTTA 1RQXA 1T36A 3FOEC 4FXOA 1G7CA 1SCIA 2WNIA 3D3NA 3I0NA 1JNXX 3A3NA 2FMHA 3UOAB 3B9BA 4CMJA 3K2EA 1ZY2A 3O31A 5F73A 5JQGA 5AXAA 4BNVA 4BQQA 4JL5A 4F1JA 2X0RA 3HCAA 2GLUA 4B8YA 4QYWA 4B83A 2PSJA 3H1FA 3ZVKA 3AJRA 2FPPA 3D54D 3IOYA 5DLPA 1AHIA 1ST2A 2V7PA 3JALB 3THXA 4CGZA 1GA4A 2JH8A 1WEKA 3O8NA 3CR8A 3P20A 4MV5A 4XUCA 3TBKA 3V4SA 1Y7IA 3F71A 5E38A 1D0VA 1ENOA 3NC4A 3ZBQA 1SXQA 4FW8A 5HMMA 3TFQA 2XMSA 1EDBA 3GNTA 5ED4A 1I5RA 3IMCA 1W29A 4FE7A 2J0SA 1MEOA 4GX0A 1U2EA 1J2TA 2N75A 5KOJB 3I8OA 3VR4D 3OOWA 4OXIA 1DDGA 1KZGB 3IVAA 1K2WA 4RKEA 3KALA 4YP1A 2G5GX 1DRKA 3K9GA 5A4AA 3I2JA 3IXMA 4M8LA 1WZ2A 4EUFA 3T3NA 3I53A 4S0XA 3IDOA 4UATA 2WHYA 1S4MA 1Y4ZA 2YBEA 4QXOA 3V2HA 2YUTA 1IXSB 4MHSA 3CIFA 3B6ZA 3UG6A 3K9QO 4BAZA 3NHKA 1RWBA 4CKZA 5KTPA 3DC2A 1EJ2A 2R6AA 3OO1A 1OTYA 1Z4QA 2ZUDA 3T7SA 4Q4JB 1UK9A 1H8EA 4TTQA 2CHUA 3VU8A 4C30A 1AQIA 1IOZA 1N3BA 3VDXA 3H18A 4BJ3A 3BD8A 2QSZA 2VJPA 3DVSX 3JY6A 3Q7TA 1MMFB 4FGUA 4L76A 4U6QA 2FVYA 2B36A 3DZHA 4X6XA 4Z1MD 3FB4A 1YJQA 3V1TC 2CZCA 3WFIA 1REQB 1M2VA 3LHKA 4ZVMA 4M1ZA 1W36B 2XA1A 1ZOIA 3MUFA 3NMUF 2KJQA 1E63A 5G4KA 4OGFA 3O94A 5I9BA 1G7RA 4GOOD 5DLYA 4KH1A 4BQPA 2ZRNA 2ADOA 5B55A 1GPDG 4XQ0A 2BMEA 3GUHA 5ALJA 3B5EA 1OX6A 1BX0A 3CIOA 3SQDA 3TQCA 2ZYDA 4B73A 3V9AA 3MXTA 4KEAA 3WZ2A 3CSSA 1SPXA 5K6AC 1WUYA 2Q8QA 3TAXA 1BN7A 2A1TR 2D74A 3H3FA 2F17A 1YZUA 4FKMA 3OMWA 2VFAA 3AJEA 5LR6A 4WXPA 4DGSA 1K3FA 4IGKA 2HU8A 4A4DA 1IBSA 1XU9A 1Z6QA 2R4QA 4B6PA 7YASA 2OTCA 1EX7A 3QVOA 1NU6A 1VTKA 4MW4A 3DMHA 9GPBA 1DARA 4DMUB 2GBLA 1KFEB 1M2OB 1GM5A 4E2ZA 2PD3A 1RP7A 3OKPA 2W43A 3D0KA 4M83A 1MH9A 1A88A 3MLEA 2BSQA 2VT3A 4RA9B 5F7XA 2PSHA 3IRVA 3IAXA 2DT8A 3MCAA 2FLVA 1B76A 4E11A 3RFVA 4DIDA 1H2EA 4Q47A 1ZUNB 2VXOA 2RIPA 2Z8YM 5E9WA 1XZ8A 4BBJA 1KFBB 2FQQA 5JSYA 1GCAA 1SKYE 1I36A 3E9NA 3GP3A 4UEQA 3U48A 2BDEA 5IFLA 1ZP6A 3N8HA 4BLUA 1EVKA 3DO5A 3ZDDA 2HSDA 3LUFA 2AE1A 1BMTA 1JQJC 1PVVA 4YXFA 2VHCA 3OG9A 3DVRX 1N6IA 3ZWNA 5KTYA 4PO1A 1U2ZA 1CNMA 1KZYC 2WFLA 3IUEA 4N54A 2GYYA 3OCUA 4Q4DA 3IV7A 3E22A 1H0RA 4LGMA 4YBRA 2Y1FA 4WZBA 3PF9A 2V3CC 1IUOA 1TW3A 3GJ0A 4M7RA 4OXYA 1OLXB 3AUKA 3WLSA 3K0HA 2QI9C 1YF3A 2A4KA 4R9RA 2QGZA 1OGIA 1DXQA 2CHFA 2DZDA 4MS1B 2I71A 4FNOA 5ALXA 1EJ0A 3W3AD 3PC8A 3IMFA 1J2YA 1KMMA 2IA5A 4M1MA 2DSTA 3ON5A 5JXGA 5E6UB 2IKSA 2DFTA 3OOHA 3FIUA 1ZGAA 3HN7A 4X7MA 4BIMA 4UXJA 3KQMA 1E6CA 3QVVA 4EG3A 5ALPA 4NV1A 4AMZA 3ME5A 5ARDA 4OUKX 4MR7A 4N7RA 5CFOA 1RYYA 1CQIA 1YTUA 3VSDA 2NSLA 1PJQA 4KV7A 2IYZA 1OSNA 3G5LA 4BNMA 4M0UA 5F98A 4JMLA 1E2JA 4LV8B 1OA0A 1WETA 4Z9XA 1Z6YA 3TCNA 5CEJA 1H4TA 3L8EA 1HZJA 2WYOA 2CUNA 1RMTA 5AK0A 3AETB 4BMZA 3VSBA 4BOYA 2DQYA 3BGWA 2XMDA 4C21A 1W52X 2BFOA 3CW8X 5L9AA 1AMNA 1NXXA 3G17A 2GCOB 3O8BA 1JT9A 3PIDA 4GVXA 1E3JA 4DNPA 5L51A 2PR2A 2YWHA 1QFXA 1YGYA 3T1OA 1N2BA 1WVGA 1XMOB 2Z2YA 4TS9A 1GNRA 1TYZA 1OFTA 1Z13A 3FNHA 3HZZA 2DC1A 2QM3A 3G0DA 3DWFA 2OR3A 4BMYA 1YIAA 1QV6A 3JQ7A 3KZ1E 4Q6WA 5AT1A 2OCBA 3D6NB 3WDLA 3KT8A 4V0KA 3KJZA 4GC9A 2XNKA 2DHQA 2HU5A 1IDN1 4BV2A 2EG5A 2VC2B 3IUNA 1NF8A 1EA7A 2Z2JA 2UZ1A 4KWCA 4EDHA 4KGDA 3ONDA 3D8UA 3TVDA 2RHHA 1E4YA 1Z08A 2NV2B 3BIXA 3FKJA 4H7JA 3GLTA 3LDGA 4PSAA 5AR1A 3JZIA 1U98A 3JXEA 2PFGA 4E2FA 4YA6A 3H9BA 1IQRA 1KJZA 1VPEA 1WHTB 2OZEA 4BV3A 1NFQA 3IL2A 2Z2KA 5CBPB 2F62A 1GAQA 1SKAA 2HKIA 4LX8A 3AHFA 3ZDXB 1H6CA 2VZ0A 5KYWB 1IAQA 1MAUA 5ESXA 3RYCA 1EUQA 1Z5OA 3H9UA 4QELA 3K1JA 3MCVA 2Q3CA 4PBTA 3UICA 3II6X 4B4VA 1E32A 4CVNA 5PGMA 1IHPA 4RH0A 5KOHB 1YFLA 1B0ZA 5K3FA 2WKPA 1Z25A 2P6NA 4X1IB 1N5LA 5FUMA 1NLYA 3FVWA 1E9BA 3SX4A 4BVGA 2GMWA 2JFPA 2I4IA 3EFEA 4MR9B 1TTQB 3HEAA 3DPUA 1U63A 2J6HA 2EX1A 3CVUA 1ONSA 5IF3A 4FGLA 5IK2D 4O1MA 1YMVA 1QYXA 1SQ6A 3ND6A 3UENA 1T5IA 1S9HA 2UZ3A 1A4RA 2P0AA 2ZZMA 2QZ9A 3LCUA 2ZUBA 5IANA 1W8DA 3DB1A 3EJ6A 4R8KA 4IJUA 4OF4A 3UB2A 3UFBA 4OHKA 1ZR2A 4ES6A 5C5EA 4IXMA 1YC2A 5KHOC 5FWAA 3QEMA 4JUAA 5FORA 2D1YA 1US8B 1H4SA 2K2WA 3C15C 3HA2A 1N33B 3JVIA 3SFZA 3OCXA 2VAWA 4F96A 1W19A 4FLMA 1C1DB 1RHQA 5LZ8A 2FSSA 2YINC 2QRGA 3MJFA 4MWOA 4WGGA 4I08A 3F49S 3N0TA 4AB1A 1V7CA 2HK8A 3M6UA 2WIJA 2I91A 1EXMA 1WHSA 2ZLBA 3H8JA 3X2SA 3ZHZA 2GKSA 3K2IA 1JEAA 4FUTA 1ONPA 3T9BA 3PGVA 3U49A 1KRXA 3DEAA 2AXEA 1ID1A 1R16A 1VE9A 3U4IA 4ZK2A 2ZPTX 2JARA 3LBIA 5EHNA 1WM1A 1TZ2A 2ISSD 2G28A 1ZUD1 1K5DA 3V4RA 1LY1A 1CR4A 1XLTC 1GR1A 2FKNA 2AD1A 2YRFA 2WEKA 3IBGA 3DGFC 3RVPA 1YRHA 4M0EA 4TV9A 3E53A 4RSMA 1L5MA 3RUCA 1MG5A 3UO8B 2LD4A 2FPOA 4P58A 4QLOA 2CDAA 4I99A 4MZXA 3QKIA 3KQWA 3LCVB 1SN7A 3V55A 3PX3A 4LOAA 1UP4A 1U31A 3F47A 1I51A 1QP4A 1B26A 1IHOA 1P19A 5BOSB 5CT8A 4MWEA 4QAQA 4BO8A 4NQZA 2O8FB 3IKLA 3N6RA 3EX7C 1DZ3A 2NXJA 1P7PA 3D8HA 3E6AA 1B2LA 3LBAA 2HIAA 5EMMA 3WKEA 4AT1A 1VB5A 2MMGA 2X58A 3IAS6 1HG1A 4F3RA 4G0QA 1BMFA 1T9KA 3Q7EA 2JGNA 3D3KA 3IVGA 3T5PA 4FNAA 1QYRA 1KH3A 1OTHA 2XHEA 2YWDA 1FW6A 4V2UA 4ZVQA 3OM1A 1GGVA 2VN8A 2X6TA 4TVOA 1NW5A 5JH7A 4A0GA 3ZK9A 1R4MB 1HLGA 1U2RA 2Q5HA 3PFFA 4HXFB 4EKDA 5IC4A 1E2NA 1Q74A 2JAWA 1X1SA 4MR7B 2D54A 2H2WA 1P9OA 1BG6A 3ZHYA 3ANXA 1ZCFA 1BVHA 4YJHB 1R5NA 1ORRA 1QGUA 2Y3IA 4KRYA 4DLPA 5LMZA 3Q9LA