4HUJA

Crystal structure of a hypothetical protein sma0349 from sinorhizobium meliloti
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
204
structure length
204
Chain Sequence
NLYFQSMTTYAIIGAGAIGSALAERFTAAQIPAIIANSRGPASLSSVTDRFGASVKAVELKDALQADVVILAVPYDSIADIVTQVSDWGGQIVVDASNAIDFPAFKPRDLGGRLSTEIVSELVPGAKVVKAFNTLPAAVLAADPDKGTGSRVLFLSGNHSDANRQVAELISSLGFAPVDLGTLAASGPIQQFGRPLVALNLLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein SMa0349 from Sinorhizobium meliloti
rcsb
source organism Sinorhizobium meliloti
total genus 56
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4hujA00
1HDZA 4GX0A 4GX5A 1O5IA 1P1KA 3Q9UA 2CZCA 1TA4A 5JLAA 4QO8A 4QUKA 3GNSA 1A5ZA 4DIBA 3GGOA 3RJ5A 3ON5A 3TZCA 1E6WA 3C24A 1ML3A 4GGPA 2Q1UA 3WYCA 5G4KB 3VC7A 3I4FA 4L9RA 3TOZA 4NJOA 4UVEA 4BNTA 4BNYA 1K0UA 2VTEA 2HUNA 2JD1A 3CEAA 1QG6A 3JQGA 1I3NA 3ICCA 3GC6A 4DBVO 1Y8RA 1VI2A 1C1DA 2DBZA 5H83A 1PIWA 4W82A 4EEXA 3FRJA 3G1UA 3RU7A 4XR4A 1I2BA 3H3FA 3GPIA 5T67A 1YGYA 1VE9A 1SNYA 1FMCA 2A94A 2UUPA 3GOHA 2IXBA 4W9NA 4YTEA 4MIOA 2CVZA 1VM6A 3PHJA 1MP0A 1SEVA 4P22A 1UJMA 1LSUA 2W2KA 2IZ0A 4E5NA 2HO5A 2X5OA 1LSSA 3L0DA 1P1HA 4ZQFA 4J0EA 3E1KA 1LDMA 1U1IA 3QE3A 5DT9A 1SB9A 1WNTA 3VDQA 1S7CA 4RDIA 2YZ7A 3KYDB 4CJXA 5FFFA 3WSVA 1YONA 2JJYA 1L7DA 4WEOA 2WYWA 1ONNA 2CUKA 4BNZA 1YWGO 2O3RA 3F1KA 4BO7A 3H9UA 5JMWA 1C0IA 4O59O 3L4SO 1V0JA 3D0OA 2CF5A 3ANMA 4YAIA 1EBFA 4Q39A 1WWKA 3C85A 1SBYA 4YACA 2IRWA 4GKVA 4O63O 2X8LA 4P38A 3D3EA 3RAJA 4KTVE 1LSOA 1GD1O 1BVRA 3EZLA 4IQ0A 5A06A 4YJFA 1PU2A 3OA0A 1SAYA 1U3WA 1ONOA 2BKAA 2D8AA 3PVZA 3I6QA 3B6ZA 3GRPA 4QFCA 4XGIA 1L1FA 3WSWA 1E7QA 2C59A 1T2FA 5B4VA 1M66A 3DHYA 7MDHA 4GWKA 1XU7A 4XZ3A 1H9BA 3R3SA 3G79A 3NT5A 2NM0A 5JDIC 1LXCA 5L3ZA 2OP0A 3VPHA 3C7CB 1A72A 3QQPA 2C2XA 1VSUA 5CDYA 3WG9A 3U09A 4NDNE 1YQDA 4P4GA 5A1TA 4HUJA 1ZXBA 3HB4X 1N2SA 1E5QA 4WOKA 5G0TA 1KOLA 1NXQA 2EF1A 2EWMA 3I9LA 4DTIA 3WIEA 1NPTO 3IAHA 3IS3A 4FSHA 3UOGA 2O3QA 4OQZA 3H3JA 4CM6A 3PDUA 4CMIB 2C54A 4CPDA 2C7VA 1XEAA 2PZMA 4PLZA 3ONDA 3HDJA 5A4DA 2E48A 4CV3A 4TRMA 1NR7A 3EY4A 4PLCA 3DHEA 4N5LA 4WLUA 4J4BA 3ZCXA 3AWDA 4Z9XA 3DBRA 2HK7A 4HNGA 3ZU3A 4BKRA 2VYND 4KTTE 1TI7A 1BXGB 3JQ7A 3ITKA 2J5KA 4J91A 2WM3A 1C3VA 4Q3NA 1ONPA 4FFRA 1LEHA 1GU7A 1YJQA 1D3AA 2NTJA 1HE2A 2H1SA 4ZA2A 4CUKA 1B16A 3Q3CA 3ZWWA 4J2OA 3GMSA 3NUGA 2RH8A 2HAEA 2XXJA 3FCOA 2J5RA 4BMSA 4NU5A 2A9FA 3JQCA 3TRIA 1BW9B 5THKA 1HF3A 3DQPA 3A28A 3SLGA 1NPDA 2G5CA 3H4VA 2QQ5A 3GNTA 3O8QA 4RF2A 5AVOA 1PR9A 1LLUA 2GRAA 2RHCA 2XOXA 3ADOA 1V3VA 1YDWA 3QLJA 4CV1A 1JKJA 1Q1NA 4AVYA 3FF4A 3ZV5A 4XRGA 3FNHA 4CQMA 5KNLA 2I3AA 3DZHA 4LCEA 3OJOA 1KEVA 4NI5A 2RAFA 1FDVA 1HZZA 4Z0PA 4WNCA 1G1AA 4YJHB 4TVBA 3BHIA 1TEHA 1RPNA 3OFSA 1R16A 1QSGA 3VZSA 4LSMA 2GF2A 4J4TA 1LU9A 3WTBA 3RC7A 4YDRA 3DZJA 3W8DA 4RZHA 4HFMA 5HWSA 1Y9EA 3EAGA 1RJWA 4TZKA 5L40A 3PYMA 5L4SA 4I5DA 3VPXA 3SX2A 4DWVA 2OORA 4B3JA 5KVCA 1KYQA 3HN2A 4HWKA 1YQXA 3GRKA 4IM7A 2CVOA 4L73A 6LDHA 3FBTA 1NYTA 3C8MA 2C07A 5CEFA 2I67A 4NR0A 4R54A 4E3ZA 4P8RA 4YCAA 1V8BA 5B37A 1Y9AA 1O0SA 1P3DA 1B7GO 3KRTA 3AM4A 4E5KA 5DNAA 3AM5A 2ZJ1A 1KEPA 1QORA 2DTDA 2ET6A 1X7HA 3H8VA 1XDWA 1R12A 5TSDA 3DAPA 4IS3A 3PI7A 3H7AA 2HDHA 4RO0A 1R4NA 2QRJA 3W8EA 3GVPA 4J1QA 3V2GA 2J8ZA 4I5FA 3C1OA 1EE2A 1GV0A 3AY7A 1TT5B 5BSHA 4IGFA 3GDFA 3M2PA 4MJLA 4GBJA 3IDSA 1Q7CA 5A5FA 2JFFA 5DCWA 4BVAA 5A3JA 1BXKA 2EGGA 3H9EO 4R1UA 3U4IA 2J3HA 3PPIA 4XYMA 1WZEA 4IZIA 3ZWNA 2D1YA 4I9NA 3UF0A 1SPXA 1BHSA 2CVQA 4UUPA 5JBIA 1F06A 2P5UA 4GSKA 4WEQA 3P7MA 4I5GA 2AHRA 5HM8A 9LDTA 2PH3A 4LISA 3AFMA 1PS0A 1CF2O 1W8DA 5FI3A 3WYBA 1ZK4A 3GDOA 4JLWA 3RUCA 2WE8A 2FWMX 5TRTA 5ILOA 3JQ8A 5C7OO 1AUPA 3CPSA 4K9DA 3H5RA 2R00C 1N7GA 3L6OO 3WDSA 3GZNB 2P2SA 4J6FA 4KP7A 4AJEA 1ISIA 4EITA 4M87A 4LSWA 4UREA 1QLHA 4PLPA 4DQUA 1PR3A 3EZYA 4QFDA 3GA0A 4RVFA 1X14A 3JSAA 5ITWA 4CR7A 3OSUA 5JAMA 2Y0CA 4NJMB 2HCTA 3WWZA 2IODA 3CKYA 3WXBA 1PGNA 4DBZA 5EQDA 4IDEA 4AJJA 3DBHB 4WLOA 4EJMA 3H2ZA 5EIOA 1M75A 4BQRA 1M2WA 4L75A 1YO6A 4AG3A 3IC5A 3QWFA 2JL1A 3CZRA 5DZSA 1K5HA 1EK5A 1JVBA 1LDBA 1F14A 3GEDA 1R37A 2BGMA 3HFGA 3PQEA 1ISHA 3LVFO 1T2AA 3N7UA 3ETDA 4J4HA 4CL8A 5JNLA 3ZI0A 2VCYA 3DBVO 2VNSA 2YUTA 5L45A 2VZ9A 3LC2O 1SCUA 4BNKA 4W99A 5IN4A 5JXWA 5KJFA 4XYLA 1UH5A 1WDLA 1PS9A 4CMBA 3TQHA 5EQFA 2RBEA 4GL4A 4IDCA 4RPHA 4RF5A 4I9UA 2VWPA 4BQPA 5JDIA 1MFZA 4DUPA 4E4YA 1C1XB 5CG1A 4CM4B 3BA1A 2I9PA 1EFKA 4EYEA 2D4AA 1XG5A 3IUPA 1SC6A 4MVJH 3DHNA 1E1NA 4E5YA 3K2EA 4NK5A 2VHYA 1F17A 3LF1A 1DJQA 2I3GA 4IDAA 2RCYA 3V8BA 4RVSA 2VQ3A 5ICSA 2X23A 3OJLA 3H9JA 1ZW1A 3RSHA 3ZWVA 2PFGA 2DAPA 2GNAA 4GLLA 4RF4A 4OXYA 3QV1A 3ZNNA 3TZ6A 2Z5LA 4XGKA 5AOVA 2Q50A 2P68A 1NWHA 1CEQA 1PJ4A 2C82A 4RLSA 4M8SA 4EW6A 1Q0QA 4E2ZA 1ZJZA 1NASA 2FY8A 1N7HA 1JLLA 1R4MA 1LX6A 2NSDA 5K0ZA 3VKUA 3OP4A 1OI7A 2TMDA 4WCFB 3PIDA 4B8ZA 1LC0A 3UCFA 1ADFA 4NIMA 1A27A 1CETA 3AY6A 5T8KC 3HHPA 4ZGWA 1N9GB 2VHXA 3WGZA 5FWNA 5JCJA 1G0NA 4Z6KA 3D4OA 2O2YA 3GVCA 2DT5A 3EGOA 5F3RA 2YFQA 3DBLA 3ONFA 4N5MA 2NQ8A 1QV7A 1JKIA 4NFHA 4LMPA 1JN0A 4RPGA 2X58A 4BO9A 5MGBA 1LQUA 4B4WA 1V6AA 4E5MA 4B79A 3MJ4A 4DLLA 3T7EA 4AICA 2NLOA 3RFVA 3ZW8A 4BUCA 3FR8A 2RIRA 4PVCA 1B26A 3JQFA 3CMCO 1I10A 1HZJA 2CMDA 1RM3A 3KYCB 1X0VA 4R1SA 2Q2WA 2VRCD 4D41A 5JS6A 3VPGA 4KWHA 4C4OA 4AJOA 2WTBA 6ADHA 2GN4A 1NQ5A 3CUKA 5JMPA 4A0SA 1DLJA 1E7WA 5BNFA 4WK6A 1H93A 3UFXA 3GHYA 4J1SA 5COBA 3VTFA 4A5OA 3R3JA 3F6YA 4WNIA 3AUUA 1E3EA 4W6ZA 2C5EA 2DQ4A 3C7AA 3WNVA 1LC3A 1T2CA 1NFFA 4W9NC 4YWJA 5A04A 1ENZA 3WGHA 1N92A 1UUFA 3FBGA 3I83A 3VH4A 3BTUA 4PN3A 2EP7A 5I9LA 1DOHA 4CLHA 2PZJA 2HJRA 3DXFA 2W4QA 2AQKA 3CZMA 3JYNA 3E9QA 1HDYA 1ZIDA 1I33A 5DBFA 3OETA 3H65A 3KO8A 4O5OA 1DSSG 3QWIA 3EC7A 4FD3A 4NQZA 5TS3A 3DMTA 3W1VA 5B1YA 1KS9A 1WLYA 3TWOA 4PRLA 3ENKA 2NU9A 2ZCVA 4MINA 1JDJA 1GPDG 1K6JA 2X5KO 3ROQA 1IHXA 1F0YA 4R4JA 3U5TA 3OIDA 4ZHSA 5ENVA 3WWYA 4MVJP 3JQBA 3QRWA 4EDFA 3MWDB 2VUTA 2I66A 3EK2A 2EHDA 2PKRA 2EIHA 4J1TA 4RVUA 4YQYA 4QTZA 4W7HA 4ZVVA 1I3LA 5U4QA 2GPTA 2B36A 2ZQYA 2ZB7A 4H16A 4PRKA 2R6JA 4E2XA 2NVBA 2ZK7A 2VUUA 2P9CA 1C0PA 4DQXA 2PH5A 3HB5X 1PL8A 5A02A 4RPKA 5TQVA 1Y5RA 3JD3A 3RC9A 1GYPA 1LDNA 5EPOA 5JW6A 4UEKA 3D5QA 4GQAA 1F12A 1DFHA 3PFWO 1GV1A 4JN6B 5IXYA 1IE3A 3AU9A 3RASA 1DEHA 1XU9A 4Y6SA 3DFUA 2B37A 3GZNA 1HWYA 3CINA 1SOVA 2Q45A 1BTOA 2ZKLA 1U8XX 1QMGA 2QRKA 5ILGA 3V1TC 4AL4A 5CG2A 1EEHA 3B1KA 4RZIA 4H3VA 1E7SA 4NBRA 3GEMA 4WGGA 4FGWA 5MDHA 4J2HA 1ISGA 3DMYA 4OYRA 3R0IA 1PS8A 4NJMA 4GPD1 3WOHA 1H94A 2PZLA 4B4OA 4ZN6A 5JFOA 2DFVA 5F1PA 1EUDA 4E12A 1K6XA 1EQUA 5L7TA 3FD8A 3GDGA 3I3OA 4PG7A 2OGUA 2GSDA 1KVTA 3F46A 3SEFA 1NNUA 2XF8A 3GUCA 4OXKA 1HYEA 4RVDA 1QLJA 4QXMA 5A9SB 3GG9A 3OIFA 4BMVA 2IXAA 2ZCUA 5JYEA 4ND5A 2EW8A 3ZHBA 3BMNA 2WYUA 4O6VA 4HADA 1V35A 4K6CA 4PLVA 4OOFA 3AW9A 4JX8A 4URFA 2EJWA 3Q9NA 2FPGA 3LC7O 4IDGA 3EYWA 3I9JA 1DAPA 1PJTA 1XR3A 4XGNA 4J9VA 4XJTA 4A03A 4A27A 1LQTA 4CM8B 5G2OA 2CD9A 3D4PA 1I2ZA 2Q1TA 1G0OA 1ZVMA 2Y66A 3LSYA 2GUGA 5TC4A 4JXKA 1AGNA 3ULKA 5TJ9A 1SZJG 1EQ2A 4IGEA 3JQ9A 3C3XA 4IXTA 1GTMA 1ID1A 4X54A 1E3JA 1YDEA 1NHWA 4IS2A 1PJ3A 4J16A 1VSVA 2GZ2A 3JD0A 4XRRA 1GZ4A 3RC1A 3FNFA 4BO6A 4BO1A 3RUHA 1ADBA 5U1PA 3WFIA 4LRTB 2WMDA 1ISFA 1QP8A 3NKLA 4NPCA 3VPFA 3WICA 4W7IA 4ND4A 3Q2IA 3GAFA 1U5CA 2C29D 2W90A 1HLPA 4NFYA 1N8KA 4RLHA 4XX0A 5AXAA 3E82A 2VHVA 4CMHA 1O6ZA 4CLOB 3KYBA 1VKOA 4QT0A 2QYTA 2C5AA 4DIOA 4L4XA 4NBVA 3WGQA 3WQQA 1U2DA 4G65A 3BYZA 2OHXA 2PY6A 3ETGA 4J49A 1X1EA 1CERA 3NYWA 1RM4A 2GZ3A 2PLAA 4BOYA 1L7EA 2YV2A 1YXMA 2ZB3A 4B7UA 5JAQA 4F45A 4PLYA 1TB4A 4TVOA 2Q4EA 1A4UA 1Z7BA 2WD7A 1C14A 5TGDA 4KWIA 4DQVA 3FN4A 3HE3A 4XYBA 1BRMA 2VOEA 4M49A 5IAAA 4YPOA 1R15A 2VWHA 1HE4A 3S8MA 3AUTA 2E6UX 1HE5A 3GZ4A 1EUCA 4D45A 3PJFA 2GGSA 3AOEA 3U9LA 1YS4A 5CDTA 3Q11A 1JWAB 3LLSA 4GVXA 3E9NA 5AXDA 4U7WA 3E18A 1UXJA 3JD1A 2BLLA 4Y6PA 3BMCB 2JD2A 3VVCA 1YOVA 2PTGA 1NVTA 1I8TA 4BNHA 1NBOA 1H5QA 4OGWA 1XYGA 1T2DA 4D0RA 4IUYA 1DC5A 1ORRA 3A06A 1KY4A 3P2OA 2CF6A 1KVQA 2OOSA 4QECA 1XWFA 4EZBA 4OXNA 3GH3A 1IL0A 3O26A 4G2NA 3AFNA 1RYEA 1UZNA 4TZTA 4U5QA 2YYYA 1E3SA 4K26A 5BQFA 3GUYA 3KSUA 4IY1A 3LLVA 1P45A 3U4HA 4CV0A 1XCBA 3BTVA 4R1TA 1PZEA 1J4AA 3QWBA 2BHLA 4L4RA 1EDOA 4LGVA 5CAEA 4HXYA 4BV8A 2XAAA 1LBEA 3NT4A 3BTOA 3ANLA 5KWEA 4CQLB 4CM3A 4ONEA 1LLDA 1GL3A 4Q3DA 1NQOA 2WWRA 4II3A 5HBRA 1H6CA 1HDRA 3FPLA 3A14A 2EKLA 3RQSA 3OJFA 1HETA 3SJ7A 1I0ZA 1IB6A 5ER6A 5CDGA 1DIAA 2V6FA 1X0XA 1QYCA 4F46A 3T4EA 1T24A 1DRUA 3FR7A 4QEDA 4YRBA 3PRJA 2NACA 1CDOA 2IDZA 5G0VA 2PWZA 3M2TA 4DYDA 2ZB8A 1B8VA 4XB2A 1X13A 5JSFA 2X0IA 1QR6A 3QVWA 2Q46A 1ZNQO 1HTBA 3PQFA 2WSBA 2AEJA 3QWHA 3SJUA 2Y67A 2AEMA 4RVHA 2VYVD 3ROMA 3N74A 1ULSA 4R51A 1ISJA 3ASVA 2B4RO 4H15A 3BMQB 5KTKA 4M86A 4BO2A 3ZWAA 1SB8A 3DZFA 1SOWA 3WGTA 1HDCA 4XQ9A 3PHLA 1LJ8A 4XQGA 3DTTA 3GAZA 3OM9A 4PFJA 5JDCA 4IIVA 3UCEA 2BELA 3O03A 4EI2A 1HDGO 1KVSA 2V65A 5ADHA 3KUXA 1PTJA 3IKVA 3TF5A 3K73O 1UZLA 3BZUA 4KDFA 3ZWXA 4HFRA 4R41A 3FI9A 4CLRB 2I5PO 2DUUA 4XKJA 4RPLA 5I7VA 1PL6A 2NU6A 1BWSA 1HXHA 4MVJA 4R69A 2YQ5A 1ZK0A 4B3IA 2P9EA 4UUNA 3KB6A 5A9RA 2RHRA 4AJ4A 5IDXA 3KSDO 1CWUA 1IPFA 1D7OA 1MG5A 3WQSB 1K6IA 5I8ZA 3V5NA 2D0IA 3FSRA 5T57A 1E3WB 4XWYA 2BH9A 3I1JA 3HN7A 3PQDA 4BNWA 1DBVO 5IF3A 4QX6A 1ZSVA 5KCZA 5K6AC 3DZBA 4KOAA 5HTOA 1U8FO 3VZRA 4XJSA 1ENPA 1DPGA 1VL8A 2GR9A 4ID9A 1X15A 4FW8A 3EVNA 2IYOA 1MX3A 1SMKA 3PXXA 1EE9A 4IJUA 1HEUA 3L4BA 4D7AA 3JQFC 4CMCA 1EFLA 5BSEA 4CM8A 4JBIA 3LF2A 2O3JA 2PKQO 3EHEA 3F9IA 3UN1A 4AJNA 2B4TO 3AI2A 3CTMA 3HDHA 3I9MA 1DFGA 4PLFA 4YA6A 4RQTA 2JD0A 1NHGA 3OF2A 4PG8A 2FOIA 5JY1A 3ABIA 1FDTA 1NR1A 1YL7A 4GVLA 4PGFA 2Y93A 3MJSA 3OMLA 4U0JA 2QG4A 3JQAA 4UVHA 3BMOA 4YRAA 1FXSA 2QHXA 1VLLA 4R5MA 1E7RA 2X0NA 2WE7A 1PJQA 1ZK2A 2GN9A 5FF9A 3TDKA 3DOCA 4OJNA 4YJGA 3PZBA 4DL9A 2O7SA 3WTCA 4D44A 2VHZA 2VHWA 5DP2A 3ZGYA 3SBOA 3E8XA 3X2FA 4FQ8A 4D46A 3DDNA 4ALKA 4LVCA 4BMNA 4EGFA 5ICMA 2I65A 1ARZA 3RROA 1Q2XA 3FNGA 3DMTC 4JROA 4ZRMA 3NT2A 3UKOA 1GUZA 4YEDA 3TZHA 1BMDA 4CODB 5KVSA 1A71A 2O3SA 1DB3A 1JA9A 1MC5A 3VH1A 2PR2A 1R0SA 2A35A 3G49A 4JP2A 1TT7A 4MVJG 2DM6A 1JTVA 5F5NA 5TF4A 3AY3A 3JQBC 4UAGA 5IXSA 2Q1SA 4A7PA 3CIFA 4GMFA 4NFSA 4AJ2A 5KVVA 5JY6A 5G4KA 5T64A 3AM3A 5JCJD 4BKQA 2PD4A 2Z1MA 4FCCA 3ZZNA 3MTJA 3QVXA 1I32A 4IZHA 3UVEA 1GUYA 1LDYA 2HKIA 3KVOA 4MKZA 2Q2QA 4BO8A 1H6BA 2G17A 3B1JA 1UP6A 3O9ZA 5G0WA 2CDAA 4JK3A 1QYVA 4FR5A 3VZPA 1E6UA 3ITDA 2Y99A 5EL0A 5DBGA 1OBFO 1E77A 3NTRA 2DPHA 3PHGA 1R6DA 3JYLA 4RGBA 1H0KA 3TZKA 4R1NA 4LVUA 4BNGA 2VN8A 3LDHA 3LQFA 1LDEA 4PLWA 1EUZA 1DRVA 4ALMA 4YBZA 3UHAA 4FGSA 1JQBA 4J0FA 1FJHA 4ZQEA 4YT4A 4IJKA 3INTA 3OEYA 4U0KA 5DP1A 3OIGA 4CMGA 4BKUA 3B1FA 3D3WB 4J9UE 3MOIA 4ZQHA 3JYPA 3ZWYA 4CMEA 1DIRA 3AI3A 3LC1O 2B83A 7ADHA 3KYDA 2H63A 4GX2A 2J3KA 1GQ2A 3HZZA 1BDBA 3QJ5A 3V2UA 4ZICA 4ND3A 3ZWMA 2F1KA 2G82A 2VYNA 5DULA 4YAJA 4YAGA 1UZMA 2Q2VA 4DMMA 5JO9A 2A92A 3PLRA 4MP3A 4OH1A 3KV3O 4CM9D 3RFTA 4L76A 4TQGA 5LCXA 3H5AA 4HY3A 5T6BA 3KOUA 5JPIA 2NVUB 2DFDA 4FBGA 4OOEA 3PFFA 2IE0A 4HV4A 2VT2A 4BO5A 5A03A 2X9GA 1B3RA 4AJ1A 1VC2A 4J43A 3IJRA 1T26A 3K5PA 5L53A 4YRDA 1D4FA 3RUFA 1FDWA 4BGEA 5IJZA 2CSUA 2P4QA 3F4BA 1UXGA 5B12A 3Q2KA 3PWKA 4CUJA 2BGKA 5KKAA 3VH3A 2VWGA 1Z74A 4WASA 2DUWA 1LRLA 1M67A 2BRUA 3WBBA 3M1AA 4JNKA 3NDRA 2OMEA 2FSVA 4D0SA 1QKIA 3MJCA 3JQ9C 4AJPA 3GR6A 3JCZA 4MIEA 1W0CA 2V7PA 5I9NA 1UP7A 2ILTA 4ZU3A 4ESOA 1RKXA 3SVTA 5A3VA 3VAZA 4FJ2A 2BD0A 2O23A 4MP8A 4BS9A 3G17A 1YL5A 2P91A 3GT0A 4BNXA 2E37A 1LDGA 4Y6RA 4Y67A 1X7GA 3GNQA 2UDPA 2VZ0A 2NU8A 1DDOA 2VZ8A 4Y9DA 4CMIA 3GVHA 4OKIA 5ES3A 1CQIA 1Q7GA 2B4QA 3PGXA 2JAHA 5EINA 3VTZA 1PJ2A 3OH8A 3FPCA 5KKCA 2G76A 5HS4A 5CDUA 2NU7A 5B4UA 3RKUA 1CRWG 3SXPA 3K2BA 3UUWA 3PLNA 4BO4A 1C0KA 4Q3AA 3IKTA 2HK8A 3PTZA 1YL6A 3IQDB 1BXGA 1YB5A 3QWAA 2EG9A 1Y8QB 5AXBA 3WMWA 1VJTA 3KLMX 3QVSA 2YV3A 2EERA 3NRCA 2OL4A 1WXDA 1M76A 5EJ2A 3HQ4O 2GD1O 4IMRA 2HRBA 1ZZEA 3S1LA 2LDXA 1U5AA 4BHTA 2EEZA 1BW9A 5I8WA 3FTPA 4XIJA 3IOYA 5K6AA 2RH4A 1E3WA 3IIEA 1OMOA 2AEFA 3ZWCA 4BB5A 1Z7EA 2VNAA 1E3LA 1EZ4A 4PG4A 3P5SA 4DPMA 4Q9NA 5A05A 2GDZA 3AOEC 4QQRA 4MVJE 2CY0A 3O38A 2VOJA 5L95A 3QHAA 4MP6A 3RWBA 4YJHA 4Z3KA 5AXCA 3PGJA 3QP9A 5G4LA 3ZNPA 2PGLA 1PGPA 1ZSYA 1KIFA 1DLIA 4Z0TA 2W8ZA 2IEDA 2YHIB 3TPCA 4YYZA 4WE3A 3GG2A 3JQGB 3IUSA 4W4TA 5HRUA 2VUSA 1Y8RB 3PHIA 4RJTA 1GZ3A 1C1DB 3RUEA 4RORA 1DIHA 3GHHA 1PQPA 2YDYA 5IZ4A 1ZMOA 4CM1A 2B35A 5GZ1A 4OSOA 2FR0A 2G0TA 1U28A 1OZAA 4UVDA 3KLPX 4XDYA 3KEQA 3DAFA 4DC1A 1HL3A 1YB1A 2HMTA 4EJ6A 1IZ9A 1P33A 2W2LD 1ADGA 3I52A 4L8VA 3TSCA 1WP4A 3ZWOA 1MG0A 2IZZA 2W2KB 2CFCA 4KUHA 1UDAA 2O4CA 1YRLA 4XEHA 4TRNA 1EVZA 2AA3A 2AMFA 3U62A 1D1SA 4OIMA 4XDZA 2BI8A 4TKMA 1EVIA 1B15A 3VHRA 5CDSA 4CMKA 2PA3A 1KVUA 3IP3A 1J6UA 1NP3A 2NWQA 1KBZA 4CM5A 2HU2A 3RJ9A 1TT5A 4I08A 2C7GA 2GO1A 5BR7A 1ZFNA 1Q7BA 1IUKA 1HKUA 1UR5A 2JFGA 3BTSA 3OJEA 3PYXA 4TROA 4UEJA 3PK0A 4FJ1A 4RPJA 1NAIA 5CP8A 2E4AA 2VTDA 4DA9A 2OFPA 2HMVA 3JD4A 4DYVA 1RWBA 4E33A 5L4LA 4XD2A 1R0KA 1NVMB 4U8GA 1I3KA 4BNMA 2POQX 5JAZA 3GFBA 4YT5A 3ADPA 3GLQA 1XHLA 4YJFB 1KY5A 1WDKA 1XSEA 4JQCA 2ZJ0A 2HMSA 2WD8A 1H6DA 1B8PA 1UXKA 4PLHA 1DAOA 2DBRA 1O8CA 1BGVA 2CDCA 5DOZA 4Z9YA 1XLTA 3MJVA 1ZO8A 3I6IA 4B4UA 2Y05A 3V2HA 3RD5A 3W4JA 3NJ8A 4JCOA 5I7SA 1ENYA 2OBNA 3PEFA 4I9HA 1CYDA 1LA2A 4CLDA 4JP3A 1T2EA 5EERA 1Y6JA 3TL2A 3BAZA 5JDCC 2GASA 2B0JA 3DEYX 4MPDA 3RFXA 1DIBA 2PD6A 4R01A 2QZ9A 3TOXA 4A10A 1MV8A 1D1TA 4HKTA 4EEZA 1EVJA 3DBHA 4YQZA 4PG6A 5KJ6A 1UXHA 1JAYA 1BVUA 1B8UA 2JCVA 1PJCA 3INRA 4IQ8A 3CSDA 1Z6ZA 5F5LA 4BNLA 2FMUA 2FRDA 3HDQA 3HJAA 1F8GA 5I7FA 3ORFA 4AJIA 5T5QA 3GK3A 3INGA 4OKNA 1NFQA 4YR9A 1EVYA 1TLTA 2Q49A 4UEOA 4GGOA 4NG5A 3DBRB 1IZ0A 4U6SA 1LTHR 2O3UA 4AJLA 2BF7A 4R68A 1N5DA 3JQ7B 1GYQA 3A9WA 3F1LA 4OMUA 3TZQA 4ALNA 1WVGA 1BXZA 4B7CA 1E1KA 1U4OA 4IJVA 1UDBA 3WLFA 3U3XA 2X5JO 5H82A 5GY7A 5JC1A 3Q0EA 1QYXA 1O89A 3L4BC 1C1XA 4CM4A 4BKOA 2B5VA 1C0LA 1P74A 2VRCA 2X0JA 5DBIA 4Y8VA 1IPEA 3O8QB 5EN4A 2F00A 3PDJA 1G6KA 1YJ8A 2QRLA 3OBBA 1F8FA 4FOOA 1DXYA 4UUMA 1M6WA 1HE3A 4MVJM 4WPGA 3WR5A 4CQMB 3JYQA 1JVSA 4HX5A 4IINA 1WMBA 4RDHA 3QIVA 4EJ0A 1W73A 3C1AA 3M1LA 1CQJA 4DRYA 3TN7A 4JBHA 3M6IA 1NX6A 3L77A 4BO0A 1WMAA 3KM0A 2PGDA 3BHJA 2B69A 3ROPA 4INAA 4N5NA 2DU8A 3N58A 1H2BA 3RUDA 2XPCA 3VZQA 1RYDA 3ST7A 4S3MA 2E82A 4WCFA 1GEEA 2O48X 3HWRA 1PGQA 2O4UX 4IBOA 1XELA 2AQIA 1AE1A 3DC2A 4BGVA 5HA5A 1AXGA 1KVRA 3DZGA 5G0SA 1V3UA 2NVWA 1N9GA 4AJKA 1GR0A 4AFNA 2PGJA 5BT9A 1Y81A 3K30A 3ZH2A 2DVMA 1WAMA 2W98A 4CUZA 3ZV6A 1BG6A 2V6MA 4E32A 3I9OA 1B2LA 3GFGA 3RBVA 4JGBA 2YW9A 2UV8A 5GZ3A 3F47A 3ICPA 2NNLD 4DPKA 3DB2A 1R4NB 5C3MA 1T4BA 2WYVA 4BNVA 4QSMA 2UYYA 4Z3DA 3DR3A 3KYCA 4ROSA 5ENDA 1W6UA 3NX4A 4OSPA 4BNFA 4BIIA 5GZ6A 3WGYA 2O50A 3U0BA 1U3TA 4HP8A 2ZQZA 4N18A 1YBMA 1KC3A 3GVIA 5AYVA 3ROKA 4IJWA 4HFJA 4K28A 2ZYGA 4YJDA 1SEPA 4CQMD 2YHIA 1ZEMA 2PK3A 2QX7A 3H9GA 4NBUA 4MVJF 1JAXA 3GQVA 3F5SA 3JQ6A 2Y1GA 4FFNA 1VJ0A 3HUDA 5F1KA 3RU9A 2YV1A 5JAIA 5TIIA 2IYPA 5J23A 4U6QA 2VRBA 2UAGA 3JQ8B 3UGKA 1P0CA 4NMHA 3QW2A 2X6TA 5C5IA 1PWZA 2C2YA 4IXWA 4CMEC 4OL9A 1LI4A 4ZD6A 4EUEA 3B20A 1LLCA 1AHIA 2DPGA 3DOOA 4MIYA 2FHSA 3JQAD 3K96A 1T1RA 4XYEA 1GADO 2YJZA 3NEPX 4K1LA 1A9ZA 2FPPA 1JW9B 3BHMA 3K6JA 4FDAA 4NK4A 1CIVA 4XB1A 4A2CA 1NM5A 3KETA 4PVDA 1HYHA 2AG8A 1UAGA 5IZCA 3NTQA 3G1TA 4GKBA 1ZK1A 4RCVA 1LRJA 1ZXLA 1E7MA 2E49A 4M55A 3NTOA 1E5LA 2AG5A 4KMSA 1WZIA 1B0AA 2Y1OA 4J7XA 4XYGA 1Z82A 1DO8A 1U3VA 4Z9FA 1OC2A 4IQGA 3ZWBA 4XQCA 3ZDFA 1J49A 1O95A 1YBVA 2FZEA 2OUIA 3OHSX 4LN1A 4PZEA 9LDBA 4E2WA 1U7HA 2WDZA 4IPTA 2J6IA 1HSOA 3WJ7A 4GI2A 3IP1A 3ZU5A 1DC4A 4CL3A 2LDBA 3ZHXA 2OP1A 2P5YA 2BFAA 1PJBA 1PJSA 4GX1A 4ZQBA 4LRSB 1XKQA 3GVXA 1ISMA 1JWBB 5C7LO 5IFLA 3NGXA 5IN5A 2DBVO 4KQWA 3OICA 1YVEI 3FWNA 3P2YA 2BFOA 1HT0A 2DBQA 2GYYA 3MZ0A 2Y1FA 3LT2A 4L4SA 2AE2A 2Y1CA 4HBGA 1FF9A 5EESA 3PJDA 1MFPA 3WB9A 4WLEA 1Y1PA 1P1IA 2X9VA 3PWZA 4WLNA 3I23A 3QY9A 2DLDA 3BXXA 1MC4A 1K3TA 2CNBA 1PEDA 3NAQA 3HDYA 2IEBA 2NADA 1DC3A 4UUOA 2GERA 4DC0A 4Y98A 4R16A 4MKRA 1E3IA 4FN4A 2BI7A 3K8ZA 5DN9A 1EDZA 4MDHA 3LU1A 2D5CA 2J3IA 1R4MB 1XQ1A 3V1YA 1P1JA 2Y1EA 2H5LA 5FI5A 1GYRA 5A9SA 5KOIA 4C7JA 3WBFA 1P1FA 4Q3BA 3L9WA 1P31A 1GQYA 3PJGA 1A9YA 1KEUA 2SCUA 4JJIA 4MOWA 4D42A 4TRJA 4ALLA 4H7PA 3AU8A 3DBLB 4ZQGA 5H81A 5KVQA 3A4VA 1Z75A 3GN1A 1MLDA 4DLBA 5KIAA 1IY8A 2NV6A 3NJ4A 4UVGA 3R6DA 2GLXA 1J5PA 2Q3EA 1U7TA 3B70A 1A4IA 1I24A 1VL6A 3W4KA 4J7UA 1D8AA 5CEEA 4CR8A 3MEQA 1YBAA 3UW3A 3GMDA 5IG2A 4B8WA 4GH5A 1X7DA 4J1NA 1K2WA 4FJ0A 4MVJI 1KETA 1OOEA 2R2GA 4IDBA 4WOJA 5CPFA 3E6AA 1I5RA 1QRRA 3AOGA 1W4ZA 3GY0A 3UH1A 2PV7A 4GAEA 1LSJA 1E6EA 1GEGA 4JBGA 3GPDG 5FYDA 2YQ4A 4XA8A 3JYOA 3PJEA 1ZKMA 2H6EA 2ZIZA 4I5EA 3H6KA 2AW5A 3TL3A 4CLOA 1NAHA 1UAYA 2Y1DA 1Q0HA 3ZHYA 2EXXA 3OQ6A 5BNIA 4UULA 1OFGA 1NFRA 1VJ1A 2ZATA 4BNJA 2IZ1A 5AQ1A 5IDQA 3V1UA 2YFHA 4LCJA 5JCXA 2ZYDA 4A73A 4DIFA 3E9MA 3S2IA 2X1HA 4NU6A 3DOJA 4KUGA 4N7RA 4QO7A 4NNJA 3UICA 1PJLA 3DAGA 4FIZA 1YB4A 5F21A 4D3FA 1GAEO 1A7KA 2AXQA 1TVEA 3O4RA 1PWXA 1I3MA 1XGKA 4ITUA 3RCBA 1GCOA 5COAA 4ALJA 1N1EA 2ZTLA 3RBZA 2A4KA 3D64A 4WJZA 4PLGA 1ZSNA 4FFMA 3RI3A 3PWSA 3VPSA 5KJCA 1LLQA 2GN6A 3DWFA 4D3SA 4E30A 3DL2A 2UVDA 1E92A 1PQUA 2O7QA 1K89A 2PNFA 2XXBA 3H9QA 4AJHA 4CLEA 3NDIA 3R1IA 1P77A 2X22A 3IJPA 1LUAA 4R3WA 3BMCA 1VL0A 2O3TA 3HADA 4E31A 4NH4A 2JAPA 1IOLA 4CV2A 2TMGA 1PZGA 1GZ6A 3JQDA 3VDRA 2FN7A 3OEWA 2Y0DA 4LMRA 2WEKA 2YHUA 1HDOA 2VYVA 4WCDA 5K9ZA 5LDHA 1IULA 1Y5MA 1ENOA 1UDCA 4TSKA 1KEWA 4PZCA 4Q3EA 4BKPA 1PQWA 1O94A 1U4SA 4FS3A 4XCVA 4PG5A 3T7CA 4E2YA 4ILKA 3KTDA 1TXGA 3S2EA 2X86A 4DMLA 3STHA 3AJRA 3GEGA 4CM7A 3LT1A 4O0LA 5FEUA 1DRWA 2NUAA 1AXEA 3EDMA 4YAEA 3S55A 3F3SA 4L74A 4CMAA 2HK9A 3ANNA 5L7YA 4CQLA 2FPIA 3AK4A 2GZ1A 3ZNQA 3DZIA 3WX0A 3C1TA 1PGOA 3GN2A 1UP4A 3AI1A 4WKGA 2J5QA 3K31A 3RUAA 5KJ1A 3PYLA 1ADCA 1EMDA 1OC4A 4CR6A 4DLAA 4G5HA 2HQ1A 3KSZO 1Q0LA 1XIVA 4BNNA 2I6TA 3C7DB 3RIHA 5L51A 5L9AA 3D7LA 2PKQP 2CDBA 4R9SA 3U49A 2YY7A 3PZRA 4DVJA 3P19A 1PGJA 1ZH8A 4B3HA 5F1OA 1IYZA 2EJVA 1XQ6A 5JE8A 2AQHA 3I5MA 4P4NA 5CPBA 4TRRA 4O1MA 2EGHA 1PZHA 4EBFA 2FSSA 1P0FA 3OA2A 4Q3CA 5TT0A 2PZKA 3U4CA 1R66A 2OBYA 1VKNA 1HDXA 5TJHA 3BMNB 3TNLA 1RM0A 2ZTMA 3K9QO 4E5PA 1QYDA 3EUWA 4FC6A 5GMOA 4BO3A 5BSGA 5DF1A 3E48A 3CE6A 2FR1A 3QVOA 1P1RA 3CH6A 3ONEA 4FOSA 4ND2A 3WQRA 1DFIA 4WECA 1NTOA 2JCXA 3BMQA 3TFOA 3E5MA 1A7AA 2X4GA 2Y0EA 3F5QA 4YT8A 1WDMA 3COSA 4E21A 3H2SA 4I8XA 3ZN2A 3I9NA 1I2CA 4YB8A 3TJRA 4BL5A 4F6CA 1WPQA 3CMMA 4WUVA 2G1UA 2HSDA 4PIVA 4RQUA 4TKLA 4C7KA 4YT2A 5L4NA 1E1LA 1SO8A 3QA9A 1R0LA 2O2SA 3ZHZA 5THQA 4DREA 3NDJA 2ZB4A 3UCXA 1ZUD1 1PL7A 3GGGA 3I4CA 1M6HA 3ZV4A 4CLRA 4KUEA 4WCFC 4TWRA 3AUAA 4PCVA 4YXFA 1ZMTA 4LK3A 5CFZA 3PHHA 3AUSA 3WS7A 3ZV3A 4S1VA 3OQBA 1YQGA 3L9XA 3WGGA 1AN9A 1QXSA 2JCYA 4BGUA 3RC2A 3VKVA 4WLVA 3LK7A 2P4HX 4FFOA 4OQYA 4ZRNA 4YVFA 2OO5A 5TX7A 4TMFA 5DDIP 1MUUA 4D79A 3ZU2A 3L07A 3LZ6A 1NWCA 2NQTA 5EMHA 3SC6A 4F6LA 3WNQA 1LRKA 4JJGA 4XIYA 2BMAA 3VH2A 4BNIA 2HLPA 2WD7B 2Z95A 4EUFA 4FPXA 3OJ0A 3D5TA 3WGIA 3GGPA 3KXDA 2D2IA 1GDHA 3I9KA 2DC1A 2FR8A 1Z45A 2GCGA 1JU9A 1X1TA 4GSLA 4KDEA 4II2A 1PZFA 1HRDA 1T4DA 2Q99A 3DO5A 4J7CA 4PLTA 4ZJUA 4EUHA 4WLFA 3FTNA 3NV9A 4M89A 1MB4A 4M1QA 5C37A 2FP4A 1EBUA 5ER9A 4RL6A 2I99A 4Z0HO 4MKXA 4BNUA 3HG7A 1YOVB 3S2FA 1UXIA 3UAGA 3JQEA 1DJNA 2AQ8A 3K92A 2HRZA 5DOVA 2QW8A 1NPYA 4J3FA 1ZBQA 5HS6A 5TT1A 4GMGA 4PZDA 5C7IO 2D59A 1U2GA 3BIOA 3DFZA 3WFJA 4L0QA 4B7XA 2DTXA 3VVBA 5BNTA 2PD3A 4MO2A 3PP8A 3G0OA 3QSGA 2Y68A 3W4IA 5TLSA 3OQ1A 4HNHA 1AHHA 1EK6A 2JFHA 4M54A 2OXIA 2FZWA 2EP5A 1U9JA 1E1MA 2ZTUA 2VT3A 1GPJA 3D4NA 4HFNA 2WJPA 4CM9A 2GN8A 4BV9A 4FB5A 2Z1NA 5IZCC 1B3BA 4RF3A 2D5AA 1JKFA 1Y7TA 2J3JA 3GF4A 4GWGA 1XA0A 3FWZA 4IDFA 8ADHA 1QYWA 2H9IA 4CMJA 2JHFA 1U3UA 1RM5A 2JKVA 4NZ9A 3RKRA 2EV9A 4KQXA 4BGIA 1ZCJA 3FNEA 1I30A 4R3NA 1GY8A 2DKNA 1HSZA 1ZJYA 2C0CA 2EW2A 1LNQA 3EMKA 4NBWA 1GUFA 3JD2A 4DGSA 4OAQA 2QZZA 2ZYAA 3U4DA 2D3TA 4JIGA 4LW8A 4J90A 2NTNA 4G81A 4CLXA 1GFSA 5KJEA 4GLOA 3LYLA 1P9LA 3DTYA 5G0UA 3W8FA 2BGLA 1YH3A 3MJTA 1H9AA 2ZTVA 1MXHA 1ULUA 3ZWPA 5IDYA 5DCYA 4D3DA 2X9NA 1GQQA 1PX0A 2EKPA 3NGLA 3EVTA 4BB6A 3ASUA 3MTGA 5LC1A 8LDHA 4ND1A 1FDUA 4P4LA 4XQEA 5JC8A 1OAAA 1FDSA 2DTEA 3HSKA 1ZEJA 3W6UA 5JYDA 3D1LA 5LDGA 1S6YA 3D3WA 1GCUA 3KEOA 2EKQA 3TFQA 1VPDA 5COQA 1V9LA 1N1GA 3PIIA 3MCVA 3WIDA 2R00A 1IHYA 2I76A 3DZKA 4IMPA 3WLEA 4R9RA 4XR9A 5L7WA 5U9CA 4KZPA 2Q1WA 3IMFA 4E0BA 1O9BA 1H2HA 4OHUA 3L6DA 2B5WA 2NTVA 3JTMA 4N54A 2HJSA 1DIGA 1T1SA 2UUOA 1I01A 5CEJA 1HYGA 3F4LA 5TNXA 3UXYA 4UVIA 4F3YA 5DCUA 5IDWA 2NVUA 1E0DA 2BFPA 1DHTA 1B14A 3QVTA 3Q6IA 5B4TA 1YKFA 4FFLA 1QV6A 3FHLA 3A1NA 4RVGA 3IL2A 3ETEA 3HNPA 1CJCA 2HMWA 1Z73A 1MGOA 1P44A 4OM8A 3KHUA 1BDMA 4A26A 3LT0A 3MJEA 4IDDA 1WW8A 4I1IA 3WJAA 1MA0A 3DONA 3ZNOA 3RBXA 1J0XO 4DXHA 5A9TA 2QYSA 4OO3A 1KC1A 4D43A 3WMXA 2JHGA 3OECA 3VOSA 5BSFA 5I7EA 3RUIA 2YDXA 2Q4BA 4B4VA 3ZW9A 4NBTA 1DHRA 4ALIA 1PSDA 1E7YA 3JV7A 4JJFA 1NQTA 2V6BA 3H5NA 3SLKA 3WGOA 1KERA 3MOGA 4FFPA 3LT4A 3W6ZA 5CHEA 1VRWA 1BSVA 3EW7A 5I9MA 3S2GA 3T4XA 1DC6A 2P9GA 4YAKA 3E03A 3ENNA 3JQAB 1HLDA 1NVGA 1FK8A 5ITVA 1MXFA 3BMOB 2W2LA 3HFSA 3G3EA 3KZVA 1NQAO 4R5HA 2QIOA 1ZK3A 3L6EA 1Y8QA 3SC4A 4RV9A 4IIUA 1T25A 4YJGB 4K6FA 3MWEB 2C20A 2X7HA 3ZU4A 5A5EA 2VWQA 3KBOA 4FC7A 2BFMA 4E13A 3E5RA 2OZPA 1H6AA 3WYEA 3CXRA 4E6PA 3RVDA 2AE1A 3Q1LA 5T8KA 3X2EA 2X0RA 2HMUA 1V3TA 4MVJD 5JO0A 4DPLA 2V6GA 1YE3A 4NHEA 1I36A
chains in the Genus database with same CATH superfamily
2C3UA 1X8JA 5AW2A 2JFXA 3OQMA 4GX5A 5JBQA 4QGBA 1P1KA 4KXNA 4W5HA 1CUJA 4EG3A 2YHBA 2O05A 3AKEA 4EYSA 3OE7A 4DNOA 2AUTA 3ON5A 1J39A 2IUYA 3C24A 4MRSA 4RNDB 2Q1UA 2JNWA 2B8JA 4TQAA 1RQLA 2IYRA 2XGSA 1S9DA 1T8WA 2C96A 4I3GA 4LXGA 3WYCA 4BPRA 3S40A 2PGAA 2I6SA 4UVEA 1MOSA 1OPRA 1K0UA 2VBIA 3GWZA 5HKLA 3NWBA 4BNYA 5FPKA 2JD1A 3CEAA 4B43A 5CNIA 1YK1A 4LF6B 1YR2A 2FX5A 1Y8RA 3HFRA 3GLHE 3HSYA 1MIOB 2JI6A 2ZVQX 1C1DA 3AUFA 2F43A 1RLIA 2DBZA 3IE0A 2FA9A 1E3DA 1PIWA 2BKUA 2GJKA 4WV3A 4LDAA 3TH5A 3Q8LA 5HZMA 3PSHA 5BP7A 2BFDA 3VGJA 1DAIA 3H3FA 1XXHE 3FDIA 3GPIA 1V1RA 4F72A 1G60A 4MEJA 3IBGA 1G17A 1YGYA 2J3QA 4E4TA 4HX2A 4BLQA 5FFNA 4KI7A 3HUUA 3GOHA 2XXAB 2YJGA 2JASA 2IXBA 2VAMA 3KAQA 3SEZA 4MIOA 4ZPXA 1JEYA 1Y5NA 3FCAA 1IG0A 1MP0A 3QLVC 4TTQA 1SUPA 1DUVG 1N0IA 2IFTA 2W2KA 4U9HS 3THYB 5IAGA 1OROA 5FTLA 2GBPA 2Q0HA 3PR2B 4J0EA 5EQTA 3L01A 4E70A 4POOA 2EX0A 4C0BA 4XWTA 1T3TA 4Z4IA 1RWOA 4RENA 1S7CA 3LY9A 2GXAA 3IQZA 4LWOA 2NZXA 3KYDB 5FFFA 1DAGA 1YONA 3FB1A 4UHJA 1JGTA 1L7DA 3QXJA 4X94A 3S70A 3TL6A 3RH0A 2WYWA 4AG5A 5T7BA 2G9UA 1XQYA 1TEVA 3UWOA 2ETXA 3F1KA 3JPWA 3SQXA 5CNKA 3H9UA 4LHVA 2QYHA 2W00A 3D2LA 4K6HA 3NU1A 1PNTA 4N7MA 2VT7A 4UQOA 4GMDA 1M34A 2L0XA 3WP1B 4YAIA 3RVQA 1K08A 1UK7A 4QBFA 4YACA 1RXYA 5ALPA 4P38A 5AP9A 4D80A 3D3EA 2C58A 5FJJA 5KNDH 3HPQA 2ONYA 3K0FA 1LSOA 4ZO9A 4DA0A 1BVRA 3ZQ4A 4IQ0A 2RE8A 2XSZD 2C8VA 1U6JA 3TEMA 3OA0A 1ZCFA 4L8FA 4MUAA 1SAYA 4C08A 2BKAA 4EENA 3NCHA 3PVZA 3WK4A 4EYOA 3EUEA 2F3RA 2WG0A 3Q40A 5AKZA 1L1FA 4RTLA 1JR4A 1TCBA 1J8YF 5LOVA 1T2FA 2AG6A 3IBSA 4IVQA 5HVNA 2FUKA 1D2EA 1A8HA 1M3SA 4GWKA 5ULLA 2SICE 4NCXA 2PH7A 4KQEA 4PHCA 1U6KA 3NT5A 3R3SA 3T5TA 1GTJ1 1L9XA 3ZXXA 4EP1A 4DB2A 5L3ZA 2LZ0A 1CUGA 2RGAA 3R74A 3UUEA 2YN2A 3QQPA 4TMWA 4K2HA 1P2TA 1S3SA 4XUGB 3WG9A 1CZLA 4P4GA 4F9FA 4K9OA 3GAMA 4YYEA 2WF9A 1AMOA 1ZWKA 1NULA 5G0TA 1KOLA 1NLYA 3TNJA 4BMXA 1M1YE 3O8CA 5ARDA 1P2BA 2ZREA 2ZM5A 3I62A 3I9LA 2FCRA 3AESB 3E53A 4MV8A 3TIIA 4EY5A 3WIEA 4E6EA 4UMEA 3WGJA 4IH1A 5KQGA 1KI7A 1Z63A 1S0UA 1DTSA 4CM6A 1P7CA 4URUR 5B57C 1T5SA 2QU7A 4K05A 2WJAA 2PZMA 3U7GA 2G9QA 1XEWY 2XNKA 1N6IA 4XWWA 2C77A 3HDJA 4DSZA 3GGJA 4LY0A 2X3UA 5FB3A 1NR7A 4LKOA 4PLCA 5DI9A 4MLPA 4N5LA 4CV3A 3LXMA 5A5GA 2HQBA 4WLUA 4M1WA 1PL0A 5ANRB 3AWDA 3DBRA 4FKBA 2HK7A 2WTAA 2FFBA 1OYWA 4HNGA 4MYUA 5FA6A 3U3KA 3DZ8A 4BUJA 5HZKA 2OO5C 1JG4A 3G8YA 1Y3CE 4C7VA 2ISSD 3LW8A 2O8FB 1Z8NA 2P40A 4LNUA 1CE8A 3ZIUA 2DFKB 2NTJA 4CUKA 1U0LA 4BTLA 4RHEA 3ZWWA 4CHTA 1X7ZB 4CKCB 1C1YA 2RH8A 3KX2A 1P7WA 2DYKA 2QN6A 1RWPA 2BJWA 2A9FA 1E2KA 3IUMA 4YJ3B 3TRIA 1BW9B 3GLUA 1D1PA 1NPDA 2H16A 3EIWA 1Z83A 2QQ5A 1CUSA 1IUNA 1ZZGA 2NW6A 5BURA 5K7SA 1QQBA 4C6SA 5BRNA 5FBWB 2RHCA 2XOXA 3N86A 4FNAA 1YDWA 1ZUIA 4US0R 3QLJA 3QXHA 4CV1A 5U4XA 3FOEC 1RWMA 4JWKA 5FTNA 4AVYA 1NW6A 2WTNA 4GI5A 4NESA 2IS4A 3IA2A 5DTEA 5GVSA 4L2IA 3RRXA 2G9RA 2JLVA 4R7ZA 1BEEA 2BEVA 3GJYA 4Q4AA 5IK2D 4FOPA 4B40A 1YS7A 3KPWA 4NI5A 2I2XB 5K01A 4KQIA 4UHKA 3SICE 4LWQA 4Z0PA 4DHWA 2M1ZA 4B9AA 3CVXA 1C4XA 1E5VA 3HZHA 2QN1A 3JXEA 3HLYA 3MGAA 1NN1A 1K9VF 1QSGA 2NUTB 5K3SA 1GPAA 2WFAA 1EM8A 1OZGA 4UXHA 4Z8YA 3P4XA 1O2DA 4R1LA 1VPVA 4HHEA 2C99A 4JLSA 4LXXA 2LE0A 3QIAA 4H77A 4C4SA 4TZKA 5C8ZA 3U4QA 2WG1A 4KNVA 2B0CA 4TMTA 3VPXA 1D2MA 2HIHA 4DWVA 1UMCA 1FTYA 1QRTA 4JC8A 1ZGHA 3AC0A 4B3JA 3HN2A 1JAHA 1O5OA 2OSBA 2XUHA 3SSOA 2Q3DA 3BWVA 3NHSA 3JPYA 2HJWA 3FPBA 2IV7A 3RRZA 3IEIA 4YRNA 3KL4A 3FBTA 2CDNA 4JBLA 4RS3A 6REQB 3D6TB 2ATIA 3A37A 1VA4A 3VKWA 1ZICA 4YCAA 4DNXA 1V8BA 3CVWA 4KQKA 1O0SA 4BTEA 1SIBE 3WK9A 2D7CA 1VBKA 4E5KA 3AM5A 2ZJ1A 2UXBB 4P3PA 4BECA 1KQ3A 3QG1A 3UW1A 4D9HA 5TE9A 1QORA 3O3NB 3UYKA 2BISA 4JJ7A 4M1YA 3ERCA 3ZY2A 2XUJA 4BYMA 5K2OA 1X7HA 3CV3A 3LFHA 1XDWA 4OB6A 3DAPA 4RACA 1L5QA 5IF9A 2ZR8A 1G42A 3H7AA 4G9BA 2Z0MA 2XZDA 2YWJA 3MWLA 4L9SA 4RO0A 1S9HA 2HREA 3GQBB 3W8EA 4AF7A 2H3EA 2J8ZA 3NHPA 4I5FA 1EE2A 1GV0A 1TT5B 4MJLA 2UVPA 3IDSA 2JFFA 2XTMA 2VDJA 2QWXA 3JX9A 5DCWA 5DLYA 4BVAA 5A04A 1OREA 4R1UA 4C4XA 3GU3A 1WTCA 3REQA 2C5BA 4BVKA 3WJ2A 4ANFA 4CTJA 3WC4A 4M1TA 1WZEA 4IZIA 4DMKA 3FWYA 2XIQA 3ZWNA 2E1RA 2IYYA 3A3NA 4DMFA 1UJ2A 3U44B 4B33A 5FBVB 1AO0A 4KX3A 1VG8A 3D8BA 4UUPA 1JXMA 1F06A 2WMNB 4WEQA 3P7MA 2AHRA 4RADA 1JFVA 5LZ9A 9LDTA 2V7WA 3AFMA 1C50A 2BGIA 1BS9A 2JCGA 2JGEA 4X24A 1JHQA 2WE8A 5L51A 4FHFA 5EY5B 1ZCBA 2XCOA 3EVDA 3MQ4A 1AUPA 4YMIA 1P4SA 3H5RA 3PWTA 3WK5A 3ANTA 5CVUA 4AZ0B 1VIDA 2QAJA 1I4TD 1V9CA 2R00C 2YTZA 3L6OO 2BFWA 2MIIA 4M2LA 1ZONA 1LVGA 2P2SA 3DOEA 4J6FA 1CZNA 4QIHA 2CVFA 4EITA 1P29A 1TCAA 4ND8A 2J85A 4FGZA 4DQUA 1RP7A 3GA0A 2MR6A 1Z4KA 2O0JA 4JVLA 4RNCA 3RIMA 3R75A 5CDHA 5JS8A 3JSAA 5DW3A 4HVCA 3RK0A 5JAMA 1M5TA 4BEJA 3KV1A 3QFTA 1TPYA 4Z4FA 3GLSA 3I8SA 2Z43A 2ACKA 5DT2A 3WWZA 1EVLA 1BE1A 1I1NA 1DDGA 4M1KA 4V0QA 1K8YB 3ZI7A 1HRKA 2C95A 1OX4B 3DBHB 3M4ZA 4KAXA 7GPBA 1ZOOA 3IAAA 4PC6A 5DRYA 4L75A 4R2IA 5ERYA 2AN5A 3CZRA 2XMPA 1Z29A 5DZSA 2ZIAA 1EK5A 1L7BA 2B82A 2ENUA 5F7OA 3H05A 3ZZ0A 3M5PA 3C2QA 2R6AA 3GEDA 5BPFA 5A4IS 1YQWA 4UJ3A 3PQEA 1FS4A 1FL9A 1AA9A 1OU4A 1JP7A 3PR1A 2EOAA 1ZWLA 4CL8A 2VXYA 1Z47A 3DBVO 3H6GA 4NXMB 1MX9A 4MW2A 3I76A 3FLEA 2VZ9A 4BNKA 2K4MA 1ETUA 3KUKA 4LEIA 2OCIA 1TJ3A 1K7EB 3QBJA 5C8YB 1RBMA 1UH5A 1J7JA 3TQHA 1W34A 3KJEA 4EB6B 3GBPA 3HRHA 4RESA 2WK1A 3CRVA 2YV5A 4B3RB 1JYEA 3ROGA 1L7AA 5CG1A 5IVPA 3T1HB 4V3CA 2A9RA 3V9AA 4J29A 4JBYA 4RKWA 4MV1A 3QYAA 4H7EA 3DHNA 3R7WB 5AFSA 1R18A 2FJ0A 2Z2XA 2HQSA 1OIXA 4E5YA 3ME5A 4NK5A 4XD7A 2D7DA 1N5MA 1FZQA 1Y33E 2W0MA 2ZETA 2I3GA 5CYFA 4CN9A 4RVSA 4ZK2A 4OLBA 2RBKA 1KPGA 5ICSA 1ZQ9A 1XXLA 2I1LA 2QSJA 4BRSA 1CQJB 1VJCA 3CLHA 3HXTA 2YQZA 5DGIA 3F3MA 1C30B 4PY2A 4ZOLF 4PYOA 3OZTA 1G2OA 1FFYA 2DUJA 1FDRA 2DAPA 4GLLA 4RF4A 1EXVA 1EX9A 4OXYA 4RFLA 1XWIA 5AKKA 5J5VA 5TQJA 3ZNNA 5IJ0A 5AOVA 1N6RA 1NWHA 1PJ4A 1CEQA 2JJ2D 3NPMA 4YMLA 1TQ6A 5FNZA 1E32A 1NASA 3IOEA 3DD1A 3M6MD 5EHGA 3S29A 3L84A 2FY8A 4AZ3A 1N7HA 1NMEA 4AWXA 5EWJA 1V37A 3AP2A 4B80A 1DAEA 5J4LA 1WBBA 1N2XA 1XVTA 2C04A 3MMSA 4K9NA 1TZBA 4HB4A 1YSCA 1D04A 2CLKB 4YCJA 4LG1A 3JYHA 3LI2A 4KFUA 1NVXQ 3AY6A 3GJSA 5KHAA 1HMPA 2YUIA 1C9JA 1TZCA 4Y2SA 5D7BA 4F7DA 3AIKA 4TMZA 4WNAA 4ZGWA 3N6XA 5K0JA 2GBGA 1USKA 3D4OA 3QFFA 5CD1A 1U1DA 1G5TA 3EBOA 1UK8A 2YFQA 2R8RA 3DBLA 3N8KA 5DU2A 5LP6C 3V97A 3I61A 1JKIA 2W70A 3PKIA 4NFHA 3DE4X 3QF4B 3WL6A 5A7HA 4KFCA 4XIIA 2XUAA 1JLSA 1ZM7A 5E6RA 4B7ZA 3KIPA 2HXSA 3CSSA 1V1MA 4B4WA 3MM4A 1O97C 3IP8A 1CVRA 3M3DA 1T36B 4L0MA 1XJ0A 3U80A 2NLOA 3CG0A 4A0GA 5LPNA 1B26A 3R7LA 5BVGB 3AUJB 4JYPA 5CVDA 1I10A 4E07A 3K2QA 2OV3A 3KYCB 2ZSDA 1NIJA 3LHIA 5JS6A 4KWHA 4QJ4A 1SK8A 1RXCA 3EXHB 2YNMC 1ZI6A 4A0SA 1DLJA 3EZFA 1CUVA 1O3YA 3K1JA 1WP9A 4IYRA 1ZKDA 3FFWA 4FHZA 5CT8A 5BNFA 3PNOA 5I8PA 3UFXA 3AHEA 2AR0A 5CK5A 1NGSA 5COBA 2Q07A 4M1SA 4TWZA 3V2IA 3KCQA 4IV0A 3Q5DA 4W6ZA 3WNVA 1X39A 2C5EA 1YZGA 1JDZA 1LC3A 2Q2OA 3IXQA 3M34A 4Q18A 4DA4A 1OI2A 4TOIA 3DOHA 3DH0A 4CT4B 3N0WA 4M36A 1N92A 2A0KA 2JA1A 3O3CA 4Z2AA 1PR4A 2B4YA 2PX5A 1XMVA 4YH1A 1TF7A 2XRYA 4EG4A 1RJ9A 4PN3A 2O19A 3Q7EA 4HJXA 4MV3A 3BGVA 3BEOA 3I1FA 4ZV4A 4CLHA 3LTNC 2X8AA 5ADUS 1VBMA 1N2EA 3CZMA 5AW6A 4YDSA 5J4KA 3ZGZA 2W2QA 1Z7YA 2RI6A 4IFBA 2IOYA 4RLFA 2VYCA 3GJXC 5L3RA 1IZ7A 4PNHA 4A16A 3H65A 4NZZA 1SBNE 1WRBA 2I55A 2OCXA 4YQEA 3QWIA 3H1FA 4HVAA 4EB3A 4NQZA 4R9VA 1UJNA 2F9FA 2PU5A 3O75A 1XLVA 1KS9A 4H31A 3EGXA 3NRBA 1GZUA 5HTKA 2ZCVA 4HH4A 4MINA 4Q02A 1M73E 4WZBE 4CDGA 1IHXA 4K9KA 3P71T 1J9EA 4B76A 4ZHSA 4QLAA 3Q15C 2CCGA 2X2EA 1SHUX 4NXNB 3EJ6A 2ADFA 3KZXA 1ZS9A 2VUTA 4DOMA 3T1VA 1FNNA 3AF6A 4PSVA 1W47A 2EIHA 3HH8A 4J1TA 4R1QA 4TSFD 4DC9A 2AJDA 5KDDA 1JPJA 4BV2A 3FUTA 4W7HA 2P3SA 1XVVA 3QXSA 4CQJA 2QLTA 3UWSA 3KOZA 2B36A 4NMLA 3HZRA 5CHYA 1PFQA 1CR6A 4AKIA 4H16A 2R6JA 3ECAA 5HBGA 3EZXA 1XDBA 2FJUA 3K5IA 3QU4A 3UK0A 4H1WA 5LIRA 4MPJA 1SXJD 2P9CA 3MB5A 4H6WA 4AYTA 3K1ZA 1Q0PA 1PL8A 1UKCA 2IPAB 2PUJA 1N9ZA 3DHWC 1Y5RA 3JD3A 3OZFA 4PYRA 4TTAA 3ZTYA 4TN1A 4MW9A 1R6AA 2XKJE 5ABPA 4JNCA 2I4LA 4KMOA 1N7IA 5IXYA 1RXEA 2HRRA 1NI4A 3AU9A 3JATB 3KDAA 3DEFA 3G2PA 5D5QA 3KC2A 3AEUB 4KQ2A 4Y6SA 1P2UA 3DFUA 2F3TA 2VJYA 4CN8A 5AI9A 5LP6F 3EDOA 1IMOA 3CINA 1VA5A 4D6PA 2H1OA 1SOVA 2Q45A 1BTOA 5BQPA 1U8XX 4XIGS 5ILGA 1VE5A 3NXSA 2EC5A 1JV2B 3ZE9A 2QMEA 1RVDA 2A5YB 1ZM2A 5MDHA 5CCXA 3U3DA 3DE3X 4LWPA 1YZLA 1C3OB 3RTCA 4OYRA 3R0IA 3U7EB 3W7VA 2PXAA 1R0BA 3WOHA 4FEYA 4JBXA 3HXKA 4ZN6A 3E84A 1MZVA 1QHFA 2OPBA 3H7IA 3CRZA 5F1PA 1EUDA 4E12A 3A3YA 2YZ2A 1EFVA 1NOIA 2ORED 1FA9A 1L7NA 3GDGA 4N0MA 1JT2A 3EVBA 3UG6A 1ADJA 2XNHA 4FKMA 3SEFA 1PFKA 4MMYB 3QK7A 5AJTA 4LZNA 3JWIA 1R9NA 1HYEA 5D01A 2H2DA 4FDTA 1FXWA 5A9SB 3GG9A 2ZCUA 1JSZA 1LK0A 1SHKA 2NO5A 4ND5A 2EW8A 1XU4A 2PMEA 5JRZA 4RHXA 5HQ3B 1BHQ1 1OAOC 3EFBA 3KZOA 4HADA 2J9XB 4S1NA 4GUAA 4URFA 3G9TA 4X8MA 3PFBA 1L5HA 1II8A 4ZVRA 3KJQA 4V2IA 1IQ0A 2ZE6A 1YV9A 1PJTA 4XGNA 2EATA 4FZ3A 3G89A 2Q1TA 1G0OA 3GJ7A 2DUMA 4GKJB 2O5EA 2VK4A 2GUGA 3L1IA 2VPYA 4E5SA 3IH5A 5AVYA 1HZZC 3ISJA 1UFOA 2CKMA 4MS1A 3ULKA 3KJNA 3OKAA 3EGDB 3CA8A 5REQB 4IXTA 4WW0A 4FMDB 4B5KA 3S8EA 4Z4HA 5KBYA 1TW2A 1KK1A 4TV9B 1SXIA 1RU3A 2I8LA 4NZNA 5EFOA 5KTTA 3UMRA 3O4HA 1KJNA 2ZJ4A 5AICA 3OCXA 4IF4A 1MF7A 2FN9A 4ZVPA 5CB6A 5AVVA 3RC1A 3O1LA 4BO6A 3NATA 1Z68A 1ADBA 4IMIB 5D6NA 4I50B 5U1PA 5H02A 1CJMA 4XPIB 1AK1A 5DRTA 2BZGA 3TPFA 1KDVA 3VNRA 2WMDA 3RT1A 3FCEA 3ZJYA 5C8XA 3NKLA 3QMVA 4FVTA 3W6PA 3H4MA 4W7IA 1HI9A 1SA0B 3GAFA 1OW3B 3U81A 5B6PA 3EDRA 3FPSA 4JSTA 2IUTA 1QGDA 2P35A 1SZDA 4RLHA 4XX0A 3T5MA 4EJFA 4KVFA 3B6KA 4Q7EA 5GONB 4MIKA 4C29A 2JFNA 3DEKA 1JB9A 2ENWA 5FOUA 5EOVA 4EHAA 4MPRA 2QYTA 2PSHA 4DIOA 1JL3A 4FFBB 3WQQA 2WJ3A 1XNHA 1V41E 3D0QA 3KBBA 3JVIA 4G65A 4NBSA 4X1IB 5DX8A 1YCDA 2J48A 1RYYA 2OHXA 2QE6A 2YBEA 2YMMA 3MRXA 5AH0A 5EKXA 2OFXA 3VHQA 2GNOA 3RS3A 2YV2A 1N77A 6YASA 4C14A 3R0VA 4PLYA 3FVRA 1UJ6A 4OQ4A 1A5AB 3RWOA 3TIVA 4KGZA 1NVEA 3Q8MA 3C4VA 2PM8A 2R0QC 3VNQA 3SZMA 4XYBA 4DQVA 2P3QA 2RI1A 3WP0A 2VOEA 4M49A 1W96A 3WO1A 1S2GA 5IAAA 1E18A 3NUQA 4HEJA 2WZBA 4H17A 5AOCA 1HE4A 1J99A 1ODKA 1M6VA 1QM5A 2OC4A 3AUTA 4W8GA 4WNYA 4Q9JA 3WLJA 1EUCA 1NJGA 3D5EA 4D45A 4O4IB 1YQEA 2GGSA 2XT0A 3AOEA 4Y9UA 3KQKA 3E2IA 3U9LA 4F97A 1N0UA 2QTLA 1ATIA 3Q11A 1P1BA 5KU1A 3FFBA 3MAGA 3F8WA 2YXNA 3E9NA 1L7XA 1RI2A 4ZAVA 4F56A 2PUWA 2OO3A 4JDUA 4URHA 3VR3D 2I7CA 4R8RA 3BMCB 4ZI3A 1DWOA 3H2GA 4BMPB 2B1RA 3LCRA 3KALA 1A5BB 2RONA 1IQPA 4RYDA 1MQAA 4ABTA 1UOQA 2H7VA 1H5QA 1ODLA 3L43A 1MAVA 4AXXA 1A95A 1R6VA 2ZIVB 4A9AA 1JQKA 2IY7A 2QMOA 4G97A 4IUYA 4PYIA 4OY3A 1TL7C 2P69A 3VR5D 5ITZA 5JLJA 1DTWA 1E1QA 2X8JB 4RFSB 3LUFA 2R8XA 3LX5A 3QBTA 4YRPA 1ZJ4A 4OXNA 2HZ7A 4J0CA 4UBJA 5ESRA 3TW0A 1VP3A 1GKYA 3CISA 3R5TA 4G2NA 1I7LA 1ZP6A 1FX0A 2H06A 2H1FA 4V2UA 3V4VB 3NC4A 5CIYA 2ODPA 3BORA 1WCYA 1UPBA 1C41A 2ZAYA 4IY1A 5B3AA 3TNDA 1HQCA 1HNNA 1UBTS 1P45A 2XB6A 4RU1A 1TFUA 4OHRA 2IY8A 1WEKA 2ZUUA 4FE3A 3WWDA 1J4AA 4RULA 1H05A 1TAGA 3KQPA 4PO3X 2N0SA 2NUAB 4B44A 4LGVA 4QLOA 5IAEA 1SR8A 2OILA 3K9NA 4HXYA 2Q4DA 1LBEA 2PJUA 2XAAA 3BTOA 3OPMA 3ANLA 5FPQA 3YASA 4W5OA 4CQLB 2NZ2A 1E1CB 4ONEA 3CRMA 4ZPJA 3UFBA 2REOA 1LLDA 4Q9LA 3R9IA 4QHSA 5BN4A 1N34B 4NZPA 1H6CA 1J2EA 3FI0A 1NVFA 2CFTA 2J9ZB 1IY1A 2A67A 2EKLA 2GPWA 2XNJA 1P80A 2GEJA 3OJFA 1HETA 3AY0A 4UZFA 1A98A 1I0ZA 1UC8A 3EQ2A 5BUCA 1IB6A 1TIBA 2V6FA 1JG3A 3JVUA 1KBOA 5J58A 1QYCA 3KKNA 2C84A 5CLGA 3DM9B 4F46A 5JV5A 4RVCA 4ENSA 1DRUA 3FR7A 1UC5B 3L3BA 4YRBA 2NACA 3HGTA 4ZEMA 2WT9A 2FH5B 3I01M 1JKXA 4HBZA 2N3ZA 4JLPA 1PUJA 1T1IA 2ZB8A 3EGIA 3IR7A 1OUMA 4YI3A 3UO8B 4CDNA 5HOQA 4QG7A 5KTYA 3SF0A 1QR6A 3E1GA 3QVWA 1Q0TA 2AOUA 1I80A 1K98A 1SU7A 3LG2A 3PQFA 3W34A 3FYHA 2BL4A 3KYIB 4OX9B 1QC5B 3SJUA 4QFMA 3O8LA 3DXZA 4EI8A 3HJNA 1ESEA 3FCUB 4OHOA 5K3FA 1A9XA 1TEZA 4RVHA 4UUAA 1NUTA 1YZQA 3SQMA 4MRVA 4FUTA 3TW4A 3N74A 4IFIA 2PQ6A 2HADA 2B4RO 2QROA 1SBTA 1D07A 1OCEA 3VKFA 4BO2A 3WA7A 3ZWAA 1SB8A 2H7YA 1AZLA 2VA8A 1E3TA 1O94D 3LBYA 4GXNA 4F1KA 3D4IA 3SG0A 1ZC3A 3H0EA 2YZNA 4FYMA 2G67A 1B2RA 4HNAA 3THRA 3OM9A 3T38A 4TVKA 4U7DA 1NKSA 2NXWA 5HMMA 2ZIXA 2IU0A 3ZY5A 2RH5A 3UCEA 5JDCA 5JJLA 2CE2X 4LTDA 5ADHA 1M2EA 2ZVDA 1UZLA 2C92A 4N9QA 4HFRA 3F0TA 1FVXA 2OXEA 4R41A 1LBHA 3RVBA 4CLRB 3I1IA 1T3HA 1DG1G 1VLHA 4M1OA 1XAGA 4LBWA 1AG9A 1J06A 2MJLA 4TV8A 5LQDA 3L92A 1RWNA 1W5FA 3BDAA 4FHDA 4JUIA 4XKJA 5FPYA 3KTAB 3CW2A 4BWVA 2H4JA 4MVJA 3OFVA 1WHSB 1XCGB 1JDPA 5KUTA 4AJ4A 1QFZA 3KSDO 2X7JA 1CWUA 1IPFA 1L8LA 1MG5A 1OASA 2GPBA 4RUKA 3WQSB 4ZCMA 4ZMSA 1YQ9A 3V5NA 4P2GA 3WOVA 4DCMA 1UDRA 3O94A 1OAOA 5AM5A 5T57A 2GHTA 1N2BA 3HN7A 3OESA 4YREA 1GFIA 4QX6A 5FOQA 1ZSVA 1XL0A 4JJZA 1OFVA 1TCVA 3ZW7A 3Q3IA 3OX1A 1D2GA 1H8HD 3VZRA 5K3AA 3J7TA 1X15A 3NFRA 4FW8A 1SC1A 4IO0A 4MDEA 1MX3A 5DO9A 2HWUA 3ZEAA 1SCNE 1HEUA 5DNUA 2R66A 2BWJA 5B55A 1EFLA 5BSEA 2PKWA 3NANA 5GOTA 1CY1A 3DCYA 3LF2A 5AVUA 4DV1B 1DMSA 4GXRA 2CEKA 4WKOA 5E4JA 4BB0A 2GM5A 3OFJA 3CTMA 1MENA 3CH5A 1TU0A 4YA6A 2DFTA 4L28A 2JD0A 3KJXA 4RQTA 2P1RA 1NHGA 5DNDA 3GAAA 3KWFA 1C4OA 1NVVQ 1LW6E 4EHJA 4PG8A 5B7QA 4GF5A 1LD3A 3KP1A 3QVVA 3T52A 2WIBA 3N70A 1VDMA 1YA8A 3MJSA 4HR7A 3OMLA 2CLMB 1X7XA 2Q6TA 3JQAA 2D62A 4M0EA 2PTHA 2HXGA 1B76A 2O0MA 1RI5A 2Q28A 3BMOA 4KYUA 4DDTA 4XH9B 3AIMA 3D54D 1SVUA 5HXAA 2AT1A 1SWWA 3O8BA 5IWCA 1AQJA 1E7RA 1ZK2A 3ZVNA 2GN9A 4ZT3A 1IEVA 5FF9A 4IKEA 3TDKA 2WM2A 2DCUA 3MBIA 3GXBA 2DSTA 3MS7A 4WXRA 1L5GB 1L5VA 3MWEA 5KWVA 1D6MA 3U1TA 3QLEA 2C5SA 4LNHA 1BFDA 3CLUC 4N9WA 3T3MB 2VHWA 1RTTA 4QSHA 3KKOA 5JATA 4C4PA 5GWXA 1EWYA 4Y18A 5ICMA 4I4TA 4Y2YA 1ARZA 2JGDA 5AHOA 4ZVMA 3UATA 3FJ1A 3MXTA 3DMTC 4ZRMA 3JSXA 4WXYB 2WVAA 1X92A 4LX8A 1QQTA 2KYRA 4YEDA 3TZHA 4I4NA 3WDKA 5KVSA 4FINA 1DB3A 4Q7MB 3C3MA 5K3OA 1JHOA 4E88A 1R0SA 2A35A 2PR2A 1TT7A 5E8JA 2UXCB 1WXQA 4L1KA 2BUBA 1JTVA 3R23A 1EXMA 1YRYE 3DE6X 2BUAA 4OF4A 3JQBC 5D3KA 1RADA 3GBSA 4UAGA 5C3UA 3S5UA 2QMQA 2ISCA 4YK7A 5JROA 2QP9X 1XKLA 3CIFA 4O8ZA 2QJRA 5AVJA 3SS8A 3TW6A 4GMFA 3DW1X 4ZHQA 1WDTA 2VJLA 4MCHA 1G8AA 2I7TA 3NIBA 1KH1A 2F3UA 2IF2A 5FI0B 1VPLA 4FCCA 4Q93A 3TSYA 3MTJA 3QVXA 1I32A 1UBJS 2QD2A 3SI7A 2AIRA 1A3CA 1JPUA 4IZHA 1T8UA 4QOJA 3H1EA 1Q7RA 2IUFA 1Z33A 4NE7A 2OQVA 2G17A 3B1JA 6PFKA 1CJTC 1OGYA 1JH9A 4HUQB 1Q95A 4EWLA 1MIOA 3HO8A 4JI3B 3OPNA 4G0QA 2UYCA 2Y99A 5GJBA 3NTRA 3OMXA 2R8EA 5JECA 2HEIA 3AUKA 3N8DA 3PCRB 4D8YA 3IQFA 2XT9A 2HPZA 2D5BA 3IHLA 3LDHA 3LQFA 4B73A 3H84A 4YRCA 4PLWA 5JSZB 2BMEA 2F64A 1T9AA 2IVZA 2QEQA 3UHAA 4PQGA 4FGSA 4J0FA 4BEVA 1BGXT 4ZQEA 4RTJA 2XXAA 2ACEA 3OEYA 5JTTA 2QLNA 3EOAI 5DP1A 4CMGA 2AKAB 4EAAA 4EGAA 4GYYA 4EELA 3AX6A 4KGXA 3R4VA 3V6MA 3THYA 3S99A 1XZMA 2JJ8A 4LHEA 5EGSA 1AQ6A 1VHJA 3IVRA 2GCOB 1X94A 4P58A 3IEXA 1GPWB 4E1AA 4DIUA 4BX9A 3KVVA 4H1UA 1IJFA 3GBVA 5SYMA 3T4UA 4YLEA 3KYDA 2H63A 3ZJUA 3PE4A 3ZI4A 1GQ2A 1PX2A 1BDBA 2C57A 3HZZA 4C88A 3I12A 3ZWMA 3MUFA 3HSSA 5AM1A 3ZG6A 4MUXA 5JG7A 2OAQ1 2QX9A 2WKWA 4XTRA 4YAGA 1EVEA 1M6YA 2EHJA 3KQUA 5TY0A 2VAWA 3T0GA 1GQSA 1X9IA 2W4IA 3CF0A 3CH4B 2GEVA 4AY5A 1Q50A 1HEYA 3STYA 5AUQA 3VOBA 2PAAA 3H5AA 4HY3A 4KJXA 5T6BA 2QM7A 4PZUA 5JPIA 2BEKA 3O3OB 4FBGA 2HC9A 2QAIA 4G2TA 2NVUB 2QTAA 2GHIA 3KJFA 4LMBA 4PRYA 4TLBA 5AQEA 4HV4A 5HMLA 5A03A 1Z4IA 4FGKA 2OKGA 2X41A 1G3UA 2WHYA 3C97A 4G6ZA 4JI0B 4J43A 1Z6AA 1D4FA 2WIDA 4PFKA 4BGEA 4BNDB 2AFIB 2C2KA 4NPHA 3LFUA 4Y9SA 1KYWA 3UG7A 1ZHOA 3VKHA 2WAYA 3GUZA 3DDZX 2V54A 1UXGA 3TKYA 1YJBA 3TTWA 2CLLB 4MW5A 4KEAA 3FG9A 4CU5A 4CUJA 4LYJA 3PA6A 2FEMA 1E1RA 5HQJA 2BGKA 1JIUA 2FQ1A 1BYIA 1J8QA 1Z74A 1Y5LA 2DQSA 2IPNA 2VH5R 2IL1A 3MA0A 4N8EA 1QG0A 3Q6NA 4LYHA 1TYCA 1RDFA 2FSVA 2WDPA 3UJHA 1QKIA 2H52A 4D0SA 3MJCA 4AG6A 3AINA 5AJYA 3JCZA 2H29A 3MD9A 4MIEA 4Z3OA 1UAAA 3LD9A 1CJUC 2ILTA 4GZLA 3EDQA 1YBFA 4ZU3A 3NAMA 2ZG6A 2HUPA 3LKZA 4K46A 2WPDD 1D9ZA 2FU5C 3KXPA 3MT8A 3VAZA 5JU6A 3D7SA 2O23A 4MP8A 4J16C 1YFZA 4LSGA 3AESA 1YL5A 4HH1A 3THOA 3OOWA 2VXCA 2YIVX 3OFNA 4BNXA 2FDXA 1LDGA 4Y6RA 5BPHA 2Q41A 3LECA 3TTSA 4EI9A 3GNQA 3U60B 1JG2A 1W76A 4X60A 2VZ0A 4YJKA 1DDOA 3GJRA 2H4FA 4Y9DA 1K5DA 4PEVA 1TC1A 5AM4A 1EX1A 4C3VA 4BQEA 4MUHA 5IKOA 1VIMA 2B4QA 2JAHA 4M21A 1PJ2A 3ROEA 3AIIA 3OTOB 5DV9A 2J0QA 5ECYA 3OH8A 1UBSB 3G02A 2G76A 5CDUA 4OK3A 2KW5A 3NASA 4FFVA 5CFMA 3PITA 4DF3A 2G71A 1AMNA 1XLWA 4BO4A 3SXPA 4DDUA 1KAGA 3HRIA 2ZUDA 3FXAA 3HM9A 2HK8A 5B64A 3CWQA 2ZYTX 4YRRA 1YDHA 3R0XA 1YR3A 4BJ1A 4ZZIA 3AVOA 3TUZC 2EG9A 1XZDA 2WSIA 4BJHB 3CQ9A 3H1AA 4CNBA 2O8FA 5KX5B 1AOXA 3KLMX 2C88A 1W0JD 2QN3A 2IH4A 1Q3KA 2OD2A 3IPXA 4NAUA 4PHHA 1OKKD 1V3QE 2LGJA 2AJBA 4LYDA 4QYTA 1ND5A 4CKBB 4PXYA 1Z6TA 4KYIB 4L5AA 3S1LA 2W6QA 3STTA 4AIIA 4YJ3A 5I8WA 1BW9A 1CX9B 3CNNA 2WY2D 2RH4A 4PZ0A 1WPRA 1YGPA 3LUDA 5LZ7A 2V4ZA 2AEFA 3ZWCA 4KMRA 5EP2A 3W2TA 3FRIA 3I4LA 2IYZA 2VJQA 1E3LA 2JAUA 3P5SA 4DPMA 1A9QA 1H1DA 1P7YA 2CXUA 4OQLA 1O4WA 2W11A 5CLLA 2AC2A 2CY0A 3HYRA 2LD4A 5L3VA 5HW0A 1B0PA 3FHCB 4ML3A 1W36D 2E4YA 3STXA 3O3MB 2IHNA 4HSEA 1XHEA 1NSYA 3INNA 1ZRNA 1CRQA 2PKEA 3M1YA 3KFLA 3PGJA 3S7ZA 4DIDA 4F2HA 1H3NA 5G4LA 3HKBB 5SY6A 2PGLA 4X20B 2NUTA 4B2IA 3CIOA 4C0LA 1DLIA 2H1WA 1FOEB 2GAFA 5A2GA 3A32A 2YN4A 2H4WA 3EA5A 4EJSB 3KS9A 2W8ZA 2YHIB 3OPXA 4YCSA 4YYZA 4WE3A 3IUSA 2VZLA 4H08A 1N2JA 3RUEA 2CXOA 1TZMA 5HR5A 1KMCA 2YDYA 3GT3A 1C4KA 3ELDA 4ZO7A 3WAGA 2B35A 3W9SA 3CE9A 5GZ1A 4L50A 4BZQA 3LUPA 1MJGA 2D8MA 2OHFA 3GFPA 5CM2Z 3RSLA 3U3MA 5D6OA 1XRMA 6REQA 3EPJA 4HLDA 2FZLA 1IVSA 1Q1GA 2P3LA 2A58A 4XDYA 4ZO6A 3FYUB 4GYJA 3AYXB 3DAFA 1JLHA 2I33A 4DC1A 1NL3A 1JHMA 1HL3A 1NYQA 4P3XA 4FLFA 3RO7A 4YAFA 3AV0B 4KR0A 2ZJ7A 1KJWA 3FUWA 4MRPA 5A2QA 4ZWNA 1MG0A 5CX4A 2CFCA 4XEHA 2FNAA 2LBPA 2HSEA 3H2BA 2AA3A 3RABA 3U62A 4DKXA 1DQNA 2BI8A 3RS2A 4TKMA 3THXB 3RB8A 1EVIA 1Y8ZA 5E4YA 2PHZA 3ILSA 4G0PA 4CMKA 1KVUA 5CDSA 4FBMA 5AJXA 1J6UA 1H4VB 3WK8A 2NWQA 2W58A 3BGSA 4CM5A 1WVMA 3DWGA 4QBIA 1TT5A 5DM0A 5JJKA 2C7GA 1VB5A 1BKYA 1NT4A 3LYAA 1ZFNA 1H23A 1Q7BA 3FH0A 1HKUA 3VUFA 1E62A 3I8XA 4JEHA 4CU2A 5KYNA 2BSAA 2IU6A 4LY3A 3Q72A 2E4AA 2ZVPX 2DFNA 1KSJA 2V59A 3AVQA 5EMNA 3U44A 1RWBA 1TDJA 3A1FA 3L0CA 5B36A 1NVMB 4U8GA 1I3KA 4BNMA 2OLJA 2POQX 5JAZA 1PVDA 4CIAA 3PNBA 1EKXA 2ZAGA 1FFDA 3RC3A 2XGMA 5LM3A 2OPHA 4D9IA 3HV2A 3L0OA 1E6KA 1LBQA 3F6BX 4CEIB 2HPVA 1KZ7B 2HMSA 2JBHA 3QY0A 3ORRA 3LH5A 1ULBA 4ZT6A 4F85A 1H6DA 1B8PA 1BCRB 3QH4A 4W5QA 4PLHA 4R3UC 5DTJA 1UF9A 4O2AF 1O8CA 3G59A 4AZ0A 2F1OA 2WSLA 1SC4A 1ZO8A 1BX1A 3I6IA 1RZVA 2R7AA 4YRQA 1NRXA 4JJKA 1XF9A 4UTRA 3RD5A 3BB1A 3E0QA 4CG0A 4PYJA 2Q3LA 1VRVA 2ABWA 2HA5A 3I32A 3L7LA 1Z12A 3NJ8A 2PUBA 2OBNA 3N0XA 4I9HA 1KAOA 3QKWA 4DJFC 3RG8A 1T2EA 1Y6JA 1G59A 3WA6A 2Y9PB 3A6EA 4AWBA 4CIYA 3D6FA 3I1YA 3P9SA 2YJTD 3UM9A 2Y4NA 2FWBA 4KJZA 5JAOA 2B2NA 4FNGA 3G88A 1EVJA 1OX4A 3DBHA 4YRJA 2FDCA 4PG6A 4RE5A 1XKTA 5JXJA 4BB9A 4N39A 1PJCA 1WBJB 3GA5A 3INRA 4QGGA 1XP5A 2PUGA 2FMUA 4JB3A 2XRZA 3C45A 3ORFA 3LNCA 1IPHA 5T5QA 4X65B 5DB4A 1I2DA 3INGA 1II9A 4AD8A 1NVKA 2Q7XA 2B92A 1RI1A 3LRPA 2BT4A 4TLEA 3AM1A 3EWAA 4FT4A 2BF7A 2OQIA 2F9MA 3NHZA 3JQ7B 2QTBA 2ZT8A 5ALOA 3K5WA 4ZFNA 2DR2A 5C8YA 4B7CA 3P9IA 1E1KA 2QI9C 3EB9A 2DFPA 2B4KA 2AR7A 3OLXA 1Z17A 3QFSA 1WUYA 3GFFA 1H2YA 5E2AA 4EB6A 4EA8A 3O4JA 2Y3IA 1L3CA 3QXGA 1T43A 1JDNA 2FDRA 3MCAA 1M54A 3Q0EA 4G67A 3DWIA 1QYXA 2EZ8A 3L4BC 3T12A 5A0VA 5H5JA 3OLVA 4HPJB 4TYPA 1DUIA 1TM7E 2FQXA 4FLEA 1IPEA 4Y1GA 4R2WA 1ZGCA 4OFXA 3NM5A 3R7WA 3GL9A