4HUJA

Crystal structure of a hypothetical protein sma0349 from sinorhizobium meliloti
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
204
structure length
204
Chain Sequence
NLYFQSMTTYAIIGAGAIGSALAERFTAAQIPAIIANSRGPASLSSVTDRFGASVKAVELKDALQADVVILAVPYDSIADIVTQVSDWGGQIVVDASNAIDFPAFKPRDLGGRLSTEIVSELVPGAKVVKAFNTLPAAVLAADPDKGTGSRVLFLSGNHSDANRQVAELISSLGFAPVDLGTLAASGPIQQFGRPLVALNLLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein SMa0349 from Sinorhizobium meliloti
rcsb
source organism Sinorhizobium meliloti
molecule tags Structural genomics, unknown function
total genus 56
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4hujA00
1T2CA 2JFHA 4WLOA 3TZCA 3OMLA 1LLCA 4XB1A 5GZ6A 3EUWA 2BFOA 1NX6A 2CFCA 4AJ1A 3PJFA 4J90A 1UUFA 2X5KO 4FIZA 5BSHA 1E7SA 3PFFA 2Y0EA 5EJ2A 1U3UA 1HYGA 4EUEA 3W4JA 1XGKA 4OOFA 1RM4A 2EP5A 1SEPA 4GX2A 2BD0A 4HY3A 4DLLA 4YQZA 5TLSA 3NDJA 1SOVA 3UKOA 1EDZA 1ISIA 1F8GA 3LF1A 3P19A 5CDSA 1GL3A 1BSVA 4LVUA 2Y0CA 1UR5A 3K92A 1NHGA 1XSEA 3GG9A 2HJRA 3PHHA 4BKPA 3PRJA 3PJEA 2NTJA 4IXTA 4ZQEA 3VKUA 1UZNA 1SB9A 4BNUA 4E33A 4E0BA 4ZA2A 4M89A 5H82A 2QYTA 1E1LA 3I6QA 4HADA 3WQSB 1HZJA 2VT2A 1H6DA 1XQ1A 4RJTA 5AXAA 2BKAA 1E5LA 1PJTA 2D2IA 2EF1A 2FR0A 3NJ4A 3OJEA 4CMCA 1Y7TA 2P2SA 1Q0QA 2DBRA 3M1LA 4CODB 3KVOA 3AU8A 3EHEA 3AY7A 1DHRA 1IHXA 2DKNA 4XGIA 4MVJF 5KWEA 2HUNA 3L6DA 5JCXA 2ZCUA 3DZBA 2UVDA 5TJHA 1GCUA 4A10A 4UUPA 2YHUA 3OH8A 2PKQO 1I33A 3IP1A 3PIIA 4DQUA 3RJ5A 1WP4A 3KYCB 2DTEA 3FF4A 4P38A 1P0CA 2JHFA 4AJLA 3S2GA 5ICSA 5JAZA 3RUAA 3V2HA 5C7OO 3VKVA 2VOEA 5G0UA 4GKVA 4U6SA 1UH5A 4CM9D 1B7GO 2FOIA 3ZWAA 3ON5A 4TVBA 3M6IA 4GLLA 5DNAA 5I8ZA 4GX0A 3ENNA 4Z9FA 3DO5A 5BR7A 1X1EA 3AFNA 5FI5A 2GN9A 3HG7A 2G82A 4YT8A 1Z74A 5LDGA 2EERA 5JW6A 2OBNA 4FD3A 4WECA 5FYDA 1PGQA 1R0SA 1VRWA 2OOSA 3RC7A 4RCVA 1LU9A 4IIUA 1QLHA 1MGOA 1L1FA 3AUSA 2P9EA 2WD7B 4CUJA 5JDIC 3WGQA 2C29D 4GAEA 2NUAA 4UEJA 1HLPA 1UJMA 4PLYA 5CEEA 4BIIA 4HFNA 1KEPA 2PWZA 4M55A 1PZFA 5A02A 4U6QA 1Q1NA 1Y8QB 3U5TA 5AXCA 1K6JA 3RU7A 4QXMA 1WZIA 3L9XA 3RUIA 5JYEA 4U7WA 1C0IA 3ITKA 1VJ1A 3JQFC 4HXYA 4EJ0A 3QVXA 4YAKA 4E30A 1O8CA 2VZ0A 3DAPA 3CE6A 2B0JA 2PZKA 1OMOA 4Z9YA 4BHTA 1KVQA 3OFSA 4URFA 4DPLA 4IY1A 1ZCJA 1D8AA 1O94A 2OHXA 1NPYA 3EZYA 1W8DA 2Y68A 1HE3A 4XQEA 3TZ6A 4W82A 3LLSA 3INGA 2FR1A 3U49A 2JD0A 3C1OA 3GEGA 3W8EA 1U7TA 5KVCA 3HDJA 1ZW1A 3ULKA 1N1GA 3S2EA 5U4QA 4DIBA 1EBFA 4BNIA 1X14A 3D4OA 4DC1A 3WR5A 4BGEA 5IN5A 3GY0A 3DBHB 3W6UA 2VRCD 2VYVA 2PLAA 1K2WA 3GRKA 3PEFA 5COAA 4FGWA 4Q3DA 4QO8A 3TRIA 3X2EA 3A06A 4E5KA 4Q3NA 5I7FA 1LQTA 4W4TA 2W90A 3NTRA 4C7KA 1NVTA 2CSUA 4BNMA 1D7OA 3SJ7A 4CLEA 5DBIA 2CNBA 2C5EA 3W1VA 4U0KA 5I7VA 4QSMA 2ZYDA 1A71A 4EUHA 1T24A 1WLYA 3GDFA 1I32A 3GF4A 5IG2A 4PLGA 1ZK4A 2PR2A 4DPMA 1VL8A 2VWQA 5BSEA 1EBUA 3GMSA 2A9FA 1BGVA 2GASA 3D0OA 1YBVA 3HDYA 3I9LA 4J1SA 1DAOA 4Q9NA 1KVUA 3E1KA 3S2FA 2WD8A 3JQGB 1DC3A 3K30A 1VJ0A 4MIYA 1T4DA 3LK7A 1I2CA 4FFPA 4E5YA 1DLIA 1XKQA 2FSSA 1Q7BA 2ZB3A 2YUTA 2DPHA 3WOHA 2GLXA 4LVCA 1BDMA 1XDWA 3PYXA 3N74A 3E18A 2BMAA 2VYNA 1PJBA 4NHEA 4PGFA 3UH1A 2V6MA 2EHDA 3G3EA 3I9MA 4H7PA 4HNHA 4XYLA 5B4UA 4NFSA 2BHLA 3NGXA 4CMHA 2VCYA 4CV0A 4EEXA 5IAAA 4D3SA 4B4OA 5I9LA 4KTVE 2O3UA 2X9VA 4ZVVA 2I99A 3I4CA 3D5TA 1NR1A 1HYEA 3RBXA 4HNGA 1Y81A 2QW8A 3QVTA 4XKJA 2BI8A 4LN1A 2C2XA 2FMUA 1T26A 4BNKA 5GZ3A 1MX3A 2XPCA 4NBWA 3FTPA 2W4QA 3AI2A 5CAEA 1HDCA 3COSA 2NLOA 1ZSVA 2X7HA 1MFZA 1PSDA 4PLTA 3ZV3A 1H94A 5EQFA 4R3WA 3G49A 4JX8A 1JKIA 2V6FA 3DL2A 3I1JA 1X1TA 2IODA 1MV8A 3AOGA 1ENOA 2A94A 4MVJP 3QQPA 5EESA 2UAGA 4KMSA 4OSOA 5CFZA 1QKIA 4ZU3A 5JY6A 3GDGA 3KEQA 5JO9A 4MP8A 3U62A 1QR6A 4QO7A 3BTVA 2D59A 3UCFA 1XHLA 1LSSA 1QMGA 2GN6A 2W2KA 1VL0A 1LDEA 4GKBA 2ZCVA 3JYOA 4R1UA 4ND1A 2NTVA 3RFTA 1E7YA 1K0UA 1B8VA 3N7UA 1B15A 5JDCC 3WDSA 4FOOA 4D7AA 3MEQA 3F46A 2VT3A 3MOGA 2VHXA 5A9SA 3PPIA 3I9OA 4K6FA 3KYDB 3NAQA 4P4NA 1R66A 1R15A 1YKFA 4R51A 3AUAA 1HXHA 3WXBA 3ZV4A 2CDAA 1PR3A 2WM3A 4R69A 3L07A 4A2CA 1YB5A 2BH9A 2GZ1A 4CQLA 5JC1A 4BGIA 1YJQA 3BYZA 2WMDA 3RC2A 2YJZA 1E7MA 4JQCA 2FP4A 4LW8A 4CLOB 2HK9A 2NADA 2J3JA 2CY0A 4I5EA 3DHEA 5C37A 4GSKA 4XIYA 1NFFA 5JS6A 1KC1A 3VPHA 5L7WA 1CQJA 1X0XA 2IEBA 2B4RO 3K31A 1ZEMA 3T7EA 3WJ7A 1KEUA 1WWKA 2I3GA 4PIVA 1UP7A 2F1KA 1B14A 3G17A 4Y9DA 1FF9A 4AJJA 2BFPA 3GUYA 2DC1A 5EERA 3TOXA 4QUKA 4ND4A 3LSYA 4J7XA 2PTGA 1YJ8A 3O8QA 4P8RA 1YOVA 4RF5A 3MCVA 4ID9A 1SEVA 2HSDA 2I5PO 4PLZA 4M49A 5C7LO 4OKNA 2I76A 2WTBA 3EZLA 3GFBA 5IDWA 4YAGA 4J1TA 2O3TA 4WCFB 2VYVD 4YACA 3G79A 2Q4BA 1ID1A 2WJPA 1A9YA 2X0NA 3HB4X 4E5MA 3TNLA 2DUWA 3BHMA 4NJMB 4A0SA 2PD6A 4PVDA 2CVOA 2UDPA 4CM4A 4NBRA 1ZK1A 1TT5B 1ZNQO 3LC7O 5B4TA 5CG1A 4N5LA 5L3ZA 4KZPA 1GU7A 3CZRA 1YRLA 4J49A 4CLRB 5L7TA 1C1DB 5JE8A 4M1QA 1FDWA 1PWZA 4PG6A 3I9KA 3CZMA 3IL2A 3IKVA 1LTHR 1DXYA 2GR9A 4RVUA 4YRAA 1NXQA 1L7DA 2QZZA 1C3VA 2GF2A 2FSVA 2W8ZA 3K73O 1E1MA 1JW9B 4Y8VA 2VOJA 5CDYA 3WS7A 3WGIA 4UVGA 3BMQA 1M6WA 4MVJM 3RC1A 2I66A 3JQFA 4D79A 2QX7A 3RUEA 3GLQA 3TZQA 5L53A 3I5MA 3QE3A 2EKQA 4Z3KA 1DPGA 4XD2A 1YL7A 3M2PA 3SLKA 5JPIA 3UFXA 1ZMTA 4XRGA 1WZEA 4N5NA 2VYND 3FNGA 2NVUB 3STHA 4BNGA 5B4VA 1E3SA 3MOIA 3GHHA 1ULUA 3EDMA 4BNJA 1TB4A 4ND3A 3WYBA 2C2YA 3AY3A 4L9RA 1LI4A 4OXNA 4RGBA 3KM0A 5CP8A 1B16A 4Q3BA 3FI9A 3O03A 8LDHA 4XIJA 1VM6A 1NYTA 5TIIA 4W7HA 3PLNA 1B3RA 3S8MA 4IDCA 4GSLA 4I08A 4YT2A 1IZ0A 3JQ9A 5HBRA 3A4VA 1DC4A 1MUUA 2D5CA 4IDFA 2ZB7A 3WMXA 5KIAA 5IDXA 3ORFA 1J6UA 4IUYA 1H6AA 4XR9A 3B1JA 3MJEA 2IZZA 3PK0A 4R01A 3UAGA 3KB6A 4WE3A 3PQDA 4XR4A 1GZ6A 4E21A 5A05A 2FPIA 4OKIA 3OA2A 2IYPA 3WGGA 5L4SA 2JHGA 1ISGA 1P1RA 2R00C 4Z0HO 5JO0A 3CMCO 4M54A 3R6DA 4NFYA 4H15A 3SBOA 3WNQA 1JN0A 4DYDA 3CINA 5IN4A 4LSWA 3VPSA 3JYPA 4MVJH 4WNCA 5CHEA 5G2OA 4FN4A 4BB5A 2NNLD 1P1FA 2PZJA 3D3EA 4PLFA 3UOGA 3V1TC 4DQVA 3AU9A 2VUSA 1M67A 1XYGA 1PS0A 1CDOA 3QVWA 1NFRA 1HDGO 1M76A 4ZHSA 4J91A 4TROA 4GWKA 1YQDA 2YHIA 5A03A 4PLHA 3I3OA 4RVGA 3ZU5A 2BLLA 1LXCA 1LSUA 1IUKA 3WTBA 2POQX 4C7JA 1IOLA 4DWVA 4E2XA 4Y6PA 3AI1A 4L74A 1S6YA 1U3VA 4DMLA 1U2DA 2UUPA 4J4HA 4GH5A 4ZICA 3WGYA 1ZJYA 2Y1CA 3OJFA 3OEYA 1ADCA 5DCUA 3GHYA 4EYEA 2GZ3A 4I1IA 3RIHA 3QVSA 4N18A 1Y1PA 2C59A 3PYLA 3KSUA 3NYWA 4KQXA 4DIOA 5L4NA 3V1YA 3WLEA 4GBJA 4IJUA 4AJOA 4BO7A 1EVZA 3C1TA 2HMWA 5HS4A 1H9AA 4DIFA 4GMFA 4XJSA 3AJRA 4LISA 1WAMA 3GVPA 4HX5A 4BNYA 1IE3A 1RM0A 3PHJA 3A1NA 2X9GA 5JNLA 4XA8A 2HRBA 2Z1NA 4L76A 2HJSA 1H6BA 4RVFA 3A9WA 3EAGA 4XEHA 1MG5A 1U3WA 3H6KA 2YDYA 2JCXA 3HHPA 3HZZA 4BL5A 1LSOA 2V6BA 1ADFA 1N92A 4II2A 1WVGA 3LC1O 3VTFA 2EW2A 4IM7A 4EUFA 3KETA 1P0FA 1JU9A 2I6TA 2ZYAA 2P91A 1N5DA 4R16A 1PL8A 1ADBA 1QYCA 3N58A 1DRVA 1YGYA 4JP2A 2DUUA 1HYHA 3DEYX 3CMMA 4ZN6A 5ILOA 4XYEA 1G1AA 1SNYA 3D64A 3WGTA 3ZWNA 1V3TA 1NAHA 3OQ1A 1IYZA 4NBTA 1KERA 3DOOA 4ALJA 4MIOA 3ETEA 1GR0A 2HMSA 1YE3A 1WMBA 2C82A 2VHZA 3PVZA 3QIVA 4N54A 1HSZA 5THKA 3WIEA 2O2SA 4FJ1A 3W8DA 2E48A 3H9JA 3W4IA 4E13A 1P1HA 2JCYA 3ANMA 4B3HA 4R1TA 3NUGA 3ROMA 1AHHA 4NQZA 4DRYA 5BNIA 3FBGA 4UVHA 4LRSB 2DPGA 1PJCA 1U5CA 4X54A 1C1XB 4WLUA 2YFQA 1DIBA 4RQUA 1DIHA 3NDIA 1W73A 1PU2A 4ILKA 3TOZA 1R0KA 2NU8A 4IDGA 5T64A 1DAPA 1QYXA 3F5SA 1EUDA 4IZHA 2VTEA 3ZU3A 3OIGA 3VAZA 3TQHA 5KNLA 1C14A 4YAEA 5FF9A 3UXYA 1D1TA 4GQAA 3OIFA 2Q4EA 3P7MA 2GD1O 1EQ2A 4FJ0A 4PLCA 1GEEA 3KEOA 1MG0A 4WOJA 3NEPX 3I6IA 4IDEA 1FK8A 2JD2A 3D3WB 1RYDA 1NR7A 1RYEA 4I5FA 4RPLA 4DUPA 5B1YA 1ZUD1 4GGOA 4MVJE 5BQFA 2DBQA 5BSFA 1I3NA 2V6GA 5DP1A 2Q50A 3OECA 3ICPA 4FFRA 1T2FA 4YJFB 1QP8A 3IUPA 3FWZA 3IQDB 5JMPA 3PQEA 1GEGA 1WMAA 4CM8B 2Y93A 3P2YA 5KKAA 2VHVA 4FQ8A 4CMIA 5K6AC 1YVEI 3RCBA 1B2LA 1B8UA 4PRLA 2PZLA 2B83A 3KHUA 3U09A 4Z9XA 3JQDA 4PLPA 3DBLA 5TF4A 4Y6RA 4RZIA 5F1PA 4HWKA 2FZEA 1LEHA 1EVIA 1M2WA 2HMVA 1R4NA 4W99A 1K3TA 5C7IO 3VZQA 1XA0A 3LDHA 4R54A 3H7AA 2AQ8A 1E6WA 5I7EA 2Q3EA 3MJ4A 2NWQA 2H1SA 4BNXA 1I30A 1J5PA 4W6ZA 1GUYA 2HMTA 4RPHA 3CXRA 2RHRA 4YCAA 4BMSA 4RF3A 4BO4A 4EBFA 3R1IA 5KKCA 1GUZA 4CMBA 1HDRA 1A5ZA 2J3HA 4FC7A 3OEWA 2HAEA 3FR8A 3TFOA 3EY4A 4NPCA 4BO6A 3SJUA 3JQAA 1TA4A 2AW5A 4MVJI 1I0ZA 5DT9A 1YXMA 4ZRNA 1YONA 1ENYA 5IJZA 3BHJA 3QP9A 3DAGA 1R37A 4AJ4A 1V8BA 5G0TA 4BNHA 4YEDA 2GRAA 1EVJA 1HEUA 3OIDA 4W9NA 3TL3A 4YJGA 1BXGB 4Y98A 3WTCA 5FFFA 3CH6A 3DOJA 5L4LA 2GGSA 4ZQBA 5AOVA 3JQ7B 3C1AA 4XDYA 4FFOA 2IZ1A 1PJSA 4A7PA 4CM6A 4CM5A 3H5AA 3OHSX 4HFJA 4PG7A 1EEHA 1QORA 2GZ2A 5JAIA 3SVTA 2R00A 1PZGA 2C0CA 4ROSA 3RUCA 3LT4A 3PDUA 5EINA 5MDHA 3MTJA 3PDJA 3GGGA 1RM5A 1QYWA 2O4UX 4I9NA 3VC7A 3GOHA 1NWHA 4HFMA 2NU7A 1H93A 2HRZA 4OMUA 4QECA 3K6JA 2IXAA 5DP2A 1LBEA 1IULA 3RBZA 3ZN2A 3GPIA 4YJHA 2HU2A 3SX2A 1CWUA 2OXIA 4MO2A 1BW9A 4RDIA 1H0KA 1M6HA 1EE9A 3WJAA 2FPGA 1U8FO 2QHXA 3LT1A 4I5DA 3JQ6A 5JFOA 4E5NA 4E3ZA 3GNTA 2AQHA 4CPDA 3TF5A 3HJAA 1AE1A 1ISHA 2BELA 4J0EA 2Q1UA 5ER9A 3JQ8A 2O7SA 1HLDA 3F9IA 1KIFA 5JAMA 3HWRA 3IS3A 1VKOA 3RI3A 4K9DA 2E82A 1B8PA 4NIMA 5A9RA 4WNIA 2Q1TA 2H5LA 2A4KA 4JIGA 1SZJG 2C5AA 4BB6A 2X0JA 4DL9A 1ORRA 1ZBQA 4XX0A 3NTQA 3RU9A 2BGLA 4HKTA 4XQCA 4B7CA 3UUWA 5KOIA 1PS8A 1X7DA 4YDRA 1EVYA 1E3WA 3JQ9C 3E82A 1K5HA 4J3FA 3GK3A 2G17A 1KVRA 2AMFA 1DIAA 3FTNA 3KTDA 4XRRA 7ADHA 3D4PA 1Y9AA 1MA0A 3PWKA 1NPDA 1CETA 5AYVA 3KBOA 1GCOA 3VPFA 4XGNA 5HM8A 3IAHA 4XCVA 1HE5A 3M1AA 2C7GA 2EKLA 4KP7A 3WWYA 3L4SO 2TMGA 6LDHA 3WBFA 4AVYA 2ZTUA 1TVEA 1G0OA 4FR5A 4O1MA 2Z95A 1JDJA 5CPBA 1A4IA 4HFRA 1IPEA 1J0XO 1V9LA 2HK8A 3O8QB 4WEQA 4A27A 4R3NA 3GFGA 5I7SA 4TKMA 1OI7A 3BHIA 3TN7A 1RM3A 4JJIA 1P44A 3C85A 3Q2KA 1DJQA 4J4BA 3GEMA 4GGPA 4MINA 3RQSA 5TRTA 2G5CA 3KLPX 4A5OA 2CMDA 3HN2A 4P4GA 4JBHA 3PP8A 2I65A 5CEJA 3GA0A 3QVOA 4GWGA 5COBA 2CF5A 2W2LA 1AXEA 4OGWA 5T8KC 3CEAA 4AG3A 5CDTA 2GN8A 5LCXA 1S7CA 1EE2A 2C07A 3AUTA 3GNSA 1ZK0A 4IZIA 1B3BA 2EXXA 4BKQA 4BUCA 3U9LA 5CG2A 4GX5A 2E4AA 5THQA 4BV8A 3HNPA 3EC7A 2Q1SA 3JYLA 3O26A 3JQCA 1HE2A 2BRUA 4J0FA 4BGVA 4PG5A 4PN3A 4CMAA 3JYNA 3KYCA 4WLEA 5L95A 1GD1O 2Y67A 1PS9A 3NT5A 4NFHA 4ZQGA 1KVSA 4RZHA 1SC6A 3OM9A 4B4WA 4IQ0A 4CQMB 3KUXA 4EGFA 1NQTA 3QV1A 4LK3A 2GO1A 2DAPA 3E03A 1EUCA 2NVBA 3DB2A 1IY8A 1VL6A 1ZK3A 3JQAD 2EJVA 4RPJA 4TZKA 4IDDA 1LDNA 4O63O 4K1LA 3ZNPA 4NBUA 1I36A 2ZK7A 4KQWA 4AJNA 3L4BC 1PL7A 4NBVA 3WLFA 4MIEA 1N9GB 2CZCA 4WUVA 2J8ZA 4XYMA 4D42A 4Q3AA 4FBGA 3DHNA 3ADPA 4R1NA 1W6UA 1EUZA 2WD7A 2YW9A 2TMDA 1A7KA 1HKUA 1N2SA 1FDSA 3QWFA 5ADHA 5A9TA 2IEDA 2VWPA 3DZIA 3E8XA 3R3JA 4GI2A 5IZCC 1O6ZA 4FS3A 5JSFA 2RBEA 4CUKA 3BMOB 1Y8QA 3LU1A 4HP8A 1PGOA 1DHTA 3PGJA 4RF4A 5K6AA 2DVMA 5A3JA 1CF2O 2AEMA 2ZKLA 4ALKA 2Y1GA 4OAQA 3C3XA 1QSGA 1DBVO 4B8ZA 4D0SA 1VC2A 4R4JA 4D3DA 4DXHA 3RVDA 4CV3A 4NI5A 1JA9A 2VRBA 1IHYA 1BRMA 1N7GA 5G4KB 4UREA 3I52A 1C0KA 2O3RA 4IINA 2GNAA 3ZDFA 3RFVA 3HUDA 1UP4A 1HF3A 4GVXA 3ZWOA 2ZTVA 4WASA 1FDTA 3ONDA 1ENPA 4FOSA 4G5HA 4A03A 1VPDA 2ZJ0A 3DXFA 4AL4A 3U4CA 1PGNA 3QWBA 3WWZA 1T2AA 4ZGWA 4MJLA 4UVEA 2XAAA 3AY6A 3NGLA 1O89A 3UCEA 5ILGA 1IL0A 3PGXA 4HBGA 5A5EA 3KZVA 2DFDA 4KOAA 3DBHA 3HE3A 1Q7CA 1XLTA 5L40A 2FZWA 3BTSA 5F1KA 1HE4A 3PWSA 3GVXA 4KUEA 2NU9A 3EW7A 3ZV5A 4WJZA 1CJCA 2WSBA 5AXDA 3NX4A 3L9WA 3VHRA 4PZDA 4B4UA 3BMCB 3T4EA 1DOHA 1HDXA 4RLHA 1E5QA 1ONOA 2ZATA 6ADHA 2B35A 1T2DA 1JWAB 1E1NA 1UDCA 5CDUA 1I24A 5DCWA 4DLAA 3WFIA 3DZFA 1R4MB 2IRWA 4KWIA 5ICMA 2OZPA 3QWAA 1GY8A 1G0NA 1QYVA 1T2EA 3NV9A 3QW2A 4PZCA 4YB8A 3ZCXA 5TNXA 3GEDA 3ZU2A 3QA9A 2D8AA 1PJ2A 1Q0LA 1LDBA 1YQGA 2EKPA 3TWOA 3GQVA 4ZRMA 1H9BA 4INAA 3JQGA 2XF8A 2XOXA 3ZWBA 5I9NA 4NU6A 4WLNA 1LRLA 5HTOA 1QRRA 1EZ4A 3BTUA 1AGNA 1SOWA 1HDZA 3KXDA 5F5NA 3CUKA 3RUDA 4EITA 4BNTA 4NG5A 4YT4A 2Z1MA 3U4IA 1CEQA 5T5QA 1AUPA 5HS6A 5KVVA 4NJOA 3PFWO 4FFMA 4YR9A 1EFLA 2PKQP 4YVFA 2ZB8A 1XG5A 3JD2A 3OJ0A 1ZKMA 5G0SA 2Q2VA 5T67A 3Q0EA 2JKVA 4MKZA 2FRDA 4RVHA 4OJNA 2CVQA 1Y8RA 4XZ3A 2W2LD 1ZEJA 2FY8A 1SB8A 2ZB4A 2GN4A 1HTBA 2BFAA 3OQBA 3VOSA 3DBRA 2NACA 5KVQA 2EWMA 1Y5MA 2LDXA 5L45A 1RJWA 2VUUA 1E3JA 3AWDA 3MZ0A 2XXJA 3FHLA 4YAJA 1E7WA 4JJGA 5DOZA 5TT0A 3CIFA 3V8BA 1O0SA 3F4LA 4PCVA 1Z7EA 3WBBA 3UGKA 3NTOA 1ONPA 1YL6A 2QQ5A 4WCDA 3TSCA 1N8KA 3O9ZA 1E3IA 3Q9NA 3ZWPA 4LRTB 2PGDA 4W9NC 1MC4A 1PQWA 1NTOA 2UV8A 4BO3A 3H65A 1DIRA 2RHCA 2O3JA 4XQGA 3DAFA 2PGJA 2CDCA 3GGPA 1M66A 1PIWA 1GFSA 3A14A 1UDAA 3H4VA 1LLQA 1UZLA 3K96A 1F0YA 4JJFA 4TQGA 5TT1A 4BO2A 1KY5A 5KVSA 3LVFO 2EIHA 2O23A 4DC0A 4FFLA 5HWSA 3PWZA 4QFCA 1WDKA 4CM3A 4J6FA 1ZK2A 2E49A 1UXGA 3MJCA 1F12A 3GAFA 5LDHA 3WFJA 4QFDA 1ULSA 2H9IA 4KDFA 5C3MA 1H5QA 4RF2A 5FEUA 3SLGA 3FNHA 3KYDA 3FNFA 3K2BA 2D3TA 3VVBA 4CMJA 4TWRA 1A7AA 3DQPA 1NQ5A 3GVHA 1V6AA 2C7VA 1KVTA 3R0IA 3IIEA 5F3RA 3ZNNA 1X7GA 3QHAA 3UICA 2P9GA 3OSUA 4CJXA 5H83A 1D3AA 2R6JA 2X0IA 5H81A 1T1SA 3HDHA 4D43A 1P1KA 4TRMA 4ZJUA 4OIMA 4CLOA 4G81A 4OHUA 1O9BA 1V35A 2BFMA 1E3EA 4JK3A 1JVSA 3GZNA 4J9VA 5T8KA 1JTVA 1LA2A 3TJRA 2G76A 1E77A 3ZHZA 4E31A 3H3JA 1F14A 2QRLA 2ZJ1A 5IXSA 3TFQA 2SCUA 1NQAO 2FHSA 2VTDA 2AQIA 2OO5A 5G0VA 1GV0A 4K28A 4R9SA 4YXFA 2Y66A 3OBBA 2EJWA 4L75A 4FDAA 4XB2A 5IFLA 2OP0A 4QEDA 1X7HA 1KS9A 1ENZA 1SBYA 1TEHA 2O50A 4GVLA 3PIDA 1R12A 4BKUA 2NQ8A 4PVCA 3KO8A 1A4UA 2AG5A 3ST7A 2WEKA 2I67A 1LC3A 1NNUA 4QX6A 2GERA 2UUOA 2YDXA 2O3SA 3SXPA 5BSGA 5CEFA 2AE1A 3DOCA 3GRPA 3K8ZA 2PH5A 4CL3A 4NJMA 4CMEC 1ISFA 1GYQA 4NU5A 1PQPA 4MDHA 3I9JA 5TGDA 1TT5A 4E4YA 4DPKA 2B37A 1A27A 3FNEA 3L4BA 1E7QA 1ISJA 3DZJA 2O2YA 3HADA 4BO0A 4CLRA 1C1DA 4L8VA 3H9EO 1X13A 4Z3DA 3JD3A 1U7HA 2Y99A 2B4TO 1K89A 3WYCA 4AICA 4DTIA 1AXGA 3CTMA 3I4FA 5GY7A 1DSSG 2GUGA 3JQAB 4KUHA 3VZPA 1HWYA 4DBVO 5CDGA 3OQ6A 3EMKA 4OOEA 4J2HA 3WQQA 5L51A 2HMUA 4HV4A 1CRWG 4TRJA 5IZCA 2X58A 4O5OA 4NK4A 2Z5LA 4WGGA 1DB3A 4NNJA 3IUSA 3QLJA 3PQFA 4UEKA 4CMKA 3Q1LA 1P74A 2BI7A 1AHIA 3PJDA 4R41A 1V3UA 5ENVA 2X5OA 4CM7A 2VNAA 3B20A 1HSOA 5EN4A 3JD1A 4ZQFA 1Z73A 5JCJA 2NVUA 3ITDA 4N5MA 2JFGA 1HL3A 3V5NA 2FN7A 2H6EA 4E12A 5JXWA 5DZSA 2Q46A 4CR7A 1LQUA 3QSGA 4E32A 3GPDG 1ZMOA 4B7UA 2EP7A 3WNVA 1ZVMA 1KC3A 4WKGA 3RKRA 4LSMA 3GR6A 2NV6A 1BG6A 1B26A 3GNQA 4PLWA 4BO9A 4B7XA 1Q0HA 4J1QA 1EDOA 1LUAA 3DFUA 2PV7A 5U1PA 3BIOA 4DMMA 2OORA 3VZSA 1H6CA 4R9RA 3FWNA 1UXKA 4EJ6A 4BNFA 3MJTA 4PZEA 1H2HA 2GSDA 5TC4A 3WQRA 4DQXA 4J2OA 1U9JA 2YQ5A 3VTZA 3DZGA 5G0WA 5MGBA 2C20A 3WSWA 2X1HA 2EG9A 1WW8A 1XWFA 4WLFA 5JC8A 3WX0A 2YZ7A 2J5KA 3ONEA 5TJ9A 2QYSA 3NJ8A 1X0VA 1ARZA 4MVJG 3RD5A 2AEJA 1BTOA 2YYYA 3ROPA 1NBOA 2OBYA 2AHRA 1UDBA 3GC6A 5C5IA 3VDQA 4DLBA 1HETA 1XELA 2BF7A 5AVOA 3RC9A 1PJLA 1F06A 1TT7A 2PNFA 4H3VA 5B37A 3ETDA 2AE2A 4Z0TA 3LC2O 4E5PA 4JLWA 4XDZA 1RWBA 3PZBA 1UZMA 4UUOA 2X22A 2LDBA 1BXZA 3EVNA 1D1SA 3U4HA 5FI3A 3ZWMA 3MWDB 1NP3A 1YO6A 2Q2WA 5J23A 2ZTMA 1YB4A 1MP0A 2PH3A 1PL6A 4YBZA 4MKRA 2ET6A 4BV9A 1NPTO 1WDLA 3B1KA 2VN8A 1DJNA 1JWBB 3I83A 4D44A 3AOEA 5B12A 2PY6A 3INRA 3QWHA 5IDQA 4S3MA 1C0LA 1U8XX 1P1IA 3O38A 3Q9UA 5L9AA 1P77A 2JD1A 4RO0A 3RAJA 1LDGA 3IJPA 1ML3A 4EEZA 5K0ZA 4YPOA 2EEZA 1BVRA 5IZ4A 1ZH8A 4IDBA 4PRKA 3HDQA 3ROKA 1XCBA 1GQ2A 1RPNA 2IXBA 3PJGA 1ZZEA 1LSJA 4XYGA 1VI2A 2X8LA 3G1UA 3H9QA 2O3QA 4IXWA 2RIRA 2YV2A 3GN1A 1NAIA 2EW8A 4OYRA 4B4VA 2PD3A 3WSVA 3S2IA 4YJDA 4IS3A 4OXYA 3JQEA 1YBAA 1FDVA 3GDOA 3K9QO 4EI2A 5JLAA 4L4SA 3WB9A 5JY1A 3V2UA 4IQ8A 2HK7A 2PZMA 4RV9A 4CR6A 4YWJA 1EFKA 2RH8A 4FCCA 4GPD1 4F6LA 3O4RA 5DN9A 2HLPA 3DZHA 4FGSA 4IJVA 4KUGA 3GVIA 1FMCA 1GQQA 1DLJA 1UXJA 3DWFA 2E6UX 1DRWA 3AFMA 5JBIA 3SEFA 1BWSA 2VQ3A 1YH3A 3FCOA 3L6OO 2CVZA 4AJPA 4YT5A 1KETA 3JD4A 4AJHA 2Q99A 1PJ3A 3H5RA 3ZGYA 1I5RA 1R0LA 2GCGA 4B3JA 4YRBA 1VSVA 1ZSNA 4D46A 1HT0A 3ZW8A 2HQ1A 2JFFA 3DMTA 3ADOA 2J5QA 3BMNA 1OOEA 2EV9A 1BMDA 4YAIA 3BAZA 1J49A 4CUZA 3TPCA 1NFQA 1WNTA 3TDKA 2W2KB 3FD8A 3NT4A 1C1XA 1Q7GA 4PLVA 4J7CA 2J5RA 1GPDG 4BNNA 2NVWA 1ZXBA 4D3FA 4BMNA 2JCVA 4BNWA 3B6ZA 3C8MA 1P45A 5JCJD 3JD0A 3ZWYA 2VWHA 3ZWWA 2Y1EA 2VUTA 5A9SB 1CERA 2X6TA 1HDYA 4B3IA 2I3AA 1ZO8A 1KBZA 1HZZA 3ZNOA 3OF2A 1D4FA 1HDOA 3VPGA 4CV1A 4J7UA 2OGUA 3M2TA 4WEOA 4AJ2A 2DBZA 2JL1A 2V7PA 3ROQA 2AG8A 3KSZO 1PGJA 2ZYGA 4B79A 3E9NA 3C24A 3OJLA 4CQLB 3NDRA 3DONA 1DO8A 4UEOA 1L7EA 2FR8A 2A92A 4E2WA 3FRJA 4OSPA 1LLUA 4LGVA 4JXKA 4UUNA 1I3LA 1YBMA 2I9PA 3D3WA 4RORA 1XQ6A 3ZWXA 5BNFA 4XJTA 1I2BA 3HFSA 4H16A 1IZ9A 2EGGA 1OZAA 3AUUA 4CMEA 4QQRA 1N7HA 4YTEA 4JBGA 2VHWA 1JAYA 1KYQA 3H8VA 1VKNA 4YJFA 2D1YA 1EQUA 3B70A 4TRRA 1QYDA 3WYEA 2B5WA 4J43A 4CM8A 1NVGA 4ALLA 1A72A 2YV1A 7MDHA 2PA3A 3UVEA 4IJWA 3VH4A 1YOVB 2Y1OA 3AM5A 3GUCA 3T7CA 4DGSA 2HCTA 3I9NA 5KJ1A 3WGZA 4M86A 3B1FA 3DHYA 3F5QA 2CF6A 1CIVA 1ZIDA 4HUJA 4JGBA 3JQBA 4E6PA 5DBGA 5EMHA 1XR3A 1E92A 2IDZA 3RUHA 5HRUA 2F00A 5DOVA 4XGKA 4EZBA 1DRUA 3VZRA 4OXKA 1ZFNA 4CM4B 4CLDA 3LYLA 2A35A 4UULA 1T25A 1U2GA 3AI3A 3JCZA 1E6EA 1WPQA 1JKJA 3PI7A 4BQPA 5JAQA 3JTMA 5KJ6A 2IYOA 1IB6A 5IF3A 2Q1WA 3JSAA 3Q11A 4ESOA 5GZ1A 4RDHA 3R3SA 1XIVA 2WE7A 4Q39A 1Z7BA 3ICCA 3QY9A 5HA5A 4QT0A 1JQBA 4UUMA 1QLJA 3PHLA 4CLXA 4TMFA 3CPSA 4OH1A 3RSHA 1EK6A 1SAYA 4XQ9A 1I01A 3WIDA 4MPDA 1R6DA 2H63A 3TL2A 3T4XA 4CV2A 1DDOA 4XWYA 4ND2A 3WGOA 1U4OA 1Z6ZA 4O0LA 1X15A 4AJKA 4PG8A 4GMGA 4FFNA 4WCFC 1K6XA 3BMQB 3VH3A 2D4AA 3UHAA 1N1EA 1YL5A 3OICA 4O6VA 1SMKA 2WE8A 3H5NA 4NDNE 4JNKA 1Y8RB 2YQ4A 4JBIA 1BXGA 3BZUA 4MKXA 5ES3A 2JAPA 4RVDA 4RQTA 5EPOA 1C0PA 4BGUA 5KJEA 4N7RA 4TSKA 5L7YA 3JQ7A 1UXIA 3SC6A 4A73A 2R2GA 3DBRB 1IPFA 3L6EA 4U5QA 3K2EA 2HKIA 1Y9EA 2ZIZA 2J3IA 3FSRA 2HDHA 4IPTA 2RH4A 3W4KA 1PZHA 1VE9A 3F3SA 1LX6A 3E9MA 5A4DA 5T6BA 2ZTLA 4YYZA 4RLSA 2DLDA 2X0RA 2PFGA 4F45A 5GMOA 1GTMA 1KEVA 4AJEA 2B69A 1MC5A 3F47A 3A28A 3U3XA 2X4GA 4JCOA 3ANNA 4Z6KA 3DDNA 4GLOA 2X5JO 4Q3CA 3D5QA 3LQFA 4KDEA 4NK5A 4Q3EA 4D0RA 4OM8A 4FW8A 3H9GA 4OQYA 2PGLA 1VJTA 4JROA 1VSUA 2J6IA 1A9ZA 1GADO 1FJHA 1UAYA 2CD9A 3QJ5A 4RPKA 3VVCA 5BNTA 3JYQA 1FDUA 3LT0A 4I5GA 3UCXA 1JKFA 3V2GA 3FPCA 1UP6A 2XXBA 3OETA 2PKRA 3HSKA 4WLVA 4ZD6A 5JYDA 4FC6A 5DBFA 5CPFA 1YDEA 4E2ZA 4F3YA 3DFZA 4IIVA 4CL8A 3KLMX 4Y6SA 3Q6IA 4MP3A 3ZI0A 1LDMA 4RL6A 1EK5A 3DTYA 3G0OA 4YQYA 1MXFA 1KY4A 4DA9A 3OA0A 3ONFA 4RPGA 4BNZA 2D0IA 4ND5A 4ALNA 3TZHA 3LF2A 2YHIB 1QG6A 3GZNB 1SCUA 4L0QA 1PX0A 2B4QA 4PG4A 1MLDA 3IP3A 4NZ9A 2Q2QA 3Q2IA 3KOUA 2X86A 3UN1A 4C4OA 1T1RA 1XU7A 1WXDA 4NR0A 3IMFA 1I8TA 1F8FA 1W0CA 3CKYA 3GMDA 4NMHA 4CMGA 3D7LA 3X2FA 4CLHA 1BHSA 2QIOA 3PZRA 1ISMA 3L0DA 3GT0A 3ETGA 2WYWA 3PHGA 4BO1A 1T4BA 4IGFA 5F5LA 5LC1A 1PJ4A 1V0JA 3D1LA 5AQ1A 3KV3O 1U28A 1ADGA 2BGKA 1ZXLA 3JV7A 4BVAA 5KJCA 1PJQA 4BNLA 3RKUA 3HFGA 9LDTA 2AA3A 4G2NA 4ZQHA 1O95A 2NSDA 1W4ZA 4FB5A 3DR3A 4IMRA 4IJKA 1YDWA 1NQOA 4S1VA 4EJMA 4WK6A 1OFGA 3K5PA 1GYPA 4L4XA 2DBVO 3MJVA 4BQRA 3H2SA 2OL4A 3E9QA 1JVBA 1P1JA 1QXSA 4OL9A 1H2BA 3EYWA 1LNQA 1R16A 1TLTA 2QRKA 4Y67A 2QZ9A 2Y1DA 9LDBA 5T57A 3RUFA 5TS3A 3KYBA 3HN7A 4LCJA 1U4SA 1NM5A 1RKXA 2ILTA 2JAHA 3AOEC 4EDFA 1NWCA 5BT9A 3C7DB 1OBFO 3GZ4A 5JDIA 4R5HA 2P9CA 1CYDA 4UVDA 4LMRA 1PTJA 1UXHA 1BDBA 2WWRA 1Q2XA 1OC2A 3E6AA 4Z0PA 4CQMA 3F1KA 1U3TA 1I2ZA 3ZWCA 3HQ4O 2VHYA 3NRCA 5IDYA 2AQKA 2DU8A 4ONEA 2IZ0A 1XU9A 2OUIA 2Y05A 1PZEA 3PHIA 4R68A 4B8WA 3I23A 4D45A 5A04A 3G1TA 1NVMB 4DYVA 1LRKA 1GZ3A 1P3DA 3OP4A 2VWGA 1YWGO 3FPLA 2O4CA 5A1TA 3WMWA 3ZWVA 5KCZA 1MFPA 1J4AA 4K6CA 3WGHA 1ZJZA 4D41A 1N9GA 2RCYA 1P9LA 3PTZA 3RWBA 5TX7A 1LDYA 3S1LA 1MXHA 4IBOA 3WICA 3S55A 3LZ6A 4I8XA 4KTTE 4J9UE 4M87A 1VLLA 4U8GA 3ENKA 2VNSA 4MVJA 1CQIA 2VZ8A 5EIOA 4CR8A 2IE0A 3INTA 3ABIA 1Y6JA 4IS2A 3ZNQA 4ALIA 2WYUA 2OMEA 1KOLA 2PK3A 4II3A 1PQUA 3PXXA 1LLDA 1OAAA 1PR9A 3MTGA 1OC4A 3BMOA 2W98A 2OP1A 4JP3A 1GDHA 4EW6A 5KTKA 1GQYA 4BOYA 1TXGA 4IDAA 1M75A 1U5AA 3EGOA 3P2OA 3SC4A 1Z75A 3GG2A 2WDZA 4R5MA 3GVCA 5G4LA 5FWNA 5I8WA 5ITVA 5DCYA 1PGPA 2Q45A 2BGMA 3IJRA 5KJFA 1BXKA 2P68A 5G4KA 3BTOA 3E5RA 1E3LA 3DZKA 1F17A 3ASVA 3DMTC 3QWIA 3UF0A 2VZ9A 1GYRA 2WYVA 1GZ4A 5ER6A 3U4DA 3IC5A 1DFGA 4QTZA 3IKTA 2G0TA 3DBVO 4AJIA 3ZZNA 3NT2A 1XEAA 1FXSA 1I3MA 5ITWA 3ASUA 4P4LA 1Z45A 2O48X 1V3VA 2ZQZA 1YB1A 2E37A 4XYBA 3ZHBA 1LRJA 4J16A 4JN6B 2NU6A 3E5MA 3FR7A 3VH2A 4CMIB 4TZTA 4YRDA 1QV6A 2GDZA 2J3KA 3H9UA 4G65A 3VDRA 4BKOA 1DEHA 3HB5X 1DFIA 3EK2A 2FPPA 3TZKA 1K6IA 3DBLB 3V1UA 3BMCA 3OJOA 1MB4A 2FWMX 2X9NA 4BKRA 3RASA 1SO8A 4M8SA 3RROA 2D5AA 2C54A 1R4NB 2Y1FA 2Y0DA 4NH4A 3RBVA 4DREA 3IDSA 4WCFA 1DC5A 3GGOA 5A5FA 3PLRA 1R4MA 1QV7A 1DFHA 2B36A 2AXQA 1GV1A 3DTTA 2CDBA 1JAXA 2DQ4A 3C7CB 2OFPA 4F46A 5A06A 3CSDA 5DF1A 4OO3A 2P5UA 3F1LA 4UVIA 5AXBA 1E0DA 2GPTA 3H2ZA 4AFNA 2DFVA 1HRDA 1LJ8A 1NHWA 4CM1A 4WOKA 1DC6A 4J4TA 5DULA 5I9MA 3FBTA 3D4NA 4ITUA 4TVOA 4BO8A 5U9CA 4L4RA 4BS9A 5DDIP 4CM9A 3IOYA 3ZHYA 3BA1A 5TSDA 5K9ZA 3VH1A 5EL0A 2DT5A 4W7IA 2RAFA 2DM6A 2QRJA 3KSDO 3GN2A 1DIGA 4L73A 3ZW9A 4IMPA 4J1NA 1U1IA 3JQBC 4MOWA 3F4BA 2AEFA 2PD4A 1JLLA 3GH3A 3MWEB 4GX1A 4P22A 3W8FA 3ZHXA 4I9UA 2P5YA 1I10A 1NASA 1WDMA 3RFXA 4YJGB 4BMVA 4WPGA 3PYMA 1Z82A 2NTNA 2NM0A 2DTDA 1TI7A 3W6ZA 3BXXA 2G1UA 4U0JA 3RJ9A 4PFJA 3FN4A 4ALMA 3UW3A 2YFHA 3VPXA 2P4HX 1KEWA 4TRNA 2QG4A 1AN9A 1E1KA 2ZQYA 2V65A 3F6YA 5JDCA 4IQGA 1SPXA 4IGEA 5TQVA 2YY7A 4RVSA 2P4QA 4I9HA 3E48A 1YS4A 4BO5A 5IXYA 1GAEO 1E6UA 3ZU4A 5F21A 1O5IA 4YJHB 4OQZA 1G6KA 2UYYA 3ZV6A 1BW9B 1ONNA 4YA6A 5F1OA 3BMNB 4CQMD 1EMDA 4FSHA 4LCEA 3L77A 3AM4A 2X23A 2JJYA 2GYYA 3LLVA 2YV3A 1ZSYA 3Q3CA 3MJSA 4BNVA 2HO5A 4E2YA 5ENDA 3JQ8B 1E7RA 5EQDA 3AM3A 2EGHA 2NQTA 1B0AA 4K26A 4GL4A 4O59O 2VRCA 4R1SA 4MP6A 3EVTA 4F6CA 3H3FA 1PEDA 1I3KA 3AK4A 4UAGA 1Y5RA 1GUFA 5A3VA 3NKLA 3DC2A 1GPJA 4DBZA 3AW9A 1BVUA 1PWXA 3C7AA 3ANLA 4FPXA 4A26A 1LC0A 3P5SA 2O7QA 4LMPA 1YQXA 2B5VA 3ZH2A 3KRTA 4MVJD 3WG9A 4DVJA 3DMYA 8ADHA 3U0BA 4FJ2A 2CUKA 2DTXA 2Q49A 5JMWA 4KWHA 5COQA 4TKLA 1E3WB 3GAZA 3LT2A 1P33A 1UAGA 3QRWA 1P31A
chains in the Genus database with same CATH superfamily
3DOIA 1YR8A 1T9CA 1XK6A 2H8GA 2JFHA 3DKKA 4WLOA 3S40A 4ZPXA 3D6AA 3OMLA 4XB1A 3H2HA 5AK4A 5BMOA 2QLNA 3PPYA 4RD6A 5EZYB 5B2ZA 3ZVMA 1TECE 3CG0A 4TN5A 4FIZA 3J81A 4OXIA 2R84A 3GGJA 1AHNA 2C9BA 1U3UA 5KVAA 3HCDA 4ARIA 1UBCA 1XGKA 2EP5A 1IM2A 3AKEA 4HDCA 1SEPA 1UBTS 4GX2A 4DLLA 5JVDF 1I3OA 4HD8A 3NDJA 4CEHA 1JTFA 1IATA 5HW0A 4UU7A 3FRHA 5KDOA 2MR5A 3QVGB 5FO1A 2C2HA 3DPUA 3NIWA 3UKOA 2XT9A 1ZNYA 2YCLA 3E2IA 3W2HA 1SCNE 1GL3A 1JHDA 2Y0CA 1YGPA 3KT6A 3V7FA 5FNVA 4V0QA 4JD5A 2OHJA 4HNAA 5AKLA 2X9LA 4ZQEA 2NTJA 1XTTA 4Q18A 3IERA 3JRWA 1SB9A 2QENA 3Q87B 2RH5A 4ZP1A 2P6RA 1RLMA 2DPLA 1ZUNA 2A5LA 2IZOA 4M89A 4ZA2A 3CJRA 1CULC 5HK9A 1HA3A 2XUJA 2FG5A 3I6QA 4H08A 2PTHA 4JR1A 4LJ9A 4UM5A 5EWLB 1KDZA 1M1YE 3KSRA 1B1CA 5J1SB 1XNQB 1XQ1A 2ZIXA 4RJTA 2BKAA 5FOQA 2WQ6A 3K6SA 1VE1A 3E4CA 1TO6A 1JEQB 4DCMA 2FZ4A 1TJ5A 1VG8A 5TMPA 4CODB 1Q0QA 3CRQA 3KVOA 4TLEA 5I4IA 3AY7A 3BSSA 3RVSA 1B6GA 1CPYA 4XGIA 5IHPA 2R1ZA 4NHEA 3L6DA 1WQ1R 4X1YB 2ZCUA 1AK2A 1NRJB 1XFDA 3ND9A 2ZIFA 2IYQA 5TJHA 1XMQB 1RCUA 3N8DA 3O1LA 2YHUA 2W4MA 3CXUA 3QF4A 4ZT4A 3S2YA 4EQ6A 1QAMA 3C6YA 1K5GA 1ZD5A 3LUKA 2QZ4A 1PR1A 3RJ5A 1WP4A 2PGIA 4WZAE 5E6UB 1NKSA 3FF4A 1UEIA 2VF4X 3D3KA 2CXPA 1P0CA 4P38A 1DQPA 5HVNA 2HU7A 3RUAA 4BC1A 4YRKA 3NM6B 3T1TA 1AIPA 2G5TA 4H7EA 5AKJA 4V0LA 3E53A 3BH6A 4LRXA 4J1TC 3RV3A 3ICWA 5D01A 1CUVA 3OEHD 4RANA 1EA7A 5DNAA 4AMGA 4GX0A 4EI7A 3KAKA 1AD2A 4BAZA 1QC5B 3KS9A 3RDPA 2VH2A 1JIQA 3ZY5A 1WCYA 2GN9A 4MVWA 1M2EA 4G0WA 1Z74A 3KPVA 1NQXA 1ZU4A 2EERA 4JT9A 4FD3A 5ELLA 4H0NA 3TIFA 5JW6A 1ITZA 1R0SA 1YJAA 4JWKA 4YR7A 4ILEA 1UT8A 4KVAA 2YVAA 3S29A 1QNFA 3QMMA 2PLFA 2A2ZA 3HB9A 4XSVA 1L1FA 2D2FA 2WD7B 2LW7A 4WXHA 4JT8A 2XRFA 1R18A 3WGQA 5ALKA 2CNWA 1PTJC 2NUAA 4EG0A 4MA0A 2IW3A 1V5FA 1RRGA 1FP4A 1UWCA 2ZI5A 2WSYB 3MINB 4NZYA 2PWZA 4M55A 2CL7X 1PZFA 5BVHB 3MWLA 2A9VA 3WI7A 1K6JA 2FVYA 3BF7A 1QZZA 3V4VB 4QUDA 2Q3DA 4U7WA 1C0IA 3DCNA 3ITKA 3T7KA 3QUTA 5CVDA 3TW0A 2J3MA 1K7EB 4RW0A 2V55B 3FTDA 3VO9A 4YAKA 2WWYA 4W5NA 4E30A 1O8CA 5KOJA 4GRAA 1S2NA 3DAPA 3MILA 5CVEA 3ZGXA 2PZKA 4N6NA 3TNFA 3ZBTA 1OMOA 5TXGA 2ZJ2A 3G7NA 5JBQA 1YU6A 1D8AA 1T4MA 1R5OA 1WMEA 1PFYA 1ZCJA 2FMKA 2QM0A 3C3KA 4G1BA 1TUBA 3EZYA 4ABYA 3O3OB 1W8DA 4QJ5A 3TZ6A 2HT1A 3P2EA 2VTBA 1KZ1A 3GIWA 2FR1A 2ZVJA 3D2BA 1JZTA 3GEGA 1U7TA 1V71A 5DNVA 3W8EA 2ZDQA 4C7VA 3OT5A 1X39A 1ZW1A 4QBKA 1T1IA 1A98A 3ULKA 1N1GA 4H1WA 2O8CB 3W3AD 5U4QA 4JVNA 3COYA 4P82A 4ZZIA 1H23A 4X71A 4R0NA 3W2FA 2XB2A 4O8CA 1QIDA 3W77A 4KWCA 2JLAA 4LEIA 3TAHA 1OFUA 3PA8A 2VRCD 5K8IA 2DETA 2NU9B 1CY4A 4AKTA 5COAA 3RYFB 3RYIA 4DJDC 1UQRA 2Q5LA 4Q3NA 5KUTA 3TVDA 1F51E 1OI2A 3IQEA 2O8FB 3LWZA 4C7KA 1IM5A 4PSVA 3GJXC 4RZ2A 3L18A 2UYCA 3BJEA 3DLCA 4RVCA 1J90A 4G0QA 1HDIA 2ZRGA 4CF4A 1NXVA 4X8MA 1V8PA 4D74A 4JGIA 2C9ZA 2JKYA 2E85A 3EVZA 4LY9A 3MYYA 1GGNA 4MV9A 5BOVA 4EUHA 3EZ6A 4Y2RA 4LF7B 3GF4A 3GDFA 5E4YA 3QXCA 3L40A 9MHTA 2H0AA 1U6JA 1ZCBA 4PLGA 4EIWA 2W6IA 4RTKA 1ZK4A 4EG5A 5BSEA 1PLLA 1XC7A 1EBUA 3AR8A 4NYIR 2A9FA 4BNDA 1BGVA 3D0OA 2I7XA 3IXMA 1YBVA 4HDQB 4X1IB 3TGWA 3WVNA 4Q9NA 1YIDA 4BFLA 5K7SA 4JKIA 1YI0A 4EHKA 2IC5A 1XBTA 1QQ7A 4G4GA 4WOPA 4C89A 3E05A 4GZ6A 3ZQUA 4UM8B 4BV3A 3KOMA 1E94E 1XL0A 2B1GA 1FUKA 2WVJA 4BQQA 2G0NA 1FRVA 2E0IA 1DLIA 1H3NA 1XKQA 1RXEA 2AEEA 1SXJC 2G8LA 1RBZA 2RKOA 2YUTA 2W7TA 4O4HF 3WOHA 3I0ZA 1T5LA 1FVHA 2E4VA 3PYXA 1Y7PA 5F2OA 3E18A 2B82A 1P7YA 2AJTA 1WTCA 1DCMA 4E1BA 1N0WA 2HZ7A 3G3EA 3I9MA 1TVKB 1PNQA 5BVGA 4MDFA 1OLUA 1ZYUA 4KFTA 2OFWA 3NGXA 4ITRC 1HQCA 3DO6A 5AHWA 4BE9A 4CV0A 5IAAA 1P2TA 2A1UB 2F1HA 1IN6A 1ESCA 1CSEE 1PFKA 1Z15A 2CBZA 2J1LA 4L9AA 2O3UA 2ZIGA 4ZVVA 3QY0A 3RANA 2ATEA 2BR5A 2BDTA 2ONCA 1ZITA 1NR1A 2PFKA 2R66A 5CUQA 2ZT6A 4NECA 3R4CA 3MHPA 4U7TB 3AM1A 1CK4A 1II0A 3F78A 3CKLA 4XKJA 2WAXA 4WL0A 2XTAA 2WR8A 2C2XA 3MJRA 3O9VA 2V7XA 2GLUA 5I9BA 1C4KA 4Q5IA 2DPYA 4HVAA 4NBWA 2CLIB 3E7FA 3K35A 4RHUA 1MB3A 3FTPA 3FCXA 1XPJA 3AI2A 3KKLA 4DY6A 5CAEA 1HDCA 2XT0A 1MGPA 4PYLA 3MG9A 3MCTA 4CKYA 1JDZA 1PSDA 3TLGA 1BFKA 1H94A 2QV0A 4P3NA 4US0R 3WZ2A 1UFKA 4NBKA 3I1JA 3N6VA 4F9TA 3N3BC 4PS0A 3V8QA 1Z0AA 3A2KA 3BFKA 2RDMA 3FDXA 1N6HA 4DNFA 2A6PA 4B2YA 5ARBA 4MVJP 4YRJA 5I4KA 3MMZA 2UAGA 4KMSA 4OSOA 5H7XA 3IMGA 1NKVA 1QKIA 3M4NA 4FMPA 5FT9A 4CYMA 5IABA 1T0BA 3L7IA 3SVZA 1Q19A 3KEQA 4TS3A 421PA 5MN6A 3R5KA 2IPOA 3QJYA 4DLRA 1QMGA 1N34B 3MBKA 3KP1A 2RIPA 5B7QA 2O8DB 4PNPA 4F9EA 4Q7QA 2ZPAA 4R1UA 3QPVA 4A8PA 2VJNA 3QI7A 3KFXA 2Z8YA 4N03A 4FGUA 4O4IB 4Q37A 3T5MA 2ON6A 1K0UA 4A1OA 3MGBA 2NZYA 3N7UA 1B15A 4B3SB 4FOOA 2HD4A 3DEFA 1CT9A 1GPWB 1OLSB 3MEQA 2VHXA 3VNUA 2Y4OA 2XE4A 1YS1X 3I9OA 3KYDB 5H1YA 5I3ZA 4P4NA 4G37A 1R66A 4RD3A 4NHOA 3TTVA 2CNWD 3AUAA 2KI5A 5C5CA 1C3OA 2VBCA 1VP9A 1KZYC 3CRZA 5TB5A 1FFAA 3L07A 4L5CA 2HIAA 3IEXA 5H9WA 1DEAA 2GZ1A 3EEBA 4POAA 1L1QA 2ZRFA 1JDPA 1B0UA 1TCAA 1TYBE 2B6NA 2WMDA 3BYZA 3QGMA 2YJZA 4JQCA 1HQKA 1K68A 4LW8A 3RC2A 3RRFA 3V1MA 4CLOB 1WQ3A 4EUNA 2J3JA 4D02A 4YAUA 5AVWA 4MHOA 4I5EA 4OX9Y 5CB8A 3DHEA 1SXGA 3THYA 1ODCA 1KJ9A 1LK5A 3B1XA 3B5IA 3SZ3A 4X92A 2C5BA 3VPHA 4DCPA 2WIBA 4JUBA 3RWMB 5BXYA 3BEOA 3DWGA 3K31A 1ZEMA 1F1BA 3EGIA 1KP3A 4HQOA 4UJ5A 5F35A 2HYDA 1KEUA 2SCUB 5JCOA 3GRUA 3MTIA 4LUCA 4UU1A 3TX6A 1G8GA 1B14A 3DHWC 1GFWA 3I6ZA 4KDCA 4Y1RB 1JBQA 3W5SA 1G16A 1W5BA 3H1BA 5JAHA 2DC1A 4IRXA 3RNOA 4B3BA 1DU4A 4IIJB 3UMMA 3ZJUA 4HDNA 2CJFA 2GD2A 4R2LA 5IPFA 3TXYA 1YJ8A 5AVSA 3IUYA 3GGCA 4WDQA 4DBLC 3MRTA 1YOVA 4RF5A 1XVAA 5EKUA 3MCVA 1N36B 2HSDA 4FILA 1G66A 3UXMA 3MAGA 2G8NA 3E9ZA 2A0FA 2ID7A 3OURA 4TMWA 1O77A 5C7LO 2QTWB 1EVQA 3EG5A 3DLPX 4HTFA 4DJTA 4PZAA 1S9DA 4DQDA 4YAGA 1EXVA 2GBLC 2GO7A 4J1TA 4WCFB 3MD9A 3DP7A 3LPLA 1FJ2A 2SICE 1QE0A 1AKQA 2HNKA 3A0RB 4INZA 3G79A 4IVPA 4QUJA 4QYSA 2ZRIA 3OZRA 1IY0A 4HNQA 1A9YA 5F7OA 1S02A 3BHMA 1CY0A 2ETVA 3UWOA 2GEDA 4A0SA 4PVDA 1SCBA 1VPEA 1QVVA 2OV4A 3EIEA 5IKPA 2R25B 1II8B 3QNMA 3ZUPA 3DA8A 5FRDA 2C57A 4KZPA 4J49A 4LJYA 1D9ZA 1MAWA 1YS6A 1M2KA 2JH9A 3CIOA 4GWLA 5ALZA 5L7TA 1QH0A 5K8VA 1TAUA 3ZVRA 3QPCA 4PG6A 2QV7A 2I34A 3GJ6A 4L27A 3AT1A 3AIKA 1DXYA 1SHJA 1TKCA 2HL6A 4JS0A 2GR9A 2W6ID 2Q3CA 1QPZA 4RVUA 4YRAA 4DTCA 1I4LD 1YHYA 4G2TA 1O57A 3EGDA 1DX9A 4D2IA 5JH7F 3BKWA 1CUAA 4ZHQF 5IJWA 1UWKA 3N0TA 5EE5B 3MXTA 3CLTD 1RPJA 1M34B 4M0CA 1PG5A 3QU2A 4IRMA 4K6OA 5HMMA 3BRCA 3M4YA 3FJYA 6YASA 3WGIA 4UVGA 5KTMA 4UBMA 1FRFS 2W2VA 1M6WA 1RXYA 3BMQA 3RC1A 3I6YA 4CG1A 4D79A 1PE0A 2V7BA 3CRVA 5B58C 1W36C 3C15C 2FZGA 1GNRA 4MUBA 4PBRA 3RTBA 5FORA 4LF8B 1DPGA 3P2KA 2BYTA 3SLKA 3UFXA 4AX8A 1X7WA 2CV0A 4N5NA 3E9DA 5KDDA 3FNGA 2WYHA 3FFBA 4TOIA 2ZW9A 4WT7A 4Q9DA 1NTRA 1E3SA 3ZD6A 1FRQA 3DCIA 4FFWA 4BLQA 1ZRNA 2R62A 3RSGA 4QU8A 4KQGA 4KGXA 4GPTA 3CO5A 1UMBB 1XE3A 4PYMA 3HEMA 1NN3A 3HCAA 3AY3A 4HGNA 4M22A 1N25A 5C8VA 3LX5A 1JIUA 1M2OB 2BKVA 1B16A 1Q77A 4HHEA 3V1KA 8LDHA 5JXHA 3WKCA 2IYEA 1VM6A 1KOJA 1B00A 1NYTA 3CEMA 3OZWA 4RETA 1P9NA 2WA1A 5ICGA 1K4KA 2TSYB 1NE7A 3GLVA 4IHJA 4PN7A 3CGGA 4YJ3F 1QRUA 4GSLA 1J8QA 1ZRMA 4YT2A 2PH1A 2RGNC 3NDBB 5LYJA 1PAUA 5CYGA 2YJ6A 5HF6A 1DC4A 1CY6A 1JVNA 1K3UB 2ZB7A 3INNA 4HZGA 5FBWB 3UEOA 5IDXA 4B71A 1SXHA 1J6UA 4IUYA 4QU5A 4DSZA 4CCYB 4KNYA 2ABWA 1WUYA 1KAEA 1TJ4A 3B1JA 4Z7QB 1LFAA 3KD2A 2IYSA 1BS9A 3NOXA 2IZZA 4ZVNA 1BVHA 2EDAA 3IT1A 2FFAA 1DQYA 4E21A 1KBOA 1VECA 2QUZA 2PPLA 3DFIA 4MJ3A 2FPIA 5A05A 3OA2A 4FBLA 3WGGA 1SC1A 1K7FB 3K32A 5JWHA 5LL6P 5JAPA 1ISGA 2J48A 5JASA 3EQ6A 3BWCA 1ZHFA 3LV8A 5EC8A 4ER3A 1IOWA 2GXUA 3CMCO 3EXFA 4M54A 3SC2B 3MTQA 1DCFA 2DBYA 3BGIA 3CINA 3S1AA 2OCYC 1GA6A 3J7TA 1AKTA 3P2JA 1P9WA 4MVJH 1WXIA 5CHEA 4YCBA 2NNLD 1P1FA 2PZJA 4KSBA 5E1OA 1G8JA 2QD2A 4DQVA 2JA2A 2O2DA 1QCCA 2P9ZA 1X38A 4O25A 3T0GA 4TN1A 1KYXA 2OXFA 1W29A 2DEUA 1RE0A 3NBQA 1U7ZA 3LQ2A 4UARA 4GECA 5LZ9A 4GF5A 1NVVR 4EVIA 3Q5EA 1AKYA 3UHJA 1M1YA 3AJ9A 4F85A 5KU1A 1W1UA 3GYGA 4TROA 2R47A 1AKWA 5GWXA 4B2IA 1XKTA 4GWKA 3I58A 4BU0A 3HVIA 3ICOA 4FYXA 4IF6A 4YGXB 5A03A 5LQRA 5EYPA 4ACBA 5ETJA 2AC4A 4I1VA 4C76A 1C8BA 4D4KA 5REQA 4D8UA 4QUEA 5I45A 5EFZA 1PFQA 2QUHA 1SCJA 1ZUWA 4V1CB 4TMZA 5IP5A 1E1QA 4DAEA 1UBJS 1IOLA 3SOPA 4KRYA 2FMIA 2PUHA 4Y6PA 3V7UA 5CA0B 2WWFA 4ZTZB 1QP7A 3FROA 3PL5A 1CVLA 2C04A 2Y1CA 4EVSA 5A4MS 1RXVA 1Y1RA 1MOQA 1TW2A 3OEYA 3K3PA 1ADCA 4WZAA 4AZSA 3EVFA 1E9AA 2YWGA 2IYLD 3QX9A 4ZANA 5K0NA 1UAAA 3UAYA 3UMVA 1PVOA 1GLGA 1DEKA 1Y1PA 2BBTA 3KSUA 4DIOA 5K4HA 2P3SA 5L4NA 1DAMA 2P6UA 1CS4C 5HPYB 3MUFA 3GD7A 1P4RA 2H29A 2QVZX 3F96A 1EVZA 1XTQA 1KI1A 2Y6UA 2WKQA 1OX6A 1E0JA 2BFDB 3A1CA 4A92A 3BXFA 5KO2A 4XJSA 1DT5A 3AJRA 3LUAA 3LX4A 4NYJQ 4TUYB 3VR6A 3SJCA 4BNYA 5TARA 2AGVA 4PAQA 4YLEA 4TYNA 5C4MA 1G2QA 2DFPA 3X1ZA 4LZPA 3IVXA 3TVYA 4I3GA 4XA8A 5KYXA 5K3FA 1DAHA 4A6PA 2IW1A 3LMKA 4LY0A 5HFNA 3M70A 1U63A 2OQRA 1W85B 1RJGA 2ZUDA 3NM4A 1CTQA 4QRDA 5TQ2B 3H6KA 4LDQA 1AZLA 2YDYA 2ZUUA 3A6LA 3BWXA 3HBJA 2V6BA 2VJOA 4II2A 3VTFA 4QGAA 5AKEA 3DV2A 5EJ9A 4V0MA 2QNBA 2MIIA 5FQNA 3KETA 5INTA 4JJKA 1JU9A 4LJSA 2IUFA 4GYYA 5CDHA 2ZYAA 2NXJA 4YCJA 2P91A 3R5FA 1N6NA 1PL8A 1OYVA 4NCAA 4UBJA 3WIVA 1QYCA 2Z3WA 3N58A 3DCYA 4JP2A 2DUUA 1HYHA 2BC9A 3DEYX 3EWSA 5ILOA 4XYEA 1VMDA 4QDTA 4IDQA 3WRYC 1XZQA 3JQQA 1RWKA 3OM8A 4ALJA 3KPUA 3GLIE 1HG1A 1HR0B 5BYJA 4C2TA 2WAAA 2VHZA 1WMBA 3FVTA 3PVZA 5H70A 3IA7A 5B3AA 2YOGA 4HUTA 2O2SA 3F9RA 4GE0A 5E2IA 3H9JA 1Z25A 3QPDA 4E13A 3AL2A 3BGWA 5AW2A 3SF0A 1YDMA 2O9JA 4DUZB 3EXHB 2IBSA 1U8UA 3ROMA 1TZJA 3AR5A 5AK5A 3C3MA 1T0HB 5BNIA 4TWBA 5AHXA 2EX1A 1G3UA 1N2IA 2ATXA 2JAQA 2IHTA 1UANA 1KFBB 1DOZA 5G1PA 7AT1A 1KEEA 3V8NA 2AD5A 3K70C 4HEHA 5IAEA 3GDHA 1QE3A 3EZ9A 1QGUA 3C8DA 3STXA 3TOZA 5CH3A 2HY7A 3B1YA 1VZ3A 1VSBA 3BL8A 1QYXA 2DJIA 2NO5A 3F5SA 1ICEA 2F62A 4DW8A 4EB8A 5HMLA 3TNDA 3UJ8A 4YLYA 3VNQA 3ABQB 5KOJB 3TQHA 4F3NA 1VXRA 3HYSA 2WHPA 1RXWA 3H2IA 1D1TA 3IO5A 1XJWA 3L8GA 4JV5B 1V41E 5HIAA 1IXKA 1QR2A 2FCRA 2VJYA 3I9V1 1J00A 2GD1O 1EQ2A 3MELA 3M6AA 3P7MA 2IEYA 3E2MA 2VDRB 3PXDA 3R23A 1W34A 2GNPA 3KEOA 1G5PA 1GPNA 2MCFA 4ACAA 3NHBA 2DF8A 3NLLA 4YI3A 3V9AA 2GBLA 2VTBB 3I6IA 2LWIA 1RYDA 4H7IA 3VHXA 2YS7A 4RPLA 5AM2A 1V45E 4DUPA 3EEQA 5B1YA 2ZXUA 3V6MA 2H1FA 2DBQA 1UKAA 1I3NA 3L3BA 2FUCA 2Q50A 3P45A 4OHCA 4ZJYA 1E3QA 2FJUA 5CFNA 2D4HA 3ITNA 3FWZA 4ZEOA 5LXTF 3ZDDA 2JANA 1EP3B 1UKBA 4OHZA 1MN6A 4MWEA 2L0XA 2Y93A 1K66A 3HCRA 1R2QA 3G2PA 3DJFA 4NZZA 5GONF 1YVEI 3OZEA 5D5QA 4DR3B 2BFFA 1DDIA 3RCBA 1ZWKA 1B8UA 4PRLA 1UODA 3O4GA 2B83A 2DR3A 1D6MA 3BDIA 4HB2A 5LFAA 2YWBA 3E58A 2Q9BA 1O6CA 3T9FA 4MYRA 1W47A 2VR1A 3FYTA 3KQLA 5HUQA 1J09A 1SUDA 4DG5A 3G0CA 2QLJA 3ZU6A 1M2WA 3F3MA 4HS4A 4W99A 1R4NA 4HCJA 1SY7A 3A4IA 1K3TA 4QDJA 5KYYB 1DG3A 2LRHA 1UWLA 2CB9A 4OIFA 2DQZA 4CVNA 1T0PA 2IS6A 2VPIA 2R97A 4OF4A 4ZI5A 4CKZA 1E1CA 4GXRA 5L8VA 4QHSA 3M6UA 5DGDA 4TL8A 4L0DA 3KJZA 4HQRA 5I7RA 2NWQA 4MAFA 1OGIA 1GTG1 4D8YA 1Y3HA 4NCXA 3TZEA 3Q5GA 4HH0A 3THOA 3TR5A 4YCAA 4RPHA 1CXZA 4EBFA 1WD5A 3NIFB 5KKCA 3BL5A 1E2IA 1E8NA 1NATA 2B34A 2QTAA 1O58A 4UCXA 2EBHX 3M89A 1E1QD 2PAAA 4QYIA 2J3HA 2PYIA 5T4HA 1BD3A 4LBYA 1UPTA 4MS4A 3OEWA 3TLJA 4WVLA 1ZJ6A 3VR1A 2YN0A 3SHOA 3AR4A 3TFOA 4NPCA 4BO6A 1JHOA 1T6BY 1IMOA 2EWVA 2UVPA 3A10A 3IJEB 3A4NA 2H4JA 3PQ6A 4V0OA 4JI5B 2DE0X 3BBPA 4KGDA 5FH9A 4M38A 1ENYA 1CYEA 4C30A 4L4YA 5F2NA 3QFCA 4BP3A 2ZRBA 1VHDA 2RGNA 2C97A 4H7FA 1EFHA 5EMLA 3TQOA 3WBKA 1QOQB 2Z8XA 3DD5A 5EUMA 4YCNA 1F0PA 4P53A 2CLKB 5EI5A 3B1ZA 4YJGA 1Y3AA 4LRYA 3WBJA 4KQHA 4U3JA 2RE8A 4JYZA 2IHUA 3CH6A 3O73A 3N2NA 4B9EA 2GGSA 2JI9A 1R64A 4ZQBA 2ODEA 5JZ9A 3KR1A 1KPHA 4GD3Q 1AQNA 2NP7A 5JQGF 3VR6D 5DX1A 1OGYA 4Z7JA 4Q01A 5LIPA 3JR7A 1DKRA 4C2AA 1PJSA 3NR2A 1WOMA 3PGA1 3W5JA 4I3HA 1TTHA 4DT1B 3ZK7A 1QORA 5FBZA 4RK7A 1VMKA 3GNLA 4UCWA 3BD9A 1TD9A 4X93A 3ZD9A 3JALA 4B87A 4QATA 3D6JA 4LF5B 1ZONA 4MQEB 1ATZA 3LT4A 2HGZA 2VCEA 2W6MA 3DDOA 3R7LA 3KELA 1P5FA 1QTNA 3NMUF 1QF6A 3OTWA 1ECBA 1H93A 4OMUA 1SCQA 1U2EA 1UADA 2C4TA 2IXAA 4RX1A 1LBEA 4KMRA 2IWHA 3ZHOA 1BE8A 2FZKA 1IFXA 2ZEJA 3CN9A 4AXXA 1O1YA 4F04A 1A5AB 3BGDA 1WHTA 1J1IA 3KSBC 3H5LA 2HLDA 2FPGA 2ZAOA 2QHXA 5ICFA 4IG9A 5K8TA 1Z17A 4U02A 2EZ9A 3GNTA 3K9GA 2AQHA 2OZKA 1HTWA 2VP9A 1MJGA 2M9MA 5AI6A 4YXWA 1OTYA 3R7BA 5BQ3A 4HDKA 2ZJ8A 5LP6C 1PEYA 2Q1UA 2R8EA 3IURA 3JQ8A 3NU1A 4FZ5A 5ER9A 1XWWA 3NPMA 5DBEX 4ENVA 5DULA 5I9MA 1UPXA 1KIFA 1UM8A 5JAMA 3IS3A 5AJVB 1ISPA 2FQYA 4TYPA 4ZWNA 3RI3A 4JUAA 1TA0A 2FCAA 1RWOA 2E82A 3O94A 4IAOA 1OIXA 4OV6B 3ZE8A 2Q1TA 4X6UA 1J0CA 2F3QA 2VH5R 1CF4A 1SZJG 3JATA 4JQYA 2C5AA 4BB6A 1RI2A 1XZMA 2N1MA 1ZBQA 4BZPA 3UUFA 4DL9A 2FX2A 4H1HA 3RU9A 2UUBB 4XQCA 1GOTA 2JGEA 4YY3B 4TKZA 3A4YA 2EL7A 2P5TB 1Z4NA 1COWA 4NSNA 3SNHA 5A4FS 1X7DA 2YINC 1Z4KA 4YDRA 1N33B 5ALQA 3KTFA 3JQ9C 3P8ZA 4IV5A 3P0IA 4FVTA 3RH0A 5FBVB 1MB0A 4DWJA 5DV9A 2G17A 3R5HA 1DIAA 2NYVA 3FTNA 3KTDA 3ELYA 4EG1A 3R8FA 1BHJA 3IJ5A 3KB1A 3KAQA 4ZVUA 3EVGA 4EFDA 3VGJA 1N9KA 3UYKA 3RREA 4BPBA 2VA8A 4RXUA 1RCFA 3VPFA 5GGYA 3RT1A 1TK2A 4XGNA 1CJUC 5JATA 2FI1A 4CKEA 5HM8A 4B83A 2CXQA 4KW7A 3LIPA 5DHTA 2O8BA 3M1AA 2PRZA 2NQ2C 2C7GA 4KP7A 2QAIA 5DNWA 4JQOA 3W8NA 1YF3A 6LDHA 5IM4F 1QYIA 1NVKA 2IYXA 3AKDA 3D2LA 4TTVA 4MDEA 2PMWB 2GH1A 3IR6A 4AZ3B 4EY3A 4HPJB 4FI3F 5EJ5A 2GAOA 4PHFA 2G40A 1XVIA 1J0XO 1A2QA 3PCTA 4WZ6A 3L1UA 3STYA 1P6UA 3D4IA 4YMIA 3R5JA 3ZDZB 4TKMA 5FP0A 5SY9A 5HCUA 5I7SA 1EFAA 4BJ6A 1YFKA 1RYNA 3PI6A 3UB4A 2VBFA 4ZCRA 1SQFA 4LYHA 4U4AA 3NQ41 3RQSA 2D0OB 2FDRA 1DO0A 2YRXA 3EIFA 3GWZA 1OA1A 4C3ZA 2KMLA 1LW7A 3D59A 2EQBA 2B99A 4JBHA 4U2EA 3RFCA 4YLGA 5COBA 3UA4A 4OI1A 3ZR4B 4OGWA 1XZBA 4B6JA 2XEXA 3KTAA 3VBEA 4M0EA 4TTQA 2GN8A 2DECA 2R8RA 3E81A 6REQA 4P98A 2JLYA 2XBLA 4RY8A 3K1YA 5SYMA 5IDVA 4J2TA 4RMHA 3S2ZA 4BKQA 2EXXA 3D7MA 3TBHA 1E4EB 2AMLA 2CLDX 3K8QA 4RZXA 5CG2A 5THQA 4Y2VA 1Q0TA 1OUMA 1P75A 2YVUA 2NUTA 3ZCTA 4CG2A 2C7RA 1UJ6A 4NARA 4CDRA 2C42A 2AVDA 1YUMA 3CNNA 4PG5A 4BGVA 1W36D 1YCFA 3HBFA 1TMKA 3JYNA 4TTJA 3TM5A 3KYCA 4B8YA 1I2AA 2PBLA 2PGAA 3LLUA 3G2HA 4F2GA 1PT8A 1RMYA 1TU4A 4MMXB 5BW8A 2Q5CA 1SC6A 2VPWA 4X6XA 4CQMB 4IGIA 5C8XA 3KUXA 3H1TA 4ZZ1A 5EJ8A 2QQFA 2YXDA 4L15A 2QPOA 2XNJA 4B4DA 4EGFA 1NQTA 4EVRA 1AA9A 1Y4AE 4O0MA 1GDDA 2JVIA 4EA7A 1XT6A 2CDRA 2YWXA 3SQDA 2XWJI 3H87A 4MUAA 3GQBB 1I51A 1VL6A 2C3MA 3Q9SA 4RPJA 2VXYA 3E7XA 1PQ4A 2D8MA 1AF4A 4CCWA 1X7WB 4IDDA 5FOVA 3RO7A 1AMNA 3OWHA 3ZNPA 1I36A 3QX8A 2GMWA 4RDXA 4LQ4A 1GG8A 1PL7A 1V2GA 1Z7GA 3UMYA 2C9OA 4WUVA 3PPVA 4XYMA 1MPTA 4D42A 3HUUA 5A5VA 2IT1A 4OUDB 4B75A 5BN3A 4M21A 4R1NA 5FI1B 5F23A 3CKMA 3E5NA 3P9XA 1M2GA 2YW9A 4AN1A 5CCBA 2I9KA 1FFDA 2FW9A 5FNVF 3ACDA 5EVJA 3MCAA 2R1VA 3F6SA 2WG0A 4QWWA 3DZIA 4ZI2A 4OQQA 1O6ZA 2EQ5A 2Q5OA 1CX9B 4UHHA 2H5JA 2N47A 2C96A 3DT6A 3R09A 1QB8A 2PQ0A 4WRRA 4RTPA 3I0MA 3VXKA 1NXOA 4HP8A 2ETXA 1CRLA 1VTKA 3I1IA 4RF4A 4I36A 5I7AA 3ZDEA 2FWPA 4AO7A 3H2BA 1CF2O 4GZ3A 4BXOB 1GGKA 4ALKA 1RC8A 3I5XA 1QSGA 1Z6QA 1KK1A 4IF4A 4R4JA 3RT9A 1T3TA 5E9JA 4COOA 4DMFA 4AMVA 3IA2A 4PYJA 5DXJA 3P9CA 4BJ1A 1JA9A 1IHYA 1BRMA 1N7GA 1EEXB 1XJQA 2CJYA 3LHDA 4UREA 3TE7A 3TW8A 4K9OA 5SICE 1T6ZA 4XLTA 3KKPA 1UP4A 3PC8C 3RU2A 1HF3A 1EGAA 4IJMA 1M6VA 3FUXA 1T9GR 4OQMA 2HLDD 2ZTVA 4WASA 1EIZA 1NY5A 4EW3A 3ONDA 1QG4A 1YDHA 4E14A 4KJZA 1Y80A 3PT5A 2BGRA 3KEMA 1ZH6A 4I4CA 4YXWD 3QWBA 3C98A 2P6NA 4MJLA 4KAFA 3AVWA 2HRCA 3AY6A 3NBYC 3NGLA 5J5VA 5ILGA 3PGXA 1SUCA 3DV9A 4E70A 2FPMA 3OKCA 3AHGA 3VV2A 4ZK2A 1XLTA 2SKEA 3KX2A 4LY6A 3BTSA 3TB4A 3WLAA 1HE4A 5ALNA 5JIBA 5JSZA 4P7FA 7ABPA 2J4FA 2QF7A 5H4HA 1IOVA 5KX5A 4F12A 2WTEA 2WSBA 4QUAA 1SXJB 3REOA 2J09A 4TWZA 2EL9A 4YAFA 2A3RA 4MUEA 4M7PA 1HDXA 4RLHA 3TKYA 3X44A 5HQTA 3MUOA 3SEZA 4OHYA 5KI6A 4HVCA 2H11A 4YYEA 1ECPA 1COWD 2DHDA 1N3YA 2O5VA 3Q7QA 1T2DA 1UQUA 1Q16A 3QF7A 1XDDA 2ZRQA 5DCLA 3AF0A 5EKTA 1I24A 3CNBA 4DLAA 1EFVA 1M33A 3R0QA 4BUZA 1G8AA 2FW6A 2IRWA 5J2UB 3AVXA 2OZPA 3QWAA 4B0OA 2A59A 1E2EA 4PO8A 3IRVA 4G5QA 4MULA 1T2EA 3NV9A 1M83A 3BFXA 3QW2A 4PZCA 4BLOA 5LBUA 3ZJYA 1GL9B 3ZCXA 1P19A 1JTEA 1BOFA 2Z6VA 5BRNA 1ECLA 3QA9A 3UT0A 3OU2A 2D8AA 1PJ2A 1R50A 4HB3A 2XMRA 4LTNA 5KTOA 2FP3A 2WFLB 3UK2A 5JBNA 4I55F 2QN9A 2XF8A 3DHVA 3VBCA 5I9NA 1A4XA 1JDBC 3ZZ1A 1J9GA 1WSBA 2C77A 4LECA 5ESRA 2QUIA 3R3UA 3BTUA 1NMZA 3EN0A 3K0BA 3VO2A 1K5PA 2WJZB 3ER6A 5EHNA 3ELUA 5F5NA 4DLYA 3CUKA 3GLIA 2O5EA 4OLBA 2CUNA 4NG5A 3UMJA 2Z1MA 1RI3A 3AUFA 5T5QA 3ZBPA 1KAHA 5KVVA 2PRJA 1SVLA 4BVEA 1C9YA 5KYXB 2CGEA 2PKQP 3B9RA 5YASA 4X60A 1FUIA 4EHBA 3JD2A 2ERCA 2XRMA 4QBGB 5JEDA 3VJRA 5G0SA 5M34A 3Q0EA 4XWAA 3WGMA 2BBSA 4OAPA 3K0KA 3P27A 4QPPA 5BOSB 2FMXA 4OLHA 1YS2X 1ZEJA 5AJUA 4L4ZA 4ETMA 2PS3A 5LQSA 4GRDA 3DE2X 3U31A 1I6KA 3OQBA 3VOSA 4WY2A 3FWHA 1LH0A 2HXGA 2NACA 4A0HA 2O1EA 4J94A 4QPJC 1TMYA 3V7NA 1Y5MA 4DARA 3JWPA 1WCXA 5L45A 1ETUA 1MR3F 1ILEA 2PX2A 3SGLA 4Q3OA 4K9LA 4EYKA 1CZOA 1WXGA 2AOXA 1H85A 3R7WA 4JJGA 4K5QA 3CIFA 3V8BA 3G88A 3L7DA 3F4LA 5CBPA 1B41A 2VJKA 3R5SA 3UGKA 5JWRA 1ONPA 1E1RA 2QQ5A 3BXOA 3GLSA 3TLMA 2NUBA 2PGXA 5ADVA 3I0NA 4FDVA 3O9ZA 4BO3A 4W9NC 2UV8A 1NTOA 3PNQA 2PX6A 3H65A 5DEOA 3TD6A 4LAFA 2Y92A 1DKPA 1NI3A 3N05A 3DAFA 4OHWA 4XQGA 2FW0A 4RL4A 3DO8A 4ER5A 4ZU1X 3F6PA 4QAJA 3WL6A 1A82A 1F0YA 1MVNA 4BO2A 4FWBA 2EIHA 1T0JB 5LQKA 1XFAA 2V7GA 3MS7A 4DC0A 1CEYA 3NHWA 2XUKA 5E3IA 4AN4A 1W88A 3EEYA 2P2NA 3GAFA 3P9ZA 5KYUA 3ZVNA 4I66A 4LF6B 2AN5A 3WKDA 1OR8A 5BYKA 2H9IA 5LWHA 3OPQA 1H5QA 2BTOA 3FYSA 1CUHA 4LFBB 4I4LA 1LS1A 3L1HA 4J03A 3I72A 5CJPA 4CEJA 1PV4A 4N01A 3K2BA 1GARA 3L02A 2D3TA 3T54A 2HRDA 3CUUA 2MDTA 3DQQA 2JGNA 1CUIA 1L9KA 3IUQA 4JMLA 1XK7A 4PX5A 4C2UA 2YRWA 2VHQA 3H1EA 2ZYSA 3Q7PA 3IIEA 3CSUA 1Y6RA 1BKYA 1UCFA 2ZSAA 2Q3BA 3HU3A 3I1YA 1VSQA 3ZHVA 1PV1A 3KKZA 4CJXA 3X0DA 5H83A 3OJWA 3HI6A 4LYYA 4DIFA 3KSMA 4KIGA 2UUAB 1DTSA 3RSFA 1O9BA 1QZXA 1H69A 1G9XA 2IIBA 3H11B 2OHVA 1X8KA 5IBRA 5GIOE 2VDUE 4P31A 4J9VA 4M8KA 1AF7A 1JTVA 4NV3A 3Q3HA 2JFXA 3E3AA 3DSRA 2HA3A 3N7AA 4GNRA 3VI3B 2G76A 3ZHZA 4KC0A 4LJLA 5DMXA 4E31A 5CX1B 1F14A 3O8NA 3PICA 1R9JA 2FHSA 3AEUB 3SQLA 1B0PA 1YDGA 2EC5A 2OO5A 1D4AA 3DD1A 4MUJA 4N0QA 5GM1A 1GV0A 3FOCA 3OZVA 3T7RA 4YXFA 4BQEA 3OI7A 4OAOA 2IHYA 1QIHA 4X1OA 1Q0RA 3NPAA 5F7ZA 1MJ5A 1N4AA 5IFLA 4R2HA 3AEQA 3HSYA 2P2YA 1KS9A 4I4TB 1YFLA 4PYNA 3P9NA 2O50A 3KKKA 1EJ0A 1I14A 2CYBA 3HVJA 3QOYA 1AKRA 3HLYA 4GE3A 1AMOA 4C06A 4F8EA 5PGMA 2BJHA 3PUWA 4OXXA 2WP8J 1E3DA 1AUXA 5CLIA 1ZICA 1NNUA 4H6WA 1BHO1 5IKMA 2OLJA 5EIWA 1JQKA 4ZVQA 1E1CB 3K53A 1X2BA 3R20A 1QGAA 2V03A 3DQZA 1NI5A 4NJMA 5JZOA 4HEQA 2BFBB 2GQ0A 2R86A 1CUSA 2LPMA 1ISFA 4NNOA 3U4GA 2YXEA 1GYQA 1R6TA 3JZAA 2W71A 4HF7A 4JVSB 4DHWA 1ISRA 3QFSA 2PSJA 3NHZA 1PK9A 4O4JB 4P4SB 3SU8A 4E4YA 1TUIA 1LPSA 1SBCA 5G1OA 2QVBA 3M34A 1E7QA 4MW5A 3UNXA 4BO0A 1G42A 1U6IA 2ORED 4CLRA 5LMZA 1GT91 4YPFA 4YUXA 3GP8A 1RD4A 1TJYA 2GPYA 1JJ7A 3JD3A 1M7GA 3S8YA 2Q3FA 3GPBA 4XWOA 4AICA 1A5BB 5FOTA 5GY7A 4B85A 3UGQA 3R9IA 5A62A 1X1CA 3MWKA 4UD6A 4GMKA 5CM8B 4DBVO 3E4DA 3EMKA 3W5HA 4YS6A 2OECA 4J2HA 5L51A 5I7OA 3MFQA 2GBCA 3EZXA 4F2HA 1EA5A 4NEHB 2OA0A 4F84A 4WIAA 3B2QA 4NNJA 5E6SA 5HP4A 4UEKA 4CMKA 5FOXA 3ZZ0A 4KXYA 5TY0A 4IIEA 2HFJA 1P74A 4KO3S 3PJDA 4PZLA 1P1CA 1XNRB 1N9ZA 3Q12A 3AIIA 2HQOA 2VNAA 1D5WA 4E1AA 2FOXA 3BJIC 4YROA 2PUFA 5A5GA 4ZAGA 1RCTE 4N5MA 4IGKA 3GA5A 2JFGA 2J30A 4B2LA 2FN7A 3F8SA 4L07A 2AFIE 3V7WA 4E12A 5JXWA 5K1ZA 2HPVA 2A9JA 3EGWA 3WNDA 2BRUC 3GPDG 4PX3A 5F77A 4HOYA 4WKGA 3RKRA 3BSWA 3GFRA 2GM5A 2NV6A 2C4NA