4HUJA

Crystal structure of a hypothetical protein sma0349 from sinorhizobium meliloti
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
204
structure length
204
Chain Sequence
b'NLYFQSMTTYAIIGAGAIGSALAERFTAAQIPAIIANSRGPASLSSVTDRFGASVKAVELKDALQADVVILAVPYDSIADIVTQVSDWGGQIVVDASNAIDFPAFKPRDLGGRLSTEIVSELVPGAKVVKAFNTLPAAVLAADPDKGTGSRVLFLSGNHSDANRQVAELISSLGFAPVDLGTLAASGPIQQFGRPLVALNLLKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein SMa0349 from Sinorhizobium meliloti
rcsb
source organism Sinorhizobium meliloti
molecule tags Structural genomics, unknown function
total genus 56
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4hujA00
4JROA 4PVDA 4IDGA 3B70A 2RH8A 1I24A 3ZV6A 5GMOA 3HB4X 1YOVA 3WX0A 4BGUA 5U9CA 5KKCA 3RI3A 2WSBA 4OXNA 2Y99A 3WQSB 5LDHA 2Q46A 3CPSA 4ND1A 5FWNA 1B14A 4E33A 5JAMA 3QP9A 3H9EO 2CZCA 1VRWA 4BKRA 2WYUA 3TL2A 3R3SA 4O5OA 4PLPA 2Z95A 4U6QA 4AJNA 3INGA 2ZYDA 4EUEA 1K6JA 1DRUA 1BRMA 3EZYA 4EDFA 1I2ZA 4M87A 2WEKA 5G2OA 4XQ9A 3GRKA 4D3SA 2PZMA 2AEMA 2G0TA 3FBGA 3HZZA 3AOEC 4YJHB 3LK7A 1HLPA 3AUSA 2Y93A 5K6AC 2AXQA 4YT5A 4UVEA 3M2PA 3ZWAA 2H6EA 1RWBA 1ZVMA 3RBVA 1EVJA 1YB5A 3QVTA 1J6UA 1H9BA 2GO1A 2R2GA 4FCCA 4R3WA 4J7UA 4RDHA 2BFOA 1IZ0A 3HADA 4OQZA 3AW9A 4CM6A 1UUFA 2QQ5A 3PXXA 4G81A 1WMAA 4J1QA 3AFMA 2VWGA 3IDSA 4J4TA 1YE3A 1MGOA 4GAEA 1X15A 5A05A 2AE2A 1NASA 4XQEA 1GU7A 1YJQA 4Q39A 3GGPA 3GMDA 5IZCA 1RYEA 2BD0A 1SNYA 3EAGA 1C0LA 3K30A 4D42A 1QXSA 1ZJYA 3PQFA 2VNAA 1VC2A 3FTPA 4PLVA 4NU6A 4CM8B 3LDHA 1IHYA 2IXBA 2UUPA 4ONEA 2VWPA 1LSJA 1Z45A 3SC4A 3E8XA 2JCXA 3ICCA 4IGEA 3BMCA 5F5NA 2HRZA 2OP0A 3OF2A 4Z9FA 4WOKA 1OBFO 1GCUA 2FZEA 2JAHA 1XR3A 5H81A 5ENVA 2O50A 3ON5A 1IUKA 2C0CA 3D5TA 3VDRA 1SB8A 2EIHA 1ZCJA 4E31A 3IAHA 1E77A 4URFA 2OFPA 2I67A 3OA2A 3M6IA 2QW8A 4ZJUA 4DGSA 3G49A 1F8GA 4AJPA 1P9LA 4CUZA 5A1TA 5MGBA 4CV0A 1YKFA 4D46A 1E7WA 2ZJ1A 4MP6A 2D59A 3KEOA 2NWQA 1NWCA 4R1UA 1HZZA 3NTOA 4HFNA 2P9CA 2C82A 5JAZA 5J23A 5IDXA 2CVOA 3D5QA 5F1OA 4J4BA 1ADBA 2Q45A 5JMPA 3ZU2A 2VCYA 4XZ3A 3UUWA 4RVDA 5L4LA 1AXGA 3D3EA 1I3MA 4JIGA 5IXSA 2QHXA 4FBGA 4B7UA 4DTIA 1N1GA 3ITKA 4CM9A 3JQBC 4WCFC 1MX3A 3VPHA 1BG6A 4BNVA 2O23A 2P91A 4BV8A 5JXWA 4D43A 4CMBA 2ZKLA 3HN2A 5A9RA 3RC2A 2R00C 4EBFA 3UAGA 5FFFA 1FDWA 4YRBA 2IYPA 3GFBA 2WWRA 3AFNA 1VKNA 3GUCA 1I01A 4U0KA 3ZNPA 4BO7A 1HE4A 3DBLA 4DQUA 1R15A 1UAGA 1JLLA 1AXEA 2FPGA 2G17A 1BGVA 2OZPA 4G2NA 3RIHA 3W8FA 4NG5A 1U4SA 1B3BA 1RM5A 1ZIDA 4CMGA 2HMSA 3ZU3A 3LF1A 5JFOA 4H16A 4D7AA 1GQ2A 2R6JA 1CERA 1T26A 3QWHA 1Q2XA 2IZZA 3DL2A 3E5MA 1MG0A 5DCUA 4E2YA 3WGHA 3GVHA 4YT8A 5CDYA 3NGLA 2OORA 3E6AA 3JQAA 2HK7A 1DLIA 1QMGA 3K2EA 3Q1LA 4ROSA 4DIBA 3ZHYA 4GX5A 2I6TA 4N54A 1ENZA 4H15A 4WECA 3ZWXA 3JQ7A 4O1MA 3DBHB 5FI3A 2Y67A 3K8ZA 1CEQA 5A9TA 2HAEA 4DIOA 3QW2A 3UCXA 3DO5A 3UN1A 3GG2A 3I9LA 5FYDA 2B4QA 3ZDFA 9LDTA 3SJ7A 4B7CA 4BO3A 4RF4A 4XJTA 4R16A 4R1TA 2RHRA 4FS3A 4OOFA 4J1TA 4DRYA 2PZKA 5C7OO 1UXIA 2EKPA 4LISA 3DXFA 2PA3A 5IF3A 3N74A 3LLVA 1Y8QA 1IB6A 4BO9A 5EL0A 5EN4A 4FFPA 4M1QA 4YAGA 1E5QA 1FDSA 5KCZA 2Q2QA 2VT3A 3K31A 1RM4A 3WTBA 3Q6IA 2AQ8A 4J0EA 3PI7A 2H9IA 2IEDA 4IY1A 4PRLA 3V2GA 1ISFA 3DAFA 4E3ZA 2X58A 1UDCA 3L6DA 5L40A 3BMOA 4OQYA 4ZU3A 4RORA 3RUCA 3SX2A 1DC6A 1JAYA 2EV9A 4BKQA 3KLPX 3MJSA 3BTSA 4PIVA 1U28A 4YJGA 4RF5A 5COBA 5IDYA 1GQYA 4E5MA 1X7HA 1Q0HA 2VNSA 3PVZA 4PN3A 1E7SA 3ADPA 1I3LA 4P4NA 1CWUA 2OP1A 1VPDA 3IUPA 3FR8A 4XCVA 1M76A 1HYHA 2O3TA 2YHIA 3PK0A 5CEEA 3ANNA 4TVOA 2A9FA 3GVCA 4R68A 1XA0A 2E49A 2DAPA 5JC1A 1E1MA 5EQDA 1KVTA 1IOLA 1GUYA 3VAZA 4A27A 2ZB4A 4EJMA 4B4UA 4AJOA 5DT9A 2BLLA 3KVOA 1PGOA 1E1LA 1KYQA 2B83A 3WGZA 4A03A 1U3UA 1QV6A 4WASA 3RUEA 3BXXA 4PVCA 4XRGA 1X7GA 3FCOA 4OJNA 1E3WA 3RU9A 2NU6A 3PDJA 3CMCO 1ZXBA 2PR2A 3L9WA 1QYWA 1KERA 3R6DA 1XELA 3I4CA 1RM3A 3PHLA 3R0IA 1MC4A 3ZW9A 1LUAA 1DFGA 3JTMA 3BMQA 5JY1A 5EINA 2VZ9A 3VH3A 3JQGA 3PZBA 5DNAA 4BOYA 4IZHA 3GHHA 1IHXA 1I2CA 2GD1O 3KHUA 2FSVA 3EW7A 3PDUA 4Q3AA 1P33A 4DVJA 3VVBA 1AGNA 5LCXA 1P45A 2Z1MA 3LT4A 4XEHA 3GNTA 3UGKA 3ZWNA 1VI2A 4CL3A 3NV9A 1GZ3A 1NM5A 2W2LA 4IQGA 5F1PA 5F21A 4BO2A 4Y6SA 2RBEA 2C5AA 4J6FA 2FP4A 3KO8A 4E5YA 1OFGA 3JD0A 2BKAA 3VHRA 3WG9A 3GDGA 3AK4A 3ZWOA 4F3YA 3INRA 4JGBA 1DHRA 1N5DA 1EQ2A 1Z82A 2PLAA 1O89A 3KSDO 5LDGA 1YDEA 3BHIA 1RJWA 3G17A 2HUNA 4GWGA 1JKFA 3WMWA 1K0UA 4EJ0A 4RPLA 2ZQYA 3ZHZA 3S55A 4E6PA 2I9PA 4RQUA 5BSHA 3HN7A 5G0UA 4YAJA 2HDHA 5EJ2A 1U4OA 1XIVA 2W8ZA 3RC7A 1R16A 4OHUA 4PLZA 3TNLA 4XR4A 3DZBA 3NDRA 1YDWA 1L1FA 1SEPA 3Q9UA 2NVUB 1SZJG 4M8SA 4BB6A 4BQRA 1EEHA 4TSKA 3TPCA 4JBIA 1LLQA 3WOHA 3I9MA 4FC6A 4LSMA 2UDPA 4BNWA 1DFHA 1CETA 3OJOA 3WGTA 3ETGA 3TDKA 1Z74A 1PL7A 2PGLA 2Y0EA 3RUDA 1HRDA 2GZ3A 2UVDA 2WYWA 2I99A 4NJMB 5HS6A 5T67A 1Z7EA 4BO6A 1E3IA 2YZ7A 2FMUA 3PJDA 1PR3A 2PFGA 4YT2A 5EMHA 4KTTE 4F45A 1N7GA 4TWRA 2CSUA 1NQOA 4J9UE 1WLYA 1ZFNA 2EEZA 1O6ZA 5AXAA 4BO4A 1I0ZA 4I5FA 4II3A 3VDQA 5BNFA 2B5VA 3DEYX 3P2OA 3JQ9A 4YJDA 1KVQA 4BNZA 3GDFA 5JDCA 5KJ1A 2PK3A 1H93A 1U8FO 2HSDA 3MJCA 5IDQA 4LW8A 3FHLA 3AU9A 2P5UA 3M1LA 4NR0A 5CAEA 1OZAA 3MEQA 4FDAA 1ML3A 3ZWMA 3ADOA 5AXCA 1YB4A 3H6KA 1RPNA 4CM9D 1DDOA 1QLJA 1A4UA 1UXGA 1WW8A 1E3WB 1EDOA 3U5TA 1I3KA 3ZWWA 4OO3A 3O8QA 1MC5A 4GVLA 3D3WA 4P38A 4XR9A 2PD3A 5KOIA 4CMEA 4ESOA 1J4AA 1TT7A 3BHMA 3DTYA 4NK5A 4CLRA 3GH3A 3GZNA 1DC3A 4B4OA 2HK9A 1LLCA 2EGHA 5JBIA 3AY7A 5I7EA 3H5AA 1GQQA 5EQFA 3EC7A 1DBVO 1QR6A 1Y8RB 2HO5A 2VRBA 4EUHA 3CEAA 1LLDA 4YRDA 2BMAA 4DPKA 4BNJA 3Q2IA 2X0JA 3ZW8A 3O38A 3ST7A 4XDZA 2AMFA 4Q3DA 4Y67A 3TFQA 2FOIA 4OKIA 1B8UA 1SAYA 2J6IA 2PGDA 4MKXA 1X7DA 3RBZA 4R1SA 3GC6A 2YY7A 1GYPA 1YXMA 4BNHA 3D0OA 1E7MA 3NTQA 5DULA 5ER6A 3IC5A 3LZ6A 1JW9B 3JQAD 4L73A 1XYGA 1F12A 3RKRA 1X14A 4WGGA 1XSEA 1GZ4A 3C7CB 1C1DB 4EI2A 1C1XA 2X23A 4PLGA 1VSUA 1UZLA 1P0FA 4Y98A 3F1KA 3I9OA 4K6CA 1R66A 1Q7GA 2QYSA 4NJOA 4X54A 3KYCB 4PFJA 3MWEB 4RVFA 4JBGA 2CDBA 3MJTA 4PG7A 4FGWA 1YQDA 4RL6A 1DOHA 5B1YA 5KVVA 4JJIA 1PTJA 3QVWA 4MIOA 4KOAA 4NFHA 1P31A 3DMTA 4FFLA 1UH5A 4FSHA 4DPMA 5TLSA 1PU2A 2YYYA 2XXJA 1F8FA 1ZXLA 2IZ1A 5ICSA 2CFCA 2FY8A 1R4NB 2IODA 3I3OA 1KOLA 3AUTA 3PJGA 4CL8A 2JAPA 3RAJA 4BVAA 5IAAA 3N7UA 5TJ9A 4FR5A 3UFXA 1FDVA 2VTDA 5THQA 1ONNA 1P1IA 3DOOA 2GPTA 4WLVA 2X5JO 1MLDA 4YVFA 3S2FA 4N7RA 4CQMA 4NK4A 4INAA 1SBYA 2DUWA 4B8ZA 3U09A 3LSYA 1YL6A 1HE5A 1XKQA 3RUHA 1PGNA 1EZ4A 4WEOA 4BNNA 1NWHA 3I23A 4NZ9A 1YBAA 2JHFA 3NEPX 4BIIA 4CMCA 1G0OA 3D4NA 3FTNA 4YR9A 3EUWA 4L0QA 4GBJA 3W4JA 2JD1A 3O9ZA 1Y5RA 4FC7A 2Y1OA 5FF9A 2CMDA 3WWZA 1D1SA 3GA0A 1I10A 1YH3A 4BNYA 4NDNE 2NUAA 3NT5A 5JO0A 1TEHA 1DC4A 1F17A 3OJLA 5DP1A 1LRKA 3W8DA 2GN4A 4CM1A 2BGLA 5A9SA 3KSUA 4L4XA 1XU7A 1A9YA 3I4FA 3VZQA 1ZNQO 2QZZA 2VT2A 2DU8A 1CQJA 1V3TA 4EITA 5B4TA 4OOEA 2O4CA 2CF6A 3UH1A 2AEFA 2OXIA 1PGQA 3EMKA 4PGFA 2WMDA 2X86A 4M54A 1T2AA 1OAAA 3HDYA 1CJCA 1XU9A 2GGSA 2X9GA 3DONA 3FI9A 1H2HA 1QG6A 3PYXA 4K26A 4R69A 4CM3A 4D3DA 4RPHA 5AXDA 4KWHA 3GN1A 2AE1A 1E3EA 2PV7A 1VJTA 2PKQP 2VUSA 4JCOA 1Z7BA 1D3AA 3DWFA 4OKNA 3KUXA 3AI2A 3DR3A 4ZHSA 4TKMA 1DJQA 2Q1UA 2JHGA 3JQBA 2E37A 4WCFA 3F5QA 3JYLA 2W90A 3ZH2A 1N7HA 1IY8A 1ONOA 4R54A 3UOGA 3ZWBA 5A5FA 1ONPA 1A5ZA 1PX0A 1JWBB 1E6UA 3DZFA 1PJLA 4ZRNA 5TGDA 5DZSA 3CTMA 2X1HA 3V1UA 4W4TA 3PWKA 4E30A 4JK3A 2IZ0A 4GLOA 1BWSA 1PGJA 1T1SA 1R6DA 5F5LA 5G4KA 4UULA 3NT2A 1NAIA 4DYVA 4HXYA 2FHSA 3T7EA 3K9QO 1JQBA 4RF3A 5JDCC 2ZATA 1UZMA 4IDAA 2OOSA 3I83A 4IDBA 1K5HA 3T4EA 1KY5A 4RF2A 1O0SA 3ZNNA 4RVGA 2C2XA 1B26A 4WLNA 4E5NA 3BA1A 2JD0A 3I9JA 4Y8VA 5A5EA 4W82A 1LRLA 3DC2A 3SLKA 2VUTA 2HMTA 3RBXA 2X5OA 4MOWA 8LDHA 2YHUA 4CM4A 1ISIA 1PR9A 3PQDA 5BQFA 4CQLA 2IE0A 1YVEI 2HLPA 3OM9A 4CMEC 2DUUA 4FIZA 5JS6A 1I2BA 4AJJA 2DBVO 3ZV4A 1R0KA 1XWFA 1HSOA 3JYPA 3MOGA 4TRNA 1NXQA 1PWXA 5DBIA 1FJHA 1XDWA 1JA9A 4GX2A 3ZNOA 5L45A 4ALJA 3MZ0A 2DVMA 4IXWA 4DXHA 1QYVA 1TT5A 4AL4A 3JYQA 3L6EA 3WJAA 2FR1A 5AQ1A 5T57A 4IMRA 4QFDA 2I3AA 1LDBA 1N9GB 3DBRB 2I5PO 4CMIA 3PJEA 2Q2WA 2LDXA 4FB5A 2O48X 3JQDA 5KVQA 1KVUA 4HBGA 4XX0A 3HHPA 3WBFA 2JD2A 2GR9A 4LCEA 4EGFA 3KYBA 2C54A 1BXGB 1Y6JA 5AYVA 5L4NA 4CM5A 3EZLA 5A4DA 1LDYA 1KIFA 1NPDA 4ZN6A 3MTJA 2NQTA 4XRRA 3RFXA 4XKJA 2A35A 4E32A 4IM7A 3EY4A 3FWNA 1M6WA 5ENDA 3A1NA 1GL3A 4HWKA 3H65A 3DMTC 3S8MA 5L7TA 2CF5A 4J91A 5HM8A 3MJVA 4KDFA 3VH2A 2D3TA 1W4ZA 2HCTA 4QT0A 1EUCA 1CDOA 1IPFA 3STHA 5CDUA 5IN4A 1GUFA 4WLOA 3ZZNA 4R5HA 1D7OA 3QWBA 3D64A 3GEDA 3EYWA 3Q2KA 2G1UA 4L75A 3E48A 4NBWA 3ROPA 4CMHA 4MDHA 5TIIA 1NFQA 2J3IA 3WQQA 2W2KB 1MXFA 3KYDA 1M66A 2EG9A 4Y9DA 4F6CA 1BW9A 2P5YA 4RDIA 4Z0TA 5JCJA 1YGYA 3V8BA 3L4SO 1NVGA 2O3JA 4ILKA 4BNMA 1A7AA 5GZ3A 1R12A 1GAEO 2DTEA 2O3QA 2A4KA 2TMDA 3UHAA 3VH4A 1MFPA 4BL5A 3UVEA 4E12A 2YW9A 3O03A 2QIOA 1W73A 1VL0A 1HLDA 2B36A 4Z0HO 1VM6A 4BV9A 1PJTA 4R41A 5HWSA 5JC8A 4JP3A 1MUUA 3U4HA 1VE9A 1DO8A 5B4VA 2GRAA 5BNTA 4CR8A 2GZ1A 2D0IA 3GGGA 1NPYA 1IZ9A 4IIVA 1GPDG 4N5NA 4MVJE 4LK3A 4XDYA 3WMXA 3ZV5A 2DC1A 5AVOA 1EE2A 3ZU4A 4XB1A 5DDIP 3JD2A 3AUAA 3WFJA 4PZDA 3A06A 5FI5A 5C7IO 4CUKA 4CR6A 4J2HA 1LSOA 5L3ZA 2EP7A 2DTDA 2PWZA 4TMFA 3PYMA 3WFIA 3WGOA 2DPHA 1O95A 4XYMA 2WD7B 1YJ8A 2AQKA 3VOSA 2PZLA 3L0DA 3EHEA 1GZ6A 4N5LA 2PY6A 1PIWA 4ID9A 4QSMA 1G0NA 1NTOA 3QQPA 1YQXA 4G5HA 3K96A 1T4DA 3UCEA 2QX7A 4DLLA 2OBYA 3NTRA 5A04A 5I7SA 1Y81A 1YOVB 2J3HA 4OYRA 3ICPA 3PTZA 3OECA 4CQMD 4YPOA 1F0YA 2BF7A 1V35A 1H0KA 3ZWVA 3VPGA 1JWAB 4IDCA 3CXRA 4ZGWA 3FN4A 3OEWA 1B15A 3WS7A 4AJEA 1BVUA 3AI1A 3WNQA 4MKZA 2UV8A 1HYEA 2OL4A 2POQX 1M75A 4EEXA 1SOVA 2V6MA 3V1YA 4IQ0A 4BNIA 2B0JA 2CVQA 4TZKA 1DHTA 3U3XA 3DZIA 4OIMA 1R37A 3G1TA 4CLOA 2Y1EA 4Q3NA 4HY3A 1ORRA 4Z9XA 5TQVA 1HDXA 3IOYA 2OGUA 5HRUA 1UP4A 5CEJA 3HG7A 3ZWYA 1T25A 1KEWA 3SC6A 5KJ6A 1DIRA 5I7FA 4MVJP 3P7MA 5ITVA 1Y9EA 4MJLA 5BSFA 2EW8A 4A0SA 2X6TA 3IL2A 2A92A 2HKIA 4J0FA 3FBTA 4LVCA 4AJ4A 3GGOA 4TVBA 4YWJA 1IE3A 1EMDA 3PIDA 1DSSG 3ITDA 4R51A 4D45A 4YQYA 5TSDA 4XGNA 1E5LA 2IDZA 1HWYA 5H83A 3CIFA 3BIOA 1U2DA 3JQCA 3OH8A 1HE2A 2D5AA 1BTOA 1ZK1A 5TRTA 3C1AA 3QV1A 4CLXA 1ZEMA 3OJ0A 4CMJA 3BMCB 4IDEA 3V5NA 2BFMA 2ZJ0A 1WPQA 3BZUA 3I6QA 1GY8A 2DT5A 4OAQA 1BVRA 4KMSA 1NHGA 4RCVA 1XEAA 1A9ZA 5F3RA 1BXZA 3DAGA 4FJ1A 4NMHA 4E4YA 4RPGA 1NAHA 1ULSA 1XHLA 2PKRA 1R4MA 4XGIA 2P9EA 4XQCA 2FPPA 2FZWA 2Q4EA 3ZI0A 2V65A 5KWEA 3BMNA 3PLRA 3RSHA 3WGIA 3H2ZA 1KVRA 4MO2A 1PZEA 3WNVA 4OL9A 5T6BA 1KC1A 1A7KA 4WKGA 3S1LA 3WLFA 4Y6PA 3OQ1A 3JQ6A 1WDKA 4FFMA 2NTJA 1PJSA 1QYDA 4B7XA 4Q3BA 4AVYA 3BHJA 4FOOA 2O4UX 1GD1O 1LC3A 3E5RA 2DKNA 2EERA 3Q11A 3PHJA 1Q0LA 3BTVA 1M2WA 3ENNA 5TNXA 5C3MA 1NQTA 4MIYA 1PL6A 4WK6A 1HZJA 3DMYA 4XYEA 2EJWA 3VKUA 2HQ1A 3QE3A 5JSFA 1Y5MA 4E13A 1Z73A 3G3EA 3JD4A 5JPIA 3AI3A 4YJFA 2ZCUA 1GYRA 3Q9NA 4OH1A 1UDBA 3JQ8A 1I3NA 1P1KA 4DC1A 3ANLA 3DBLB 4UUNA 1BSVA 2JCYA 4DA9A 1T1RA 5CDSA 3NAQA 3U4IA 1B3RA 3TL3A 4YA6A 2WDZA 1ZEJA 2ZB8A 1HDCA 3GEGA 1M6HA 1JKIA 2BI8A 4LMPA 1P44A 1U1IA 1C0IA 3BYZA 4XGKA 4PCVA 1B8VA 3GAZA 5FEUA 5I8ZA 3LLSA 4BGIA 3JQAB 1GEEA 1SCUA 2IEBA 1X13A 1R0LA 1GADO 3JQ7B 5T64A 2B4RO 3OSUA 3L4BA 3F4LA 5I9MA 4CMKA 4CV2A 3PRJA 3G79A 4CMAA 3D7LA 3PHHA 1TVEA 2DBZA 2VHYA 1PGPA 1KETA 2ZK7A 5ICMA 4FQ8A 3PZRA 3DFUA 4NQZA 2D1YA 5L7YA 1S6YA 3PFWO 5JW6A 3ZHBA 1H94A 2GDZA 2UYYA 3QVSA 4C7KA 1WDLA 2D2IA 4U5QA 2EKLA 3HE3A 2YV3A 3GEMA 4TRRA 1PQWA 4FFOA 3AM3A 1P1JA 1Y8QB 4QO8A 3ENKA 1H6AA 1UZNA 3RUFA 5JCJD 4TRJA 3R1IA 3MTGA 5A3JA 3M2TA 4NBTA 5CG1A 4XD2A 4PG8A 3W1VA 4J2OA 1EE9A 2QZ9A 3G0OA 3IIEA 2I65A 4I9HA 4IJUA 5B4UA 4BB5A 2E6UX 1DIGA 3BMOB 1V8BA 4C7JA 4B79A 4ND2A 1ADFA 3U62A 1HTBA 1EK5A 4KQWA 1GCOA 1ULUA 1Z75A 4YJGB 3OFSA 4BO8A 2QYTA 4OM8A 1U7TA 3U49A 1GV0A 4CPDA 4AJHA 4UVIA 2Y05A 2Q49A 3PWZA 4YRAA 3BTUA 2YHIB 1YQGA 4I08A 2NLOA 2EXXA 3RQSA 1L7DA 1JVSA 3KETA 3W4KA 1DIAA 2B37A 3GMSA 4WNIA 3WYCA 1NX6A 3RD5A 1V3UA 1HETA 2AEJA 4BMNA 1B8PA 2Q3EA 4UVHA 1PSDA 2O2YA 1E7RA 2VOEA 3AY3A 1I33A 3L77A 5DCYA 2BFAA 4BMVA 1ZMTA 5JLAA 4BKPA 2GLXA 4W7IA 1AHHA 1QYCA 1N92A 1D8AA 3VPXA 4UUPA 3C24A 1YONA 1WMBA 2IXAA 3A28A 3FNHA 4UEJA 2YQ5A 3H9JA 1CF2O 2I66A 2AQHA 4D0SA 5MDHA 2BGKA 4ZQHA 1K6XA 2YQ4A 1NPTO 1E7QA 1JAXA 1VJ1A 3WBBA 3BMQB 3RASA 4LMRA 4P4GA 3JQGB 4I1IA 1CIVA 4XQGA 5GZ6A 4ZA2A 4MVJI 5COQA 2X22A 1TB4A 1V9LA 4ZQGA 3PGXA 2PGJA 2WYVA 4FD3A 3DDNA 3LYLA 5CPBA 4EZBA 3TZHA 5JE8A 2X8LA 3HFGA 3OBBA 4FFNA 5G0SA 4ZVVA 4KZPA 2RIRA 3PPIA 4LSWA 4D41A 1KVSA 1PEDA 4WNCA 4Z9YA 2WM3A 4IDDA 5L51A 7MDHA 2VRCA 2Z1NA 4NIMA 1X1TA 1C3VA 1ZK2A 4Z3KA 5KJFA 2P2SA 4WJZA 2GN9A 4J43A 1KS9A 1U8XX 3VPFA 4CJXA 1YL5A 1AHIA 3PJFA 3FR7A 3V1TC 1GDHA 1NQAO 5I9NA 3VZRA 2JFFA 2P68A 2VHXA 2Q1TA 4IGFA 3KZVA 1SC6A 2G76A 3ASVA 3ZNQA 4YDRA 1PS0A 4GI2A 1XCBA 4WEQA 2HMUA 3FPCA 3NUGA 3S2GA 5L9AA 4KWIA 3MWDB 4FJ0A 1BHSA 1KC3A 4MVJM 4PZEA 2ET6A 1E7YA 4L8VA 1T2EA 3UCFA 2GASA 2YV2A 5AXBA 4A5OA 4DL9A 1ADGA 4WUVA 1U5AA 2C7VA 4YBZA 2NU8A 2VHZA 2JJYA 4L4RA 4J7XA 5CDGA 4NU5A 1EK6A 2RCYA 5DP2A 3S2EA 1G6KA 3QWIA 2AG5A 4HFJA 2BFPA 2WD8A 2FR8A 1HDGO 4DC0A 2E82A 3GT0A 5TF4A 1U3TA 2VUUA 3QLJA 1A4IA 2P4HX 1HF3A 1HL3A 2CDAA 1LU9A 3K73O 1ZSNA 3LC1O 3M1AA 4WLUA 2H63A 4W99A 4J9VA 1MP0A 3H3JA 1P1HA 3VH1A 4J3FA 2O3RA 4RV9A 2D4AA 2PNFA 4J1NA 1LX6A 3F6YA 3JYOA 2YDYA 1P3DA 1HKUA 2DBQA 3IJRA 4Z6KA 8ADHA 5A3VA 1NVTA 1V0JA 4GX0A 4ND5A 2ZTUA 3X2EA 4J90A 1PQUA 4LCJA 4RGBA 2QRJA 1EVYA 4BHTA 1EUZA 1NR7A 3A9WA 3L4BC 4N5MA 4QEDA 3DHEA 1O9BA 3FRJA 3TZQA 2Y1FA 3NJ8A 1LSUA 3UKOA 2ZB3A 2BELA 4LRTB 2FR0A 3Q0EA 1VL8A 2Y68A 4JXKA 1E6EA 5EESA 4N18A 4EJ6A 1E3SA 4CR7A 4A2CA 3DTTA 3O8QB 4FPXA 4PG6A 4W7HA 2BGMA 3D3WB 3PFFA 1ZJZA 1DFIA 2DTXA 3WWYA 4CLRB 4FOSA 1PZHA 3ZWPA 3GZNB 3FNFA 4OSOA 4IZIA 2X9VA 3ROMA 3JD1A 4YJHA 4PLYA 5C37A 3KXDA 1B0AA 3IP3A 3OA0A 4NHEA 3WSVA 5IFLA 5JY6A 4E0BA 3JSAA 3T7CA 3EDMA 2EJVA 3H5RA 3U0BA 2C2YA 5ER9A 2VHWA 1QRRA 1UP6A 3EVNA 2IRWA 4MIEA 4ALIA 1U2GA 4EEZA 1LBEA 3C1OA 2W2LD 3KB6A 2VWHA 4HUJA 3TJRA 1BDBA 1DAPA 4Q3EA 1AN9A 1YWGO 4QO7A 1MB4A 3PEFA 3WQRA 4DBVO 3HWRA 1C1XB 1E92A 4QXMA 3RUIA 1PZGA 3AUUA 3VTZA 3RUAA 2SCUA 5G0TA 4KUEA 3TFOA 4IUYA 4CM8A 5BNIA 4YB8A 4UEKA 2ILTA 2NADA 5ES3A 1I5RA 1LDMA 1ZSYA 7ADHA 4BGEA 4E21A 1WAMA 2J5RA 5CPFA 4JQCA 2ZTVA 3DFZA 4MKRA 4WE3A 1JN0A 4IJWA 4IDFA 3D1LA 5CFZA 2V7PA 5TC4A 3GNQA 5I9LA 5JYDA 1WP4A 1PJBA 4GSKA 3ZV3A 4AJ1A 3IKTA 5TT0A 2X5KO 2GSDA 2YDXA 2NV6A 3HDHA 2O7QA 2YUTA 4OGWA 1MV8A 4CUJA 4E2XA 1IULA 2PTGA 5BT9A 3JQFC 2V6FA 1PWZA 3SVTA 5ITWA 1T2FA 4R1NA 3AOGA 1U7HA 4NPCA 4J7CA 4YAIA 4CQMB 4GGPA 3EK2A 4XYLA 2UAGA 3F9IA 1WDMA 3OICA 1DRVA 1O8CA 4KUGA 4JN6B 5G0WA 1E3JA 3D4PA 4R9SA 1QV7A 1HXHA 4R3NA 2EKQA 4O6VA 4ND3A 3ORFA 1OC2A 2OUIA 1DAOA 2XPCA 4AJ2A 3KM0A 2BH9A 1SB9A 5H82A 1F14A 3RCBA 3GK3A 2A94A 2VWQA 4UAGA 4O59O 3ROKA 4RPKA 2Q50A 1KEVA 4HV4A 3QY9A 3P2YA 2PH3A 5BSEA 2GN8A 2VYVA 2Y0DA 1EQUA 1E0DA 1FXSA 4CODB 5JAQA 5A9SB 4DYDA 3F1LA 3CKYA 3TZKA 3NDJA 4B4WA 5CDTA 5TX7A 1YS4A 1EBFA 1U9JA 3FF4A 4DIFA 2GZ2A 3NJ4A 4JNKA 1PJ4A 2EHDA 4PLWA 3ZWCA 3KBOA 4RLSA 4CV1A 2AA3A 1CRWG 1WWKA 4NBVA 2Q1WA 4GX1A 3H3FA 1ZMOA 3F4BA 4HNGA 1SPXA 3QVOA 4MVJH 4FN4A 1VLLA 5CEFA 4D3FA 2QRKA 5CP8A 3RWBA 1IYZA 2JFGA 3ASUA 4HFMA 2C59A 5ADHA 4BGVA 2DM6A 3K92A 1RKXA 1P74A 2HRBA 1DIHA 4WCFB 1DEHA 4UVDA 5U4QA 2Y1DA 3EGOA 2OMEA 3WYBA 1YO6A 3HJAA 5JMWA 2RH4A 4GKVA 2YFQA 3X2FA 1IPEA 5G4LA 1QORA 4PRKA 5EIOA 3DBHA 4IJVA 1E1NA 1ARZA 4TQGA 4BNXA 2Q4BA 2RHCA 4DPLA 2YV1A 3OP4A 3UW3A 3F46A 4II2A 1LDNA 3WSWA 5G4KB 2VRCD 2XOXA 3E9NA 3DZJA 1LC0A 3UF0A 4WLFA 5HTOA 3QWFA 3QWAA 3VTFA 5IXYA 1DIBA 1TLTA 4UUMA 3D4OA 1NQ5A 4GKBA 3LT2A 3IMFA 1T2CA 3KRTA 3U4CA 4LRSB 2VTEA 1AUPA 4PLTA 3FPLA 1F06A 1T4BA 1P1RA 3NRCA 4U7WA 3TSCA 4RVHA 1WNTA 1W6UA 1ZO8A 3W8EA 2NU9A 3COSA 3TZ6A 1RYDA 3IKVA 4CM4B 2WE8A 3GN2A 3AWDA 5L53A 1H5QA 1DB3A 4QTZA 4CQLB 5HBRA 1TXGA 4XWYA 1FK8A 3CH6A 4RZHA 3IS3A 4RLHA 5K9ZA 2H1SA 1JKJA 2EF1A 1UJMA 3C7AA 1B16A 3PHGA 2TMGA 4I5GA 4MVJG 4NFSA 1EFKA 4QFCA 3TQHA 4LN1A 4JP2A 4R01A 3INTA 3B1FA 3PLNA 2CNBA 4AJKA 4H7PA 1DPGA 2GNAA 1TT5B 2UUOA 3T4XA 3DHNA 4CM7A 1PZFA 3LVFO 4ZQFA 5TS3A 4LGVA 3P19A 4CMIB 3U9LA 4KUHA 4BNLA 3PWSA 1WXDA 2O3SA 3B6ZA 3BAZA 2WJPA 2EW2A 4DMMA 1NBOA 1Y9AA 3CUKA 1A72A 3IUSA 2FN7A 3GZ4A 4MINA 1FMCA 1JU9A 1R0SA 2CUKA 3C85A 3C8MA 3HQ4O 4Q9NA 4K1LA 5TT1A 4QX6A 4EYEA 3TOXA 1VL6A 1QKIA 3QRWA 3FD8A 4YCAA 4DQVA 1KEPA 4HNHA 1I32A 4O0LA 1UXKA 1FF9A 2BHLA 3MJEA 4I5DA 4RZIA 3WICA 4DUPA 2X0NA 2C20A 3VPSA 4DLBA 3N58A 3GOHA 3HDJA 4UUOA 5C7LO 5KVSA 1VSVA 1OI7A 2B69A 3H9QA 1LSSA 3RKUA 4L76A 2Q1SA 3VC7A 4MPDA 5GZ1A 4ITUA 1HDOA 4U8GA 3PP8A 1Q1NA 4Y6RA 1ZBQA 3LU1A 1IL0A 1T24A 2VYNA 3VZPA 4GLLA 2F1KA 3S2IA 4BKOA 1XLTA 3ZHXA 3KYDB 3IP1A 4YYZA 4U6SA 1BMDA 2YJZA 3FNGA 4HKTA 1BW9B 3Q3CA 3GPIA 4QUKA 2PH5A 2C5EA 1ZUD1 1HDZA 1M67A 4FGSA 4GVXA 3IJPA 1HT0A 2BI7A 2J5KA 3GF4A 4XA8A 3TZCA 2I76A 4IMPA 3H9GA 3AU8A 2J3KA 2BRUA 2GN6A 2EGGA 1LXCA 5JO9A 1E1KA 3KOUA 4D44A 4C4OA 4AJLA 2H5LA 4BUCA 5DOVA 4EW6A 1KEUA 4FW8A 1U3VA 3OJFA 1C0PA 3JD3A 1UXHA 2B4TO 2ZTMA 4BNFA 4BNTA 1ID1A 2PD6A 4L9RA 1K2WA 3AY6A 1PL8A 4IJKA 3LC7O 2V6BA 1UP7A 5KKAA 4ZD6A 4PLHA 4NI5A 5DN9A 2NVUA 1XQ1A 3OIDA 3PQEA 1LJ8A 5L4SA 5ILOA 3OHSX 3KTDA 5EERA 5JDIA 3LQFA 3JV7A 3FWZA 2O2SA 1PS8A 3KLMX 3K2BA 1AE1A 3GQVA 4JJFA 1L7EA 4E2ZA 2E48A 1MFZA 4YEDA 1XGKA 3C1TA 2RAFA 5AOVA 3VVCA 4YTEA 3WXBA 2AHRA 4NJMA 3RJ5A 4I9NA 9LDBA 3RC9A 4BNUA 5GY7A 3ONDA 1PJCA 4RO0A 3NYWA 4UEOA 1LTHR 4OSPA 4K6FA 2GYYA 4D0RA 1GPJA 3KSZO 1WZIA 3SXPA 3B1KA 3I9KA 1UXJA 3WLEA 1ENOA 1ZZEA 1SOWA 3GFGA 3H8VA 4RQTA 1B7GO 3WR5A 5KNLA 3NT4A 3LC2O 1JDJA 3O26A 3GRPA 1LLUA 2P4QA 4CV3A 4ALMA 1NFFA 4A7PA 2GCGA 5HS4A 1GUZA 1P0CA 4CLHA 2XF8A 1EFLA 4NBRA 1BXKA 4DLAA 3VKVA 3OQ6A 2W4QA 2J3JA 5I8WA 3CZRA 5BR7A 2G82A 4Z0PA 1D1TA 4ZQBA 5IZCC 2C7GA 4NH4A 3F5SA 4IS3A 1T2DA 4AICA 3DAPA 1UAYA 1GR0A 4BQPA 4CLOB 5L7WA 1ISGA 4I5EA 4MVJA 5IJZA 3DQPA 4MP3A 1C14A 1NVMB 2JL1A 2VYVD 3JQEA 2W98A 2Y1GA 4TRMA 4BKUA 4R4JA 1GV1A 4PG4A 1GTMA 1ISJA 1GYQA 2VHVA 3WYEA 5I7VA 1MXHA 4RPJA 3GNSA 5KVCA 1K3TA 4J16A 2JFHA 3OIGA 3JYNA 3DOCA 3HB5X 2HU2A 3DB2A 3E03A 4RVSA 4TROA 4XIJA 5COAA 3CSDA 4O63O 5KJCA 3ETEA 1QYXA 4NBUA 1MA0A 4NNJA 1Y8RA 2NU7A 3E9QA 4BS9A 3GVPA 5LC1A 3I6IA 3A4VA 4UREA 1QLHA 3H5NA 3ONEA 5ILGA 4M89A 4IIUA 2FPIA 4H3VA 1X0XA 3GDOA 4RJTA 1ZSVA 4M49A 4J49A 1DRWA 1HSZA 2X7HA 3ZCXA 4B3HA 4M55A 3K5PA 3GVIA 5THKA 2PD4A 5KTKA 3MJ4A 4J1SA 3RFVA 5IDWA 1WZEA 3SEFA 1U5CA 2LDBA 2GERA 4BMSA 1LDEA 1LQUA 3DZGA 3QSGA 3NGXA 2HMWA 3PIIA 1Y1PA 1W8DA 1C1DA 1VJ0A 1NFRA 4GH5A 4PLCA 3WGYA 3C3XA 3GUYA 1N8KA 3UICA 1GEGA 5DBFA 1K6IA 3CINA 1ZK0A 3WDSA 3KYCA 2DBRA 4XYGA 2D5CA 4I8XA 4YT4A 1HE3A 3SBOA 4KTVE 4EUFA 1R4MB 2O7SA 3BMNB 4LVUA 2HJRA 2CY0A 3DZHA 2V6GA 3NKLA 4DBZA 1Y7TA 1H9AA 4P22A 5HA5A 3HDQA 3PYLA 1GFSA 4JBHA 2Y1CA 3EVTA 1O5IA 3WJ7A 1XQ6A 3WGQA 4UVGA 1U3WA 1UDAA 1R4NA 1PJ2A 1XG5A 2DFVA 4XIYA 5JNLA 1BDMA 2NACA 2X4GA 4CLEA 4R5MA 3WIDA 2GUGA 1LI4A 4HX5A 1WVGA 4YAEA 1J49A 4GMFA 3PGJA 1YRLA 3ZU5A 3GG9A 4D79A 1NHWA 2AQIA 3CZMA 1PQPA 4XYBA 3RC1A 4WPGA 1EVIA 1LRJA 2NTNA 4IS2A 4JJGA 1DC5A 1ENYA 2WTBA 3V2UA 4B8WA 5A02A 4S1VA 4S3MA 1YBMA 3AM4A 3P5SA 2CVZA 4YJFB 5G0VA 2X0IA 2DQ4A 3L9XA 1N1EA 4PZCA 2DLDA 1YL7A 3JQ8B 3WTCA 1FDUA 4QECA 2YFHA 1LQTA 3JQFA 1X0VA 2JKVA 4AG3A 2EWMA 2ZB7A 2OO5A 3LT0A 4W9NA 3RROA 2B35A 2O3UA 4K28A 2ZYAA 4CLDA 5IZ4A 2OHXA 3F3SA 4YQZA 5T8KA 4GL4A 4Q3CA 3C7DB 2HMVA 3B20A 4JLWA 5DOZA 1ISMA 2ZYGA 3OJEA 3TOZA 5JDIC 3WB9A 3W4IA 2C07A 4HP8A 2NVBA 1RM0A 1Q7CA 3ETDA 4RVUA 1OC4A 4JX8A 4A10A 4YACA 1I8TA 3OEYA 4OXKA 2JCVA 2DFDA 2FRDA 2ZTLA 1C0KA 1PJQA 3MCVA 1Q0QA 3G1UA 3LF2A 1D4FA 2X9NA 4E5PA 2I3GA 3TF5A 2VYND 1ENPA 2HJSA 4E5KA 4ZQEA 4W6ZA 3AM5A 4BNGA 3GVXA 3JCZA 4P4LA 3OETA 3E18A 3VZSA 1ISHA 3CE6A 2G5CA 3RVDA 4KQXA 1FDTA 1EDZA 3FNEA 3I9NA 1SEVA 1S7CA 2GF2A 4NFYA 1Q7BA 1P1FA 2QG4A 3DBVO 3DOJA 3E1KA 3E9MA 1JTVA 2Q2VA 3AOEA 3SJUA 2HK8A 5JYEA 4U0JA 1QP8A 5C5IA 5IG2A 5K6AA 1KBZA 1MG5A 3FSRA 4XJSA 4IQ8A 2FSSA 4XB2A 4ALLA 2VZ0A 5B37A 4DMLA 2Y66A 3QA9A 3ROQA 4GMGA 1YB1A 2OBNA 1CQIA 5F1KA 4A26A 1KY4A 2D8AA 1LA2A 1H6CA 4IXTA 3ZN2A 4WOJA 1H2BA 3GHYA 4I9UA 4K9DA 1ZKMA 4G65A 6ADHA 5CG2A 1B2LA 1NR1A 1OMOA 4IPTA 3HSKA 4L74A 4GPD1 5DF1A 1A71A 1HEUA 2IYOA 2NNLD 2B5WA 5L95A 2NTVA 4KP7A 1TA4A 2QRLA 4L4SA 4WCDA 3MOIA 3RJ9A 2VQ3A 4B3IA 1ADCA 4R9RA 4DREA 2NQ8A 4YAKA 1H6BA 1DLJA 6LDHA 1QSGA 4MVJF 4F6LA 4P8RA 1LDGA 1N9GA 3DBRA 1DJNA 3GLQA 4IINA 2X0RA 4B3JA 5A06A 3RU7A 3ABIA 1SMKA 4GSLA 3TN7A 4Z3DA 5CHEA 3HFSA 4MP8A 4ZRMA 5TJHA 2AG8A 3OMLA 5KJEA 3SLGA 1J0XO 4FFRA 3AJRA 3TWOA 4J4HA 1W0CA 1E3LA 4M86A 1SO8A 3CMMA 1N2SA 1BXGA 3GPDG 2WE7A 2ZQZA 3ANMA 1VKOA 3IQDB 1V6AA 3U4DA 1Z6ZA 3QIVA 5JAIA 1OOEA 3I5MA 1NYTA 2EP5A 1EVZA 1I36A 1PS9A 1ZH8A 5EPOA 4MVJD 2NM0A 4ZICA 3NDIA 4ALKA 3NX4A 3L6OO 1ZK3A 3K6JA 3F47A 2C29D 4OMUA 3W6UA 4AJIA 3H7AA 5K0ZA 3V2HA 3L07A 1J5PA 3OIFA 1E6WA 5B12A 4B4VA 3WIEA 4BO1A 3HUDA 1G1AA 1V3VA 1O94A 1LEHA 3I52A 4E2WA 5BSGA 3QHAA 4KDEA 1A27A 4YXFA 2J5QA 2XAAA 2Y0CA 1HYGA 3QJ5A 2W2KA 2J8ZA 4QQRA 3H2SA 4IBOA 1ZK4A 3HNPA 1EBUA 1ZW1A 4WLEA 3WGGA 3DHYA 5JCXA 3GR6A 2CDCA 2R00A 3ONFA 1H6DA 3GAFA 3GY0A 2F00A 1HDRA 4PG5A 2ZIZA 3QVXA 1X1EA 2XXBA 1TI7A 4BNKA 2AW5A 1YBVA 3H4VA 3JQ9C 3A14A 2DPGA 2NVWA 1HDYA 2NSDA 4HADA 2VZ8A 5DBGA 1LNQA 1K89A 3DZKA 4ALNA 3O4RA 2CD9A 3TRIA 1DXYA 4TKLA 1P77A 5KIAA 2VOJA 4DQXA 2E4AA 5DCWA 3I1JA 3KEQA 4W9NC 2ZCVA 3PHIA 1PJ3A 4ND4A 1UR5A 3E82A 3W6ZA 4OXYA 2Q99A 3OQBA 4FJ2A 4A73A 4F46A 3LT1A 4GGOA 4BO5A 2PZJA 3H9UA 5A03A 1NNUA 4GQAA 1JVBA 1NP3A 2PKQO 5U1PA 4TZTA 5T5QA 5T8KC 3R3JA 2P9GA 2WD7A 3ZGYA 2Z5LA 4PLFA 1I30A 4BO0A 3KV3O 4HFRA 4GWKA 2FWMX 3ULKA 1CYDA 3RFTA 4AFNA 4DWVA 2VN8A 3UXYA 5IN5A 1EUDA 3B1JA 3BTOA
chains in the Genus database with same CATH superfamily
2C2GA 3RTCA 5IBCA 1KU6A 1SULA 3RF6A 2W93A 4OA5A 3GARA 2GZSA 4I4TB 5KKCA 1WZNA 2BCGY 5K01A 3VHLB 1BJRE 3DEZA 5EXDA 5IKXA 3AJ9A 4ND1A 2OT3B 4E33A 4RA9B 4RTOA 1E8NA 3H9EO 3PICA 4K6MA 2P3QA 1EFRA 4ODIA 3R3SA 4KI0A 4O5OA 3HEBA 1UFKA 1V5GA 2WKRA 2BF4A 5KDOA 3BGIA 1M72A 2ZT7A 2PT9A 3AR2A 1C8LA 1MIOB 2N42A 1I4EB 3KOXA 1FUKA 4A6XA 4EUEA 1BRMA 2ECOA 3EZYA 1KIAA 4LYEA 1QVRA 5IBRA 221PA 3ZDCA 1GGKA 5HVNA 1XXLA 5CVVA 3BDAA 3KAJA 5THXA 4POAA 3EASA 4WBSA 1ECBA 1ZUNA 2G0TA 3LQQA 3DKRA 4KGVA 5J59A 3FLEA 3HZZA 4UNSA 4YJHB 1UPTA 3AUSA 1RT9A 2Q5HA 4K46A 4RA6B 3QELB 2CNWD 4UJ3A 3L8EA 4MQ6A 5FOXA 3OQNA 3ESCA 4GFDA 2Y93A 4AMZA 1Z5ZA 5K6AC 2HFKA 1N6PA 3FNQA 2RGNA 4DNQA 3L92A 4UVEA 1GZVA 2AKAB 2H6EA 5J4KA 4KVFA 1V95A 1YRAA 5ESXA 3RBVA 3TINA 1YB5A 4EJSA 5JCPA 1U0FA 1H9BA 2R2GA 3BIWA 4R3WA 4UBJA 4IX1A 1GPNA 3HADA 3M6UA 4DLPA 2XITA 3HK2A 2GAAA 2QMZA 1PJZA 1PTKA 3NOVA 3OOYA 3PXXA 4J1QA 4J03A 1NQXA 3GLFE 4OX9Y 4RMNA 4QTXA 3WGMA 2BP7B 5IWAB 1N2XA 5A4MS 4CVNA 1BC5A 5LQAA 4QVIA 1T9GS 3SHFA 2C1EA 2B0CA 3K2IA 4R0VA 4FHGA 3TD9A 3GJ6A 3STUA 3LKZA 4D42A 2YVUA 3D7MA 3UIEA 1E64A 1ZUWA 2VIIA 3P0HA 5E6UB 5FUMA 2OHVA 5KYWB 2CL5A 1NATA 3FTPA 1JJAA 4NU6A 4CM8B 1D1QA 4S2EA 2VDVE 4HH4A 3R24A 4G26A 2B6NA 4M4SA 2F8MA 4IR7A 3F9RA 3VTAA 2JCXA 3EISA 4HR7A 2C2ZA 4M1MA 5F5NA 4MPJA 4EG1A 2ECKA 5JYCA 3G7NA 4HG2A 4Z9FA 5GJWC 4IJMA 3UZUA 1IBLB 4BTEA 1V4VA 1W59A 2B9VA 4K03A 1GCUA 2VT6A 1T0IA 2Z4TA 5B7GA 5K3OA 2X3UA 1LPSA 2UXBB 1KTVA 5H81A 3WRWA 2FQWA 3RTEA 4POOA 1QAOA 3ABRB 4M1KA 1U7WA 2DECA 3IAHA 1O57A 3NNNA 4E31A 3H3XA 3CRZA 4KE6A 4YRLA 5BUQA 4XARA 5AIBA 2QW8A 2F2TA 4UM7A 2V3CC 3MGKA 4AJPA 1P9LA 2F3TA 1MRZA 4ZTUB 1OH5A 3T1YB 3AFIA 4C7MA 4RTNA 4MP6A 3W8NA 1XN4A 3K70C 5C51B 3ACCA 2YNMC 1ZD9A 4FINA 3NTOA 3BWDD 5DPMA 4PZAA 2J4FA 3BXOA 3UPDA 5HMMA 4DIEA 3OSZA 5AW7A 1KH2A 2CVOA 3D5QA 2A6PA 4J4BA 2WZQA 3PUYA 3CZ4A 4Z6KA 2Z2KA 4CXMA 3QUAA 2Q45A 4ZZ2A 5JMPA 3KKMA 4G9BA 4I9FA 4AWAA 4D5EA 1NLUA 3PKIA 3KHTA 4GRAA 2MMCA 1H8ED 1GG2A 1M34E 2G8LA 2A0YA 3D3EA 5HKKA 1ZS9A 4QU8A 4R6XA 4AUMA 1ZA1A 1JSZA 4FBGA 4B7UA 2CB9A 3GMIA 4KH1A 2C04A 4P3PA 3RVJA 3DDUA 1IHPA 1P19A 1XFAA 2FK8A 3EXHA 2XCLA 3ONNA 3WGKA 4CKBB 4EHAA 1K27A 1TA9A 4H0NA 2PNJA 1R5OA 4IVRA 4I3HA 5JXWA 1AKNA 2CKMA 3EFOB 1NNSA 1FBTA 3GNLA 1SKAA 4EUKA 2IS6A 4LRUA 3ASYA 5GM1A 1QZZA 5A9RA 1EVKA 2ORVA 1F5NA 5AM1A 2R68A 3GFBA 2FW0A 2HWUA 2AIRA 1L1QA 3IJ5A 4G56A 3V9AA 3BDIA 1L8OA 1FYWA 2APJA 2FPMA 4HX2A 1J8DA 1KAEA 2GPYA 3G5UA 4FMBB 1HEYA 3DEKA 4JLUA 4U2EA 1VMDA 1R74A 4UHFA 5F3WB 2HU8A 1D4AA 2A0FA 4AN4A 2G17A 2YMPA 2XQVA 4G2NA 1N6NA 3NP7A 1J39A 3REQB 3W8FA 4F8JA 5H70A 1RYHA 1ZOSA 2YBEA 1QK5A 1TD9A 4K9MA 4RC9A 1B3BA 5EJGA 2CK3D 3OQVA 3UV7A 2E5LB 4CMGA 3FMGA 3KBBA 1FJ2A 1U5BB 1XTZA 4H16A 4NZNA 1PZXA 2GVZC 1LZKA 3QWHA 4CFYA 5AW1A 1B4DA 1USVA 2AC7A 4NF2A 2KPOA 3DL2A 4B8YA 4BFTA 1STOA 3T1TA 3WAJA 4G4SO 3V4FA 2Z2ZA 3LO5A 3QW4B 4B46A 3PUJA 5FTKA 5ALSA 1E2MA 2QI9C 2GDJA 3BK1A 3Q1LA 1HNWB 4Z4CA 2JJMA 3H2BA 3I04M 2I6TA 3NR2A 3OF3A 4N54A 4O2LA 1CRLA 5TMDA 3OOWA 4QUEA 3RRJA 5JZ9A 4M83A 4MV6A 4YNBA 2J9FA 3HZRA 3NHSA 1CEQA 3ZDAA 5A9TA 1JPUA 2HAEA 3QW2A 1OYVA 3D2LA 4FGZA 4DMGA 3AEZA 1L7RA 2YVAA 3I9LA 5FYDA 4ZVTA 9LDTA 1J23A 4IHAA 4DA7A 5HF6A 3BK7A 1O94D 4B7CA 1NYRA 2REQA 2Z6QA 4TSFD 3EC2A 5K8CA 4R1TA 4PQEA 5IP5A 2FSHA 1UK8A 2QTWB 4J1TA 3IHTA 4WFJA 5C7OO 3MPUA 5F12A 4MQBA 3CV3A 4MJ7A 1XRPA 5AW8A 3BORA 2VDPB 4EYGA 4KB5A 4CQNA 3N74A 3CCCA 2B8WA 1SC4A 3COYA 4YJ2B 1KFKB 1VSTA 3PNQA 3QZUA 4M1QA 3DB1A 4QC2A 5EN4A 2YFKA 5IT4A 1DBWA 3KVRA 4CIDA 1P4AA 3R09A 4Y2VA 4JBYA 3ZZTA 4WBNB 4ZZ0A 5KCZA 2OE2A 4LXTA 4B6SA 4R2LA 3CH7A 2VPPA 4TS1A 3MWKA 4J0EA 2JLWA 1C2TA 2H9IA 2FPUA 2QMQA 3NWBA 5BR8B 4PFQA 3A1SA 3DAFA 3TLCA 4E3ZA 1UDCA 1U8YA 2PJZA 1EHIA 4JL8A 5L40A 5E9WA 3BMOA 3RUCA 2ZYTX 1DC6A 4JT2A 4BKQA 3H04A 5J5CA 2Y2VA 3KLPX 4F9EA 4RACA 2H17A 3HDTA 4XPIB 5J4HA 5LXTB 1GQYA 4QPDA 1X7HA 1G38A 4JSTA 4TMWA 2VNSA 3S40A 2IOQA 4JMLA 2YZKA 1IK4A 3PVZA 3ADPA 4DARA 1I3LA 4BX8A 2ETXA 4KWEA 1RZRD 1G41A 2VAMA 2QB5A 4LJ4A 4UBKA 5I48A 2EQ5A 2VUHB 3VOTA 3VVLA 4B76A 3IUPA 5DM4A 1B73A 3GLFA 1QK4A 1WP9A 4V1CA 2EATA 1KJWA 3GVCA 4DJAA 2SBTA 1ZPDA 1JT2A 2BHSA 1DP4A 1Q3KA 2E49A 1S3FA 1UK6A 1E1MA 2WHEA 3K3PA 5DN6A 3TL6A 1KVTA 4UUBA 2AD1A 2XQGA 4MGYR 1SVKA 3KVYA 1QRTA 2ZB4A 1JQAA 1FU8A 4FBMA 3TOCA 4KI7A 3UT6A 4AJOA 5E1BA 2BLLA 3B51X 3A10A 1ZJJA 4GOLD 1KYQA 2PAFA 4JLAA 3WGZA 4H7DA 4JI1B 1AUQA 4ARZB 4EHDA 4EVSA 3NVKI 3BXXA 1X7GA 3ESBA 2XGGA 2NPIA 2PH7A 4GXNA 4NHOA 3A1CA 4V38A 4WZBA 2QM0A 4E08A 3DAYA 3UJPA 1WB9A 3VGPA 1ZXBA 2AC4A 3W9SA 4MHSA 3AXTA 3L9WA 3JZDA 2OHIA 1RM3A 3CRRA 16PKA 1KL7A 1L4HA 1P2DA 1REQA 2F7SA 2OGSA 2QV7A 3ZW9A 5LDDC 1FTYA 1LUAA 1DFGA 1NSFA 2JB9A 3A4YA 3AIIA 3BMQA 3FZEA 4HNRA 4X8MA 5JY1A 3RIGA 5DGHA 2RCNA 1KI7A 3EXFB 3K1JA 4GT1A 5EINA 5DNAA 1L5SA 5HP4A 3C6YA 3EDOA 4MV7A 2CHEA 4RV4A 5IVPA 2X77A 3GLIA 3CEHA 1Y4ZA 2GD1O 4L7VA 4TLAA 3PGMA 3VU8A 2C7QA 2HR1A 4HDNB 4LE1A 4QICA 4COOA 2FSVA 1JQDA 2F3UA 4Q3AA 1P33A 5DEIA 3ICOA 3RAGA 4BYMA 2DH5A 3DUWA 3KELA 5LCXA 1KMIY 5CA1A 3A6FA 1D2HA 4XEHA 5HCUA 1V1MB 3T4PA 1USUA 5ILQA 1EH5A 1PWYE 4FONA 1X7YB 1HA3A 1UEXC 3PF8A 3EBLA 3OLXA 5KTYA 1OFGA 3N8IA 1XL1A 3JD0A 4HPXB 1XDSA 3WIOA 5JBQA 1J70A 3W79A 3VHRA 4BLTA 1KMNA 1YZYA 1E69A 1OXBB 3ZWOA 4DV4B 1O95C 1EQ2A 2X9LA 1QK3A 2JRLA 4CKZA 2PVSA 2JJ2D 4GWGA 2HUNA 1KQPA 4B35A 4URUR 3CXUA 1UBJS 3EA5A 4PYKA 5C1DA 1PZNA 1QOZA 4M7WA 2OC9A 3LM8A 3M1IA 5BSHA 2G28A 3HN7A 5CVJA 3IHLA 4YRMA 3FTFA 3LVQE 1MC8A 1O1YA 4YAJA 5BQOA 3MJHA 3RDPA 5EJ2A 1NNLA 1U4OA 1WQ4A 4EKNB 1KMMA 3P27A 1TVKA 4LK2A 1L5KA 3RC7A 5H7XA 4PLZA 3TNLA 4XM2A 4Y1GA 4KEAA 1E59A 4AUNA 3GPLA 4XASA 3D6FA 4CKCA 2V54A 1GIAA 1Z5PA 4BVKA 1JV2B 1TCUA 2B34A 1NW4A 1URPA 1EX9A 2LCFA 3R0ZA 4FI3F 4IILA 2YC4C 4WESA 3WYAA 4EWLA 2FW9A 2W71A 2AN9A 1GRRA 4QUGA 3B1WA 3U44B 3WOHA 3I9MA 4FC6A 2UDPA 2YRXA 1DFHA 1CETA 1TNDA 1BE0A 3LBAA 3OJOA 1UZUA 4KHZA 4ZI3A 2DKOA 2Q6TA 2CLHB 4TVKA 2EYUA 2PGLA 4LI0A 2QT1A 3SEAA 3D2CA 2GZ3A 2ZRAA 2WYWA 3G9XA 3RWMB 4DADA 5T67A 4BO6A 3R3ZA 3TDNA 1NJ1A 1T5OA 3C3AA 1Z18A 3DCNA 4KTTE 1N7GA 2WAYA 5AW5A 3TLXA 3WLNA 4TWRA 4OXQA 5JAUA 2CSUA 5IWCA 1NQOA 8ATCA 1JHOA 1PT5A 2EFDB 4ZT3A 4B6QA 1P7VA 5DX0A 2WTNA 1O6ZA 4FFBA 3RUPA 2NO7A 5JVDB 1NVVQ 5AXAA 4NCBA 4I5FA 2G8NA 3HGMA 2ZJ8A 3EQ9A 5FQNA 5BNFA 3IQHX 3DEYX 3DR5A 1O6FA 2QS9A 1KVQA 3HJHA 3GDFA 1JX6A 1YUBA 5KJ1A 2PK3A 2FSUA 4UTNA 1U8FO 5B3JC 1DKOA 2IF0A 1V41E 3AU9A 5BXYA 1DWQA 4OHFA 4D25A 1E5XA 4L16A 4ZODA 3I3SR 1EHCA 4TTIA 1T0BA 3MEQA 4J3NA 1ZMXA 3FX2A 5HJ2A 1CHDA 3ZE9A 4QPNA 2MWMA 1YB4A 3T0GA 4NYIR 1HG1A 1THZA 3H6KA 1UXGA 3UMBA 4F1KA 4IHQA 2VPYA 4DLUA 3SJBA 1E3WB 1A50B 1VZ2A 3U5TA 2XTZA 1IN5A 1GA6A 4UDYX 4YGYA 3IO5A 2EZTA 1T15A 4TL9A 5IDXA 4P38A 1EFAA 1AHNA 2IUYA 3FNIA 4Q0MA 4CMEA 2J87A 2JAQA 3I39X 3EUEA 3RVOA 4JELA 3GZNA 3KQMA 3LQ4A 4HRXA 4B4OA 4C1BA 2QTCA 4S1PA 2C8KA 2PFKA 4U8HA 1KZ6A 2CGEA 4KRXA 4G8DA 4JYPA 5EQFA 3EC7A 3CHYA 3MD0A 1DBVO 1Y8RB 3GLGB 2H1HA 4EUHA 1X1CA 4B3SB 3CEAA 1LLDA 4Z7NB 2BFEB 4OEHA 3GROA 4Y2SA 4YRDA 2YZNA 3Q2IA 6AT1A 1IOZA 5I3ZA 4IYRA 4E1AA 2BKLA 4Q3DA 4R98A 2EL7A 5J2UA 4C20A 1AIPA 1J00A 2HREA 1VBKA 2PGDA 3RBZA 3OFVA 1WCV1 2YY7A 3F7NA 3N2KB 4OTZA 1KO8A 4LFAB 5B6JA 2G09A 3CGGA 4X64B 3NHLA 3AM1A 2VDMB 1FTQA 4HGOA 3IC5A 5KNDA 3FYUA 3HVUA 2R1ZA 1ZH4A 3TGWA 3ZGNA 1ZQ1A 3GV0A 1QQBA 1SXJA 3ZHQA 1W0JD 1X14A 2VUIB 4IHJB 3C7CB 3KT8A 4IO1A 2WC1A 3LX6A 1QVVA 1U99A 4G85A 1M6VA 4PLGA 1VSUA 4DDMA 1D2AA 2QP3A 3BXHA 3LL7A 4XI9A 3VZDA 4NJOA 4K6CA 2QYSA 1CZHA 1Q7GA 4KLCA 4ON9A 3DNPA 3NBFA 4RVFA 1XMQB 4JBGA 3VR5D 1P8JA 4M36A 4REOA 1DQRA 2JFBA 1RQLA 1GNVA 2G4CA 4RGYA 2R8YA 2RGCA 4I55F 3L8GA 3SQOA 1U7ZA 2I4OA 2EZ4A 4NOJA 4IRUB 3V46A 1T8SA 2AK3A 4KOAA 2JIZA 3Q12A 2K4MA 4NFHA 3UGQA 4FFLA 3ZBPA 1UH5A 2KBFA 4CNQA 4DUZB 2XXJA 1F8FA 2IZ1A 1Z7WA 4FD2A 5ICSA 1PKXA 2VSXA 3T5DA 2CFCA 2IODA 4XWOA 3ZLUA 1VMEA 3PJGA 1W96A 2RHGB 4OVKA 3NPAA 2XNCA 2FFQA 4AU1A 3SIRA 4ZAWA 1BGWA 1KFBB 1Z0DA 3T41A 5EWJA 3NVDA 5TJ9A 4F2HA 2P1ZA 4YLEA 1FDVA 4RKWA 2K2QB 5FWXA 5A6SB 2X5JO 1MLDA 2HHLA 4YVFA 3S2FA 3E5HA 4N7RA 2HWKA 4TZ6A 4YAFA 3FFAA 1SBYA 3MUFA 5MN6A 2DUWA 3GEEA 2ACKA 3LSYA 2QRMA 1YL6A 2GYUA 1HE5A 1XKQA 3GH1A 5HF8A 1PGNA 4BAUA 4BNNA 3K0HA 3BHNA 3SN6A 4DDTA 5KU1A 5DM70 4R9UC 4ZXFA 2NQ2C 3TCNA 4PHFA 2C5LA 3VJKA 1KYIA 3WNCA 3BIXA 1TU4A 3NEPX 1SHJA 2I7DA 3A4TA 4C4AA 1DZ3A 3TGPA 1AX9A 1ORTA 2ZREA 3EF1A 4KV9A 4PN7A 5KYKA 3PFCA 4FC7A 1DKPA 2DF8A 1EGMB 1YUMA 1I10A 1K97A 1YH3A 4O4JA 4U7GA 1NSTA 2V4MA 3EOBI 1YR6A 3NT5A 3EZFA 3TQOA 1DC4A 3ESZA 1NYLA 1F17A 3UAYA 3FM9A 3WMFA 1LRKA 3PDIA 2GN4A 2QROA 4CM1A 1DAGA 1A04A 1OLSB 1YQTA 4ARVA 1A9YA 1NC3A 1TW2A 1YZHA 2QN8A 3WYNA 4RGVA 2P6RA 4OOEA 1UBUS 2CF6A 3I42A 3WVNA 3Q0IA 4LC9A 2AEFA 3EMKA 3QY0A 1QHHB 2FN9A 3FE2A 3OZCA 4U7TB 2X86A 2DUNA 4KK4A 2YS6A 2HA0A 1Y8CA 3K5IA 3N2YA 4GSYA 4HQ0A 5CW1A 3VNAA 1XU9A 2GGSA 4BMPB 1H2HA 4XTCS 1L2TA 2ORIA 4KQJA 3ZDRA 2XNDA 4CM3A 3T06B 5AXDA 2G4LA 4NU0A 2RI1A 1DX9A 3G8CA 2JGMA 3WBJA 1JDBC 2AE1A 2PV7A 1VJTA 3OZWA 3WIBA 1U8TA 2AEEA 4JCOA 2WJIA 3JATA 3VBEA 1ZDMA 3GFTA 2AN5A 1RTKA 1X94A 4UMDA 3VR0A 1XTPA 4GO1A 2E37A 1SIOA 3FPBA 4WCFA 5D1HA 2ZSKA 1K63A 5A5FA 4UPDA 3EPHA 2N0SA 1H2ZA 2AYYA 1FSZA 4P9NA 1E6UA 2IGTA 4ZRNA 5TGDA 1HOXA 4H6WA 4UW9A 1XTRA 1OPXA 2QTBA 4OQPA 5H16A 1XD8A 4C21A 4QGBA 4C0JA 4FGJA 4MMYB 3RU2A 1V7CA 3TM5A 2IZ0A 5L3SB 1BWSA 1T1SA 1CJMA 5DWQA 2NP6A 1OASA 2JCGA 4HGNA 1AZTA 4TLLB 4E5VA 3QPVA 2JBWA 4DYVA 2I6SA 3DDHA 3T7EA 4KQ9A 4F5DA 2GCNA 2CT8A 3P94A 1SCNE 2VK1A 2ZATA 3OWOA 4NCAA 4MYDA 3H4MA 3BFXA 3N3BC 1YQWA 1ESNA 1K5HA 2N75A 3ZNNA 2XAUA 2C2XA 2RGEA 3N70A 1DKRA 2QRPA 1IJKA 1PP4A 1XMVA 2JD0A 3FRIA 1PO7A 3GRFA 4G24A 4Y8VA 5HGJA 1EK2A 5TY0A 5A5EA 4GOND 1KJIA 1AMNA 1R8JA 3T15A 1XCOA 3C4QA 1I3OA 1TKAA 2Z04A 1MAWA 3IYLW 1Z06A 5D86A 1LRLA 1T8UA 3DC2A 4UM9D 5ELLA 2VUTA 1OU0A 3N8KA 4K6HA 5C2JB 2QVXX 2X5OA 3W5CA 2ID8A 3F3MA 2I3ZA 2EGUA 1FFBA 4M37A 3FNBA 3AEQB 2XBUA 8LDHA 4E70A 1ISIA 3UQZA 4TV9F 1J8QA 3NDPA 1X74A 1FVHA 4F86A 1WF6A 4CQLA 5BQFA 5DK4A 2PRIA 2HLPA 4DLVA 1E60A 4FIZA 4ID3A 1EGQA 4X41A 5JS6A 3LJKA 3NBKA 1R0ZA 1I2BA 2KYRA 5LJLA 3R5KA 3SSMA 4EUSA 5A0VA 4FZ3A 2X2FA 1EAMA 1R0KA 2OO3A 1E94E 2VJQA 1T6XA 2GHIA 3C6BA 1U0OC 4Q24A 1TQDA 5DBIA 2XBLA 4R2KA 3ZCQA 4LJAA 4PQYA 1LBIA 4X6XA 1OXVA 4BNDA 4IIHA 3L0OA 4BE9A 2V55B 4K9KA 4ALJA 1UJNA 1OAOC 4KHPB 4NFLA 5JNWA 5TMPA 3PNOA 1M1NB 3L6EA 1OTHA 2FR1A 4FS8A 4PYOA 4RKEA 2ENUA 4WK0B 1G20B 4CZ2A 4QFDA 3EXIA 2I3AA 2WMOB 3SICE 3BEDA 3I64A 2QPLA 3KTAA 3SX0A 2QRVA 5EIHA 1QGZA 4D0NA 2QTLA 4FB5A 4AW9A 1TZBA 2XZDA 3ZY6A 1S1CA 4IIYA 4R6WA 2V59A 5KVQA 2AC2A 1KVUA 3F6BX 3LP6A 3OMXA 5DYGA 4MI1A 4HBGA 2C00A 3FZYA 3HHPA 2FZCA 4TWJA 1PLLA 1G1MA 1TJPB 2V96A 3D6TB 3WIVA 3WWPA 4ZI7B 3RFUA 2GR9A 2GJ8A 3G2IA 1ZR2A 1ZH2A 3DEIA 2JG3A 1B6GA 2PWPA 1LJUA 3RE1A 1Y6JA 3M6LA 2QN9A 4W5NA 4UD2A 5D2CA 2V9CA 3JVIA 5A4DA 1IOVA 4IG4A 1LDYA 3IPRA 5HUJA 2GRUA 3KJZA 1KIFA 4LF9B 4XLZA 2RONA 3MTJA 3M9LA 3E27A 1AA9A 5IAOA 2N46A 1R7RA 1K5PA 1CUFA 2I03A 4CHTA 4RKFA 2WQ6A 2A35A 1HT3A 1N6RA 2OILA 2V58A 3D7KA 3FWNA 5ENDA 4JL6A 2GZRA 1GL3A 1VTKA 3H65A 5FV7A 2FX3A 3HI6A 3W34A 3PWTA 3ET5A 1DBIA 4DJJA 4J91A 1QJ4A 3IHWA 4QA9A 1Y6GA 2YJ4A 4NCIA 2OD7A 1ORVA 2K7ZA 5H02A 1O8BA 1W4ZA 2HCTA 2WT8A 3BGSA 4QT0A 3ZHUA 3L1KA 3E4DA 3GGJA 4R5HA 3QWBA 1PNVA 3T7DA 4L75A 2YWBA 2P9TA 2QM7A 1HFEL 2X2OA 1X7WB 1SRQA 5CURA 4B85A 4HNUA 2W2KB 3AF4A 1XHFA 3OZSA 1PE0A 2EG9A 4Y9DA 5JRDS 3MTBA 2P9QA 4O4HA 3ZVRA 4CEIA 4B7AA 5EG5A 5B30A 4Z0TA 1WPXA 1TMOA 3U48A 1W2HA 3NIFB 2O3QA 4I36A 4S35A 2TMDA 1OIWA 3FZGA 4BMDA 2QQGA 4EF5A 2XKKA 3VH4A 2IDKA 2PUEA 4KYTA 2GB4A 4BL5A 3PIRA 4FXPA 2VBFA 3A3PA 3OI7A 1VM6A 2E4VA 1Z6GA 2YWCA 3CLUC 4BV9A 4R41A 4KDCA 1P1BA 4PC2A 4IOJA 1SXPA 2XRFA 1DO8A 2EF0A 2ZUWA 5BNTA 4BZXA 4MAMA 4CR8A 4MWEA 5CGZA 4RABA 3RODA 2WUGA 4IIVA 1GPDG 3ZV5A 1KMHB 1TM5E 2GJSA 4DNOA 5AVOA 2M1XA 1M2NA 2DRIA 5BNZA 2HHAA 1I9GA 2JW5A 2WW8A 4R0NA 3WFJA 1CS0A 2ASVA 1QCDA 3EXG2 2BGTA 2KWIA 3E8SA 3PUXA 3K6RA 1IJEA 2FWIA 4QYXA 5FI5A 5IK2D 2WUWE 1LSOA 1E32A 1V39A 1VJ5A 4FDMA 3I2HA 3STWA 1L4BA 2B1RA 1NI5A 1WVIA 3DDZX 4TMFA 3FIUA 1NJSA 3IVGA 2OV8A 1UDXA 1BDHA 1UKAA 3BRQA 2AQKA 1OYWA 2X2EA 1KDYA 4S05A 2XT6A 1ZVQA 3EHEA 1GZ6A 3D4BA 3GQBB 1PIWA 2O0MA 4N5LA 1G0NA 4D4GA 1ZHOA 3QX3A 2BOVA 4LG1A 1BZYA 2OYSA 3UCEA 3KOOA 5A04A 1JNXX 1Y81A 1ZRMA 3L0CA 1OGYA 2GK6A 5AM5A 2VXBA 4O4IF 3BRCA 2J3HA 3B6EA 3PTZA 3GBVA 3LYUA 2ZU6A 4JQOA 4CQMD 3TCKA 4FE3A 3JWEA 2H7YA 3FUUA 3OTWA 1SBZA 3L7NA 3MJDA 4IDCA 3RWOA 4C3ZA 2HUPA 3G8YA 1IFXA 3CXRA 1I13A 3OEWA 4ZGWA 3P0JA 4DKJA 5YASA 5KI6A 1RXVA 4FMCF 4AJEA 3HO1A 3Q85A 3TO5A 1GL6A 1HYEA 1XC7A 2OL4A 5AP9A 2V6MA 1Q84A 4IQ0A 2QXTA 2ZJ7A 1EK0A 4BNIA 1RWKA 2B94A 2ZBUA 5J1SB 2IHNA 4C0BA 2CVQA 4I3GA 4TZKA 5CJJA 4F5ZA 2PUDA 4TT3A 2JI4A 4OIMA 3G1TA 2BM1A 1JHXA 3WL4A 4CLOA 5FBKA 4GGMX 4AKHA 1NNI1 1XKXA 1BH6A 3DMRA 4HY3A 4YXWA 5L8VA 5HUHA 2JLUA 3IOYA 2YYAA 4JVMA 1N0UA 3ND9A 3M1YA 1U0EA 3NPMA 3LY5A 3KPUA 1HORA 5EHNA 4LNAA 5F2EA 3C6ZA 1DMSA 1NW7A 1T25A 4UZEA 1KEWA 3ZK7A 1KP2A 4G0YA 4RTPA 2O1WA 3T0FA 4LOAA 5BRNA 1DIRA 1ECJA 1H2AS 4BV3A 5I7FA 1G3MA 4BBZA 2BGJA 5T4BA 2YX1A 3IAXA 3IL2A 2A92A 4RCZA 4FKZA 3T61A 3GGOA 3MILA 5E0OA 4TVBA 2ROQA 2PSSA 4X8LA 3I37X 4R9VA 3NIBA 3UK6A 1ZCAA 1ZUHA 4V39A 5IJ0A 1L3BA 3W5HA 1L5QA 3O5AA 5I4KA 3DFMA 2PUAA 3ZJUA 2OV2A 1VKHA 4YQYA 2CHUA 4HWOA 2IDZA 2WMNB 4JHXA 5EMMA 4OMDA 1M2OB 3W6NA 3JQCA 4PQRA 1UT6A 5CCEA 3OH8A 1CNMA 1HE2A 4KRGA 3H97A 4OQXA 3KG2A 2EC5A 3CE9A 3K8YA 1L6IA 1P2SA 5ISMA 2C4UA 3DF7A 4CMJA 3V5NA 3T4UA 3QSYA 3K6KA 4D9IA 1Q20A 1WPQA 3UWOA 4EQ6A 10MHA 1EEXB 2DT5A 1GKYA 2QN2A 1NA5A 4KMSA 2ZBDA 1XEAA 4X20A 1A9ZA 3TVYA 4RJIA 2UZ0A 3Q3GE 3BM5A 4NMHA 4GL2A 1UKBA 1T5TA 3TW8A 3KZ1E 4NYJQ 3I1FA 4GRDA 2CBZA 3GWZA 3FOEC 3AKZA 1N2HA 4N7MA 4B2LA 1YZGA 3ZC3A 3K1AA 3I30X 4EH1A 2P9EA 4I7EA 2FPPA 3ID6C 3ZI0A 3BMNA 1RJ9A 1V7ZA 2C84A 1GU1A 3H2ZA 1OF1A 3PLRA 2C4MA 2ZI6A 3ZGXA 4D8UA 5KU7A 4EHIA 1P17A 3I2KA 4GZ3A 1V45E 1A9QA 3CNLA 3P9NA 4GEGA 4BPRA 2F4NA 2NSJA 4OL9A 3WNVA 3LOPA 3K0KA 2MJLA 4WKGA 1IEWA 5HIIA 4EG4A 5KOHB 1QKKA 4Y6PA 4LF7B 1UEJA 4M46A 3ZD7A 4KXFB 3JQ6A 2NTJA 3AERA 1QE5A 1PJSA 1MCZA 4X6UA 4UPEA 4B7XA 4KKXB 1KI4A 2YIJA 3BHJA 3P97A 4N0QA 4Y2UA 1UBNA 3EAFA 4FOOA 4ER5A 5J23A 1EESA 4LBZA 3AXSA 1GD1O 4TM8A 5HOEA 2VS1A 1QZXA 3LWNA 3C87A 3KT6A 4BUJA 3PHJA 4Y1FA 2JGIA 3AEUB 3NRJA 2XCQA 4BZPA 3HRIA 4DUYB 4OG2A 3NNSA 1UMDA 4GQBA 1OYOA 1DX4A 4HAOA 5DCLA 3DMYA 3G89A 1X3LA 4YRTA 2O0HA 4UCWA 5F51A 1IRXA 2IXEA 5J40A 3QJGA 4K0RA 4ZANA 5JSFA 4QBKA 2GEUA 2OAEA 3G3EA 2E85A 4IWNA 5BMVF 3AI3A 4RYDA 4YJFA 4HZIA 4X62B 3I01A 1W5TA 2ZCUA 3GPBA 5BN1A 4AY3A 1GYRA 4I3FA 3BRWD 3LCMA 4GOOD 4WMLA 2ZP1A 3FMIA 1KDZA 1UDBA 3RSFA 1I3NA 4KO1S 1TTPB 2DERA 1MJGA 4BX0A 5HX7A 3UXMA 1L9XA 2COUA 3GLHE 5C5EA 2IHYA 2Y3IA 2JKZA 4OHOA 4X6LA 2O8CB 4Q7KA 3IURA 1T1RA 5CDSA 4CNBA 3U4IA 3QVVA 4QOGA 5BO5A 3HKBA 3KZXA 2WDZA 1RC1A 2PT7A 1QYIA 3RM3A 1CY1A 1QCCA 2QD3A 4IH9A 2RFLA 3AF1A 5DYYA 3DT8A 5AFSA 4GMHA 4Z0NA 1TC1A 4CN8A 1PFKA 1GSAA 2OCPA 4TTAA 5ITSA 2IP2A 2VQDA 2O20A 3TQTA 1VLZA 3BGVA 3LLSA 3MIIA 5DHAA 4BGIA 3JQAB 1GEEA 1SCUA 4MDFA 2FOLA 2IEBA 3O8LA 3DYIA 4ZTZB 3LKVA 1GADO 3A1VA 2IEZA 2Z2XA 4PX3A 1T0PA 2PMWB 3OSUA 1HTTA 4DMFA 3L04A 5IANA 1T36A 4CMKA 1N3YA 1VL2A 3PNYA 1KOGA 2XCOA 3G79A 1BOFA 4OU5A 5LVAA 1X80B 2Z9DA 3DYVA 1OXMA 2H1FA 4GHWA 1SY7A 5I9BA 4YN3A 4C7VA 2IEAA 3SXUB 1WCWA 3DFUA 3ETNA 4NQZA 5L7YA 2JIDA 2VF7A 2CHVA 2G7ZA 2OXTA 3ZHBA 3OE7D 4BFYA 4OLFA 1ZA2A 2D0OB 1JE1A 2UYYA 1WDLA 2WM8A 2IS4A 4OB6A 1QH1B 4KPUA 4BWVA 1SUBA 2ZJAA 1UT8A 5A2QA 2VQFB 4TRRA 1NW8A 3QLUC 4FFOA 3E5NA 3ZDZB 1U94A 1JI0A 1FMLA 1P1JA 4LEIA 3FWYA 2BTEA 1H6AA 5E38A 3MS4A 2W6NA 1JTEA 2JI9A 3FCUB 3HCEA 4TRJA 3MTGA 4IOLA 1GFIA 5GVRA 1JUDA 1SUFA 2NX2A 1H2WA 2VPXA 3A58B 3K53A 2ECFA 1QFYA 4OBEA 1EE9A 1J8YF 4TYQA 5BV7A 2QZ9A 1MEJA 4PXYA 1MB9A 1K5GA 3G0OA 2BZGA 1JLMA 2I65A 4A6PA 4BB5A 4E03A 2W2OA 5LKRA 2OKCA 3AR5A 1ZIYA 1J22A 3L7LA 4H0CA 1WXFA 4C7JA 4NXMB 2IC5A 2CYBA 3DKPA 3AIKA 1A5AB 2O0LA 1GCOA 1N75A 4YJGB 5IYZF 1QQ6A 2ECPA 2P2DA 4WKBA 4JB2A 3EX7C 2I6QA 4RM3A 3ZIUA 4OM8A 4I55B 5AM2A 1W8IA 2DUMA 2WWTA 3TQFA 1I6KA 1U11A 4CPDA 4AJHA 2GTIA 4EMUA 1G8MA 1O77A 3O7WA 3IXQA 4UXHA 2X13A 2M1ZA 2DXIA 3NHFA 1XF9A 4KR6A 2FF5A 2OCDA 3K72B 1ZLYA 1KH1A 1WUTA 3AP2A 5BWNA 3W4KA 2ZM5A 3KALA 3S5JA 2G40A 2HN9A 4LRWA 1RZ3A 3UMFA 3WYCA 1DKMA 2CB0A 4N03A 4X7PA 1V3UA 1U7DA 4OB8A 3BJRA 3L7CA 4HK4A 4BMNA 1B8PA 4TX1A 1E6MA 1PSDA 4UVHA 4F6RB 1XA3A 2VOEA 3P9QA 2LP4Y 2JGKA 1I33A 4HTFA 3FTQA 4V24A 1G21A 2FW7A 1V5WA 2E18A 3NRBA 2R7MA 2QE7A 3QU9A 2XGOA 4NCXA 4C1NA 1FFSA 1X70A 5JHHB 4W7IA 1AHHA 4EHKA 1QYCA 2MINB 3MRVA 4ES6A 3ZJYA 5JWRA 4ZVSA 1JS1X 2PZAA 2NU6B 4D26A 4MA0A 3EAQA 3A28A 3K8OE 3FNHA 5D5HA 2PCJA 3L8DA 1NUPA 3IJEB 4G0WA 1J33A 1THGA 2BGKA 3L40A 2YQ4A 4TMVA 3WRVA 1E7QA 1JAXA 3BGOS 2ZPUA 1CRZA 1FFGA 2Q9AA 3IQIX 5CW2A 4DLXA 4ECEA 5J2TF 4WXEA 2A0KA 1KK0A 3RASA 4LMRA 3SF8A 1NBWB 3JQGB 1CIVA 1IZ7A 1U3FA 4ZA2A 3KLNA 2W6QA 2LZ0A 4ZJYA 2RB4A 1KORA 1TB4A 3OLYA 2ZI3A 3GB9A 2XDWA 4Z9AA 4LC1A 4OGGA 2PBRA 5CPBA 1XJQA 3D6UA 4JLNA 4EZBA 5CBPB 2WG2A 1NBME 1W1UA 2G3YA 4NBSA 2QTRA 1XTBA 4M21A 5EZ6B 4E2FA 2W0SA 1I4TD 4ZVVA 2RIRA 2I4TA 3DV0B 5GGXA 2A9VA 1Q14A 4BQFA 4AG6A 3L0PA 2WP8J 2XE7A 4EVIA 4AY6A 2FP4B 4US2R 1EJ0A 2Q4RA 4IDDA 7MDHA 1I4LD 3SQMA 2G0AA 3HU3A 1C3VA 2XVXA 4QXAA 4Z3KA 2IXGA 5BWMA 1I1NA 2VNIA 2Z8YM 3B1YA 3EFEA 4FGUA 2R6CA 4M99A 3CZ9A 2O2ZA 3TTYA 4F7DA 3LVRE 3WV4A 4LQCA 4CJXA 5JRJA 1J8VA 1B42A 3UT5B 1GDHA 1NQAO 3DTVA 3ER6A 3QKSB 4BRWA 2CXUA 2HU5A 3GFRA 4XUGB 4M0DA 4LV5B 1H8HA 4IIGA 3KZVA 4BRZA 1CZRA 2R6FA 1SC6A 3DEHA 3Q3EA 2G76A 4L07A 3ZNQA 4BVLA 1AK1A 1PS0A 2HXYA 4GI2A 3FDZA 3K7EA 4IKOA 1GL9B 1VLMA 4QJ5A 4Z4IA 4WEQA 3FPCA 1NVEA 4DDKA 2UUCB 5CT6A 2CVFA 2EL9A 3NUGA 4L4ZA 1G7CA 2OAGA 2O8FB 2E9SA 4KWIA 1YQ9A 2HXSA 1ST3A 2VK2A 4FJ0A 2ET6A 3HVJA 1FZTA 1CJUC 1XQYA 1XD2A 4G97A 3TR0A 2DHDA 1NMQA 1G55A 2Y1XA 1T4GA 3QFTA 4KPYA 1E99A 2WU1A 4JJ6A 4LX0A 1EHYA 3I2JA 3U1VA 1GZUA 1E98A 1RKVA 1TYEB 3GLHA 2G07A 2OCLA 4V2UA 5EJAA 4NU5A 1EK6A 2VJNA 2H16A 4Q1FA 3QWIA 4HI0E 2NZJA 4ZREA 2E3JA 5J63A 2BFPA 2WD8A 1WCIB 2BISA 2CFIA 3A4IA 4PCAA 4WXYB 1HDIA 4AT1A 5DTIA 1Y98A 1P61B 2AL7A 2PCLA 2P9JA 3QLJA 5IUKC 2W5UA 2ZE5A 4ZI5A 2CDAA 1LU9A 2OOKA 1ZSNA 2C78A 2VG8A 3HBMA 2H63A 1JTFA 3TTSA 3UB4A 3H3JA 1P1HA 5E7JA 3ZYZA 4BY9E 5EMKA 4HYQA 3QF4A 2W8BB 1XJ0A 1VSBA 1YU9A 2L18A 2O14A 2QYOA 4PPGA 4TV9B 5BV8A 4QAQA 2R6GA 2H5EA 2NT4A 5JANA 4Z4FA 5IMBA 1Z5WA 4EKEA 2YVQA 3MTAA 3N0VA 3OZDA 3UJ9A 3K1ZA 3DCIA 1X1BA 1CUVA 1G2QA 1V0JA 2FOXA 2VYCA 3LO8A 2FN4A 4RGBA 1J7KA 1KZGB 1EVYA 4BHTA 1ZRNA 4N3NA 3FW1A 5CB8A 2GF0A 1ESEA 1AO0A 1O4WA 5IUJC 1A9XB 1ZI6A 1SWVA 3OCCA 1XE3A 4WN9B 1EP3B 1M1ZA 2PXXA 2QQFA 2AFIA 1MX5A 1W4CA 3T0IA 3ABOB 3L6UA 5TEVA 4CI0B 2FR0A 4G23A 3ZJVA 2Y68A 3LUCA 4D0LB 3RIEA 4EJ6A 1RMTA 1XVAA 1E3SA 1C3OA 2PO7A 4U2KA 4C87A 4I0WB 3KZKA 4Q48A 1TAHA 2QTVA 3AETB 2I6GA 4YCDA 3QNWA 5AVKA 4A2CA 4PG6A 4W7HA 3NYRA 4BFXA 2ESRA 3ZGVA 1JQKA 1SUDA 3MERA 2GFIA 4ZCSA 3VU1A 2GZDA 3U61B 2V7UA 3KL4A 4CLRB 2B8TA 1YA4A 2JIQA 1N5RA 1PZHA 2GHRA 3O8BA 4EPTA 3FNFA 4OSOA 3GBSA 3OKAA 3H17A 5KNBD 2FI1A 4IZIA 3QHPA 1G3QA 2W6JA 4IAOA 3KXDA 3SG0A 1B0AA 3OA0A 4IIJF 5CCXA 5JY6A 1C29B 2QW1A 2IDMA 3GX1A 4HB2A 4NZMA 2HF7A 3KWLA 2VHWA 2ZAYA 1WCYA