4LQDA

The crystal structures of the brucella protein tcpb and the tlr adaptor protein tirap show structural differences in microbial tir mimicry
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
144
structure length
123
Chain Sequence
GVDRWSKDYDVCVHSEEDLVAAQDLVSYLEGPGGAIVSELCQALSSSHCRVLLITPGFLQDPWKYQMLQALTEEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Toll/interleukin-1 receptor domain-containing adapter protei
publication title Crystal structures of the Toll/Interleukin-1 receptor (TIR) domains from the Brucella protein TcpB and host adaptor TIRAP reveal mechanisms of molecular mimicry.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 123
sequence length 144
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13676 TIR_2 TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 4lqdA00
4LQDA 2Y92A 4W8HA 3UB3A 4C6RA 4DOMA 5FORA 4LZPA 3UB2A 4C6SA 3UB4A 2J67A 4W8GA 4EO7A 4OM7A 1FYVA 3H16A 1FYXA 1FYWA 4FZ5A 4LQCA 2M1XA 2Z5VA 5H3CA 1T3GA 4C6TA 3JRNA 1O77A 5KU7A 4C6TB 2JS7A 4C7MA 3OZIA
chains in the Genus database with same CATH superfamily
3PC4A 2FWAA 4PLHA 1PSWA 3DXZA 1RJ9A 1YC5A 3WNCA 1YQEA 4C3VA 4EJSA 5K0CA 2E9SA 3GLIE 4Q3KA 4ZICA 1O95A 1KPIA 4IFBA 3RS3A 1TK9A 2ET6A 1NHWA 4YPOA 1SZCA 1Z8HA 5GJBA 8GPBA 4PX2A 4NZZA 2Y0PA 1VLHA 2FHSA 4MUIA 1Z7YA 3ZBQA 4MMXB 1GVHA 2DJIA 2DXIA 4WH0A 3DZFA 1FFHA 4Y9DA 3WRYA 1R10A 3Q87B 4PG7A 2WU3A 3AY7A 5DHPA 5BN5B 3WLQA 2J3QA 4QGSA 3BGVA 5AUOB 4MUYA 2XCOA 3THWA 4ROSA 1X9HA 2HDOA 2QE7D 1PS8A 3M6VA 4IFEA 4KQWA 4QOHA 4Z2YA 3DC7A 1UWKA 4AJPA 4TMFA 3QYAA 3O8LA 1IULA 2MSWA 4PXSA 4DA8A 3L49A 1TKRA 2FW9A 2NSLA 1WRBA 4BB5A 1QK5A 3O75A 3MFQA 3W6ZA 4DPLA 3UMBA 1G7TA 1V2GA 5EPUA 1W48A 4TPKA 2HWKA 1J70A 4TLMB 1FYDA 2H5IA 3M9XA 1EP9A 4UFNA 3LP8A 4A8JB 4CR7A 1CUDA 1FS6A 1RSZA 2R7NA 4FDLA 1P44A 5FORA 2PR7A 2WAMA 4ZVPA 5B3JA 2R5WA 3RK4A 3MF4A 4YRIA 2W6ID 4WY8A 1BXZA 3QTBA 4RD1A 4BO5A 2XQFA 2V45A 3JWEA 4NIMA 2ZUEA 1A3CA 3W5CA 4TMKA 1CG6A 1KKMA 1P5JA 2GOYA 2JB9A 2P4EA 4I6GA 4JLUA 4ML3A 1FNNA 1SAYA 2PT9A 3PRYA 4PYJA 1O2DA 4YUXA 3AHIA 4DNXA 4ZT5A 3T3HA 1U9IA 2ZWOA 3LHKA 2XY4A 2O0HA 2M6RA 1EVLA 2WUFA 4WD3A 1GL7A 1TGYA 4OSEA 3QVTA 1FNDA 1GFIA 1NLYA 221PA 1VYTA 4XOUA 3ESBA 5DX8A 5K3EA 1Q91A 3VJLA 4F2DA 2GCPA 1EVEA 2AFIB 3KK0A 4FGKA 2QIPA 4HQLA 3SSMA 4BUJA 4IHKA 4GS5A 4GX5A 3NAQA 3BIWA 3ORYA 5HBRA 3GQBB 5I8WA 1C8KA 1ULZA 4QOSA 4U39A 3PEEA 4WPGA 1SXPA 4HR7A 4TL9A 4RHEA 2GBCA 1S89A 2X13A 4KMOA 1XQXA 3BKXA 3ZV4A 4ALIA 3BORA 3PFHA 5TVGA 4OP1A 1JFVA 4HNAB 2FF7A 5KU7A 1BQ3A 2VJMB 1IAVA 1T4CB 3FPKA 3HY3A 1E6LA 3FTNA 3FWNA 3P45A 3RWMB 2OUKA 2H11A 2YN4A 4RE5A 1H6DA 5AIAA 3ZX5A 2IPOA 5BSEA 1HDGO 4CM7A 1YR7A 2QW8A 3QMVA 3QWBA 2C77A 2O20A 1OAKA 5ALHA 1RZRD 2HF9A 3HRHA 3OCJA 3TBFA 3CG4A 1FMCA 1K1EA 1SIWA 5LYJF 1COWD 2W70A 5L3VA 4FR5A 4FVTA 4PO1A 1LPSA 3THOA 5KNCH 1YUMA 3TI7A 1DDGA 3IPCA 3JXEA 4Q3AA 1HT0A 3VKFA 1KK2A 2NSHA 3LBIA 4BNIA 3QUSA 4NQRA 4CFYA 2GBPA 4IJ5A 4EYGA 1OXBB 2H9IA 5TEVA 4TSKA 1XJ0A 3OIGA 3EUAA 3GGSA 3E27A 4LISA 5MGBA 3IPRA 3P9CA 3G2NA 3AZQA 4LZOA 4RS4A 1AOXA 1X8LA 1DG1G 4RQAA 4WXEA 2V6FA 5C37A 2QRHA 1PN3A 2ZU0C 3KWJA 3GVHA 5J63A 2AW5A 1Z33A 2AL7A 3UM9A 1J24A 2CXHA 2XPCA 4XX0A 3G49A 5TGDA 5TT0A 4RQTA 3IDFA 1E69A 3L3BA 2CSUA 2G71A 4R9SA 1Z62A 4CEHA 1F7VA 2Y1OA 4PTZA 2WTXA 2NZ2A 5BMVF 4RVNA 2PRIA 4M6WB 1ZPDA 3JQAB 4TVOA 2GXAA 5KYTA 4XLLA 3Q8LA 3LUKA 4Q05A 4QNMA 3NHLA 1QFZA 1V7PC 1XTSA 3EF3A 3KWLA 1T6NA 5FR1A 5IYZF 1ZI9A 3NVAA 3GJXC 4ALJA 1PQWA 2IWHA 1L1QA 1L8AA 3PS9A 2B1RA 2YFKA 3OZFA 4M0UA 1RI4A 4N1AA 1ACJA 1J0AA 1ULSA 1CZKA 1N2OA 3D1JA 3P2KA 4P84A 4HNSA 4KUEA 2DGDA 4H9GA 1XD2A 3HB7A 4KFTA 4IPTA 3KWMA 1ZDMA 4FOOA 4ER7A 5HOQA 2QN1A 2GN9A 5JFOA 2N75A 4D97A 4EF5A 3EQ6A 1P0CA 3OMLA 1GGEA 4QARA 1R8SA 4GPD1 4LI0A 3QFRA 3LCCA 3FRJA 4OI4A 1HC7A 2WTEA 3AEKA 5KNCA 1QFYA 3BHJA 1NN3A 3K6JA 5DYYA 1GAWA 1Z4JA 4WLEA 1WVGA 3FGNA 4FFLA 1TU0A 2UYGA 1T4DA 3ZH2A 3L02A 4ICIA 3H87A 2EG5A 4LYYA 4J2OA 5ULLA 3I6MA 1WM1A 4CU2A 1M8KA 2F90A 2CNOA 1K2VN 4CF5A 3R9IA 1F3LA 1KAGA 5ARCA 2MU1A 1ZAYA 4UKDA 4EF4A 3DKRA 4RL6A 3DAGA 1Q6ZA 1NN1A 5AW3A 1WP9A 4EG1A 3BFJA 5E6SA 4FBMA 3HNPA 3KZCA 2NU8A 4DLNA 3IX7A 3T7JA 3O0DA 1Q7CA 1EIZA 2XLCA 3NHJA 2I0FA 4G4IA 1DG9A 2QA5A 3DOEA 4NJMA 2ZR8A 3G85A 5KSPA 5J40A 2WLSA 2R6JA 3OD1A 5J4LA 4EY4A 4AYXA 2XA1A 4HLUC 2WQ7A 5K0GA 1O1YA 4M86A 3KTOA 2VJDA 3GC6A 4RMHA 5CK5A 4TKUB 1F14A 2IUTA 3LBHA 4Y0VA 1LPPA 3N70A 3T54A 2X1VA 1QIMA 2GAIA 4A26A 1HT2E 1ESDA 4DCTA 1KAMA 1E2LA 2NNWB 1ZL2A 4M49A 4Q3BA 1AS2A 2ZS8A 4RHUA 4RIHA 1MQ8B 1V43A 3EFHA 3HMKA 4YRPA 2DFPA 2UVQA 3VYUB 4DT1A 4UMEA 4DDUA 4D80A 4NBNA 3PK0A 3ANYB 1SPBS 3PPVA 2R8BA 4QICA 2BKEA 3KT0A 3LZ6A 4ZI7F 3C7AA 3SQOA 1CJUC 3R76A 2IUFA 4PONA 1I14A 3OA2A 3NBKA 2YZKA 2I6FA 4GOLD 1R4MA 1Y3BE 1EMDA 2NAFA 2XEXA 3TSCA 2HRCA 4IYRA 3RADC 3LVQE 3N6RA 4LS3A 4MTCA 5I8PA 4AO7A 3AF0A 4CG2A 5J2TF 3G0IA 1DLJA 2Z2JA 1N6HA 2PZLA 2GETA 5KOJA 3I8SA 3OUUA 3U3OA 1CIPA 1ZJ5A 4BFZA 1YE3A 2ZSBA 1Y4UA 2EARA 3RANA 2RE8A 5JPCA 4ZAWA 2CXSA 4OD0A 2JGKA 1D04A 3Q40A 3SQXA 4X92A 4KU4A 3I2YX 3WLTA 2IY9A 2UZ1A 4OQEA 5IKOA 4CMGA 1UBCA 2B4KA 1HEYA 3DHEA 2W2XA 2GB4A 4CWAA 2OK8A 1V3QE 4E1VA 1BFDA 2FEPA 3RV4A 4NZNA 1A8QA 4JYBA 3CEAA 1U5BA 2QL7A 2HPHA 4KREA 1L5RA 2BM9A 2Q3FA 4L0QA 1H2RS 4NOKA 5GOTA 4K9PA 1UK6A 3D0KA 3EDYA 3C7CB 1FUUA 2A5GA 1N5RA 2FPIA 3DZBA 4NCIA 4RDHA 3UAYA 1N5IA 4C0SA 3IFSA 5GY7A 4JP5A 4MYTA 5CB0A 1IQRA 2P0EA 4B8WA 4MKXA 5EIHA 4QODA 1F0PA 2ODEA 4D9KA 3JQGA 1TJ5A 3IBYA 4AZSA 4YUWA 1WXQA 2ID9A 1R2QA 5CNMA 5KTRA 2F8SA 3WB2A 4IHJB 4NCKA 3PR3A 4Z0NA 1PW5A 1XLVA 5GINE 3FF4A 1ZGAA 1WMSA 2XMZA 4U2CA 2GEFA 5ALRA 4TTSA 5AVUA 1RJ9B 2CXUA 5D5QA 4EJSB 2VF4X 1TW2A 1Y3IA 5KYWA 3SZ3A 3KOMA 4WECA 3KD3A 3OLQA 4I5GA 1U11A 3ETLA 1XV5A 3L8MA 2J3DA 4NYJQ 4OP3A 1T3HA 3NR2A 1IK6A 1IOZA 1NOKA 3VVLA 4LOIA 3AJ8A 2H2DA 4HT3B 4R9VA 3B2QA 4F06A 1WB6A 4LRSB 2OYCA 2LRHA 4B35A 5ITVA 2CXOA 2YJ4A 3SYKA 2M6KA 2WWTA 3N9IA 4JDPA 3C8HA 5JAPA 1XYYA 2JLBA 2VLIA 2HNKA 2WJVA 3FYSA 2K7FA 4AECA 3MBKA 2QUAA 3DTTA 4NU5A 4A6DA 3TUZC 4UHCA 1DVRA 2AZTA 3Q6NA 2ZRGA 2XXBA 3LCMA 1KAEA 1KXJA 1M67A 1K7XB 1V8ZA 1W7AA 4LV6A 4OXNA 1JZSA 2IJGX 2OILA 2PUJA 3EGDA 5ILOA 4XDYA 1O54A 1G3UA 1GN9A 2IODA 1NXPA 4FGWA 2Q9AA 1YBAA 1N3BA 3DW3X 3LXXA 5AHKA 3ZHYA 2XUDA 1CK4A 4I2VA 1HZZA 2Q0QA 2DUWA 4OQ4A 5LMUB 4CPDA 4L4UA 4JJEA 3FAKA 5T57A 2Q4OA 3H1EA 1R5BA 5BT9A 3MB8A 5GVSA 3LDFA 5KOHB 2YW9A 1VJCA 3R0VA 4BRWA 2XZLA 3DZIA 1S5PA 1KOLA 4FYVA 5DX1A 1M34A 3NWEA 4UUOA 2OAQ1 1RCUA 3F5DA 3GEMA 2YCLA 4RV4A 5EJ5A 1T9GR 5C5IA 5JSZA 2VJOA 3H2JA 4X1OA 3EULA 3GNQA 4HLUA 3ZI0A 1LDNA 2VSOA 4DKJA 5LZ9A 5K01A 3O90A 3LUCA 3RTAA 2YN2A 5I4BA 3RTBA 4NFHA 3N8KA 2CUTA 5DTRA 3C6YA 3WDKA 4R8RA 3T9EA 4D3SA 2VH2A 4B74A 3UJDA 5HEKA 4GM4A 5HM8A 4ZP1A 2E4YA 1IB6A 2GN0A 4CKWB 1WSAA 1H8EA 4MVJH 2FRDC 2OP1A 3IEIA 3BGDA 1N3LA 1MJGA 3HY6A 1R4ZA 1T4BA 2K2WA 2W0SA 3RKSA 5I47A 3LZCA 3ZU4A 5EWMA 1ID1A 2IOQA 2OE2A 1N8TA 5U4QA 4ZHQA 4BP9A 2KMLA 3VNBA 2VUIB 3MTBA 2CXNA 2F1RA 2IEDA 2Q5HA 4X63A 1FX0A 2D7JA 4X9XA 4DNQA 1A9TA 2GFHA 1E5XA 1MU0A 3O9MA 2D6FA 2G6TA 2QRQA 1DDOA 3CH4B 3FPHA 4L9AA 5C2JB 3ENKA 3MWKA 1CQJB 4KQFA 4MYCA 1T34A 1V8FA 3PDUA 1ZN9A 1R5JA 3MUOA 4A16A 3U9LA 4GRIA 3GPCA 3HDJA 3RC8A 4RZSA 1B6SA 1SUFA 3DYVA 3QLEA 1UPCA 1FTGA 3IBSA 5E1MA 4EITA 5CFMA 1NSTA 2AMJA 3DM5A 3OUTA 2VHEA 2X0JA 3R5KA 3TM5A 5DM60 3C1OA 3AJEA 5EPEA 2BMJA 4QPCA 5EMHA 2YVKA 1G8KA 1HLFA 1RQ7A 1EEHA 1U6IA 3KSUA 3VU0A 3E1KA 4XD2A 4B32A 4LJRA 4JVMA 2F59A 2WAYA 3D1LA 3H2GA 3CQ9A 4RLHA 2I1WA 5AVXA 1WQ1R 1IJFA 1P3Y1 4MDFA 1UMDA 4YALA 1W0JD 3QIAA 4LXXA 5JO0A 3QLJA 4JP2A 3CW8X 1U8UA 3GF4A 4KVFA 2P9ZA 1QHNA 2VUSA 3RLFA 2YFHA 1MF7A 1Y6GA 3HBNA 4XXHA 2P6UA 4IVPA 3W2HA 1XX6A 2JIRA 2XMQA 1MO2A 3CRRA 1XD2B 3I5AA 3I9MA 1P5RA 1VL6A 3A7EA 3DOHA 4MZDA 4ZQIA 3UMYA 5CIYA 2H48A 1J49A 2P6RA 2A78A 4ZVKA 1E3LA 3GJ4A 3TCXB 3ZD8A 1JDSA 2HWXA 4H1WA 4IF4A 4ZMRA 5JZOA 1QF7A 4EGAA 5AK6A 3WNDA 1I94B 1U63A 2JIQA 2WHYA 1MAHA 2Y2UA 2BHLA 2QZPA 1OZGA 4V38A 4D74A 3HI6A 5D1NA 2AKAB 3KQWA 2HDHA 3EC7A 2QM7A 3B6ZA 3I9V6 3A1FA 3Q8MA 3KYDA 5JJBA 4P2BA 4MUHA 2WA1A 4BU0A 2LXNA 2R1ZA 3BIXA 3E9NA 4ZT2A 3GEIA 3KKPA 4E6EA 3P5BA 2FZLA 2WT4A 1UQUA 4H7KA 2VRNA 3LXMA 5HFNA 2C9MA 4D9NA 4KFCA 2CMDA 2O3JA 4J1QA 2C95A 2OC4A 4AW9A 4ZJYA 1WXFA 3RFCA 5C5CA 1JR6A 2Q5QA 1QE5A 4Z9YA 1EUZA 4G24A 2ACVA 5JD5A 1UPUA 2JC3A 4YV7A 1P9NA 2A8YA 5E6SB 5EI5A 4IZHA 3BILA 1VG8A 2PLAA 4DV2B 2ROQA 4KK4A 3VPCA 1VCMA 2WDPA 3WG9A 2ATVA 1E0AA 1K89A 2D1FA 2P2DA 1EDBA 2J85A 2X77A 3WGOA 3SC2A 1NLMA 1O9BA 2EGHA 4XB6B 5KX5F 5AI9A 1DO0A 1ODJA 1TXGA 2JCGA 3NV9A 3O7MA 4H60A 4WZBA 1E3EA 1E1MA 1I2CA 4AJIA 4ZYTA 1QZ3A 1N75A 3SIRA 4M1MA 3ZU5A 2VJQA 3ZWDA 1NWCA 3HK2A 4NAUA 3P9NA 4QTXA 5BSWA 4CTOA 3EC2A 3EIQA 4K0RA 4QQKA 3EGEA 4BMSA 1KYIA 4K88A 3IB6A 4UQLA 2H9YA 4DT1B 3IAFA 2AZXA 1K4YA 2WJIA 4LDPA 5DLEA 1I2AA 4YC7A 3KSRA 2FSHA 4FXPA 2R6AA 3DB2A 4DV7B 5K51A 3WHIA 2OHVA 1H4VB 3FUTA 1RXVA 3KUDA 1JQAA 3A36A 1OJ7A 1J8FA 1Z17A 2JCYA 1XJWA 1B6RA 2GYVA 2Z4TA 4JN6B 1XBTA 1J7JA 1AZWA 2PUVA 3HDQA 1XHFA 1K3TA 3IQDB 4KGXA 4HDMB 3E61A 3I6IA 1KH2A 1WXHA 1N78A 3MJRA 1Y5RA 1PYGA 1G17A 2G17A 3TIFA 2BM1A 4M2LA 3SLGA 3QGMA 4E15A 2ERCA 4HB4A 2D5LA 1DRJA 4OQNA 1T2DA 3PL1A 1SBIA 3BGOS 1JF8A 2HA0A 1NAHA 3GP3A 1MO6A 3SC3A 1GLGA 1VBNA 2V97A 3BE4A 3VHRA 5LU9A 3P32A 2C4NA 3QTTA 4OBWA 5B12A 4MO2A 2JBHA 2E7ZA 2VHQA 4WOCA 4WVLA 5LNK1 4P4NA 3DF9A 4XGQA 2VT6A 1CZOA 4NK5A 1GQFA 1U2SA 3AFOA 3RGGA 1YVDA 1JSXA 3QH4A 4MKZA 1PLLA 3FMPB 5JCXA 4C1BA 4QWWA 3TSWA 3OHSX 3WGQA 2IQIA 3P19A 2EHJA 4C4PA 3GI1A 4LSGA 2YICA 4HG2A 4KQ1A 4N39A 4URHA 1DXOA 1D2CA 4WY5A 1E7MA 4MRNA 1RQRA 5AI4A 3C7TA 1M7GA 2CN1A 1Z38A 3WNVA 2JLAA 2YV5A 4IG9A 2ILVA 4D4KA 3PD1A 2E4VA 2QUIA 4WQMA 3OHPA 3EDMA 1DAOA 4N49A 2HIHA 5HWSA 4BNHA 3L4BC 4XPIA 3L1KA 1RYDA 4X6YA 1X7WA 3HQ4O 2OXTA 3N05A 1PHRA 1A97A 1RLOA 3UHPA 4JCCA 2H51A 1DEXA 1KFEB 1VXOA 2QPTA 4Z9BA 4DA9A 2GXSA 4GFDA 4WJZA 1KYXA 3MQ2A 1QP0A 2QX4A 4LVOA 2O1WA 4ZAYA 1JILA 1N0WA 1Y42X 3E2MA 1YCDA 5I9BA 3F73A 3BE8A 3NHPA 1QBGA 4J7CA 4X54A 5HFJA 4B76A 4WX2B 2WA2A 4KJXA 1QSGA 3ROEA 3TVYA 3GX1A 3EVAA 4US2R 4G0MA 1FRQA 4IIXA 3EGDB 4C7KA 3EIWA 3RJMA 2QRMA 1AIPA 1SBQA 4KXQA 4P8RA 5FXMA 5K6AC 2ZAIA 1EB8A 3W5UA 3N5CA 2IBSA 5BOSA 4FEGA 4AKTA 3GDFA 4RPLA 4C78A 1SXJC 4UEJA 4WXRA 4TGLA 1FBTA 2C8VA 1FDRA 2UYOA 2XNCA 4KLCA 1PR1A 3VX3A 4B75A 1O89A 1VKNA 2RHDA 4IJMA 4CEJA 3L6RA 5L53A 3HXKA 5AM4A 4E3WA 4BKPA 5E3JA 1WF3A 1CUBA 1Z3CA 3PNMA 3GFQA 3K2QA 1JIXA 2H2IA 4O4HB 3JZAA 4RY0A 2IIQA 5JSZB 1RC8A 1EVIA 1HK7A 1BD3A 5THXA 3H9EO 5LQNA 4G3XA 1X80B 3DEIA 2O1SA 3D2BA 5CT4A 4Q37A 2Y9PB 1DXHA 1X9IA 4MPRA 3MWDA 2Z4SA 5HDQA 3UGQA 1TTQB 4DR6B 1UC5B 4GZLA 4BVFA 3TQOA 2AQIA 1AQ6A 2J6BA 1BE1A 2CNNA 1CR1A 2I03A 2XNHA 5FYDA 3C1UA 4FMDF 1FJ2A 4W6ZA 1KJWA 1JTFA 3N8HA 5BW4A 5I7VA 1H2AS 5IXJA 5JRJA 3L46A 1D5WA 1HOTA 2ZYSA 4JI4B 2QUBA 3O1IC 4OLAA 2GZDA 5AVVA 5SYAA 2DU8A 2AN1A 2Q4DA 2O2ZA 2YZNA 3L7DA 2NIPA 3HSKA 4ESOA 2W2TA 4F56A 5CBKA 3TLGB 3I32A 3FNIA 5DV9A 1AQIA 4ZHQB 3D6FA 5D3QA 2GN2A 3E4CA 4JLPA 2OGZA 3M5WA 3MPOA 4IF6A 4MMZB 1T9CA 1QORA 4LRQA 3GRVA 4IVNA 4CLHA 2C9ZA 2IV7A 4M89A 1SOVA 5DULA 5NULA 1W1UA 3NHBA 1Z8DA 3OO0A 1W44A 2AG6A 3LY8A 2NO7A 4QQFA 3VRHA 1J8QA 3GLQA 4JA2A 3JWPA 3A05A 3LG2A 4JDUA 3TOZA 4B47A 1RHUA 2WYHA 4KR7A 2XA9A 1LFDB 3EPRA 5J47A 1Q3HA 1HETA 4PPFA 1NMEA 4Q19A 2VHXA 1V8DA 3Q3IA 3LT4A 4KBYA 2VYVD 2X2EA 4CGZA 3WYFA 3RVRA 4R0VA 3CLRD 1BWSA 3UFXA 1TUIA 4HRVA 1CUAA 4DBLE 3ZHUA 2W6CX 4AU1A 4B7CA 3T3GA 4UTNA 2H29A 2VATA 2I4LA 3GRZA 4ZO9A 4EPRA 4RMIA 5H8WA 3GDWA 1UMDB 1TF7A 5AW7A 4FHFA 3H1PA 3SS7X 1EWVA 1EEXB 5FOSA 5AKHA 3R8FA 4ZC8A 2XE4A 4IDAA 4LNUB 5I3CA 1BYUA 3AIIA 3G2OA 4R7GA 1XKTA 2NX2A 4JL8A 3KJGA 4Z9XA 3TLXA 2IIBA 2O7VA 1FMLA 4E12A 5BSKA 3NETA 4MVJM 1VSVA 3H5AA 4G0ZA 4F96A 1M1NA 4JHLA 4D9CA 1C2TA 1T9BA 2JGIA 2VXOA 3AP2A 5D7NA 5FBQB 2AG5A 2BR4A 1VPTA 3BAFA 1WJGA 4FGJA 5THQA 2V7GA 3OAAA 3SZGA 4M7WA 1QNFA 4E3ZA 3DCYA 3KYDB 5LD2C 3JVUA 1OYOA 3EZ7A 3HB1A 4RPIA 1C0IA 2WWVD 3ESCA 2JJ2A 1NFFA 2NO4A 1U7DA 2P2NA 3X1XA 2CKMA 3ND6A 4LQLA 3G9ZA 2WD8A 3R77A 1SVUA 2FRXA 4KVAA 3TYXA 1P0PA 3KPWA 4GZ6A 5IN4A 1QGOA 4AM8A 5D00A 5L8VA 3B1VA 4OQFA 1KJJA 4D1YA 3OM8A 4O2BA 4N0QA 1GZVA 3A6FA 3JQ7A 4GGPA 4Q1VA 1NSYA 1E94E 2AKEA 4LXTA 1U90A 1DI0A 2C2OA 2FG5A 5JQGA 5D8DA 4EK9A 1J42A 1MW9X 5K6AA 1AKMA 2O4CA 1CX9B 4HDKB 4IICA 1XG5A 3AB3A 5GZ3A 1N2ZA 3GH1A 1UJCA 4OXXA 1XRNA 3SC2B 4FC7A 1SXJA 1SU8A 4NC9A 4F4DA 4YYZA 1ZVMA 4V0ME 2A9PA 4HLNA 1PJTA 4BVHA 2PH5A 3E7WA 1MFZA 1ZHHA 2ZK7A 4WZBB 1GLNA 3DFUA 3PD0A 4QT4A 4P4LA 3IXMA 3SXJA 3OPYA 4OB8A 1XAHA 3QJYA 2QI9C 1T29A 4ATNA 2D2FA 2IDMA 3CLTD 3L0ZA 4J0GA 3NFYA 3PE3A 3AGQA 4GKBA 5JV5A 2VZ8A 1G5TA 1ESCA 1T35A 1YJQA 5I8ZA 5K8IA 2HO4A 4WZAE 5T4EA 4DDHA 1UC4B 4D6XA 1Z08A 2Z4RA 4BMVA 7ADHA 1GDTA 5CHYA 5LA6F 1DKNA 5E1BA 1DRVA 1ESZA 2ZTUA 1P7YA 2ZPAA 4IDPA 2J8ZA 4CKXA 1W9MA 2BCGY 4BZZA 3AM1A 4BB0A 3MQ4A 4QECA 3K0FA 4RZ2A 5JXGA 1N36B 3SPXA 1T0BA 1HDRA 2JLQA 2EZ4A 2HK6A 2DQKA 5K0ZA 2AEMA 3S8EA 3QBJA 4ID3A 3L4EA 1JKFA 2OBXA 4IDCA 3LM8A 3U7IA 1NASA 4KE8A 3SDSA 2HJGA 4A2PA 1NUAA 4M9SA 1QKKA 5C81A 3GELA 4OVKA 4K81B 3UMCA 2JFQA 3K9CA 2DBYA 3FOCA 4HGNA 3WV5A 1ZCFA 4B4DA 2O6LA 4LNAA 4O0MA 4U02A 4CQLA 3IRVA 4Z5XA 1GIAA 5BPHA 4FZVA 4JLJA 3RNOA 3UQZA 3A3NA 4CU5A 7REQA 3UH0A 1T13A 4FYIA 4ERXA 4TMTA 1R6TA 1U4NA 2ZIVB 3ELYA 5H3LA 1W0KA 1GCAA 3LDAA 5EIOA 2EGGA 4MB2A 3TS1A 4JSTA 2F3TA 4B45A 1DMRA 2Z5GA 2BT4A 2KLHA 1Z7GA 3B36A 3UPDA 1X1QA 3Q7RA 1WVIA 1H2FA 2C0CA 1I7NA 1OR8A 3LIPA 3LQ2A 4B17A 4OL0A 4YEDA 3LBNA 2QV7A 3W0LB 1D09A 3GHHA 4ZEMA 5IS2A 4G5SA 5ECGC 2GPBA 2O5VA 1RPNA 4JKOA 4DRXA 3FOAA 2K5UA 1J5XA 1WUKS 1YZNA 1HDYA 1X7YB 3KUUA 3R6GA 5GONA 4C06A 4EX7A 5M04A 1SEVA 1QC5B 3K2EA 5ENZA 3THSA 4QVKA 4D5EA 5KJ6A 2WUEA 5GWXA 3PLAE 4PN7A 3QEJA 1VB3A 3CUSA 5EP2A 2C7GA 1JG2A 1JW9B 1CUXA 2HIGA 3OOEA 2GPYA 5BOVA 3QYJA 4A10A 4E6PA 3PUKA 5J3JA 2BISA 2CK3D 4MQ6A 4XPIB 4EZEA 4X24A 4PR0A 1O3YA 1WWKA 4K6CA 1VL5A 2QAJA 2YV3A 4RK7A 2W4MA 3CRQA 1L5SA 4GPZA 4PYRA 4TQ9A 5IN5A 2Q41A 3LLSA 4TX1A 4W5RA 3PFFA 2WB2A 2O0JA 1YRAA 3SDZA 2LKDA 3BSYA 1NP7A 4BX0A 2P41A 2BGUA 4MNTA 3RVBA 5DYNA 3O8OA 2X2OA 2Z2ZA 5JSKA 5LKRA 1Q0UA 2O07A 5A04A 1TEVA 4WBNF 3RVQA 1AS0A 1L9KA 3E5NA 4HCJA 1YZVA 1BH6A 2ID4A 4KO3S 2YRFA 3DAFA 1OI2A 3M3DA 1LSUA 3LC0A 5KYNA 1CBUA 2ZJYA 5JFTA 1CETA 2VP5A 3ZE0B 3ND9A 4AYWA 1QV7A 3E22B 4D8XA 2XBLA 1NQTA 5DDIP 4IVQA 1T9HA 2Z95A 4ZQHA 3RC3A 4BDTA 2FAXA 4F5EA 1OU4A 1FDWA 4QYWA 3VO2A 2UXCB 4CKBA 3OMWA 4PZLA 3W7VA 1IG0A 4EA7A 3BXOA 3HC7A 2OT3B 2WSSD 3MXOA 4Y9TA 2FHPA 2AUMA 5CVTA 2W2KA 5ELMA 2NO0A 4OQLA 1N6KA 3PFCA 4CM5A 3Q5DA 4NVRA 1LLDA 5B7NA 1GZUA 2BUBA 3C1AA 5G0VA 4YJFA 2ZUCA 3E4DA 2O2DA 1ZGHA 1CUFA 3AEXA 2HK7A 5FUYA 5AW1A 1G20E 1JEYA 3NT2A 2R25B 2CLOB 1JLLA 2VRCD 3A9VA 2XYGA 2WKWA 4ITRC 1SIBE 3Q0TA 3LSTA 4L0CA 2P3LA 1I3KA 3OI7A 1G3MA 4G26A 5HQJA 3HCNA 5I7SA 2MSLA 4DDTA 4W5NA 1KMNA 3ENNA 4ZZ3A 3ZN2A 4PFQA 1UANA 2DHDA 4YP1A 2ZR9A 3S1LA 1TYZA 1CDOA 4Z8XA 4DQDA 4EKDA 1BHQ1 2IYSA 4PIPA 4QPPA 5ICFA 5IAGA 1J22A 2WJWA 3OBBA 4CIDA 3WAJA 1S02A 4JI3B 5EJ6A 3KR9A 2IU3A 3IO3A 3ZCQA 3DEZA 1TD1A 3BVPA 3PJEA 4Y6GB 1T1IA 2OFOA 3D6NB 4LC9A 2VCYA 5EXEA 3AGPA 1RQLA 3EVTA 1SR8A 4BNXA 1YOVA 3KJEA 2XOKD 1VB5A 3C41J 3DZ8A 4KMRA 4YTEA 5EERA 2OXFA 4ZOEA 2CMHA 4RFSB 3CS3A 2PL9A 4C4ZA 4CTJA 2QYTA 1KE1A 4C0XA 1HRKA 2AMFA 1CUGA 2PWBA 3WZMA 4QAJA 4EG4A 2G1AA 2XB9A 3FLMA 3FOBA 3T1QA 2XCTB 4M0LA 1NQUA 4KPYA 3R7AA 3VPSA 4BNKA 1F8UA 1T5TA 2BMWA 4H3SA 1PX0A 3AF4A 4GM1A 5E2BA 4EG0A 3LAWA 3KETA 3FVTA 5LQKA 1AHNA 4Z4CA 2HXGA 3QBEA 1D03A 2P9CA 1CIVA 4URUR 1HDEA 2AV6A 4L8YA 4E30A 1YCHA 3DM9B 1OLUA 3V8BA 4C6SA 4GLJA 6PFKA 1WPGA 3LW7A 2GGSA 2IEIA 4UOZA 5IHXA 1ECFA 2VCEA 2W6MA 3AB7A 3IAM1 3NOOA 4CYMA 5A5EA 2J3KA 3MUNA 1BMFD 2IF2A 3PFWO 1BHJA 1KFBB 3S40A 2QZ4A 2ORYA 4YMLA 5CLLA 2FRVA 3DAYA 4ID9A 3ABSB 1C14A 3NAMA 4ZGGA 5IP5A 2X15A 6AT1A 3W9BA 1U8EA 3OKPA 1YGYA 3GZNA 1CY6A 1LEHA 2DUNA 2IYRA 1E3DA 3W04A 3WSWA 3KBBA 4ODIA 4UNSA 5DBHX 2ANBA 1KMHA 4QJ3A 4HMOA 3WLLA 4Z1OA 3VAAA 1GUAA 2GJ9A 2P0YA 4NTZA 3MGBA 2FK8A 2PUDA 4N5IX 1PJLA 1M1NB 4EYKA 3HYLA 1LPMA 4G5YA 3R7WB 1U7TA 4CN8A 2FX5A 1AO3A 1RRKA 2QGFA 4KLRA 4R2JA 5FTMA 1YC2A 4QYTA 4RTSA 3V48A 1ZJYA 2H9AA 1Z68A 4XFDA 4EHIA 4OBXA 5JCOC 4HGZA 2NVUA 3ZXSA 1DKQA 3SNKA 2R0QC 1JWLA 2VLBA 2XH8A 4OHKA 4C7OA 1V45E 2V7PA 1I01A 3RW9A 4BO0A 1U0FA 3F1LA 4BO4A 5IEJA 2C8JA 2HC9A 5GGYA 1T10A 1Z7WA 1RYBA 3TUJC 3CKKA 2QW1A 5ALNA 2Q6VA 1QONA 2OBLA 2IPAB 2QJOA 3OM1A 4NBKA 4P0PB 1OX4B 2X3UA 1D2NA 4P0TA 1KP2A 3JQ7B 1SXQA 1QFJA 1QO0A 1R0YA 2NG1A 5IWCA 1OQAA 1MMFB 4MCJA 5HDBB 2LCFA 3HB5X 5JASA 2E55A 3SZMA 3QEKA 3ZWYA 1AA6A 3HN2A 2I71A 1FFAA 2W71A 3ESXA 4PVCA 1U04A 1CJCA 2VAVA 2C88A 5DCUA 2V5AA 1D07A 2V5UA 3TUIC 3I0ZA 2C4MA 2M6SA 3I5MA 2BOVA 5H80A 5AICA 4AUKA 4F38A 1QZZA 3ZS9A 1TLTA 3TTUA 1EGMB 3GRCA 3OPYB 3DB1A 3OF2A 1IEWA 3UJHA 2PX5A 4V24A 2OQRA 4D3XA 1CQXA 1AO0A 2MIIA 1X3LA 5CXXA 1Q0ZA 1QGUA 1ZU5A 3KQPA 3AF6A 5BNWA 1KKLA 2VZLA 3NBQA 4CM9D 3K6RA 4M7RA 4G8JA 4DTIA 3GGJA 3KIPA 3PZRA 4P6VF 1P6QA 2JJQA 3OIVA 4WOPA 1RYYA 3CRNA 1OWLA 3UK6A 1HQKA 1D1PA 1BS9A 1MOSA 1NVGA 3FNEA 1JFRA 2H8KA 3KXLA 4HDSA 4OM7A 1W6RA 1RYFA 3K0FB 2APJA 4Q9LA 3WMEA 3RQSA 3FVRA 3JR7A 4Z7OB 4A15A 3MVEA 1SQFA 5FWNA 4C08A 3T7EA 1ZAKA 3GG9A 4G0WA 2CL7X 5AOAA 1RKBA 2ORIA 3QHQA 3QNMA 2GASA 4M88A 1CY8A 1OHHA 4ILEA 3M33A 4J90A 3PLRA 4E14A 2I7CA 1OI4A 4UXIA 4BPBA 2PJZA 4MJXA 4X0EA 1PJ4A 3JQRA 1MG5A 2GHIA 1IY8A 3I1YA 1ZJ4A 2GCNA 3RSZA 1X3SA 2H1SA 3JPWA 3AVVA 1PZMA 2Q2OA 4YCJA 5D7BA 4YP6A 4EUSA 1UXGA 1BHSA 3KHUA 5CFZA 3QFFA 3GLFE 2V7VA 3G2JA 3KHSA 3GPBA 1DXQA 2OO5A 1G7RA 2JJYA 2AWNA 2PUTA 4FHEA 3BRSA 4MGZR 3DQPA 4GUDA 3ERCA 2HA3A 4I46A 2QP3A 1XZEA 2BFFA 1D2AA 1ONBA 4JBGA 1ZN8A 4EHAA 4XWYA 2ZTVA 1I4EB 2ES4A 2CL6X 3EY9A 3MTJA 4NBTA 3SY8A 3C5VA 1NUHA 3R4CA 3NZEA 1SY7A 2KLBA 4AO8A 4ESVA 1XLUA 3WWCA 1L4GA 5TR9A 1J33A 3H3XA 5K05A 2HDNB 2QAIA 3SIPA 5CDUA 1XJCA 2OK7A 2WW8A 2XCQA 5B64A 1XIVA 2QE7A 4JS0A 4FJ1A 1CW2B 3DA8A 4QUJA 4QT0A 2PFGA 2ZLBA 2LE0A 3S5JA 4K6OA 4LRUA 4E32A 4C7OB 1JR3E 5BUSA 4PZ0A 5F64A 1PUXA 2IIVA 3EIUA 3HKDB 4EW3A 5TQ0B 2HJ9A 4MGIR 2IXEA 3UICA 4MVJP 2XF2A 4TOIA 4CF6A 4OKIA 1HSZA 5EJ8A 5DNWA 2HQRA 1M76A 2DPXA 1G8JA 3TPFA 5A4JA 1L7PA 4XSHA 4YJ3F 3UV7A 2WWYA 4B3SB 4OHMA 3LQRA 4FT2A 4Q7EA 2GZAA 1AKEA 2W6IA 1O6GA 4ZRDA 3ZJYA 9ATCA 1N92A 3FA2A 3IERA 4LHVA 4CIVA 1HLPA 3JQFC 1MO5A 1XALA 4PR3A 2IEGA 4R40A 4U5XA 4YS6A 4AMUA 4LTDA 4DLLA 5JDCC 4J0QA 4PHFA 5CT6A 3RR2A 2FR1A 3MYYA 3QU7A 2RC5A 2AFIE 2X8WA 3WLAA 3QBTA 2BFOA 4TLDA 2Q1SA 4WKBA 1YFLA 4MMYB 2RK4A 2RI1A 1VL8A 1I7PA 1Y3DE 5JCOA 3IHWA 3FCEA 3O8OB 4YJ2F 3M6XA 3H99A 3IV7A 3QF4A 4D3DA 1Q2XA 1RU3A 2Q9CA 4BTVA 2HT6A 2G7ZA 4JVSB 4MWEA 1I3CA 1V5WA 1ISJA 1FLDA 1NKSA 1GU1A 2A9OA 3MUFA 3O2NA 4D45A 4H4CA 3P5SA 5A9SB 1E9CA 3QXCA 2X5JO 5FJJA 5FWXA 1I4DD 4UMDA 2Q21A 5JS2A 3CCCA 2INGX 3NTUA 1U7XA 2KS6A 3I2JA 4KG7A 4CMHA 4EI9A 3RTEA 1M2FA 2WK1A 3T4EA 4UULA 5LQAA 2HLNA 1I6WA 3H42B 1QB8A 3DBHA 4MW4A 2PX8A 3WVNA 1YMVA 1BEEA 4R1LA 4RK4A 1QYCA 4CIBA 2NZUG 1RWQA 2XCRB 4YJFB 1RZRA 1P3JA 3AB8A 1J20A 1L5YA 1XQWA 3S2EA 2YYZA 3VPXA 1XEFA 1ZD3A 4OK3A 2OZPA 1BAPA 1COWA 4QUAA 1JLLB 1ZCZA 2SHKA 1NVKA 3AJRA 4YFVA 4IQGA 1NW3A 2OFXA 1WD5A 1I7DA 4RLFA 1UP7A 2EVWX 4PINA 3WSVA 1QS0A 2A9KA 4PTYA 5DNYB 5H1YA 2J9FA 3C6MA 5BWMA 4P86A 2KI5A 1FPQA 4TKVA 3DLBA 5IBPA 4HAVA 4L07A 1H0KA 2V6IA 4GBED 2Z1DA 2C9YA 5J58A 5LC1A 2XXAA 3EZYA 4G4SP 4OI1A 2QLNA 5B7PA 3KYJB 5JEDA 1KQNA 2DSNA 3COVA 5ED0A 1KRXA 3MNFA 4RE6A 3HSSA 3GNSA 7AT1A 4F4FA 4AG5A 1YOVB 2VP3A 4BJ3A 3BCSA 1A8SA 1BJTA 4OGKA 2JDID 2OBMA 2Q5LA 1PNTA 2VHTA 3A10A 3ABRB 5FBWB 2X22A 3FPJA 3DOJA 1L7NA 4S1OA 2QSZA 3FHTA 3JYPA 4LRXA 3G7UA 3L1UA 3M1YA 4U4AA 4XGRA 2WFZA 3SZOA 1EZ1A 2FPPA 2PNJA 2ZYVX 4MKGA 1Y48E 3DHNA 3TOSA 1DKOA 4ARBA 3CCBA 5FD8A 2BH2A 1GVNB 5AVJA 5G0TA 1SVMA 2A3RA 2Y1XA 1XELA 2A0FA 2PM8A 5E0OA 2A9JA 13PKA 2XTJA 2BM0A 4MWOA 3JAMA 1PBNA 2YHBA 1RQNA 4I4TA 3ZWWA 3SD7A 4FD2A 1TA9A 3B1KA 3BRQA 1C0KA 1X15A 1NYLA 1UC8A 4TWJA 2ENUA 5DXAA 3PX7A 3AY3A 3RT7A 2BZ1A 1TQ2A 2A88A 2H1LA 3TEJA 1J21A 3ZOKA 3SJZA 5FP0A 4RJLA 4DKXA 5LXTB 3MGAA 4OQQA 3KZKA 5C3MA 3GZNB 2CL0X 2BGNA 4MP6A 2Y71A 1CJVC 1PKEA 1TKAA 2PQMA 1QHFA 3GNLA 3K5WA 3PPWA 3VR0A 1KMHB 1XUOA 1O6ZA 2FB9A 2PZ8A 2W48A 1NVVQ 1VJGA 2B4TO 2JAUA 3BCRA 3RAGA 1H3EA 4CM4A 1PS9A 3O4JA 1DZIA 3O8CA 1LS6A 2FSFA 4LZAA 3AKCA 2CVOA 1K6MA 2H7YA 3HBFA 1BX0A 2QTVA 4ND8A 3Q7EA 4OAPA 3W06A 2WDZA 3W2FA 3ROMA 1V26A 4DL9A 1T5IA 5F73A 3CWQA 2GKSA 2J0SA 3LKBA 2IE0A 2QD3A 3VVMA 1K2WA 1DKPA 1CRLA 3RCBA 4BEBA 1UDWA 2NAPA 3AI2A 5JDCA 4RZHA 5LQMA 1GL3A 1YK1A 4ZCPA 5B53A 1V7QA 4AY3A 3ZHCA 4GP9A 1QUEA 1VL1A 1GG2A 2QUZA 4HQ0A 4J43A 3BWBA 4QUKA 4I1UA 1XDBA 5AHRA 5IZCC 4FFNA 3EGOA 4W7SA 5BV1A 2Q07A 2DYKA 3OM9A 4TZ6A 3Q9LA 1M1YE 3NH9A 5TSDA 2PL3A 3L7MA 3I39X 3R23A 2R00C 2FSSA 3CUVA 2ZRIA 2D1RA 4G5FA 4GXNA 4KFSA 1Z0KA 4HXYA 4KV9A 1WCIA 3VSBA 2IZ5A 4JYPA 4CRWB 2FA9A 5HIJA 3ZTYA 4CVNA 1R66A 5FPKA 3QU5A 5U1PA 4DWJA 4HDCA 3L1IA 1E1RD 1G42A 1MKYA 2I1QA 4YIHA 2ASVA 3NH6A 2IE8A 3PL5A 4YO8A 2JBAA 1ZJJA 2F3PA 4IXNA 4QAQA 3D3EA 3HSYA 1M2JA 1YBFA 2IXGA 2LNDA 5C0OE 1UJNA 2QNRA 6LDHA 1BGVA 3FVQA 4L5AA 1M6VA 2GVNA 4Y2RA 3ON5A 1PR9A 1GQRA 4HZIA 3RC2A 5FBRB 1Z36A 4UREA 1LTKA 1IHPA 1QGUB 1VOTA 3DZKA 1US8A 2H8GA 2GCGA 4D92A 3ROXA 1V39A 3GZTB 2P6PA 2PAAA 4RVDA 3SJUA 2RHMA 1RMYA 4BMPB 5HM6A 1MRNA 1BRMA 4TS1A 3UKOA 3NEAA 1E32A 1ZHFA 3A6HA 3ABQB 3SMQA 2ZETA 3KEMA 1F2TA 2CUNA 1UM8A 3RRNA 4HDSB 4ZODA 1OH5A 2YOGA 1DCKA 1RW4A 3DR3A 5EFZA 4TTVA 1KRWA 1KEEB 4DDVA 3CINA 5B3AA 3E3MA 4YR7A 4LZWA 3SVLA 3BN3A 3E82A 4OTZA 1J2YA 4R01A 4YDHB 4RTKA 2COKA 3FUVA 2LZ0A 4Q5IA 2WU1A 1LX6A 4L6AA 3CX6A 3VOSA 3R9XA 4K87A 4XR4A 2V7BA 4CTKA 2PKQP 2HB6A 5AHXA 3KKMA 4MV8A 1L4MA 5FNZA 2FE4A 4X6LA 4WV3A 4HZUB 1I0IA 2I67A 4O4HF 4DG9A 3U7RA 3BKWA 2QHXA 3LUGA 4FNOA 4KITB 1C3VA 1V8OA 1FJXA 1QYWA 1P77A 4G67A 2G06A 3BWYA 4I19A 2F9MA 2HUPA 4NFLA 5EP1A 4BVLA 1ECPA 2WM2A 1CRQA 3ZKWB 3IKJA 3UGJA 1MFPA 3AFNA 4U9IS 4YMHA 1Z16A 1XT6A 4BAZA 1TMGE 3DDUA 3C70A 3OCCA 3T4PA 5DT2A 2QRKA 1T91A 2WPNA 3CHYA 4YK7A 3Q2OA 4BJ1A 1V8BA 3E7FA 2PS0A 1FW8A 3OE7D 3RO7A 1ANKA 1QDEA 2QR2A 2OXCA 2YHIA 1EE2A 1RAFA 4OKSA 4RHCA 3RK1A 5JANA 4PO8A 2YX1A 3FCUB 4JUIA 3AHJA 1UFQA 4XM2A 5B37A 3G0BA 3SHTA 3AR9A 5KI6A 1Y7HA 4EHNA 2YZMA 3B7PA 1M2GA 4J91A 5DHRA 1NHGA 5EKUA 2CCGA 2ECOA 1IN6A 1XCPA 2NTEA 4RY2A 4A1FA 2CF6A 3GOQA 3QKUA 2HQOA 3AW9A 2AF3C 4DV4B 3HVUA 4FCTA 1X8XA 2FWMX 3MJEA 5REQA 4DQXA 1Z88A 4W63A 1WDWB 1D2GA 3B52X 3ZZUA 2WIJA 3FNHA 2NOAA 3INGA 1LRKA 2NWQA 2VBIA 2H57A 3GFSA 2V7WA 1NG1A 3PDHA 4LJ9A 3MPUA 4CUKA 1RRMA 4DRZA 1L0BA 3RVKA 2PHZA 4RVSA 1UBMS 3Q72A 4L0DA 5DGXA 3QP9A 3GA7A 4JX8A 1U8XX 2ZT7A 4O5OA 2CF5A 4IKOA 4RIIA 3RTCA 5IULC 1UBLS 1N6OA 4NOLA 1YRBA 5AO9A 1M6NA 2NSDA 1OX6A 4MV9A 3SJAA 1W5EA 3HDTA 3EBPA 3QF4B 4M1QA 3VV2A 3H7AA 2Q4RA 4YRTA 5A4IS 3T3OA 5DNDA 1UBUS 2QR5A 1FDOA 2P11A 3O38A 5FUBA 2C3MA 3L01A 2Z0MA 3VU8A 1KIAA 1NBWB 2J0QA 4RH1A 3HUDA 4M0FA 1Z5VA 3NGXA 4EW2A 1FU7A 1O87A 2X7JA 4HS9A 5FWXB 5IZCA 4RZUA 1M0EA 1QQAA 1A96A 4QNNA 4CMAA 3O4RA 2D7CA 4XJTA 3DV0A 2SICE 1RLIA 3OP1A 1ORWA 2R00A 3DBRA 2BKXA 1JDNA 1NOJA 1R9JA 3EQ7A 3NDPA 4G5XA 2QTBA 4IHAA 4JMLA 3S28A 1PZFA 3DBHB 1CUEA 1YB7A 3FSRA 1RJWA 3HR7A 3Q6MA 5L6LB 1T9AA 4MUEA 3Q1LA 4ZCRA 2ZE7A 4Z4EA 2NTVA 3HVKA 4ZOLF 5BQ5A 4ZVSA 1P0MA 1HRDA 3QWAA 1R0BA 4FGUA 3HL4A 1Z39A 2G0AA 3JVVA 3JZFA 4F6RA 1P4SA 4G6ZA 4A0QA 2O8BB 2VHVA 4MVJI 2E4XA 4FC6A 1JQDA 1ZBQA 3TLBA 1EGQA 2JFYA 5ELXA 1YRLA 3RAEC 2DUUA 5EHGA 4C4AA 1JFTA 4D02A 2OYSA 1WDTA 3IP8A 1GKKA 3O5AA 4ZAVA 1BDHA 1BCRA 2ETXA 3LXRA 2J9FB 4UUQA 4E13A 2B8NA 3WE7A 4LV5B 2GCIA 2K87A 2QVYX 3STXA 3EF1A 2FP4A 3MRSA 4D9JA 2PKYX 4M98A 4ND6A 5BSMA 4KR3A 5TLSA 2EKDA 2HHJA 1C0EA 2PS3A 3ER6A 4RM2A 4XD7D 5ALYA 5YASA 3ZW7A 2XXAB 4PANA 2ADOA 4KIGA 3PZBA 2IYEA 3NRJA 2CD7A 4Y8VA 5B1HA 4EVQA 1H3FA 4YAWA 2QTAA 1WX1A 3HG7A 4KSCA 3OKFA 2VK4A 3QMPA 5I9TA 1HYHA 1ISRA 4RGVA 1BU5A 1YASA 3H2KA 4JQZA 3AW8A 2WSLA 1A69A 4RHXA 4EHDA 1W0JA 1UT5A 4UBLA 6REQB 3HHPA 5A9TA 3M6UA 4UUPA 1IXSB 2XV1A 5BVGB 1GTG1 3S44A 5LMZA 5HX7A 5H5JA 4RPKA 4D8WA 4B85A 1QPBA 2Q6IA 1R1DA 3FYHA 1U0RA 2FWIA 2DFDA 2H2GA 2JAOA 3TWOA 1FLNA 1ONPA 3NM6B 4IFIA 2B3TA 2XECA 4KLAA 1E77A 4KYTA 3CISA 1E1KA 1U3VA 1FY2A 2ALJA 5CVUA 4W5OA 1WBBA 5FNVA 3RHSA 4ND5A 1PE0A 3SQMA 5H4GA 1BOOA 1NFQA 4I4TB 3HI4A 2CNLA 4Y18A 5BW8A 3KALA 3KPVA 1KQOA 4OFZA 4KAAA 2J0VA 1R9MA 1Z06A 3BZWA 1X7HA 2WYIA 1E9FA 5HZHA 2CJPA 1AMUA 5IT9A 3DV9A 3V8EA 1MIOB 4N5HX 2WU4A 5BQOA 5JYEA 1OZFA 4I1PA 2NXNA 1IVYA 5BRNA 1DTEA 1GKYA 5A0VA 1GPJA 1R6VA 1HSOA 3HXTA 2AOTA 4EEKA 2UUAB 1NMSA 5FF9A 4F7DA 4LF5B 3VC3A 2XODA 1WDLA 1YKFA 3V80A 1DAHA 1SOWA 1TYBE 5AUQA 1I33A 3DDHA 4U9UA 4YXFA 4CM4B 1D2RA 2CXPA 1JHPA 2O8VA 3GFTA 1L8XA 1XRQA 3NS7A 3INYA 3FE2A 4EYQA 2C7RA 1OV4A 1G63A 3CUYA 3NO4A 5ESWA 1WKBA 4GNKA 3HA3A 4JBXA 4Z7NB 1FPMA 1C29B 1JYSA 1DHRA 2OR3A 3W9UA 3QKSA 1VE5A 1P74A 1E8NA 5LWQA 2O0KA 3DL7A 1QGZA 2DFKB 3QVSA 4XQ0A 3DOUA 4COOA 3CY6A 1XA4A 4QG7A 4QOGA 2W00A 1WNFA 5CBPA 2VJKA 1LNQA 1J9EA 1P2GA 3EY4A 4KIJA 2P40A 2H3HA 4QXRA 5JWOA 3ZCXA 3OETA 4MWCA 2YDXA 5TS3A 4H18A 1ZIDA 1M72A 2CJWB 4BQOA 4O1HA 1ARZA 4S1VA 3H65A 2X41A 3E53A 1WCIB 3NXKA 4L8WB 4XA8A 3SKVA 3SHQA 2C5GA 1GKUB 2C5BA 2W2MA 5T41A 2PA0A 1W36D 4E7OA 4OOFA 4XASA 4P3KA 2JBAB 5FOUA 3AUJB 3RAJA 1SBNE 2P9QA 4INAA 4JIMA 2X1LA 4ABTA 1Y3CE 1X70A 3HU1A 1FQJA 1QK4A 1Y9DA 2PK3A 3EXHC 4NXMB 4ACAA 1M6VB 5DHQA 3A9UA 2P75A 3QUBA 2YJZA 1ID8A 3AR3A 2EW1A 4OH7A 2FOXA 1US8B 4GOOD 4LHYA 5J43A 2YWEA 4HUQA 3QVLA 1QYVA 2QQFA 3G9XA 3PVZA 1P19A 3O3CA 4V0LA 3U1VA 4DEYA 3JQ8A 1GL6A 5DPMA 1T1SA 2BMAA 2IFTA 2W0MA 3JQBA 5DNAA 4BN4A 1F2TB 1F8XA 1U2PA 2DWQA 5LFAA 3THXA 3TFOA 2WF9A 2A14A 4MEBA 1Q0SA 1E58A 2J31A 4BJHB 2M1XA 5IFLA 3HDYA 1XJ5A 2FMXA 1FFXA 2OZEA 4GE3A 5BR4A 5JNRA 3AHCA 2FX2A 5BNFA 4BV2A 1RADA 3CC8A 1MQ9A 1A71A 4YVFA 4CKEB 3ZHQA 5DEIA 2GH1A 3P9RA 1ULHA 2JPDA 4RAOA 5KTYA 1UM9A 3R9XB 4IEEA 4JEIA 3B1XA 2F43A 3BTSA 4M1SA 2RHOA 1O9HA 1Y82A 1KYYA 2VJYA 2QP9X 4LZPA 3TZBA 3UHJA 5K99A 2Z43A 1OY1A 4W8OA 4XQEA 4DC0A 5C8VA 1B4DA 4IJWA 1ODCA 2I3DA 2NO5A 2NT3A 3BG5A 1SBZA 3GEEA 5E2IA 2RB4A 4DFDA 1VHWA 5AK5A 4DR5B 4Q3CA 1RI2A 3B2EA 4HPXB 2FW8A 4B6PA 1KHHA 4P4UA 3NVKI 1AC5A 5KPDA 4Q9JA 1Z6TA 3DG9A 1XRLA 2RGXA 3AI7A 3L43A 2A35A 3ZDEA 4YRZA 4Y2XA 2QZSA 4Q7JB 2NZ8A 2FPUA 1OC4A 2IRWA 2ZTHA 2HAEA 4Y1GA 1T2VA 4LCBA 2YHIB 3UJPA 2I3GA 4FYMA 3A3PA 3OX4A 2B6NA 4FLEA 4OSOA 4EHLA 1UJMA 3HXOA 2V9ZA 1U2GC 1NRXA 2VNSA 4EQ6A 2H17A 3I28A 3D4OA 2YXDA 1LH0A 3AIKA 1M0TA 3K53A 3GEGA 1JHYA 3C74A 4UZFA 1ML4A 1P7VA 1BCSA 1PZHA 1T8YA 5K3OA 2HH9A 2BMFA 4C20A 1X2EA 2WV9A 1M34E 5BWCA 4OBEA 1TIKA 2DWUA 2IZOA 1K8QA 4C0KA 4V1CI 2ZZNA 2XDAA 5LDGA 4C89A 2O7SA 2PSFA 3S1AA 4J76A 4ARZB 4HEA1 1PEDA 2IBMA 4HWKA 1C7IA 2AA3A 3CSDA 1V9SA 3IAXA 3R2JA 1B0ZA 3CNEA 1OFTA 2H06A 4ZT4A 3G9TA 4RJIA 1I51A 3R6WA 5LPNA 3SC6A 3EFOB 5D51S 3ELUA 4ZD6A 3CLTC 3EVZA 3UQYS 4CLXA 4BTLA 1JUDA 1Q83A 2EERA 5F9HA 3MMPA 4BMXA 1FRNA 4B0PA 2FE1A 4TXHA 1JTEA 1VBFA 1PDWA 2PX2A 3ASVA 1TZJA 2O0MA 3IP1A 4G4JA 2G4CA 3C5CA 1ADYA 1C3OB 2ARKA 4MQFA 4X85A 2H4ZA 1TF5A 1RWXA 5K3SA 1HMPA 3HWSA 4KQJA 4QBGB 5F5XA 3TB4A 1ULUA 4ISCA 3A2MA 3C24A 1Z4OA 5JY1A 4DDWA 5U9CA 1NI4B 3MJCA 1VBMA 3U6BA 1WL8A 2ZR7A 3S4YA 3WKDA 2IYPA 4OU5A 4FOPA 2EZTA 1YA4A 2VQ6A 3FPFA 1BVYF 4Q4DA 1RQ2A 4UM8B 2HSDA 3Q12A 1VKZA 1ZD8A 3BIJA 3AVWA 3UWKA 2CLDX 3CNOA 3WGLA 1V41E 2JK0A 2XKBA 5BR7A 4AT1A 1FSZA 4MR9B 4RGYA 3ADDA 2X8JA 3AKDA 1Q0RA 1UZLA 2PH1A 4IXTA 1Z4NA 3PRKE 2XADA 1VDZA 3PBKA 3V5NA 4AKEA 1VCOA 3WJ2A 3PQ6A 2V4ZA 1GAEO 5PGMA 5HIMA 1IM5A 1BA2A 3EXHA 1BX1A 1WG8A 1DOZA 1K06A 3IVAA 4H6WA 4QWMA 3TPCA 5A3JA 4INOA 1VE3A 4IW3B 3JTMA 4KODA 5FL3A 2I2FA 2I7TA 2BLLA 2OFPA 1DBSA 2UYQA 1OAAA 3BJEA 3PGLA 4MB6A 3SBXA 4M22A 4FFRA 3TZEA 1DO2A 2ZS7A 4KWIA 3TIVA 2KWIA 4PC7A 2IYLD 2GWRA 3HS3A 5DH9A 5K3AA 5TF4A 4EO4A 4XIFA 1E2DA 5CMLA 4J6EA 4XW2A 1BMQA 2FP4B 3DWGA 1GPH1 5IF3A 1AUVA 4J6FA 1XRRA 2F8LA 4YN3A 2VYVA 1ZM9A 4ZREA 1C9MA 3DCJA 3MRVA 4H3KB 4ECEA 1XEXA 4PRKA 3MHTA 3RVJA 3IEPA 5F77A 3SIWA 1AMOA 3GB9A 1CS0A 3U81A 4GWGA 3PE6A 1JNXX 1U98A 4MWTA 3I1IA 2JGFA 4G63A 2QTTA 5I7FA 1IY2A 1P2VA 1TUEA 4FWBA 2PMDA 2QRZA 3C98A 5KS2A 3VSEA 1FIUA 2C4KA 2BEUA 2ZAGA 4HAIA 3A4NA 3KZOA 5FBLB 3U40A 1SVOA 3VYSB 3BL5A 4MSUA 1C41A 1RTKA 4Y98A 1CRWG 1PT6A 1I32A 3DTVD 3OO1A 3PDIA 4LVNA 4UFOA 3ZZNA 1OPXA 3RBZA 3ZE1B 5C1DA 3O8RA 2M2IA 1V8PA 3PHGA 4AG3A 3W5IA 3R20A 1YZHA 1NY6A 2DKOA 4PHTA 3VXKA 1ZUNA 1E2IA 3M1AA 1N6IA 4YQEA 3U2QA 1BYIA 4GP6A 1HO3A 2FQXA 1Y34E 4Q3LA 1NE7A 4HV4A 3A9CA 3TOCA 2KPOA 2R1TA 1EFRD 1H2EA 2R5NA 4UDOA 4ZU6X 4LDJA 3QLVA 1JPVA 5CJJA 3EA5A 2BFMA 3VA7A 4MVCA 4GOKA 1KO8A 1CVLA 1R88A 1BXGA 4J1SA 3EQ2A 2GYWA 4AYTA 4MA4A 2OLJA 3QU4A 2IYUA 2YIDA 3CTMA 2ZCJA 4NKRA 3RKRA 2FGJA 3WYEA 3ZK7A 3WL8A 1I6KA 2QD1A 4KL8S 4LRYA 3SQDA 3VZDA 2GXQA 3C1TA 1PS0A 1B7GO 1YXMA 2PD6A 5FEUA 1VQ1A 1IOLA 1U2GA 3T7RA 3TI9A 1E2JA 1J7KA 3PFKA 4YAKA 2GRUA 2QG6A 2UKDA 2GUGA 1LBHA 3M2PA 1NATA 2PMBA 4WZBE 3M49A 1PJQA 5CFOA 2JIPA 5KNBD 5C8XA 2G5TA 2MSEB 3QKSB 3KLBA 3F90A 1L5FA 1XCLA 2C99A 2UVPA 4V39A 3U49A 2VS1A 1OOEA 5DNCA 5MHTA 4NAVA 3VBCA 2ZATA 2CHQA 1E3WB 3JARB 4L3VA 4GKAA 2VEOA 1NQ5A 4PFJA 4PAQA 3LTEA 4AJ4A 4EHKA 1JIQA 4B6FA 5CBPB 4OB7A 3SU8A 4P4SA 1N1EA 2IXFA 2PGXA 2XUZA 3AYZB 2CE2X 3GGPA 3QMMA 4JU9A 4MAMA 1FSPA 1R6UA 3MB5A 1VDMA 3GRYA 1C3XA 4Y1RA 3H11A 4FE3A 4Y30A 2HA7A 2QXYA 4IZ6A 2QRGA 1L5LA 2EDAA 4OREX 4C03A 4PCLA 1XJQA 3OJEA 2JIBA 3K4QA 4RKFA 5L45A 5DISB 2PQ2A 4FSXA 4TL8A 3V1NA 1F38A 1FTSA 4EM6A 3IDZA 1L4HA 5ALEA 1EDDA 5EJ4A 4PPNA 3DDOA 3CIOA 2BHRA 4IMPA 4TTIA 5DW3A 3OZ7A 2QL6A 4M9XA 5IMBA 1Z0ZA 5HF5A 1SVSA 1X8JA 2BFBA 1ZRMA 2GYYA 5HMMA 3RU9A 2RBEA 2YYSA 1XKLA 2AUTA 5EPOA 4ALNA 5IRCD 4I08A 2PGDA 5AQ1A 4KAXA 4DBZA 2CUZA 4NZMA 5KJEA 4RSGA 3U3RA 2EP5A 3ED5A 4E2WA 5JNVA 1U5AA 2F7SA 5ARDA 1TM5E 4HUQB 4KN8A 4F1WA 2Q27A 4IS2A 3L5OA 4DG5A 3RFVA 5A05A 4GBJA 1EUYA 2YXPX 2D62A 3A31A 1SKAA 2YOFA 1OCEA 4LJ6A 3CPHA 3MIZA 2DVMA 2Q5JA 2XIJA 5KYXA 3A3OA 5EUCA 1OT5A 3BMQA 2NUAB 2GDZA 1AM4D 1A7JA 1KP9A 2MMCA 2ZJ4A 4PNPA 4YDRA 5C18A 3KKNA 3K73O 3KLNA 4RYDA 5AFSA 4UVDA 1GYPA 1TM4E 1FC0A 2PNFA 3JTEA 1FFXB 4LOHA 3ZJTA 2A9QA 3FFWA 4K03A 1KEPA 2V0GA 4DB4A 3EPHA 5K8TA 4H1VA 3O1JC 5K9ZA 2JHFA 1L4NA 1P17A 2CNKA 2Y1WA 3NRBA 4IXDA 1D4AA 1S3FA 1IIBA 1VE6A 4MV0A 5E38A 1KDZA 4EFDA 2JLYA 1RP1A 1SG9A 4IUDS 4QBKA 4RACA 2QU8A 4CCWA 2QXTA 1Q5PA 1Q77A 2BHTA 2F43B 1NXVA 2VG8A 4E5UA 2ATCA 1KYVA 1YBVA 3LH5A 2WFLA 1NT4A 4G89A 2BC9A 3H2YA 1P2TA 2X23A 3BH6A 3CEHA 3R6TA 5IC6A 3U7QA 5D5PA 5HQ3B 4N40A 1YZGA 2H31A 4C3OB 1N5JA 5JIBA 3ISTA 1G2IA 1GUYA 3DULA 3NYWA 3OLVA 1NR1A 1EDEA 3B8HA 2C2HA 2XUOA 2CK3A 4UEOA 5FTLA 4O4IF 5A0FA 4NX2A 2E82A 1G6Q1 1IN5A 1UKBA 2HBZA 3BMNA 4LC0A 1G5RA 3H0EA 4MIEA 4YLEA 3TZHA 1BZYA 1KK3A 1ORRA 3ZD6A 4BO9A 2G4LA 4O6VA 1U4SA 3UMGA 1Z37A 2PXHA 3UGTA 3QKRA 4DAEA 5BUCA 3QX7A 1G8YA 5A7HA 3FCOA 3GLIA 4GR4A 1L7EA 4NHOA 5I4KA 1ZK4A 3C4VA 3HACA 4IG4A 4OG2A 4ZK6A 2JFFA 1ECCA 4R68A 1UINA 4H7EA 2B8WA 2VTVA 1PNQA 1KKUA 2I4RA 2ZT6A 3L04A 3LK6A 3E7DA 4KPFC 2LVBA 3W4JA 4MRVA 2J7PD 1I3LA 5ALFA 2P7HA 4YX9A 2C61A 4ENVA 1EUQA 1YR6A 2XNDD 2FOIA 3FLBA 3IHTA 4ZYWA 3BZBA 4ANFA 2J59A 1P1IA 4WL0A 3TLCA 1XNJA 5SZKB 1XZCA 5CLGA 1P0IA 2VJAA 1QHYA 3TX2A 4C05A 2E4AA 4R6WA 3HHEA 2A5JA 2O2EA 3COPA 5EQJB 2JKVA 5FLKA 3EYWA 1PWZA 4EVIA 3Q2KA 1IXRC 3CRMA 3EGCA 2B21A 1RTTA 4URVR 3TD2A 1UXHA 3GP5A 4WN9A 2J3MA 2OHJA 3FPEA 1L4FA 1MX1A 2VBCA 4PC3A 3F0TA 3JWIA 4NZOA 5HKOA 3PQ7A 2C5AA 3U39A 1PFUA 3SR3A 4EKIA 3JV7A 4MICA 3WQRA 1OBHA 4RV9A 2WSSA 3FAZA 4OQMA 4EA9A 5AM2A 4AY5A 4O4LF 3BJIC 1RZVA 3HCFA 4J0JA 4EJ6A 3AL3A 2ZJBA 4MQFB 5T3YA 2H0RA 4JZKA 4WXYB 4FGSA 1F9EA 2EFDB 4B4WA 5K8LA 2VRWA 2RC6A 1UWCA 1FQOA 2VRCA 4JLKA 2SECE 3TCNA 4D8TA 3I05A 3NHRA 2P9FA 4UEKA 1QYIA 1NSFA 2AC7A 1THTA 2ZDGA 3D8UA 4R41A 2FMIA 1RRPA 2NSJA 2Z1MA 2GMWA 5CLHA 2FPWA 5I4IA 5E9QA 2ZRNA 1K8RA 5LXTF 1JEOA 2WZDA 3T7AA 4DLYA 2IEAA 2PUWA 2R7KA 2WJPA 4GGOA 1O94D 2WSYB 4QUGA 3T3EA 4GVLA 3N2KB 3K6KA 4RIFA 3BHMA 4N47A 3PUZA 3EUFA 2CHGA 1K5DA 1Z0IA 4DLTA 2Z6UA 3ZDZB 1CUZA 1ORIA 3K0SA 3PVCA 2FQ1A 1OXXK 2XOKA 1JIUA 4LBYA 3RABA 1LFAA 4RMNA 2HQBA 4F8JA 2FFHA 2NPFA 1E7QA 4TKMA 4QGAA 4OYLA 4QGBA 1YTUA 1JSLA 3P0HA 3I62A 1XZNA 1BC5A 3OFVA 1W5FA 5CNJA 4TT8A 5A1TA 2WRZA 3FSGD 2MSCB 4K46A 4BYGA 4QM7A 3CVOA 3FJOA 1DAIA 2H4FA 4DV0B 1TZMA 1T36A 1GV0A 3KZXA 1DFGA 2BFDB 1ZKDA 1PT7A 2ZE6A 3FPGA 3QU2A 1PNRA 1GJRA 4MV7A 5F2NA 3IIEA 3JQ6A 1BHO1 3N76A 4PFSA 3TIXB 5CLFA 1XEXB 5A7GA 4GXRA 4ABYA 5CB4B 1VMDA 2VSNA 4MI3A 1W52X 1CS0B 3SXUA 4D2IA 4KTVE 4ZI2A 2C58A 1BMFA 5ALVA 1KR5A 3L7LA 5LBTA 3CZCA 2RBGA 3L7OA 2HRZA 3CKMA 4IUYA 4EVSA 2G1KA 5HP4A 2QJFA 3VZCA 2D7DA 2GR9A 4BMNA 1XTTA 3RF6A 5IAAA 1MOPA 4HTAA 1XMOB 2G70A 2QRVA 3PDIB 4P38A 4RY8A 3L9XA 1E2EA 1GARA 2DETA 1KYTA 2AXEA 2X76A 2CEKA 3LPAA 5I9IA 4H7PA 1JIJA 2C9BA 4BIIA 1UL1X 2B2CA 2C5HA 5F7OA 4WKNA 3E9CA 1TJPB 1RABA 4P3PA 1I7SB 3U56A 1NBAA 1FYWA 2IW1A 5CIWA 4WCDA 5CB8A 4CR6A 1XI2A 3WGVA 4CLEA 5HRAA 4HFRA 2Y4OA 1RXYA 5GJCA 3RT9A 3VJMA 4G0VA 1XDUA 3FRHA 4GEKA 3W8RA 3VR4H 3CSUA 1R3UA 4IHQA 1E3TA 1ISPA 1XHEA 3OX1A 4ZZ1A 1N2JA 3DJYA 4PZAA 4QJBA 1JFSA 3F67A 2C0PA 3KUXA 4EECA 3QVGB 2GAJA 4M8NE 2O8FB 3WK7A 3CUKA 1G0OA 1D1TA 3CE9A 3HCBA 4LHEA 2JZOA 1SXJE 5ALWA 1UAAA 1Y3AA 4ZYVA 5DWDA 4LKRA 1KZ9A 2B0CA 5EJ2A 1R6DA 3TPZA 3SM9A 1OW3B 4KLNA 5JD3A 4DPMA 5K5EA 2AQ8A 5JC1A 3PNPA 3U0VA 2R6GA 1RAHA 2XMPA 3E0XA 3GVIA 3LFTA 4DR1B 2OWDA 1JKIA 2XQVA 1XTUA 2UVPB 3SMVA 3RB8A 1PFKA 4IKPA 3ZCTA 3T35A 3WIEA 4RHFA 2GHTA 1KI8A 1NM5C 2EG9A 1GTZA 2DQYA 2P3QA 4XDGA 3WLRA 4ZVMA 3ADCA 3IV6A 3ZZ1A 1M8JA 1IBMB 1LJLA 4P4SB 2ONJA 3SVZA 3O31A 2IY7A 4YHHB 1IQPA 4LPKA 4QPZA 4Y1RB 3H11B 3LC1O 3THYB 1I1HA 2BGKA 2PUEA 1W76A 4HWGA 4CM9A 3ZEIA 3ENZA 4P7FA 1G3RA 4CQJA 5LQRA 3W6NA 2JD2A 3ABIA 3I58A 1VA4A 4GT1A 4I9UA 2H2AA 2AH5A 2OGSA 3DMRA 3L40A 1EXNA 3REOA 1RXWA 3UYKA 2NUBA 2Y68A 3DFIA 1WCV1 1WSDA 3F3YA 4K86A 3RRBA 2P5YA 2PJUA 3I8XA 4MV3A 3VR4A 5FBVB 1ZYUA 2JFPA 3OIFA 1EX7A 2BFBB 4H7DA 3W5AA 3R74A 1CEEA 1CHDA 3LBYA 2VNIA 2PO7A 3FMGA 4QA9A 4B87A 5EOVA 2QK4A 3FYUA 3CH6A 2VJBA 5ETJA 2COEA 4MHSA 4OLJA 3D6MA 1T8RA 1A82A 4M76B 1G60A 1PJBA 2ZULA 3E9DA 4LI3X 4NYJR 5HTKA 1II9A 1XAGA 4IKEA 4NECA 3WTCA 1Y1LA 2FUG6 2BSXA 3W8DA 5KYXB 1OC2A 1KVQA 3GDOA 4XWWA 1LDBA 1KJYA 5CCXA 2FG7C 2B3DA 4UHDA 3L4KA 4B2YA 5IU6A 3DXFA 1SWVA 1GFWA 1ZK1A 2GLUA 3Q11A 1UBGA 2AKYA 1NMZA 3C15C 3DBVO 2I6XA 2LCQA 5ADVA 1MHTA 4NBSA 5A2GA 4R8LA 3D4LA 1YNSA 4DHEA 3I4FA 3EYAA 2HU8A 3VM6A 2IA5A 3ZD9A 4DCCA 1FFYA 4P5PA 1CDDA 4ZO4A 1NURA 3ICOA 3W5HA 1QRUA 4FYKA 4TWBA 4REQB 5DRTA 2Q7OE 1AX9A 3E84A 3OPMA 3FB4A 4Q47A 2QQ0A 3CEJA 4D7AA 1SXGA 4JBWA 1POWA 1X8KA 2O0LA 3IEXA 2I8AA 1A0OA 3BTUA 4YV2A 5FAKA 1NV8A 1USWA 2I7VA 2ZFUA 3KE9A 1EWYA 2QM0A 3U7QB 4D43A 2ZVDA 3W90A 1W35A 1NF3A 1R0WA 3F2VA 1JA1A 2HI0A 2P62A 2IS2A 4JLAA 3QUTA 4MUGA 3E5RA 4B3XA 5K0EA 3WK5A 2BY4A 3TRFA 4JHXA 2J5KA 5A5DA 1A04A 2IYAA 4BC1A 1S1CA 3U4AA 3N2LA 2DLDA 2WG0A 1SG6A 7MDHA 3GJSA 3M7IA 1Z7BA 4V1CB 5M2QA 2PSJA 2DE0X 5JI3E 1H9AA 2RDMA 4ZEOA 1BJKA 2P9YA 2JGEA 3HKEA 1I13A 2QLLA 4WLFA 4ZQEA 2JRLA 1IB0A 3A06A 1PX2A 2J3EA 4GD3Q 4LRTB 1U5CA 1ZO8A 3TIGA 2FOLA 3UGKA 4JENA 1ZSVA 4XE5A 4HTFA 4QFCA 1YRYE 3NGLA 4IDQA 2PEZA 4OM8A 3V7FA 3VTZA 3BFXA 1WCXA 2A0WA 2WHEA 1DOHA 2UU9B 1P5FA 2ILTA 3BREA 4DV3B 2QMYA 3LOQA 3P8ZA 1AHHA 2XTNA 4II2A 3F8TA 4XAQA 4XTRA 4GPBA 3CBGA 5TIIA 2BR3A 1JX6A 4BLQA 2AHRA 2D2VA 3I0NA 3T12A 3USZA 3W5DA 3U4QA 4E08A 1FQKA 3BQ9A 3ILHA 3BDAA 4Q6BA 4RWEA 3ZNOA 5DSTA 2IU4A 3VJRA 2GCOA 2GTHA 2LKCA 3HB4X 3I01M 4WN9B 3P9SA 4PSDA 1QCDA 3R7LA 1QVAA 2E5FA 4IRXA 5LQDA 4NH0A 5C3UA 2FCAA 3WGTA 3OA0A 5C52B 2CFSA 5TRTA 1ISGA 1WPRA 1SBTA 2ZRJA 3KLOA 5DRYA 3UMJA 2I3BA 3B1FA 3U09A 3D5QA 1NJ2A 3Q85A 3RJ9A 3HVJA 2RGEA 2XRZA 2PKQO 4G86A 1IM8A 1G1MA 2A92A 2JI6A 4FS3A 4JFRA 2XRFA 2VHYA 4ZVTA 3UKJA 5FX2A 2J3LA 3G8CA 1NM5A 1UADA 1W2GA 2H85A 4JC4A 2XYQA 3RV3A 1GFZA 1O6BA 3ZC3A 1RBQA 1YS2X 2UZ4A 4EIWA 1ZY2A 2NM0A 1RJFA 2EBWA 2YJ3A 2ABWA 4ZCIA 4L5BA 4V0QA 1YHZA 4F4HA 3NP9A 2GD0A 3B20A 3TQRA 3LF2A 3VO8A 3KYBA 1JIIA 2H16A 1U1CA 3KQOA 4XCQA 5DM2A 3AG6A 1VZ2A 3L05A 3S3TA 4UARA 4BWVA 3NP7A 1AKQA 3ASYA 3Q10A 1OD6A 2O2SA 1U81A 2PKEA 4MLPA 1XZQA 2ONKA 1ZUWA 1N3YA 2X14A 2VPXA 4OV6B 2C7QA 1V48A 1E79D 2E1PA 4MW7A 5A4DA 1FDIA 3KOOA 1PR2A 4DMFA 2B4AA 3CN9A 3NFRA 4IQFA 3AEUA 3B6MA 4JIGA 3A1UA 4K05A 1DIAA 1T6YA 3PXBA 4XGNA 1I7QB 1EM6A 3LL7A 4A7PA 1C3EA 2JDIA 1P5HA 3B89A 1SC1A 4RVFA 4CIAA 5LJLA 2AJTA 5B1SA 4UEQA 2N3ZA 1TI7A 1L7DA 1GR1A 2GWHA 1MXFA 3IPYA 5FDFA 3A6GA 4ZJPA 1DTWA 3B7WA 2F00A 3LS2A 3RM3A 2CHUA 3KT3A 1RWOA 1YZ3A 2UUBB 3IULA 2UUPA 1J00A 1E2QA 3LUFA 1E4YA 1XTVA 3O3NB 1E4EA 1F12A 3AETB 1C1HA 5DHTA 2A0UA 1AKTA 4L5CA 4US0R 5B1DA 3N8IA 3SXUB 2XKKA 1BW9A 2POCA 4F9TA 1GCIA 2ACEA 2QR3A 4UBJA 4CJXA 1AQYA 3R6LA 1VKHA 1T4MA 3DHYA 4ZVLA 1GNLA 3DV2A 3L6DA 1AKYA 3IBTA 2HGZA 3QYFA 1QIDA 1PRYA 3NBYC 1ZD2P 3P9XA 4ZVNA 3G6KA 3TLZA 3WICA 3MCZA 1ONNA 1S2IA 1L4YA 1NJFA 2QRVB 3PUIA 3QE2A 1XU7A 2HTFA 3I9JA 4GL4A 4MW9A 3OCZA 2LD4A 2WMOB 1OMOA 3V9PA 5JZMA 4TUYF 1H0HA 4FQ7A 2VFAA 3PXAA 5F76A 1NVUQ 4QPDA 3TR0A 2CJYA 1G19A 2NXJA 3DKVA 3SFTA 3D6VA 1GTMA 2HBQA 3FMFA 3JD4A 3L7IA 1NFRA 2I8LA 4RTOA 3UK1A 4Q4AA 5BYKA 2WVGA 3KHTA 3EW9A 3EZLA 4IWXA 2B4YA 5FQNA 5BVHA 3RYHA 4EKYA 1Y1PA 1YQWA 5CH5A 5LYJA 2QAGC 5LLDA 2OY0A 3ND5A 1F5SA 4IGIA 2AMYA 4DUGD 1KO5A 2P65A 2PKXA 4Y6LA 4TVKA 4LF4B 3IT3A 1OYWA 4LFBB 2VRBA 3JAWB 4WGGA 3Q2IA 3D54D 4EZBA 3NHSA 3UMFA 2Q28A 1SPXA 2FFAA 1J1IA 4FW9A 4I9HA 1AHPA 1NMQA 2C42A 4BX2A 3PQDA 4G1FA 2V3WA 2ZJ7A 3MWEB 2AHOA 2G9UA 5BN4B 1JWAB 4J8PA 3TLMA 1CF4A 2JGNA 2BD0A 2R8XA 2YWBA 3ZUPA 3HXQA 4JR2A 4O4JF 2CLIB 3FHJA 1G8FA 4MW5A 2FY8A 5AOBA 2AE1A 2PBRA 2ZSJA 1T8SA 5HIKA 4PZYA 3U61B 1SOAA 2EIXA 1E1RA 3GARA 3DZHA 3IXLA 1AUPA 4YFYA 5D87A 2IV2X 1YMQA 4K5QA 3DHVA 1XWWA 3E8SA 1GPMA 2B36A 4KO2S 4HS4A 4P92A 5BMVA 1B0PA 1QP8A 2A1TS 1Z2DA 1RZ3A 3GUZA 3R40A 5JNLA 1P7WA 4P32A 1HWYA 1G8SA 5FLYA 3KLPX 5FL7D 2B99A 5AKIA 1TTHA 1IIRA 2ZQYA 4AZVA 5EIEA 2I1VB 1ZMTA 4CDNA 2WR8A 2D0DA 3MA0A 3NOQA 4CCSA 1DBVO 3IBCA 1QDLB 1AY0A 2I80A 2IUEA 4EHBA 3RBAA 4Z7QB 3DPIA 1CVIA 4W99A 3AT1A 3H1FA 1MLDA 3BWVA 1HLGA 2AXQA 2P2SA 3HBAA 2ODPA 1TO1E 3L4JA 5FB3A 1PJAA 1KVRA 2CEAA 4NICA 3V3TA 4S0XA 1QGAA 4K40A 4OL9A 2JIOA 2KM1A 2QP4A 2OCKA 1J6UA 3MMXA 3FUUA 3LQ4A 2XWJI 1YZYA 4XKJA 3ZY3A 4XVCA 4ZOQI 5C8ZA 1M33A 4TS4A 1CNMA 1ZS9A 5AP9A 3FYUB 4JQOA 2X7XA 2XHZA 3QF7A 3T4XA 5ADWA 1ZQ9A 1NN5A 3LCVB 4YI5A 4ZTZB 5IDXA 5G02A 2XJ4A 4RJ2A 1LVHA 3BRWD 4TL7A 3HO8A 4M1TA 2Z2IA 4GE0A 5BQXA 2PZMA 4OMDA 2M9MA 2OYRA 5LOVF 2HWYA 3PC2A 4BX3A 2PGLA 3I0MA 1ZJZA 5CLQA 3NC4A 5BSHA 4QZVA 2QZJA 2DP4E 1X87A 5FPHA 2V6MA 4NJOA 3R3YA 2H1IA 1QR2A 4WOBA 1RKQA 5BSUA 1EVJA 4Q0MA 4MUJA 3BM5A 1JQKA 5DM1A 4YJHA 5ICMA 1D2HA 4ZQCB 5K4AA 5LP1A 1U3TA 2AK2A 2GJKA 4UASA 3AXSA 1NIPA 1EJ0A 3Q7IA 4HC4A 4HQNA 5FCDA 4B9EA 4DJDC 1A50B 4LBZA 4Z8YA 3OE7A 4L74A 4YR9A 4I36A 3N6XA 1TD9A 4WE3A 5EQTA 3RK0A 5HJ7A 1Y1KE 1KEWA 1IZ8A 4BECA 5BSTA 2DB3A 1G7SA 1FTYA 1DCFA 1SXHA 5CVDA 4B5LA 3FFBA 4IJQA 4ZI7A 5KHOC 2H7VA 2XUAA 3ITEA 1G7CA 1PQ4A 3UT5B 1Y6QA 1RIIA 2C7VA 2P7IA 4GYWA 1AUOA 1G3IA 4PYNA 2WHPB 5A5GA 2ZPUA 2GEBA 4E31A 2FG6C 1DELA 2WTNA 3ABOB 3G02A 3N2IA 3VR6H 1G4AE 4QHTA 1VPLA 3MINB 4HQFA 3BCHA 2GXUA 5DI9A 2EX4A 5J2TA 3U4MA 4LWQA 2GPJA 3ID6C 4BWGA 4JFAA 2BEVB 1DAMA 2BI7A 3E05A 3QVKA 2QY9A 4R3UC 4FIZA 4JJIA 4MS3A 1IRIA 3D6HA 1ZR2A 4RZXA 1TYAE 1CULC 1B43A 2QG4A 4HTFB 2ZM6B 1XLTC 2ZWAA 5C35A 1M75A 4A6PA 1U2RA 1UFKA 1V5GA 1ZUHA 2DAPA 3EMVA 3FIUA 4X1IA 3IMCA 5CYOA 1GU0A 3ED1A 1YOBA 2JI9A 3G2PA 2QAGA 3SJ7A 3T1OA 3BOSA 4U3JB 2FN7A 1KFJB 3MIIA 3QKTA 5GADl 1FNBA 1WMEA 4ENQA 4AF8A 5KO2A 2NV2B 3Q8XB 2GK4A 1GOTA 1NNUA 1E0DA 2Q99A 2WICA 2Z3ZA 3AOGA 2H65A 4MTLA 3ZQKA 3U4QB 4M1KA 1VHDA 4DM4A 4LN1A 5BRAA 3H6KA 1KU6A 3RIXA 2Q8QA 3ZHRA 4N3AA 5EJFA 5G4KA 2WM9B 4WHMA 4BLPA 1PG5A 1QO9A 3O8QB 3I04M 1S6YA 1JHMA 2PXAA 3GZ4A 3HJGA 3B51X 4QYMA 5EVCA 1JLKA 1H1TA 1P8JA 3QJGA 2JGLA 2XUFA 3CF4G 3K15A 5FPPA 5AXAA 3WJ1A 4A3SA 5B5SA 1QAMA 1K8XB 3KYCA 5JAIA 1WUTA 3NEJA 2WUDA 1V4NA 2O5EA 2ZYAA 5CDHA 1O5IA 1IH8A 2F3UA 4R2WA 3DKIA 4XM1A 1Q0HA 3AC0A 1XU9A 1KI6A 5LZ7A 3RIMA 1EXVA 1PWYE 3SQWA 4PSAA 3EEIA 1WIWA 1PSDA 1FTWA 4JC0A 3ZPXA 4BB6A 1EB9A 2GHQA 2CVZA 2VPWA 4Q4JA 3KJFA 1NC3A 4FDVA 1R6BX 4LYGA 2PGNA 3RIYA 1NJ8A 2HJHA 1B6GA 5DGIA 1R0LA 4JB3A 5FUXA 3EFEA 5HF9A 1UJ4A 4NBWA 4DQLA 4PCAA 5IEBA 2OMKA 4XD7A 3GJRA 5CT5A 4FYJA 3AEUB 3WL4A 2BF7A 3FMOB 4OLBA 4C5BA 1O0CA 2A67A 1ORDA 1CIJA 2C9DA 1C1XB 3DE3X 3CUWA 2IYOA 3JAKA 4UBKA 5LUBA 3UEOA 2BMVA 1P4AA 5HMLA 4NV1A 3RREA 4KZPA 1MENA 1S4MA 3OZAA 1LF0A 1YO6A 1ZP6A 2WKQA 2QGZA 3ETCA 1FVXA 4D5GA 1E0JA 5E8RA 1UJ6A 1K63A 3EWIA 4YRBA 1WZ2A 2XOEA 2H4JA 1I9CA 1LV8A 1GA4A 3W8NA 3BK1A 4ALLA 3IUPA 3ZWKA 2XKAA 3MJSA 4JUBA 1DTWB 1K6EA 3CG0A 4E2FA 5B4UA 1T6XA 4MS4B 4NJEB 1MBZA 1XLWA 2QPAA 2WWXA 3OZCA 3RRZA 1H4QA 3BA6A 4UAVA 3H1TA 4AUEA 2MR5A 3BD8A 2F3RA 4HDNB 2O8EA 2NZVG 4LFAB 5JXJA 3UJNA 4ZA2A 1RBMA