4LQDA

The crystal structures of the brucella protein tcpb and the tlr adaptor protein tirap show structural differences in microbial tir mimicry
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
144
structure length
123
Chain Sequence
GVDRWSKDYDVCVHSEEDLVAAQDLVSYLEGPGGAIVSELCQALSSSHCRVLLITPGFLQDPWKYQMLQALTEEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll/interleukin-1 receptor domain-containing adapter protei
publication title Crystal structures of the Toll/Interleukin-1 receptor (TIR) domains from the Brucella protein TcpB and host adaptor TIRAP reveal mechanisms of molecular mimicry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 123
sequence length 144
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13676 TIR_2 TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 4lqdA00
2JS7A 4C7MA 3UB4A 1T3GA 3JRNA 3UB3A 1FYWA 1FYXA 4C6TA 3H16A 2Y92A 4C6TB 5FORA 4C6SA 4DOMA 4FZ5A 2M1XA 4W8HA 5KU7A 5H3CA 3OZIA 4LQDA 4C6RA 4EO7A 1FYVA 4LQCA 4W8GA 3UB2A 2J67A 1O77A 4LZPA 4OM7A 2Z5VA
chains in the Genus database with same CATH superfamily
3SD7A 1U1FA 5TMEA 4JI7B 1Z5GA 3EVDA 5D3ZA 2BKXA 2VSQA 1E9SA 1X1DA 1NP7A 5AK5A 4FU0A 3FGPA 4V39A 5GJVC 2IYRA 1POWA 4AKEA 5KZMB 2PH3A 1PCXA 3PD0A 1XEWX 2OECA 1N6RA 3Q5EA 1IBKB 1HDYA 1VYVA 1ZCZA 1X7GA 2JHCA 2PCJA 1CUJA 3IDSA 3ND7A 3X1ZA 2EFEB 4G0UA 4CIYA 4C7OA 5CDGA 2EHJA 1E6UA 2XUZA 1R9JA 2I62A 3OLZA 4TRRA 2WUGA 2VWHA 5LN1A 1U90A 2LP4Y 5IFKA 1MW8X 3K1YA 3FB1A 3U60B 2WJ6A 4CKEA 1B41A 4IDCA 4V2UA 3D4IA 4FNMA 1SZPA 1UZUA 2FZ5A 4DMFA 1X3LA 2FR8C 3IDOA 3DFMA 4D81A 3IELA 4F84A 5JR3A 3H4IA 3F6PA 3JR3A 2DH6A 3RVQA 2WPDA 1WHSB 3QLUA 2Z2JA 4HF7A 3WK6A 4C7MA 1GSHA 4MA0A 1PL8A 3PXAA 2CLFB 2WFMA 4WBSA 1HT0A 4I50B 5I4CA 2OWDA 4LRQA 3DMTC 4AECA 3QELA 2GFHA 4XWKA 1AUPA 3VNBA 2KM1A 1I2CA 1J70A 3C7KA 5NULA 1DO2A 4MW0A 4DC0A 1H4QA 4MUIA 2PGDA 2QSJA 3D0QA 3IESA 4LBWA 2W6CX 4FIDA 4C0XA 3OZSA 4DSTA 5DX8A 4AF7A 2IXEA 3OM9A 3AERB 3E58A 2A6PA 2NQ2C 2H06A 1HT3A 3C3JA 5K4HA 3PUVA 3UYKA 3KYJB 3L1UA 4WUVA 3UPUA 2ADFA 3E22A 1S1CA 5EI5A 1XX6A 4I5FA 3MJDA 1NFFA 5FOVA 3IFSA 1OSNA 1CUVA 4KSBA 3D0OA 5DTJA 2PZ8A 3UJ3X 1LPNA 2DWCA 1VIVA 3OA2A 3IUSA 4GDMA 1ABEA 1Y8AA 2P30A 5GONA 4BKQA 1E9CA 4RZUA 5KSPA 5IWAB 2RE8A 2JVKA 4URUR 1N32B 3RAGA 1NQUA 1EK6A 4M1OA 5IT4A 3GHYA 4S1WA 4YMVA 3PYXA 4O4JA 4R9UC 2B8TA 1TJ3A 1NRWA 1GITA 2ZB4A 3FFWA 4OQYA 1W2GA 3AF4A 3I4CA 5CXSA 3EBOA 2XNSA 5ALPA 4NQZA 4YJ2A 1FB5A 4H7EA 2WUDA 4QVGA 3FCSB 2RGGA 4DANA 5C5IA 5AVRA 5KU7A 1IMOA 3B5IA 4RTPA 2IYTA 2G9QA 4E7PA 2XEDA 4JH0A 2OBXA 3T3DA 3USZA 4YQEA 1MFPA 1NVKA 3ZHSA 3D1LA 2HMVA 4M83A 1CR0A 4I1VA 5CG2A 4HDKB 3B9BA 1XK7A 1T3SA 4UEWA 1YK1A 3OU2A 4BLVA 3AZOA 3H5VA 2QKYA 5AR1A 1SKUA 4A16A 1EJ6A 1W1UA 2MSEB 4Q47A 3GDOA 4P80A 1N7HA 1GRVA 2E4WA 2FWPA 2PPLA 1NVAA 3AR8A 4MS3B 4NCNA 3H7IA 2VH5R 3SC2B 4KQWA 3IILA 1CLEA 5T8KA 4C6TA 1J39A 1JIUA 3OQVA 1ZC4A 4FHEA 3MOGA 2B0JA 4JLDA 3TLYA 5CAEA 2W37A 1VPEA 3O38A 4EHKA 2YNMD 2V9ZA 2Q29A 1Z0ZA 4FYVA 4ZQFA 2VZEA 1C3LA 1O2DA 3C6YA 2REBA 4N49A 1USIA 2EKZA 4LN1A 3UOGA 1YDMA 2G88A 2H92A 4A8PA 5JQGF 1B3RA 1P1BA 2ZJ2A 4I1PA 3R41A 3TPCA 4EF4A 3SKVA 3WLTA 4RK0A 3K0AB 4HCJA 2NW6A 4CTMA 2XQFA 3DF9A 3HU5A 1VE5A 3K8OE 4KVGA 5M5BA 1DO0A 3G9TA 4HAZA 3LGSA 3MGGA 3CPJB 2M6LA 4AJJA 4Z9AA 4KQCA 4D44A 4DM3A 3AKYA 2CV1A 3NTUA 2P6PA 4BNFA 1YC5A 1DJOA 3PUZA 2R86A 5A05A 3DQZA 5A4DA 1A9ZA 2DWUA 3PF8A 4NCXA 4C3VA 3RC3A 3QKUA 2AT1A 3NC0C 1OXUA 4MO9A 3MWLA 3R7WA 1T2VA 2QJTA 5J5CA 1YVDA 3RUCA 4IPTA 5MN4A 1E7SA 1N8NA 3HV0A 1HI9A 2PSFA 4FGZA 4LYAA 5CIWA 4LGYA 3RBXA 3T1NA 3MMSA 1RRGA 4PSKA 3VR5D 3SHTA 1IHXA 2FN7A 3C8MA 3INGA 3ILVA 4P3KA 5FUBA 2XB8A 1Y8QA 3ADOA 1P9LA 4OGKA 4RXMA 4EKEA 4UAJA 1K4KA 1N0WA 2G8NA 1E3QA 2AG5A 4U7PB 4OP3A 4UAUA 521PA 1XSEA 4EFMA 1BW9B 1RP1A 4FB5A 2PAFA 1M3SA 2RI1A 1QHIA 3GLGE 3TTXA 5HR5A 2BKLA 1PZNA 2JAPA 4YPOA 1G21E 3GLHA 3MJHA 4KITB 1JDZA 1XQ1A 2KJQA 3TLGB 3OIVA 2FF7A 3L77A 3UMSA 3SYTA 2ROQA 1AN0A 1QKIA 4CLDA 4MKRA 2FWRA 3LL4A 5KINB 1A8IA 3AW8A 1CT9A 4WBNA 2JATA 1P1KA 2X0JA 2AOVA 4DYVA 3ADDA 5IW8A 2SNIE 4KDRA 2QUIA 8AT1A 2JANA 4GX0A 3TIVA 3IOCA 1ZR4A 1ODKA 1P4HA 4OA8A 3TDMA 3ANLA 4G56A 3RS0A 2QIOA 2SECE 1SKBA 3LY8A 3A1EA 3LBIA 3PJFA 4ARBA 4FFWA 3ED5A 3C6QA 4MMYB 1QBKC 2A67A 1U1DA 3EUWA 1DC4A 5ITSA 1RYBA 3ZK8A 4JJEA 1E7YA 2QZ9A 3DBOB 2G72A 1CQJB 1FJ2A 1XP5A 4QYXA 4ZCMA 3HKCA 5EXDA 4EA9A 2P5YA 3QVKA 4RM2A 4CL8A 1S7GA 1T8RA 2HJSA 1IG3A 3OJCA 1Z5VA 2ODNA 2X9GA 3DUWA 2F3SA 4I4CA 1XWWA 3UPDA 3RUFA 3IBCA 3ZV4A 2CLHB 1R64A 1DTWA 4IHJA 1RYNA 1G5QA 3G9QA 4MS1B 4B7ZA 2R8OA 3L9XA 3R0JA 4RTLA 2V5UA 5K3FB 1Q22A 5ICSA 1EK2A 3AVUA 1KQFA 1VQ1A 5B4TA 5A4IS 2A5JA 5ALOA 4EYEA 2XDQA 4JOQA 3R4CA 3MHPA 3QKWA 1G2PA 5DDIP 2E5FA 3AF6A 1U63A 4OMFG 2CLEB 1GPYA 3LDFA 5IJ0B 4DMMA 3TMKA 3LUPA 4UE3S 2VUHB 4CDMA 3VSEA 3GLIB 4G0WA 3QLEA 2WW8A 2QTAA 3V4ZA 3KTAA 2RSLA 5FBHA 2XUOA 4BNTA 2QHXA 3QNWA 2AI3A 3OG9A 3PFGA 4U9HS 4N54A 4WLEA 4C5AA 2XYVA 3GFSA 3EPRA 4MGKR 1FQKA 1S3SA 4NG5A 3UK2A 4ZCTA 4XQ0A 3N8KA 5LUAA 1P1IA 3E1GA 1L5OA 2X0IA 1Z13A 3ZVKA 1U0GA 2A3NA 2A78A 2IUSA 2GPSA 5AOAA 1TA0A 1VHDA 3HMQA 4YCMA 5BSGA 4JC4A 5IUJC 5CCBA 3COJA 4F56A 1D0IA 5FPQA 4DLTA 4QJ5A 2PZBA 1E4YA 2R65A 2UXCB 3JCZA 1XQXA 1WAMA 4BV9A 4NECA 2Z3ZA 4Y30A 2EBHX 4QBIA 2ZSDA 3NBQA 3N5KA 1AZWA 3AY7A 4GI7A 4XE5A 3LTNC 5JAZA 1NMYA 2PQMA 3DGEC 4ZYUA 4INAA 1S4QA 2ZRDA 2D4AA 3BB3A 4Q1BA 4E31A 5LP6A 3MXTA 3JQBC 4LHVA 4MJ7A 3WE7A 2J87A 3G2KA 1C4XA 2IWRA 5D5HA 5DEIA 4HAYA 4E5KA 2E21A 5B7GA 4LYEA 3I23A 3KEFA 1NBME 1T2EA 2HQ1A 2BDEA 2Z09A 2A86A 1SD5A 3PCTA 2C0CA 3BYZA 3ECAA 3V7FA 3QEBZ 1KQ3A 1OBOA 2VBFA 4LOIA 4LXQA 2BKVA 2NNWB 3BJIC 3HU2A 3OFVA 3OWHA 4L3WA 1WQ1R 2B8EA 2GJ9A 4KOAA 4B3HA 4WN3A 1B76A 1ZNXA 2YXEA 4JIGA 4S1NA 4ALNA 4R1NA 1DB3A 5DGDA 1EJ0A 5BPFA 5KYUB 3UQZA 2PD6A 1HE3A 3CKMA 5IXYA 2N75A 1QO9A 3DH0A 3FZQA 4F38A 4ATNA 2TECE 3SF0A 1WSBA 3QTBA 4DA6A 1XK6A 1ZVQA 3CONA 3QKSA 3NHBA 3HPQA 4QELA 4EVSA 1LQUA 2BI7A 1DAPA 3CVOA 3FOCA 4RJIA 3MJFA 2A5LA 3QVWA 4INOA 4NESA 5ALYA 4N7MA 1SH7A 2HXYA 1YUMA 4I4TA 4EMSA 4HXEB 4EJ6A 3FFAA 3PQCA 4NZPA 2WM9B 4X97A 2AD5A 4M21A 4AJ4A 1RQ7A 3PC8C 2AJBA 3PDCA 3QWIA 4YLGA 1ZH2A 5KMGA 3JVIA 3U7QB 4AJIA 5EPEA 3NQ41 1DJLA 2EW2A 2VHWA 4KIFA 5BY2A 1II8A 4DXHA 2XYPA 1LVUA 3G82C 3OQ6A 1UMKA 4W1PA 1PJRA 5H68A 5HTKA 4AQ7A 2ZULA 5B2FA 4AURA 1JEQB 1P1HA 4YRNA 5IULC 3OF3A 1EK0A 3EZYA 4QBTA 1HZJA 1YD7A 3AKDA 4R2JA 3S7ZA 1JBEA 4HQKA 4ENSA 2RG7A 3DFIA 4TYQA 3DDOA 4RCYA 1YQUA 3ZS9A 3LYAA 4I6GA 3W9SA 3TL6A 5T57A 4DV0B 4Q01A 9LDTA 4B45A 2GJ4A 2QX6A 4KXNA 4D9FA 1KZ4A 5LQCA 4K46A 4US2R 2HHJA 1G8GA 1UFVA 2D5CA 5GVSA 1I30A 4KQFA 1YIAA 4K40A 4QFCA 4RGQA 1CQIB 3IAAA 3RE1A 3FNEA 2I6GA 1K8ZB 4B7XA 2Q5HA 2F64A 1EUYA 2FK8A 2WM8A 3GR6A 1K8YB 1NIPA 2ZJFA 3CSSA 3IIMA 4UTPA 4WLVA 5B3LA 5KTYA 4J0HA 1G0NA 2QV7A 2J1LA 4RWEA 3D3WB 3IP1A 1YWGO 4JP8A 1V3VA 4PYKA 3N5CA 3SIWA 2F59A 4OLHA 3A6LA 1XXHE 2VF8A 5AI0A 4B32A 2Z5VA 1CJVC 3KZNA 4BNWA 4PBSA 2G82A 1Q83A 4G23A 4HB2A 3BSSA 2OBLA 3NRCA 1L4EA 1P4RA 4XVUA 2I4MA 4HL6A 2GR9A 4PNPA 1ADBA 4GT1A 3G0OA 3IKMB 3ZW7A 1MHPA 1BGWA 1K08A 1U7OA 1GU1A 4HWTA 3OEWA 5M04A 2NADA 3NJRA 2XNCA 1AUVA 1N2GA 5EC8A 4ZAZA 1E99A 1BVRA 1X8LA 4OHMA 1J0XO 4N18A 2CDAA 2GMWA 3WMXA 4V1CA 2WK1A 3H3JA 2P41A 4QU8A 4ZZIA 4C6RA 5D3QA 1C7JA 1PF7E 4FEAA 4R1UA 2HLPA 3RC9A 3EFBA 3UA3A 4O29A 3DT6A 2YJ5A 3EVCA 3TJMA 3NH6A 3GFQA 5BW6B 1RLJA 2IS4A 3WGLA 1GCOA 1Z9BA 2YUIA 3PPXA 2WY2D 3B48A 4AP9A 5A5EA 1X1CA 5CK4A 1GRRA 1DV2A 5F1YA 3WLJA 5P8WA 4YMLA 3JYPA 4OF4A 4RV9A 2BCGY 1R0SA 5BSRA 1L5YA 3DOEA 1LPSA 1W47A 3QXSA 2ZUBA 3NPAA 3SXUA 1CHDA 4OQLA 1JDBC 1BMQA 2GLUA 3KBOA 5CA1B 2BEJA 2IXTA 4O5AA 2B83A 4Y9UA 4AIRA 3I2JA 4EF5A 1E0SA 2WWWA 4BAZA 4ZO6A 3BERA 3D43A 3KVOA 1V1MA 3LFHA 4TTTS 4EIWA 1L7AA 3K96A 2J67A 4QTTB 5KTKA 1OH7A 3OLQA 4OFWA 4PCAA 1JP7A 2JJ8A 4AJEA 1V5WA 2F43B 3OQIB 1NVBA 2NZ2A 2CUNA 1WZIA 5I9SA 4WEQA 3PD7A 5E1OA 4GYWA 4Z6KA 4B81A 2EZTA 2H17A 1M5TA 3NM6B 3IJRA 2XGMA 3ROEA 4UE6A 5ESXA 2D3WA 1WXQA 1XZJA 1SU4A 4J0QA 2YW2A 4RJTA 3GVXA 2K7ZA 2FOLA 3GJ8A 3QI7A 3I3OA 3W2GA 4RMNA 4WHMA 3D6FA 4ZK6A 4MHTA 1QRRA 2QAIA 3BA6A 1KZ6A 3H9JA 3U4AA 5TB5A 4G4GA 1XEWY 2D1FA 3MTDA 3IQXA 2HLDA 4KLAA 4MJLA 4IMRA 4BGVA 2O8DB 1DOAA 5I7SA 2X15A 4Q66C 4RADA 1GZ5A 3E0QA 5FT9A 5MGBA 1B0AA 2ZAGA 3WZ2A 4F21A 3U1VA 2PMEA 2HWKA 1UODA 3KXPA 5JUWA 4IHQA 3HR8A 3WNZA 5E4TA 2WWFA 2XOXA 2CZGA 2P91A 3U80A 4BU0A 3R3YA 4AY5A 2VP4A 1S89A 1XB2A 4X66B 1J0BA 2HDOA 2VFAA 1J49A 1B15A 2IQ5A 4IJUA 5DLYA 3UG7A 4F3CA 3P2OA 5EA2A 1CLUA 4S2UA 1NNI1 4AKIA 1WMDA 4UEKA 3AFMA 3KIPA 1CS4C 2R96A 2RMKA 2W2OA 2WIBA 3HDHA 1IAVA 1Z0KA 2AFIA 4IP0A 4TLDA 5DASA 4RZIA 4PM4A 3RJ5A 4QOHA 3EUFA 4RZQA 1TGVA 4XQ9A 3USES 5ED4A 3W1VA 4DDTA 2EL7A 2GH1A 3RT9A 3WWCA 1ADYA 2XT6A 3NWEA 1USVA 2HNKA 2HWWA 2ZXEA 3BWMA 4TV9A 1IJFA 1DBWA 4DGSA 1AO0A 4FMCB 1VMEA 1Q12A 4RD1A 3SC6A 2HQBA 5F1OA 5LQUA 1GGFA 1JILA 3E9QA 3IALA 3LVRE 3CLUC 1V35A 1M72A 1M6HA 2ZS7A 4O1HA 4I4IA 5G0TA 3AESB 3KYDB 3WYAA 1ZONA 1JDSA 2CYAA 4AZSA 2FFHA 1W36D 1K0UA 1Q77A 3JQ8A 3ER8A 1YI1A 3ZDQA 4NK4A 2FPXA 3V46A 2JLWA 2BKAA 4HBGA 2R2GA 4BNDA 2XT9A 2JLUA 5EHQA 3GJXC 3E15A 3H0CA 3FOAA 4KN6A 2YFQA 3WOVA 2FGKA 3NDIA 4NSNA 3FYUB 2NUTA 1IDN1 3QF4A 3S5UA 4DVJA 2CLKB 2O07A 4JP5A 3OAAD 2C84A 4YCJA 2XGJA 5AM1A 2CJYA 3Q3CA 3CIFA 2X3UA 3FNFA 4ZGGA 5JCPA 1F4PA 2RH8A 4CT4B 1ZIDA 1V95A 3WA7A 2Q9AA 2PLNA 2IHZA 1SUSA 1CW2B 5SY4A 1B0ZA 2A4KA 2H57A 1VI6A 1XZCA 4EHBA 3GARA 1NBIA 5EG5A 1W4ZA 2UVPB 3ZV3A 1GO2A 5CGQB 5E1BA 2QRVA 5D84A 1G7TA 1IHPA 1J56A 2QGFA 1JAHA 1W5AA 1ZM9A 1YBFA 1GNLA 2O2XA 3MTJA 5T3UA 1JEDA 1YJ8A 4U2GA 3M2TA 2KX7A 4OI4A 1XYYA 1IEQA 4B6SA 4PNEA 5HF8A 5I7UA 2EX0A 2X5OA 4HGRA 2YS7A 1IEXA 2BEKA 3RSQA 3UCXA 2Z6QA 4FOTA 1N7GA 1I14A 3STYA 1H0HA 4C21A 5JYBA 1EXWA 4N9QA 1FS4A 3PNOA 2ZPTX 2RJ3A 4IS2A 2J9FA 2JA2A 2OG2A 3G79A 4ND1A 3AM3A 2EXXA 2W2LD 1LK5A 3PNQA 5JD6A 2HSGA 1JTEA 2QN8A 2VK8A 2ZUSA 3VHXB 2PGLA 2ZR0A 1MA3A 3A7DA 1Y6JA 3SQXA 1ECCA 3LWBA 4ZCQA 5EKUA 1MKYA 3NIBA 5HCIA 3P2YA 3A6GA 5IG2A 1RRCA 2QR3A 3R6TA 4FYPA 2XOKD 2Z95A 3DV2A 3I04A 3QVTA 1MEJA 4O3FA 1V48A 4XFDA 4YDHB 4CN8A 5CITA 3DW3X 5D87A 2ZVQX 2AV6A 1MG0A 5BXQC 3NDRA 2IHKA 2WIDA 1JXQA 1YZQA 2BZ0A 3VO2A 5ADWA 3ZTTA 1PJQA 2Q5OA 5K0EA 1Q20A 4ZYYA 1SCQA 2M2IA 4GNRA 1IYZA 1VG1A 2VNSA 2O7NA 3PJDA 5AKXA 4P4TA 4DSAA 4JDPA 4C4TA 4I1SA 1CRZA 5JS2A 2AOWA 5LM3A 1TTTA 2Y4NA 2C2BA 1ZA2A 1SNYA 4XTCS 1VPDA 1XZ8A 3WLRA 3HJTA 3AXTA 4RA9B 2PJRA 4I9GA 3T5DA 1D2CA 4M54A 1NAIA 3R7FA 5KBYA 2J3LA 3SM3A 1F5NA 4IIGA 3K1AA 5ALDA 1BC5A 4WDQA 2GEFA 3IURA 2A58A 3LT1A 3UMCA 5BMVA 1GAWA 4Q9HA 1EIWA 3QBVA 4BO1A 2AUNA 4GXTA 5LQKA 1OAKA 2BGRA 3CVJA 3MWFA 4QRDA 1JIIA 4WXHA 1KZGB 2BI8A 2RIRA 2ONCA 4QTXA 4C30A 2O9JA 3ZUPA 4MWSA 3CSUA 8GPBA 3OCUA 1VG8A 3L8EA 1VA5A 2C07A 3ZGLA 1CF9A 4N9WA 1VKRA 1DBIA 1K5PA 2HA5A 4XSGA 5JNSA 2WYOA 5E8JA 5CVTA 1W73A 4L9SA 5F3DA 3RBZA 2Y66A 3GYBA 4EO9A 2FG7C 5COBA 2WG0A 1YRBA 1QZUA 3AYXB 1XROA 1EHYA 2VDLB 1KJJA 4GZLA 4HQ0A 4P35A 5CCEA 4XQGA 1XCBA 1NVMB 1OV6A 1XLTC 3GELA 1HE5A 2CFIA 3KV1A 3LY7A 3M1IA 3NV7A 3QBDA 5AM4A 3C7AA 2X23A 3G23A 4HUTA 1KXZA 3C1OA 3QUAA 3ANSA 4PZPA 5A4KA 1Q15A 1M2KA 2Z2YA 3PE6A 1ZVMA 3CJRA 4KPGA 1OFUX 4P4UA 1NU8A 1U7DA 4MA5A 4HTFB 1A5AB 1AZSC 4OL0A 4XTRA 1PR1A 4Y18A 4H1TA 2Z8YA 4YGXB 2A2ZA 5ALXA 2VJBA 4I6JA 4HZGA 3T94A 3OBIA 1RW4A 3GFRA 4FUQA 4FHFA 3WTBA 1TPZA 1ISSA 4PHCA 3OTIA 5B7NA 3JARB 2AOUA 1KSJA 1R9MA 1UPXA 2JIQA 1GTJ1 4DMLA 1NVDA 3NVDA 1RWPA 4YT8A 2VZ9A 3TIXB 5H4GA 1T35A 2QL6A 1X38A 1I7SB 3N8HA 3CLVA 3LRXA 3PQ3A 3ZTWA 3QMVA 5AJZA 1SUBA 5GM2A 3RAJA 3ZHVA 5KUTA 1JAIA 5I51A 3E7PA 1C1XA 3RJMA 2OWEA 2WVJA 4PLZA 4H77A 4WCFA 2ZSJA 2O8FB 1NUPA 1TYCA 1IZ7A 3FUWA 3MYYA 3OE7D 4Q0MA 2HBRA 4N47A 4EJSA 3BXOA 3DMNA 5BQ3A 3IQEA 1OLUA 1PP4A 5B30A 2V74B 3DLHA 1MIHA 4D9CA 1SVNA 3GFTA 1J1ZA 5TEVA 4B44A 5LYJF 1SJ9A 3EB9A 2WWRA 2A1UA 1EUCA 3CINA 3JQ9C 3C3CA 2KSQA 4OVKA 4CR6A 1UXJA 3B2EA 1TVEA 3KB1A 3RS8A 2DBZA 3L8YA 2IGTA 2QB5A 4RA6B 4MGHA 3GJTA 3GD5A 4C22A 5K8LA 4D6XA 1TRHA 1ZHOA 4R8LA 5IARA 3LQYA 3WA6A 5HOQA 3DBRB 3UGQA 4LRTB 1N2ZA 2VPYA 1M2OA 2Y9MB 4JC8A 1F2DA 2J5QA 2GKSA 1AMNA 1VRVA 3RVOA 4CJXA 1GGMA 2Z1MA 2V3VA 3SZOA 2FEWB 1Q7GA 2VSXA 4UEQA 4P38A 3ICEA 5JI3E 4ZXPA 5EEGA 1WDWB 1FSSA 3HK2A 2GBCA 5F4ZA 2DF8A 1V6AA 2IDJA 4LXHA 3ZS8A 2TYSB 2NO7A 4Z9BA 5JZOA 2BEVA 4NP6A 1H85A 3FLBA 1IRXA 3OO1A 5CT5A 4GZ5A 5FNVB 3SVZA 1QFJA 4GSLA 5JBNA 2FZVA 3PA8A 2G76A 2JCVA 1JSLA 1VRWA 4HLCA 4KWEA 4F7DA 4UOQA 5E7QA 4ZARA 3RFCA 3OKCA 2TRSB 1E6KA 3II6X 3LD9A 1KZ9A 3BXZA 2GHRA 5ILGA 4ZIRA 1P5JA 3NP9A 1YR1A 4JQYA 4OREX 5E1MA 5EQTA 2ZR9A 2P9FA 3U13A 3O9ZA 3LGXA 1V6SA 1EDDA 4HPWA 3V1TC 2NTEA 4GRIA 4QU5A 4PNHA 4BOYA 2BMAA 5BVGA 3H1AA 1H2RS 1KEVA 4H15A 3THXB 2F8SA 1CY7A 1AKRA 1DXYA 1P17A 3L49A 5B7QA 1M2WA 4QREA 3V1UA 2O7RA 5EUCA 3FSGA 1I33A 1C7IA 1U8XX 1UBFA 2H3HA 4KBFA 1OZFA 4E5UA 6LDHA 3THYA 4DV7B 4CV1A 3SNHA 3GLFE 3VHRA 2XTJA 4C89A 5DNYB 1ZOLA 4FFMA 3GBVA 1BX1A 3TAHA 2XZLA 2Y8EA 5F2EA 3WBKA 3WGOA 1Z15A 3WRWA 1N9GA 4BVBA 5FHRA 1M2FA 2IW1A 2C7OA 5C34B 3GA0A 4PFQA 2OHHA 2QM8A 4MP6A 4A2PA 2QVGA 1ZAKA 5T6MA 4X3CA 2PKRA 3JQFC 3IAM6 1DEKA 2H8KA 1U80A 3OEHA 2DAPA 5FUYA 3L7NA 1KY3A 2Q3DA 2DR2A 1C9KA 4MI6A 5EIFA 3MZ0A 4Q7MB 1RKBA 3DUFA 1SBQA 2DWPA 3WDSA 2P67A 4F2PA 3P9KA 5T7BA 2C7BA 3NHYA 2A9RA 2O0HA 5DYIA 5F76A 2FQ1A 2PS0A 2VHTA 4XI9A 1K3FA 3UK6A 1ZMBA 5F23A 4Q1DA 3EWAA 3OZCA 4BUZA 4O63O 3ZCTA 2MU1A 1NOJA 4D56A 5IJ9B 3HB9A 3CZ9A 2NO9A 4NU8X 3ZHTA 3ETLA 4HNAB 3IVAA 2O8CA 1S01A 3QMWA 2Q3FA 2QD5A 2K6GA 2WZCA 1RE0A 3K72B 1PYDA 3OZUA 5GPBA 2WB2A 3D2AA 4H31A 4OGWA 3JATA 2HX1A 3OFKA 3OURA 3QM1A 4JKYA 4OG2A 1P5RA 1ZR2A 3NT4A 1TAUA 3D1VA 1GP2A 4M9CA 4EKIA 4D0LB 4Q4AB 1Y1RA 2IKSA 4CL3A 1HA3A 5KTNA 1J8DA 4PRZA 3NTOA 2VQ6A 1L4FA 1F5SA 5YASA 1Z7BA 4BLUA 2YJZA 3I2IA 2JDIA 1G2QA 3WWYA 4O2BA 4EUFA 2UYGA 2WVHA 3FBWA 4MHSA 5ALNA 5EN4A 1G6KA 3EX7C 2EOAA 4KVZA 5DN6D 1ES9A 4Q7JB 3ZX5A 3TMAA 2EATA 1G291 10MHA 2BT4A 4JB3A 5T5QA 1YR7A 1SVSA 1QQTA 3SXPA 3A32A 2HXGA 5HKKD 3PFBA 4FPXA 1H5UA 4HGYA 5AW7A 3R3WA 2F8MA 3I5MA 4Z1OA 4EQ6A 5KYXB 2XKAA 1ZUD1 5K8VA 3BL6A 3PXBA 4FX5A 4XIJA 3ABQB 3M5PA 2QAGB 2MTBA 1XYGA 4LYFA 2G9UA 4XVRA 2Q2OA 3LUGA 4C76A 3CLRC 3GBPA 4LV6A 5B57C 5GOZA 2PSEA 3ZW9A 4F12A 2DX7A 1UEIA 3BFXA 2QTVB 3BGVA 1QK4A 3FMOB 2IBTA 3P0JA 3ZWYA 1UJMA 4HDAA 4P86A 2K7FA 2J41A 4R1PA 2PT9A 2FX2A 3IUJA 4W6QA 1QRUA 2F3QA 2CXNA 4CN9A 4YBZA 3OJFA 3EA0A 3ZDZB 1RRKA 3ENZA 1A5TA 2V6BA 3ZN2A 3KAQA 4IJ5A 1KYQA 4RPLA 5H5JA 1M6WA 2AQIA 3NXSA 3ITNA 1EESA 4CNQA 1CZHA 2C5FA 2ONZA 3ORYA 4WFJA 2F8LA 4TS4A 1IH8A 5KSYA 1ZQ9A 1C8BA 3VX3A 1CKEA 2AKAB 4DCTA 2PV0A 1GR1A 1BXRB 1XEXA 3MPOA 1RZRA 4A36A 3ZCPA 1X7YB 3LCMA 1NW7A 5H3HA 5K3DA 4RPCA 3D59A 1CTQA 1NYTA 1RLMA 2GEDA 2ZGVA 2R68A 3D9QX 1V71A 3CNNA 4U6SA 4XR4A 3F98A 3Q7PA 4L74A 4YCAA 4ZCLA 5HDQA 3R74A 2P7IA 1IY9A 3MPUA 2JFUA 2PA0A 4X3OA 2VP0A 1HORA 2ZRPA 4J4BA 2K2WA 1JLLB 1WA5A 4JOCA 3UUFA 2VQ3A 1O6GA 4IWNA 2CWWA 1H3FA 5LU8A 1U3UA 3H9CA 2XCQA 3I0NA 2HHAA 2KMLA 1R8JA 2FEKA 5ENVA 2WWHA 1GNTA 2XRYA 1PTJA 1F0NA 2RI6A 3EIHA 1G17A 3F5SA 2Y93A 3DAOA 2O1EA 1RYMA 2PE5A 5K3SA 1NR7A 4MYHA 2FUG1 4YAEA 4HQNA 5I9IA 1ORTA 1Z0UA 1EUDB 3ILXA 1QIKA 1ECLA 2FZKA 2QDXA 3L8MA 1PR5A 1U3CA 1KDZA 3Q6MA 2BN4A 2D5BA 4K9KA 2KB0A 3CH4B 4ACAA 4J4TA 3MD0A 5SYAA 3EGDB 4NZOA 2PUTA 3Q5GA 3GUVA 1T3TA 1R6XA 4G89A 2LRHA 2A0FA 3AL2A 3UAVA 3UZUA 3KKNA 4YX9A 4PAGA 3R09A 5CFRA 4KODA 2A9PA 5C32A 1FMCA 3ZDAA 1YCDA 2ZSEA 1W25A 3N7AA 3GRKA 1WABA 3I2FA 2Q7XA 5JSUA 3QNMA 4OQPA 1G8HA 2JZCA 2XI4A 2ZRKA 1ZVJA 2ZBDA 3UBMA 1C1HA 4D45A 5IRCD 4J7AA 1WSAA 1DRWA 4U39A 5FBQB 7AT1A 2YDYA 2XF2A 4RQBA 1UOQA 1OXKB 3DPIA 1KPGA 2FFQA 1W8IA 2G8LA 1Y9ZA 2OV2A 1OROA 3FAKA 3QWHA 1TDJA 1KAMA 1XN1A 2HYDA 3PCXA 4H7IA 4Q3EA 5DTEA 3EPJA 1ZNWA 2IDKA 3TXYA 1DHTA 2ZJ4A 4DA7A 5AKIA 1GSIA 2QG4A 1OT5A 4TQAA 2PANA 3TMYA 1ESEA 2BFMA 2C5SA 3W4KA 3KQKA 4LJLA 5CLJA 3GQBB 3L7JA 4ARZA 4WZZA 5K0GA 1JA1A 2GRAA 4R98A 3RT1A 4EFDA 1DRJA 3BT7A 3TFWA 1NI4A 4W5JA 3RVBA 3K7EA 1YZ3A 2YBEA 4MRMB 3GBSA 2MYNA 1U8AA 1PYOA 4ON9A 4KBYA 3CUTA 1CIJA 1YE5A 4TS9A 5AHKA 1NDUA 1V11B 2I8CA 2P6OA 3EWSA 1RMYA 2YNMA 4HX2A 4RVGA 3W8DA 3WGGA 1NBAA 2QT1A 3VU3A 2X41A 4CQMB 1EKXA 4X0EA 4MARA 4IIJA 3OECA 2X8WA 4BVKA 4ZOLA 3QP9A 1XZEA 4HNHA 4KFRA 2QTCA 1L4MA 3KLMX 3ZY4A 1C7ZA 5BORA 3L0ZA 5DMHA 5GZ3A 1MO4A 1A95A 1Y6ZA 4YK7A 3CUKA 3CVUA 4XCXA 2O2CA 5FLEX 2HO4A 3TE7A 1U8UA 2VVTA 1GRNA 1YOVA 3BGSA 3S8MA 1Z4LA 2FG5A 3JQDA 3U49A 5AESA 5CX1A 2B37A 2D5IA 1MQSA 1PFUA 2F1OA 3O21A 5JEDA 1Z17A 5ERGB 4KK4A 2C3MA 2LDBA 3V80A 1CNEA 4TXLA 4CMKA 4MHOA 4G5GA 1YB6A 3C5HA 4FE4A 3DJFA 5DYGA 4DMKA 3E7WA 4CMIA 4CYMA 4ER7A 4MUMA 4YAFA 4D9GA 3AEXA 5CB4A 5JAPA 3ORFA 1KJNA 1X19A 1ODCA 2IP1A 3A05A 1QRAA 1GZ4A 2D7DA 1ZBQA 4E09A 5DI3B 2D5LA 1N3IA 1DBSA 2GVDC 5CM9C 5G4LA 5EMJA 1MH9A 3X1YA 1RIFA 2HC9A 5BN4A 5KKCA 2PHZA 1A97A 2Z5LA 2FPOA 1E20A 1GYPA 3H11A 4Z9YA 3SR3A 5AW8A 4Y1GA 5DCLA 5EFOA 3VR5A 3NNNA 3W6PA 4F11A 3E82A 2FHSA 1CG6A 2PH7A 1CR1A 3WGVA 4WEOA 5LMZA 4JWTA 4MULA 2AZ4A 5KDLA 3ICQB 2RHMA 1F8XA 3NYQA 1NXVA 2N1BA 2O52A 1U04A 1O8BA 4GKAA 3RR2A 3MILA 1JTVA 4I1IA 1O4WA 4K6OA 2DHEA 2OA0A 4DREA 1DT3A 3AUYA 3T7EA 1EFDN 1GUAA 1UR5A 1KBZA 3DXYA 4JSRA 4DQXA 2RHOA 1N6LA 2O06A 3C43A 5I9TA 2PUGA 1GGKA 3GXBA 5DK4A 2PL5A 1WVGA 1I1HA 2WT4A 2PMDA 2Y1LA 3I83A 3LQKA 1QOZA 3PQ5A 4KE9A 1O94D 2WV7A 5K0NA 3SY8A 5BWBA 1NUSA 1SXJB 1C2YA 1XNGA 1SQ5A 2COUA 2E5WA 2SKEA 5BW8A 1DKPA 4DR6B 3DZGA 2H7XA 3OX4A 1GNQA 2Y1DA 1M0WA 4LY9A 1UWCA 1W76A 1TA9A 1L5RA 1UADA 2HM7A 3BE6A 4GC5A 4H7PA 4HGOA 4JASB 1ZM2A 3W7BA 1Z82A 1NQAO 2B6NA 2YZGA 2GBPA 3VHLB 1ZI8A 3A9VA 3CX6A 3SSNA 4OXIA 2IEYA 4GOOD 3V4SA 4RIGA 4DIFA 2C57A 3IOBA 4NEHB 4QQNA 4MR9B 3V8QA 3WWZA 2G40A 2ZQZA 3JD2A 4FMBB 4RLFA 1U0OC 3ELUA 4NJMA 1T0BA 5ADHA 5H02A 1ZD5A 4PZAA 3PCRB 1U6IA 3HTXA 3Q3GE 2PD4A 4QOGA 1GDDA 3R24A 1B8UA 1M1NA 1ZKDA 3IKJA 3U6BA 3L1HA 3PENA 1TIBA 4OSOA 4BJ6A 4P3YA 1X0VA 1OYOA 2V45A 3DVAB 1F8FA 2B7LA 1XTIA 4IH1A 5FF9A 5BNFA 4ZT2A 2I76A 1JJVA 2C4NA 4BMXA 1KRHA 2HREA 2JL1A 3I2YX 3UTCA 3PB3A 1SY7A 3BJMA 3E2IA 1DCMA 5CPBA 4LY0A 1SUPA 2QMHA 2WYWA 3GUYA 4KKXB 3JAMA 2YWGA 5TMBA 1RBYA 4ND8A 1T9DA 3S4YA 2CXHA 4XH9B 1NZJA 4W8OA 4BJ3A 1JHXA 2VZ8A 3I9MA 4WKOA 4K86A 1VG9B 3M5DA 3F49S 5IH3A 4FM9A 3IMKA 2XF8A 1X92A 1NN0A 3EJWA 3F46A 4UMDA 4WFIA 4KU4A 4BQIA 1E0AA 4L27A 3L0IB 1KJ8A 1Z83A 2REQA 3NB0A 4GPZA 3WLNA 3X1WA 4BRWA 1OFUA 1SBCA 2GOYA 3K9GA 1GZUA 1E2MA 1A9RA 2QRKA 3BRWD 4OKIA 3QQ5A 1GCGA 3P2IA 4NULA 4F72A 3NPMA 3C6ZA 2O20A 2X0NA 3E3OA 1FSFA 3FPCA 4OXRA 1AGXA 3ASYA 4GSYA 1XUOA 2VNAA 2O2IA 4XUCA 4K3UA 2Y27A 5TXGA 4UNRA 4JA0A 1OAOA 6CHYA 1E0DA 1PFWA 5C52B 5ARCA 5I8PA 1XV5A 1G6OA 4GWGA 2E1PA 3VRHA 2HBZA 2RC5A 5TMDA 2BTQA 4XDHA 1UKZA 2GT1A 2V8OA 2ZTMA 3BXGA 3USCS 4KAJA 4RYDA 5BV8A 3GLVA 4OI1A 4CEJA 3OM1A 5LWHA 3LGAA 3SWWA 3QA3E 4JR0A 2JGAA 5HM6A 1P8AA 1ADGA 1N6KA 2QEQA 3C4QA 4M1EA 4AG3A 1CZOA 5JWHA 4RJKA 4A5SA 1MU0A 1ISJA 4PC2A 2XMSA 1E64A 1R37A 1OZGA 3FWYA 4J75A 2IIQA 1WPQA 2B8WA 3I30X 2XA9A 1IHUA 4JBWA 4W1QA 3GGGA 3ESZA 5AVWA 1NF2A 2ZI3A 3HABA 2IU3A 3Q1KA 4P2GA 1L5GB 5A7HA 3STTA 3TUIC 3K8QA 5MN6A 3K09A 1E69A 2JHFA 4WACA 4ABTA 1IN8A 4QDZA 2DSTA 1J2JA 3GJ7A 4BNIA 1WEHA 1FP4B 2VTBB 5ALLA 3ILHA 4QO8A 3DMGA 3R5KA 1GPKA 1UK7A 3LPMA 3QYFA 3U1BA 3FGOA 4KCGA 1YKSA 4TWAA 1AIPA 3ZU3A 3FTNA 3COZA 4BGUA 2E4AA 4DLZA 4ZI7F 4D25A 2ZKLA 4BX3A 1R9NA 4BLQA 4HAUA 4X7PA 2POQX 2YJNA 2B69A 1H2EA 2IYLD 4IJ6A 4DCMA 2I1LA 2HR1A 1OXXK 1T2FA 3TCKA 3ZUGA 4DABA 2FMHA 3FDZA 2O5RA 1T6NA 3ENQA 5IP5A 1WBDA 1JLSA 4EKYA 3HCPA 4EPVA 2WOOA 5TC4A 4PU0A 3HRHA 1K6EA 4KACA 1QAMA 1R2QA 2QQ0A 2LPMA 3KKPA 4BNHA 1KH1A 2EFHB 1NBMD 2QW0X 4BO0A 4LRSB 1DBRA 1NFRA 4DLKA 3SHWA 1XALA 4O59O 1C0KA 1SVLA 2ZDGA 4LBYA 1SBIA 3TSOA 5ALMA 5KJ1A 1EE1A 4PO3X 2QY9A 4DB2A 1Q0QA 3E5HA 5CH8A 4TLAA 5K6RA 3K9CA 1QCCA 2FRDC 1D6MA 3GFPA 1P5HA 2M6RA 3LZ6A 4JBNA 1JALA 3SFZA 3ZDYB 1VP9A 1X80A 3H5NA 2O0MA 1V43A 3G2LA 4TMKA 1YB1A 2W6QA 4EJFA 4B7CA 1ESDA 3QLVA 1F20A 2Y1WA 5LD2C 3BORA 2FOXA 3G0IA 1JEEA 1TCAA 4HY3A 2CHEA 4HB3A 2YYYA 5EIWA 1WCIB 2WTNA 3K05A 1EP2B 1MRZA 1X74A 3L8HA 4BY9E 1J0CA 3VZPA 3W6ZA 3E70C 2YHIB 3WBBA 4KL8S 5JNUA 1IG0A 1COWD 1GNPA 1HY3A 2NPIA 2CJWA 5B36A 1N36B 1B6RA 1AKWA 5JSQA 1VJ5A 1YTUA 5EJ4A 2QJRA 3GZNA 4DPMA 5I9BA 1ADCA 2A94A 3SYNA 3MGCA 4G41A 1Y82A 2GXQA 3D6HA 3DJYA 3GDFA 3UENA 2BBTA 3HGQA 3VR5H 1E4EA 1JSCA 1I1OA 1Q1GA 4CODB 1C3JA 3KTOA 3JVUA 4KGZA 1RP7A 1OLXA 1VL0A 2AGVA 3SZ3A 3K6SB 2I4LA 2EWMA 2P27A 2P9ZA 3PE4A 4HK4A 1CERA 4CR7A 4YT4A 3L6EA 2I3AA 1D9XA 1W85B 2AYXA 3UICA 3ANXA 4ZGWA 2HT1A 1EGMB 1Z2EA 2B94A 1K3UB 3EG9B 4NEGA 4LY3A 1KC3A 1J8MF 1DJQA 1Z45A 3K4QA 3LCCA 1L3CA 1ZICA 3PUYA 3MLBA 4O3MA 2KBEA 4DCPA 3TVDA 4LWPA 1G1MA 2ZSIA 1IZ8A 2C82A 4PIVA 1BKYA 3QLJA 4U2KA 2Q46A 1IOZA 4XIGS 1JKJB 1VFPA 1ID8A 2GGSA 5JZ9A 2O0LA 4KI0A 3EDRA 4G8JA 3TK1A 1OTXA 2OBNA 1ISHA 1I4TD 3U40A 3DDWA 1E2EA 1QSGA 1QG0A 4RS3A 3RWMB 3JS5A 4JNCA 4O8ZA 3SIPA 4ASUD 4DF3A 1EUQA 2I2XB 1FQWA 4MR8B 1U7PA 1NDHA 1NYLA 1X7ZB 5E7IA 1JQBA 1NBHA 1RJWA 3F8SA 4Q3KA 5CD9A 1ZOPA 3UXYA 3OTQA 4BMPB 3A14A 4Z7JA 5EWJA 2AC2A 3T7SA 3DM9B 2GJ8A 4YRIA 1TQ8A 3ZCUA 4FXPA 1Q0RA 1SRQA 3CF2A 3E4DA 4G5RA 2GN1A 2OO5C 4TLBA 2UZ4A 5AW4A 4KXQA 2WF7A 4NBNA 1TEZA 4ZQCB 2WD7A 2YH2A 5E38A 3Q2IA 1MDBA 1X1SA 2GYUA 3ZJTA 1TUBB 1LPBB 2NSYA 4R01A 5DYYA 4UCFA 1ATZA 5AHOA 1DRKA 2ORYA 2QL7A 1NF3A 1PWEA 4ROSA 1BDJA 4Z8XA 3RRFA 1L8AA 4EPRA 1N57A 3BIXA 5J63A 2VRCD 4BRZA 4Y9TA 5I9NA 5LJLA 3FYCA 1WCYA 1ZEMA 4NDAA 4A82A 5E9AA 5A2GA 3IKLA 3TZKA 1DOZA 3A8TA 5IT9A 2LZ0A 3NEYA 5LP6C 2OKCA 3MOSA 1FXWF 5DU2A 3WWEA 4DEXA 1PWXA 1QDEA 2WJ3A 4ND2A 2BDTA 3GJZA 3QKTA 3DTTA 3GPIA 3MTQA 4S0ZA 4F92B 1SVWA 2X2EA 3KJXA 4IVPA 1CJKC 4H18A 4WOBA 1QLWA 2WHEA 5BNWA 3K35A 3P1JA 3QKRB 1S9DA 3F6EX 4F3TA 4ALJA 3HG7A 4WKCA 3KB6A 3O4GA 5A1TA 4D8WA 4XEUA 1E5XA 2OGTA 3TTVA 2ZS9A 1GQQA 1JG2A 1XJCA 1AKEA 4RM3A 1O0BA 2RD2A 1SVMA 2XD9A 3ICVA 5DCWA 4NYMQ 2CFRA 4XLTA 5KHOC 4OJTA 4GPTA 5DNVA 5JSYA 4ZVSA 1BOOA 1BEZA 4MV7A 3ZH9B 3HJAA 4QPNA 3GLFB 1J8QA 1GPLA 2OCIA 4KUHA 4HLQB 5DHTA 3TN7A 3KXDA 2PZGA 1QIJA 3TRIA 5KKNB 4FLFA 3QE3A 1DKMA 4Z86A 1UMDB 1C8KA 1Y3AA 3L6CA 5C8ZA 1U4SA 2UAGA 5JJBA 1DIRA 1NTRA 4LC1A 1Q19A 4YVFA 1A88A 5CTAA 3SFVA 3TSYA 1H69A 1G8YA 3OBBA 3K53A 4JBIA 4WADA 5AMXA 3TG2A 4IDOA 3FLEA 2AXEA 2QZSA 1E2UA 5J59A 5H16A 4F8JA 1RXVA 2DU8A 4D74A 2Z57A 4KMOA 3DM5A 1CDZA 4NZNA 1C7FA 1ZMRA 1SU6A 2EWWA 1V16A 1DQYA 4PLTA 4JP1A 1JDJA 1JFFB 5EHGA 2GEKA 3N0TA 1EX7A 4MVJP 4DRXB 3KQWA 4FDTA 4RSHA 3R3HA 2WQ6A 4NYIQ 1OF1A 1FE8A 3FVVA 3OOHA 4WDRA 2P9EA 5D1HA 4RD2A 1URPA 2H54A 4Z0PA 1ZJ5A 3GF4A 1J6UA 1ODTC 4KXUA 4MYSA 3VO9A 5FTWA 4CLHA 2GD2A 3PF9A 4DMUB 3KQLA 3DLBA 1H2BA 3UW3A 3OAAA 5KYGA 1LJLA 1D3AA 3OCZA 4PV7A 1R1DA 1E5QA 3EAQA 4MB0A 4PC7A 4JEHA 2PZKA 4BLTA 2Q4BA 5G40A 1OC4A 3PHIA 4N0EA 1Q92A 1TUIA 2Z1DA 1XKLA 2J7PD 4U7TB 4TM8A 1DJPA 4OH1A 1H4TA 2QN2A 1G8PA 4YALA 3BWEA 3CNQS 5DBFA 1AOXA 1E3TA 2AC7A 5IZ4A 4M7PA 4YRTA 3B1VA 5KQPA 2WHYA 1RI3A 1XD2B 4KBGA 4I8XA 1A4UA 4L16A 2KBFA 1VBKA 3UMFA 1BH2A 1N2CA 5IMBA 3ST7A 1TVKA 2HJGA 3QE2A 2WUVA 2W00A 1SCUB 5BQFA 4CEHA 5JAOA 2Z1NA 4X1IB 1Z0AA 1T5OA 5AK3A 1ADFA 1HFKA 2WYIA 4TSKA 4QDTA 2Q8QA 2YXBA 2F6RA 4W82A 3KSZO 1ESCA 2HA6A 4TTSA 2CBZA 4QDOA 3MMZA 1W87A 2W2LA 2I2AA 3AM1A 9MHTA 1S8FA 2P62A 3JZIA 2ZRIA 2Q6LA 2WYHA 4D98A 3STHA 1Z35A 3NOXA 1F2TA 1TMYA 1QS0B 1T5LA 2AWOA 3ZIUA 4BJ1A 4KPUA 3ZHUA 1OFIA 3IA2A 2A0KA 1T9GR 4GM4A 3HLKA 1U8FO 2XOKA 2VTDA 1T8PA 4MWZA 2CXRA 2IC5A 4MB6A 4BHTA 3GRVA 3GJ5A 3E3AA 1IZ9A 2VP9A 4YP0A 3O74A 4ECEA 3IP3A 4X6YA 4JXZA 1JSZA 1XJQA 2BFAA 4O2AA 2C2OA 2OCPA 2ODBA 2HHLA 4GICA 4UD2A 4ZYLA 4EFNA 3D81A 1L1EA 1WZ2A 2ZRBA 2DCMA 3G88A 3IE2A 1M34E 1GGHA 2BHTA 3DXZA 3GVCA 3ONNA 4S12A 5LMUB 1XNRB 2QU8A 3IXMA 4EEKA 4A23A 2GN9A 4Q7EA 5HQ3A 2Q5LA 4ENVA 1E58A 1CB0A 3I9KA 1SXJE 3KWMA 1JB1A 4UTRA 5FWYA 2ZM5A 4LXGA 2X42A 3KJZA 4QO7A 1NP6A 2O8BA 1Y42X 2WDPA 1YNOA 4MLDA 4DBZA 2IZZA 3CWZA 5EE1A 4M60A 4X20B 4JVMA 1R74A 2R6ZA 1ZD8A 1BWRA 1N6OA 2W8BA 1RLTA 3WB0A 2EGUA 2F55A 1OX4B 1CSEE 1BWQA 5BUQA 2FPIA 1WCWA 4HOYA 1MTZA 4D92A 5EESA 2AHRA 1ST3A 3CQ9A 4IV0A 4R7TA 2YFHA 4GPIB 3X44A 2QMOA 1GPDG 2C78A 2D06A 2O2ZA 1EXNA 4BVEA 2AEMA 3AMVA 3MT7A 3EC1A 3LF2A 2ON6A 3P9IA 1LTHR 1T8UA 4DNQA 1D8AA 4N5DA 1CY0A 2FAXA 1J2EA 4F45A 1KS9A 3HXKA 3O3OB 3VVLA 1GILA 3ROQA 3K9HA 1O6CA 4NDNE 4K05A 3ZNPA 1CUYA 3FWZA 5GM1A 3WQHA 2G83A 4X62B 1ULZA 2W90A 2JH3A 1JAYA 1E6MA 1YZFA 4FKMA 2SICE 4F85A 4ENTA 4R7GA 1DKOA 4FSHA 1E3WB 5JRZA 2Z2ZA 4BGDA 4HAIA 4QYSA 1UBNA 5JALA 1UBEA 3GRRA 3RRJA 1KK3A 3FVTA 4P81A 4GU5A 1CQZA 4YAOA 5AXBA 4W5OA 1VMAA 4Q6BA 2WJWA 1NQTA 1W4BA 5DHRA 5DLPA 2PTHA 1UOOA 5FUWA 4UNQA 5CDTA 2GJKA 4DM4A 2MR5A 4NYJQ 2BFOA 4XYLA 5B58T 3Q7QA 4WLUA 2FFAA 4MKXA 2Q3MA 1O97C 4S24A 5HF9A 5EE9A 4CIWA 2DQSA 1YVRA 5JXHA 3EZNA 1U0RA 1WTAA 1XL1A 3GLUA 2WSSD 4IYRA 4LRYA 3WB1A 4CG3A 3H2ZA 1FPQA 1QC5B 1BN6A 3VX4A 1BCSA 3N0WA 3RFXA 2X19A 1G5PA 2IF2A 3OE7A 1CEEA 2P6UA 3RHSA 4PZEA 4G1BA 2HU5A 2XYGA 4GMXA 5ALTA 3T5MA 2BFDA 3KLOA 3KZKA 4JB0A 1U2QA 3UAGA 2VPPA 3IUQA 4YRJA 4ARAA 3A3PA 1T3GA 2O7VA 3I92A 1YDFA 3KVYA 3N2ZB 4AD8A 1YFJA 1VCNA 3PV0A 5F5LA 4UTOA 1VJDA 2Q4TA 1EVIA 2YHBA 3NP7A 1OREA 2X58A 1OU0A 2ETVA 1CUHA 2GZRA 3VJMA 2WPNA 3CRQA 1N0HA 4MW1A 4FJ1A 2EJBA 3CEHA 2H1OA 3LY9A 1XU7A 3CUSA 4XB2A 1PW5A 1BOFA 4MDHA 4WCVA 1JEOA 1DDIA 4Q34A 2XVXA 3N2KB 2ZAYA 3LQRA 3ND5A 4M9QA 4O4HF 1X9HA 4RZHA 4Z3KA 2H65A 2OHGA 3QPWA 1DUVG 1QGED 1KZ1A 4C2TA 1V1RA 2QUJA 3PD1A 4GMFA 4H1UA 4OV6B 1P3DA 4BCDA 2EDAA 4WXYB 1TU0A 3C7CB 5BPHA 1GTSA 4KO8A 3EXEB 1NSFA 1GAEO 4ER6A 4F97A 5IT0A 5J3JA 2FZ4A 3HL4A 3L0PA 5F3WB 4L76A 5CLGA 3DOHA 1H2HA 2MIIA 3QPVA 1WV0A 3SIXA 1P1RA 5JSFA 3A1CA 5JE8A 2CV2A 2XHEA 1UDXA 4XD7D 1IB0A 1DXOA 4ES6A 3GCGA 3VPFA 4DLVA 5F2NA 1Q0LA 4OP1A 5DHPA 4ZTBA 5SZIA 3SXJA 2VJQA 5LJIA 1KDRA 2F1IA 3O2QB 4YQZA 2X14A 3KAJA 4IJWA 3JAKB 2JIDA 4DJTA 1QV9A 4II7A 4PS0A 2QRMA 3L0BA 3FCYA 3PGMA 3Q88A 4V0MA 4IILA 5DBHX 4R0VA 5SZKB 4INJA 5J2TF 2VT6A 3BDIA 3TEFA 2ZTLA 2VYFA 3R1IA 4LYJA 2FF5A 2WF8A 1HLPA 5E0OA 4DPKA 2CXTA 2IH5A 3ZXXA 1PK9A 1RAGA 3L93A 5K0LA 1O96B 1A7JA 2OV8A 3H4TA 3Q3HA 3TQCA 4EG6A 4MV1A 3WL3A 1TECE 5KNBD 3QVUA 1Z4MA 1OTHA 3VGJA 1YS9A 2W6PA 3BMXA 5HS6A 1WPRA 3EXFB 4MCIA 4YN3A 4BMVA 5C1PA 5J2UA 3T7AA 2ZJ3A 2ZJAA 2P2GA 2REOA 3H17A 2ZUVA 3MWYW 4FDLA 3OE1A 4HLUA 4A0HA 3DHVA 1UBHS 5B6PA 3G8DA 5JZBA 3K2IA 1F8YA 5JBIA 5CNJA 4JFAA 2GBLA 4PAMA 3SG0A 4OK5A 3C3PA 2UZ1B 2OBFA 4GYJA 4R1TA 4E2WA 3V4PB 2Q4OA 1Z3CA 2D7CA 4QUJA 4B48A 3MTEA 3RANA 1HQCA 4QAQA 2V3CC 4N65A 1RCUA 2CHGA 2HPAA 2Q2NA 3CJTA 4BKRA 3WNBA 5AJYA 2PSJA 3N3AC 1DCTA 1IQRA 4N12A 1R4NA 1SOAA 2IHVA 4PFSA 4U5XA 4BMNA 4TKVB 4FYWA 1X9IA 5AVTA 4U4AA 3OJXA 3I09A 3VVCA 1UZLA 1XELA 1GNSA 1Z16A 3ZJYA 4ENQA 4RV4A 4X8OA 3SSMA 2MYPA 3OJOA 4C7VA 2OCLA 5G2OA 4N7BA 1LU9A 2O3RA 4TLMB 4X1YA 2IYPA 1O57A 2CYCA 3LC1O 3N05A 1D1QA 4Q9DA 3RVRA 3LDUA 1V26A 4LRUA 4HUJA 4MP3A 5HRAA 2CNOA 2ZUDA 2PL3A 4LHZA 5FULA 4FFBB 4NBWA 5H1YA 1JRLA 1RKXA 1RPZA 4N6GA 5HFAA 5DXJA 3TQOA 1G8AA 1J25A 1LW7A 2WA1A 2GB4A 3C1UA 2JK1A 1C1YA 4G97A 4J0CA 4JCCA 2ODAA 4R8VA 5CVCA 3U0VA 5IVPA 3FJOA 3BMCB 3KSDO 1VB5A 1BXGB 2JLXA 2H1HA 4JVOA 4L0QA 1GQ2A 2UUPA 3VBEA 1QR2A 4M0FA 4PLWA 3LXRA 4X1KB 1T34A 4EEZA 1C3OA 1XRLA 4UJ3A 4JLVA 5CUQA 1LC3A 1XRPA 1A9QA 5DN6A 1YA6A 1P39A 2QNIA 3RSZA 1U2DA 1IXKA 4YUXA 4JMPA 5LC1A 3WWOA 1E1CB 3HYCA 4WZAB 2IHBA 1GT6A 1PL6A 2O2YA 3LLUA 4ZALA 1MABA 3VU9B 3PHLA 1ZD4A 4K5QA 2Z4RA 4Q1FA 4Q4LA 4F4JA 1CJCA 1YR3A 1OJ7A 2AQKA 1OFHA 1XZIA 2OEPA 2WU0A 1LA2A 1TL7C 1VE3A 1P61B 3DZHA 3FUVA 5TVKA 1SZDA 4W5HA 2MINB 4CEIA 1EDBA 1PZGA 1DIAA 4X54A 3W77A 5L7WA 4PAQA 1XRQA 4UVGA 5TGZA 1BU8A 1PQPA 1Q6ZA 1TGYA 5E6RB 1OASA 1JMYA 1QVRA 1Y4AE 2QIPA 5HEKA 3RBVA 3MK31 3STXA 4EB8A 4CW7A 3B6JA 3DOCA 1J5PA 3C3WA 2V6MA 2JB9A 4WCFC 5TQJA 4DZTA 1O0CA 3AVXA 2I34A 2FTKE 2HK9A 4N4AA 1JEAA 4Q39A 1WB5A 4IG4A 3K4HA 1FFWA 2PXHA 3JYQA 4TPKA 3W7VA 3TSZA 1Y6QA 3ODPA 5DN9A 5MF6A 1EAYA 5E9WA 1PWZA 4D8TA 1GXSB 1RI1A 5A71A 4RMGA 4BX0A 1ECGA 1F2UB 3U6KA 5KX5A 4NJEB 5BRNA 4W5TA 3SHFA 2F3PA 3BRCA 3RGWS 1QUEA 2CUKA 2WE7A 1C0LA 1SFRA 3EARA 3O4FA 3QKIA 1PE0A 1QYRA 5HIAA 5LFAA 5F77A 1P7YA 1VHWA 1SEVA 2X86A 3A4IA 4HGPA 3GZTB 3I1FA 4U2CA 4UUNA 2IZ1A 5E4JA 1JR6A 1OB2A 2Z43A 5DP1A 3RH0A 1XVUA 2ZJ8A 3DWGA 1E9RA 4DZRA 5C37A 4RTJA 4PFJA 4UEOA 5THQA 3PS9A 2HU2A 4CMJA 4L15A 1UEXC 3AJAA 4G5XA 5G0UA 4IIDA 1AKUA 2WIGA 1SVOA 1UMCB 2YIJA 4FGJA 4I08A 3VPBA 3NDPA 4N5HX 4CLEA 1A9TA 5DM60 1D1PA 1G3QA 2XE8A 3LXXA 4QFDA 1OY1A 1O03A 1TM3E 3IP7A 4FONA 1P6QA 5DCUA 4X8HA 5KYWB 1JVBA 3AY3A 4TQUS 3GZJA 4WRRA 3OE4A 3U3DA 2ZFUA 3L4SO 1D4ZA 3NXKA 1PG2A 4H6PA 1NVUQ 2ZREA 1PUXA 4YNBA 4JUDX 1FZQA 3DCNA 3BULA 1XF1A 3M1YA 3T4UA 4NAVA 3SQLA 3T5CA 1H1DA 3KLPX 2X0RA 1H66A 2DPMA 5FOTA 1BS1A 1L7MA 5GIPE 3K20A 2ZUTA 3AOGA 5JTTA 2AWNA 3HN7A 3V97A 4B3BA 4H27A 1DCFA 1V9SA 4PRYA 1XA4A 4QLOA 3ZWDA 3ZHBA 5JQWA 3T4XA 2BFFA 1E98A 4LIPD 3S55A 5K8TA 3EULA 1LBSA 5C81A 1Y9AA 3SU8A 2J9YB 3NBMA 1OXTA 2QMUA 1MAAA 1EBFA 4LJ4A 3SC4A 3KZMA 4I55A 1D6NA 1G18A 1XLVA 2VQDA 3CMCO 3U3OA 5IBCA 3FFBA 3GN1A 2PEYA 1NJ8A 4IXDA 3D7LA 3VKVA 4B82A 4IDEA 1RACA 1TYDE 1UFKA 2NNLD 2NU9A 4PLVA 4B4WA 5HQTA 1KGSA 3DNMA 1T8YA 4J16C 3S2UA 3DBHA 1T9ZA 3W1EA 1OQAA 4OX9B 1QGDA 2OHJA 2IITA 4YEDA 5GJBA 2QTZA 2GETA 1BHO1 1WXIA 4X6UA 2BE7A 3WL5A 4DAEA 4ZI7B 3A1DA 4URHA 5GONF 4HDSB 3WWPA 4KO2S 5TPZD 3B60A 4BFTA 4J0JA 4DTIA 2Q3LA 4IDFA 2JAOA 2WV9A 5SYMA 3ESCA 2KHZA 4O4JF 1GGJA 1Z08A 3RDPA 4I9UA 3M82A 1PJTA 5A3QA 2X8BA 5IASA 2VDPB 3IUPA 3JYLA 2P8JA 1QHHB 2QYOA 1KI6A 1TOAA 1S8OA 1QDLB 2ZIWB 3EEBA 4R8KA 2IUTA 3G9ZA 1FUUA 1IUNA 3DCIA 2DLNA 2V7UA 4GD3Q 2INGX 2PNFA 3AWDA 3HXOA 2PZLA 1A2OA 4KUEA 2EVWX 1XNJA 4IO1A 2CMGA 2CNBA 2LIPA 3A1TA 3NWOA 1AKTA 4PINA 1JZSA 5DTQA 1UFQA 4F4FA 3CRNA 4UM9B 1ACLA 1EGHA 1T2NA 3U5TA 2ZSUA 2HADA 2EBWA 3TQTA 1JVSA 4ZTZB 1T0IA 4EHIA 3CTPA 3BZBA 4ZVRA 3TZQA 2QBYA 4BNXA 2UZ3A 2BY4A 1RBQA 2O1SA 3D3KA 2XQKA 3FTQA 4JLWA 3KHUA 4OU5A 3WRVA 7YASA 3L05A 2PUWA 1I7LA 1BDBA 3LIIA 4RDCA 4W99A 4RZSA 4UUAA 4BNUA 1F2VA 4QM7A 3A0UA 3HBNA 4FN5A 1HE2A 1T36B 4INZA 3M4XA 4PFKA 3ZD7A 1NASA 2VHEA 1PJLA 2WZDA 4BL5A 2B1RA 1K7XB 1XMOB 1PJZA 5A62A 1DARA 2OXFA 3AP3A 3HXQA 1OA1A 4GEGA 4UMEA 2HRQA 2AMVA 4QNNA 4F9GA 1MJFA 4L9AA 3OU6A 2P3QA 1DLJA 4I14A 4Q24A 3HB5X 3RAEC 5IC6A 2XMZA 5KVVA 2OZEA 4AJLA 4ZYWA 2FWJA 3HUFA 4GYYA 1BMDA 1EFRD 1YZNA 3H3XA 3D02A 2H4WA 2GN0A 3ACBA 4M7RA 4MMXB 4YJ3B 4YRFA 5EIOA 2XQGA 1XDWA 1RYDA 5AIAA 3VM6A 4RIHA 2ACVA 2I6UA 2BMJA 5CH3A 5JRDS 1Z6GA 1O94A 1ISIA 1T9KA 3QUSA 4K2HA 1M33A 2VQSA 4YRDA 3S70A 3H84A 4I1UA 3RJZA 2HQSA 3WIUA 1O6FA 5U1PA 4PPYA 4JXKA 2PGIA 1P9NA 3AUFA 1UL1X 1TEXA 4BCCA 2VRBA 1VL1A 5I4IA 3GLTA 1Q74A 2XWBF 4YRAA 1JLRA 4ZYTA 3ADBA 1EP9A 4TV8A 2XTAA 4LZNA 2X4IA 3PEVA 2OCXA 3AETB 3E5MA 2XUFA 3HN6A 5IX8A 1V8PA 3ABRB 3N6XA 2FI1A 5IKMA 3OZDA 4MITA 4I3FA 1A96A 5TQ2A 1NXQA 5ALZA 3BXXA 1TT5A 1NZDA 3A1UA 5THKA 1SA0A 3ZIDA 5LMNB 3I53A 1XQ9A 5A04A 4NH4A 4CQLB 5L7TA 4EW3A 4IV5A 4XGNA 3HY3A 2HRZA 2IE0A 4LYYA 1L7XA 1Z12A 4Y98A 1XHFA 3COPA 2NAPA 3WQQA 1FP1D 2B4AA 1M6VA 2XODA 2AFRA 4JX8A 2JLAA 2M98A 1RHQA 4GPD1 4RELA 4MUNA 3MS4A 4WBNF 1G21A 4IGKA 1MMFB 3CR7A 2EAUA 2VXBA 2WT8A 3GT3A 5A9SA 1PTJC 4IWYA 4C08A 4WN9A 3OUUA 3RC1A 4M89A 3ZE6A 2QR2A 2C2WA 4LZPA 4AZWA 3E3MA 1H4SA 5ARBA 3C5WP 1N1DA 1PW7A 2BMEA 1A8SA 1UMBB 5KDOA 1CUAA 4PHGA 2ZU0C 3IH5A 3T3PB 1NR5A 3W6OA 1AURA 4AMVA 1EK1A 3RYCB 1G60A 4ZZ2A 3VTKA 1M7HA 2JJMA 4UOZA 5AVJA 3E2PA 2A1TR 3VNAA 5F7JA 5EERA 1FYFA 1DSSG 3RRYA 3EGWA 4NVRA 3OF2A 1HTBA 1RDFA 3H3FA 3GLKA 1K92A 3QTTA 3TBHA 5JDIA 3BRWA 1WKBA 4R2KA 1NVVQ 3ZC3A 3EGXA 1MN6A 1Z56C 2QUHA 2BM1A 4P3OA 2V7VA 4KIGA 2XA1A 3KPJA 4EY5A 5KNCA 3OSZA 2LW7A 4RKFA 1L8LA 3NU1A 3QEMB 1O9GA 2ES4A 1CZUA 3FRHA 5AKGA 1AGNA 1Y3BE 4X93A 3F71A 1BAPA 2VAVA 3KWJA 5JCJD 3AC0A 1XEAA 3CNBA 2FDCA 1TYEB 3IKVA 1BEUB 5HCNA 4E5DA 5BSTA 1RYFA 3F97A 3ISVA 3N59A 2VG8A 2DBRA 2F9MA 2J6HA 2P90A 2VYVD 2W43A 4ERNA 3KV3O 2G7MC 2BFBA 1HNXB 2O8NA 4N5LA 3FPKA 4O6VA 4DWWA 3CN9A 3KJNA 4KLZA 4ND7A 1NNEA 3A9RA 2OC9A 3G8BA 3WGMA 1U0TA 2O4CA 3H1BA 4LZWA 2H1SA 1QK5A 2IEDA 3RS3A 4CKZA 1QKKA 1MBZA 2B8JA 3KRTA 4GBGA 3H5WA 5TDHA 2GDJA 4G8BA 3WJAA 2ATCA 2PR7A 3LFUA 1Z5ZA 4BMCA 1JPJA 1QIDA 1U8ZA 2G67A 2YNMC 1J24A 3K8ZA 3KFVA 4RGVA 3D7RA 4UNNA 1TTQB 1LB1B 3I32A 3RYIA 4GL2A 2V98A 1MOSA 4P93A 2GBIA 5C1IA 3GIDA 5TF0A 2HSEA 4CFZA 1EWYA 4EZBA 5LBIA 3EC2A 5LP6F 1DUSA 1R3DA 3KR0A 4JYMA 4BB5A 1Z29A 1FTQA 5KC9A 3NWBA 1ESZA 1KETA 3DDCA 2C42A 5H3LA 2IEZA 2WIFA 3BCHA 3UIEA 5EHZA 5F5NA 1BKDR 3ZCRA 2ZE8A 4OBEA 3D5EA 3JYNA 4X1OA 5TJHA 1BE0A 1WCV1 2IYSA 2RG1A 1AGYA 4TQ9A 4XM0A 4ETNA 1GIAA 2OLJA 4BQNA 1QVVA 4Z4QA 3IR5A 5BO5A 2EKPA 1NBMA 4P8RA 2IXGA 1UPAA 2FW1A 5DNEA 3WP0A 2VKQA 2PV7A 4AZ3A 2FWAA 1V5FA 5REQB 4CKBB 2DYKA 1F6DA 1T29A 3NHLA 1JWBB 4KQKA 3UJ6A 3LTEA 4DLNA 2FKNA 4XWAA 4YYEA 1Z63A 5INTA 1C9EA 1WVIA 3L6RA 3OKPA 2IYZA 4U3JA 5FJJA 5BQ5A 3VR0A 1PR6A 5EKSA 3HU3A 2M6SA 1GL9B 3U4HA 1PL7A 1GVHA 3VV2A 4N41A 1QAOA 2FX5A 5C3MA 4TS1A 1E1KA 1GY8A 3M4NA 3ELWA 2B82A 1FNBA 2YICA 4IXTA 2ZJ0A 4L9RA 3WLSA 2PT7A 1BX0A 1IPEA 1MOPA 1S96A 2BUCA 2NZYA 4BB9A 1EXVA 5CIQA 4L8WB 3O95A 4MO2A 4RAQA 3E2MA 1KFEB 4IIXA 5M3BA 4DQVA 3FUUA 3V2HA 3QENA 1FUEA 3GRCA 2PAAA 4B3TB 2EZUA 3V6MA 1SIWA 2F90A 1J23A 3EFEA 1COWA 1KSFX 1Y1SA 2WNSA 4UCWA 5ULLA 3TL3A 4F96A 4AU1A 4Q3LA 4ER5A 1I32A 1I4EB 5KPDA 3EWIA 5J58A 3R9WA 1Y8RB 3C45A 4KO4S 5ALHA 3RASA 1T9HA 1OB5A 3O1JC 4E2ZA 1RC8A 5GZ1A 4GOLD 3HCCA 4G1CA 4EVRA 1ONBA 3B3JA 1KEEB 2Q50A 4ZVVA 5JSKA 4UQOA 1Z7WA 3CNHA 4F5YA 1B42A 2JEZA 2PGAA 4G07A 5FUVA 3ZWNA 2VSOA 1NU6A 5JXWA 3P26A 2I2DA 2VJMA 3CVYA 3DE2X 4ZHQA 3UWPA 3TPFA 3W3ZB 1OWPA 4D0RA 3CRVA 2ECFA 4U8GA 3FNBA 5G41A 1DAKA 3YASA 2I3BA 1AS2A 2Z04A 2C5AA 1J06A 4CM4B 3OZWA 4LZJA 1W94A 1TEHA 2BGGA 3RS2A 4LNUB 4BGIA 1LDGA 2VF5X 5E3IA 3TWOA 2VJPA 4E13A 1UJ6A 4WZAE 1Q0HA 4R2WA 1JI0A 1DEXA 4PGAA 3RD5A 4ZTUB 3DEZA 4NBRA 4F9EA 1M54A 1H2AS 3FUCA 1YUNA 4MVWA 4HG2A 4PONA 1E2DA 3SBEA 2H29A 4ZJUA 3VR2D 2O4UX 3ECCA 3ZBQA 1NMEA 2NU7B 1YJQA 2IY9A 2R4TA 1VHJA 3K0KA 3J7TA 4YP5A 4ASUA 5JS6A 3U7EB 3M6FA 4TKMA 3BHJA 1JQ5A 4TUYA 3BJEA 4DFDA 1YKGA 4P36A 5EJ2A 1Z5UA 2PX8A 5HKLA 1AH2A 5EJ6A 5KWIA 1XXHA 4JJ6A 3IEXA 1RAEA 1AQLA 3DE7X 1A9PA 2R85A 3LP5A 3MINB 5COQA 1NT2A 4CUKA 1JH8A 2VF7A 4MPPA 5FAXA 1B8OA 4M4SA 4CFYA 1E2HA 3L7CA 4HDQB 4PWZA 1QGZA 5DE3A 2L42A 3WK4A 2WC1A 4QYWA 1FX1A 3AEKA 4UAGA 3UOWA 3V33A 3VC2A 4FOOA 3VI3B 1NM5C 2A7QA 3FCXA 4PPFA 3L1IA 2E3JA 2PT5A 4B8ZA 7REQA 3T7DA 1X8JA 3V55A 4KREA 2AVDA 1QHNA 2VRCA 4K81B 3UYLA 3WL6A 1OE0A 1YVEI 1Z22A 2GYYA 2QN1A 1ZNQO 2VLIA 3BFKA 2ZCJA 2IXFA 4QXPA 3IOEA 3PWKA 1P33A 4L5YA 3VR3D 3SC3A 4HHEA 2GS9A 3ER6A 1RVV1 4BKPA 2JVIA 1J33A 3AIMA 3HP1A 3IUEA 3PI7A 1J22A 2ZWAA 3FH0A 3GMSA 4WJKB 4DXAA 3V4OA 2A3RA 1W88A 1CYEA 1S02A 5ADVA 2E4UA 3D6UA 4MUFA 4DSUA 3JASA 3TLJA 1JU4A 1C7EA 2XZPA 1JFRA 3UK7A 3QH4A 2WFLA 5HS4A 2WHXA 1F8GA 3VU8A 1QTQA 1Z0FA 2P78A 3LJKA 1R6UA 2HSJA 4UU1A 4BASA 2NUAA 3GPBA 4EO7A 3HBAA 3KUKA 1XEFA 3K09C 2HKIA 2Q7OE 5KNCH 2AFHB 1EEXB 1WNFA 2GASA 2DFNA 1O95D 1W9MA 1T3HA 4U02A 1S2LA 5CXQA 4DADA 3OZAA 1KOFA 1L4BA 1INLA 2PVSA 2OCBA 4HLDA 1GFZA 4ND5A 1S2GA 121PA 1F1JA 1GTG1 1KZHA 4D0GA 4U8HA 1FDOA 1FVFA 4BATA 3G2OA 3ZCXA 3N0VA 3QG1A 4I4NA 3ADCA 2D2VA 1FTWA 3RTGA 3VSCA 5FORA 2R5NA 3Q10A 1LXCA 2ZANA 2ZJ5A 2QI9C 2PMWB 4UHCA 4G81A 1B1AA 2RGAA 3SBDA 1RLOA 3FI9A 4NMWA 1BYIA 1ENYA 2JH9A 2WJAA 3KPVA 4AX8A 3VDNB 2OR3A 2RGWA 3VH1A 1G7RA 3LUAA 1SK9A 3RGGA 4B6QA 1ZGBA 4LISA 4YT5A 3S0JA 3SJZA 5JS8A 4JL5A 1R0WA 1WG8A 2VL7A 5HZMA 1SKQA 4CQNA 2HJHA 1WHSA 3K9LA 4RIFA 5IAKA 3VKWA 3EFOA 1WXHA 4O4HB 5LLSA 3SS8A 4DQLA 1T3LA 2G0AA 1MAVA 2VJKA 4H7DA 4R2HA 2ZI4A 4J6FA 4LWZA 4NE9A 4GE3A 1E1QA 2OO7A 2Y1CA 3WHKA 1DX4A 3KUXA 2PS3A 1RRMA 1UBOS 3EHEA 4PYMA 4DLBA 1NVWQ 3T1HB 4RE5A 4WASA 3CY6A 3QLVC 2QPAA 3EK2A 1MX3A 1ESNA 3EEOA 3OIGA 3AERA 1APBA 2XWQA 2WHPB 6Q21A 2DT5A 3LNTA 3Q3JB 4A4DA 5BSVA 3VZRA 4R8RA 4OSPA 1I9GA 1C0PA 4RD3A 3PC4A 1NY5A 1JBQA 4EUKA 3T41A 3ET5A 1GG9A 2B1GA 2GCNA 3QLTA 1XZMA 4X71A 4YJHB 1CIPA 3SEAA 1AO3A 4MDFA 3DL0A 1BS9A 1P0MA 3F7TA 1NNUA 2Y99A 4AVYA 4Z7OB 2MCFA 2C99A 4PBTA 4N48A 4D7AA 2MSWA 3NCHA 2CL6X 5KWSA 4HSEA 1RZVA 1ZIYA 3LUHA 5C1DA 3CRW1 3DZJA 2Q27A 3V5NA 4BV8A 3COVA 4C4RA 1YHYA 1YO6A 1P0CA 4DCGA 4YLYA 3IAM1 3O26A 1PFVA 5FTLA 5MHTA 1OUMA 3A37A 4UKDA 4CI9A 3UHOA 2CXUA 3WBFA 5D5QA 1FVOA 1O9HA 6PFKA 3IKTA 4I81A 3RYTC 1PN3A 4KXXA 1K68A 2Y4OA 1WSWA 1E6LA 1LW6E 3ZLTA 1RJ9B 3JD1A 3QWBA 3NBKA 4KMRA 4XWWA 2OMEA 3H9QA 3K8YA 1NPTO 2VHYA 4EGCB 3WLMA 2VT7A 4FE7A 3P9YA 4GHWA 3FHTA 3GT4A 3C41J 2ZU6A 1Q3HA 3R3ZA 4J1QA 4MS3A 5B1IA 4QHTA 4R2XA 4NR0A 3U9TA 4LJYA 4DCNA 5L3RA 4IQGA 3SC2A 3W2FA 1F3LA 3OIWA 1GZSA 4K9LA 4Z0NA 1Z75A 3BE4A 3IPXA 3BIFA 4JSTA 1NGSA 3SJ7A 3V7UA 1Y4UA 3LH5A 5EJAA 2HNAA 2A4MA 5F98A 1MVLA 2JI9A 3BWCA 4MVJG 1CP3A 3EZXA 1R5BA 3NNSA 3V7YA 5KO2A 1Z39A 3EGEA 4M8SA 4CQMD 2IV3A 2FW7A 3CF4G 1ZUNB 2J3DA 4Z51A 4ISBA 2AFVA 2DMRA 4G0XA 1CUSA 3WX0A 4A15A 5JFGA 2QLTA 4DLRA 2QE7D 3ZQ6A 4LQCA 4IDHA 2IV7A 5BOSA 2ZUFA 1ZD1A 2O5EA 4P4NA 1Q7RA 2XVZA 5BQOA 3N6VA 4OQXA 2ETXA 1KO7A 2YR0A 2JD1A 4DV2B 4ENRA 2WRZA 1GA1A 5JWRA 2B5WA 3CZAA 4EO4A 1BN7A 2JD2A 1VPWA 1EA5A 2QZJA 5IDQA 2R1UA 4JHLA 1PT5A 5DM70 4MCAA 3UJCA 2KS6A 1X7HA 1L4YA 1KU0A 2JBAA 4EK9A 3EIOA 421PA 4CU5A 1TADA 4ZEVA 2CL5A 3GO4A 1BQ3A 5EP4A 1DCKA 2HI0A 4CL0A 3A9WA 3MJSA 4IRUB 5AYVA 2V0CA 3HBFA 4C0KA 2WKRA 5K0SA 3AUAA 3G17A 4X45A 3L7DA 3R7AA 4ARSA 1Q91A 5BVHA 4R5HA 1TVCA 4YMIA 4HT3B 4DDVA 1VIAA 3S3TA 4QU0A 2V8BA 3A04A 4J43A 4ZT5A 3L8FA 4AUEA 4YJFB 4FHZA 1FVHA 2VPIA 2Z5FA 2WJHA 4YHBA 4H4CA 5HFJA 2Z9CA 5GV7A 1YR6A 4BNZA 4AQYB 1TO2E 4LFAB 1AKMA 3AEZA 2L0XA 1JJ7A 1WE2A 3Q7RA 4PG5A 2OOSA 5JSZA 4ZPXA 3EDMA 1R9GA 1GUBA 4L3OA 1VI5A 4IFBA 2IYXA 4HWPA 1FFXB 1NJ5A 1UXGA 4J91A 2CFOA 4Q4JB 4RGBA 3TD2A 4F1JA 3EPLA 3WQBA 3W34A 3NTXA 2ZBVA 2PZAA 3AOEA 3MMXA 4I5GA 4OJYA 3AFNA 3TLGA 4PSCA 3G85A 4JI6B 5BMVF 2P4UA 2IPNA 2VPTA 2ST1A 3FMVA 3I1IA 4P4LA 4TN5A 4TL6A 1ZUWA 1EFPA 3MMNA 4W6ZA 4N3AA 3A2MA 3OC6A 5CEEA 1TYBE 4YI5A 1SXJD 1BU5A 3REGA 2C2MA 1UAAA 4G4SP 2JFNA 4NS4A 3BCUA 4I1YA 5K2MA 5B2ZA 5JC8A 4M9RA 1BCRB 3HNPA 4IOJA 4QGHA 3THRA 3ZJ5A 2ZI5A 1KAQA 2OUIA 1R6DA 4U1RA 5HIKA 5JLAA 3CSDA 1VXRA 1ND6A 3MSXA 4PZZA 4E4YA 2ZYVX 1J0AA 1GUFA 1NSTA 1U8CB 2B2CA 4TKUB 1LK7A 3RRXA 1JHPA 3WJ2A 1TMOA 3UFXB 4CF4A 4UUBA 2GPAA 5FJIA 1DPFA 1N5DA 1CQJA 1ZGAA 2YDXA 1OH5A 2WJZB 2G6BA 1WL8A 2WSSA 3HGMA 1Z07A 3PXXA 4J9UE 4ZQGA 3DHNA 1MO2A 4KXYA 1FQOA 3AV0B 4UHEA 4D9KA 2H1LA 4OBWA 1XJWA 1L7BA 4CF7A 1FRZA 1T6BY 3NEAA 4MWEA 4K9QA 2GFIA 3AB7A 4MS1A 4Q21A 1USGA 1KNXA 4CMEA 5ALEA 1GG8A 5CDFA 5LA6A 1W36C 3B2NA 2HRCA 3KO8A 3NBYC 4ITVA 1YL7A 2AJ8A 5D1NA 3MERA 5HF6A 2OAGA 2HZBA 5C2JB 1IY1A 3O8OB 4E03A 4QZVA 2R11A 3N8IA 3RSGA 4BB6A 4X6XA 1R5OA 1E6WA 3FPLA 3ZZ0A 2GARA 4BO3A 2IH2A 4XUEA 1V45E 4N6NA 4C0QC 4C6SA 3L02A 3EY9A 3IMEA 2ANBA 2CN1A 2V7GA 1V8ZA 4DLSA 3AVWA 1EDOA 4ESEA 4C7OB 3GFVA 1EQAA 2PY6A 3CW9A 1KK0A 4TMZA 1EDZA 2PO5A 1KIMA 3OZRA 1GTMA 1W34A 2OD7A 1C14A 1RQ2A 1D04A 1CXZA 1LLQA 2J8ZA 2V54A 2BGMA 3GA7A 3IVMA 3RC8A 3WHIA 1WF6A 2VDOB 3JTMA 5E6UB 1QYIA 3C3BA 4QD3A 4ZAYA 4MQEB 3T1OA 3TI9A 4MB2A 2BM0A 4BX2A 3DD5A 4NBTA 3ZY2A 2RAUA 4RQUA 5B5SA 3RSHA 3C87A 4XD7A 3S7TA 5AVSA 3DKRA 4PIPA 2RJOA 4TVBA 2CFTA 3QJYA 3QELB 1YKFA 4IHKA 2CK3D 3QFHA 1SC6A 2WWYA 4DIMA 1M5UA 4MDEA 3I5XA 5L7YA 4RBNA 5LL6P 3LBAA 5F9MA 1FDWA 1KFJB 1KDOA 3ZQKA 4P58A 3DXXA 1M0TA 4OYHA 3F7OA 3WFIA 3WJ7A 1KMIY 4FQ5A 4L4RA 5L3VA 4HQRA 4LJ8A 1JKXA 4DIEA 2G1AA 4XM2A 2YJTD 1L8OA 5KTSA 3DVRX 4JVLA 5KNBA 3EOZA 4KVAA 4EBBA 2FN3A 3HL0A 4YUAA 4KH0A 5AI8A 1ZSNA 3HHPA 5GONB 4F1WA 5KYUA 1H23A 2PSDA 1XMIA 4LTDA 2N47A 1FX0B 4O4JB 4MUYA 4RC9A 2QYHA 2VHJA 1G7CA 3DAHA 1SGWA 1O0SA 2VYND 4H2DA 4D4GA 1C30A 2V65A 4YAUA 3GT7A 4EY4A 1MVNA 2BMFA 3EIFA 1XCLA 1Z73A 4KSYA 1RAFA 2P2SA 4BNKA 4QTYA 4HEJA 3PLAE 1JFLA 1LSSA 721PA 2JLVA 4BO4A 4JI0B 1SU7A 3TECE 3H8WA 1GCIA 3ND9A 1JVNA 1SVKA 4MQFB 2D62A 3L7OA 4HYEA 1BE8A 1DV1A 1USUA 1Y5IA 5FCDA 2CB9A 4R41A 4DIOA 4OYRA 3FKQA 3WGQA 2DRIA 4IBOA 1DL5A 3AEYA 4TZTA 4TTQA 1C5KA 3H0KA 4TN1A 4Z2AA 3R23A 1L4GA 1JEQA 2CDBA 4MV3A 4BVAA 2IRWA 5EWMA 1ZGZA 1JE1A 1VG0B 2YV4A 2ZDQA 1KZYC 1UC8A 2KYRA 3OA0A 4RJLA 4WNYA 5ECDA 5FWDA 3Q2OA 4OK6A 5JTUA 4BRSA 5DV9A 4RY0A 1ESMA 2ZTUA 4X63A 1KYXA 3HLYA 3F9RA 4WOCA 3JZMA 1DX6A 5C4IA 4JC5A 1DFGA 1ZGHA 4LE2A 4M1QA 4RVHA 2DWOA 4NG4A 2PGNA 4L4YA 1XHLA 1CQIA 4NZ9A 4Q7QA 4EP1A 3C6MA 1OI3A 3OQ1A 4FLEA 2DFKB 4N3CA 4HDOB 2XMPA 3T9CA 3WSWA 2XVMA 1EQ2A 1MB0A 3GCXA 3LKDA 4Q16A 2C9ZA 1GU0A 2ORIA 3A2LA 1JHDA 2HA7A 3LHFA 3N07A 4NATA 4BNMA 1GUDA 2JFYA 3R7WB 1D6JA 3G2PA 1KJ9A 1GLNA 2FMKA 2VTEA 5IUNC 1OW3B 2GILA 1WXWA 2ID4A 4L72A 4TTJA 2OQ2A 3LRPA 1YZVA 1GQOA 1LDEA 3O8QB 2A14A 5BV0A 1MJNA 4L78A 1CUGA 3NUGA 3BVPA 4EITA 1Q0PA 3IE1A 2GCPA 1Z0IA 4KE7A 2VS1A 5TS3A 1QHSA 1IJEA 2J9RA 1OBFO 3FHOA 4NU6A 4PAWA 2A33A 2AB0A 3AM4A 1N4DA 2FSGA 3PC8A 5CT8A 1CNMA 3PQFA 3PGVA 1DTEA 2HAEA 3WXBA 3GLHB 5F51A 5JROA 1ZJWA 3H13A 3NM5A 1GL3A 1VL2A 2CJPA 2J31A 2E4YA 2OCYC 2TMKA 4NCIA 2OT3B 4PSVA