1KDYA

Pseudomonas serine-carboxyl proteinase complexed with the inhibitor aipf (this enzyme renamed "sedolisin" in 2003)
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
368
structure length
368
Chain Sequence
GTAKGHNPTEFPTIYDASSAPTAANTTVGIITIGGVSQTLQDLQQFTSANGLASVNTQTIQTGSSNGDYSDDQQGQGEWDLDSQSIVGSAGGAVQQLLFYMADQSASGNTGLTQAFNQAVSDNVAKVINVSLGWCEADANADGTLQAEDRIFATAAAQGQTFSVSSGDEGVYECNNRGYPDGSTYSVSWPASSPNVIAVGGTTLYTTSAGAYSNETVWNEGLDSNGKLWATGGGYSVYESKPSWQSVVSGTPGRRLLPDISFDAAQGTGALIYNYGQLQQIGGTSLASPIFVGLWARLQSANSNSLGFPAASFYSAISSTPSLVHDVKSGNNGYGGYGYNAGTGWDYPTGWGSLDIAKLSAYIRSNGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE-CARBOXYL PROTEINASE
publication title Inhibitor complexes of the Pseudomonas serine-carboxyl proteinase.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Hydrolase/hydrolase inhibitor
total genus 137
structure length 368
sequence length 368
ec nomenclature
pdb deposition date 2001-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1kdyA00
4Z2AA 1GA4A 1XF1A 1Y3BE 3AJ8A 1BE8A 1CNMA 3P5BA 4OV6B 1AV7A 1TM7E 3DE3X 1Y33E 2WUWE 3WQBA 4J94A 1SCJA 4YN3A 3GCWA 5CW1A 4BWGA 5ARDA 1SUDA 1HT3A 2X8JA 1GNSA 1MEEA 4CG0A 1AK9A 1ZVJA 2HPZA 1AVTA 3Q40A 1DUIA 4ZARA 1P7VA 1VSBA 3VV3A 1YJAA 3DE6X 3DE5X 4NE9A 4DJ5X 3VSBA 4HX2A 3LPAA 3AFGA 3DVQX 1A2QA 1SUAA 3DW3X 2Z58A 4LVOA 3EE6A 5AQEA 1T1EA 1ST3A 2PQ2A 1SUEA 1SELA 3BPSA 1SH7A 1PJ8A 2GKOA 2PWBA 2PYZA 5SICE 4WOBA 1GT91 1Y48E 1OYVA 1P7WA 2PRKA 3EIFA 1YU6A 1PFGA 1C9MA 1KDZA 5B1EA 1KE2A 5JXIA 3ZXYA 3VHQA 5I9SA 1OYOA 1OT5A 3A3NA 3TI7A 4NMXB 2E1PA 2SBTA 1SIUA 2ZRQA 5FFNA 1Y1KE 4GI3A 2Z2ZA 2SNIE 2ZWPA 1IC6A 1WVMA 2W2OA 1Y3CE 4M1ZA 1TECE 1SBCA 1SBHA 2DP4E 1TM3E 4NE7A 1Y34E 2W2QA 1JEAA 3GT4A 3LXUX 5ARCA 4H6XA 3DE0X 3I34X 3SICE 2QTWB 4I0WB 4C3UA 2V8BA 2Z30A 2X8JB 3DVRX 1DBIA 3DE1X 4AKTA 1PTKA 1WMEA 3F7OA 2Z56A 1AU9A 1LW6E 4CFYA 3A3PA 1KDYA 4JP8A 1V6CA 1YJBA 1TM1E 3BGOS 3I2YX 3DW1X 4HVLA 3UNXA 4FONA 1KDVA 1WSDA 5JMOA 2IXTA 1C3LA 1Y4AE 2PKCA 1SUPA 2ST1A 5AMXA 4ZOQI 2DUJA 1SCBA 1Y3FE 1SUCA 3VYVA 2B6NA 1Y3DE 1BFUA 1TO2E 3DWEX 2HD4A 3LPDA 1TK2A 2ID8A 1SIOA 3DDZX 2WV7A 5ARBA 2Z2YA 3D9QX 2W2MA 1NLUA 1SN7A 2Z57A 1R6VA 5FBZA 4AKSA 1S2NA 4OMDA 1Y4DE 2PMWB 5AVJA 2G4VA 1WMFA 2W2PA 1SBIA 3HJRA 3TI9A 3PRKE 1UBNA 4RYDA 3Q5GA 5B1DA 1GTL1 3WIUA 1SCDA 4K8RB 2PWAA 3T41A 4H6VA 4OMCA 1AH2A 1TM4E 1ZVKA 3DYBA 5JXHA 1SBNE 3DE4X 5K7SA 4KB5A 1CSEE 1AF4A 1EA7A 1NDUA 3I30X 3F49S 1MPTA 4H6WA 1T1GA 3VTAA 3WHIA 1SVNA 3DE7X 3TECE 2ID4A 3AJ9A 1GA6A 1Q5PA 4DWWA 3GCXA 3DE2X 5JXJA 1GCIA 1BFKA 1BH6A 3QTLA 1SCAA 4WOCA 3D43A 4CFZA 3BX1A 1ST2A 1PEKE 5AVKA 1V5IA 3ZXXA 1GTG1 1EGQA 4KG7A 1SIBE 3PTLA 3I37X 3GT3A 1BE6A 4MZDA 2P4EA 1TM5E 1P8JA 3EDYA 1S01A 2WWTA 1GTJ1 3VV2A 3L1KA 1S02A 2SICE 3LPCA 1IAVA 3H42B 5JXGA 1NDQA 4DZTA 1SUBA 1GNVA 1SPBS 3F7MA 5FAXA 4KPGA 2ZWOA 1GA1A 2IY9A 4B5LA 1BJRE 2WUVA 3CNQS 3A3OA 1SCNE 4LVNA 3WIVA 4C3VA 1T1IA 3CO0S 2XTJA 1Y9ZA 2XRMA 3QMPA 2TECE 3QFHA 1KE1A 3OSZA 1TMGE 1R0RE 1SBTA 3SQOA 2DQKA 1TO1E 1AQNA 1YJCA 1THMA 1R64A 1C9JA 2W2NA 2SECE 3DVSX 1WMDA 2Z2XA 1C9NA
chains in the Genus database with same CATH superfamily
2D3TA 3KT0A 1E2MA 3MELA 3O1LA 4RHTA 3LCMA 1A9PA 1U0OC 4ZOEA 1RAFA 4U2EA 2J9RA 4CHTA 3AF4A 4FLFA 5KVSA 4U2GA 2B9EA 1XB2A 3QLTA 5DWVA 4EHJA 2ISCA 1WHTB 5K03A 1AJEA 1NUSA 5I6DA 3QVGB 1VCOA 1TXGA 5DXAA 4J2TA 1KO7A 1RXIA 1CNMA 3QWAA 4MLCA 3S40A 4HXGA 1Z8FA 3LPNA 5EN4A 4UHEA 3GJ3A 1VIAA 1HI9A 3T4XA 3WL3A 2HCJB 4CKYA 7MDHA 2BF4A 1SHZA 2Z4RA 1A7KA 4PLFA 4MVJH 5LP1A 4FCCA 1Y5RA 5FL7A 1EGAA 4Y6QA 5FYDA 4ZVSA 1G6Q1 2HQOA 4QU9A 1U9YA 4TV8F 4CTOA 1WEKA 2Q6OA 3GRUA 2ZTUA 1PDOA 2P9FA 4YRFA 2E4UA 4P1ZA 4ZU6X 4UEKA 4ZVTA 1V3VA 1GY8A 1HX7A 2CZGA 2X23A 4GBGA 4CEIA 1YS2X 3OT1A 4A23A 3H5TA 4PTLA 2PGXA 3GCWA 2VHQA 4LOJA 4G5GA 1ZXXA 1RRFA 2JCYA 2YV3A 4MO9A 1D04A 3H6GA 3OPMA 3R44A 4YCJA 4CG0A 5LQKA 5LL6P 3DBHA 4P9NA 3EWIA 4PU0A 4WY5A 3KSBC 3IPRA 2BTQB 4US0R 1QYXA 3HDQA 5BY2A 4PGFA 5TMBA 3ZWYA 5DU2A 5KSYA 4KXNA 1KSGA 2PGAA 3KXPA 1W0JA 4IINA 3EAQA 2BVNA 4R2XA 4KNWA 1ZOIA 1VSBA 1UK9A 4Z1MD 1ORDA 3ZHRA 2IQIA 2V54A 1UMDB 2HQBA 3T5CA 4EQZA 5CVJA 1A9ZA 2I6GA 3PQEA 5JVDA 4J0FA 4NE9A 4L8VA 4G0UA 2H7CA 3B78A 3HBMA 2GPJA 4AULA 2YHUA 4H7JA 4HX2A 1ECPA 1LRLA 4WH0A 1J21A 1G16A 3NDBB 2CD7A 2ZXUA 2H85A 4RIHA 3IP1A 1T5SA 2Q49A 2YC4C 4BNJA 1PX2A 1BW9B 1TVEA 2A9VA 2XNKA 1WZUA 2HUNA 3ITDA 4NZMA 2G0TA 2QLJA 1QF9A 3S2FA 5IMSA 2O19A 4LVOA 2CXSA 2WI8A 3CINA 2FRDC 3DEHA 3ZY5A 5FJIA 3O9VA 3HVKA 4YPOA 4CCAA 1PLLA 2XZTA 2Q99A 3L18A 4Z9YA 5A5FA 1W36D 1DC6A 5E6RA 1UK8A 3Q3CA 4COKA 1V8FA 4OQPA 3T9DA 1T1EA 5ALOA 5EE0A 1Q57A 2QM8A 4PLZA 4DF3A 4DGSA 5KNBH 3TQCA 1FS5A 4EOGA 4M60A 1UT6A 1IM5A 2QP4A 3G3EA 4IDGA 4KV9A 4ZANA 4E6EA 1PJ8A 1PVDA 4EKYA 1P61B 3RU3A 4AC9A 4WY2A 4LKOA 3N8KA 5EIXA 1VOTA 1UT5A 1XMVA 1XPRA 3R5FA 5AI8A 3OM1A 1Y0BA 3E5RA 4XGKA 3HCOA 4HH4A 1BS2A 2UZ0A 2R4TA 4DV1B 1TVCA 4QLAA 3LLUA 2ACEA 3PFWO 1YHNA 5EG5A 1VJCA 1GGJA 1U11A 1JQJC 3C8DA 3D2AA 5FNZA 3VR6A 3ESAA 3WYCA 1YIAA 2H0QA 5KSPA 1TNDA 1XPOA 3HA5A 5JAZA 1HOTA 1KJJA 2J4DA 2UZAA 3R41A 1FUEA 3D0KA 2VJLA 1U1GA 1LDMA 2NQ8A 1UJ4A 1XDWA 2C2ZA 2A1TS 4OBWA 5H7XA 1NP6A 2W6IA 4DCSA 2B78A 3OZEA 1ZI8A 4C04A 1EHIA 4P3KA 4AO8A 2ICAA 1KZ6A 4B4KA 3HXOA 4NRDA 3N2KA 3P2MA 4DJFC 3KQOA 1KI2A 4ND3A 1P19A 2Q3DA 2X15A 5FBQB 4ABYA 2CWDA 3AR2A 3BVPA 1C0PA 1WCIA 1WDLA 3BSWA 2CJFA 5CAEB 1S7CA 2FLVA 2WSBA 4BNDB 1P5JA 2NZUG 3TRKA 1KZ4A 1RBQA 3MB5A 2NU9A 2HJHA 2G7MC 4IGAA 4YMUA 6REQB 2NP6A 1PJCA 2FTKE 2JEZA 4ARVA 4BP1A 4DGQA 3DB1A 4ZHSA 4C4TA 2VDJA 1RLOA 1SIUA 1YZHA 4M88A 5CCEA 1YB6A 3O7WA 2NZ2A 2ZJ1A 4RK0A 2CB9A 1KAOA 4IFTA 4O0LA 3DFMA 3G17A 5IABA 3D3KA 2OBFA 2P7IA 4LJAA 1Y3CE 1P9NA 1M8GA 1Z3IX 2ATEA 3D8SA 2IV2X 4A91A 1L7MA 3R8CA 5HRUA 1FP2A 4PZ9A 4KH1A 3RYFB 2PUBA 3LDFA 3TLEA 6PFKA 5KKAA 1A96A 4MQ5A 2Q46A 4EKEA 3QFTA 2OWEA 4HDKA 4XWWA 3A14A 2Z04A 1CEXA 3OKAA 5K0LA 3KQLA 4BQQA 4IHKA 3WO1A 3FVTA 1E1KA 2EFJA 5HQJA 4EMUA 4JY7A 1DOAA 3AEUB 3EIHA 1B15A 2ZCVA 1KMIY 4CDGA 1CCWA 3WGTA 4C87A 5ADHA 5C4IA 4IJQA 2OKGA 2WYOA 1MRNA 2PGJA 3CHYA 4Q0MA 5L4NA 5KS2A 1THZA 3NM4A 1QTRA 1XJWA 4WASA 3PJRA 2QU8A 2KMLA 3M0EA 1DBIA 5KWIA 2R48A 1EJ0A 1GPUA 2G4LA 2P30A 2J4FA 1AMNA 4NTZA 4S1NA 1X77A 3Q6MA 2IEBA 5F2OA 1SU6A 1KP9A 3F3MA 4Y7CA 5J5AA 4YBRA 5KI6A 4ND4A 4O4HB 3CZQA 2OE2A 2JLRA 1GTZA 3MT8A 3SEAA 1NVBA 3OCCA 4JOBA 1XMSA 2A0YA 4FSXA 4LN1A 4Y2UA 3SLKA 4TYYA 3LCCA 2VK1A 1KEPA 5H68A 5IMBA 1GITA 5CBPB 4RA6B 5BYKA 1Q6ZA 2OCXA 4L2IA 3M6LA 3TQIA 4DQ0A 3DHVA 4B5KA 2IBTA 2J09A 2Y4OA 3COVA 4B85A 4MVXA 3U16A 4IGEA 3BWEA 3UOGA 5C5CA 3UPTA 1XVVA 4HUQB 1Z25A 1UWCA 2FW1A 3ZVMA 5AUPB 1YDEA 3C7AA 3CONA 3VU0A 2IS6A 3C85A 1OREA 3C8HA 3HYTA 1TM1E 5ENDA 5BMVB 1FE8A 2B7CA 5MGBA 3IJRA 4ZVLA 1GQSA 5CIWA 4QM6A 1L1RA 4L1KA 5G3YA 4BTLA 3F2IA 1DJNA 1PT6A 2FKAA 2WU4A 4LDZA 1ISIA 2G9ZA 1QQ5A 3KAPA 4QATA 1P3DA 4LRUA 2VQ3A 2K7ZA 3GJ7A 1H9CA 2X58A 5KNLA 1HE1C 4D4MA 2COUA 5JSQA 3SLRA 3H11A 3NEPX 3RAGA 2JI6A 4C08A 5EE9A 4NK5A 4X97A 1N2CA 1ESMA 1K0UA 2O5RA 1PUJA 2I78A 1Z6ZA 1NBOA 1YVDA 3U4MA 4PCLA 1IPHA 4TZ6A 2GWRA 5ESXA 4Z9FA 1Y3FE 3FMPB 4KREA 5LQAA 2RH9B 2JKYA 4ZO8A 3TOZA 4CKWA 3E8SA 2IUSA 3K0EA 1YA6A 3JSXA 4DJJA 1EWYA 2GZSA 4QASA 1HBJA 1RHUA 1V0JA 2G1AA 1NJ6A 1TO2E 1BU5A 3GGSA 4PLCA 3RRYA 4N5IX 2VHVA 2YL2A 3BMNB 4DOMA 1H3EA 3GLKA 3UWDA 2C96A 3CUSA 4YS6A 3UYLA 4QUIA 3VR6H 5B7GA 3UJDA 3FYHA 1XXHB 4X6UA 1LC0A 2W0SA 3LY9A 4PLGA 3NATA 3VSDA 2PZ8A 2ZTVA 1P0PA 1QPGA 2AG1A 3GT7A 4D9CA 3R5XA 4L22A 1YVEI 4BQSA 4P4NA 4YP1A 5T3UA 4JLUA 3PHHA 1RACA 4LAFA 3HC7A 1T6NA 1KKUA 3WNDA 1LV7A 2VZ0A 5CB6A 3OUZA 1FIUA 1P18A 1QP8A 4ZIRB 1KR2A 3E9DA 3L84A 2W6JA 1VDZA 3WLLA 1HEUA 3O9ZA 4W5WA 3WL7A 5LBUA 2RGBA 2R8BA 5KU1A 4A8HA 4YAFA 2IBMA 1SGWA 1GKKA 3JQDA 4CLEA 1F48A 3HU3A 3KKEA 4B6EA 5KO2A 4UMDA 1WCWA 1E20A 3JCZA 3WO0A 3NFRA 2N0SA 4K9MA 1ONNA 3DF9A 3AHHA 5KDDA 3BA1A 3Q5EA 4DCTA 4QHSA 2RGRA 2BGGA 1XDBA 1PHRA 4IIJA 3V32A 3D5EA 1XR3A 1X39A 3DP7A 3D7MA 3G68A 2XE6A 3OZ7A 4KH0A 1WUJS 2ZRKA 1EIWA 1Q22A 1PV1A 1L7PA 1T2DA 3KJHA 3LKBA 1QIMA 2GDJA 2OHIA 3M5CA 1FVFA 4RD0A 1UMCA 4DV5B 1J90A 3OWXA 4KSCA 1O95D 3F67A 2D0DA 3ELYA 3NHWA 3P2IA 4AZ3B 5F4BA 1E64A 1PI3A 5ALFA 1ZA1A 2GAAA 2Z8YM 1KPHA 2H4YA 1CUFA 2DH6A 2X3UA 3TCXB 1SVWA 3RIEA 1TQHA 2LKCA 1RXUA 4OH1A 2XADA 3ZVRA 3H75A 4K0KB 2QW8A 3D31A 3O4VA 2FSPA 1HV8A 2C2KA 2ZSIA 1NXXA 4HNTA 1Z63A 2OM6A 1UBRS 1XAGA 1YI8A 3EXIB 1QIHA 1H0KA 3IR6A 4M7PA 5LMCA 3W6OA 1Q95A 1X7XB 2VHYA 2VTKA 1NG9A 2HLHA 2Y0DA 3QUQA 4YT8A 3I30X 4IOJA 3KZKA 1MPTA 1WVGA 3W90A 3X2SA 3PIIA 1F60A 3IQFA 1LV8A 4PZZA 4ZQGA 1P6UA 3UATA 4BMSA 3ZHUA 1UF9A 1UXKA 4FYVA 1PWEA 2C57A 1PS9A 2I3BA 3CEMA 4H7EA 3S1LA 3VHXB 4AN1A 5AUNB 4KAXA 1BDIA 1C8KA 1GL9B 4KQXA 3C48A 4N3GA 3JW8A 5JCJD 3CGGA 3WLFA 2FUG1 3PQFA 1QCCA 3GG2A 4PHCA 1QG4A 4YAJA 3YASA 1E1LA 4P92A 3LDHA 5K3CA 5CG1A 5EZ5A 2B8NA 2HMWA 4U9IS 4LWQA 4PZEA 3C6MA 3WA7A 2EX0A 1MU0A 1YRAA 2GDZA 3VKGA 1EXMA 4XWAA 3O8CA 1FDSA 2J3KA 4WCFC 1VM6A 2DBQA 2IHJA 3NOQA 1QG2A 1SCAA 1GNRA 1GUDA 4DLVA 1C29B 2PA3A 2PO7A 2BE7A 2KI5A 4NAVA 1I7NA 2GCOA 4Y1EA 2Q07A 4OYYA 1W46A 1Z4KA 2HB6A 2PX2A 3NIDB 1GM5A 1U9ZA 2X8AA 3D7LA 3PR2B 3EIEA 2G1JA 3OBIA 3B1XA 3SYMA 3ZK9A 3M6FA 2IDMA 3I04M 5FB3A 1UDXA 2WJZB 3IS3A 1DEXA 3BB1A 4J7UA 1LDYA 2FUKA 5IKPA 5GWXA 4X8OA 1EAYA 2AC4A 1KBZA 3PX2A 4XWTA 2D2VA 2YWEA 1GTRA 3A0RB 4EO7A 2NSDA 3DOFA 3ZE1B 1E2IA 1U7OA 3FCSB 4AYXA 3T06B 1CUHA 1R6DA 3A6HA 5DI3A 1AB5A 2A3NA 2Q2VA 4ZOLF 4MH0R 4OGLA 3T52A 4KKXB 3TQHA 1D4AA 3GLRA 3I9OA 1Z0FA 3U9LA 1AQUA 2WJVA 3T9CA 4B84A 4IYJA 4TS9A 4MWBA 3H5NA 4J43A 3RSGA 2F3PA 5CT8A 4RPCA 1A04A 4HKTA 4M2LA 4J3NA 5C34B 3O1JC 4IH4A 4NU5A 4WCDA 3V97A 3RADC 3L1KA 4MP8A 3MG9A 1CZNA 3ZQ6A 5CA1B 1RU3A 4BOYA 2AVDA 3AT1A 1IHPA 2IZOA 4OL0A 1JFFB 2XTZA 4M6WB 1MA0A 2JC3A 1UJMA 2EF0A 3LO5A 3PFIA 4AURA 4F06A 3ZQJA 3QPUA 2XGMA 1L8XA 2V9ZA 4I2VA 1LFAA 4I1IA 4IKPA 4OB7A 1UJ5A 2Y1XA 2F3RA 1WW3A 2PUVA 3HWX1 1STOA 2WM9B 3HDJA 5E1MA 2W70A 3UYKA 4PONA 1IAQA 5C80A 3THXA 2F1HA 3LDAA 4QIHA 3AGPA 4HLUA 4I4TF 4JL5A 4RHCA 2FMXA 1ISHA 4BC1A 1NMYA 1GPAA 3HB5X 5JZBA 3OESA 3KEQA 4BMNA 5FOWA 5FI0B 4E2WA 1DEOA 4KCGA 1FRZA 4NZYA 3NXSA 4BMZA 1ZNXA 2G76A 4EF4A 1QMGA 1EFTA 2XMPA 3GB9A 3VR4H 1K4KA 3IX7A 4E5PA 1Y9ZA 3KD2A 4ZPJA 3HV0A 1RYDA 1YTLA 4CM8A 2M6LA 2QVZX 4LGYA 1QCZA 2GRAA 4BQOA 4ZJZA 2O8DB 1XELA 2NVWA 4EDFA 4Y9TA 3OSZA 3PZBA 2HBZA 2OBLA 1NNLA 1K3UB 4UEOA 3OKPA 2VJMB 3F78A 1N9GB 4J2OA 4PN3A 2QX7A 2XUDA 2YMMA 3AF6A 1Z74A 3R7FA 4EKDA 1X1EA 2C92A 1NOJA 2IIPA 1VLVA 3GA7A 1PCXA 4N1AA 5A5DA 2C31A 3NEAA 4KVAA 2QE6A 3TTWA 2CMKA 4AMUA 2DPHA 2PR2A 4UARA 2I3AA 4DDTA 4EG5A 2XLBA 1UMKA 3TG2A 2FRXA 1VMDA 1Z2OX 1MKYA 4R8RA 3WQSB 5C5EA 1KQOA 2I4NA 3ST7A 2OHVA 5CB4B 1I6LA 1DCFA 2DQYA 3ESCA 5A4MS 1EP1B 2FSGA 3FPLA 3AYZB 4HWSA 2FSFA 1WNFA 4F1JA 1ECLA 1JHOA 4GBMA 5L45A 3N7UA 4UCWA 4F2HA 1BE8A 4DUGD 3MMPA 1FFSA 2EU8A 2IHUA 2FR0A 2FQQA 3LRPA 3N2IA 4JB0A 3T7EA 3FSJX 3LTNC 3ROXA 2ZS8A 4EATA 5J1TB 4MV4A 3GI1A 3ZWVA 4XSGA 4ZO6A 1UFVA 2FPSA 4V03A 3G85A 2A92A 3EDQA 2B1QA 4QOGA 4GXQA 3EZNA 1T5TA 1WTCA 2PZKA 3HB4X 4XD7A 4MRPA 4A10A 1EJ6A 2YINC 4RADA 5CLHA 4YC7A 3ZU5A 3WGUA 4QEZA 3F6SA 4F21A 1GRRA 1U7HA 2APJA 1HC7A 2QV7A 1R5OA 3O1HB 3DLBA 1YUMA 3WFIA 1YCDA 3RVMA 4BKQA 5C9ZA 4EARA 1YZTA 3PDIA 1RFGE 2HTFA 4FINA 1JBEA 1N2HA 3OLCX 1JQLB 4KK4A 3DWIA 5I4BA 1VYVA 4EQ6A 2O8FB 4FFNA 4BNNA 2JGIA 2WSSA 3QKTA 1P60A 1B0ZA 2VC2B 3KL4A 4BMOB 3OICA 3EQZA 1E2GA 2ZU6A 1OZ0A 2QHXA 3JTEA 4D43A 3ZHOA 4JA2A 2I54A 5B2EA 2VPQA 4RDIA 1W5TA 3GVPA 4FLMA 3GJYA 5LQNA 5LZ5A 3OEED 5DNAA 2I3GA 4UXHA 4J4HA 3RTEA 1A69A 3DZ8A 3I1FA 1NKVA 3H18A 3WE7A 2VDWB 4WNAA 1W5EA 4DL9A 3W2TA 5M04A 3OWOA 1RHKA 3N39C 1A0OA 4HY3A 1HOXA 4P83A 3JD1A 2WVHA 1WF3A 4MUAA 1IXYA 2XUKA 5D01A 1H8HA 1Z0ZA 1V16A 4OHXA 3HU2A 1XDUA 3D3EA 3DBLA 3U0BA 1KFCB 2G63A 4GSYA 4QRDA 4JQZA 3X0DA 1RVV1 4ZYVA 2JZCA 5E2BA 4DLRA 3KFLA 4RLSA 5JARA 1PIWA 1DX4A 3LFUA 2XUQA 2GUWA 3DQQA 5A2GA 2ILTA 2VDUE 3GH3A 4OYRA 3AVWA 3KSAC 1NONA 2DHRA 2DT5A 1OTHA 4HH1A 5CGZA 1DE0A 4KLZA 3EA4A 1UM9B 3JZIA 4WXMA 1N1MA 1HFWA 3K1TA 3WK8A 2HUPA 2HSWA 5TS2A 1JALA 4LRXA 1JBQA 3IHWA 4PG7A 4BMPB 4CF7A 1FQOA 1G41A 3WGZA 4RSHA 3M4ZA 4WESA 2HDWA 5JNTA 3HGMA 3QNUA 2V59A 2I1QA 1SQFA 2J7PA 4AN4A 1CJCA 2CL5A 2JGMA 4OP1A 4JGBA 5EEGA 1XWIA 4HDRB 4OQFA 4UJ5A 4W63A 2IHBA 2O14A 5LLSA 3W2HA 3FDJA 1HQKA 1ID1A 4FGSA 4GNKA 3ROQA 4E21A 1HZJA 1J7JA 5KOJA 4MAMA 3J81k 1P7WA 4AIIA 5HSGA 1B6GA 2REOA 1W2GA 1OQAA 2PRKA 1PVOA 1XZIA 3ANYB 2WHRA 5B1IA 3FN4A 4O59O 4TRMA 3V8QA 4WBNA 3S8EA 5CT5A 3A2LA 1E2NA 2BRUC 2C5LA 3L05A 4B17A 4I6JA 3C6ZA 1E6CA 3A1FA 3K1JA 3AUAA 3LO8A 3P2JA 1MW8X 3OU7A 3CW2A 2RHOA 3QE4A 2GRJA 3FCUB 3KU4A 4Y1RB 1QAQA 4EGSA 1SFRA 4CM7A 3F6CA 1MC8A 2IXDA 3UXYA 1GJRA 1JS1X 1BEUB 1ZRMA 3GIWA 2LPMA 3MFYA 4MV6A 3K6RA 1GT6A 2IYEA 5EY5B 1D2CA 2W6QA 4LUCA 4XWKA 5BSRA 3REGA 5NLLA 1J39A 1DCKA 4M0KA 3AERA 3QK7A 5BQ5A 4KDRA 4PWYA 5IHXA 3H2GA 1HDYA 2WFAA 1M7BA 1IULA 2MJLA 3PC8A 4JXZA 2V1UA 2W4IA 4RC9A 5EYPA 4Z3KA 5G0VA 1UOPA 2I80A 3AUXA 3WMEA 3GNQA 1JIJA 3L0BA 1E59A 3PQ8A 4NZPA 1H2AS 4EB6A 5A62A 2WD8A 4M99A 3RK4A 3HWWA 4PW0A 5G1PA 3PKIA 4OHVA 1I1NA 3B5JA 1VXRA 3QMVA 3RAPR 2Q7OE 2BOVA 1FSZA 1NVAA 3GUCA 5AJVB 3S0JA 3OLQA 5A05A 5EZYF 2A57A 3W06A 4ROTA 3HGQA 4CCWA 4F56A 2DAPA 3QA3E 1YUBA 5HKBA 4H31A 1GFSA 1MOQA 4XVCA 2DP4E 4YRAA 1W4LA 2P7HA 3KLOA 3NHRA 2XUJA 3TRDA 1LBSA 3M1AA 3RT9A 4J49A 3C6XA 1FLVA 1E4EA 5JLAA 5AVWA 3CUTA 2GEVA 5D1NA 2JHGA 1TGYA 5C18A 3V6LA 1DRKA 3ESYA 3LVQE 4BTVA 5CFMA 2O3JA 3K15A 1HE8B 4BV9A 5HYVA 4GI7A 5EUQB 1MJGA 1GTVA 3P4UA 2PO5A 3RYIA 3C5CA 3BFXA 4AQ7A 4JKIA 5AKGA 1OAOA 1U1IA 4JSYA 1YAHA 4CEIB 4YQYA 3OT1B 3LHIA 1UPXA 3EOBI 5KKCA 1T3GA 3CX8A 1T9AA 2ONZA 2XUAA 4G0QA 3KDPA 4TTQA 2J5QA 1Z36A 3GFPA 4IL5A 2POCA 1VECA 3EZYA 1X86B 3BGIA 3F9IA 1MG0A 4OIFA 5HG0A 4Q7EA 3S2UA 4BO5A 4F46A 2IBSA 1WV0A 1M5UA 1T2EA 4OXXA 3KSRA 1TLFA 4E3ZA 5JWRA 3DBHB 4GYWA 3ZLBA 1G66A 2HBRA 3LW7A 1QKIA 3UMJA 3W5SA 2QRQA 3WYDA 3EA0A 2Q6KA 2HF9A 4H6PA 2OAP1 3DDSA 3W6ZA 1YB5A 2X76A 5ALGA 4ZEMA 3LY7A 4ZD6A 2GJ9A 4TT3A 4JVOA 3HDYA 4GLJA 3N74A 4L15A 5EHQA 1NLMA 1U2GC 2Z98A 5JVDB 3QU4A 2G28A 4GGOA 2D1YA 3DHWC 4R2MA 3A2KA 4NZOA 1GLVA 4KIWA 2PS0A 3CH4B 2YZGA 3LZDA 3MRSA 3IESA 1QE3A 1XZAA 2YVUA 3IKLA 1IXRC 1USUA 2DECA 1YJBA 4HQNA 4ZQEA 7MHTA 1SXJA 3I2YX 1L4LA 2DFKB 3JQ9C 1IFXA 2AG6A 5HF9A 1AIPA 1ZKDA 4FVTA 2C7PA 2ZPTX 1JU9A 1X70A 2G25A 1YI0A 4NLLA 5E0OA 1KQ3A 3VHLB 4FONA 4MTLA 5I48A 4E5DA 3KLBA 3LA6A 1Q16A 3FFXA 1GRNA 4AO6A 1BH2A 4EF5A 4D42A 5AOCA 2N42A 5E6RB 4JI1B 4AM8A 1XWWA 2JAPA 4M1MA 4DMRA 2WT4A 1ONPA 1JUDA 4N3AA 2W6NA 3IODA 3K31A 3EVNA 2RK4A 2H5IA 4FILA 4NZZA 1JR3E 5J59A 2YVKA 3WKDA 3ZDYB 6ADHA 3SJAA 4BPBA 4EELA 1DARA 2GAJA 2H5EA 4QBKA 2D2IA 3NCTA 5ESRA 2VYVA 3TO5A 3TAXA 1LBEA 3WWEA 4C43A 1N2JA 1H2RS 2B21A 4OAQA 5BSVA 3CNLA 4KI7A 4W6ZA 2XKBA 5DHSA 2XKKA 1T5IA 1IBSA 3SP1A 2QR2A 3GVCA 4S0ZA 5BRJA 3DWGA 2RHBA 2EWWA 2E18A 4RTPA 4N18A 4D9GA 2BGWA 4G26A 1HT0A 1N92A 3LPDA 1T91A 1MNQA 4HO1X 3WLOA 1U7ZA 1I30A 3S81A 3PBKA 4DPLA 2OO7A 4MS3A 2OWDA 2OUKA 3L6BA 4ND8A 3DHYA 3TSOA 1QV6A 1X3SA 2O4UX 5IAEA 3F6YA 3R4VA 5J63A 1DFGA 3D8NA 1HE4A 1QS0A 5B4UA 2G77B 2KX7A 1ZM3A 2W98A 3AR8A 4JGGA 3P71T 1CUEA 3EXHA 3M6IA 4MQMA 3CYFA 2FWNA 1Z6YA 1M0WA 3N2KB 4GQBA 1Z28A 5AJWA 4TYPA 5JFTA 1N6OA 3T9EA 2FN3A 1NURA 2JJMA 2X5JO 1N2ZA 1O9BA 1ODTC 3JU3A 1WCIB 3IQHX 4IS2A 4IHQA 5DLDA 2XF2A 4C30A 3WRXA 4BB6A 2FAXA 1UDCA 2Q4DA 3AFNA 4PC2A 1S8AA 2ZTSA 2NU9B 4UFPA 7GPBA 1RHRA 1EWKA 1XIVA 1GQOA 3N8GA 4L8YA 3TZQA 4CUKA 2GBLA 4KE6A 2DU8A 4GMHA 3U9SA 4RORA 1VIMA 2OC9A 3RBAA 5ALTA 1JHMA 1MT3A 4BNIA 2C7BA 3KOMA 3K9HA 3ZVNA 2PBFA 5EFOA 2QD4A 1VPWA 4HGYA 3V4ZA 4R8KA 1GAEO 1JQ3A 3J80A 4JFRA 1GFIA 4GFDA 1LPSA 1CYDA 1X0VA 3G5AA 5F2KA 5DH9A 1FMTA 3WWOA 4P58A 2C3MA 5P8WA 2IYRA 3FNQA 3JQ6A 4WNIA 1N8NA 3ZY2A 2QVYX 4U5XA 3RS7A 2ALJA 2WK1A 3LHDA 1HFJA 1IQUA 3FCAA 4PYIA 2V6JA 2VF4X 2VA8A 3F5FA 3HN6A 4HDKB 3HR8A 4K8RB 1FEZA 2B0CA 4Z0TA 3TWOA 3TIIA 1K2WA 2XUPA 1CR6A 1M1YA 2QRGA 4EY7A 2EIHA 4RZQA 10MHA 3ED5A 1M7GA 2EXXA 1QWOA 1FLNA 1H66A 1PQ4A 2YN4A 1ZWKA 1T5DX 1P80A 3MT9A 3QEKA 3FKSD 4HBGA 4C21A 2ZSFA 3FJOA 2FHSA 2G06A 3ONDA 4BQIA 2X9GA 3PJDA 1XC7A 2J8ZA 3ZV3A 2BJWA 1G21E 3LM8A 6ABPA 5LQSA 5E3IA 2RHRA 2YRFA 1DIOB 3OOEA 1LPBB 1JFTA 1EB8A 3E27A 3DAYA 1USKA 4DR7B 4JBGA 4Z3OA 1M2KA 4HL6A 4Q66C 3CX3A 4R2WA 1W581 1KU0A 2BTEA 1HEIA 3CZMA 3PZRA 4M38A 2RIRA 1MP0A 5LMZA 2HNBA 4N12A 3KO8A 4QUHA 2GD2A 3W2FA 3WHIA 1GAXA 1M6WA 3RSFA 2HRZA 1FQWA 4QTXA 5IK2D 2ZM6B 3VKHA 4L2IB 5FBWB 1JB9A 1P2UA 2QUHA 4TWZA 3T7SA 1G20E 1UPTA 4QRIA 3KR9A 2YXBA 3L8DA 3NVDA 3P52A 4IRMA 4KYUA 4L72A 4QQFA 4U63A 1SRRA 3NHKA 2WA2A 4Q1FA 4C0KA 4MUEA 1DRVA 3FTFA 5HRCA 2PUEA 1GPKA 1BFKA 4MR8A 1V8PA 3K94A 3QVWA 5L6LB 2FPKA 2OCLA 1Y7PA 2Z08A 3ER6A 3GUVA 3MJHA 3NTOA 3CY6A 2OMEA 3WYBA 3ZI0A 1JPJA 2CZQA 5BSMA 2Q3HA 2E9SA 3LXXA 2O20A 3KBOA 4NCJA 2NWQA 1OASA 1KYIA 3VVCA 4UJ3A 3X1KA 4LXYA 4DXHA 4BB9A 4LMRA 1WB4A 2GJ4A 1L5FA 3H11B 4YQZA 5JCZA 4K6MA 4CEHA 1N2CB 5IT0A 1G18A 3W8FA 4BB5A 3W5AA 4MLPA 1VBMA 3HKCA 4W1SA 1MO5A 1YMVA 3CCBA 3FKJA 4BCBA 4YXFA 5BWOA 1VG8A 2GYWA 3CRZA 3UV3A 4CKWB 3VM6A 2FPXA 3EIWA 1KQNA 3T7TA 3RAFC 5C4MA 4MZDA 1J0AA 3FOFC 1OH8A 3OEHA 3G9ZA 2BFNA 4ITUA 4GX5A 3OY2A 2VSNA 3BDAA 3Q8KA 4NZNA 4WUVA 3OE4A 4ZQIA 4EW1A 4RKYA 3CVWA 1MO6A 4J0JA 5HIIA 4X41A 5BSKA 2H4FA 5T64A 1ULSA 3N9IA 1JP7A 3JYLA 3B48A 3HS3A 4ZK2A 1A9RA 1TADA 1HDIA 1LDBA 5EMLA 2QP3A 4ISBA 1H6DA 4OLAA 2AJTA 3QHPA 1Z38A 3S55A 1Q77A 1BS9A 2GCEA 3VZRA 4ZCRA 3L5OA 3L4JA 4EI2A 5H59A 3TZCA 4IUCS 1XKQA 1QTQA 1KZHA 1N7JA 2NVUA 3EOAI 4LZAA 4C9BA 3GLGA 4KX5A 4IJVA 3SY8A 1E6LA 2VP9A 1NI4A 1UBHS 3GJ0A 2NUBA 4YQFA 2QPTA 2CKMA 3ZHCA 2YWXA 3LS2A 3EYAA 1LUAA 3QX9A 4TSRA 3A6LA 2WTXA 2P11A 2VXBA 3VFDA 1XMPA 5EXSA 3UN1A 4AJ1A 5B4VA 3CH7A 5DISB 3ZGLA 4ALMA 5JSZA 1XN4A 2XTJA 4XGIA 2ODQA 4IIJB 3PHIA 4DCUA 4F04A 1JW9B 1MC5A 1E9VA 3DFIA 3PGXA 1GKIA 1UIMA 2BF7A 3GUHA 2ZBQA 1UMCB 2PKXA 3OQJA 4L4ZA 4MKXA 4UFNA 3W9BA 3E4DA 4Z4EA 2ZYIA 3HZOA 3LUDA 1PE0A 1UJ2A 1XTKA 4JMPA 3R3HA 4YRLA 2OQRA 5DM0A 3ZNOA 4BGEA 2ENUA 4EW6A 5AM3A 2CFIA 1XZHA 4C2TA 2E85A 3LBYA 1YE5A 2X6TA 3H2IA 4GAEA 3GX1A 3NM6B 2UYQA 2AC7A 3ONEA 3G9TA 4JC5A 2WQ6A 3E0QA 5BVGA 3SF8A 5DBGA 1IBKB 1VE1A 2D2XA 4LISA 2OGZA 5G1NA 3CX6A 1V5EA 1XI2A 2RARA 4A0GA 4EI7A 3L9XA 4EFDA 4PM4A 4BN4A 3AKCA 4P4TA 3EG5A 3MHPA 1Z62A 2OD2A 4RJKA 3QV2A 1SWWA 5BSEA 1ZH2A 3Q8WA 1K89A 4RK1A 2A35A 4RK5A 5LN1A 4B4OA 1L7BA 1YR6A 2HHLA 1USWA 4DJDC 1RTTA 4BGDA 2X3YA 1YONA 1UPBA 4OREX 5A3RA 4ZYZA 1RYNA 5AXDA 3FPEA 5AVYA 3VAZA 2YX1A 1MTZA 1N2GA 1OA1A 3BFPA 5TQ2A 4DYVA 1WCV1 1P1HA 3X1YA 2JAXA 4TLAA 4M46A 4WFQA 1IUOA 5I7HA 1ZG3A 2PLAA 3FCYA 1E3EA 3ZD8A 3ZHTA 4LE1A 1MB0A 2YWDA 1A88A 4X65B 1WD7A 5C7IO 4JVSB 1YR1A 7ABPA 3KYCA 4DA9A 1XT6A 4XFJA 3O21A 4E4TA 3HJAA 5CW1A 3R7SA 1IEWA 4DB4A 1A8SA 2GCOB 2Q2QA 3ZLVA 2F67A 1VA5A 4IR7A 1BX0A 1DXOA 1QRRA 2UZIR 2WZCA 3ETCA 3NIBA 3BD6A 1XCOA 3IHTA 4JJAA 4R69A 2PU5A 2FEWB 3CJQA 3WJ2A 4BP9A 3FNHA 1IUPA 1BD4A 1NE7A 1PWZA 3UMRA 4D0RA 8AT1A 4RTKA 3O74A 1G38A 5GJBA 4IAOA 1U2DC 4RO0A 5AW8A 1UBLS 4RU1A 3IUNA 2M6SA 1DUIA 1YKGA 4BQRA 2P0AA 1FS6A 4TM8A 3IAM1 3WIBA 4B4WA 5K99A 4MPJA 3LOQA 1ORWA 4G5XA 5DI3B 1XZEA 4QAQA 1W2HA 3SQXA 3DNFA 4O2AA 1EXNA 3C6KA 1N6RA 4KIUA 4NE2A 3WGHA 2GD0A 2WTMA 5BWNA 3C3CA 3H2YA 1EUZA 2LIPA 2FFHA 2RGWA 4QELA 4JUFA 1O7JA 1XRJA 4GPTA 2CXXA 4JB3A 2W93A 3OSUA 2VCYA 3PFNA 4BEVA 2ECKA 3NAQA 4IYRA 1HURA 2R97A 1Y82A 5DRYA 1Y6JA 1YR2A 5JO9A 4EX7A 1T3LA 3RC7A 4X45A 3ZV7A 4M1QA 4MYCA 1W88A 2HMUA 2HJVA 3SDZA 2GJSA 2J5RA 3HYSA 4HHEA 3T34A 1QLWA 4NEHB 1SELA 4N65A 1GNTA 2QXYA 2PJZA 4Z0HO 1VBKA 2RHTA 1RI3A 4LX0A 1YA8A 3BPSA 1Z33A 3UIEA 4A7PA 1O6FA 5HEKA 1IU9A 3QHQA 3OM8A 3THXB 5J2TA 1N77A 2XJ4A 1S1CA 1XZQA 2P9HA 3AHEA 1BE1A 4G0WA 3MNFA 4MLZA 2NXJA 2DBYA 1XRLA 2DBRA 1YXMA 1ZLYA 1CY1A 2IKQA 3B9PA 1QWSA 4QLBA 1E2KA 1ZJZA 3ORQA 1HWYA 4YP6A 2JIPA 2F8LA 1ZQ9A 3R0JA 3EEQA 4RF3A 1OX6A 1YU6A 3BGDA 2OCBA 2VP5A 1FYXA 3QPDA 4RVUA 3RRBA 1KPIA 2JGNA 2KJQA 4EFKA 5IJ9A 3EZGA 1KF0A 4BLVA 4BLSA 1RMYA 1Y1SA 1C3JA 4I81A 1PFGA 3HVRA 1CQXA 3RFUA 4CM8B 4MIKA 4LXUA 5ECWA 4M8KA 2XMCA 3NOOA 1ZY2A 4QOHA 2ZYSA 4JZYA 1BMFD 1ZWLA 2COEA 2DUMA 3EF3A 4N41A 3B2NA 1DU4A 1NASA 2WYHA 2OHXA 1C3EA 2JGAA 3O0TA 4EUEA 3C1OA 3WB2A 5L7TA 5I45A 4RY0A 5JE8A 1FTWA 3K2EA 5DV9A 4MIEA 4BNWA 2ZULA 3E8MA 4ZCTA 1P73A 2V3WA 2YIDA 4JP2A 1XFDA 4P82A 1K0FA 4AY6A 1WZNA 4F9EA 1IOLA 1HUQA 3IKJA 3IUMA 5ALHA 1UL1X 5C8YA 4RH3A 3P1JA 4A3SA 3P20A 2BV3A 4H4EA 5TPZD 4GM4A 3RS8A 3CF0A 2AL7A 2HSEA 2XCIA 2GEFA 1NN1A 2FG7C 3GV0A 4IIYA 5F76A 4A16A 1R0YA 4XB6B 1GEGA 2RGXA 1QYVA 4MQ6A 2ZSKA 4KMSA 1JPVA 3GLIA 1OZAA 1QKKA 1F17A 3GH1A 4OM7A 4EIWA 5AOVA 1ISGA 4ZC8A 4HJXA 4Z3DA 3DA8A 4UQPA 1XD2A 1UBEA 1LVUA 4KRYA 2CLOB 3QKUA 4TLCA 5C7YA 2AOTA 3RHTA 1Y34E 1Z0AA 2VPXA 1JEAA 3DZIA 3UCFA 3LXUX 1FFEA 2EATA 3CN7A 4W8GA 2GEDA 1G8YA 1YJ8A 2FK7A 3EMVA 4C5AA 1J00A 1RC1A 2CKDA 4DLTA 5K3SA 3KPVA 4YR9A 1YDWA 3HI6A 1E62A 1VLMA 1KY4A 3UJ3X 2B1IA 1QC5A 1K6EA 1ZHHA 2X1MA 3CFYA 1QK5A 4MGYR 4YASA 3PDIB 5ALRA 4FDTA 3TYXA 4HTFA 4MPDA 2X8BA 3TVDA 4C29A 1F7UA 4A8PA 2FP4A 3GD5A 4EQ6B 3QNMA 3RWBA 4EH1A 2WKWA 3IKMB 1T36A 1QAMA 1SBZA 4NARA 1K9VF 2VJYA 4BJHB 2Q3MA 2QPOA 2IDZA 1C4OA 4HWOA 4ZAGA 2QZPA 3WGVA 3T7DA 2WRZA 3BK1A 4QTZA 4BKRA 4D8YA 3E5MA 5IT9A 2Z5LA 3BMCA 3BE6A 1IJEA 4HP8A 1WDKA 1GSOA 1SWVA 5EE5B 2VHZA 1HKHA 1E1QA 3OIDA 1DQPA 1T3ZA 3PJFA 4WNAB 1N3BA 3PXUA 2XMQA 4Y9RA 3VR5H 1Q1AA 4LGCA 2JW5A 1W85A 2DY1A 3M4YA 4AS3A 2JGEA 2YVLA 3IQIX 2VP2A 5FLKA 3SOZA 1V16B 1V41E 5MF6A 3DBLB 1U63A 1DWQA 2AFHA 1KY3A 1NN5A 2XMBA 1VTKA 3S29A 3TNDA 4LZNA 1SC9A 2AEMA 3IH5A 5SZJA 5JFGA 3CLVA 1X0XA 1W49A 2PJUA 3NBUA 3AUYA 3B6ZA 3PUZA 3UAOA 4TKLA 4BU0A 2XOEA 2CL7X 1ODJA 4L0CA 5CXXA 1TEZA 5IWCA 3VJLA 4E5YA 1F3LA 2HQ1A 1D2NA 1HKUA 4ZZ2A 4D8UA 1OTYA 2YQ5A 4HCJA 2YZKA 3U26A 2PH5A 5BQFA 3QELA 4JSTA 2ZB2A 4C0LA 3W6UA 2AZMA 2ST1A 4NG5A 3CRVA 2OUIA 3WB9A 1JIUA 5IW8A 4BP8A 4DABA 1Q14A 3SFTA 3BFKA 2NT3A 1SCBA 1Q11A 2D5BA 2GETA 2IEGA 4I55F 1ZVVA 3G2KA 4BVAA 3HXKA 4J4TA 3I73A 3AL2A 4XRRA 4WOPA 1DB3A 1MHTA 4PHHA 2A5LA 1V43A 2D0PB 4EHFA 2FWBA 2G67A 2XA1A 4EPRA 2QTTA 1RKBA 2HY7A 1VIDA 5KOJB 1KTVA 3VDXA 2H0RA 2I4RA 4JYBA 3CGWA 1MJFA 1RLIA 2ADFA 2DG2A 3EJ6A 5MN4A 4KLAA 2MINA 3PITA 3SMQA 1P3Y1 4FYHA 4WBNB 1C80A 2QL5A 4J8PA 1HDEA 2EFYA 3KPJA 2PM8A 1J0DA 4DIUA 4TS4A 4BBJA 1RS0A 2QM7A 2J87A 1G3UA 4IMPA 1W0CA 2ON6A 1KU6A 3L0ZA 1M54A 4TRNA 1I94B 4Z4GA 4YAOA 3E15A 4IJMA 1S8OA 5HMMA 3QPVA 1CUVA 5FPKA 2NO9A 5AYVA 3FWHA 5HA5A 2YXLA 4LYGA 2CLDX 3UT6A 1Y89A 2X4GA 4N3BA 1H2HA 4I6EA 3HADA 4P22A 4RMNA 4YRQA 2LNDA 3B36A 3WLKX 3EVCA 3C1UA 2V97A 3T7AA 1RAIA 5EJ8A 3HO1A 3C3KA 3R3WA 1H2BA 2OD9A 1TKCA 3AERB 1DPGA 1JEQA 3B7WA 1FRFS 4KMMA 2A14A 4OMUA 2DBZA 1C7EA 1MXHA 4JBHA 5ALYA 1NHWA 2LV8A 3DNMA 4JKOA 4Y2HA 2DEUA 1Q1QA 1H8EA 1M66A 1OF1A 1S3SA 1U6JA 2H65A 1J42A 3AYXB 4PZUA 4Y1GA 5EYPB 4BXOB 3VPAA 5IEJA 1LRJA 5DB4A 4W8HA 4EB6B 3TZEA 4R3NA 1MQ9A 5AVJA 2W83A 5GJVC 5GGXA 5IUNC 5EKUA 4F93B 3QJGA 3A31A 1B14A 1Y7LA 1P44A 1L6RA 4EWLA 4Z8XA 1IHUA 5K4GA 1CRZA 3VX4A 2BBOA 3HJRA 5FLXA 3WGIA 2X86A 1JF8A 3J81A 2RJOA 3R40A 4D4GA 3OFNA 5KYXA 4RYDA 2D59A 3Q5GA 1QFSA 2R7NA 2XCRB 1VYUA 4XOUA 5KTYA 2FA9A 3OF3A 4XLTA 1E4EB 4QHYA 2CCKA 4UD2A 5FOVA 2Z4TA 2QM3A 2W6CX 3V7FA 3LZ6A 1QPZA 1DIBA 4QXOA 3B6JA 3A1EA 2ZKIA 3RWOA 1VLHA 4KVGA 3COYA 1ISFA 5HUJA 2QS9A 1TM4E 4ZVNA 2C94A 4YJFA 3RYIB 3IOEA 1PL7A 2J41A 2V7QD 3BQ9A 4MEAA 3VBEA 1IJKA 4X93A 2QA5A 5F3RA 2DWUA 2G5PA 4RXTA 4EG0A 1B8UA 3BJIC 2P2GA 4AY3A 3GJSA 1N8TA 2FVXA 4PQYA 2OCPA 2FPPA 2A4KA 2XUIA 1L3IA 2XUGA 1NXTA 2YXEA 3QOWA 3P2OA 3RM3A 4DSAA 1SHKA 2PCJA 1HDXA 3UG6A 3NHFA 1O03A 1D0VA 3GWGA 3ZCTA 3VU8A 1L9KA 4C2UA 3QYAA 2V65A 1A72A 4M86A 5BNTA 1SCKA 1KAGA 1T4GA 1Z4MA 4H1HA 1E3DA 1G5HA 3MF4A 4K3VA 4PSAA 1SU7A 5G2OA 3U80A 1U2PA 1D2RA 3SEZA 4OM8A 3HPQA 3L7JA 3U6BA 1R0WA 3NETA 3ENZA 2Z9CA 3GLFE 2YNMC 3KS9A 4AJPA 5DM70 3PX3A 5DTIA 1SG0A 3C97A 821PA 1RKVA 2GK3A 1K2VN 2OV4A 4I46A 4KDFA 3OBBA 2IZ1A 3A7DA 1M2JA 2PDAA 1BH6A 3QXXA 2A1IA 5H80A 1SXJB 3FF4A 1CG6A 5E7MA 3WLPA 4REOA 5IYZF 2QSJA 5JH7F 2ZJ5A 5F9HA 1KQGA 4DBLE 3UJAA 3CCFA 3DEIA 1JG7A 2QGZA 4AWXA 4WOCA 1KOGA 4MEJA 3JWIA 3SEQA 4CFZA 1RP1A 2E89A 1DQYA 3L8GA 4US2R 1N7HA 3WRVA 2XRFA 3L6EA 1VIYA 5AVKA 1HLFA 4W9NC 2AZ4A 1N36B 3H9JA 2YZMA 4K1LA 2D6FA 2ZYTX 4J16A 2B25A 3GRAA 3SHFA 1AC5A 2QD1A 4UU1A 1JFLA 1CY2A 2N46A 4G63A 2R6ZA 4ARUA 2ZUUA 4UFOA 5LQUA 1HXHA 2JFWA 1PG5A 3PTLA 3V46A 5LP6A 3PGA1 4QDXA 3RPEA 1TEVA 2A7QA 2LTAA 1YZ3A 1U0LA 2QJWA 2QYTA 3BWCA 2V5VA 3FFWA 1LEHA 3K8OE 3LQFA 3RFTA 3U3KA 4PSDA 5PNTA 1BE6A 3EVZA 2EGUA 4CNBA 2BAGA 1TM5E 4IDCA 3MILA 5L95A 5DP1A 5DGXA 4EGCB 1GCAA 2VYND 2X5OA 2X8LA 2PZLA 1HTTA 5DWQA 5PGMA 4S04A 1RZRA 4B4VA 2XRZA 3RYTC 5KTMA 1W73A 3IFSA 4CF3A 2O48X 2HLDD 1ZR2A 4TYQA 3PLNA 2AFIA 4DEVA 1G6OA 3HXTA 3CIFA 3KVRA 1ZD1A 1H23A 1KOJA 1N6IA 3LPCA 4HAUA 4MS3B 4ND8B 4RPHA 4NQZA 4X7BA 5K6TA 4B3MB 3T1TA 3PKJA 5TPWA 3JR3A 1QS0B 2ZITA 2E5FA 4RNCA 2IITA 4BE4A 3EZXA 1CJBA 3EXHB 2ZXFA 3S2SA 3RLFA 1RIFA 4OXNA 1VL2A 2OZEA 4KNYA 3T5AA 1CR0A 2F1RA 1NNI1 1CZLA 3W2EA 2G8NA 2YJGA 4MV7A 5CLJA 1L5MA 2A9QA 1MOPA 1HYQA 1PGPA 1XAJA 5HF8A 4YP7A 5KTOA 3ETNA 1TQ4A 1WV1A 4R1SA 4ZOCA 2GTHA 4FWBA 4B5LA 2VF8A 3TTYA 1V45E 3UANA 1RKQA 4CIDA 5KQPA 1JG4A 5KU7A 1ZK3A 1HL3A 1GZ6A 1XKXA 3PYXA 4NONA 4JQSA 1ND6A 1SVMA 2BHSA 4YUXA 3IO3A 1TT5A 2YDXA 3TOSA 3TPFA 2H2AA 3TUJC 3WL4A 3WK4A 3W3AD 5AICA 3CXUA 2II6A 4LTDA 4HS4A 2VNAA 2OORA 3FLBA 3OE1A 4YAUA 4E12A 2DFDA 2FSHA 2DPGA 4P5DA 3A9SA 3M1LA 1IZYA 2GAFA 2Z95A 4LJKA 1S3FA 4QE3A 5CYFA 4NAHA 4G37A 1VJTA 1W93A 3QU9A 2PJDA 4YO7A 4CU2A 2ZYRA 4Y6OA 4OQNA 2ZRBA 1K5DA 1E8MA 1R0RE 3P9SA 4GP6A 4OXIA 2VUUA 1TL7C 2PWPA 4IW3B 5F1PA 2NT4A 4G25A 4KQ1A 4DC1A 1N32B 3SFZA 2Y77A 3ANSA 3IDOA 1KJQA 4RW0A 2G5TA 1M0EA 1M1YB 5TNXA 1U7WA 4QBTA 2BSAA 3IT2A 1JAIA 2FQ1A 3KSUA 3L6CA 4XB1A 5T41A 4DR3B 2GKSA 4C7JA 3OJFA 2QV0A 2P1RA 3DVSX 1GKYA 3HCAA 1N5KA 4FKZA 1B4DA 1AGRA 3RNOA 4XYLA 2QSZA 4I9NA 1ZGHA 2YTZA 5CXUA 1ONBA 1JAHA 4K6GA 1OW3B 1PRYA 2ZIAA 3WMFA 1XCGB 1QVWA 4KRGA 4WNYA 3RIYA 3U7HB 1MQAA 4IDPA 3TFQA 1WPRA 4LZOA 3W1VA 2XMDA 1UC4B 3VTKA 3P5BA 2QZJA 4Q24A 1ZX1A 2JIBA 1HNZB 1DPFA 5E1DA 4G1BA 1JDNA 5LA6F 1UZNA 3DE3X 5IJWA 3FE2A 3MMXA 4Z7JA 1UANA 4DAEA 2O59A 4C20A 2IW3A 3P7MA 3PFFA 4FQ8A 3U2QA 1MT0A 2AJDA 1PZEA 4UBNA 1AKTA 3EGCA 5P21A 1QTNA 5EJGA 2RBEA 3OHMA 3KSZO 4PX3A 1GPDG 5LXTF 3O8QA 2E21A 5H3HA 2TYSB 4MR8B 2J9XB 4OK3A 4EPWA 2KWIA 3FBWA 2WIAA 4H0CA 5ARDA 1ZD9A 3L8EA 1H2EA 1SUDA 4PR3A 3HWSA 3ACDA 4TTIA 1PFUA 1A4IA 1KVRA 4HRAA 5F3DA 5IZ4A 1WM1A 5KVAA 4IIEA 2Y1LA 2VHTA 1KIMA 2VZLA 4MKZA 1C81A 4OB8A 5DNVA 5GV7A 1KWKA 4P4GA 1NPTO 1F8FA 4HYEA 3V1UA 2IKSA 1DQSA 1K63A 5HMLA 4CEHB 1V8ZA 1LQUA 3P9YA 3SIXA 3ZUGA 3MSXA 3Q98A 1H9AA 3HKCB 2AMVA 3G8AA 1ZJ4A 2B7LA 2V96A 3MS4A 1PL6A 3PENA 4M0UA 4OHBA 2D74A 1NVDA 3H7IA 2JCXA 3BOSA 3NXKA 3ABQB 4F4UA 4IP0A 3DZBA 1T4BA 1TKAA 4N8EA 3CVUA 3SQNA 4B6GA 1OB5A 1C2YA 2ZE5A 1FYDA 3DMTC 1T9HA 4JOCA 4TX1A 4TWBA 4EITA 5ALQA 4Z7NB 3NBMA 3OPYI 2PMKA 4OKNA 1WUHS 2XV1A 3Q3VA 1CQJA 4IF4A 4G8DA 4K9RA 4XCQA 5D6OA 1FFAA 1ZM4A 1J9EA 3C7DB 3DCNA 3FAZA 1V9SA 4UEJA 5JOQA 4W5NA 3MWDA 1UKEA 3D8TA 1U7XA 4D74A 2R751 2FMUA 3M89A 2AXNA 1R8XA 3KQSA 5H3LA 1KKMA 5EOVA 1KFEB 3ZS9A 3I9MA 1A8UA 3L8FA 1VMAA 1GZUA 1ZCFA 4K05A 3ES9A 1TMOA 1YGPA 4CL0A 2IX9A 4I9UA 2X6RA 4MGKR 5MN5A 3GMDA 4C7KA 5FO0A 2OV1A 2NVUB 1NUAA 2XAAA 3GLGB 2IXGA 3RIXA 2IS2A 2CVOA 2H1HA 4KVZA 5SICE 4PYJA 4QXAA 3BORA 4W5RA 2CJWA 1NI4B 4YGXB 3R75A 3SKYA 3BTSA 4YAIA 5J2UF 2QMZA 3BD9A 3M34A 1AM4D 2ES4A 3F74A 1SPXA 2XT0A 2DTEA 4JLPA 1B16A 2REXB 3KB2A 4XYEA 4GLLA 4P32A 1XL0A 5EI5A 3W0LB 5JSZB 3L9WA 4H3KB 1THTA 4RF4A 1AKNA 4RIIA 2YY7A 5IVKA 2HK6A 3I6MA 3M4XA 1U04A 4C3OB 3LY5A 1XTZA 1SEPA 2W0MA 4IJ6A 2VH1A 2QN7A 4I3HA 3QH4A 3T3PB 3V3TA 4X64B 3X1JA 4PCAA 2HRRA 8LDHA 5C1BA 3ZW9A 2WJIA 1ODCA 6GPBA 1CTQA 2GH1A 2R87A 3FTDA 4C6HA 2OAEA 2IU0A 4IZOA 1LF0A 4JCCA 5KX5B 1IVSA 4OSEA 1CJSA 1ZD2P 4JNKA 1L6IA 4F4DA 3E5HA 1KERA 2V4UA 1NUQA 2I7VA 2XA2A 4XOIA 2Z3WA 4P84A 1L7RA 1EK0A 1IXZA 3T1YB 1DIHA 3K5PA 4GM1A 3X3HA 2H16A 3P9ZA 3P0FA 4KBFA 4CF5A 2E49A 4TSFA 4Z1MA 1IWPB 2V5AA 4AF8A 4NMXB 3CLUC 3SF8B 5BVGB 2EGHA 2KLHA 1MB2A 2O8NA 1K7YA 4UW9A 4N76A 5CVUA 2X2FA 2PZJA 1KEWA 1U0JA 1ZCJA 3LUAA 3CNEA 5AVOA 3UK2A 3LQYA 5CA0F 1A27A 2BI4A 3F4LA 1J23A 3O8NA 4TN5A 4EG7A 5K6AA 1YFJA 1OH5A 3SBXA 1IQRA 3I32A 1TECE 3VMFA 4Q3BA 2ZXEA 4G1UC 4QOIA 5E95A 3CVXA 4LY0A 2P67A 4BO8A 4BLWA 3CZ4A 5I8WA 1DAIA 1VCHA 5AP9A 1N5JA 1Z4IA 4Q82A 3U3XA 1IWOA 2FQXA 1JQ5A 4LXGA 4GYKA 4M0MA 3ZEIA 1Z37A 5B1HA 1PO7A 2J0VA 3AJRA 1SD1A 5TQ2B 4A2QA 1YCFA 4PQRA 4EHHA 2C83A 4IQ4A 4BMYA 2CC2A 1XVLA 3WB0A 4E30A 1QONA 2GA8A 2WWYA 3NIWA 4CGZA 3NYRA 3COJA 2AEEA 5I7WA 5FWNA 2N75A 3DVLA 1HLPA 2IQ5A 4FPXA 3KYCB 3T95A 2D2FA 3AUKA 3TNYA 4YPVA 3KVOA 2OZVA 1FP6A 2P4SA 5CTAA 3PWTA 2OECA 4UDYX 3AL0C 1N9KA 3GEMA 3AX6A 4ICIA 1E1DA 1FQKA 1G2IA 5EL0A 4BWFB 4OQMA 4ZGGA 3KYIB 4M1YA 3VZBA 5I47A 2VTBB 1E3MA 2CLIB 1G6HA 1JHQA 2EAUA 3G88A 1RRGA 1EFRD 3MJDA 4LGVA 4LXQA 4QLOA 1YZYA 2I3ZA 2KPOA 2BJVA 4YY3B 4YJKA 1IATA 3UAVA 2Z56A 1SAYA 3Q1LA 3KAJA 4WZZA 2XHZA 4BAUA 3EQ9A 3F6PA 1TE2A 1VZ3A 4LZPA 2IYAA 3M9WA 1UP6A 4P80A 4WHMA 3VPFA 3TFOA 4QKQA 1TDJA 1JJVA 2GWHA 4O2AB 4O3MA 1DP4A 2FK8A 3FYCA 3MWKA 1A4UA 3K9BA 4GMGA 2EQBA 3EPJA 1ENPA 2VUSA 5ADUS 5DYGA 1QIDA 1NYTA 3QLEA 1RLJA 3I2HA 1NW4A 4Q01A 1NN0A 1E0KA 1OROA 2HNAA 1G6KA 1WSDA 3JWGA 2K4MA 1U0GA 2HMAA 3GGDA 2WYIA 1V96A 3PRHA 3QIVA 4K9KA 5NULA 1U8XX 4NV1A 1BWQA 1W88B 3A4NA 3HCBA 1BN7A 3KB6A 1XU4A 1ESEA 3GGOA 3HDTA 1GGFA 4P3YA 4YRZA 3AV0B 5JEEA 2VDMB 1GZHB 4MTCA 4OU5A 1Q6YA 1U3TA 2GXAA 3ZCVA 5AKXA 5J2TB 3SZUA 3OCUA 1C4WA 2OMKA 2R7LA 3ASVA 1E9EA 1KPGA 1X80A 2MMGA 1EHYA 2BFAA 3WMXA 3LL4A 3OD5A 4E46A 1ZU5A 1V3UA 2JRLA 4Q7KA 2CLCX 3A6FA 3PFBA 3D4NA 3H04A 2PQ0A 3KOYA 4U2BA 3NIGB 3CO5A 5G1OA 2XD9A 4RDCA 4WESB 3GXBA 1JSZA 1P4SA 2XQJA 3MXOA 3ZOKA 5ELMA 1GRQA 4P2BA 5IJ9B 4Y9SA 2P0YA 4WL0A 4BZZA 1BO6A 3GEPA 3PNLA 1KEZA 1Y7HA 1FNSA 2EX1A 3MB8A 1NHGA 3ZDQA 4EA8A 2A2ZA 3IALA 1WPGA 3PD7A 2IPNA 3BRQA 2ZCJA 3O38A 1JHRA 1Q1NA 4R51A 2GM5A 3P0EA 4KR2A 2IOFK 4RTJA 3ETDA 1XRNA 1H2ZA 2VF7A 3FGNA 4MIOA 3UBTA 2FFRA 2N9UA 4AZWA 1WAMA 5EQFA 4YRCA 1U8YA 1DAGA 1GG5A 2YJ5A 3C3DA 3EC7A 4EPYA 3LLCA 1VE9A 3CRRA 5MHTA 1P4JA 3VNBA 4JJ7A 4DTCA 3BIOA 1CY7A 1PVVA 4MP3A 3QEJA 2V7PA 3LY8A 4P4SA 4II2A 4YJ2A 5IYZB 1OMOA 4B7ZA 1V2HE 3M6AA 4TV9A 4JHXA 5E8JA 4CGYA 4OJTA 2YN2A 1IZ8A 1ZH4A 3G7UA 4EHLA 2J0SA 5ED4A 5DW3A 5C8YB 4YCDA 1L5OA 2BZSA 1AGPA 2JAUA 2IIVA 2QUKA 3FSGD 3KEFA 2OEPA 3MJRA 5DEOA 1CUCA 5DGDA 3TN7A 4CM4B 1J1UA 3EX7C 1ABFA 3ZV6A 3INGA 1TRHA 2A9PA 2WAXA 2W2PA 1NU8A 1W0JD 2D1RA 4V0LA 4B3HA 4EP1A 2WC1A 4D3XA 3GLIB 3DTVD 4QXQA 3WLIA 5FRDA 1B00A 2P6PA 5JCXA 3RJTA 1K92A 1PSWA 3HFRA 3OLWA 4ITVA 4Q1CA 1XD2B 2ATCA 3NI2A 4ZRDA 2O2EA 2AOTB 2HEIA 4JJEA 3NGLA 3WYNA 1CT9A 2ZG6A 3EC2A 1H2XA 4AMZA 2PPVA 4KVFA 5TQJA 3ULKA 3AFMA 4Z49A 1NXPA 4JQOA 4MQ4A 4FR5A 1C9KA 2Z1NA 5CVEA 5LOVF 1MGOA 3PXEA 5KTRA 4C0AC 4LRYA 3L07A 4IEEA 2UZ4A 3EZ9A 4B76A 2G70A 1QC5B 1R6UA 2WFLA 1Y6GA 2Q5OA 4HTFB 2ZE6A 1S96A 1HYEA 1YB4A 3FYSA 5EJEA 2FGJA 1VG1A 3C3EA 3KVYA 2BE9A 2D06A 3G6KA 4KFUA 1T36B 1NJGA 3E7DA 1ZIDA 3G2NA 1GN8A 2H29A 3MSCA 4P7GA 4HV4A 1N1DA 3WOVA 5EMKA 4JAVC 3SSNA 3LECA 1AF4A 3BF8A 4GPD1 4UDXX 2DUNA 1NNSA 2YKGA 1RWQA 2P8SA 4YIHA 5GV8A 3DO8A 5KYGA 5CCDA 1PHPA 3VTAA 2IS1A 3OA2A 3DPIA 4FJ0A 4LZWA 4OHWA 3BMCB 3PLRA 1DZIA 4JC0A 4RMHA 1PJ3A 3DEJA 2Q9CA 3MJVA 4P53A 3TECE 2QVGA 1OGIA 2JJQA 1ZVMA 2WKQA 4Y2PA 5GADl 2QN9A 1W1UA 1W85B 2A0XA 3O3OB 3O91A 3PWKA 3D6FA 1OC4A 1TF7A 1YVUA 3I5MA 4KIGA 4X92A 4DY6A 4UBMA 5GQSA 1P5FA 2CVQA 3A1TA 3DS8A 4MB6A 1IPEA 5DM2A 2AFHB 1KFKB 2Z0MA 4FZJA 1NBMD 4KZKA 4KPEC 3SZRA 3CR8A 2Y0BA 4LBZA 1P1BA 1OX4A 2RGUA 3WKBA 3G5TA 5EJ2A 1Z8NA 1CB7A 1FS4A 2Q0SA 4HPJB 3K73O 4IDOA 2CSXA 1YK1A 1J09A 3AG6A 3G1TA 3KTOA 2VJDA 4NATA 5TQ0A 3KPUA 1UC9A 3MLBA 4I8IA 1S8FA 4C4RA 3Q6IA 2WU8A 2C4NA 3QELB 3NHSA 5FLYA 2IPOA 1YQUA 2XRYA 3ZJTA 2CL0X 3UUGA 3LHSA 4C0QC 2OKCA 3I64A 1RMQA 3CR3C 4BYMA 3E8XA 3CF4G 2BR3A 5GJCA 4OOFA 2AKEA 3CG4A 2BC9A 2CBGA 1GFWA 1PD0A 1IN6A 1SK9A 2BGIA 3IB6A 4BPRA 2NADA 1YR8A 4OVKA 4RENA 1KH2A 4PNPA 3HZRA 1NOIA 5DSXA 3EDYA 1ZUNA 2QM0A 2NV2B 4MRVA 4BNZA 5JR3A 2MINB 5L51A 3R0QA 1F9EA 4GO1A 1I7SB 4TTRA 1DO2A 3DXYA 2WVAA 2A94A 4DBZA 2CV0A 1XU9A 1FF9A 3R9WA 3CSUA 1HEYA 3GUZA 3JQBC 2CSUA 2H63A 2PPLA 4W82A 1ZBQA 4I4LA 4YJHA 5D87A 2IYYA 5ICMA 3W8RA 4QM7A 2DLDA 1TD9A 5D7NA 5KJ1A 1Z2EA 5LA6A 3TL2A 1W1IA 2JH8A 3JARA 4CKZA 2VL7A 1WBJB 3RHZA 3RS9A 3AXTA 4KPGA 1Z0JA 2PSFA 3TW4A 4ENRA 2Q1YA 3FDZA 3GWZA 4QUDA 2GJKA 3Q8LA 5DN6D 5HKOA 4R16A 3TNJA 4I4IA 4KO3S 4N49A 2HXYA 1JEQB 3JVDA 3O0DA 4RF2A 1NJ8A 3LWDA 3CUEF 4EF6A 4BAZA 2WIFA 2QK4A 5FHRA 1PKEA 1Y9JA 3BIJA 5LXTA 5JCJA 3U81A 5SZHB 1BXRA 3A4IA 3CUWA 4J1TC 5I9TA 1OFGA 1ZITA 5F7XA 5K09A 2H0AA 4QFMA 5HFNA 4ESHA 4LOIA 5B55A 2PE5A 1RQ2A 1U02A 3GHYA 3JS5A 3LX4A 4LX8A 3TPZA 3WLRA 4DNXA 4G1MB 2I67A 2I4IA 3RUPA 3TOVA 2ZDGA 1M0TA 1ZBDA 2HIMA 1JYEA 4WE3A 1QPBA 4NPAA 5C3UA 1EDDA 1M1XB 5AW1A 5KYXB 2GRUA 1ULAA 2OO5A 3L8CA 4CLRA 1Q74A 1NSYA 1DV2A 3D1VA 2JVKA 2MSCB 3FHCB 1OE0A 4JEMA 5HDQA 4V0MA 3PQ4A 3CLTC 1CLUA 5EJMA 4A4DA 1E4OA 2XE8A 2PMBA 1JMVA 4FZ3A 4PNHA 4PV7A 3EXFA 4TQUS 5I3ZA 2H1OA 1DQNA 4DSUA 4YJFB 3U6KA 3RV3A 3RVSA 4LIPD 3UJ6A 4NMMA 1A5TA 5B12A 3IMFA 3BCRA 2W58A 1XHFA 2HHHB 1T43A 3UT0A 1GVHA 1I8TA 4Z0NA 4J3JA 4QT4A 3OI7A 2FZCA 2I22A 2C03A 2FPPB 2O0KA 4C5CA 4DR6B 3RS5A 1S2LA 4Q93A 1LGYA 2IP4A 1B76A 1YRBA 1FP4A 3EULA 3OQBA 1RWPA 1Z45A 2QDXA 4M1SA 5D1HA 3TKYA 3FNFA 3FDXA 2I99A 2CYCA 4GHWA 1EX1A 4UHFA 3HJTA 3O1IC 3NO4A 3OFVA 2RHLA 4WQMA 2FR8C 4ZQBA 4ZTUB 2CNBA 2VK8A 3MGGA 2DSNA 2NZJA 5CX1A 3LC2O 3L7YA 4A15A 1G5TA 2VT6A 3W7AA 2VAVA 2LW7A 1VRWA 2WJGA 3GDHA 3DMDA 3G1WA 2R8ZA 4Y2XA 1VI5A 2R6AA 4HLCA 4B09A 1UK7A 2FYTA 4F9GA 1M2EA 4F72A 5E4FA 3NBAA 1IEQA 5A3JA 1F1JA 2D4HA 2OBMA 5IEBA 3CZ9A 5B53A 4MVJM 3WK6A 5HOQA 4MCAA 1ICIA 2I3DA 2VPWA 1U2RA 1KAQA 2BFMA 4PRKA 2Q62A 2GCNA 3UZUA 4BLRA 1PP4A 1ADCA 2E4WA 1WMAA 3BH0A 1DVRA 1Y63A 2NUPA 3OX3A 1AKQA 3NB0A 4JNCA 4BUZA 1B2LA 1ZS9A 2WNSA 4JU8A 4E6PA 4H77A 2HR1A 1GNSA 1XMXA 5D86A 5ULLA 4B0OA 4OLBA 1Z39A 3OT4A 4QPJC 2QJFA 2W4MA 1XJ5A 3K0FA 4UUBA 2PTGA 4E5MA 2C9DA 1A82A 2QIOA 4FYWA 1KY5A 1TJ3A 3UC9A 4DMKA 2OB1A 4FFLA 3X43A 4R40A 3ANLA 1WIWA 1IM2A 4JOQA 4GICA 4MROA 4AD8A 1FU8A 1HYBA 2ZI6A 3W5UA 3ITKA 1LI4A 3D7SA 1ZLXA 2XQKA 1X87A 3COPA 5IZCA 3IKVA 1KEEA 5AKEA 3S8MA 5LP6B 1X38A 3SSAA 4QQKA 3VSBA 4YRIA 4QDTA 2F59A 1WZCA 3BXEA 4U2FA 3OZDA 4DA8A 1BWRA 4I3GA 3DVQX 5SV2A 3KHTA 5JNSA 4DC0A 1YQTA 3EODA 3MUNA 4PZ0A 3OVMA 4RSRA 3U40A 3R0ZA 4IIVA 3IP6A 4GWLA 3PRYA 1BRMA 3RC1A 5I7RA 5I5GA 5J4YA 3DZHA 2RJ3A 2I8AA 4BGVA 2AFIB 3SLGA 4F5DA 1SXIA 3FCEA 1KJ9A 3QVJA 5DT2A 3CZRA 4L8GA 3TMKA 4EMBA 1JB1A 6CHYA 4CPDA 1NXWA 3BQMB 1JDPA 1SKYB 1ZNYA 5TPWB 3RVJA 4ER3A 5H3CA 3SCZA 1Z6PA 2RGEA 3G0OA 1OLXA 2OV6A 4Q3AA 4Q6BA 4MITA 3IAAA 4UHHA 2WM2A 2EC5A 5H83A 1CP3A 4ARAA 4AROA 2NSHA 4IHJF 4LBVA 4RJ2A 4DUGA 3BC1A 2LCFA 4NKRA 3STYA 3OZUA 3M9LA 4AZSA 2P9TA 4Q4DA 4RL6A 2O7NA 4YYEA 1PFYA 5BSHA 3A70A 3QY9A 3O2JA 4HD8A 2PUDA 2J45A 1OYVA 2PX5A 4H1TA 3NDIA 2J7KA 1L3CA 1PGJA 5K2MA 3MAGA 3UA3A 1BWPA 1EFUA 3AEZA 4C76A 1MX1A 1TT5B 3HRHA 4RV5A 3I4LA 3R5SA 1T1RA 1HSZA 1DC3A 3R74A 2AN4A 2BMEA 2ZE7A 2QLNA 3KX2A 1IBCA 3PUKA 4JYCA 3FKQA 2DHCA 3RAEC 1XA4A 3N8HA 1KO8A 2I4MA 1T3TA 4XM0A 2XT9A 3U7RA 4HMOA 4EGAA 3GFOA 3E9MA 2PVPA 3S5JA 1E0JA 3IIMA 4F71A 3HJHA 4US1R 1J9ZA 4JR0A 3UMMA 2E48A 1Y80A 3VHQA 3OQMA 2C9OA 2XMGA 2J1LA 3QITA 2LR0A 2I66A 4RM3A 1J8VA 5FNVA 4RIEA 1QIGA 2H00A 1XTBA 2WOJA 3OUUA 4NCHA 1M2VA 5JCOA 3E3NA 3OEEA 2X0EA 3I2JA 5SZIA 2C5HA 3ESRA 1NFRA 2PMCA 3OZIA 1ADJA 4JYMA 5IJXA 1B0UA 4G0OA 2SBTA 4P4LA 1JDTA 4Q4HA 4TSKA 3QJYA 1BVUA 4KW7A 4Q39A 3UXMA 4Z7OB 4MGIR 4HLNA 2NPIA 3JALA 3PGLA 3TUIC 2Z2ZA 4UVHA 4B44A 2SNIE 5A5EA 3GNTA 2C5FA 4IILA 1D9ZA 5J40A 5EKDA 2K87A 2ZPAA 3Q7TA 2OV2A 4F38A 5BP7A 2WB4A 3FNRA 3EW9A 3K0SA 5IFLA 5EJ4A 5FUMA 3B5EA 2HA2A 2CLSA 1YT5A 1M2WA 2V58A 5DEIA 5IKEA 3QLVA 4FHZA 1EIZA 4KR3A 1KVQA 4P93A 1XEWY 5GPBA 4ZHQF 1FSGA 3ZCRA 2V6IA 1OB2A 4I0WB 1AQ6A 2D1TA 3TIVA 4C3UA 3AM1A 4ZI7F 1KTIA 1CV2A 3OIYA 3O8QB 1ZIYA 1SU4A 5CDHA 5BR7A 1ZL2A 1R16A 1XXHE 4KNVA 2D1SA 4DCNA 3R5KA 5ES3A 5IC6A 3C24A 4MUJA 3EIUA 3IUJA 4DMLA 1XZNA 2B8EA 4K86A 1IBRA 4LC1A 2HLNA 3QU5A 4BQPA 2RD2A 1NV9A 1TA4A 3DE1X 5HJEA 3EUWA 3PHLA 5SY4A 3W04A 2IC5A 1MFZA 4RD4A 1HZZC 1P7ZA 3COZA 4KRFA 2FEXA 2ZTHA 3V6MA 1WXFA 3U4HA 4LSWA 2Y2UA 1CERA 3UAGA 1H05A 3H17A 5HGJA 4FWTA 2DLCX 2I6FA 1KC1A 5A4FS 1CUIA 4K6CA 3SXJA 4RF5A 1UOOA 3SI7A 2ZATA 1TLTA 4QECA 5HILA 1P33A 2VG8A 2YJ4A 1JHAA 4YUZA 2MYTA 3F90A 3JAKA 3ICWA 5B6PA 2IYUA 1Q7GA 1ACLA 5E7IA 4FT2A 1APBA 3TX6A 1ZGJA 2OBXA 3RSLA 3V2GA 1ENZA 4OHFA 3N8NA 2YNMD 3PTZA 2AK2A 3DOIA 1FA9A 5DHUA 2XB8A 1CQJB 4RELA 1U94A 4RHEA 3AOEC 1OFIA 2WWXA 3L7OA 1KH3A 3LSTA 1BXGA 3Q0IA 4NWIA 2YRXA 4PFSA 1QCDA 3MWDB 4C0WA 5I9LA 2IXTA 3URKA 2HJSA 3LBIA 2NZVG 1N9ZA 3KZNA 5SYMA 4NCIA 4DMGA 1MQSA 4B74A 1NIJA 3TS1A 1AT1A 2WF7A 4BAGA 2XSZD 5KPDA 1CPYA 5JC1A 5TXGA 2AR0A 1U8FO 3P9KA 1BMDA 3OTIA 1WL8A 4YROA 1COWD 4MULA 2YWJA 4D44A 5JAIA 1GAWA 1OYYA 3AI2A 2CJWB 3O4IA 2XF8A 2B6NA 1KO1A 2Q4OA 3ISVA 1R0LA 4UNNA 3WBFA 4Q9NA 1F0YA 1SQSA 1E2DA 3IHKA 3C15C 4IFBA 3ITEA 4MS4A 1AGXA 4G0ZA 1P2FA 1KARA 2MYNA 3WRYC 3WVNA 5A6SA 1VMIA 1GDHA 2Y1EA 5LQMA 2GLTA 2HRQA 4TQ9A 5T5QA 1VBFA 5C81A 4HPXB 1C0EA 1HNNA 2XNCA 2FEAA 5REQA 4TYWA 2NMVA 3ESQA 3JQFA 5ARBA 2OK7A 1NBAA 2AMYA 2JCGA 3ROMA 2DR0A 3EF0A 3G7SA 3FPSA 1E9FA 2A67A 4IUYA 1FDTA 1A1SA 1BE0A 1DJQA 1G42A 1MBZA 1XSEA 2X14A 3DEYX 2XE4A 1YOVA 4JUAA 4ENUA 2GZ2A 3KLNA 1RP7A 5IH7A 1LPNA 1S2DA 2VHXA 1BEEA 2FWAA 4TYMA 4BLQA 4QOEA 3NCHA 1OFUA 4XQEA 2B4QA 2ODWA 1JGTA 4LJSA 4HUTA 1XQ1A 2H92A 2XB9A 2NPFA 1CRLA 4LFAB 1SG9A 3CU5A 5E7JA 3FDIA 3E6AA 3UAXA 1N6HA 1S2NA 2VQFB 5ILQA 2GN1A 1NQTA 3WQRA 1OKKA 2WFMA 3ADBA 3SPXA 2GAIA 4LKRA 1V7QA 4BVKA 4JR2A 1YU9A 2YHAA 3PXAA 1GRCA 2OCGA 3OUTA 4PZCA 1QU3A 4GYYA 3ZJUA 3O90A 4LY3A 4ZAFA 5U4XA 4F4HA 3W8NA 4BLTA 3O4FA 4DANA 4FHCA 1SKQA 2IODA 3CE9A 4Y7DA 5I9MA 2V7VA 1W19A 1RXSA 4YV2A 5EINA 3IIJA 1P4RA 2A9RA 5JBIA 1PS0A 1XMQB 4KO8A 1G1AA 5ALPA 4UU8A 5I9NA 3DDNA 4Z99A 1W36B 5B58T 3A4YA 5J4KA 4BX0A 2O2HA 3B38A 3T41A 4MQFA 3TRFA 4ZWNA 2K7FA 1A9TA 4HGPA 1RBMA 3IVGA 4MUIA 5GGYA 5CU7A 4F92B 4D8TA 1X2EA 4FT4A 5C3MA 4C89A 5JANA 1L3BA 2Q50A 2P9BA 1ZGBA 4B87A 1L4UA 1G2PA 3JASA 3D6TB 5E4JA 1ORRA 2IYPA 4OG2A 2H6EA 2QP9X 4UNPA 4XIGS 4AT1A 4B83A 4R1OA 4GR9A 2NUTA 2C78A 2AH5A 1M75A 4HATA 2Q21A 3KR2A 5HRAA 4YXWD 3S2IA 1D6NA 2R4UA 2FLWA 2VNSA 4TTPA 3RSQA 4ENWA 5K0NA 4RX1A 2HU2A 1D4FA 1TLLA 2PIDA 3GJQA 5JDCA 4QGHA 1Z2DA 2R6HA 3DKIA 3U17A 2Y71A 2X9QA 3RBVA 3H87A 4NDAA 4A8JA 2QAGC 2I6XA 3FRJA 3WNQA 3DP9A 4LHEA 5F3WB 2HQSA 4EENA 2IF0A 1VDMA 2Z3ZA 3DV2A 1SC3A 3NBZC 3NV9A 4CDRA 5K0JA 1GCGA 1RWXA 3EFHA 4PLPA 3FG9A 4RV4A 5ECDA 3BE4A 2FRVA 1QH9A 5F33A 4GMDA 4E5KA 1DKMA 4X00A 5KAMA 4DIBA 1MQ8B 2JS7A 4LRSB 3NALA 1QR6A 1SCQA 2JIDA 2ZWMA 1GCIA 4UMFA 1UKZA 1AS2A 1NA5A 1V71A 3FTEA 2IEDA 2O8BA 5E7QA 3U4QA 1W25A 4H7KA 3U3MA 3L7IA 3PXCX 1ZD3A 1VIVA 3D3JA 4P7KA 3UXHA 3CG0A 4CQJA 2QAJA 1N0WA 4BJ5A 2I6UA 3DO5A 3KUXA 4PZYA 2PSSA 3DV9A 3OZXA 3TBFA 4EY3A 1WE2A 3KXIA 2WJJA 1QFMA 3L4SO 1RWMA 1Q0HA 5FWDA 5H9VA 3EGOA 2QMHA 1AHHA 3UHAA 4GVXA 4TL9A 3QG5A 2RG7A 1XNHA 5CYGA 2QXTA 4LDAA 4TZTA 4X1YA 4NBTA 1P62B 2GYYA 2ZQ5A 3BCUA 3AFOA 4FYMA 1X80B 3L92A 4AMYA 4M9CA 4ACAA 2NYVA 4JVMA 3NC1C 5K6RA 5FBHA 5LJIA 2FG5A 3WK5A 1J20A 2BLLA 2NV0A 1XZLA 3E9NA 1BHQ1 3GARA 4X1KA 5KJEA 4BNYA 4EG6A 3EXG2 3KT3A 4B6FA 1XQVA 4MUKA 1XXLA 1JKIA 4AYWA 2ID7A 3GZNA 3DMGA 4BX3A 5AW9A 2MSKA 3AY0A 4AX4A 3WHPA 1GAQA 1IBMB 3I3OA 4C05A 1YJXA 3QP9A 5TR9A 3WFJA 2A78A 8ABPA 2F3SA 3DO6A 4WVFA 2VHUA 3ZH9B 2C2OA 4BZPA 5KKNB 1V47A 1QVAA 1A9OA 1EQ2A 1KETA 4EZIA 2AYYA 3QQPA 4MVJE 3DXZA 4HAXA 1XQXA 1ZJJA 3VZPA 1MHPA 2Q45A 1KJWA 3AFIA 3P2EA 4ILEA 2HWXA 4RK7A 3N0RA 5J5VA 2HPVA 4CMAA 2KBFA 3GW8A 5IBQA 5LQCA 4P4SB 1HDCA 4PC6A 5A0VA 1HQDA 3FZNA 2B8WA 5IK2A 4I6GA 3ZIUA 2UUBB 4YJ2B 3EW7A 2E4VA 2HHJA 2VWPA 1JDBC 2OOSA 2PEYA 4TV9B 3D2CA 1D6MA 3PEEA 4A26A 2MSLA 2QTVA 3R5HA 2CFTA 2XCLA 4Q3NA 2ZVJA 1V9CA 3FCOA 5KQRA 5I7SA 1GNLA 5EGNA 5T6BA 1HDGO 2ISQA 2HXSA 2GPYA 2GILA 2VLIA 4J0EA 4J03A 4PLHA 1NAIA 2H17A 4J0IA 3L1VA 4KAAA 2O2XA 4IQFA 3K4PA 4Q7MB 2XEDA 2XRMA 4MR9A 2HZ7A 4JYPA 2OPBA 3BZUA 5EP3A 1U8ZA 1JSXA 4O4HF 2VCEA 4FX2A 1YZNA 1CDZA 2B5OA 2AFVA 2WWHA 3I2IA 1I3MA 3ND6A 2HHAA 1WQ4A 2ZSDA 4GRAA 1RI2A 1RPJA 3BHMA 1B0AA 3DLIA 3H8VA 4JQCA 4WGGA 5DBOA 4CM9D 4EG4A 2H2GA 4V0QA 2RBKA 4AY4A 3WC4A 1W30A 9LDTA 1QRDA 2N1BA 3KTFA 5J5CA 1PWHA 4WSOA 1YE8A 3TR5A 3MJEA 4A0QA 3AUJB 1EYZA 2XJ9A 4FEEA 1E1RD 1JQBA 2OBBA 1QQ7A 3AUUA 2ZQYA 4IJKA 4YDRA 1CU1A 5C8VA 3BTOA 3LBFA 2YW2A 1FFHA 2XPCA 4ZXPA 2W8ZA 4NYMR 3TQQA 2FW7A 4DR1B 3NYIA 3V5NA 2EOAA 4NC9A 2WFLB 1D9XA 2H3HA 2QT1A 2QJRA 4X85A 1OVGA 3HI4A 4QYSA 2AXPA 4HAWA 5IBCA 1C4KA 2I5PO 2WMDA 1GCOA 2LZ0A 3VGJA 3RFFA 4PAWA 3WSWA 2C5AA 4KJXA 3ZLJA 2VDOB 5KJCA 1ZYUA 2IUEA 3CLUD 3CEJA 1NVMB 2P9GA 1T8TA 3HVHA 1E9AA 2JVIA 1H0HA 2ZT6A 3D8BA 2R25B 3WICA 5FUQA 4O5AA 4IV8A 3T3DA 4RY2A 1Y4ZA 2IVZA 4Q18A 4AJ9A 2IK8A 1EK2A 2MDTA