5HCIA

Gpn-loop gtpase npa3 in complex with gdp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
257
structure length
257
Chain Sequence
SLSTIICIGMAGSGKTTFMQRLNSHLRAEKTPPYVINLDPAVLRVPYGANIDIRDSIKYKKVMENYQLGPNGAIVTSLNLFSTKIDQVIRLVEQKKDKFQNCIIDTPGQIECFVWSASGAIITESFASSFPTVIAYIVDTPRNSSPTTFMSNMLYACSILYKTKLPMIVVFNKTDVCKADFAKEWMTDFESFQAAIKEDQDGYMSSLVNSMSLMLEEFYSQLDVVGVSSFTGDGFDEFMQCVDKKVDEYDQYYKKHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of GPN-Loop GTPase Npa3 and Implications for RNA Polymerase II Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords GPN-loop GTPase 1
total genus 104
structure length 257
sequence length 257
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.6.5.-:
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03029 ATP_bind_1 Conserved hypothetical ATP binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5hciA00
4ASUA 4M1TA 3CZPA 4WXRA 4B6FA 3GJ4A 1Q1EA 3VNUA 2FX3A 3P26A 5GJCA 5JRJA 1G16A 1QHNA 3H86A 1SQ5A 5EJEA 1XEXB 4IDQA 1MO5A 3UWKA 1X8JA 2GK6A 1VG1A 1UEJA 2D3WA 3ADDA 3I73A 1AIPA 4HDCA 4GMDA 1EFUA 5AJWA 3TIFA 3IEUA 3BXZA 1UKYA 1G19A 4Q7MB 3CX8A 1F2UB 3JZMA 1U0HC 2AR7A 3LQRA 2BM0A 4A15A 4KFRA 2RGCA 1CU1A 3EWSA 3EZ2A 3X1ZA 4TYNA 2FGJA 4JLOA 4DLSA 2TMKA 1R5OA 1II0A 4C7OB 2V8OA 3U4QB 2ERYA 4US1R 1DARA 2XOKA 4KI0A 1DOAA 4M1OA 4UNSA 4NCHA 3BH0A 3IDQA 4PX9A 1TADA 2JJ1D 3PR1A 2GESA 3A1WA 5EZ5A 1NSTA 421PA 4EPYA 4Q21A 3CNLA 4QHTA 3NWJA 4Y0VA 3EARA 4A2WA 4DB4A 2QPOA 1E32A 3QI2A 4N1AA 3BBPA 1YR8A 1U99A 4ACAA 1XJ0A 1DAEA 1KMHA 2D4HA 2JAQA 3FHCB 1AQUA 3ND8A 2IL1A 4TMTA 4WZAE 2ZR9A 4M2LA 1XTQA 1XTIA 2AN9A 3P27A 1BOFA 2HUPA 4LYAA 1SVSA 4KLNA 3EZ9A 4E03A 2J7KA 1OIWA 3H1TA 4E5UA 3GFPA 4DC9A 2BBOA 5AJXA 2FEMA 2CNWD 3BK7A 2BEJA 2E9SA 4LV6A 2QL6A 4B44A 4DCTA 1D6JA 1W48A 1ZM7A 3QXHA 4LK2A 1SVWA 1KYIA 1N3BA 1GSIA 1JQJC 4QOSA 2WOOA 2QMUA 3V4FA 3WNCA 5CIWA 1G4UR 2YVUA 1HURA 4X8HA 3E1SA 1VPLA 3P32A 4PPGA 3KDSE 5IF9A 4R9UC 4DSNA 2MSDB 2QG6A 2BEKA 4M8NE 4QBGB 5FBWB 5DHAA 1Z0FA 4DLXA 1B23P 4JBYA 3SOPA 4D0GA 4AG6A 3NKVA 4DCVA 3K70B 2OCBA 4BEBA 2FDCA 2R6DA 1D2EA 1OXSC 3SZRA 1UKVY 2FSHA 2G0NA 4C2TA 5LDDC 1G3RA 3CRW1 2WM9B 2GWHA 2Q9AA 2I3BA 1QDEA 3TQFA 3OE7A 4A9AA 4US0R 3I5YA 2NO9A 4G0NA 1P5ZB 4C0BA 2F6RA 2FFBA 1NVWQ 4RZUA 2IWHA 1D9ZA 4C3ZA 1VTKA 1XXHB 1Z0KA 4MKGA 1U9IC 2ORIA 4PZLA 1Q1ZA 1UF9A 4U5XA 1W36B 3LVQE 3HJNA 5FPSA 2H16A 1EX7A 1S0UA 3V4RA 2GJ8A 1XU4A 4DSOA 4YMTA 4XH9B 2F9MA 1GKUB 4I99A 2E1RA 4B3FX 1NVXQ 2PMDA 1CJKC 2VSXA 3MFYA 1E9BA 3AGPA 1MABB 1GRNA 4D6PA 3W3ZB 5DE3A 2IYLD 4CEJB 2X77A 4JJZA 3MRSA 4V0NA 5DI3B 2H7VA 3KX2A 3NBXX 1Q0UA 4AURA 2V3CC 3QOFA 3B1XA 2CXXA 4B76A 1OHHA 1IN8A 3VHLB 2NQ2C 1MOZA 1UDXA 1NRJB 1N0WA 1Z3IX 2D7CA 2VHQA 3VU9B 2JDID 4MYUA 1S9DA 1G8GA 1ZRHA 5H70A 1N5KA 1XMVA 4PAQA 1N6KA 1XB2A 1XEWX 3NBFA 2J7PD 3SDZA 5CB8A 5J4HA 3AVVA 1LV7A 1QHGA 2WPDD 4TSFD 2R62A 5HE8A 3D7MA 4QC2A 2O8CA 3VKGA 2CCKA 4Q47A 3O8DA 4LJYA 4F38A 2O8DA 4IRUB 2BCGY 2FPLA 2BJVA 3CPHA 1W4AA 3PUYA 2RGBA 1GTVA 4G3XA 4M0LA 1JAIA 3KJIA 2KWIA 5JRZA 3K0FB 2NZ8A 2IHBA 2ZQ5A 4NU0A 2XXAB 2BOVA 1A82A 5TDHA 2VTKA 1QHHB 4B75A 1EFRA 2ZETA 3GCGA 4Q4HA 4F7WA 3AF4A 3VKHA 1F2TB 2FFQA 1EFCA 1J99A 2F1JA 4FMDB 4CT4B 3CZQA 4F4JA 4YDHB 4NYJR 3HWSA 4IVQA 4WXPA 4XD7A 1C9KA 4BLPA 1A2BA 4PC1A 5LB2A 1IHUA 1JR3A 4BLQA 4OI2A 2ZRHA 3NC1C 3RS3A 2HEIA 4RCYA 3AF3A 4EPVA 1EG7A 3AVPA 1FFHA 5L3SA 3J81k 1Z0AA 4M9XA 3EIQA 5IDVA 2GTPA 1A7JA 2WJHA 4D80A 1XMJA 3WRXC 1XEFA 3KB1A 3AVXA 4DKXA 1IM2A 2C03A 3FWYA 2OBNA 3UK6A 4DWJA 4XWOA 2IEYA 2JATA 2R6CA 3BC1A 3IKJA 2RGGA 3N2IA 1XXHE 3TJZA 1NL3A 2WVJA 4MYCA 4PTLA 4TLEA 4DDUA 821PA 3HDTA 3GP8A 1HV8A 2QAGB 2ZJZA 5SZKB 2NPFA 1CEEA 4HAUA 2GF0A 3KXIA 5AR1A 5FI1B 2GRJA 3TR5A 1ZBDA 1DPFA 4UQOA 2AXPA 5KPDA 1QVAA 2OESA 2ZTSA 4BEJA 2WWYA 5JJLA 1W49A 3B82A 1BIFA 3K09A 3WMGA 4BLTA 1YZGA 4QGAA 4XIGS 4ZDJA 3PXGA 1XD2B 2ZU6A 1ZMXA 4P3YA 1UM8A 2XEXA 1ZU5A 1OXVA 3C41J 4URVR 2DPXA 5EQTA 4URYR 2H92A 2CLSA 4F92B 3ZVMA 4ARZA 1XMSA 4EFMA 3AV0B 4XJXA 2HXYA 1G41A 1UBGA 2NG1A 2QPTA 4BFYA 1T5IA 5A4JA 1VHLA 6Q21A 2EVWX 1NF3A 3B1YA 1VKJA 1K6MA 3ONWA 3ETLA 2F55A 2JCSA 4WOPA 1U8ZA 3E70C 1LFDB 5FTKA 2AWNA 3RABA 1PUIA 1NVUQ 3TBKA 3QIAA 2OO7A 5GADl 2FFAA 3ECCA 4L9SA 2DFLA 1G64A 5HZKA 3ZIAD 1T8UA 1P2SA 3TSWA 3A37A 1IN5A 2G1KA 4FXPA 4B3XA 4OHWA 3KUDA 3I62A 2VP9A 2VF7A 1IOZA 3PEVA 5L3QB 4JKYA 4V0ME 4HUTA 5JSZB 2GJSA 3B1VA 4PSVA 5FH9A 1G9XA 1WB9A 4LPKA 2DY1A 4QBIA 5DGXA 3VKWA 3CIOA 3SYKA 4R2HA 1W5SA 1Z0DA 5AJYA 2VIIA 5G3YA 3SYLA 4NPHA 1E4VA 2VF8A 4N3NA 2LWIA 3V9PA 4HB0A 2REXB 2W00A 3FE2A 4YMWA 2WSSD 2CHVA 3FMOB 3LVRE 2AXNA 621PA 5JWRA 4TZ0A 1W0KD 2QQEA 2I4IA 4NCNA 2ZUBA 2O8EB 4I1OA 1HTWA 4D82A 4O2LA 3FOZA 2QI9C 3F8TA 1WMSA 3UG7A 3QKRB 5KSYA 5BN5A 1ZNXA 3B60A 4FD2A 4DJTA 5JWOA 1GM5A 3FVQA 2ZRGA 1P2UA 5JHGB 3KTAA 4KITB 3AVYA 1S1MA 1KSJA 2IYZA 1J2JA 3CX6A 1WXQA 3EC1A 4D4LA 3BB1A 4GZMA 1M74A 2QENA 1R4AA 1NKTA 1N6IA 3BD9A 1H65A 2XTZA 2PZFA 1G20E 2QTFA 1IN7A 1U90A 4LV8B 4PZZA 2QN6A 3CF2A 2ZRBA 2ZS9A 4TMXA 1QBKC 2QT0A 4KJZA 5J4KA 4CGZA 1MV5A 3P4XA 1SXJA 5FUVA 1S1CA 4EPWA 2YOHA 3AUXA 3EW9A 2R65A 2L0XA 1E1RA 1G7SA 3LWNA 1NP6A 3ZQ6A 1Q3HA 2P65A 2NMVA 4F4CA 3RSLA 2JLWA 3NBZC 1DS6A 4K8OA 1C4OA 3IPYA 4FCWA 1M6NA 2B8TA 2GK7A 4JVMA 1P7CA 1FP7A 1Z2AA 5EE3A 3AEZA 1TQDA 2OG2A 3CBQA 4IOMA 2XXAA 2XB2A 4DLVA 2OZEA 4Q1FA 2X2FA 4QKQA 1Z6GA 5FL7D 1ZAKA 2YOFA 4LHZA 1N5JA 4TTQA 3N2EA 2GZHA 1ZIOA 1YR6A 1X6VA 3H4MA 4EKDA 4B34A 1IN4A 1TEXA 4OYHA 4ARZB 1NNEA 4UKDA 2CMKA 2JLXA 1ESMA 1GRRA 4MGIR 4QGFA 4ZIRB 1LY1A 3LNCA 5EP4A 4Z1MA 1OXUA 3AKCA 3QSYA 1P2TA 4TMWA 5FTNA 2QAJA 3U5ZB 4LI0A 5CYOA 4P31A 3LQQA 1E6CA 1E3MA 5DHFA 2RAPA 2H18A 5IK2A 2EQBA 4IW3B 3SHWA 2PJZA 1IJFA 2AHOA 3EAQA 1M8PA 3CO5A 2O8BB 5JCZA 1JNYA 4DDVA 2IYQA 1NG9A 4I1SA 2ZI5A 3Q5EA 3QY0A 4LX0A 3IHLA 2ZE6A 4R98A 4XTCS 1G17A 3W6OA 1RRCA 4HAXA 3VR2A 3SFVA 5FTLA 1XPRA 2HT6A 1N6OA 2ATVA 1ZM9A 2JJ2D 2ZAOA 2XSZD 3W5IA 4BFWA 3LRPA 4A6XA 3T1TA 3W6PA 2FFHA 1E2JA 2FSGA 3F3YA 4PPQA 2QSZA 3FHOA 5GJVC 4DIDA 1A2KC 1NBMA 5JEEA 4IHQA 4LJ8A 1NY5A 1G3QA 4KV9A 5KDLA 5IRCD 1ZC4A 4RD2A 1VIAA 3U2QA 2JJ2A 4Q18A 3HU1A 5EE1A 3SHFA 1NJFA 1I4TD 2GA8A 1EWQA 4IDHA 3G82C 4B3BA 2B21A 5FPKA 1Z6XA 5EP1A 3PEYA 2BM1A 1YJ5A 2QP3A 3B7GA 4TYQA 3OIWA 1BMFD 4MRSA 4ASUD 5ELXA 4QM7A 3KFVA 4PC6A 4AG5A 4CZ2A 1T6NA 2IUSA 1Z6YA 4ILEA 1LS1A 2VSFA 1ODFA 1OSNA 3DM9B 4B74A 3A1VA 4QHSA 1DG3A 1IAQA 1UFQA 2LKCA 1YZUA 3K0AA 3KJHA 3RS2A 1CKEA 1KDOA 1Z8FA 3H84A 4V03A 1TF2A 1Z6TA 3SJBA 1TU3A 4YONB 4FMCB 1XEXA 4CF7A 2ONKA 1OLOA 1QZXA 3AP2A 4TQUS 3PJRA 4P4SA 1DAGA 4LHWA 4PQYA 5L3QA 2EWVA 2ASEA 4TYPA 3ZZ0A 4TMKA 2RGEA 4B48A 4EPTA 2ZRLA 3IPXA 3M4YA 3KQLA 2BCJQ 4URXR 4V0OA 3AVTA 4BLSA 3I32A 2VP2A 1DO0A 1MRNA 1MT0A 2R2AA 2A30A 3QKSB 2PH1A 1W4RA 2W83A 5TB5A 2PZEA 3FDIA 4NYIR 4URWR 5KNBA 3K9HA 3PEWA 1SVKA 2ZRJA 2AKAB 1FQJA 4LBZA 1LTQA 3NIBA 3C14C 2GCNA 2N42A 1KSFX 1ZM2A 3QVUA 4C0QC 1RC8A 3U60B 4KVGA 2A5GA 5DNYB 5FUYA 2CVHA 2J9RA 4MRVA 3FYHA 4FIDA 2GBLA 3HYRA 3CWQA 5EZ6B 3O8BA 2BWJA 4LC0A 2J0UA 1TMKA 2QA5A 5DSZA 3S1AA 2YNMA 2OEPA 4B32A 4ITRC 4Q48A 3DVLA 3H2YA 4Y0AA 2IX3A 2CCGA 2FH5B 1LF5A 2ZRKA 4IVPA 2JDIA 3UG6A 2ZI6A 2GCOA 2W2VA 2G6BA 5BN3A 2YWGA 2CCJA 1OHHD 3AF2A 3GJ0A 3GFTA 5HZHA 2QAGA 1US8A 1ZD8A 3AH8A 1W5TA 3GJ3A 3DMNA 1OH8A 2WMOB 1E9EA 1BYIA 4IOJA 4DLZA 4OQNA 4QGGA 4II7A 2P6NA 3QKRA 3VQTA 2ZAMA 4NHOA 1WE2A 3QUSA 4L8GA 5H68A 1AM4D 1XJCA 3KFXA 3TUJC 3T5GA 5DI3A 3FPAA 3OFNA 2EFHB 4PANA 3EZFA 1XWIA 2NPIA 1W36D 2ZRCA 2OBLA 2SHKA 3M1IA 5F9HA 4BWYA 1OPXA 1E2MA 2O0JA 3R7WB 2P5TB 5GJWC 3QF7A 4TYWA 2OBMA 4FN5A 4GOKA 2H1LA 3A4MA 1YZKA 4C0KA 5KU1A 5FPTA 5DIFA 2ZEJA 1OB5A 5JSZA 3GLGA 3PENA 1UDWA 3C5HA 1C1YA 4PAMA 4YDSA 4EJSA 1ZM3A 3DMDA 3FFAA 4POAA 2E87A 4Q1BA 4AKHA 2A78A 3D3QA 4GOXA 4MKHA 3QNUA 4M1YA 5BYKA 1E1RD 4WZBE 4XVQA 1G6OA 1QG4A 5FTJA 3AKDA 3VU9A 2QZ4A 3DL0A 3SR0A 4RKFA 2ODEA 2NO7A 4N0DA 3MSXA 1G3IA 2FE4A 1GIAA 1HT2E 4L4UA 3M6AA 4UJ5A 4BLRA 4EQ6A 2K5UA 1N6PA 3EZ7A 1RFLA 4W5WA 1LB1B 4NBSA 4OK3A 3RC8A 3L0SA 2OCPA 2OT3B 5KSOA 1S96A 2A9KA 2WJVA 2FWRA 4GSYA 2AX4A 4DIEA 4FWTA 3U44B 4Q7LA 4X8MA 4D4JA 4DLUA 4BZPA 1D8TA 2QQ0A 2XTNA 5CIQA 5FBVB 1U8AA 1CR4A 4LHYA 2JLRA 2FSFA 4OBEA 4FCTA 1T4GA 2IF0A 3ASZA 2CNWA 3QJYA 2YINC 2EFCB 1XD2A 2A5YB 4RSGA 2GHIA 3WNBA 4DEXA 3D6TB 4DLTA 1CXZA 4NZYA 4OK6A 1T3HA 5JFGA 3QPVA 5JS7A 3TW8B 4G5RA 4LHXA 3OFND 3SJZA 3EC2A 3IBYA 3X1XA 3CF6R 4OQXA 2CJWB 1TL7C 1G4AE 1VDZA 4LJ7A 3ASYA 1IXRC 3W90A 1AZTA 5KPJA 3TGPA 2ZJ8A 1KY2A 3TSOA 3KKPA 4CIDA 4LC1A 5D3MA 2ORVA 4S2EA 4QHYA 1RRPA 3MGCA 2Z5FA 1FNMA 4UXJA 2ZRDA 4MGZR 4TTPA 2GILA 4PQRA 4AI6A 1P60A 4PHGA 4NYMQ 2HV8A 5DN6D 4IEEA 1KDTA 1LF0A 1Q21A 2ZSEA 3AF0A 4RVCA 1OH5A 1XNJA 2BDTA 2V9PA 1FTSA 5DYGA 1NLFA 1YRAA 521PA 4DHEA 4PO9A 2UVQA 3GLGB 4IOLA 3CKLA 2HF9A 4U7DA 3CUEF 4LSGA 1BYUA 4PO8A 4UXIA 1D2NA 1WF3A 4RFSA 4AYTA 4DUGD 4MA4A 1XCPA 1RRFA 2UZ3A 5JI2E 5CYPA 4R2IA 4BE7B 2ZU0C 4L5BA 1GOTA 5J47A 1KO1A 2IYWA 1OYYA 4QJ3A 1SHZA 4OHYA 3THYA 1E2PA 3X2SA 1ZNYA 4HLUC 1Q44A 3RDPA 4W5JA 1E2QA 1GWNA 1E9DA 3AVUA 4JYCA 4JSTA 3TAHA 2GJ9A 1GNQA 2GDJA 5FBRB 2J3EA 1XFAA 4LJAA 2NO1A 2KB0A 3SQWA 3U44A 1FX0B 2ODWA 5AWFC 1EK0A 2OCYC 2D62A 3DHWC 1X8KA 4JYBA 4C7OA 1CJVC 2WPDA 4TSFA 3QEOA 4W9MC 1W1WA 2GXUA 4G1UC 1PV4A 2PEZA 2ZS7A 5CM9C 2AFIE 3CB4A 4BFUA 1MH1A 4JLDA 4DCSA 2BV3A 2Q9CA 1R10A 4XVRA 3QEJA 2WWXA 3NVAA 1G1MA 1XCGB 1E79D 2DFKB 1WBBA 3P20A 4XVUA 1Z08A 4ERNA 4D4KA 2CJWA 1E79A 3VX3A 3C4JA 2JLSA 1D2MA 1SVIA 1WCV1 3KKOA 2ZRPA 2GCPA 5CLLA 2OAQ1 3CM0A 4MITA 4V02A 4GMXA 3L8YA 2ZJAA 2O8BA 3VNVA 1IONA 1K5GA 1Q1BA 3Q7PA 1Y3AA 4TLDA 2IYUA 2P0EA 4PFSA 1E2GA 5D3MB 1JPJA 2IHYA 2VHTA 2EFDB 4DDWA 1MKYA 1XBTA 1LW7A 2QNRA 3R8FA 4JJKA 4FMBB 4Q4LA 3VR3A 3X1YA 2I1VB 1NMXA 2QMHA 4Q66C 1WQ1R 2ANCA 2ERXA 5AJVB 4GI7A 4JLMA 4B6EA 2ANBA 1ZU4A 2QP4A 4GRAA 4KFUA 3VAAA 2CL7X 1K5DA 2YYZA 3IEVA 2WWGA 5KNCA 3A1SA 1ANKA 5GVRA 5FOTA 1RJ9A 3LO5A 1VECA 1LS6A 4CEJA 3RC3A 4MGYR 3CRMA 2IYRA 1S2MA 3GD7A 1OXTA 1AGRA 1DTSA 3EA5A 2RKOA 3UXMA 1VCMA 1RE0A 4M1KA 1JECA 2P6UA 2QY9A 4MDEA 2GZAA 3BGWA 3A8TA 1VMAA 2OFOA 2VP0A 2WBLC 1FUKA 4A8JB 4PQFA 4E22A 1W7AA 1OFHA 3QVVA 4AKGA 5FPHA 4NYJQ 1HUQA 3B1WA 3PFIA 3QPUA 2F3RA 1JALA 1E0JA 1S9HA 2WKPA 3T35A 1ZUHA 3QBVA 1CR2A 1VHTA 1XEWY 1L2TA 3SQXA 3T15A 2OFWA 2O8FA 1X86B 3PVSA 4DBLC 2IXGA 4H1VA 3L0PA 1AK2A 2IYVA 2GXQA 1ZC3A 2YWEA 5E95A 1G5TA 1EFTA 3U7HB 3U6KA 5B58C 1E69A 2N1BA 2UKDA 4TL7A 1NVVR 4FMDF 1OV4A 1A1VA 1EWRA 4A0GA 3KJEA 3U6BA 5J4VA 3W8RA 3EIHA 4B71A 1AJEA 1BS1A 1T91A 1IXSB 1E1QD 2XNDD 5DO9A 2F1IA 5H1YA 2D2EA 3O8RA 4QGHA 1NVVQ 3BWDD 1KMHB 2ZM5A 5BN4A 2IT1A 3R9IA 3KKQA 2GVZC 2OXCA 3BH6A 3I61A 5G41A 4B3GA 1K8RA 4WVFA 1Z29A 4JVLA 2D2FA 3LDAA 5ANRB 1ZM4A 3C15C 4PZYA 1W2GA 1JJ7A 1U2RA 3RS4A 4B35A 1T8TA 1Z47A 3FFBA 5BYJA 5KNDA 3OEEA 4A6PA 2OHFA 2Q0HA 4LHVA 2W0MA 3LY5A 3CR8A 3K9LA 4ZCLA 3WP0A 3SJCA 1NLYA 1CTQA 3NG1A 3DEFA 5IK2D 4DRZA 3THXA 4KBFA 1IY0A 4A2PA 3GLFB 4MRRA 3WY9A 3KQHA 2OXRA 1U94A 4JLKA 2BVNA 1VG9B 2G3YA 2GXSA 1ZJ6A 1RPZA 1GL9B 4HLDA 3LV8A 2Q6TA 3VR4A 1E98A 2CVFA 4Q7KA 1SULA 2VHJA 1G8HA 4LUCA 1KI4A 1R2QA 4UNRA 5FTMA 3UIEA 5SZHB 5AUNB 4LJ9A 2R9VA 3GLIE 2ATXA 2WWIA 5BW8A 2VHCA 2D06A 5JMTA 3EZ6A 3RHFA 1Z28A 1FX0A 3AUYA 3ZVLA 3HPRA 3FB4A 4ABYA 5C46F 1FL9A 2W2TA 2JLZA 2FNAA 1G3UA 3BFXA 3VR5A 2GXAA 1II9A 3BE4A 2AKYA 4B2PA 2QBYB 1U8YA 2H5EA 4LBYA 1S4QA 1R5NA 4HAZA 4QJ5A 3GLGE 4TL9A 4KLZA 1TAGA 1Q57A 1YKSA 4LDJA 5L8VA 3THYB 1M2OB 1CRPA 4C0AC 3PIRA 4M53A 2PJRA 1SXJD 3HP1A 2ZJ5A 2MSCB 4Q4JA 2JJ1A 3P4YA 4JL8A 3CRQA 1Z5ZA 1AKYA 2ORWA 1QHXA 4NCKA 2QU8A 3H0KA 2PBRA 1BMFA 4HAYA 5CM8B 2RGNA 2F3TA 5B2ZA 5KDOA 1NKSA 2ZJ2A 4G01B 4JBWA 2IYXA 2V4ZA 3LAWA 2B7BA 5HCIA 3X1DA 3ZS8A 2J0UB 2YHSA 3HU2A 2Z43A 4FW9A 3RYTC 2FSIA 1PZNA 3EPHA 3ICQB 4ZCMA 1XXHA 3DZ8A 3SBEA 1COWD 1JB1A 1PLLA 3ADKA 1CRQA 2J0SA 2XZLA 4TYYA 4A92A 3AP3A 1J8YF 1DO2A 1E96A 1FMLA 3FMIA 3OEHD 2VRWA 4JLPA 1CULC 2QMEA 4AYXA 4JT4A 4TT3D 2Z0MA 1U81A 4ZCIA 4IDPA 2O0HA 3FKSD 4XWAA 2J87A 5P21A 4OI4A 3W3AA 1T3SA 4CW7A 2IUUA 3WHKA 2HJVA 1GNPA 1YE8A 2VO1A 3SC3A 1WRBA 2WSSA 2IYYA 1OH7A 2QRZA 4D2IA 1ZVQA 1KIMA 4G5QA 3QENA 1UBCA 4F4IA 2C9OA 1IXZA 5C18A 3NC0C 2V6JA 2QPAA 2WIAA 2CK3A 5EP2A 4D81A 4HUQA 4B47A 1KO8A 4DT1A 2H8KA 1KJZA 4XSHA 1IY1A 1OFIA 2JIZA 1KI8A 4JLAA 4P4SB 4BECA 1II8B 2GEUA 2W58A 2W6JA 1AS0A 1XJQA 1CJUC 2WKQA 4RY2A 1N5LA 3T5DA 2R6GA 5H8WA 2NO6A 1BO6A 2V1XA 3RLFA 4JLNA 4L16A 4LGMA 1GZSA 3Q9LA 4XD7D 4NMMA 1KAGA 1UKEA 4K46A 5HR5A 4QFMA 1AQYA 4IDNA 2CK3D 1YZQA 3GEEA 5E3HA 2ZVQX 3BOSA 5JWHA 4A36A 3U3RA 2FG5A 4M9ZA 3QPWA 5A5GA 4URZR 1NJGA 3EG5A 3O47A 2D7DA 2EFGA 2G0TA 3V00A 1FP6A 4NE2A 4AK9A 3IGFA 4JLBA 3R8CA 3GJ8A 4OQFA 1CS4C 2C98A 2BBTA 4EDHA 1DBSA 4MGKR 4Z54A 1HYQA 3RWOA 4CEHA 1KJYA 4LV5B 5D3QA 4URUR 2VA8A 3ZH9B 3CLVA 3AGQA 3FTQA 3DOFA 2D74A 4HDOB 4S35A 2ZVPX 3OESA 1OIXA 4HB2A 3IBGA 4KYUA 4LYFA 1V43A 1KI3A 2HYIC 4MUBA 4KVAA 4HB4A 3VR6A 2ODNA 4L9WA 4Q9LA 5DH9A 2YWHA 1W4BA 3QKTA 1HT1E 4HATA 4IFBA 1H8HD 5C2JB 4GT1A 1ONBA 3ZJYA 2ZANA 2CE2X 1HY3A 1GKYA 1NBME 2VQSA 2NIPA 4Q1EA 4Q4AB 1T9HA 1KKLA 2OV2A 5EE0A 1RIFA 1ZD1A 2P5SA 4M21A 2YZ2A 4LZZA 5KYKA 2J45A 4ZI3A 2Q9BA 4Q00A 2ONJA 4B3CA 1YU9A 2XNDA 4EIWA 5JJIA 5FOWA 4LJ5A 1VCOA 2R6FA 4ZDWA 3TH5A 5KHOC 4JT2A 5FBLB 1RZ3A 3ZVRA 3TNFA 3RS0A 2HXSA 1R0ZA 4V0KA 4BFSA 1ZCBA 5FI0B 2KJQA 1VYVA 1HE8B 2F7SA 3ZLJA 3A4LA 2BJWA 3SE0A 3QXCA 3KL4A 2WOJA 5F98A 3N5CA 4EJSB 4KFTA 4JLJA 1ELOA 3LXXA 4XTRA 2F43B 2PLFA 1R6BX 2V7QA 5KSZA 2JLUA 2ZXUA 1N2CE 4LRWA 2G1JA 4Q9HA 1QG2A 5LB4A 3K0FA 1XTJA 4A8JC 5EE5B 3HR7A 4ESHA 4GNKA 3B1ZA 3QKSA 1F60A 1DAMA 1E9AA 2C9YA 2Q3MA 1Z22A 2VBCA 1N6LA 1DADA 3P1JA 2EYQA 3MD0A 3JVUA 5FFMA 5TXGA 3TKLA 3A1TA 2WHXA 4BRUA 1E2FA 5EUMA 4WA7A 1NMYA 4KBGA 4PPFA 3Q72A 4OI1A 3BH7A 4ZDIA 3WYAA 4DB2A 2Z6VA 1G8FA 4UNPA 3NBYC 1H8EA 5TVKA 1CF4A 5EP3A 3MMPA 2C8VA 4TZ6A 2PCLA 3PV0A 1UAAA 1BH2A 2FGKA 5FUXA 4MYTA 1F48A 2B92A 2EU8A 4KU4A 3U7EB 4HLQB 1L8QA 1TUIA 4BASA 4IOKA 1E1QA 3A1UA 2CDNA 2OE2A 3A58B 4F91B 1XD8A 5FPYA 1E2IA 3VMFA 2X1VA 3KQUA 2JGNA 2R6AA 1SKQA 1KDPA 1RJ9B 2VP4A 2W0SA 1TPZA 4IVRA 3C5CA 1PVOA 2ZRMA 4QNRA 2DWQA 1SZPA 1FOEB 2VHUA 2RHMA 4LPSA 4PHTA 4M9SA 2EWWA 4G5GA 3U7GA 1R8SA 2DB3A 4RZ2A 3GJXC 5FOXA 4AY2A 3U3KA 1QHYA 3RS7A 1KKMA 2ZIAA 4PSAA 4MDFA 3EIEA 1ZIPA 2X8AA 1OYWA 4JSYA 1KOFA 4HB3A 4JKIA 2GAAA 3SFZA 2XB4A 4UNQA 3KQNA 1N0UA 1KZ7B 3EX7C 5J4YA 3B78A 2O52A 4IDOA 1I4DD 1E2HA 4BGDA 2ZSFA 1RRGA 1Z6AA 3UKDA 4A0RA 2WJJA 2RMKA 2QBYA 1P73A 3LLUA 4TQAA 2DFNA 1E9RA 4V0MA 4DCNA 3ZVNA 1ZCAA 2WSMA 3RANA 4TLCA 3CONA 3NH9A 2Q21A 3SS8A 2Z4SA 4XOIA 4Z8YA 1XF9A 5KDDA 4Q4HB 1AA9A 1SVMA 1KO7A 2B6HA 3TVDA 4BUJA 1XPUA 4GP6A 1XD9A 2BKEA 3CPJB 1FZQA 1ZYUA 4A8JA 1D9XA 3VTKA 1SGWA 2GVDC 1VYUA 1WA5A 2P2LA 1WBDA 1VYTA 121PA 3QG5A 3RRYA 2DR3A 1GVNB 3GEIA 3SI7A 3VFDA 4HZUA 3TW4A 3I5XA 2VP5A 1N5IA 1P62B 2AK2A 4B43A 5EE9A 1HH4A 2OILA 3L0IB 5G40A 1P2VA 1V5WA 1A5TA 3E2IA 2WKRA 2WICA 2JIZD 3MJHA 4DSUA 4P4TA 1KAOA 2RGNC 2ZJBA 4NYMR 3MUFA 1JAHA 4JL5A 1G7TA 2HYDA 4C0LA 2EW1A 1ZP6A 4OHZA 1JEDA 1M34E 3REGA 4GFDA 4RJLA 4F93B 4EAQA 4BQSA 2ZYTX 4AWXA 2XJ9A 3LBNA 5JS8A 3W8NA 1A4RA 5GVSA 1KI6A 5F3WB 2P3SA 4RFVA 3N70A 4HSEA 3AKEA 4ZO4A 1FUUA 1NN5A 4LOAA 4O25A 1TF5A 4O2RA 721PA 2Z4RA 2F9LA 2KSQA 2X19A 1YZLA 3KXLA 4CEIB 3RS5A 4NTZA 4JMPA 3T1QA 4D0NA 4E07A 1AGPA 3Q7QA 1ZNZA 4Q02A 3R7WA 4DLWA 2A5FA 1UPTA 3TK1A 2GEVA 4Q01A 1R0XA 3M0EA 3OIUA 3PG5A 3U7FB 1KI7A 2QGZA 1EESA 3FMPB 1AS2A 1JR3E 4RFSB 1MABA 3EPJA 3ZS9A 2OAP1 2G88A 2AWOA 1M1YE 5CDFA 2FEOA 1FNNA 3GLHB 2QE7A 1CJTC 1T0HB 1XCMA 2IUTA 2V55B 1OJLA 3WBJA 4MRPA 4G5OA 5CITA 3WMFA 1JXOA 3QXJA 4I1UA 2HT1A 3SN6A 4DLYA 4Z1MD 2W6JD 2V7QD 2IWRA 1L7VC 1P75A 4WIAA 3EPLA 4EFLA 1SKYB 3NH6A 2VP6A 1JBKA 4YXWD 3SYNA 3S1AB 1KI9A 4P4UA 3T12A 3T1OA 3LXRA 4Q7JB 2FZLA 2N46A 5TV2A 3IUYA 5AJZA 1NIJA 3DPUA 5FL7A 5EUQB 1TF7A 2GCOB 2ZR7A 4LWZA 3AVOA 4NH0A 3BS4A 1P3JA 2CHQA 4IXMA 4JL6A 1DELA 4OK5A 1TQ6A 1S3SA 2GF9A 2PMKA 3IO5A 3LX8A 4B33A 4TLAA 4H9GA 1ZD9A 1KHTA 4QM6A 4BRWA 2HLDA 1IN6A 3THWB 1F6BA 4TT3A 4C0JA 2V1UA 3THOA 4DDTA 1XTKA 3OEHA 3IO3A 3CH5A 2YV5A 3AVWA 2AD5A 1W47A 4Z8XA 3RVBA 5C1BA 1COWA 2IS1A 4NYIQ 1B0UA 1G5PA 1ZW6A 2BMDA 2CHGA 2CLCX 2H57A 4RKEA 4YC7A 3U3JA 4BFTA 1P9NA 4WAUA 3NTUA 3GLFA 3L43A 5TMPA 1UBEA 2IYSA 2RH5A 4QL3A 5FBQB 1DAIA 1I4LD 1E0SA 4FMCF 1O3YA 3NDBB 3L8ZA 3MCAA 4LYHA 3W34A 5JEDA 5FOSA 1QVRA 1E2NA 3C16C 4ZPXA 5DLQC 3TR0A 2YOGA 5EXPA 1L4UA 4YQFA 3CRRA 1YZTA 2QAGC 4GZLA 4MRNA 1NN3A 1UKZA 1GITA 3REFA 3RWMB 3BIFA 3W5JA 4Z51A 3X1WA 1KNXA 2VEDA 1IY2A 3K70D 2ZITA 2FN4A 4OL0A 2PEYA 1CP2A 2PL3A 1EGAA 4GDFA 2UZIR 2ZPTX 1ESNA 1XZQA 1CR1A 2I1QA 1XP8A 4PC3A 5B30A 1NIPA 1QRAA 2VYFA 2A2ZA 3GLHA 1E2EA 4C4PA 4QBHA 1PLJA 3MWYW 1QHSA 3K8YA 1CLUA 4NP6A 2BHRA 2WAXA 2BKUA 2MMCA 3ZDQA 2WWHA 2BBSA 3UWOA 2XAUA 2B7CA 3IIJA 1NMZA 3ZGXA 3AKYA 4OI0A 1N25A 4RCZA 1LNZA 3WXMA 2ZSAA 2B8WA 3KB2A 1ZUIA 2A7QA 1J90A 3OAAA 4LBVA 2O8FB 3WHLA 2XTMA 4FI3C 3K70C 4BFVA 5E7IA 3IHWA 1OKKD 3SEAA 4RZXA 2C95A 3KXKA 3A6PC 2FPKA 4OKSA 2O8EA 1SVOA 2G83A 4IFEA 5IT5A 2WJGA 4B2IA 2QRNA 1W0JD 1U0JA 2ZRAA 3MAAC 1HQYE 2KE5A 2OLJA 4Q9JA 3OIYA 5J5CA 2XITA 3EASA 3TRFA 1OW3B 2IC5A 1JR6A 4YMUA 2ZJOA 2KBEA 2A5DA 1G5RA 2IK8A 4Q5IA 2PZGA 1KSGA 1M7BA 3NHBA 2CEAA 1PLKA 1KI1A 3MWKA 2FZ4A 4AD8A 2C04A 1NN1A 3ZYCA 4BLOA 1XDBA 1TX4B 4C9BA 1G291 2ZROA 3U3MA 4MH0R 8OHMA 4AKIA 1U9IA 5LPNA 1KO5A 1E4YA 3THXB 4HAWA 5L3SB 4P0TA 2ZI3A 4FINA 5K8LA 3FKQA 4CDGA 5G53C 2QGNA 4WZ6A 4ZI2A 1JJVA 2QROA 4H1UA 1Z83A 3LBIA 3TQCA 2GAOA 2OCAA 2O8DB 3FMFA 4ZKEA 2RHDA 3QXSA 2J5XA 1NN0A 5FR1A 2JLQA 2BMEA 3C7KA 1XTSA 5BQ5A 2AD1A 2MMGA 3L0OA 3F5FA 2RGAA 4FCVA 2ZYWX 1II8A 5KSPA 1OKKA 5B64A 3MWLA 1G18A 5CJ2A 5SZJA 4IXNA 4A4DA 1KGDA 4UJ3A 1ZINA 3IIMA 2FJUA 3K0CA 1DE0A 4PHFA 2ZI4A 3AM1A 3I3SR 4C0HA 4C0SA 1DVRA 5JBQA 3PITA 3R20A 1W46A 1DAFA 3NEJA 2PX3A 2ZRNA 2QE7D 4R7ZA 4R71A 1AZSC 4DCUA 1RYFA 3DKVA 4HLCA 4V0LA 1BKDR 4KYIB 5FUWA 4B73A 5C4MA 3LW7A 5HKKD 5AUOB 1KI2A 1EFRD 1JI0A 2F43A 5JECA 1X8LA 3CNNA 1ETUA 4OQLA 4X8LA 1G21E 3R9WA 3K09C 3DO6A 2QTVB 2ZUDA 2J41A 3ICEA 2J0VA 3CW2A 2ZI9A 2ZRFA 3TLXA 5AUPB 2ZE5A 1GNRA 4GBMA 1T3LA 2FV8A 3B6EA 4EUNA 2QEQA 4Q19A 1FPMA 4EQ6B 5CDFE 3FKSA 1E99A 1KK2A 4CRWB 2XNSA 2KBFA 3U61B 4NCIA 5EXTA 4US2R 2W2XA 4CT5A 2C96A 3GPLA 3T34A 2ECKA 1LVGA 2PT5A 3T1VA 3TVTA 4KSCA 3HR8A 1GILA 2C5LA 2O0KA 2IXEA 221PA 3CNOA 1QF9A 1CBUA 2EFEB 5M04A 2RGDA 3I4LA 3RRNA 5F9FA 2MSEB 1MO3A 1E94E 1G7CA 2IS2A 5KOYA 1ZUNB 2R44A 1L4YA 3DOEA 1G7RA 2GBLC 1Z0JA 3LH5A 2BMFA 2WAYA 1GFIA 3AP1A 2NTYC 4D0LB 4PO1A 2IBMA 3B85A 4DVGA 2WWWA 5KTYA 3PUVA 1I2MA 4DXAA 4C30A 5KO2A 1HQCA 2C78A 1HE1C 4LBWA 1OT3A 1W44A 1KNQA 2FPMA 5EXSA 1VG8A 1TUEA 2G77B 3KKMA 3RSOA 3K0SA 1X3SA 1YHNA 2VSOA 3K0AB 3RNLA 2FA9A 2Q3FA 4HUQB 4TTRA 4RZ3A 4PXAA 3TMKA 2VL7A 4TL8A 5K8IA 2CBZA 1XTRA 2XX3A 1GKIA 4RD4A 3QF4B 3UATA 2P67A 3QF4A 4U00A 3LX5A 3Q85A 5J4LA 1S3GA 4GL2A 3CR7A 2DWOA 2C77A 3A4NA 2IXFA 4JS0A 4YXWA 1KZGB 1WDTA 2BMJA 4HDQB 4TMZA 3SU8A 3CH4B 1GAJA 1R5BA 4BZQA 1R0YA 3OE7D 5HCNA 3K0CC 1Z63A 2OUKA 4I4LA 1TTTA 1KMQA 3CRVA 1CR0A 2ZE8A 4TN1A 2NGRA 1YR9A 3EXAA 2IW3A 3ZIAA 4D25A 1FMJA 3ZZTA 4EPXA 2VLIA 2DHRA 4GOJA 4TQ9A 3GLIA 3JVVA 3GLIB 4TL6A 3LA6A 1O87A 1CIPA 1UBFA 1RVDA 3DDCA 1OF1A 5DN6A 4HZIA 3OEED 5TY0A 2P6RA 4AC9A 2HDNB 1XPOA 1KK0A 2FF7A 1R0WA 2A5JA 3K9NA 4RD1A 1M7HA 5L3VA 3Q8XB 2BBWA 3QE0A 1TNDA 1N0VC 4O0MA 1NI3A 2ZSDA 1VCIA 3VHXA 4I1VA 1Q12A 2JJ8A 2FU5C 3I1FA 4P32A 3Q5DA 4TWZA 5CLQA 3U4QA 3EA0A 2X2EA 1MO6A 4D26A 3WYFA 3QG1A 3EWAA 3WP1B 3CF0A 3ZD7A 5EXXA 4RD0A 1DEKA 5IHPA 1OXXK 2CL6X 2IA5A 3AF1A 4UNNA 1RYHA 2NZJA 4IKEA 4UXHA 3BERA 4NONA 1N6RA 5DYIA 3QQ5A 4M1WA 4OHVA 1HA3A 1H8ED 2ZUCA 4AIIA 1G8YA 4JBXA 3UANA 2GJAA 3BB3A 4JVNA 4DLRA 1DAHA 1UJ2A 4LJ6A 5FL3A 2C99A 3BFKA 2J0QA 2HF8A 1VIYA 1IBRA 1EX6A 2WMNB 1GDDA 2ZYVX 3BORA 3L82B 4O3MA 4NL4H 2WZQA 4OJQA 1X1RA 4WBSA 3T06B 2PCJA 2Q3HA 3B2EA 2QMOA 3LW8A 5LBIA 2IS6A 5JZVA 1YQTA 1XRJA 3RRMA 1XMIA 5L3RA 4C2UA 3LFUA 3ZQJA 1OE0A 4KO8A 4QXAA 2O8CB 3CX7A 3IQWA 1P72A 4KCGA 5AUQA 1E2LA 2BC9A 1JXMA 2RCNA 2R8RA 2YC2C 4N0EA 3KZ1E 4PC2A 3G0HA 2OLKA 3W6NA 1T5LA 3WNDA 3WYGA 3K9GA 2ZR0A 4JIMA 5CB6A 4DUGA 4IEIA 4XSGA 3KQKA 5CK5A 2V6IA 2J46A 3PEUA 4CVNA 1QHHA 2QORA 4Q4JB 5C4GB 2WIBA 4DSTA 4JLVA 1MRSA 4HLUA 4OHXA 1GL7A 3TUZC 4HI0E 3UMSA 2QP9X 5CJPA 5JI3E 4ACBA 1XZPA 2AL7A 2ZI7A 4PR0A 2J59A 3B9PA 4M1MA 4ZIRA 2JASA 1AN0A 3IIKA 3ADBA 4EFNA 3QBTA 4A82A 3GFOA 4ZKDA 4ESVA 4JVSB 4YMVA 1G3MA 1GL6A 3RRZA 5FOVA 4QG7A 3QKUA 1P9RA 1JEEA 1OFTA 3NEYA 3VX4A 1H8HA 4KAXA 5E7JA 3NHAA 2XOKD 2H17A 3B9QA 2NO0A 3CPEA 3GJ6A 1DAKA 4Q4AA 2DBYA 2O5VA 1OFUX 1PUJA 1YVDA 4B2LA 4QBFA 3A36A 2PLRA 2ODBA 1G8PA 1FTNA 1TU4A 3JZAA 3KTAB 4IJMA 4LJ4A 2PX0A 3I8SA 4P33A 1NBMD 3R9XA 2OFXA 3LBHA 4D4MA 1TQ4A 3KUCA 2YWFA 5A0FA 4HEJA 4QRHA 1KY3A 3RAPR 1Q20A 2XSZA 2QT1A 3BAFA 3PQCA 4G5SA 2OM2A 1TQ2A 1IQPA 2DCUA 1I2DA 4BFXA 3PCRB 3B8HA 4Q1AA 3B5JA 3BFVA 3T61A 2C2HA 5KUTA 2REOA 2YJTD 1SXJB 1T0JB 2GKSA 3I92A 4PC7A 5BXQC 4X8OA 4EJSC 3KKNA 5HKKA 4L15A 3AB3A 5HTKA 3IILA 4WW0A 1KI6B 1GUAA 1E9CA 2JLYA 3WMEA 4PHHA 1E2DA 4K81B 2CLDX 2JA1A 4LCBA 5HE9A 5DISB 3GQBA 3K53A 1OH6A 4Q03A 1IJEA 5G3ZA 3I8XA 4E09A 3MWJA 4NCJA 3GLHE 5F2EA 2J7PA 1E0KA 1N6NA 1KJWA 2WJYA 1KK1A 3VR1A 2QM7A 3F0TA 4EPRA 2C9CA 5FR2A 3O8CA 2ZSBA 3TUIC 2QUZA 1N6HA 3OHMA 4Q9KA 1Z2CA 4CEHB 2ZYUX 2XZPA 1SXJE 2FMXA 5LD2C 2ZREA 3ND9A 1E9SA 3GEHA 2XZOA 3MG9A 1SHKA 4KFSA 4AYWA 1YZNA 2WWFA 4RD3A 3WRYC 1KDRA 1VG0B 1W36C 1KO4A 4MKFA 1OIVA 1U0LA 5HPYB 4PPNA 1J8MF 3UMRA 1KK3A 4I81A 3G5UA 1GG2A 2Y8EA 3GLFE 2QM8A 3OIVA 5JHHB 3CWZA 1E0AA 5E4FA 2A3RA 4KHZA 3MLEA 4DZZA 1P61B 3WBKA 3FHTA 3D31A 4PSKA 4BZXA 4DT1B 3I72A 1PJRA 4M4SA 2QSYA 3IQXA 4MKIA 2AK3A 1MO4A 3LD9A 2XJ4A 2PT7A 5GJBA 1CJMA 1NLZA 2KI5A 3BJIC 4ON9A 2IS4A 3E5HA 1YRBA 4MQBA 2V54A 3UPUA 4JZKA 3OZXA 5UKDA 5B57C 1JPNA 1RW4A 1NY6A 4TMVA 1Q22A 1UEIA 4TLBA 3HU3A 2WV9A 4OQMA 1US8B 1Z06A 3TSZA 5K8TA 1JQLB 3OAAD 2DFTA 1GP2A 3SNHA 4BPBA 2Z83A 3ZZUA 1Z0IA 3FGNA 4OJKA 3NXSA 1E2KA 2NOAA 3ZD6A 4XWKA 2RB4A 1E9FA 3DM5A 3OF5A 1G6HA 3GJ5A 4YLGA 4HAVA 1W2HA 4GPTA 4ZV4A 4KXFB 2ZE7A 1Q1QA 1AKEA 4FWIB 5K8UA 5JJKA 3QXXA 1F5NA 1R8QA 1F2UA 1M7GA 1SXJC 1F3OA 2CL0X 1NSFA 3TE6A 2VH5R 3ADCA 4HYYA 2VPPA 3SJAA 2WJIA 5FOUA 1J70A 3MJRA 2REBA 3L2OB 1TEVA 1OB2A 4Q9IA 1GRQA 1S8FA 3NDPA 1MR3F 5JCPA 4DEYA 5TARA 2XGJA 1P6XA 3DKPA 4M22A 1UADA 1FQKA 5CK4A 1EXMA 2WTUA 2DWPA 4QJ4A 3EPKA 3U3OA 2GEDA 1HEIA 1Y63A 1U98A 2BIFA 2GZDA 2RGXA 3D8BA 3PUWA 4W7SA 4A0FA 3GMTA 1EFHA 2FOLA 2AFHE 1VCNA 4AKEA 1F2TA 2G9NA 4BFZA 1KTVA 1YR7A 3KJGA 2W6IA 3LLMA 5LD2B 4PAOA 3SBDA 3K0EA 2ZJYA 5BWMA 2HCBA 4LYJA 4MYHA 4HZUB 5SZIA 1J7KA 2YKGA 4NKRA 1QHIA 1Z07A 4B3DA 1D5CA 5AK0A 1R7RA 1W4CA 2IEZA 4Q1CA 3W9YA 2HLDD 3BB4A 1SVLA 2ZRIA 2LCFA 3GJ7A 4KODA 1NG1A 4KSBA 1FW6A 2JEOA 1W0KA 1KSHA 1AS3A 2LKDA 2GNOA 4YMSA 3K1JA 4M9QA 3THWA 2W6ID 3HYTA 4RD6A 5E7MA 2IYTA 2YC4C 1ZNWA 1P4SA 2F1HA 1DG1G 1SKYE 1W0JA 2HJGA 3B13B 3PUZA 1X1SA 4Q1DA 2JLVA 1WP9A 2IF2A 3DZDA 5DI9A 2ZS8A 4A1FA 4U02A 3Q3JB 1P9WA 3PUXA 4QNMA 2DYKA 4CEIA 3C8UA 5J40A 3TAUA 1RKBA 4J0QA 4CYMA 1JR3D 1XX6A 3HPQA 1Q3TA 2F1RA 4GP7A 4A0HA 2GJKA 4W5HA 2QTHA 4M1SA 4ZDKA 3AQ4A 2CE7A 4A2QA 5JLJA 2EYUA 2HCJB 2OSBA 3AVQA 2GETA 3BRWD 4LY6A 4MUAA 3UMFA 4NDZA 2J1LA
chains in the Genus database with same CATH superfamily
2QYHA 3TTUA 1WVMA 1ZRMA 2F3SA 1D7AA 1W4LA 1PJSA 3CZPA 3RW9A 1BD3A 2DAPA 4I50F 2HB6A 3P26A 1CE8B 1Z5OA 2Z09A 3GEBA 4EW1A 5ALMA 3H86A 3LKZA 4O4HB 4P3OA 1E5XA 3L8EA 3QYFA 5EJEA 1P7YA 5DTQA 4UUPA 1RQGA 1WHTA 3KWMA 2DPLA 4QFBA 3RVMA 4JJ6A 5B6IA 3UWKA 4XVCA 3K1ZA 3QNWA 3M89A 4IO0A 5AOCA 3KZOA 2JAHA 5AH0A 3OC6A 4RORA 4UHHA 3TIFA 3W5CA 3G3EA 3I6MA 2HRQA 2Q5CA 4ZA2A 4RE6A 1U0HC 4LJSA 5IXYA 3PS9A 3EWSA 3V1UA 1B8UA 3TOVA 1UBJS 1WR8A 2FPSA 4TYNA 2FGJA 2D3TA 2XWJI 1A50B 2TMKA 1GTJ1 3GXOA 4GS5A 1II0A 1PK7A 1AQ6A 1RAAA 1FBNA 3U4QB 1HDOA 5T67A 5JYEA 4WLNA 3K7EA 3DBOB 4PFKA 4BJ5A 4YFYA 1DARA 2P62A 4I4NA 4DMLA 2BFCB 4EA6A 3EBOA 3F98A 1EAYA 4M1OA 4WPGA 3IDQA 4WE3A 1XTZA 1FDWA 1TADA 4EPYA 1NSTA 1LA2A 3CNLA 5DYYA 3KETA 3K32A 2AI1A 3WMRA 1RLIA 4ZU1X 3W2IA 5JZ9A 4N1AA 3GEDA 5FJJA 1Y6FA 1TAHA 1XJ0A 1PNOA 1MBZA 1DMSA 4WZAE 2IL1A 1F1BA 2R8EA 4MW9A 4XQ9A 2VPYA 3S2FA 1XTQA 2AN9A 4YMGA 2DSNA 2C2MA 2EEPA 2UVDA 2J3DA 3E6AA 2BR4A 3I2HA 2DCMA 2NXNA 4TTTS 4DC9A 1PNRA 1O5IA 3QYJA 3N2ZB 2VC2B 4TVOA 4Z9FA 3QFSA 4J0JA 4D97A 4Q9DA 1XNQB 2GPAA 4GX1A 3VZCA 3BK7A 4LZOA 2Q4OA 1V2HE 1C30B 2WTAA 1WDMA 3IE0A 1Z2NX 3WFIA 4DLNA 5DM2A 1W48A 3NHJA 1HZJA 3QXHA 4JELA 4LK2A 1SVWA 3PYMA 4OB8A 1ZN9A 3H7AA 4AVYA 1JQJC 1OI3A 2ODAA 1G8MA 4QOSA 5LMUB 4GZ5A 1PFVA 1T2VA 2E5WA 2EL9A 4PLWA 2FLKA 1M2GA 4NNPA 3P32A 2G72A 3DOHA 2JKYA 4ETMA 4AN0A 3IQHX 4R9UC 4DSNA 2MSDB 1K8XB 3VI3B 4EUHA 1A9TA 2ZR8A 3HCFA 2D5BA 2XWQA 4RS3A 4ZAZA 4CU5A 3QVLA 1H3NA 1U5BB 4X7BA 3QJGA 2HMWA 1B23P 4BO2A 5HK8A 3UFXA 4D0GA 1EWKA 5KBYA 2OCBA 2FDCA 3ABSB 1D2EA 4I4TF 1OXSC 1UKVY 2G0NA 2FSHA 3A3KA 5F51A 3VVCA 2HMUA 1G3RA 5IYZA 2WM9B 1X1QA 2GWHA 2Q9AA 1NXQA 5LQMA 1U3CA 2JJYA 3SFTA 3TQFA 3V4VB 5L7TA 4RHFA 2C8KA 4MINA 4A9AA 2AJDA 1QR6A 3PGKA 4N18A 1GRCA 2NO9A 1NVDA 5K3FB 5H83A 4FJ1A 1WHSB 3ECAA 2UXDB 4MS3A 2FR8A 2F6RA 2H4WA 3T7DA 1N7JA 3E58A 4C3ZA 3IE2A 1DDIA 4MKGA 1I9CA 3UZUA 3VPCA 1DV1A 3A9RA 3NOQA 4RF3A 3VV2A 4BJHB 4ECEA 4MCHA 2FHSA 3VPFA 1W36B 3LVQE 3HJNA 2AMYA 3HUFA 4KWTA 1EX7A 1I7DA 2FI1A 4UVEA 1WMBA 1Y4SA 2XMPA 1JA1A 4X00A 4YMTA 1VLMA 3LUAA 1GKUB 3MIZA 3N9IA 4I99A 4PLPA 5KTNA 2VHWA 2YCLA 2VSXA 2FUEA 1E9BA 1PJAA 4WKOA 2XE7A 1G38A 3LBFA 2A0UA 3ELWA 3NOVA 1UC9A 4NOKA 3QA3E 4D6PA 3N8HA 3Q3VA 4IUBS 1U2DC 2X77A 4G9GA 2OCLA 4V0NA 1C0LA 3W9BA 2H7VA 2PUBA 10MHA 1LWNA 3QOFA 3B1XA 5C8XA 2F3QA 1IUNA 1KU0A 5G1NA 2FZ5A 2GT1A 5LU9A 1IN8A 4TS4A 1EXWA 4X45A 3VHLB 1FIUA 1LSSA 2Q45A 4N7BA 1NRJB 4M8SA 1N0WA 4U3JA 2RH8A 3SYRA 3E7PA 3UAZA 4CMEA 3VU9B 2JDID 4IDBA 2C9DA 1W4ZA 4U8GA 4GDMA 4WCFA 2F00A 2K7ZA 5BNTA 3IOBA 9LDBA 5IZCC 3EHEA 2IHUA 3K1AA 3QRWA 4E5MA 1XMVA 5JQGF 3PD0A 1A2QA 2J7PD 3O92A 3E7FA 4EGSA 1HT0A 3EVTA 3CX4A 3HJAA 3QE9Y 1VZ2A 5C7OO 4RKQA 5DNEA 3Q10A 1E1YA 1WDLA 2BCGY 2RG7A 3ZE8A 4CV0A 3A9UA 4NIMA 1TKBA 2P0AA 2OC9A 5AW8A 1SCKA 1W4AA 1BROA 3EOBI 1I1HA 5I7FA 3UAGA 1GTVA 2XZDA 4G3XA 2I2FA 2C58A 1QQ6A 2QXYA 2YN4A 3BG5A 2M1XA 4LZNA 1PR3A 3C43A 4MV3A 5LBTA 3RFXA 3VJMA 4C4ZA 4YUAA 4YACA 2NZ8A 2HQ1A 3ZDDA 6REQB 4MEAA 2XXAB 2XB6A 1SZJG 2HKIA 2JGRA 4YFVA 1EINA 2R751 2H63A 4H7DA 4Y9RA 5CU7A 4Z4GA 1N2HA 4Q4HA 4REQA 4F7WA 3FVTA 1U0NA 3AF4A 1NZFA 3T5BA 3VKHA 1F2TB 1GPAA 3B3GA 4IFIA 1B74A 3C1OA 4U2GA 3CZQA 4P80A 3IT0A 3B6JA 4YLEA 1K92A 1IFXA 4XLZA 4IVQA 4YRFA 4WXPA 1OGYA 1GG8A 3DL4A 4ZGBA 1WIWA 3A6JA 1V8ZA 2JEZA 5BNZA 3SCZA 1HE4A 2O7NA 3ITEA 2B37A 2Z9BA 1JS1X 2Z8YA 4ZHSA 2LV8A 3H8JA 2GCIA 2PD6A 1VMDA 4EPVA 5A3RA 3NLLA 3AVPA 4NV3A 4UAUA 1Z0AA 1EX1A 4M9XA 4CL0A 4D80A 1DT5A 3WRXC 3FZNA 1TC2A 2C03A 2Z2IA 3FWYA 2EKBA 4PZ0A 3UGTA 3V8BA 4DWJA 4XWOA 2R6CA 4F21A 3IKJA 2OB1A 4OF4A 1OQAA 3G2HA 1SK8A 1XXHE 2F8SA 1JJIA 2V74B 1NL3A 3C24A 3CLHA 1WXWA 3FLMA 4RL6A 3GP8A 1HV8A 2QAGB 5AKYA 5SZKB 1ODCA 3EZNA 3GGDA 4RV5A 2GF0A 2GRJA 3LQKA 4MB2A 3P2JA 1KMCA 1ESZA 5I3ZA 1V7PC 2CJFA 3N6XA 4KGDA 3K0HA 3HA2A 4ZDJA 4FFBA 3JCZA 3AG6A 3PFKA 2VK4A 1P2FA 1R3UA 1UM8A 1U3TA 3R5XA 1XK7A 2JFOA 5EPEA 3EOAI 2P90A 5EHQA 3OE5A 3KL2A 4YRQA 2Q1XA 1UMDB 4IM7A 3WXBA 4J03A 2GN1A 3JQBC 1XMSA 4ZC8A 5JPIA 3WJAA 2C8LA 2HXYA 1R37A 1T5IA 1OLSA 1VHLA 2DRIA 4RH1A 2OCIA 1E3LA 4OXYA 4U8HA 4PLHA 3B1YA 3FDXA 4EMSA 3QFTA 5COQA 1TZJA 2ASVA 1K6MA 5K0EA 5I47A 2P4HX 3OE4A 4NS1A 1YDFA 4NBNA 1IZYA 1RQNA 3EFEA 3I9NA 4ZV7A 4AKTA 4C5AA 2FW8A 1TK2A 5FTKA 4X5OA 1NVUQ 1E6MA 4FIZA 4KXMA 2OO7A 4KUEA 5DGIA 3RHZA 2AGVA 2GZSA 1JIJA 1Q6ZA 1OZFA 5GGXA 2DFLA 4IJUA 1G64A 1RJGA 2YTZA 3ZIAD 3WK8A 4EB0A 3UFBA 1XZEA 1SQGA 3VTAA 3TSWA 1K08A 3A37A 4LJKA 4BMXA 2Z98A 2CNDA 2HM7A 1M75A 1KY5A 1LBEA 5L3QB 2D1TA 2ZB3A 1CR6A 1TM1E 2R79A 2RFLA 3SHQA 2GJSA 5A5EA 3B1VA 4I46A 1NI4A 3PWSA 3PT5A 3TMAA 3L0BA 1N36B 3W6OA 1HYEA 3HKCB 3PF8A 4DPMA 4GPBA 3RPEA 3LUBA 3SYKA 3EB9A 1W5SA 3TBFA 5K8CA 1DIGA 5AJYA 4FR0A 3UUFA 2VYQA 2EC5A 1E4VA 2X5NA 5GGYA 5AKEA 3PUIA 2W11A 2P2DA 2WSSD 3LVRE 3OT1B 4UAJA 4ZAYA 5KB3A 4TZ0A 1W0KD 2I4RA 2O8EB 3AETA 1K7FB 2VJAA 2Q2OA 2UUPA 1HTWA 1QH1B 4K0RA 5JCOC 2OENG 1P91A 2UYCA 2QI9C 1WV0A 4MW6A 1ZNXA 3B60A 3GY0A 1ZKMA 1J2TA 4G9EA 2KPOA 4KK4A 5JWOA 5KTKA 1NT4A 2ZRGA 3WJ1A 2JIMA 5JHGB 1WMEA 1OX4A 2G25A 5DPMA 2IDZA 4UW9A 3MGBA 1UK7A 1J2JA 6CHYA 2R68A 1WW2A 1ZS9A 1MJ5A 3GV0A 3IJEB 1EIZA 4RPLA 3TWOA 4GZMA 1Y7TA 2HNKA 4H6VA 1QIGA 3OMXA 3K0KA 1ACLA 4KXLA 4D8TA 2C29D 1HDXA 1QO0D 2D0IA 1MNQA 2W8ZA 5DHPA 2YRFA 1L7DA 4B4OA 3AHFA 3F6EX 4YCLA 1PSDA 3PTZA 1U90A 1FFDA 1BNCA 3VVMA 4ENUA 2QN6A 3TMYA 3D8RA 2QT0A 1TM7E 1HLPA 1C80A 1JSXA 1PHRA 2YQZA 3TVYA 1SXJA 1G21A 4PG7A 4V2UA 4CF3A 4EPWA 2YOHA 4JBLA 4YJFA 3C3EA 5A71A 3M3DA 3ULKA 3EW9A 5JXHA 5U9CA 2LD4A 5FBZA 1PL6A 1UKBA 1XDUA 5D00A 3ZHBA 3ZQ6A 5JC1A 2P65A 2PH3A 2NMVA 2AMFA 4F4CA 3N6VA 3JAWA 4YV2A 2JLWA 2VUSA 1DS6A 4FSDA 5K4AA 1QZUA 4A6EA 1P7CA 1FP7A 2WF6A 1XYYA 1Z2AA 3FOCA 3IRUA 3KM0A 3LCVB 1ACMA 1TQDA 2OG2A 3I83A 3Q7EA 2NN3C 4MGEA 2XB2A 2IVZA 1ZH0A 3NDIA 2OZEA 3STUA 1PQUA 4D8YA 3FBTA 3KDPA 4OGFA 5JNVA 1O9GA 2DH6A 3A28A 4KNWA 1ZD3A 1GUDA 2XQKA 3ZZ1A 4QKQA 1N4DA 4P83A 4TTQA 1N5JA 4YT5A 3FX2A 3WWEA 1LDMA 2G1PA 3RC7A 1V1MB 1VMIA 3QOWA 1YR6A 1HKHA 1MG0A 1RWOA 4LXXA 4MKXA 4UZSA 3BRWA 2IPMA 5JS1A 5BSRA 3TLBA 1IN4A 1NNEA 4WJLA 3C8HA 2CMKA 4UKDA 2RIRA 4XUCA 1AXEA 1J6UA 3VZRA 4ISCA 1N5OX 1YA4A 1Z45A 1JVSA 4N65A 4RTJA 5EP4A 4ODIA 16PKA 4WK0B 1JDSA 3AKCA 1G42A 4PY2A 3QSYA 4PIPA 3O7WA 4TMWA 3KQOA 4QYIB 1I3LA 2N0SA 4A27A 1RBZA 3OLVA 4Y2TA 4B6OA 1ZHHA 2WG0A 1OBFO 1E8NA 5ENVA 4KMMA 5SYAA 3SQLA 1F3LA 4CCYB 1FDSA 4RXMA 3NBAA 4O8ZA 5DYTA 3U4IA 3SHWA 1QX3A 1IJFA 3DDWA 3CUWA 3ACCA 1KETA 3PA6A 4UHEA 5K3FA 5P8WA 4CWAA 1TYBE 4ETWA 5AVSA 3OZWA 4O6VA 1JLKA 3QFRA 4KOEC 2C7PA 4IV5A 1AGYA 4MVJM 1UC4B 3ZE9A 4BN0A 5J2TA 2Y1FA 1WB4A 3NNDA 4C03A 4KR6A 4HAXA 3NKLA 3SFVA 5JW6A 5CB4A 4XZ3A 2ET6A 2I4NA 2ZAOA 2QS9A 5FCDA 3TQQA 3EUAA 1Y5NA 3LRPA 3MRXA 4A6XA 2PS0A 4Z49A 3T1TA 1WAMA 2BF7A 2B4KA 2Q0XA 3RRJA 4DIDA 3F3YA 3OLWA 1A2KC 2YJNA 4LHSA 4EHKA 1NBMA 5JEEA 4IHQA 4WBXC 5EQDA 2ZJ0A 4KV9A 2X4LA 4JJ7A 1Z12A 5IRCD 2C00A 3OTQA 1RZVA 3MINB 3H11A 2HZ7A 4Q18A 4YCJA 2FAXA 3SHFA 2QN3A 4OGKA 4D56A 3GO4A 1EWQA 2YV3A 4J3JA 1USWA 1G4HA 1QHFA 1F2VA 5EP1A 3PEYA 2HHAA 2QP3A 4TYQA 3OIWA 1WY7A 3OX3A 1BMFD 3IJRA 5DH9A 4ASUD 4D9HA 3U80A 3KFVA 3TDKA 1SRQA 1W5BA 5AJUA 4C4TA 2JFWA 1T6NA 2IUSA 1Z6YA 2VYVD 2JD2A 3U3DA 1X80A 3SHOA 3MYRA 3RRXA 1H66A 5FPPA 4KE8A 1IAQA 1YIOA 3CW8X 3TD2A 3ETHA 3HQ4O 1Q7TA 1W30A 1CKEA 1T24A 1V48A 1Z8FA 1JMVA 2DR0A 2H3EA 2PGIA 2UZ1A 4I1YA 4LRSB 4QDXA 4F2HA 2AZMA 3KSRA 4HEA1 3K35A 1XEXA 1Y80A 2WE8A 3O4JA 2H1RA 4BXOB 1OLOA 1QZXA 2OCGA 4KUHA 3K6RA 1FJXA 1P31A 3PJRA 3OJEA 3F46A 2D1QA 1DAGA 5T3UA 3UHOA 1E92A 1JW9B 5L3QA 3HA5A 5CVVA 4KX5A 5AXCA 2ASEA 1EA7A 5F23A 2P4UA 4B48A 3KQLA 4A10A 3M4YA 1QV6A 4D3XA 5AP9A 2BCJQ 2IYNA 3OPXA 4V0OA 4RVSA 3AVTA 2DY0A 4XCXA 5DNAA 5EQJB 1DU4A 1P1HA 4EJMA 3ZTWA 1SMKA 2A30A 3I52A 4JEMA 1I7SB 3IXQA 5TB5A 3FDIA 2O1SA 3P2KA 2OZLA 1JFVA 3K9HA 2BI7A 4LXYA 4MUIA 1B6SA 4DJEC 5IVDA 2AKAB 3R5FA 4LBZA 1LTQA 3GVPA 1LJUA 1HMPA 1X9IA 2JW5A 4WFKA 2PKXA 1BCSA 3B3FA 2B0JA 1KSFX 2QUBA 2W22A 5IXJA 4FR5A 4ZO7A 3QVUA 5DYNA 1UUFA 5I9MA 4BAUA 1Z17A 2PZKA 3I37X 4DAEA 4X7PA 2P2NA 3ZG6A 3C8MA 2I1WA 3HO6A 3JQAA 5AVJA 2QVYX 2GBLA 4PG6A 1VHQA 4YASA 1UMBB 1T2EA 4FGSA 4DWWA 2BWJA 4EEXA 1TMKA 3S1AA 4CKEA 1VE5A 3B6ZA 3NDRA 4GAEA 4B32A 4Q48A 4F4FA 3NFYA 4G4IA 5KNDD 1FVHA 2WNHA 2ZRKA 4IVPA 4RGQA 4IZOA 4YP5A 4MWDA 2VFAA 3S29A 2W2VA 2AZTA 3KT8A 2ILTA 1OHHD 3ERCA 3AF2A 1C7JA 4DV1B 3ZE2B 5F12A 5I4CA 2QAGA 1US8A 3KYCA 3GLVA 3GJ3A 2P9JA 4RIFA 4JA2A 1BYIA 2JCBA 2JIRA 4OQNA 5DB4A 2HCTA 4NHOA 4BGDA 3WWCA 1QK4A 1E5DA 1UBTS 2IEBA 2BFNA 3FPAA 4MGHA 4YH1A 1X9HA 3V2HA 3UT0A 4G67A 4QARA 2Q3DA 2Z5GA 4X7RA 2YS7A 3M7IA 2OBLA 2SHKA 3DBRA 3RSGA 2AW5A 2XBMA 4X65B 3I9V6 2O0JA 3K5IA 3W5DA 5GJWC 3RK0A 2R5WA 2ZT6A 1M0TA 5LU8A 4MI1A 2ZIFA 2HBQA 2O20A 1C9JA 4R5MA 1N7GA 4ER6A 1RLJA 1ODLA 4LOIA 4Z2AA 5FPTA 5DIFA 5F7JA 2EIXA 1AQIA 1OB5A 1DBIA 4QTZA 3OX1A 5F1PA 1RPNA 4FOSA 1Q17A 1U7ZA 2UAGA 5IMSA 1YQUA 1ZWLA 4OP2A 3IAFA 3FFAA 4CG2A 1NAHA 2QR2A 4Q1BA 4RANA 3A32A 3HKBB 4EUEA 5I7UA 4AKHA 1XT6A 2A9FA 1V9LA 1ZCZA 3IVGA 4WJZA 5JH7A 2WQ6A 3FN4A 4M1YA 3ZQ4A 1RYNA 2IOYA 4RPHA 4ATNA 4EVSA 2Z6QA 4Z4HA 3UK0A 1C2YA 3FCSB 3REQB 2WR8A 4O4JF 1LW6E 5CLJA 1J5EB 4RKFA 2GHRA 3PDIA 2ODEA 5IZCA 3OVMA 3SE7A 1I24A 4GE0A 1IBMB 4R0MA 2FE4A 1GIAA 5B4TA 3FDJA 1WVGA 1HT2E 4L4UA 1BU8A 1J0CA 2CLOB 1APBA 4FHZA 1RFLA 1NUPA 4ILKA 4NBSA 3RGGA 2PRIA 3EXFB 3L0SA 1SCUA 4IQ0A 4MI6A 5KSOA 1E1CA 2A9KA 2WJVA 2FWRA 4C08A 4DIEA 2Z8YM 2NYRA 4HXYA 3NAQA 4B1FA 3DVAA 5EGNA 3VH1A 4BZPA 1DOZA 4DM4A 1D8TA 4N3AA 4I1RA 2X14A 5PNTA 3ZCPA 3BF8A 4EYSA 2ECQA 3DDNA 1U8AA 1ES9A 2B9VA 3KFLA 4O02B 4OBEA 3QLVC 1KR5A 1R18A 3QJYA 3MA0A 2YINC 2W2QA 2V6GA 1LTKA 4DLTA 5CDTA 2FPRA 2R1ZA 2HHLA 1MFZA 4KBYA 4M0MA 3TQHA 5JFGA 5ITSA 5BNWA 5DLEA 3UXYA 4W82A 5ALWA 2VNAA 3RS2A 3IBYA 5CDUA 5KTMA 5BOVA 1X38A 3DE4X 3O8OB 4RVGA 3BE6A 1Q83A 2CJWB 5AI5A 2EJTA 1G4AE 5DBFA 4HGQA 4LJ7A 2COUA 2GOYA 2CZQA 1NJ5A 3OFSA 3ROPA 1BQ3A 3KZCA 4Z0NA 1IXRC 1TO2E 1W88A 3G8DA 3R74A 3W90A 2WD7B 5KPJA 3TGPA 2JBWA 1I3NA 4RK7A 1EZ4A 4I9UA 4TKVA 1XVVA 1YH3A 1W9MA 1RHJA 4FSXA 4MPTA 3WMXA 1L3IA 1OFVA 1QOPB 2BSXA 2ORVA 1FSFA 4CR7A 3O5AA 3DDZX 2DGDA 3DONA 2NVUA 4NICA 3ZLVA 1BD4A 2CHFA 1TC1A 2H1VA 3B89A 5CT9A 1SPXA 4DR3B 3P0RA 3UPDA 4EOGA 3NVMB 4LC9A 3TIIA 1W9HA 2D2XA 3FYUC 2AI2A 5DM70 2IPNA 2G8NA 2W6NA 4DM3A 1P4JA 3BTSA 2V9PA 4H7EA 5AOVA 3ESZA 3HCNA 5E7QA 3RU3A 1NLFA 2R3SA 4Z4CA 4PO9A 4CMGA 1SHUX 1YR2A 1UQTA 4IKOA 4IOLA 5EIWA 3RG8A 4U2DA 4EJ0A 5EVCA 2VTBA 4B4KA 3WLJA 4EW6A 4LSGA 3FNEA 5ITZB 5DWVA 4RW0A 1AKVA 1ECFA 3HKBA 1NPDA 4GF5A 1XCPA 3V6MA 2PGDA 5JI2E 2PS9A 2OCDA 4W6ZA 2DKFA 5CYPA 3ZCXA 5BV2P 4QPDA 2ZU0C 5KWIA 3RUPA 3C3CA 3OIDA 4U6QA 3SVLA 1WU7A 1P4GA 2WYOA 3EGXB 4J2OA 4L6AA 5HOQA 1JAZA 3CKYA 4HZGA 4W5JA 4GI1A 2GDJA 4IMIB 2Y77A 2CKDA 4TN5A 1AUOA 2NO1A 4AM8A 5IW8A 1CQJB 1R3DA 1FX0B 3KTOA 3U44A 2OCYC 4O1HA 3U26A 5LL6P 1KZ1A 3GBVA 4EHIA 1HOXA 1YVRA 5AESA 1LQUA 3I1YA 1N1EA 1DJQA 2D5IA 3KEFA 4WCDA 1NW3A 2NVBA 2Z5VA 1W5EA 3FJOA 1W1WA 1SC1A 2EAUA 2OBFA 3L0CA 3PNVA 4G1UC 5IBQA 2JAOA 4BFUA 3PQ4A 4DC0A 5BOSA 2BV3A 3FAKA 3AL0C 5KHAA 2QD5A 3E27A 5FI5A 3VR5H 5H0IA 2NU8A 3GLKA 3C6MA 3RBZA 2XUOA 1SG6A 3AKZA 1J56A 1NR1A 3R24A 4LOHA 3KVNA 1KQPA 4LZAA 1MGPA 2FSSA 1ACJA 3R0VA 4AMYA 1XMQB 2JLSA 1WCV1 4J16C 2J9FB 1D6SA 3RKUA 5K3BA 3FUCA 1R6UA 2OAQ1 3BMOA 3CM0A 5CLLA 4MITA 4H7HA 3WB0A 2ODQA 4GBED 4WFIA 3W2EA 2O8BA 2UV8A 1Q1BA 2O23A 1XSEA 2I6FA 2J4CA 2Q27A 4CMHA 2XCUA 3CT4A 4TVBA 2IYUA 3CGGA 4PFSA 3E7DA 1E5VA 4L1KA 3MTEA 4WH0A 3PUJA 1WKBA 3VR3A 7MDHA 4Q66C 1F7UA 4O2BA 1M6WA 3T7SA 3QEBZ 1K0UA 3WWPA 3ZI4A 7MHTA 4F1WA 4EZBA 3A2NA 3VAAA 4W4TA 3T95A 3S8MA 1U3FA 1MENA 1YDEA 3EODA 4B09A 1DXOA 1OZHA 3ZHTA 3QTLA 4L5AA 5IN4A 3AO0B 1CZRA 3OHSX 5FOTA 2JK1A 1TYDE 1L1QA 3LO5A 1SVUA 1HLFA 5L6MB 1VECA 4CEJA 2FMIA 1PK8A 3CRMA 4HDKA 5FNZA 3TI7A 4D96A 2O54A 1HYBA 1NF2A 1DTSA 2BFAA 2D4AA 2F67A 1VCMA 3WLMA 4AF7A 5I5EA 3R3XA 4GMGA 3AEKB 4OQDA 4R31A 2ENUA 2QY9A 4IXTA 4YHBA 2PS3A 4Z7JA 5IVKA 2GZAA 3A8TA 3PYXA 3RG2A 3E9MA 3M4JA 2WBLC 5C3MA 1FUKA 3K73O 4PQFA 3LYLA 3ZDBA 1AF4A 3INRA 3ZLBA 4BBAA 3FPGA 4NYJQ 2C88A 3B1WA 4DLAA 3PFIA 3QPUA 2F3RA 1JALA 1KQ3A 1KC3A 1P1KA 1S9HA 2WKPA 4UMEA 3MM4A 5FULA 5HKBA 8MHTA 2JBAB 1XEWY 1L2TA 2R6HA 3SQXA 2JD0A 3HB4X 2OFWA 3A9SA 3DTVD 3WL5A 1WZNA 3ZWQA 2CF6A 1DWQA 2ZB7A 1GCAA 1TCBA 1MB2A 3L0PA 5E95A 1G5TA 1CUEA 4I08A 4RLQA 4JUCA 3U6KA 2G07A 3N75A 3W4IA 2R2GA 1T6ZA 1NT2A 4KRXA 3BICA 5F3DA 4EI7A 5H3HA 5I01A 5ABPA 4TL7A 3KJZA 1JJFA 4FYKA 5TPWA 3VPGA 1CY0A 4X60A 1A1VA 1JEQA 1EWRA 1KDYA 3RIMA 3U6BA 2PKQO 3BXEA 5J4VA 1TRHA 2XGGA 1CY2A 3E9YA 2D7JA 3IODA 3W5UA 4NOJA 1AJEA 1T91A 3S68A 4B6JA 1IXSB 3O8RA 2DUUA 5JH7F 5H1YA 2MSLA 5KKCA 1UXIA 3LIIA 3PIIA 2HZBA 4FFOA 5CEEA 2XQGA 5J2TB 2ZM5A 4ZT3A 2VQEB 5B4UA 2GVZC 4JC5A 4QT0A 1L5LA 1ISPA 3ILYA 4B3GA 3BJEA 2R8OA 1K8RA 3JXEA 4MPDA 4QA9A 5JZSA 1D8AA 1S6YA 3LDAA 1ZM4A 3FUWA 1OLXA 5E6SA 1U2RA 4CT0A 2ZBFA 1TVEA 3PJEA 1FSSA 4OXRA 4YX9A 2VSQA 4J6EA 2RGUA 2E5FA 2YWDA 1POWA 2P1ZA 1QF7A 3OEEA 3TQSA 4LYDA 1LK7A 5GP1A 3E7XA 1DGQA 1MA0A 3IJ5A 4LHVA 2B1IA 3CR8A 3WNVA 1DO8A 1NMQA 1OXBB 1W34A 3GPDG 3MERA 4CLDA 1V1RB 3NG1A 3DEFA 3BA1A 2QMQA 3KEGA 5BN3B 3EG9A 4A2PA 5AKJA 1QZZA 3VNSA 1XUOA 2CHEA 4XPIA 1ZO8A 3FCCA 4EH1A 2NSHA 2ZIZA 1H0SA 2OXRA 3CPSA 2AOTB 1T0IA 4BN5A 2YY7A 3HXMA 5CB0A 1EI9A 5FWNA 1YL5A 1HZZC 3LV8A 4HLDA 5LMCA 3ZNQA 1YIDA 1RJWA 1SUFA 2JI7A 1KYZA 1E98A 2PSHA 4B87A 1FLAA 3MGAA 3UUEA 4U6NA 2VHJA 1OT5A 4YRSA 2WM8A 2CDRA 2QTLA 3UPTA 3E0QA 1JFRA 1J1ZA 2RK3A 1QRTA 2F8TA 3K15A 1KI4A 2I2DA 3PNKA 1IQRA 2HBRA 4GSLA 2BHLA 5C8ZA 3FCAA 2YJZA 3GLIE 1BWPA 1CIVA 4XB2A 2VHCA 5I9IA 4ZTUB 1XRSB 1O95A 3QPDA 5JMTA 3OZVA 2EJVA 3RHFA 3JATB 4LRQA 4H7IA 1V1MA 5C0OE 3C4VA 4ABYA 3LC7O 1QMPA 1FL9A 4FZ3A 5ALOA 2W2TA 5FXMA 1D4AA 3HBNA 3OZIA 1EWTA 4HMOA 3SEFA 3VR5A 2F4VB 2IIVA 2H5EA 3W6UA 2FN7A 4M9RA 4KLZA 1TAGA 3PDIB 3L3BA 4M89A 4XIYA 1RU3A 1ZEMA 4UUMA 1CRPA 1JUDA 4C0AC 4K6KA 1JVNA 4Z0PA 1HFEL 1OZAA 3TDNA 5JD5A 1PZFA 3HP1A 5THXA 3ORHA 1JHYA 2WYIA 1KZHA 4Q4JA 2CL5A 3WR5A 5I4IA 2VDMB 3KKEA 3C7DB 2IOFK 3CRQA 4QU0A 4CF5A 3O3NB 1QHXA 1A71A 2PBFA 3GGPA 3H19A 2EATA 5CM8B 1TZ2A 2HPAA 2C3MA 3HN7A 4BNYA 1HG0A 1NKSA 1IEWA 1KJQA 2ZJ2A 2PPLA 2V4ZA 2B7BA 3QEMB 1XZMA 4G01B 4NZZA 4OFZA 3PFGA 4NRDA 4OVKA 2YHSA 3F71A 3HU2A 5NLLA 1PBTA 2E3JA 3Q40A 4OSOA 1ISSA 1WZUA 2HMVA 1I10A 2FP4B 4XUDA 3UOGA 4FBLA 2IXDA 1DO2A 2AFVA 1LZLA 2F9FA 2WA1A 2Q5HA 4QWWA 5LQCA 1U3DA 2Z30A 3A3PA 1DJNA 3QKIA 1Z4KA 3PHLA 5DTRA 4ZCIA 4IDPA 4M0FA 2J87A 1Y5IA 2GCEA 4KWEA 4KE6A 2WB2A 5JE8A 4MB6A 3HB5X 4UBMA 5G1OA 5I4KA 2IUUA 1O5OA 4FT4A 1YE8A 2VO1A 5F5LA 2QSUA 1CQWA 4KVZA 4NJOA 1UXHA 3G88A 4HH4A 1E1KA 2XGSA 1HQDA 3E5NA 4EG3A 4D74A 2H2IA 3W7BA 1UDAA 5CVEA 3QENA 4REOA 4F4IA 4RPJA 2VYNA 2CLLB 3VPDA 2QPAA 5D3KA 1SD5A 4G6ZA 1AN9A 5I9LA 3OY2A 4EB6A 1T1EA 2QY6A 1VE9A 4JODA 3HBMA 4WACA 1FS6A 1KAQA 4QQRA 4ZOAA 2XDQB 2Y05A 3ITDA 4EHBA 4MUJA 3LK7A 4BNDA 2FRDC 1GNSA 3DMFA 4KIWA 2QJRA 3FTEA 4JLAA 4P4SB 3SGLA 2FPPA 2GEUA 2W58A 2W6JA 2W2OA 1G5IA 1C3JA 1A9OA 1CJUC 2O3JA 2WKQA 3IVAA 2X6QA 2C7RA 1BO6A 2MJLA 3RLFA 5AVXA 5KTPA 2YMLA 1R50A 2OPBA 1GZSA 5ENDA 4XD7D 2ID7A 4LRXA 1RLTA 2AN3A 3PHGA 4TS9A 3E3NA 3HDYA 3LX4A 4ERXA 2I6XA 4CLHA 2CGEA 1KEVA 1TD9A 2QTZA 1CEQA 5CHYA 4BP9A 1Q1AA 2CK3D 1YZQA 1ZICA 3SIPA 3ZV4A 1ZX1A 1QDLB 2WU4A 5E3HA 2QW0X 3HNPA 3PQEA 5JWHA 2O7SA 1QVVA 2FG5A 1U2GC 2Z57A 4MA5A 4M9ZA 4DA8A 1NJGA 5A5GA 1XZKA 2GPBA 3HFJA 4BLUA 2BR3A 2G0TA 1Z13A 2DQKA 4A26A 2D7DA 3P94A 1TUBA 4NE2A 1Q84A 3GBPA 2O07A 4NSNA 3UO8B 5CBPA 2IPOA 4G1BA 5K3SA 3IGFA 3OEWA 1SC3A 4QOHA 1NPTO 2BEVA 2HWXA 2JLAA 4OQFA 4I5EA 5G4LA 1CS4C 5H59A 4DR4B 1NUHA 4B80A 4UBOA 2Q29A 3DVAB 4X93A 4WXYB 1HYQA 3RWOA 2C0QA 1KJYA 1V6CA 3OQVA 5L7YA 4BB5A 4JC4A 2Y3IA 4H17A 3UW3A 2GDZA 3WISA 1B00A 5KX5A 1OIXA 2ZPAA 2DMRA 1V43A 1KI3A 3N0TA 1IRXA 4UDXX 2O1XA 4KVAA 3LWZA 4JR1A 2IV2X 2ODNA 1YBAA 3EDYA 5EZYA 3SS9X 1QSGA 3D7NA 1T9AA 4R51A 4Q9LA 3Q3IA 1GV0A 4GKBA 1ARZA 2EKDA 2GZRA 3ONNA 1JHZA 1HPLA 3QU5A 2Q7DA 3RC1A 5BV7A 2DTXA 2WT8A 3QKTA 3SK0A 3T5AA 1H8HD 2VDJA 1ONBA 4GT1A 3QFFA 2W9XA 4GMFA 1CVLA 2IFTA 3GGSA 2CE2X 2DP4E 3BIJA 3NJ8A 2E18A 1MA3A 1G20B 4Y7DA 1NASA 3C39A 4NBRA 5FTWA 3WKBA 4Q1EA 5EE0A 3DE6X 3AR6A 3OKAA 1KYXA 4R2LA 1NBWB 5EG5A 3C5WP 2AJCA 1QH9A 1UM9A 4YAFA 2WIJA 1K9SA 4DA9A 1ZCFA 1GZ4A 3COVA 2YZ2A 4WK2B 4LZZA 3VAYA 1EJ0A 3FA2A 3K2IA 4PLFA 1DUIA 2IXAA 3G2QA 2Q9BA 1RI4A 3PHJA 4W1QA 3UA4A 4B6QA 4ZI3A 4QYMA 2O2GA 5D85A 4UTZA 5JJIA 3VU8A 1PJCA 5FOWA 2QLBA 1JHXA 4TV8A 3S8YA 1JDJA 2O5EA 4JSRA 2R6FA 3TH5A 3D9QX 4X3OA 3ZVRA 3RS0A 1JX6A 5E6SB 4ZYUA 1J49A 4KKXB 4V0KA 4TSKA 1TT5A 1X74A 2C2YA 2FW1A 4BFSA 4I1PA 1KVRA 1OGJA 5LLSA 4G0MA 3WL7A 3ZBUA 3DT9A 3ZLJA 3A4LA 1WUJS 2GUWA 5CPBA 1DDGA 3SE0A 3QXCA 3SKVA 3UV7A 4AJ9A 5T57A 5KINB 2P9BA 4MYSA 2Z2KA 3COJA 4JLJA 1EBBA 3MMXA 3VYUB 2XDAA 1Q7GA 2PLFA 3D7LA 5BVGB 4HWPA 2PVSA 3TM5A 3ILVA 4EENA 1JFSA 5FBKA 3LY9A 4GPD1 5KSZA 2FR0A 4AJ4A 4CKCB 1N2CE 1EFPA 2ZSKA 2P8SA 3IP3A 3M70A 4LRWA 1F0YA 1QG2A 4Q9HA 4XX1A 2J3MA 3AY3A 1FLNA 1UJBA 1XTJA 4OB7A 4R8MA 1TLTA 2XUQA 3SLKA 1AGNA 1JE0A 1ODTC 3QKSA 4R3NA 3D4BA 1L5GB 3ANSA 1RADA 3WJ7A 1AF7A 2ZYDA 2C5GA 2DJIA 4B6SA 1JGTA 2QLTA 4EFDA 1N6LA 3FLBA 1JVBA 1DADA 3P1JA 5T41A 2GRUA 3SHVA 5EESA 3MD0A 3JVUA 2VAPA 5FFMA 3A1TA 4KR7A 3T9EA 3DEKA 2WHXA 1GARA 1V7CA 1VP3A 3MXTA 5EUMA 3FR7A 3ZHVA 1FSPA 3UV3A 4IHJA 1N1DA 1Z4QA 3ZD9A 2ECFA 3Q72A 1SZCA 3GU3A 5C7IO 1Y1LA 1QHEA 2JLBA 2TYSB 2Z6VA 4ZZ3A 4UNPA 4FDMA 3NBYC 4DOMA 4ZYTA 3KSAC 1QJ4A 1CF4A 1XRLA 1QE5A 2FWJA 1NXSA 4QTXA 4P34A 4E1VA 4TZ6A 3PV0A 2OV6A 3WGGA 4X64B 3U19A 1BH2A 2BL4A 2FGKA 5SV2A 2XXBA 4MYTA 1F48A 3ESBA 3ER9A 3CEHA 1SRRA 3JQ9C 4HLQB 3QVTA 1YK1A 2JNWA 2Y71A 4L51A 4TKUA 4HNUA 1K88A 1JMKC 3A58B 3D6UA 5JASA 1XD8A 1E2IA 2V9CA 3ICPA 2JGNA 2FG7C 1RJ9B 2NUAB <