5HCIA

Gpn-loop gtpase npa3 in complex with gdp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
257
structure length
257
Chain Sequence
b'SLSTIICIGMAGSGKTTFMQRLNSHLRAEKTPPYVINLDPAVLRVPYGANIDIRDSIKYKKVMENYQLGPNGAIVTSLNLFSTKIDQVIRLVEQKKDKFQNCIIDTPGQIECFVWSASGAIITESFASSFPTVIAYIVDTPRNSSPTTFMSNMLYACSILYKTKLPMIVVFNKTDVCKADFAKEWMTDFESFQAAIKEDQDGYMSSLVNSMSLMLEEFYSQLDVVGVSSFTGDGFDEFMQCVDKKVDEYDQYYKKHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GPN-loop GTPase 1
publication title Structure of GPN-Loop GTPase Npa3 and Implications for RNA Polymerase II Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 104
structure length 257
sequence length 257
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.6.5.-:
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03029 ATP_bind_1 Conserved hypothetical ATP binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5hciA00
1SXJC 3CX6A 4B75A 2IF0A 4DDTA 1PVOA 4U02A 3W9YA 1FX0A 2KE5A 1M34E 3PG5A 4FMDB 1TQDA 4KBGA 3PEUA 4UNSA 4UXIA 4TL8A 4V03A 1COWD 3TSZA 3SJAA 3RS5A 3WRXC 1D9XA 4JJKA 3FMPB 1NVVQ 2QNRA 1R0YA 4Q66C 2ZJ5A 3TR5A 1TTTA 1MABA 2PEZA 4TMVA 3TUIC 2WOJA 1Z29A 4KFRA 1S9HA 4OJKA 1KGDA 4YONB 5KPDA 1TAGA 2ANCA 2G88A 2PZFA 2V6JA 4DCVA 2ZRDA 3CONA 4AKIA 2VP5A 3ZVLA 3KJGA 2GK7A 2VHJA 4OQXA 2J46A 1A7JA 4JLKA 2V1UA 2G6BA 2EWVA 2XTZA 1NN3A 4HSEA 2IYUA 4R71A 1KZ7B 3DDCA 2G9NA 4BPBA 1IJEA 1C1YA 1E2KA 3FHCB 1KJWA 1AKEA 4WZBE 3A36A 1VIAA 1AS2A 5C2JB 2IYZA 3ZIAA 1JECA 4K46A 3KL4A 3R7WA 2FF7A 3B78A 5IK2A 4B3GA 1AJEA 2HT6A 2C03A 2QM7A 1U8YA 3THYB 4D0LB 1J8MF 2JGNA 3AVXA 1W0JA 1RRFA 2YC4C 3TBKA 4BQSA 1E2PA 4NMMA 3SI7A 1RC8A 2C9CA 1SVWA 3AVYA 3TVDA 3OIUA 3SN6A 4M1TA 4HB3A 1SHKA 4PC3A 5E4FA 4G1UC 1Z0IA 4I1SA 2ZUCA 4XTRA 2EU8A 3V00A 1CR2A 1UDXA 4YMTA 5EUMA 1G8PA 4XTCS 4ZCIA 4YQFA 2Q3FA 4S2EA 3MUFA 4JBWA 4X8HA 2GBLC 1JAHA 4DLYA 3T1TA 3QKSA 5E95A 3TNFA 3X1XA 1QHHA 4NCHA 4EPXA 4WZAE 2ZE7A 1NIJA 4URWR 1W2GA 5ELXA 1XZPA 1HEIA 1NP6A 4Q9HA 4M1MA 4GNKA 3RYTC 2WKRA 1D9ZA 2WPDA 4OHWA 1F48A 4EFNA 5B64A 3ZD7A 1TPZA 2ZJZA 1NBME 2B7BA 2DWQA 3CF6R 5BYJA 1R0XA 1OE0A 1K5GA 2W2XA 2XNSA 3QKTA 5CLLA 1WBDA 4IEIA 4OHZA 1A82A 3K9LA 1MOZA 2NO9A 3KKNA 5EP3A 1S3GA 4DZZA 3LRPA 4RJLA 4PQRA 5TDHA 4TQUS 5EP4A 5JHGB 2NPFA 3DMNA 3FOZA 1NBMD 1Z2AA 1W36B 4IDQA 2H92A 3N70A 4DEXA 4P32A 2DWOA 2FOLA 1JR6A 1I4DD 2AR7A 1P2TA 2QRNA 4M4SA 4OJQA 3PUVA 5UKDA 5AR1A 4C7OA 1KSFX 1PUIA 1PV4A 3RRYA 1FQKA 3AV0B 1OYWA 4TMTA 1E98A 1FMJA 1NJFA 2GCOB 2RH5A 3KDSE 1U0HC 1CS4C 3E1SA 3HWSA 5EE3A 3KQKA 1TEXA 4QBIA 1PZNA 4IFBA 2IYLD 2EWWA 4CZ2A 3O8CA 5D3MA 2HF9A 3FKSD 1XTQA 1CRPA 1AQUA 3U5ZB 3C41J 4Q00A 1KDOA 2WICA 1W36C 5JSZB 2D4HA 4R2HA 3GJ7A 2BMEA 2AFHE 3ZYCA 2IX3A 3RS3A 2PT7A 4NCJA 3DHWC 4JL8A 3U3RA 3N5CA 4G0NA 1QG2A 4ZI2A 1HURA 1YRBA 5CK4A 2FX3A 2JJ2D 5FUYA 2J41A 5HCNA 4DUGA 3WMFA 5FPKA 2IA5A 2Q9BA 3I32A 1KO5A 2GEUA 2PMDA 4RY2A 4V0LA 5H70A 1HY3A 1GUAA 1YR9A 4AY2A 2H1LA 1AQYA 3FGNA 1N6NA 2BDTA 2FMXA 1II9A 4FIDA 5CB8A 4POAA 2R6DA 2BMJA 2WBLC 1S3SA 1MO5A 2NPIA 4Q1AA 2EFGA 2O8DA 2F6RA 3B1WA 3EA0A 2PZEA 3W6NA 1KI9A 1Z6YA 1KMHB 1SVSA 3VNUA 1VIYA 2GDJA 5A4JA 2RGBA 1XD8A 4M1YA 4NP6A 2WKQA 2YOGA 1M1YE 2ZRIA 1Q1EA 4RD0A 4EFLA 5KSPA 2OT3B 2UZIR 4O0MA 2D7CA 5J4LA 1KK3A 5CIQA 2GCNA 5G3YA 3EZ2A 1VYUA 1G6OA 3IDQA 1QHYA 1TUEA 1AK2A 2QGZA 2JIZD 2GCPA 4F93B 4Q19A 2V6IA 1DADA 3PFIA 5LD2B 2FPMA 3UANA 4D82A 1CJTC 1DELA 1A4RA 1M8PA 3LD9A 4NYJQ 2NGRA 2EYQA 1OXVA 1ZCBA 4A15A 1E0AA 4BFXA 3CZPA 4C0HA 5L3SB 3TH5A 3DZDA 2XTMA 1DG1G 4JYBA 5FH9A 1J70A 1KJZA 4ZKEA 4B74A 2JLZA 3B1ZA 1QZXA 4PPNA 4DRZA 1XJ0A 1XTSA 3PUWA 1P72A 1PUJA 1MT0A 1AN0A 3IBGA 2DFNA 4D6PA 5LD2C 4FCWA 1Z8FA 4HB4A 5CITA 2W6JD 3SYNA 1U0LA 2RHDA 4LJYA 2OXCA 4RD2A 2CLDX 3HU3A 5EQTA 3MLEA 5KSZA 4BZPA 4XVQA 1NI3A 2QM8A 1TADA 1SKQA 3K8YA 3I1FA 3T35A 3PCRB 4OHYA 1AZTA 1J90A 1ZC3A 3PEVA 2BMDA 4FMDF 4TSFD 1VCOA 2J87A 2GAAA 2C78A 1YZTA 1S1CA 4MKGA 4TL7A 1E9DA 4B73A 1YHNA 1E9BA 1JJ7A 1US8A 1N6OA 4MDEA 2A5DA 4HZUA 4CIDA 1OKKD 3ADCA 1KO1A 5F3WB 2A5YB 4LHXA 3AH8A 4PR0A 1QHSA 4IW3B 4R98A 1IY0A 1B23P 3QEOA 5EXPA 1KSJA 2WMOB 3ZGXA 4NCNA 1SHZA 4UXHA 1OLOA 1G7RA 3CR8A 2H57A 2PLFA 1GOTA 1DAFA 3GLIE 5C18A 1RZ3A 4MGYR 1E2QA 2OCAA 4P4UA 4HAWA 4MGIR 4AWXA 1LTQA 3P27A 4RFVA 3B8HA 2P65A 1S8FA 2ZRAA 3CLVA 3Q7PA 1RJ9B 4OQLA 1VPLA 1MH1A 3EX7C 2QGNA 4DIEA 2QP3A 3BOSA 1MRNA 1R10A 4D4JA 2ODNA 2PEYA 3IGFA 1YJ5A 2GILA 4LBYA 2Q3MA 1XMIA 3ZD6A 4EFMA 2OCBA 2PMKA 2WWXA 4LV6A 4IHQA 3FHOA 3AF3A 4GP6A 1UKYA 4Q4AB 2YOHA 1DAIA 2CCKA 1TU3A 2F1RA 2A5GA 3BFXA 3KKPA 3I62A 5DYIA 2B7CA 4Q4HA 4GP7A 2IWRA 2AKYA 2VSOA 4UNQA 6Q21A 4PZLA 1VCMA 1XPRA 1CEEA 1FW6A 1FUUA 2QUZA 3N2EA 1ZRHA 4US0R 3TVTA 3AKDA 2F9LA 1NMXA 5FPTA 3RSOA 2RGNC 5EP2A 5JJKA 1XX6A 1A2BA 3KB2A 1XBTA 3UMFA 3QKRB 3BORA 4TT3D 1I4LD 3GJ3A 5LPNA 1FUKA 4I1OA 3SC3A 4CGZA 1MO3A 2DPXA 1Z07A 3B1YA 4KAXA 3KQLA 4C3ZA 2B92A 1ZIPA 4AG5A 2JEOA 1G7TA 3EIQA 4D26A 5EE9A 4II7A 1IN6A 1Z6TA 5GJWC 3VR2A 3E2IA 1OXXK 4JLBA 2SHKA 3BC1A 3TUJC 1GL6A 1K5DA 2ZI6A 3B5JA 5DHFA 4OI2A 4YLGA 2IL1A 4KI0A 1PLJA 3C5HA 3OAAD 2CCGA 2WV9A 3EC1A 5KUTA 3UMRA 4TQAA 3RRZA 5J4YA 3OF5A 3TKLA 1Q57A 3KXLA 4UJ5A 4C9BA 2W6ID 3QBTA 1M7GA 4Q1FA 3BJIC 4CF7A 1N0WA 1OT3A 3HPQA 3QF7A 4I81A 3Q7QA 4JLJA 1AS3A 1SVMA 2QI9C 1NMYA 1NN1A 3X1DA 2JLQA 4ERNA 4HAXA 2GJKA 2G0NA 5BN5A 2LKDA 1G17A 3KKOA 4Z51A 3QIAA 1XD2B 2WIBA 2WJYA 2PJRA 2XNDA 2IC5A 1IN4A 2F55A 3EZ7A 5EZ6B 4LYFA 3L43A 2HYIC 1ZUHA 2OFWA 5DN6A 2FU5C 4BLPA 4OK3A 3IQWA 2IF2A 4ZDJA 5SZJA 3K9NA 3FKQA 1GRNA 1KI3A 1R5OA 2J7PA 4XOIA 3OIVA 4UQOA 3DMDA 4C2TA 2A5JA 4DVGA 5G41A 3LO5A 1HV8A 1KZGB 4M2LA 4GZLA 4KYIB 4Z8YA 4QNRA 3PVSA 4F4JA 4US2R 3GFOA 3K0AA 3KQHA 4EJSB 2R65A 4HLUC 2P2LA 1V5WA 2WJJA 3GCGA 3UWOA 2ZRGA 3OE7A 1XNJA 5DO9A 3AF2A 4WIAA 2H16A 1BS1A 4HLDA 4BGDA 1SZPA 4URVR 2BWJA 3CB4A 5HCIA 1X3SA 4A2PA 2RKOA 4IXMA 1J99A 3KJIA 4NHOA 2JA1A 1ZINA 2WSMA 5JI3E 5TVKA 3VR3A 4NYMQ 2ZI4A 1GG2A 1NY6A 1CRQA 4TWZA 5A5GA 5AK0A 4OK5A 1NVWQ 4LV5B 1CTQA 1KK0A 4DC9A 4TL6A 4FINA 2JASA 5JS7A 4Y0VA 4BRUA 2GHIA 4XD7A 2JAQA 1MV5A 5H68A 1DAEA 1E94E 1KHTA 2X8AA 3AP1A 1UADA 2ZRMA 3GP8A 5C1BA 4X8OA 5DSZA 2R6CA 1G7SA 1Z3IX 2PL3A 2RGAA 3K09A 1HT1E 1RKBA 1RYFA 3FWYA 5FOSA 4QM7A 4YDHB 1P75A 3RS2A 3AUXA 1XEXA 1F6BA 5FOTA 3A4NA 1XRJA 4G5GA 1Q0UA 2FSIA 5GVRA 2XXAA 3NBFA 1W1WA 3KX2A 1D2EA 4GZMA 1KI2A 2QBYB 3JZAA 4LUCA 5JJIA 2Q3HA 2Q21A 3OEHA 3VX4A 2GEDA 2IS2A 4IDHA 4AD8A 3K0FB 3IO5A 3LX5A 4BECA 5JMTA 2WTUA 2RMKA 3AQ4A 5KOYA 2P5TB 1BMFD 3SQXA 3IPXA 1M74A 3M4YA 1P6XA 5K8LA 1T5IA 3QVVA 4S35A 5EE5B 3VTKA 1B0UA 4Z1MD 4JL6A 4A6XA 2VSXA 4F91B 5P21A 1W46A 1GKIA 1HT2E 4LHVA 2HF8A 4MUAA 3AGQA 4HYYA 2IS1A 5K8TA 2J59A 1K8RA 4RSGA 2HJGA 5FL7D 1N0UA 5TMPA 1SXJA 5HE8A 2ZE5A 4GFDA 4TYPA 4BZXA 2VP2A 2X2EA 3LV8A 1YZGA 4MYHA 3HR7A 3TSWA 1OHHA 2QEQA 2R2AA 1JNYA 3FVQA 4CEJA 3RWMB 3RANA 2ZR9A 4ARZB 4B2LA 1CBUA 3NKVA 1YZKA 2ODWA 4JLVA 2ONKA 2ZE6A 4DLUA 3QSYA 3TAUA 1XTIA 2DYKA 3GMTA 3I8SA 4DLVA 2EFEB 5CB6A 3F8TA 2F1JA 2WOOA 4A36A 1DARA 1HTWA 1FPMA 1K6MA 3GLFE 2VHQA 1FFHA 2OZEA 4RZ2A 4O3MA 1ZW6A 2OFOA 3KFVA 3P4YA 2RGDA 2ZI5A 3WNDA 3AF0A 3ETLA 3KUCA 3VX3A 2EW1A 1NVUQ 3D6TB 3GEIA 3SYLA 1EWQA 1JEDA 4A0FA 4LX0A 3AF4A 1U90A 2AWOA 2CBZA 2L0XA 1P9WA 2WHXA 1WP9A 3ND9A 2QZ4A 3G0HA 2P6NA 1GSIA 1X1SA 2ZJAA 5FI1B 1XTRA 2ZREA 1E4VA 2VP0A 3ZLJA 5HPYB 1E9RA 3UKDA 4HZIA 4XWKA 2NG1A 4PSVA 2YV5A 2YJTD 2AXNA 4JL5A 3FB4A 5JRZA 2VSFA 1OB2A 1IY2A 1W7AA 4LGMA 1AIPA 1WDTA 1G1MA 2D2FA 3AKCA 1OV4A 1XFAA 4GT1A 3GJ5A 1N6PA 1OPXA 2CK3A 1JB1A 3OFNA 3AVQA 4ZDKA 3MWYW 3IIMA 2J7KA 5AJZA 3RC3A 3I61A 1S0UA 3F0TA 3GJ0A 3CIOA 2IHYA 3DO6A 1X1RA 4Q18A 4FCTA 3RVBA 1N6LA 1T0HB 5CDFA 3BS4A 4HEJA 1JR3A 2AL7A 3P20A 4G5QA 1UJ2A 3O8RA 4JLMA 4EDHA 4EPRA 2F1HA 4IVQA 2OLJA 1OFTA 2CNWA 4IRUB 4Q1DA 4QM6A 3GJXC 5FTJA 5TY0A 1OH5A 1H8HD 2GBLA 1IN8A 4OKSA 3X1ZA 3KTAB 5K8UA 1Z22A 2GXQA 5J4HA 1E2FA 1ZMXA 3CM0A 4MITA 4BZQA 2DB3A 2ZUDA 2KSQA 4QBGB 1T8TA 5BQ5A 2OCPA 1GDDA 1L2TA 2ZYWX 4BASA 1KK1A 1WA5A 1LV7A 2QT0A 1XCPA 1EFRD 4JIMA 4KCGA 4TYNA 3ND8A 4MKIA 1Z0KA 1NF3A 1XB2A 1C4OA 1W5SA 3MSXA 4DSTA 3KJHA 5EJEA 3LA6A 5K8IA 3FDIA 3CWQA 3OZXA 2FFAA 2Q6TA 1G3RA 3QG5A 1WXQA 3L0IB 2ZAOA 4GRAA 2RCNA 4M9XA 1H8ED 4TQ9A 2P3SA 5JEDA 2OILA 3GFPA 4CYMA 1UDWA 3MWLA 4MRSA 1UAAA 2ZR0A 3CX8A 5D3QA 1Z0FA 5CYPA 2XZOA 3GLFB 4RVCA 2F1IA 2OCYC 2PLRA 1CJMA 1YZUA 1W0KA 4PANA 2IYWA 4Z8XA 3AVPA 3HYTA 1UBEA 3RRNA 1T9HA 3MRSA 3GEHA 3U3KA 2VP6A 1NSTA 1HYQA 2IYQA 2XSZA 3WP0A 3A37A 3BFKA 4Q02A 1YR8A 1KKMA 3LDAA 1CIPA 1YR6A 3ADKA 2GNOA 2ZYVX 4HAUA 1VG8A 4MRPA 5FPHA 1XP8A 2MSDB 1DE0A 4X8LA 2ZRFA 4DCTA 1XU4A 3BWDD 3CH4B 4FW9A 1CJVC 2C2HA 1EK0A 3ZQJA 1DO0A 5HKKA 1N0VC 1Z6XA 3FTQA 3TW4A 5FOUA 2GCOA 3MFYA 1GL7A 3KUDA 3T12A 4TLDA 3VKWA 3LX8A 1CF4A 5JCPA 1JAIA 4LRWA 3DZ8A 3LW8A 3ZH9B 5CM9C 1ZCAA 5FPSA 5JSZA 1GZSA 4D0NA 1MR3F 4ZO4A 3PXGA 5IHPA 3BH0A 5AJXA 3VMFA 1A5TA 2GJAA 5JWRA 5SZHB 4GOJA 1IOZA 4XJXA 3EXAA 2ANBA 4M0LA 2PCLA 2WWHA 3NHAA 4EIWA 3CKLA 2ZSFA 3Q9LA 3NDPA 8OHMA 2AN9A 2ATXA 1FTSA 3E70C 1KYIA 2YYZA 4I1VA 4B3BA 4GPTA 4IFEA 4A92A 1RVDA 4Q9LA 5JFGA 4ESVA 2ORVA 2V3CC 2DHRA 1RE0A 2ZRBA 4LDJA 2AXPA 4LHWA 4OHVA 3W5JA 4BEBA 4MUBA 1YZLA 3GEEA 3U4QB 1ZUIA 1E2HA 4DBLC 3ZIAD 1KMHA 3PUYA 4TL9A 2G1JA 1M7HA 2R62A 2AK2A 4AURA 1N2CE 1W0JD 1T3SA 4B2PA 3CRVA 1KMQA 2J9RA 4KFSA 2N1BA 1KJYA 2EYUA 1R8QA 2GJ8A 4LZZA 4WA7A 3Q5DA 4B6FA 2CJWB 2PZGA 2HUPA 3M1IA 5FL3A 1F2TB 1XPOA 5BXQC 1CLUA 2NOAA 4C0KA 1E4YA 2H5EA 4DIDA 2QPAA 2YC2C 3IPYA 1NVVR 3TQFA 2ZU0C 3I4LA 2ORIA 5BW8A 2CDNA 3F5FA 2HLDA 3FHTA 2HXYA 4LY6A 3KKMA 1X8KA 1II8B 3X1YA 1XTKA 4RD4A 1FNNA 1Z0JA 2A30A 3SBEA 3BE4A 3TK1A 4OI4A 1E9CA 3WXMA 3U6BA 2X77A 4IVRA 2XGJA 2QTHA 1UBCA 1T3LA 5L3SA 1GKUB 2WPDD 1Q20A 2QG6A 2JLUA 4TZ6A 1U81A 3TJZA 2W58A 3D8BA 4NKRA 1Z06A 1HA3A 2I1VB 1GAJA 1WRBA 3VHXA 5L3QB 1BYUA 5DISB 3ADDA 5KDLA 1E0SA 3UPUA 4N3NA 3FKSA 4KXFB 1UF9A 3NTUA 4B3XA 1P60A 3L82B 1V43A 4C2UA 1AS0A 1QHNA 4M1SA 2XOKD 5GJVC 2QP9X 221PA 4A82A 2PH1A 5LB2A 3A6PC 1E0KA 2FFBA 4QL3A 2G77B 1IBRA 1LNZA 2GF9A 2IYXA 2JJ2A 1S1MA 3C16C 3CPEA 3QXXA 3GLHE 4H9GA 4M53A 4UKDA 4ZCMA 3OESA 4MYCA 1EFUA 3GLGE 1NG1A 3IIJA 2CHGA 4JT4A 1QRAA 2E87A 3WYFA 2WWYA 1E96A 1GNRA 1TQ4A 1UKZA 3HDTA 2MMCA 3L2OB 4LYAA 2GWHA 2QROA 2VBCA 3T1OA 2CMKA 3LH5A 2FZLA 4V0NA 3K70D 4PX9A 3R7WB 5GJCA 4A6PA 5JRJA 4QNMA 3C7KA 1KKLA 2REBA 2ZAMA 1UKVY 3FMFA 2DY1A 1ZM4A 4W7SA 4XIGS 1ZM3A 5LDDC 1VYVA 2B8TA 3QEJA 3VAAA 4GI7A 1G4AE 1PLLA 4E03A 2GXUA 1MO4A 1P62B 1RJ9A 3QPVA 1LS6A 4XWAA 2V7QA 1E1QD 4DUGD 3LQQA 1Z0AA 1RYHA 1KNXA 2WIAA 4ESHA 1ZM2A 3QQ5A 4URZR 1ANKA 2ZRPA 1UPTA 1W49A 2WJVA 1XJQA 2GTPA 3SZRA 3AVWA 1UBGA 2JIZA 2WSSA 3F3YA 4TTRA 2YOFA 3GD7A 3M6AA 1TU4A 1P3JA 1XTJA 2RGNA 4HDOB 2VH5R 4KVGA 2D7DA 1E32A 2FSFA 5DH9A 2VIIA 4V02A 3THWB 4ASUD 4BLSA 3QUSA 5EP1A 4Q4AA 3U7GA 5JS8A 3U44A 3B9QA 4CEHB 5SZIA 2X19A 2QAGB 2BEJA 4M21A 5HTKA 1N6RA 4B34A 1HE8B 2W00A 3EZ6A 1KNQA 3LWNA 3U3OA 2GVDC 1NN5A 2XB2A 4ZDIA 4CRWB 2ZU6A 3EC2A 4P4SB 3W90A 3W6PA 1FQJA 3Q8XB 5JEEA 2J0QA 2FSHA 4LJ8A 4A0HA 4DLWA 1ESNA 1DPFA 2ZM5A 3ASZA 4B3FX 4Q47A 5DE3A 1G16A 1EGAA 3NH9A 4Q03A 3WHKA 1U9IC 2W6JA 1Q1BA 3EASA 4BUJA 2GEVA 4PXAA 5JI2E 2W2TA 2IXFA 2NO6A 3EARA 1KI8A 3S1AB 2QAGC 3K53A 1KO7A 2KWIA 4M9SA 1NL3A 2A9KA 2Q0HA 2F3RA 1IM2A 4D2IA 2VHTA 3QNUA 4NH0A 4QGFA 4EAQA 3AM1A 2GJ9A 1A1VA 1OKKA 2JLSA 4QG7A 3A4MA 4M22A 5KTYA 4LSGA 3SJCA 4JLOA 3ZZ0A 2WAXA 2OBMA 2FH5B 1EFHA 2RHMA 2P0EA 4MRVA 3ZVNA 721PA 3GLHB 5FBLB 1JI0A 3G5UA 2IYYA 5BWMA 5JCZA 4HAZA 3UWKA 3GLGB 2O8FB 2EVWX 3ADBA 2NQ2C 1Z5ZA 3X2SA 1NG9A 1XD2A 1G5TA 3WYAA 4JT2A 4YMUA 4Q7MB 4RKFA 4UXJA 4G01B 3UATA 4TYWA 2DFTA 2P67A 1D6JA 1TQ6A 4D80A 1NVXQ 4NZYA 3THXB 2OESA 1ZD8A 1GVNB 2LWIA 2E9SA 1GNQA 4I1UA 3NEJA 2G83A 4HLUA 2O52A 5FFMA 4R9UC 4Q9JA 3IHLA 2ZJOA 4PO8A 1S96A 4MGKR 1P2UA 3UXMA 3RHFA 2O8DB 2OFXA 3B2EA 2ZANA 2JLXA 2XX3A 3EWSA 1O3YA 3MWKA 2IEZA 4HDCA 4NYJR 2XB4A 2GZDA 5EUQB 2J0UB 2QMHA 4YXWA 1ETUA 3D7MA 1G5PA 2BBWA 1X8LA 4W5HA 3REGA 5CIWA 4EJSA 3IIKA 2CLCX 4QOSA 3UMSA 2AHOA 4FMBB 3G82C 2IYRA 4D4KA 4TLBA 4DHEA 2F3TA 4BFUA 1G3MA 3GFTA 3QF4B 2DBYA 3DM9B 2QE7A 3SEAA 4C0QC 2JDIA 4LOAA 4GDFA 5FR1A 4DT1B 2OSBA 1OFUX 3R9XA 3P1JA 4QRHA 4LPSA 4M1OA 4DSOA 4TMKA 5FPYA 4O25A 3K0EA 4XWOA 5HZKA 1NMZA 4ZIRB 5A0FA 4YMVA 3OAAA 5F9FA 3QXHA 4KU4A 4AI6A 1ZBDA 1IAQA 2GK6A 2ZRJA 4BFZA 1Z6AA 2AX4A 4NYIQ 2F43B 2NMVA 1Q22A 5C4MA 2EFHB 2MSEB 1SVIA 1QBKC 4BFSA 4JJZA 1S2MA 2JLVA 3HP1A 1ZU4A 1E1RA 4LBWA 2YINC 2XEXA 2ZJ8A 4PPGA 1OXSC 3RDPA 2IEYA 1NIPA 1OYYA 4LYJA 4PC2A 1IXRC 3ICEA 5BN4A 4QHSA 5EXSA 2WM9B 4PHGA 4Q4LA 2QBYA 4KSBA 4JS0A 4RFSB 3A1SA 3PITA 3O8BA 4E22A 2FGJA 3CF0A 2BBTA 4PHTA 3VHLB 1KY2A 3K0FA 4IEEA 2I1QA 2Z0MA 3LAWA 4IDPA 5TARA 4PHFA 2ZI3A 3EAQA 2NZ8A 3QBVA 4Q4JB 1DOAA 1N5LA 4A8JB 5GVSA 1UM8A 4B47A 1TNDA 3GLIB 1ZNYA 4DDWA 1PLKA 3JVUA 4TTPA 1XZQA 4DCNA 4LHYA 4LC1A 4HDQB 4P4TA 1W47A 4O2RA 2J45A 3X1WA 5JBQA 3VQTA 2OEPA 5H1YA 4DSUA 3I5YA 3VR5A 2REOA 5FBRB 4H1VA 5DHAA 1T6NA 3LBHA 4JKIA 3THOA 2IYVA 2IT1A 2O8CB 1CR1A 4NBSA 3NIBA 2OXRA 3FMIA 2KB0A 3MJHA 4PZYA 1DO2A 1BKDR 4A8JC 2NIPA 4O2LA 3IUYA 1NNEA 3ZVRA 4ARZA 4DXAA 4N1AA 2N46A 1S4QA 5J4VA 1KO4A 4PSKA 2A2ZA 1W4RA 4V0KA 5FR2A 2ZVQX 2QN6A 4HUQB 1ZVQA 3R20A 2GZHA 2J7PD 5L8VA 2D62A 2YWFA 4NE2A 2V54A 1N6IA 2PBRA 3WNCA 2FDCA 4UNNA 4DJTA 3NC0C 4JVNA 2QP4A 2ERXA 4Q01A 4EJSC 3UIEA 3HR8A 1E79A 4JSTA 2WWGA 5SZKB 5KSYA 1U8AA 4N0DA 5J47A 2W2VA 1FTNA 1J8YF 1Z08A 4IVPA 3KXKA 5AJVB 3HPRA 4KITB 1AZSC 2IXEA 1CKEA 2FNAA 3HU1A 3EZFA 3O47A 3OE7D 3I5XA 3RABA 4C0LA 1ZJ6A 3CUEF 3DOFA 4OQFA 4G5RA 1J2JA 1TL7C 3LBIA 4PC7A 1E2IA 1QHGA 2P6RA 4BLQA 3B7GA 3OEED 3DEFA 2GVZC 3HJNA 1SULA 3QI2A 4AK9A 4CT4B 2CXXA 4LJ5A 1R5NA 5DI3B 1Z0DA 2OBLA 4TTQA 5CK5A 1D2NA 3RSLA 4OI0A 2VO1A 2ZRCA 4E5UA 2VF7A 1SVOA 3RWOA 3PEWA 3OHMA 1E99A 2IS6A 3QENA 1XCGB 1W4CA 4DWJA 1KI6B 3QKUA 3KZ1E 1BMFA 3W6OA 2HYDA 2H7VA 1N3BA 1XXHE 3GJ6A 4A2QA 3EPJA 1OH8A 4C0AC 3SYKA 2VRWA 1F3OA 4HAVA 1YKSA 1E9FA 2ZSEA 4FWTA 4OYHA 5H8WA 2CVFA 5EZ5A 5KDDA 2O8EA 4GMXA 2LKCA 3KTAA 1NY5A 5FL7A 4DDVA 2HDNB 1OXTA 2WWWA 4LHZA 5JJLA 3TGPA 1Q44A 4ON9A 3DOEA 2PX3A 2X2FA 3LXRA 4RD6A 2YKGA 1RFLA 3NBXX 2ZXUA 2W0MA 4BFVA 3OEHD 3ZS8A 1XEFA 3KQNA 4PQYA 1E2MA 2LCFA 2FSGA 2C95A 2H18A 2J3EA 1SXJE 2W0SA 2J0SA 1AA9A 1ZP6A 3BGWA 1P7CA 4QJ4A 1G8YA 1EXMA 3AP3A 1GNPA 4RD3A 2JATA 2GESA 1JQLB 2B8WA 4Q7LA 4TMXA 3QXJA 4J0QA 1J7KA 4JSYA 2RAPA 4NYMR 3RRMA 3I3SR 1TF2A 4GMDA 4AYWA 2GA8A 2H8KA 3RS7A 4DSNA 2P5SA 2UZ3A 3DVLA 3PEYA 3B82A 1KDTA 2ZSDA 2J1LA 2NO7A 2YWGA 1SXJD 5IT5A 3K0AB 2ZTSA 3BD9A 3O8DA 4XSHA 2ZQ5A 3GLFA 1F2UB 5KNCA 4NU0A 4F4IA 4QFMA 5JWOA 2OM2A 4EPTA 2ZIAA 5TV2A 1G3UA 2O0JA 4Q9IA 3R8CA 4BFYA 3BB3A 2ZPTX 4JLNA 1IJFA 3SHWA 4B33A 1VMAA 1CULC 3Q3JB 4PZZA 4D4LA 3QPWA 3H86A 3TQCA 3BH7A 2JJ1A 1DAMA 3A58B 1N5JA 3EW9A 5GADl 4Q7KA 2HJVA 4M9QA 3UK6A 5JZVA 3H84A 4KVAA 2ZRHA 4WVFA 4YDSA 3LW7A 1N25A 3VU9B 4W9MC 2OV2A 2RGGA 2QY9A 4NPHA 4C30A 5E3HA 1LFDB 1XEWY 3FFBA 1BOFA 2IS4A 1T8UA 1QHXA 2G0TA 2CE2X 1JPJA 1CP2A 3NXSA 5CDFE 4P0TA 5CYOA 5E7IA 1JR3E 1ZNXA 2ZITA 5G53C 3THYA 1OIWA 1VDZA 2HV8A 2KBEA 4FXPA 4IOKA 4RZXA 1XXHB 4OK6A 5JLJA 3OFND 3HU2A 3B1VA 3Q85A 3J81k 1U2RA 1C9KA 4ACAA 4ZI3A 1Y63A 1GTVA 4A0GA 3CBQA 3LQRA 2OUKA 2IUUA 3M0EA 1DAKA 4PPFA 1JALA 2AKAB 2W83A 3A4LA 3EA5A 4QC2A 4B2IA 4BWYA 1JR3D 5KDOA 3U6KA 1GFIA 1ONBA 3C5CA 3T1VA 4ABYA 1OH6A 1P61B 5LB4A 1G291 1L7VC 3U4QA 2CNWD 621PA 1VKJA 4QGHA 4LWZA 1CJUC 2C04A 1I2MA 2UVQA 3AVTA 4F38A 3AF1A 4PC6A 2WJHA 1R0ZA 4KHZA 5AJWA 4AIIA 1XJCA 1IONA 1UEIA 4V0MA 2WWIA 3LNCA 5E7JA 3SE0A 3T34A 2BOVA 4KO8A 2ERYA 1SXJB 4TMWA 1MO6A 2CJWA 1G9XA 4TLEA 1ESMA 1M7BA 3W8NA 1F2TA 3K1JA 3U60B 4LYHA 4FN5A 1QVAA 3BAFA 4PHHA 4WAUA 4DDUA 1AGRA 3IKJA 1COWA 2BCGY 1IN7A 1DTSA 1SQ5A 3QY0A 4L8GA 4PTLA 1DBSA 4G5OA 4CEIB 1DAHA 1SKYE 2QMUA 1SGWA 1VCNA 1ZM9A 5TXGA 1II8A 2R9VA 3A8TA 1LVGA 4OI1A 1M6NA 1CR4A 4L5BA 4GL2A 3PV0A 3B60A 5KNBA 4U00A 2FA9A 4AC9A 4AKGA 1MRSA 4URXR 5FTNA 1OIXA 4M8NE 1ZNZA 1Q3HA 1KI1A 4GOKA 2KJQA 2QPTA 4L16A 4PSAA 2OBNA 4CT5A 1XD9A 3IQXA 5FI0B 2C9YA 2G1KA 5F98A 1L4UA 1KAGA 1G18A 2VF8A 2WKPA 3H0KA 1N5IA 2XITA 4LPKA 3SJZA 5L3QA 4KSCA 2EQBA 4GBMA 1W0KD 1T4GA 3V4RA 1SVLA 3N2IA 4JVSB 2AWNA 2Z6VA 4PQFA 3R9IA 2RGEA 5IRCD 2WJIA 2GZAA 2XSZD 3CO5A 3A1WA 3NWJA 3B85A 1KTVA 4JLAA 4MQBA 1UBFA 4IDNA 1KSHA 3ZS9A 2OHFA 2V4ZA 4IKEA 2IXGA 1G41A 2VEDA 1VCIA 3A1TA 5FOVA 1WB9A 3ICQB 1W36D 2O8BB 4NDZA 4MYTA 1P5ZB 3D3QA 4N0EA 3LVRE 3SOPA 2DR3A 3SQWA 4UNRA 5AUNB 1WBBA 3K0CC 4D81A 5FTKA 2WAYA 4Z54A 2D06A 1E6CA 2QTVB 5HKKD 4LK2A 3BB1A 1NLYA 1IY1A 1OFIA 4KBFA 3T61A 3ZVMA 1VYTA 1ZC4A 2RGCA 3P26A 2QU8A 3PUXA 4MGZR 3NBYC 4BLRA 3VR4A 1G7CA 1E69A 1F5NA 4HB0A 2A3RA 2G3YA 4BLTA 2NZJA 3K9GA 1Q3TA 3BB4A 1L8QA 5IK2D 2HEIA 2IYTA 2CHVA 4YMWA 3QG1A 1R0WA 1E3MA 1ZD1A 4OQMA 1FMLA 3WRYC 4IDOA 5AWFC 1RPZA 4ITRC 2JLWA 1G3QA 3WMEA 4FMCB 1VTKA 4DB4A 2IHBA 3IO3A 2YNMA 1GIAA 4TN1A 5CJ2A 3QVUA 4JLPA 4EQ6B 3AVVA 3RAPR 1JPNA 2VL7A 2J5XA 2XTNA 1G19A 4W5JA 1YZQA 2IYSA 5F2EA 3E5HA 3THWA 1DVRA 1U9IA 4TZ0A 2BHRA 1KOFA 4AKHA 2H17A 3I8XA 4L9SA 5B2ZA 1EWRA 1NBMA 3AVOA 3W3AA 4RCZA 3RS4A 4K8OA 4CEHA 5J4KA 1OIVA 1KI4A 2CLSA 3WY9A 1SKYB 1FL9A 2QAGA 2ODEA 4D0GA 2I4IA 2C96A 2D2EA 4M1WA 2BJWA 4LC0A 1FX0B 3Q72A 4DEYA 4LI0A 4P4SA 1S9DA 1SVKA 2OO7A 2FFHA 4B71A 2BC9A 1KSGA 2GJSA 2QL6A 3B13B 1VG9B 3TMKA 2B21A 4LJ7A 4QHYA 4P31A 5LBIA 2BM1A 421PA 3LY5A 1R8SA 2XOKA 1XPUA 4EPWA 2HLDD 4MRRA 4B44A 4B3DA 4JVMA 3S1AA 2VP9A 1GKYA 1MABB 2O0HA 3CPHA 2QRZA 3PUZA 3I72A 4HLQB 1TF7A 3FFAA 2N42A 4JKYA 1CJKC 2ASEA 1GM5A 1XDBA 2R6AA 5JWHA 3EZ9A 3CPJB 3SS8A 4B43A 1LF5A 2Z43A 4NCKA 1IXSB 2QPOA 1RRGA 4AG6A 5L3VA 4A2WA 1FNMA 3C15C 4LV8B 4MH0R 3GLHA 3JZMA 5DLQC 2BBOA 2WZQA 3GLGA 3CR7A 1WF3A 2V9PA 1JBKA 4GSYA 2O8FA 3PQCA 1D5CA 4P3YA 2NO1A 5M04A 1VHTA 1VG0B 4R2IA 4Y0AA 2AD5A 3TSOA 2ZS8A 4IJMA 2QMOA 1E1QA 4KV9A 1OSNA 5EE1A 2ODBA 3THXA 1KDRA 4GOXA 1Z47A 1Z28A 3IBYA 1P2VA 3TUZC 2F7SA 1JJVA 4TMZA 1E2LA 2JJ8A 3WBKA 4L9WA 5AUPB 2C9OA 1HUQA 1FP6A 4BLOA 2Y8EA 5G40A 4ASUA 4M1KA 2ZETA 3AGPA 2FFQA 4I4LA 3QKSB 1OFHA 2QSZA 4Q48A 5C4GB 2ZJBA 1YU9A 3QE0A 4A1FA 1QHHB 121PA 1JEEA 4KFTA 2J0UA 1KO8A 1YZNA 4ZCLA 1NSFA 4ZV4A 5KPJA 3KJEA 4Q1EA 1NN0A 2B6HA 1WQ1R 4I99A 4PC1A 2OG2A 4JVLA 2CL6X 2VLIA 4BEJA 4E09A 2V7QD 2F9MA 4F7WA 4EPYA 2ZSBA 2QENA 3T1QA 3QF4A 3U3MA 1OXUA 4EUNA 1D8TA 1ZU5A 3QKRA 2WSSD 3BIFA 1EFCA 4DT1A 3BERA 5IDVA 4UNPA 3GQBA 2XJ4A 1E2JA 2IW3A 2WMNB 5C46F 2R8RA 1ZUNB 1RRCA 3NDBB 4NL4H 2ZSAA 3RNLA 2KBFA 3FPAA 3CRW1 2P6UA 2QTFA 1L4YA 4CDGA 1AKYA 4ZIRA 3RC8A 4TSFA 3NEYA 2NO0A 4FI3C 4XVUA 1DS6A 4KLZA 3TR0A 1OB5A 2PJZA 3LLUA 5BYKA 1QHIA 1CR0A 1G64A 1R5BA 2OLKA 2QSYA 3CNLA 4C7OB 5FUVA 3Q5EA 2F43A 2QQEA 4PAQA 1TF5A 5JHHB 3U3JA 2FN4A 3K70B 3SHFA 4KLNA 3W34A 1R7RA 2FEOA 1EX7A 5D3MB 4DLSA 1CXZA 3CRMA 2JLYA 1G8FA 4LJ6A 2C77A 4HUTA 1E0JA 4WXPA 4XSGA 1PJRA 3HYRA 4AYXA 4DKXA 4CW7A 1ZD9A 3GPLA 3MWJA 4OBEA 4RFSA 4CVNA 2FJUA 2PCJA 5B58C 1GILA 2IK8A 3QPUA 1NKSA 1G20E 3CZQA 4P33A 4YXWD 2A7QA 1JXOA 4Q4JA 1RRPA 2ORWA 4A8JA 2D74A 2GXSA 2Z4SA 4NONA 3K70C 4B32A 3W3ZB 3GLIA 1YE8A 2ZROA 1QDEA 3CNOA 3CX7A 5DGXA 4DCSA 4B48A 1GRRA 3KQUA 2BIFA 2YWEA 1XEWX 5AJYA 2CL0X 5EXTA 3TE6A 1W44A 4WW0A 1XCMA 3QOFA 4H1UA 821PA 1N6KA 4U5XA 4A9AA 4WZ6A 1EG7A 3ASYA 1FZQA 1DAGA 3KXIA 1BO6A 3AB3A 1E9SA 4Q7JB 2O8CA 4L4UA 1VECA 2XAUA 3L0PA 3MCAA 3NVAA 2DFKB 3IHWA 4FWIB 3K0SA 4HI0E 3DM5A 4DCUA 4QKQA 1BH2A 3CWZA 1NJGA 1ZYUA 1VG1A 5FUWA 2YZ2A 1RW4A 4JMPA 521PA 3BFVA 1I4TD 4WBSA 1LS1A 1LF0A 2CHQA 3ONWA 4TT3A 4URYR 1P9RA 4TYQA 2FPKA 1Z6GA 1ELOA 5FTLA 4FD2A 4HUQA 5KNDA 3ZDQA 3EPHA 1KY3A 2C8VA 2FWRA 3U44B 3R8FA 3EIHA 1TQ2A 1FP7A 3AKYA 4QBFA 4RZ3A 2MSCB 2CCJA 2WJGA 4FMCF 3SR0A 1AGPA 1ZNWA 5BN3A 1KAOA 4BRWA 3BRWD 3LVQE 5FUXA 1IHUA 2MMGA 4FCVA 3WMGA 4B6EA 5KHOC 3P32A 2W6IA 2HCBA 4DLZA 4L15A 4E07A 2AK3A 1P4SA 2VYFA 2FGKA 2QE7D 1R4AA 1ODFA 2FPLA 2JDID 1LY1A 2ZRLA 3W5IA 4D4MA 4HAYA 3SU8A 5KU1A 2YVUA 4LJ4A 3WHLA 4DLXA 2BEKA 1E2NA 4LCBA 5DI3A 3T5GA 1GWNA 1NKTA 3NH6A 3PJRA 2ECKA 4RCYA 1E9AA 4DLRA 1W5TA 2K5UA 1F60A 3GJ8A 4F4CA 3OIWA 1H65A 1UFQA 1BIFA 3D31A 4NTZA 4LBZA 5HZHA 2QAJA 3CNNA 4LBVA 1US8B 1KI6A 2C5LA 4MKFA 1Q1QA 1UKEA 4HZUB 3TW8B 3SFZA 3KFXA 2GAOA 4MKHA 2CL7X 5CLQA 3UG6A 4B76A 3NG1A 1U99A 3BXZA 3KB1A 1EX6A 2D3WA 5TB5A 3ZZTA 1E1RD 4QXAA 2REXB 5AUOB 4U7DA 5AUQA 4QHTA 1IQPA 4JYCA 4EKDA 1GITA 1WE2A 2ZJYA 4DB2A 3MGCA 2ZRKA 4JBYA 4B35A 1T91A 1YRAA 1YQTA 1XF9A 3LLMA 1GP2A 2IWHA 3AP2A 4C0SA 4F92B 3B6EA 4KYUA 2V8OA 4ILEA 3WBJA 5EXXA 2VP4A 2XNDD 4A4DA 1WCV1 4HATA 1HE1C 3LBNA 3EPLA 1R2QA 1T3HA 4QGAA 3V4FA 4AKEA 1E9EA 1TEVA 3H1TA 3VR6A 3BK7A 5DN6D 5HR5A 1G5RA 1DG3A 4LJAA 1R6BX 1HQYE 3FMOB 3U2QA 2EFCB 2PT5A 2X1VA 2AFIE 1KK2A 1IXZA 1TMKA 2XZPA 2Z83A 2C99A 3IILA 3LXXA 3PR1A 4Q1BA 5HE9A 4Q21A 1NLZA 2TMKA 3C4JA 4BFTA 5ANRB 1MKYA 2IUSA 3BBPA 4IOMA 1YR7A 1N5KA 4YMSA 2BJVA 1DEKA 2ZR7A 2ZRNA 2VA8A 3L0OA 4Q4HB 1NRJB 3CW2A 4JLDA 4BFWA 3A1UA 4OHXA 3WYGA 1F2UA 4PFSA 1U8ZA 1CU1A 2ZYTX 1G8GA 3A1VA 2I3BA 4NYIR 5JECA 3AEZA 1G6HA 3TLXA 4TLCA 3UG7A 4B3CA 3R9WA 4IOJA 1BYIA 3OEEA 2R44A 5FTMA 3OIYA 5DIFA 1Q1ZA 3SBDA 3BH6A 3C8UA 4ACBA 1Z2CA 5KO2A 5J40A 4WXRA 2DCUA 2ONJA 1G21E 3RS0A 2V1XA 4RKEA 2OAP1 2GETA 4LJ9A 5CJPA 5EE0A 2BMFA 2A5FA 2C98A 2QT1A 3VU9A 1E2DA 4W5WA 2Z5FA 1E79D 4K81B 1X6VA 3RLFA 1G3IA 2BKEA 2JCSA 4C0BA 3U7HB 1UEJA 2JLRA 2GF0A 5L3RA 4XD7D 1X8JA 1P9NA 2O5VA 3EG5A 1GRQA 1TX4B 4JBXA 1WMSA 3PENA 2XJ9A 3EWAA 4Z1MA 4R7ZA 1OH7A 3VKHA 2AD1A 4AYTA 1LB1B 2GKSA 5B57C 4EPVA 4HLCA 2XZLA 1P2SA 1LW7A 1GL9B 3MMPA 1XXHA 3IEUA 2BVNA 2Q9CA 4X8MA 2VQSA 2OE2A 3KKQA 3L8YA 3QXSA 4QBHA 1QVRA 4PO1A 1VHLA 3MAAC 2NTYC 3CF2A 4HB2A 3VFDA 3TAHA 3MG9A 2IBMA 3FE2A 4MA4A 5CM8B 5FBQB 3ZJYA 1II0A 1IN5A 5KSOA 1OW3B 3AVUA 2BV3A 1M2OB 1U0JA 2QA5A 3H4MA 3B9PA 1NLFA 1W4AA 1E2GA 2ZUBA 3MD0A 1ZM7A 3DPUA 4G3XA 2ZE8A 1D2MA 1EFTA 1U98A 3CRRA 4KODA 4PPQA 4Q1CA 4MDFA 5FBWB 3SNHA 1A2KC 1KDPA 3NBZC 1EESA 4US1R 1HH4A 2HXSA 5FOXA 2HCJB 4MYUA 4JZKA 2HT1A 2Q9AA 3I92A 3T5DA 2GXAA 4Q9KA 3DL0A 1Q12A 3DKPA 1TUIA 2QQ0A 5DYGA 4V0OA 1W2HA 4NCIA 3IEVA 4URUR 3TRFA 3L0SA 1FOEB 1OHHD 4CEIA 4PAOA 2BCJQ 2CVHA 4YC7A 3SJBA 2A78A 2BBSA 3T15A 4ZKDA 3EIEA 1T5LA 4M9ZA 2VTKA 1HQCA 5J5CA 4C0JA 4XVRA 4PAMA 5F9HA 2ZVPX 4G5SA 4UJ3A 4A0RA 2ZI9A 2CEAA 2FZ4A 2VHCA 2WVJA 2R6FA 3U61B 3U7EB 2KI5A 1G8HA 1YVDA 3U7FB 3ZZUA 2ATVA 4QJ5A 3VR1A 2ZI7A 3NHBA 3T06B 3SFVA 2J0VA 3VNVA 4KFUA 2V55B 5IF9A 1E2EA 3K9HA 1T0JB 1XMSA 3K0CA 4OL0A 3NC1C 3SDZA 5GJBA 1W4BA 2BM0A 2EFDB 3REFA 4DLTA 4BE7B 1KIMA 2CE7A 2ZEJA 3V9PA 3QJYA 2ZS9A 3C14C 1H8HA 1N6HA 2ZJ2A 1OJLA 3P4XA 4IXNA 3CRQA 5FBVB 4C4PA 2R6GA 3I73A 2JJ1D 4QJ3A 1XMJA 1XEXB 2E1RA 1QF9A 2O8BA 1Y3AA 2DWPA 2RB4A 2XXAB 3ECCA 4MRNA 2CK3D 1JQJC 2GRJA 2UKDA 3TIFA 2BKUA 4WOPA 2ZS7A 1G4UR 1EFRA 2Z4RA 4RZUA 1X86B 1XWIA 5DNYB 2WWFA 2PX0A 2DFLA 4IOLA 3AUYA 3K09C 4D25A 2FV8A 5DI9A 4PO9A 2YHSA 3QXCA 4ZPXA 3EPKA 2OAQ1 1P73A 4XH9B 1O87A 3WNBA 3DKVA 5FOWA 3GJ4A 3FYHA 2O8EB 1W48A 1H8EA 2ZYUX 5E7MA 2QMEA 4RD1A 1QG4A 1U94A 2QORA 4ZDWA 3CH5A 1I2DA 3PIRA 4KJZA 3MJRA 1Z83A 3L8ZA 1Z63A 1XMVA 3JVVA 3H2YA 5KYKA 4OQNA 1OF1A 3ZQ6A 4EQ6A 2O0KA 4CEJB 1KI7A 2IUTA 3W8RA 3WP1B 4V0ME 3VKGA 1AM4D 3B1XA 2FEMA 4Q5IA 4QGGA 2YWHA 1ZAKA 3LFUA 1Q21A 2VPPA 1JXMA 1ZIOA 1RIFA 2RGXA 5G3ZA 5B30A 3AKEA 2VHUA 2FG5A 4TYYA 4TLAA 2FE4A
chains in the Genus database with same CATH superfamily
3T3PB 1T1IA 1EQAA 2IF0A 2EZ4A 3RTAA 1GZ7A 3W9YA 1BXZA 1NBAA 4ZCTA 3BICA 4FMDB 2PT6A 1HLFA 2ECFA 4KBGA 4W8HA 1N1GA 4ZREA 5EIOA 2PD4A 3O31A 1X74A 2PUHA 1C7JA 1ILWA 3KHSA 4FLEA 3M9XA 5LQCA 4Z4QA 1VP3A 3W04A 5CA0B 1HYGA 1YNSA 4WWHA 3X1JA 5JIBA 1GPYA 2YWDA 1M1XB 1V1RA 3L46A 3ORHA 2YJ5A 3AHGA 3CW9A 3K1AA 3NWPA 3O95A 4WY8A 4DWWA 3A9CA 5JXWA 4GKVA 3RKRA 4FE7A 3K0HA 1MABA 1DIOB 3QI7A 2AZDA 4KFRA 4UULA 5TSDA 3CY6A 1TW3A 5JH7B 1AGNA 3CTPA 3THSA 3PT5A 2G88A 2GPTA 2ZRDA 1M67A 1J0BA 2VP5A 1T2CA 4WK2B 2GK7A 1PEYA 4OQXA 4UUPA 5TPZA 1NW7A 4TTVA 1VOTA 1HG0A 3ZHVA 5IAJA 3WSTA 3H42B 3LVBA 4KQ9A 4JUIA 1XEAA 5A6SB 4IO1A 4CMJA 1KZ7B 2C5EA 1RM3A 1Z18A 2WLSA 2G9NA 1TJNA 4BPBA 4C7KA 1L5YA 2A9FA 1KJWA 4JI2B 5TJHA 2GHQA 4M0KA 4OSOA 3VSCA 1RLIA 5DT9A 5CLIA 2BDEA 4DNPA 1I51A 1KEPA 1VIAA 1A2OA 2BFDA 3HABA 1QS0A 2XADA 4MQUA 1JECA 4K46A 3R7WA 3C6QA 2FF7A 5IK2A 3I83A 4RJJA 3NTVA 1FYEA 4DQVA 3AVXA 4FLMA 1FVXA 3C3DA 4RY9A 1RLTA 4FHFA 5EMJA 5IARA 2BFBB 2C9CA 5CXUA 2CXRA 1PV1A 3FDJA 4JJ6A 3OIUA 3AVYA 4DQ0A 2BF4A 1FDTA 4PC3A 4G1UC 5A62A 1QH9A 1EXDA 1VKNA 4WSOA 4DA0A 4R84A 3G17A 2EU8A 4IV0A 3T3DA 1ZVKA 1UDXA 4YP7A 5EUMA 1G8PA 4XTCS 4EG1A 5KCZA 1KH3A 2FSPA 4YQFA 3KETA 2D6FA 2PXXA 3GA7A 4S2EA 4QU8A 1KL7A 4JBWA 4PS1A 2PSJA 1U7PA 4D8YA 3F6PA 4D9KA 2GBLC 4DLYA 2AOUA 3G5TA 4QBKA 5BVHB 2OG1A 2FWAA 1AKVA 3CSUA 2Q0XA 4ZT7A 2Q5EA 4WNAB 1YCFA 3OQHA 3VR4D 2Y9MB 4EPXA 3ORRA 1PJ8A 4N5DA 2EBWA 2NNWB 4URWR 2QS9A 7AT1A 1SEVA 4V2IA 2PANA 1HEIA 4RSMA 1NP6A 4Q9HA 5AKYA 3V1LA 4M8KA 2V5VA 4GNKA 2WTMA 3G02A 5SY4A 2BMAA 3AC0A 3JPWA 2I2FA 5E1DA 3V6MA 4QU9A 4Z4CA 1XZMA 1F48A 1YH3A 4EFNA 4Y2RA 1YD7A 2XODA 5B64A 4DCJA 5JNRA 2G80A 3G2PA 4TM7A 5DBFA 3RSCA 2OZKA 2Z2KA 2W2XA 3QKTA 1XTVA 4NVRA 3CC8A 3GFRA 1A82A 3AESB 4MTCA 1VE3A 2UVDA 3DWFA 4OKNA 5EINA 5LP6C 1MOZA 3E61A 2BH2A 3AJ8A 5I01A 5KYYA 1FBTA 1HZJA 3RAJA 4YYZA 1H9BA 1PI3A 1BVYF 1Z5NA 4P36A 4R9SA 5JAZA 3RYHB 4Y9RA 4QXQA 3ZQUA 2FR1A 2XQGA 3EDRA 1O6FA 3LRPA 4ZEXA 4RTQA 3CWCA 1L5KA 1D0IA 2ZFUA 1LLQA 4ZEMA 1OI7A 2NPFA 1H66A 1V48A 3L8EA 4Y0NA 4F3CA 4BHTA 1Z2AA 2IZOA 4TQGA 1H1LB 3I2GA 2DWOA 3BIOA 1EP1B 1B14A 4MJ7A 5IM5A 2QRNA 1JLRA 3G0GA 3PUVA 3V1NA 3AI2A 3WGTA 5UKDA 3VO9A 4DLLA 1JHOA 1V3TA 4MPDA 3RRYA 1FQKA 1P7YA 4QPJC 3ZJ5A 3PRJA 4BCBA 1MDFA 1Z73A 3NGMA 2RH5A 1P4HA 5HS6A 5KSWB 2EKBA 1U0HC 3E1SA 4QELA 4ZAWA 4QBIA 4EFDA 4IFBA 4U2GA 2IYLD 4CZ2A 3O8CA 1PQYA 3KPYA 4IYRA 4YAJA 3V7NA 2A0WA 4YMLA 1A88A 1CRPA 2J5BA 3L4EA 2WICA 4Q00A 3LT2A 1W36C 3QUQA 2D4HA 4BV8A 3VR6H 5MN6A 3ZYCA 4EECA 4ZVMA 1S3IA 2WB4A 2I33A 2QTLA 1P4GA 2ZUVA 3RS3A 4NCJA 3ML1A 2JC3A 5JSUA 1NNUA 1QG2A 2AOTB 2I65A 3WB9A 1HURA 1ZCZA 4ZI2A 3AEYA 4LRSB 4NPAA 2J41A 2I78A 1IE3A 1SHJA 2WT4A 2IA5A 2GEUA 2CWDA 5THQA 2F4NA 2VH2A 3DDOA 4M0CA 1GUAA 5KB3A 2H1LA 4ZALA 2BDTA 1H05A 1V5GA 1LV8A 1X1TA 3KOUA 4XR9A 4B6QA 4MLCA 1RMQA 2YWBA 1KRWA 2BMJA 2PJDA 2WBLC 4HTAA 2GKOA 3PDWA 3WA7A 3DEZA 1EEHA 1SPBS 2NPIA 2RC5A 3UV7A 5ALTA 2O8DA 2Y9PB 3DAHA 3DBHA 3GGGA 4K05A 4PQEA 1WZUA 2ROQA 5GONB 1CDEA 2H00A 1J1IA 4RANA 1QG0A 2C3MA 3VNUA 4QEZA 2NYRA 5G0TA 1U8XX 5C32A 2YJGA 1BX1A 3OZRA 3X2EA 5A4JA 1ZH4A 1Z36A 2QQGA 3PRHA 4F86A 1UC9A 1R18A 3G9UA 3E8XA 3KVNA 4MVJE 2BYTA 4IHJB 2C7PA 2AS0A 1M1YE 3PGKA 4OJNA 4M9RA 1R64A 4REQB 2WG0A 3A7EA 4RMHA 3FVRA 4YN3A 1IM5A 2CLLB 2OT3B 5L45A 4L8FA 3ZIUA 1K27A 1ZQ9A 4MVYA 4WZAB 3T0FA 2GRAA 2GBFA 3A6JA 2RDMA 1M2JA 2XWQA 2GCNA 2QT9A 4A03A 4F2DA 1V41E 4PLCA 1CUHA 1AK2A 1TUEA 5D86A 1G98A 1FSGA 1TKBA 5IXYA 4IIBA 4MVJD 2CVPA 4HX5A 3RBAA 4UTVA 2QR2A 2AMLA 4CKCA 2ZCJA 1Y9AA 4EB3A 2XUGA 3LWZA 4BVAA 2ZK7A 3OU6A 4N03A 5BV0A 1CETA 2QN1A 1EZZA 1CNEA 2FPMA 4D82A 4BN4A 1CJTC 5B3LA 2O2EA 1UANA 4PLWA 5I6DA 4WNIA 3GOHA 4TTIA 1ZVJA 3F7TA 2B1RA 4MKRA 1OXVA 2OHGA 2PFSA 2XKJE 3CZPA 2J3KA 2X40A 4C0HA 3ZGOA 1D7AA 4G1VA 4ZGBA 1AKRA 2BHTA 3MK31 3TH5A 1LDMA 1T3TA 3FB1A 2A94A 1DG1G 4B9EA 5FH9A 1KJZA 4XWWA 1I30A 1JQ5A 3H8SA 1QZXA 4PPNA 3ZOZA 1UMCA 1ECBA 1XJ0A 2Q3JA 3OECA 4U7WA 5J23A 1KQ3A 1CZOA 1PJAA 1AN0A 1VHWA 3H9BA 3IBGA 3PQEA 4JNKA 4QLAA 4FCWA 4MRMA 2NU6A 3JS5A 3QV1A 2RHDA 4IIFA 4LJYA 5HKOA 2EZUA 2CLDX 1GTSA 3JZFA 4BZPA 1WXWA 3CXRA 3NOVA 3NOOA 4RKWA 1TADA 1GU0A 2J3IA 3FCXA 2H54A 3O74A 4UHBA 4I1YA 1OYOA 3CLHA 1DEOA 3PCRB 4YGYA 3UJDA 1AZTA 1DLIA 1J90A 3PEVA 2BMDA 1EVIA 1XF1A 2O9JA 3IJ5A 4FSXA 4MKGA 2C8JA 2QJTA 3RF6A 1E9DA 5FB3A 3QUAA 1PTJA 4MDEA 4RC9A 2A5DA 4QFCA 1JGTA 1K6JA 3FSGD 4HZUA 1B73A 1M6EX 5B7QA 1YZYA 4ND4A 1QYXA 2PYIA 1Z62A 2A5YB 4MWCA 3AH8A 2EQ5A 3IUMA 4B6GA 4PR0A 2J32A 1QHSA 4L8VA 3R6DA 4ZJUA 1Y7HA 3QFCA 4IW3B 1B23P 4OO3A 5LMUB 4O5AA 4X1KA 3ZGXA 1IHXA 2MSWA 3HDYA 1J24A 2VTEA 1OLOA 3ZZNA 3EF3A 3FUTA 4KDFA 4D92A 1GOTA 3PGXA 5C18A 1RZ3A 3WA6A 5LMZA 4HAWA 1LTQA 3DMTC 2PNFA 3B8HA 2P65A 3O5AA 5CVCA 3U4HA 3QH4A 3FF1A 2IXTA 2AQIA 2C2WA 2YQZA 3WK6A 2QP3A 3MHPA 3L6BA 4RGQA 4IRMA 3BOSA 1GA1A 1K7SN 2K2WA 2PEYA 2CJPA 3D7RA 3W9BA 3GAZA 3TECE 2QUIA 2VPIA 4FUQA 1G63A 2VLBA 3ZWBA 1YJQA 4BJHB 3CUKA 2XPCA 4PN7A 3O9MA 4TWIA 5IYZF 2Z56A 4EHAA 3A27A 1FQOA 4LV6A 3FHOA 4PM4A 3R0JA 5MFZA 2J85A 3IQEA 3BWEA 4GP6A 4V3CA 3PIDA 3F3KA 2CCKA 1TU3A 2GTHA 2P9ZA 3A28A 5ALRA 5KOJB 2J3JA 3L6CA 4QE3A 1CWUA 4PYJA 5IVPA 3M49A 2D4AA 2KLBA 3W79A 4L5CA 2VSOA 2ERCA 1P9OA 2ZBQA 3JYNA 4G4SP 6Q21A 1SCKA 1B93A 4PZLA 1XPRA 3AZOA 1BJKA 4MVWA 3TD2A 4EVQA 2CXQA 1FUUA 3CN9A 2ZJ1A 1ZRHA 4US0R 4AZ0B 1P45A 3C8MA 4PG7A 5GM1A 5ADUS 2D00A 3ON5A 5ADVA 4DNQA 1XX6A 3P0HA 4HNUA 4TT3D 2KX7A 2PGLA 3BGOS 4FKBA 4AUEA 3SC3A 1POXA 4H3SA 1EDDA 3QBJA 5BSGA 4DQLA 1JQDA 1OPRA 2Q5IA 2I4LA 2J6HA 1EUZA 3O1HB 5D5QA 2H4XA 4BNZA 2K6GA 4C3ZA 5C8XA 3JAWA 1M76A 5J2UA 3EIQA 1W1UA 4II7A 4J2OA 3SQLA 1IN6A 1GZVA 2QN2A 4OLFA 2GVNA 1OXXK 3E2IA 5I7WA 3VU8A 4LI3X 1K5DA 5LMCA 3B5JA 1OI4A 5CXXA 4YLGA 3NNNA 3WGHA 4KI0A 1PLJA 3HQ4O 4W1SA 3D7LA 1EQUA 2CCGA 1PJSA 4TQAA 3ET4A 4L57A 1P81A 3ZK8A 5J4YA 3OF5A 5LIRA 1EAMA 3GPIA 4J1SA 3X2FA 4ZI7F 3ZY4A 2NV6A 3R9KA 4COOA 4O63O 1MEEA 2PV0A 3BMCB 4GG1A 4I81A 4TXJA 1AS3A 4COKA 5TE9A 4H4CA 1ZN9A 3X1DA 1NMYA 2I87A 1G20B 2WM3A 1C5KA 1SOUA 3CPSA 3G88A 5HGJA 5LYJA 3RC1A 4B5LA 3LT5A 3FVTA 2BHLA 3GH1A 4HNAB 1HMYA 1WBJB 3O3MB 2J9XB 4FLFA 2J48A 2JGFA 2W2QA 3VPDA 2B36A 3GB9A 1L7RA 2XNDA 4UW9A 3N0VA 5D87A 2IC5A 3O4JA 5DFAA 3WK8A 1P17A 1UUFA 2KS6A 1UT8A 1JLLA 4PGMA 1X1BA 3D1VA 5EMMA 2QD1A 2W6CX 2HYIC 1YZ3A 3B3QA 4OLHA 2FU5C 2Z3WA 4R1PA 5ALYA 5LNK1 5G0SA 4OK3A 3IQWA 4ZDJA 3NDRA 1YSCA 1ZVMA 4ZVLA 1GG8A 4Y8VA 1K75A 2FP3A 2J7PA 1X87A 2JFFA 3LX4A 3ROMA 1L7BA 2GT1A 3OIVA 5I3ZA 2IQ5A 5AT1A 3PC6A 1GRCA 2GAJA 4RZIA 4ZEOA 2UXDB 5ULLA 3VSDA 1NBIA 4C2TA 5GGYA 3HCPA 2YS6A 5G41A 5CURA 1C1XA 5A9RA 4M6WA 4GH5A 2JNWA 2VPQA 3FZGA 4R3UC 4RMIA 1P1HA 1P5FA 2BKVA 3NWEA 3ELDA 4OB7A 1D1SA 1KMMA 1GN9A 1QH8B 3F6EX 3I23A 4FUTA 1G5QA 3SHTA 1GQYA 2R65A 2VPXA 1KYXA 3QE3A 4X60A 3BHNA 1XNJA 3EE6A 3TGWA 3OLQA 3JAMA 1BNCA 3AF2A 1EDBA 3BPSA 2V7PA 3DTVB 1TRHA 4KTTE 1H2HA 1BS1A 2Z9DA 4A8PA 4BGDA 4KX5A 1U6KA 4URVR 1EQ2A 3FSRA 1RJFA 4ZAGA 1Y8QB 2LRHA 2E5FA 1L5OA 4NHOA 5JI3E 2WSMA 5LZ4A 2HIMA 3CV3A 4UARA 4XKJA 3TNJA 3FGPA 4N0PA 4K9MA 1NY6A 1P4RA 3WYDA 4GKJB 1T9ZA 1K7YA 2QKYA 4CR8A 3FYTA 1KK0A 1ZA1A 4DC9A 5C8VA 1DQRA 4FINA 4HWTA 4EGAA 3E3LA 1V7QA 3ZE2B 2TECE 1TD1A 3AR7A 4Y0VA 4YCCA 2GHIA 1M2NA 4ZQEA 4IJ6A 2QD2A 4FDVA 3RS9A 3TFQA 3GIWA 5H68A 1DAEA 3G3EA 3O1JC 2XMPA 3EQ7A 4HVAA 3H4VA 2P4EA 2O2DA 1UADA 2EF1A 3MJTA 5A71A 3C39A 3IQDB 4L28A 4WFIA 4D0SA 4UFOA 3PLNA 4EYSA 3PUJA 3V3KA 2PL3A 5K3AA 1CZHA 2X4LA 3TX6A 3ECSA 3TF5A 2OFPA 5ISMA 5HIKA 2Q6VA 1XEXA 1C30A 2H7XA 2WIJA 4FNGA 4KVZA 1XRJA 5GVRA 4NCXA 1LPMA 1B74A 3I01M 3R4VA 5AM4A 3NVDA 4GZMA 3R77A 4OHOA 1KI2A 1AZLA 3WKBA 2QBYB 3D1JA 3U19A 3HCOA 4I1IA 4DABA 2C4WA 2VUTA 4FDLA 5FUMA 1U3DA 5AM0A 4ZU1X 2IS2A 3CUUA 4KQHA 4OM8A 2IU6A 3PPYA 1VSQA 4JQYA 3TRIA 2RMKA 2B1QA 3AQ4A 3CEHA 5KOYA 1AB6A 1UXGA 3DUFB 1L8XA 2P5TB 3EEFA 3FDXA 3R3SA 2NTJA 3IPXA 1P6XA 5K8LA 3QVVA 4KRYA 3LXUX 3OQBA 4V24A 3VTKA 3QVSA 4K88A 4NMWA 4Z1MD 5IJ9B 2GJ4A 4F91B 1KU0A 1ECLA 5P21A 4LKOA 1GKIA 1ML4A 1I7LA 4MUAA 5K8TA 3ETCA 1JWLA 4TGLA 3NETA 4CMIB 4O3FA 5CG1A 1NUUA 4L75A 3H9UA 1J2RA 1HO3A 1MB2A 1PYGA 1MNQA 2AJDA 2HJGA 3GPBA 1N0UA 1WUYA 2JHGA 3QBDA 2GEFA 1U6JA 4EG0A 2X2EA 4M0DA 5K09A 4R8KA 2XUFA 3CB2A 3IPLA 3LPLA 4YAUA 4MEBA 3HR7A 1RE1A 2P9YA 1OHHA 1TEZA 1WB4A 4G0VA 1A8IA 1JNYA 3WJ1A 3ZWDA 1BD3A 2QRMA 1W75A 4ARZB 2WM8A 4LSWA 3NKVA 4P84A 2PKRA 5FWYA 3QSYA 1VKHA 4QO8A 9LDTA 3GMTA 1FJ2A 1AK1A 3I8SA 4DLVA 1WV0A 2X0NA 2WILA 3IERA 3VVBA 4C3VA 4ZAXA 2F1JA 1BVUA 2JBAA 4AI6A 2O2JA 2OZVA 3MQFA 4W9NC 1FPMA 3GLFE 2VHQA 3OZAA 4LOJA 4AJ9A 2XBMA 6GPBA 2QGFA 3OZUA 1X7YB 4ZTUB 3A6ZA 5DRYA 1WEHA 3JU3A 3MOIA 1ILEA 1NVUQ 1Z45A 1Y4SA 4JB8A 4A0FA 1B15A 4RBNA 3WL8A 1HZZA 1Y4DE 3SPXA 3LK7A 1QTIA 4YJHB 1GGVA 5HMMA 3C85A 2P9GA 4LZWA 1RJWA 1QF6A 1KR5A 2G08A 2P6NA 4L22A 1WUTA 3SCZA 1GSIA 1YR3A 1QFYA 2Z2IA 4J16C 4JYMA 2ZREA 1BWPA 3JQGB 5BVGA 5GAJA 3ZLJA 5EIXA 4Z4FA 1GLVA 1JVSA 2YHIA 2Z5LA 1I1OA 4X41A 1MJHA 3UKDA 4MVJF 5JYDA 4PSVA 3A3KA 1RLMA 3H9CA 3RF7A 2IDJA 3FB4A 4JL5A 2VSFA 1QLJA 3PHJA 1XQVA 4B46A 3HL4A 4Q9DA 5A1JA 1IY2A 1WDTA 4MK4A 1XFAA 2PVPA 3H5IA 3ZGZA 1DJPA 2R87A 1NU6A 4GMGA 5DMXA 2TMDA 5J2TB 4Z3DA 5BSRA 3BD7A 2YXLA 2IZ7A 3II6X 1JLKA 1PR3A 3JATB 3HV2A 2PD3A 2QD3A 2WU4A 1GAWA 3CH6A 4C7BA 1AUQA 4Q18A 1ORRA 5C8YA 1E64A 2QUAA 4C87A 1Y9JA 4HEJA 1JR3A 1UEXC 3S68A 1WHSA 3V7UA 5I4KA 1M10A 4FC7A 3R75A 1YF3A 4EPRA 2OLJA 3EGEA 4Q1DA 2D2IA 1O97C 4TVKA 4CF3A 1O0CA 3H8JA 3D0RA 2GN2A 4XVHA 5F21A 2Z98A 3FGOA 3FY4A 1SUEA 5EJ7A 2ZATA 3MTGA 4OMDA 1FDWA 1CQIA 1N5OX 4RQAA 3VZRA 4YO7A 3W5SA 2DUUA 5J4HA 3FNQA 3AOGA 2IH2A 1R0KA 1UOOA 1ZMXA 4UBOA 4BZQA 4R1NA 1H2XA 5EXEA 4Y9DA 5IP5A 2KSQA 2B9EA 2A9VA 3Q5GA 4ZAFA 4ABTA 2BEUA 1WA5A 2QT0A 1XCPA 1SHTX 1EFRD 1RQRA 3CO0S 1BQ3A 3ND8A 3PL5A 4G8BA 5U4XA 3V1KA 2W8BA 3E81A 3FZEA 4R16A 1Z0KA 1WR8A 2Y0PA 1GYRA 2DBQA 2RHBA 3GA5A 4DSTA 3MJEA 1XZAA 3H5WA 2CHEA 3CWQA 3G1TA 5CM2Z 2DOKA 2FFAA 2G5TA 5FEMA 1G3RA 4BRZA 2W2NA 2VYVD 3CZ4A 4GC9A 2ZAOA 2WW8A 4ZYXA 3SJUA 5LJIA 3T9EA 2A9PA 9ATCA 1I3MA 1CHDA 1DDGA 2P6MA 5JEDA 3FLBA 1RWBA 2JIDA 2JH3A 3JQDA 2V8BA 4YAIA 2AKEA 3AFGA 2LV8A 3MWLA 3R3UA 2JGJA 3WGYA 3KCNA 4FONA 1CYDA 1Z13A 1JIXA 5CYPA 1ZSNA 4CMKA 2F1IA 1E7MA 2PLRA 1GZ5A 3O73A 1RYDA 3R5TA 1YZUA 3CJRA 4PYMA 5BR8B 1N5DA 5IKOA 4HSGA 2Q7XA 1NE7A 2F3PA 1VGRA 1Y4ZA 1RWXA 1T9HA 3PFGA 1J5EB 3MRSA 3U3KA 3V8NA 5LQSA 3TVYA 4RM2A 3A37A 4CN8A 1KKMA 4P08A 5BPFA 2Z8XA 1CIPA 1YR6A 3LFTA 4IEFB 4B7XA 2GNOA 4HAUA 4NWIA 4DJEC 1DT5A 3LCJA 4DA4A 1Y6FA 4MRPA 3SR3A 2I34A 3L02A 3AILA 2MSDB 2QLBA 5FPHA 4BY9E 1M1ZA 2G28A 4DIKA 1C3JA 1YKGA 1K8YB 1YQQA 1XU4A 2PKXA 2IV2X 3B3FA 3CH4B 4BNUA 2QW8A 4FW9A 3FCSB 1PJ3A 4IGAA 3Q8MA 4J49A 5DCWA 1IZ7A 5BOVA 4ARBA 3N8DA 3AHDA 1LBIA 3IQHX 5HKKA 1PT6A 4DMRA 3FTQA 1QGAA 4V2UA 4ZQFA 4MV6A 2WMYA 3KUDA 3SR4A 3U81A 4MUEA 1CF4A 3H75A 4R83A 1MB4A 1M1NA 1XQ6A 4UUOA 3DP9A 3DVAA 3LW8A 3B12A 5KVAA 5JAUA 3ZH9B 1GR0A 3DOCA 5FPSA 5KYUA 1GZSA 4ERXA 1MR3F 4G07A 4ZO4A 1N0IA 4CUKA 4F8EA 4ZMBA 8ABPA 3TM4A 5IHPA 1SAYA 3L4JA 5I4CA 4EJMA 4WN9A 5JWRA 5IKMA 3Q9NA 1I80A 1NT2A 2ANBA 3PBKA 4M0LA 5CH3A 5ESDA 3GW8A 3DFIA 5JXHA 4OX9Y 4FQ8A 3Q9LA 4K7JA 1YDMA 4RLQA 4D9BA 8OHMA 4F46A 5IANA 1T5BA 4MB0A 1KYIA 3F7OA 3SAJA 4RDXA 4K9KA 4ND3A 3NLLA 4IFEA 4Q9LA 4ESVA 5JNSA 5AFSA 2V3CC 5IN4A 3W5JA 2ZRBA 4LHWA 2AXPA 4BEBA 5IXSA 3RTBA 2W98A 3ONEA 4G84A 3U4QB 2J3HA 1ZUIA 2X42A 2SNIE 2PWAA 2VZ0A 1B6TA 1T0UA 4LEIA 1SBNE 3LMKA 3CZRA 4HTFB 2EC5A 4PAGA 4GQAA 1Z37A 2OLEA 3K92A 1E1CB 3NVMB 1CUIA 2X76A 1N2CE 5ITZA 1T3SA 1ZH6A 3BDVA 3BVPA 4I50A 2Q41A 2WD7B 4JD5A 4KFSA 3D81A 2PMFA 3WIEA 1KJYA 2F48A 1R8QA 4RDCA 3CLTC 1NUTA 3M6LA 1Y3IA 2ONCA 5FL3A 1W96A 4ZZIA 4IIJB 3DT8A 5BV8A 1CLUA 3TQRA 2NOAA 3ME5A 3IYLW 2Q6LA 2C2GA 2H5EA 3KP1A 1V4VA 3IDSA 2AFRA 1NDHA 4Q7QA 1CCWA 2FQQA 4ZHQF 3TQFA 3AR4A 3COPA 3LO8A 1YVRA 4MUGA 3W0LB 3OOJA 4LW8A 4JHLA 1C80A 1LPPA 3KKMA 1LDYA 1II8B 3UOGA 3W1VA 3RROA 5SYAA 1QIKA 1VHDA 3S3TA 4BV3A 2E3JA 1NDUA 2IGBA 3GG9A 4AMZA 4HN2A 1SXGA 1XTKA 4ID3A 1FNNA 2FR8A 5BUQA 4WQMA 4OI4A 4YCBA 4QRDA 3WXMA 4H08A 3U6BA 2X77A 2O0LA 1AQIA 2G8NA 3QU7A 3BDIA 2XGJA 2QTHA 3RASA 4TKVA 1T3LA 3TXXA 5L3SA 4NZ9A 1GKUB 1X7DA 2D0DA 2XH8A 3ZXSA 1Q20A 3BRQA 4W5NA 1U81A 4QXRA 4S1OA 4RJIA 1VI2A 4C4TA 4NKRA 3KHKA 3VHXA 2I1VB 2V6MA 3FNEA 2VTVA 4B5KA 1BYUA 1CSEE 2PH5A 1UDBA 2ZBRA 1SOWA 3AI7A 3UM9A 3ADDA 1YTLA 3GGPA 1CUYA 1UJCA 1V1RB 3BCUA 3SS7X 4R69A 1P60A 3WAGA 3W7BA 3HCCA 3WI7A 4CLXA 4NDAA 3SE7A 1QKKA 3UMGA 1U1GA 2UXBB 3B38A 3A6PC 2P2SA 5FA8A 2CNKA 4IF6A 3OLVA 3ZKAA 2FFBA 1FVOA 1Q7TA 4MUMA 4QL3A 2G5GX 3QXXA 1N7JA 4M53A 1FK8A 3S29A 3VR5H 4CM8B 2VQEB 1DX6A 4M1QA 5BQPA 1NG1A 3DNFA 2J33A 2VXYA 1E3SA 4JT4A 3I3OA 4KSYA 4M37A 1E96A 5JSFA 1UKZA 4CMGA 2DUJA 2MMCA 4HD8A 4O33A 5DGIA 3GN1A 3IEIA 3I6QA 3KWFA 2VBCA 5DT2A 3T1OA 2CMKA 2JIBA 4V0NA 4ZOQI 3K70D 1OREA 4PX9A 3F47A 4YJGB 3TOZA 3IVCA 3R7WB 4KWCA 5JRJA 3IPCA 3C7KA 3O21A 3U1TA 2DY1A 2I9PA 4H3VA 1ONPA 4WGGA 5F78A 4B8ZA 3SKVA 2JH9A 1OILA 5KQLA 2GN1A 4MHOA 1LH0A 3DE6X 4CM4B 1PLLA 4FZJA 1O0SA 3WQRA 2GXUA 1MO4A 2OO3A 3S28A 4KQ2A 5TRTA 3JSXA 4FOLA 4XWAA 1NPTO 4DZRA 1E1QD 4MWDA 2NXCA 1X7HA 2H1RA 3C3KA 3CUVA 3LQQA 1ZESA 1KNXA 3KZKA 4P1ZA 3H87A 4M7PA 4TRRA 5EWMA 4URZR 4QGSA 5K6TA 2ZRPA 2WJVA 4S05A 3SZRA 5AKIA 2JIZA 2I99A 2Z1MA 1WEKA 2Z58A 3GDGA 4OXXA 4TTRA 4JI1B 2AG6A 1TU4A 2RGNA 4HDOB 3TOCA 2D7DA 1YIOA 3LY8A 4LG1A 3R74A 1QP0A 2VIIA 1LTHR 1T6BY 3DLTA 2NYAA 4P3PA 1JMYA 5EP1A 4ASUD 4BLSA 1ODSA 3IL2A 4CTOA 4OBBA 4ANFA 4TKMA 4EY7A 1ULHA 3EDMA 2FB9A 2G63A 3MPUA 4Z9XA 4V38A 5SZIA 3OZFA 3I45A 3WS7A 2I03A 1GNSA 2QVYX 2V0CA 1ZJYA 3LWNA 5GZ6A 5I9MA 3U3OA 2GVDC 4RENA 5B3AA 1AOXA 3RFCA 4ZDIA 1WQ3A 1Z75A 1QJCA 4BZWA 1SD5A 3W5CA 2ZIXB 2BTQA 5IKXA 3W90A 5IVKA 3HMKA 3BWMA 3Q8XB 5FD8A 1DTWA 1PW7A 4N8EA 2PPLA 3ASZA 2PO5A 3NT5A 4EW1A 3UV3A 4FHGA 1EGAA 2IZ5A 2QPLA 2QXUA 3DXYA 2W6JA 3WHKA 2B4KA 2GEVA 3LGSA 5AO9A 2XVYA 5KQRA 1IMOA 4CDRA 1SCUB 1RRMA 3EARA 1ODLA 4QZVA 1E3WA 1L7PA 2QAGC 4M49A 1YTUA 5ECWA 3HDVA 2CFRA 3T5MA 2C4NA 1W4LA 1FFXA 2EJWA 1IOWA 2KPOA 1NL3A 1SC6A 3P0JA 4X91A 2VDJA 2OL4A 2B4AA 4KPUB 3SLGA 4CIXA 1IPEA 3E5NA 4BQQA 6LDHA 1XZBA 4IBOA 4NH0A 3LFHA 3AFOA 4GM1A 4ID9A 2ZYSA 1W76A 2CFCA 1AUVA 1MNAA 3HCDA 4M22A 1QV6A 5L7TA 1LWOA 2C57A 3TNYA 4ZTBA 4EY4A 4ENSA 2GZMA 5J58A 1VSUA 1OR8A 4L9RA 2RHMA 5CGZA 3ICVA 1MAWA 3GLHB 4YAFA 1RABA 1TZKA 2P0AA 3EIOA 2EHJA 3O6VA 2COKA 4FYXA 1ZJ4A 4LYGA 1QPZA 4C88A 2ZB4A 1QO0A 2EVWX 2XKAA 2NQ2C 4BS9A 1FZTA 3DZGA 2HDHA 2HNBA 4RA6A 1R4NA 3NJRA 1XD2A 3VZPA 1NG9A 5ER9A 1SZJG 3UYLA 3OCWA 1JH8A 3T5BA 4YMUA 3EEBA 3UATA 4LRXA 1NQOA 2DFTA 2P67A 1D6JA 1TQ6A 2BI8A 4S0ZA 3WNVA 4NZYA 3CG4A 2PGOA 4HKTA 5CEJA 2E49A 1YDWA 3GV0A 3PNQA 1ZD5A 4KXNA 2R85A 1L5NA 2HHJA 1XMXA 2PS9A 1DKUA 2CMDA 3PGA1 5FFMA 5DBHX 5EHIA 4UOZA 4JYPA 1L5FA 4PO8A 3EW7A 4MIEA 2Z3VA 4I9NA 3D43A 4ENRA 2VNHA 1P2UA 2J30A 5KJ6A 2FSVA 4P3NA 2HQOA 2O8DB 2P9FA 2QX7A 2IZZA 3GLKA 2C2MA 2QTRA 4D8TA 2OFXA 1VLQA 3B2EA 4GYWA 5CT8A 3R5XA 1TVCA 2RI6A 2GO1A 4X00A 4FD3A 3HACA 4OOEA 4C5AA 2Z3ZA 5FKJA 4EUFA 1QH0A 1HDGO 2ZCVA 4C4YA 3V8RA 1E61A 2QSUA 2QK4A 3LHKA 5E9JA 4OMCA 3G68A 2JGMA 3IIKA 1EFPB 4EJSA 3QE2A 3VPXA 3RUCA 4QOSA 3QQPA 1B1CA 4O4IF 2ZDGA 4YRNA 4OY3A 3SQDA 2G72A 5F3DA 4ZHSA 3DC7A 3L92A 5H9VA 4BFUA 2BGKA 1JKIA 1FLVA 1S4MA 2DBYA 2QE7A 3DZCA 3BREA 5FNVA 3KBBA 3UJBA 2O2SA 5E6SA 4MUJA 3OD1A 4GDFA 3PR3A 4DC1A 3DEAA 4CKCB 3QYPA 4QQNA 1PE0A 3FJ1A 3LL4A 5DM0A 2WFZA 4ZQIA 4BLWA 5ABPA 4LPSA 1Y1TA 1XRLA 3GT4A 2GNAA 1B8VA 1NR5A 3CRNA 4I1RA 4ZVVA 1R8JA 4B1FA 3T5PA 4BNYA 4HXFB 3ZLTA 2DUWA 4CM5A 1RP1A 4O25A 5L40A 4X7BA 2HMTA 2A0UA 4GBGA 4M46A 5A0FA 4R1LA 4YMVA 1R4MA 3O2NA 4MDHA 4RS4A 2RARA 4OFBA 5DGTA 4YCLA 2GBIA 5KC9A 5F9FA 3ETEA 4WA8A 1K1EA 1ZBDA 5KX5B 5AVQA 1NBWB 1YQXA 4NYIQ 4AJLA 4PHCA 3AETB 3IP6A 5JAQA 5AW7A 5JNLA 3SFTA 1EFVB 1SVIA 1QBKC 4BFSA 4BMZA 4A6EA 4GOND 4BV9A 1PFVA 3H3XA 4J7XA 4ZV7A 2ZJ8A 4OX9B 4UUAA 1OXSC 1SCAA 1VFPA 1DWOA 5EVJA 3CVOA 1USVA 1OYYA 4GICA 3ICEA 1HKHA 2WUWE 4YP0A 4CTMA 1EU1A 1TA4A 3CURA 1JQBA 2SECE 3FIJA 2WM9B 3OJWA 4KBYA 3TCKA 5AOVA 5BN4A 2ZDHA 3IOEA 5AVOA 2PBFA 3H4IA 4JS0A 3ACDA 1F5SA 3PITA 3LHDA 2CVQA 2Z5VA 4ROTA 3QPAA 3FZNA 3V6LA 1RVV1 3CQ9A 4NAVA 4IDPA 3EPPA 3QHAA 5AKEA 4F1JA 1AKNA 1PV2A 3IAM1 2ZI3A 3QBVA 4Q4JB 5MGNA 5GVSA 4A8JB 4H1HA 4M1ZA 1KVUA 1UM8A 1T1EA 1TJYA 3N0RA 4KWTA 1TNDA 4MUNA 3GLIB 4FEYA 1ZNYA 3I58A 5KOHA 4W8OA 4N7JA 4TTPA 1XZQA 2FW1A 4DCNA 4LHYA 3BMOA 1WNTA 4P4TA 2VRCD 2J45A 2F8LA 2RK4A 4R68A 2C5AA 4X1KB 5H1YA 3M5DA 5TMEA 3I5YA 1U0BB 3K1TA 5FBRB 4J0DA 1JJFA 3KJNA 3AEKB 5DHAA 1ISPA 1NVGA 2NNLD 3B1FA 3I76A 4MI6A 4PRKA 3ZDXB 3V33A 5BORA 1Z15A 2PX5A 3GO4A 4A10A 5BQFA 1U7TA 3NPMA 1XVAA 3L7YA 2X8BA 2OXRA 2DM6A 2KB0A 3CEMA 3VI4B 4AL4A 3MJHA 3NXKA 4PZYA 5B1YA 1ADYA 4P9NA 3IUYA 2PSSA 1DIHA 4BX8A 2JIPA 4IDDA 5EKUA 1K6EA 4EZBA 1Y7LA 2N46A 2WWTA 2Y93A 3G8AA 4C3UA 1XKTA 5J4VA 2YYYA 1RIIA 3Q41A 1W4RA 2OO5A 1ADGA 5KVQA 3ZDEA 4B7CA 1GTMA 1CJBA 3VR6D 1V6SA 4HUQB 1P8JA 1ZVQA 3FUVA 4RHFA 1G38A 1ESZA 1NTOA 5DWDA 1IRXA 4B3RB 2PUTA 2VC2B 4FNMA 1XALA 1LLDA 1N6IA 2PBRA 2BE7A 1MD9A 2QXYA 4Z3OA 4LOHA 4LTDA 5KWIA 3R8XA 2GPAA 4XM2A 1OZAA 4OAOA 1TIKA 1R27A 2C0CA 4R51A 3MWGA 4Q01A 3FNFA 5EIEA 3HR8A 1E79A 7REQB 1I0ZA 4WT7A 1KTIA 3H1GA 5KSYA 1DGQA 2IDKA 4UMEA 4KFCA 1PK7A 3F6CA 3PPVA 4IVPA 2RK3A 3P9NA 3ND7A 5B58T 5A0TA 3O47A 3EZFA 2M32A 1BEEA 3JQ8A 4LRYA 4CKEA 3QLVC 2BN4A 3AG5A 2WDZA 4K1XA 1L7OA 3CUEF 4IILA 3A6FA 3DB1A 4OEHA 2ZIFA 1M5RA 4WVLA 3TRJA 3SNKA 1PWEA 3P2JA 1E2IA 4PC7A 4PYOA 4OP3A 5ARDA 1QHGA 2LP4Y 3VTFA 4BLQA 2P6RA 3I52A 3K30A 2BKLA 4YTEA 3Q3CA 4CT4B 4OAPA 3GNTA 5JYCA 5JS1A 4BYGA 3S99A 1DWQA 2PE5A 4EKIA 2V7BA 2ZB2A 1MC5A 4YRGA 1Z0DA 3RSLA 1PK9A 2O1XA 2QLTA 3UJ8A 4OI0A 3SY8A 5DW0A 5KWJA 4JR2A 2ZRCA 3PQ8A 4HGOA 4FBMA 1EWTA 1Q1NA 3KQYA 4JBIA 1NQXA 4WL0A 1LLUA 3RWOA