5HCIA

Gpn-loop gtpase npa3 in complex with gdp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
257
structure length
257
Chain Sequence
b'SLSTIICIGMAGSGKTTFMQRLNSHLRAEKTPPYVINLDPAVLRVPYGANIDIRDSIKYKKVMENYQLGPNGAIVTSLNLFSTKIDQVIRLVEQKKDKFQNCIIDTPGQIECFVWSASGAIITESFASSFPTVIAYIVDTPRNSSPTTFMSNMLYACSILYKTKLPMIVVFNKTDVCKADFAKEWMTDFESFQAAIKEDQDGYMSSLVNSMSLMLEEFYSQLDVVGVSSFTGDGFDEFMQCVDKKVDEYDQYYKKHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GPN-loop GTPase 1
molecule tags Hydrolase
source organism Saccharomyces cerevisiae
publication title Structure of GPN-Loop GTPase Npa3 and Implications for RNA Polymerase II Assembly.
pubmed doi rcsb
total genus 104
structure length 257
sequence length 257
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.6.5.-:
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03029 ATP_bind_1 Conserved hypothetical ATP binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5hciA00
2EQBA 2MMCA 1KZ7B 3VMFA 4OYHA 4BFZA 4DB4A 4A6PA 5FUXA 2QAGA 3L8ZA 4MGIR 4B6EA 3L2OB 2VEDA 3EIEA 3K0EA 1U9IC 4GOXA 3I5YA 4BE7B 1E9FA 1E94E 3IEUA 4BLSA 3CPEA 4FXPA 2H1LA 5GJVC 4BRUA 2CDNA 3MWYW 2G1JA 2YINC 4M1YA 3P4XA 1KO7A 4CF7A 3FB4A 2HLDD 2P6NA 4MH0R 4EQ6A 1ZUNB 2VHQA 2WKRA 2Q9AA 1U9IA 4XVQA 5FH9A 2QQEA 2ODEA 3AVWA 1H65A 1FZQA 2CK3D 2G3YA 3R9IA 3J81k 4DT1B 2BKUA 3QEOA 1K5DA 1TQ4A 3R9WA 4FI3C 2GETA 2P0EA 2FV8A 2G77B 2C77A 3D8BA 5DE3A 1ZM7A 3BFXA 4M1SA 2JJ2A 4XSGA 5DH9A 4DLRA 1E99A 2WWGA 1G21E 1JR3A 2J1LA 1D9ZA 3LV8A 1U2RA 4KU4A 2F1JA 2W2XA 4LBWA 1E2JA 2C04A 1HTWA 2FN4A 3OEHA 4TTQA 1DAKA 1GVNB 2GAOA 2RB4A 2HXYA 2D7DA 5KSPA 1YZUA 1OXSC 4OJQA 4TQUS 2VF8A 2WZQA 2G0NA 4AG6A 2QM7A 1UKYA 1D8TA 3K09C 1BOFA 2GZDA 2PX3A 4Q4HA 4LUCA 3LDAA 2ZJOA 3WBKA 1T9HA 1ZRHA 1E96A 4DDVA 2ZSDA 1ZC4A 4QNRA 4TTRA 3AKDA 3FFAA 1L2TA 2HJGA 5FI0B 2ZR9A 4HZUB 4DCSA 4DWJA 3UANA 3IKJA 4BWYA 2ZS7A 1F2TA 1TQ2A 2R2AA 4G5OA 1CJMA 2DWOA 4EQ6B 3GPLA 1N5JA 3QXXA 2Z4SA 3DOEA 2C9OA 3EW9A 5F9FA 3OZXA 2ZSBA 1ZM9A 3RNLA 2CEAA 1KO5A 3OESA 1EX6A 3OE7D 1XEWX 3WHKA 2MSCB 3P32A 4EPVA 3H4MA 1LW7A 2MSDB 2WICA 1S3GA 2GJSA 5BN4A 2D4HA 2VP5A 4CW7A 2EWVA 2PCLA 4OHXA 3TH5A 1T5IA 2Q21A 1G7CA 4JLJA 3W3ZB 2WKPA 3Q85A 2VRWA 1M34E 3X1YA 3QXJA 5TARA 1RJ9A 2EFHB 4OHVA 1R6BX 1OIWA 5GJWC 2OE2A 3V4FA 1YZGA 3BAFA 2J59A 4M9XA 1MO4A 1NJGA 1KKLA 1NKSA 2C96A 2HYIC 1DAMA 3LQQA 4I1VA 3G82C 3BORA 3AEZA 3K0FA 4TYYA 3GFOA 2AX4A 4TL7A 4C0HA 1BIFA 2VF7A 3IIMA 1NI3A 4Q7LA 3VU9A 5E3HA 4JVLA 2GBLC 4LJ9A 3WP0A 1KI4A 5IK2D 3W90A 4L9WA 1E1QA 1QHIA 5FOUA 2VTKA 1XCPA 2NG1A 2X8AA 4LJ4A 1QHHA 5A4JA 1UBGA 2IHYA 3IUYA 4QFMA 5HZKA 1VG8A 2JLVA 5DISB 3I72A 2CMKA 1HURA 3KXKA 1XCMA 1Z8FA 3IIKA 4Q4LA 1OFIA 4W9MC 3P1JA 2JLWA 2A78A 4B33A 1YRBA 2N42A 2ZROA 4URUR 3ZLJA 3FHTA 1KI3A 1JB1A 4RZ3A 1F3OA 3A1UA 4URZR 1UM8A 4TMKA 3OHMA 4CRWB 2IS6A 3RS3A 1OH7A 2JLQA 1E2EA 3TKLA 4KVAA 4A9AA 4ZCMA 4PC2A 4TMTA 1T8TA 3P27A 4URVR 1US8A 3CWQA 1KSFX 3NC1C 5FBLB 3O8RA 1GNQA 2O0JA 4NCJA 1Z6AA 3U6KA 1XD9A 3DL0A 3TK1A 2GXAA 3PG5A 2OG2A 3ZQJA 3TNFA 3CRMA 3WMFA 4YXWD 4JKYA 3A4MA 4EPTA 2QRZA 4JL8A 4LWZA 4A36A 1P9RA 1SVWA 2TMKA 1OXVA 4BFUA 4GRAA 1VG0B 4C7OB 5CITA 1P5ZB 2A5YB 4DSUA 5JI3E 5TDHA 3AVTA 2ZUDA 4MRRA 3AF2A 3GJXC 5JJKA 1KK2A 1RYHA 4BZPA 2YOFA 2C03A 3QI2A 4PAOA 3K70B 3C5HA 1ZYUA 3K0AB 4YC7A 4BRWA 2XXAB 4ACAA 1II9A 2W0SA 3MG9A 4G01B 4XOIA 1P9WA 3GMTA 3W6PA 1GWNA 1P3JA 2EFCB 2XJ4A 5FPSA 4EPRA 5EXTA 2V9PA 1OT3A 2PX0A 1SXJE 4Q7MB 2WTUA 3EXAA 2QE7D 5HKKD 2PZEA 2P6UA 2WOOA 2B92A 1RIFA 4LJYA 1Q1ZA 4Q1DA 1OXTA 4WW0A 5EXSA 2AHOA 4HLQB 3QXHA 1XEFA 1LF5A 3H84A 4PXAA 3SHWA 1KI6A 2RHMA 3THXA 1UF9A 1Q0UA 3MWKA 1I4TD 2GF0A 4JJZA 4ZI3A 1DPFA 4R9UC 3AF4A 1R8QA 1KIMA 2R6CA 2VHUA 3LBNA 3NHBA 3P20A 3SYNA 1OH8A 2ZE5A 3CF0A 3PUYA 2BEKA 4DXAA 4Q19A 1DAGA 4JLBA 2J46A 4ABYA 2EWWA 1M7HA 5C1BA 1FX0A 1DE0A 1ESNA 1W4BA 4GOJA 3CO5A 4L9SA 2F6RA 1JALA 4RD2A 1XZQA 3SNHA 1DG3A 3P26A 5BWMA 1XD8A 4L8GA 3X1DA 2PMDA 2WIBA 2CVHA 1DAFA 3ZVRA 4KFTA 2BBOA 3LXXA 2FSHA 5HZHA 2QBYB 5FL7A 1LFDB 1H8EA 1KO1A 5AUPB 1WQ1R 3SR0A 4G1UC 4Q21A 4I81A 4KBFA 4B47A 3ADKA 4IXMA 4ZI2A 4F38A 1EFRA 4GNKA 3CX8A 4YMUA 5FBRB 3U60B 1OB5A 2FPMA 2GXSA 2ZR7A 1QG4A 1E1RD 3RDPA 2NQ2C 3BIFA 5JRJA 5DI3B 3HR7A 4S2EA 1XMVA 4F93B 4D0GA 2XNDA 1VCNA 5C4GB 2Z4RA 3TIFA 1AQUA 5DHFA 1N6PA 3NH6A 3VR5A 4C0LA 4WZBE 3WRXC 221PA 2ZJ8A 3WYGA 1JNYA 2D7CA 4C0BA 3B60A 1OH6A 4DDUA 3JZMA 4WBSA 2ZSEA 3IBYA 3TBKA 4RD3A 1KDTA 5JWOA 4PO1A 5FTNA 2OSBA 3NBFA 3CF6R 1F48A 2QZ4A 4IW3B 1E2FA 1Z0FA 3RS7A 2JEOA 721PA 1SKYE 2P6RA 2VHTA 4B71A 1AJEA 5FI1B 1KI8A 2ZRNA 4IOJA 2XEXA 2FNAA 4RD4A 2NO1A 3R9XA 4NBSA 4AKHA 2AWOA 1U8YA 3E5HA 2GEUA 3FDIA 1DELA 3QBTA 2G6BA 2EW1A 4H1VA 4M9ZA 4XJXA 3NTUA 1OE0A 1KTVA 2GXQA 2J0UB 4GZLA 4ZKEA 4C0KA 1J8MF 1GKYA 2F43B 1T0HB 2KB0A 1ZU5A 2J7KA 4DB2A 3ZZUA 2EYQA 1KNXA 2JJ1A 1U0HC 1GG2A 1Z28A 3KXIA 2P3SA 4LHYA 4TMXA 1NNEA 4PC6A 1WA5A 1F5NA 4DLTA 3THYB 2CLSA 2QMEA 3K0CC 4YDHB 3QVUA 1KJYA 1HE8B 5E7IA 1HE1C 2O8DB 1BO6A 1FMLA 3KKNA 1LY1A 1G8GA 4X8OA 5CM8B 2KE5A 4M8NE 4B48A 1QVAA 1R10A 1XTRA 4EPXA 2JDIA 2NIPA 3BH7A 3GLIE 3Q7QA 4KXFB 4Q9HA 3DOFA 4KITB 3EWSA 1DVRA 3ZQ6A 2WIAA 4KLNA 4XWOA 1T3SA 1QHXA 1W46A 3MJRA 1FP7A 1W0JD 3DZ8A 4LC1A 4LK2A 4Z8YA 2NOAA 4GOKA 2BEJA 2NO7A 5DYGA 1BMFD 4AK9A 2J7PA 5CM9C 5L3QB 1S2MA 1T91A 4BZXA 4CYMA 3A1TA 2AK3A 2UVQA 4NYJR 4IDNA 4O0MA 1NF3A 2ZEJA 1AGPA 1U0JA 2OBLA 1E9CA 4KFUA 3KB1A 1D5CA 3NVAA 3W6OA 1W47A 4B3XA 1NRJB 1X8JA 4Q66C 1E2PA 1AZTA 5JCZA 3GJ8A 4Z1MD 2BMDA 2OT3B 3ZVLA 2FPLA 2UZIR 2R44A 4YMSA 1OW3B 1TMKA 1E1QD 3MWJA 5DI9A 1W2GA 4TLEA 3SFVA 5H8WA 3K09A 4C0QC 3MCAA 4MUAA 5G41A 3IQXA 1UADA 2CE7A 4DCUA 4EJSA 2V4ZA 5JBQA 4NU0A 2AR7A 3N70A 5LD2C 5K8LA 2YZ2A 3T61A 4E03A 5LB2A 1QDEA 3OFNA 1OHHD 4LYJA 4V0NA 1IHUA 2YWFA 4UXHA 3QUSA 1XTSA 2A2ZA 4TT3A 2DCUA 5TMPA 3SFZA 2AKYA 5FTMA 5CK5A 2I3BA 2XXAA 1WRBA 3UG6A 3EX7C 2NTYC 1N5KA 4NE2A 4PX9A 3CH5A 1KI2A 3Q5DA 3UXMA 2ZU0C 4OHWA 4DVGA 4MYTA 3O8BA 3CWZA 1PLJA 4HUTA 5J47A 4KYIB 2QU8A 4Z54A 2ZPTX 3BB3A 3R7WB 2CLDX 4LHVA 3ETLA 3MJHA 2YOHA 4KFSA 5AWFC 5CB6A 5FTLA 1PLLA 2RGNC 4TL8A 4V02A 4NL4H 3IGFA 3CLVA 5CYPA 3ND9A 1N6HA 1EFRD 3U7FB 1Z47A 2GAAA 2J0QA 2QMHA 3Q72A 4FWIB 4ERNA 3N2EA 2BVNA 3ICQB 2GJ9A 1RVDA 3PUXA 4F7WA 4JYCA 1AS3A 5IHPA 1VHLA 1X8LA 4I1SA 2QTFA 3GJ3A 2ZRKA 3UMFA 3AF1A 5IT5A 1ZNXA 4KSBA 4B2PA 3CR7A 2QEQA 1NSTA 3PVSA 5FBQB 1E2IA 3VX4A 2VBCA 3OF5A 3C4JA 1JPNA 3BJIC 4NCHA 3TE6A 1K8RA 2KBEA 2QQ0A 2IYVA 2VSXA 4O2LA 3SC3A 3DHWC 5EP1A 3WXMA 1KYIA 3Q7PA 1FW6A 1AKEA 2IYSA 4PO9A 2H92A 4QJ4A 5FPKA 4FMCF 4AYXA 2QUZA 2HUPA 2JIZA 1IN7A 4Q4HB 5EZ6B 1OF1A 4A2PA 1YR7A 2ANCA 3E2IA 4XH9B 1WE2A 4Z51A 2VIIA 3PITA 2YKGA 1FTNA 2XOKD 1OIVA 3D3QA 1G6OA 4PFSA 3LA6A 4ZIRA 3MUFA 2QTHA 5B2ZA 3K53A 1V5WA 3EPJA 5G3ZA 2A5DA 2FF7A 3B85A 2QENA 2O8DA 1Z6XA 5J4LA 2JCSA 1W36C 1YR8A 5BW8A 4F92B 3LFUA 5DN6D 3U7HB 2WJHA 4H1UA 3NG1A 4U5XA 5D3QA 2IS1A 3QJYA 4BUJA 2RAPA 3BB1A 1L8QA 3FPAA 3FVQA 2AN9A 4RD1A 1W2HA 3LW7A 4Q47A 3BRWD 1E32A 2WJGA 5SZJA 4XWKA 2H18A 3B5JA 2NGRA 4NH0A 1NN0A 4BZQA 3TMKA 1G17A 3M6AA 3DMDA 4Q4JB 3SJBA 3I62A 1GRRA 2GEDA 2GCNA 2VLIA 3K9HA 5CK4A 2IYXA 3ADBA 2OEPA 3T5DA 4OJKA 1AZSC 3AKEA 5JFGA 4GMDA 5L3QA 4C2TA 2OXCA 2ZE8A 4JJKA 1OXXK 1SXJC 3NEJA 4XTRA 5KYKA 1A2BA 1N0VC 3CRVA 3BGWA 1SZPA 1YU9A 3KTAA 3H86A 2OAP1 2ZRJA 2VSOA 2EFEB 5JMTA 2CE2X 3EPKA 4A0FA 2O8BA 2BCGY 2E9SA 4FD2A 3GFTA 4ARZA 3AVUA 1IN5A 4DKXA 1A7JA 3B82A 5DGXA 2V6IA 5KPJA 2BC9A 1EGAA 4Q18A 2XZLA 1IAQA 3UG7A 1AKYA 4YLGA 1NBMD 1U8AA 2CNWD 4ZIRB 2O8FB 3Q3JB 4LOAA 2G0TA 3MAAC 1ZBDA 1J90A 4EPYA 4Q1EA 1KMHB 5ANRB 1NG9A 2YC2C 1S9HA 2GVDC 2DY1A 2UZ3A 2XSZA 3LNCA 2JLRA 4NPHA 5FOTA 3WYAA 2WWWA 4ZDKA 3X1XA 4JZKA 4XWAA 2WWXA 1KY2A 4YMVA 4EDHA 4BPBA 1XEXB 5J4YA 1AM4D 3C5CA 3FMPB 4UNSA 4NMMA 1W0KD 2FSFA 3QENA 1EG7A 1N0UA 4BECA 2HEIA 1II8A 2V7QA 1XBTA 3C15C 1AIPA 1E4YA 3L0SA 5EXXA 2ZRBA 1D2NA 1UFQA 4JLDA 1W48A 3KX2A 4A8JC 3GLIA 5JWRA 3ICEA 1KHTA 1G64A 5IK2A 2ZUBA 2OESA 4IOMA 1CEEA 4PPQA 4NDZA 2ZAOA 3ZH9B 1K5GA 1XXHA 1G16A 4AY2A 3KKQA 3SQWA 4FMDF 3PV0A 1IXSB 4CEJA 3OAAA 4GT1A 5KNBA 3LY5A 1GL9B 3MD0A 4HDQB 3EZFA 2CHGA 1NKTA 1ZAKA 4KVGA 4LGMA 1ONBA 3VR1A 4BFWA 5DIFA 3GJ7A 1N6RA 4B44A 4NYIR 4F91B 1A82A 4QJ5A 1XB2A 4HDOB 1GUAA 4WOPA 3I32A 3VR4A 1P61B 1ZUHA 2XAUA 4LJ8A 1FFHA 1R4AA 1Q22A 1S96A 4YMTA 3U4QA 5DI3A 2JDID 4B74A 2ZI9A 4B6FA 2DFNA 1NIJA 3GJ5A 3KFXA 4TYWA 3OE7A 3U6BA 2Z5FA 2VP0A 3KUDA 2ZI4A 4L15A 2CL7X 2IXEA 2J9RA 5A0FA 1QVRA 4HUQB 1KI6B 4R2IA 4Q1FA 1VKJA 1U0LA 1NVVQ 4LYHA 5L3SB 2A7QA 4U7DA 1RRGA 2VPPA 2HLDA 4UQOA 1XXHE 3QF4A 1GRNA 1IBRA 1DTSA 1XFAA 3V9PA 1JBKA 2QNRA 4DUGA 2BIFA 4M0LA 1ZUIA 4D4JA 1Z0DA 2ZRIA 3AUYA 2V1UA 1FPMA 1GP2A 1N6OA 4P4SB 1VHTA 3GLHA 1P75A 3EIQA 3K70D 3W5IA 3QNUA 2BJVA 4GI7A 5AJYA 2RGGA 3TAUA 1Z63A 3AP2A 4UNNA 4MGKR 1VIAA 1OXUA 3KZ1E 2XTMA 4OL0A 2OLKA 3PIRA 4NYMR 2SHKA 2W0MA 1EXMA 1VYTA 2H7VA 1R0ZA 2GRJA 4WVFA 4HAYA 4HLUC 1E2LA 3DPUA 2J5XA 2OLJA 1TX4B 2N1BA 4P3YA 1KSHA 2J0VA 4IFEA 5LPNA 2CJWA 1E79D 4QGAA 2ODBA 2QAJA 4L5BA 4B34A 2F3TA 3QVVA 2QRNA 3OIUA 2R6GA 2IEZA 4D25A 2V3CC 1YE8A 4AC9A 1OH5A 2OM2A 3LBIA 3SDZA 3SS8A 4M9QA 2IT1A 3FKSA 3IHLA 1RRPA 2OCBA 4QC2A 4XVRA 3EC1A 1XJ0A 1G5TA 4OHZA 5E7MA 5KSOA 1PZNA 3VR3A 4ZDWA 1VYUA 3JZAA 5CIQA 3GD7A 4ZDIA 5JLJA 1KI9A 4QGHA 4ZPXA 2CK3A 3L0PA 4G5QA 1FNMA 2XB2A 4LV6A 5G53C 3F5FA 2ZRHA 2VP2A 2IUSA 1P9NA 4LPKA 4MRSA 3PQCA 2V54A 1SKQA 1M6NA 1ZVQA 2FA9A 2IL1A 3MLEA 3IO5A 4P0TA 4XSHA 1T3HA 2HT6A 2WWHA 3KFVA 3CZQA 4URWR 2BWJA 4P4TA 4C7OA 1G18A 4LY6A 2JIZD 2CXXA 1XU4A 1ZD9A 5H1YA 1P2SA 4D4LA 4F4IA 1SVIA 3NDPA 5EE5B 3L8YA 2JLZA 4E5UA 3NC0C 1D6JA 2HYDA 5FBWB 1GAJA 3KQLA 1GKUB 4V0OA 4DDWA 5FUYA 2GJAA 4IHQA 1ZNWA 3BS4A 4V0MA 4DLXA 1G3QA 3U3KA 2W6JA 2WSMA 2Y8EA 4LV8B 4A8JA 2RGXA 4PR0A 4YONB 4ESVA 3RRNA 1KDPA 4B32A 1YVDA 3QXSA 3SBDA 4MYUA 5CLLA 3CX6A 1C4OA 1E2MA 2RH5A 4LBVA 1NLYA 4M2LA 3TQFA 4AKGA 3SBEA 2AL7A 3BWDD 2VH5R 3KJIA 1VG9B 4A6XA 1G3IA 2QSYA 2QI9C 2QT1A 2Z83A 4N3NA 4IRUB 1E69A 3B78A 1R0WA 5H68A 4E22A 4PSVA 2HJVA 3PXGA 3PENA 2W6IA 1IN4A 4Q7KA 3TGPA 5HE8A 4TZ6A 1Y63A 1KY3A 4GSYA 4JS0A 1FUKA 1GIAA 1NMXA 2J41A 4RZXA 1Z0JA 3ZS8A 3U5ZB 1BH2A 2C2HA 3IILA 1XP8A 4Q00A 5KU1A 1GZSA 4PC7A 4NYIQ 1HA3A 2G88A 3NIBA 3R8CA 1OFTA 3UIEA 1HT2E 4WA7A 2IYWA 3EASA 1L4UA 3QF4B 3THOA 2A5GA 4MKGA 2RGCA 1P2UA 5K8IA 3NHAA 1IY2A 1GSIA 1IJFA 4Q9KA 2WWFA 1X6VA 3AVYA 4RFSA 4JLKA 4Q9LA 3U3OA 3T5GA 1E9AA 3B1WA 3SI7A 4PPFA 2YJTD 1ZM4A 2CLCX 2Q9BA 2XJ9A 4R7ZA 2E87A 2JATA 4A0GA 2ZREA 3CUEF 3Q8XB 4MRPA 3WNDA 1SXJA 3GQBA 4PHHA 4PZZA 4BLRA 3CONA 3EA0A 3TSWA 4A0RA 4CGZA 2F9MA 5H70A 4DCNA 2FZ4A 3TSZA 3I92A 1GRQA 3LX8A 4ON9A 1ZIPA 4JLAA 4NCNA 2D74A 3RS4A 1OFHA 2UKDA 5GADl 1R0YA 3WRYC 4PHFA 1KJWA 4PQYA 3IEVA 1SVSA 4OHYA 3BBPA 4M9SA 4JBYA 5J4HA 2IXFA 3BFKA 5BYKA 1FUUA 4I1UA 3LRPA 1JAHA 4QHSA 2X19A 2ZSFA 3B9PA 3FKSD 2JLXA 2GCOA 1Z83A 4NHOA 3OIWA 4B3GA 2LKDA 1ZJ6A 3UWOA 3MRSA 1KAGA 2OUKA 2R8RA 1W1WA 3AM1A 5TB5A 4TLCA 3PEUA 4LC0A 5GJBA 1R0XA 4LCBA 2ZRDA 2RMKA 3AV0B 2WWYA 2ZJZA 3A1WA 5KSZA 2IC5A 3OFND 4D82A 3FMIA 2FPKA 2O8CB 3A37A 2X2EA 3OEED 5J40A 1Z5ZA 2WAXA 3GLGE 5JRZA 1IXZA 4QHYA 4JBWA 3FFBA 2PBRA 4PAMA 4W5HA 1JECA 3NH9A 3I8XA 3HYTA 3KB2A 1ZCAA 3QXCA 1P62B 4HUQA 5JS7A 5TVKA 3DO6A 3O47A 2QP9X 4P33A 3B9QA 4FCVA 2XNDD 4QM7A 2KJQA 3RRZA 3LH5A 3NXSA 2EU8A 4LJ7A 2HF8A 4EUNA 1X1SA 5IF9A 1XPRA 1CBUA 1TU4A 4P4UA 4TZ0A 4TN1A 2BBTA 4ITRC 2QBYA 4DUGD 1ZD1A 4EPWA 2HT1A 2OXRA 4IFBA 2IF2A 3T35A 1O87A 2GZAA 4IOKA 4LI0A 5G40A 4OQNA 1JAIA 1Y3AA 3AVQA 3GEHA 4AWXA 2W6JD 2DWPA 2C5LA 2YYZA 3A58B 1I4LD 2X77A 5JSZA 1TEVA 1G8HA 1XF9A 2ZUCA 2GKSA 2CNWA 1FL9A 1NIPA 1NY5A 4TL9A 1P60A 5SZKB 3TW4A 1M74A 1OLOA 3E1SA 4FIDA 2RGDA 4Q48A 2YC4C 2WSSA 4TSFA 3VTKA 4DT1A 1HY3A 1M2OB 1NN3A 4CT5A 4MDEA 3BH0A 2ZI5A 5FL3A 5AJXA 3BXZA 1NVXQ 4LJ5A 5DNYB 2QT0A 2ZU6A 2ZS9A 4FMDB 5LD2B 3ZVMA 2O8EA 1Z6GA 1ZNZA 3OEEA 5BQ5A 1CXZA 2FFBA 4DLVA 4TYNA 1E0AA 1QG2A 2ZE7A 4JVSB 5F3WB 2KWIA 5JS8A 2QP4A 1OYYA 1D2MA 4FMCB 4PSKA 3VU9B 1Q3TA 3Q9LA 3TR5A 4IVQA 4F4JA 4RSGA 3RAPR 3VX3A 3LX5A 2CHVA 2V55B 4A2QA 2YWGA 4FW9A 1VIYA 3VFDA 5KNCA 5AJWA 4A1FA 1NBME 4RVCA 2B21A 4BEJA 3HU2A 5HCIA 2PZFA 2Z0MA 3EIHA 3A4LA 2OZEA 3VR2A 2RKOA 4RCYA 2BCJQ 3LVRE 4PO8A 4W5WA 4IDQA 121PA 2FFHA 4QKQA 2H16A 5FOVA 4J0QA 2NZJA 4RKEA 5E95A 2V6JA 2IXGA 2LCFA 3CNNA 1HH4A 3A1VA 2IK8A 1R5OA 2B6HA 2FDCA 4RJLA 4DEXA 4AKIA 3AGPA 1MKYA 3FMFA 1E98A 5AUQA 1G4UR 1RZ3A 3BERA 3NWJA 4D81A 4B3DA 3SJZA 1R2QA 1S0UA 4BLTA 1DEKA 1IOZA 2ZRCA 3AF3A 4DIDA 1IM2A 4JVNA 4HYYA 4TLDA 4K8OA 4DSNA 1G6HA 2JJ2D 4KCGA 2DB3A 2REBA 4TSFD 1V43A 3BOSA 4JBXA 4D26A 2NO6A 2OCAA 1COWD 1NP6A 4R98A 3DZDA 1I4DD 1VMAA 2ZVQX 4EAQA 1E1RA 4N1AA 4WIAA 2FEOA 5HKKA 1CJUC 1OB2A 4DSOA 3QKSB 2IHBA 1RC8A 2ZRLA 2XTZA 1CTQA 2ZYTX 2HCBA 3AB3A 2GEVA 3A36A 2W83A 1T6NA 4JSYA 4V03A 3B1VA 4MGZR 4FWTA 2O8CA 1MR3F 4RCZA 3SZRA 2C9CA 4OK5A 5CJPA 4JLNA 1G7SA 2IWHA 2G1KA 2HXSA 5CIWA 1X8KA 1RPZA 2ORVA 2ZTSA 5TXGA 4CIDA 2YVUA 2ODWA 1B0UA 3L43A 3OIVA 3EA5A 4NYJQ 4M4SA 5FTJA 1XD2A 4D4KA 2C9YA 3FYHA 3U3MA 1TEXA 3T1TA 4LYAA 2EYUA 3CF2A 3K0FB 3ECCA 3GLFA 1XMIA 5AUOB 3ADDA 2JASA 1CS4C 4LJAA 1WBBA 2QORA 5E4FA 5KSYA 4LJ6A 4AG5A 1M1YE 1XTKA 3DMNA 1IY0A 1M7BA 3QKRB 1SVLA 2KBFA 4HAVA 1W0KA 3HWSA 4B2IA 1WBDA 2GJ8A 1CULC 3QIAA 1WXQA 1F2UB 1CJVC 3JVUA 3O8CA 1B23P 2ONJA 2BM1A 3PEVA 1DADA 2L0XA 3TLXA 3U4QB 3R8FA 1S1MA 3OAAD 4DSTA 5A5GA 4MUBA 1W49A 2QY9A 1VCIA 5FBVB 1E79A 4JT4A 2FG5A 4NZYA 4URXR 1SULA 4M21A 2QPAA 4HI0E 3GEEA 4JVMA 1P72A 2VO1A 3AUXA 3K9LA 1H8ED 3T1QA 2QROA 4D0NA 4DLZA 3QG5A 1NN1A 1Z0AA 1T8UA 1LB1B 4O25A 1KGDA 3QG1A 4BFTA 2GHIA 2PT7A 4CT4B 2C98A 3HJNA 2BJWA 4WZ6A 2GBLA 3K9NA 1QHHB 4C30A 3G0HA 4TYQA 1HYQA 2DWQA 1KJZA 2BOVA 2ECKA 4PQFA 3ZDQA 1Z6YA 1E3MA 1C1YA 4BEBA 3ZD6A 5EUMA 3DKPA 1DS6A 4HEJA 2D3WA 1C9KA 1WB9A 4RY2A 1NBMA 3CM0A 3KJEA 4UKDA 3ZZ0A 4PHTA 3EAQA 1RE0A 2D2FA 3FE2A 1TNDA 3MGCA 8OHMA 2PL3A 3AKCA 1E9EA 5JI2E 1JR6A 1DAIA 2O5VA 2ZJAA 2QE7A 3C41J 1JI0A 1M8PA 2Z6VA 2GNOA 2I1QA 2RHDA 1LTQA 2N46A 3K8YA 1EWRA 1R5BA 3K9GA 3D6TB 3IO3A 3CNLA 3BH6A 5AUNB 4KO8A 1E0KA 1LNZA 1DAHA 1OHHA 3IQWA 4ILEA 4KYUA 4XVUA 2WHXA 2I4IA 4BLQA 4DLWA 1W36B 3RHFA 3ZGXA 1G3RA 1AGRA 4AYTA 2JJ1D 3EZ2A 5EP2A 1Z29A 1NLZA 1U81A 1ESMA 2XZOA 1OIXA 5LB4A 4B76A 4R71A 2IX3A 1W4CA 2BDTA 2J0UA 4QM6A 1DAEA 3ND8A 5EQTA 3THWB 4YDSA 1HEIA 1KK0A 2OFXA 1IY1A 1PJRA 4HB0A 4W5JA 2XGJA 3WMGA 3EPHA 3GP8A 1RYFA 2ZR0A 3RS2A 4IEIA 1BYIA 2R6AA 4ASUA 3BD9A 4C3ZA 1KMQA 4LBYA 3GEIA 1S1CA 4URYR 2GK7A 2OCYC 2F43A 3GLHE 1T4GA 521PA 3SJAA 1U90A 2C78A 2BV3A 4EFLA 1KK3A 3LWNA 3EC2A 1YZTA 4RD6A 5FOXA 5SZHB 1LS1A 4KI0A 5LDDC 3CPHA 2IS4A 1VYVA 1MOZA 1SVOA 4JSTA 1XNJA 1Z2CA 3GCGA 2J7PD 1YRAA 4HLDA 2YWEA 3KTAB 1EFCA 3QPWA 2KSQA 5FPYA 1JXMA 5DLQC 1JR3D 2WKQA 1J7KA 1G3MA 5CLQA 1DO0A 2ZI7A 4NKRA 4E09A 3S1AB 2Q9CA 1OKKA 4IJMA 2AXPA 4IKEA 3GLFB 6Q21A 1J8YF 5DYIA 1FQJA 1UEJA 3PCRB 5TY0A 1II8B 4CEIB 2ZETA 4LSGA 4L4UA 1Q21A 2C95A 2VHJA 2IYUA 3WMEA 4QBGB 4QBIA 3NEYA 3GLGB 2W58A 3TUIC 4P4SA 1KI7A 2YV5A 1UBCA 1L4YA 1XEXA 4I99A 1XZPA 2BBSA 5CDFA 2GDJA 4LHZA 2ZI6A 4LDJA 3SE0A 4DLSA 3QE0A 4D80A 4NTZA 2ZS8A 1Z6TA 2IBMA 1UAAA 2NPFA 3PFIA 3CRW1 1H8HD 2QPTA 4KBGA 2ZRMA 1UPTA 3EARA 4Q1CA 3AQ4A 2DBYA 2CCJA 4IVPA 1N6NA 2ZITA 1E2QA 2R9VA 3UKDA 4IVRA 2GK6A 4BASA 3W6NA 2ZIAA 2YHSA 4POAA 1RRFA 4NP6A 3CKLA 3GJ4A 1TTTA 3MMPA 1N3BA 1X3SA 2VSFA 4DEYA 2WJJA 3M1IA 2FE4A 3BC1A 2W00A 4Q9IA 2VYFA 1JQLB 5DSZA 4XIGS 2F55A 4O2RA 621PA 3CZPA 1P4SA 5L3SA 1BMFA 5KDLA 4YMWA 1ZD8A 2IYQA 2IW3A 1W5SA 3EWAA 1W36D 1EX7A 4GP7A 1RFLA 4HAUA 3RABA 1G41A 4ASUD 4GL2A 4G0NA 4CEIA 3U7GA 1IQPA 1JPJA 2WWIA 3K70C 2ZRGA 5KDOA 2FJUA 3B8HA 1CR4A 1QHNA 3CW2A 4DBLC 4UXIA 2GZHA 3LAWA 4JYBA 4DDTA 3FOZA 1N0WA 3SOPA 2WJVA 1S8FA 1P73A 1WF3A 5FR1A 5JECA 1G3UA 2JGNA 4KHZA 3TUZC 4Q4AA 1S4QA 1BS1A 1SKYB 3LBHA 4PTLA 2A5FA 1WDTA 1EFHA 3ZYCA 5L3RA 1HUQA 3WP1B 1YZNA 2ORIA 1GDDA 2OBNA 4B75A 1KO4A 3RLFA 1MRNA 3NBZC 3AKYA 3SJCA 1N6KA 1FX0B 1W4AA 3RRYA 4PC1A 5EP4A 3NKVA 1VCMA 5HTKA 4XD7A 3B2EA 1G7TA 1KDRA 4HSEA 4I4LA 1SXJD 3UATA 3PEYA 1KMHA 2W2TA 4B35A 5F98A 2P2LA 2WM9B 2HCJB 3GLHB 4Q9JA 2IUUA 4II7A 3RC3A 3V4RA 4N0EA 1NMYA 5JHHB 4DCTA 4AIIA 1VG1A 2RGEA 1ZCBA 5DN6A 1D9XA 3IPXA 4C2UA 1UDWA 3RANA 4ZDJA 4MKHA 2VQSA 3T1OA 3CH4B 3C16C 4AYWA 2ZI3A 4WXPA 5CYOA 3HDTA 4TT3D 3VAAA 1LF0A 2ZANA 2WOJA 1N5IA 4DCVA 3BE4A 3U7EB 4PPGA 2CHQA 2RGAA 4CEHB 1T5LA 3FTQA 3Q5EA 3V00A 2VP9A 3MWLA 1QRAA 5K8TA 4NCKA 4OQFA 3ASZA 1TQ6A 4Q4AB 1CR2A 1RKBA 4DLYA 1HV8A 2DHRA 3IHWA 2P5SA 2QTVB 5CJ2A 2CCGA 4YXWA 1Z08A 4LPSA 1E2KA 4UXJA 1Q12A 1FQKA 4H9GA 4C0JA 3HPRA 3DM5A 2VL7A 3ZJYA 2OV2A 4Q4JA 1SQ5A 4M53A 4LRWA 1P7CA 4OI4A 4YQFA 1P2TA 1IXRC 2GESA 2LWIA 2QMOA 3HU3A 3IPYA 2JLYA 5IDVA 3X1WA 1AS2A 4XD7D 5EE1A 4ACBA 2PEYA 3VNUA 1G8YA 3WYFA 3SHFA 1XRJA 4TWZA 2BHRA 4QGFA 5FFMA 2FGKA 4U00A 5TV2A 3W3AA 1A5TA 2OCPA 1G8FA 4HLUA 1GKIA 1U94A 4ARZB 4ZCIA 4JIMA 1CIPA 1Q1EA 1KI1A 3CB4A 3M0EA 2GA8A 4AURA 5JSZB 2R6DA 2V7QD 2GWHA 3UMRA 3RC8A 4TQAA 1ZP6A 3TVDA 1COWA 1TF7A 5CB8A 3H0KA 3SYKA 1NG1A 3TVTA 4Z1MA 1W5TA 2ZRAA 2AXNA 4GPTA 4IDOA 1AQYA 2EFDB 2RGBA 1G1MA 4PAQA 4DIEA 4EFNA 1J99A 1PUIA 4E07A 4EKDA 2F7SA 4ZV4A 1IONA 2OHFA 4A4DA 1F2UA 5EP3A 3ADCA 2O8FA 3W34A 4Q02A 2GF9A 2BMEA 1QHSA 4GZMA 1K6MA 5D3MB 2PJRA 2GXUA 4MGYR 1IN6A 2P65A 5GJCA 4DLUA 5KPDA 2FOLA 1PV4A 2GILA 2BM0A 3I61A 4Y0VA 4Q03A 2ZAMA 5KNDA 4GP6A 5KDDA 1TADA 2HV8A 1QF9A 1II0A 2RGNA 1XJCA 4TLAA 3SYLA 2QA5A 2B8WA 3RRMA 5C4MA 1MABA 3KUCA 1I2DA 3VHLB 4RKFA 2D62A 4HB3A 2VA8A 1FP6A 3U3JA 1VDZA 5FPHA 2CL0X 4JMPA 1QZXA 2B8TA 2XB4A 2ERYA 3REFA 2ERXA 3CNOA 1G4AE 2WJIA 4KV9A 1Q1BA 4A82A 1G9XA 1PUJA 5B57C 4CVNA 1RRCA 4IEEA 2AKAB 3VR6A 1G5RA 5JEDA 3QKSA 2YWHA 3I5XA 4W7SA 1UKEA 3RSLA 1NMZA 2FFAA 4CEJB 4NCIA 2HF9A 4OK6A 1CJTC 1TL7C 3KQUA 3HU1A 3RVBA 4HLCA 1NY6A 1MO3A 1ZU4A 2DFLA 1ODFA 2BMJA 1YZQA 2E1RA 5FUWA 5J4KA 3UMSA 3ZIAA 4B43A 1YZLA 5FUVA 3I1FA 3EZ9A 1XMJA 3THXB 1WP9A 1A4RA 1ZM3A 3AH8A 1NVUQ 1UBFA 3G5UA 4CDGA 2GCPA 4NYMQ 3K0SA 3B6EA 4TTPA 2J3EA 1G5PA 3GFPA 4A92A 1Z06A 821PA 1TUEA 5BN5A 2X2FA 1R5NA 1EFTA 1HT1E 1E2DA 1NSFA 3QQ5A 5JZVA 5EJEA 1QBKC 1J70A 2O8BB 5JEEA 4KSCA 1KKMA 1SHKA 1US8B 2JLSA 2REOA 3SU8A 1TF2A 1OPXA 3VNVA 3F8TA 1FMJA 2FMXA 4A8JB 1TU3A 2GTPA 2WPDD 2WV9A 2QAGC 2O52A 3TJZA 2ZYUX 4CEHA 4C0AC 3E70C 3C8UA 4N0DA 2O0KA 2NPIA 3QBVA 4OI0A 3FHCB 3GJ6A 1ZM2A 1YHNA 1TF5A 1E9BA 2PMKA 4JLPA 5KUTA 1E2NA 2ZM5A 4V0ME 3AVXA 2IA5A 2ORWA 1ELOA 3NBXX 3FMOB 5DHAA 1E6CA 1JQJC 2IF0A 5DO9A 4QG7A 2W2VA 3RYTC 3B1ZA 4HAZA 5FR2A 5BN3A 4V0KA 3LW8A 5LBIA 2JJ8A 3TRFA 2ZSAA 3M4YA 5M04A 1E9RA 2Q0HA 2YNMA 1XEWY 4TMZA 1JR3E 1Q57A 3BFVA 1L7VC 2ZJ2A 1GFIA 1KSGA 3A1SA 3T1VA 1NN5A 1EFUA 2X1VA 5B30A 3QY0A 3FHOA 4QRHA 1JEDA 3KKPA 4Q5IA 2PLFA 2J87A 1Z0KA 2QAGB 2J45A 2ODNA 5KOYA 1Q3HA 4BLPA 4OBEA 3TAHA 3CRRA 2ANBA 2IUTA 4U02A 4UNPA 5AR1A 5B64A 4PC3A 4FCWA 3IIJA 2R65A 3AP3A 3SEAA 1JJVA 1IJEA 1F60A 1Z22A 4A2WA 2MMGA 1HQYE 1U8ZA 3LO5A 4EIWA 2PEZA 4LHWA 4B3BA 4LBZA 5FTKA 3AVOA 2XTNA 3MSXA 2DYKA 1LS6A 3CR8A 5E7JA 2ASEA 2FZLA 4EJSC 2QGNA 3VKHA 4P31A 3IDQA 3I4LA 1G8PA 1YR9A 3DVLA 3NDBB 2VP6A 2IWRA 4F4CA 1FTSA 1ZC3A 1CP2A 3ZZTA 4ZKDA 4MITA 2AD1A 1MO6A 3C14C 3FGNA 3A4NA 4OK3A 3U3RA 2LKCA 2PJZA 2PCJA 4Q1BA 1UEIA 2O8EB 1E4VA 1P6XA 2YOGA 4KODA 3L82B 4RD0A 1XPOA 4DC9A 2FFQA 4KJZA 1ANKA 1QHYA 2GCOB 4IOLA 3BK7A 1NLFA 4OI2A 5EXPA 1S3SA 1XMSA 4JKIA 4V0LA 2Q6TA 4GMXA 2IEYA 1E9SA 3KDSE 4QHTA 3QKRA 3WHLA 1YZKA 3WNCA 4ESHA 5JHGB 3QPUA 1E0SA 4HZIA 2FEMA 2FWRA 5J5CA 2NZ8A 4D4MA 1G20E 1Z2AA 2ZYVX 3KJGA 2B7BA 4PANA 4OQLA 1Q20A 3RS0A 1E9DA 2FH5B 1XXHB 5FOWA 1CR1A 4HDCA 1R8SA 2ZQ5A 4QBFA 1GITA 1E0JA 5ELXA 4PHGA 4CZ2A 4ZO4A 4IDHA 1ZMXA 3T34A 5J4VA 3K0CA 1S9DA 2OO7A 4JL6A 1HQCA 3O8DA 1MV5A 1XWIA 4JLVA 4DHEA 4LYFA 2FU5C 3VHXA 4UJ3A 5IRCD 2XX3A 2XOKA 1OYWA 3B7GA 3QPVA 4M22A 3F0TA 3UPUA 2XNSA 4UJ5A 2QPOA 1OSNA 1ZIOA 1FNNA 3ASYA 1DO2A 1G7RA 1XTIA 4GFDA 4MA4A 4MKFA 4EJSB 1PVOA 4G5GA 4OKSA 1GILA 2WAYA 2QGZA 3W8NA 1EESA 3U44B 3ZD7A 2Z43A 3PUVA 4MQBA 1ZNYA 4S35A 3KKMA 3D31A 3LXRA 2VHCA 1N5LA 2GJKA 1NJFA 3RSOA 5JCPA 3RS5A 2R6FA 2WPDA 1ZINA 3HP1A 4D2IA 1OFUX 2ZJ5A 3PEWA 4IDPA 4Q01A 5C46F 1SXJB 1BKDR 4TLBA 2R62A 4KLZA 2B7CA 1TUIA 1YR6A 3H1TA 3TQCA 4HAWA 5SZIA 4D0LB 3KQHA 1G19A 2A5JA 3GLGA 2QL6A 1KO8A 3SN6A 1KAOA 4WZAE 2ATVA 3FWYA 4JLOA 2PT5A 4TYPA 4BFYA 2W6ID 3FKQA 1XDBA 4JL5A 4HB4A 4ZCLA 3RWMB 3WNBA 3KQNA 2PH1A 1KDOA 1Q44A 1O3YA 4PZLA 1CRQA 4O3MA 4C4PA 1W7AA 4AI6A 5EE0A 1N2CE 2CBZA 2C99A 1ETUA 3B13B 1YKSA 4M1MA 1F2TB 2NO9A 1WCV1 3K0AA 4X8LA 2GVZC 3TUJC 1GL6A 2RCNA 2ZRPA 5KO2A 3WBJA 3QOFA 3GLIB 1AN0A 4BFXA 1J2JA 1LV7A 3I3SR 3I73A 2G83A 4DRZA 1X1RA 4UNQA 4IXNA 4FMBB 3THWA 1IN8A 1Z3IX 4BGDA 3REGA 3QKTA 3U44A 4RFVA 3TR0A 2ZE6A 2DPXA 3R20A 2QMUA 2ZRFA 1FOEB 4WXRA 4C9BA 1DOAA 2QN6A 3HYRA 2EFGA 4MYHA 4BQSA 3K1JA 2PLRA 2WSSD 1OKKD 3CIOA 1Q1QA 4LV5B 3TW8B 2FSGA 4C0SA 2F1RA 5AJVB 2CJWB 3ZS9A 4AD8A 3AGQA 3LLUA 5HE9A 2ATXA 2OAQ1 5GVSA 2FSIA 2D2EA 2NMVA 4I1OA 1UKZA 2QM8A 2AK2A 5JJIA 4OQMA 2P67A 4US0R 3VKWA 4X8MA 5HR5A 1OV4A 3EZ7A 4Q7JB 3U61B 4QGGA 5UKDA 2AFHE 5HPYB 2P5TB 4MKIA 1PLKA 5L8VA 3DM9B 5C2JB 3ONWA 2KI5A 1CRPA 1E2GA 3H2YA 1KSJA 3CX7A 3X2SA 3KL4A 2A3RA 4TQ9A 2AWNA 4X8HA 4G5RA 2D06A 3GJ0A 3B1YA 3QSYA 2BMFA 1N6IA 1AK2A 2REXB 3LD9A 3WY9A 1F6BA 4JLMA 1G291 2QSZA 3T06B 3KJHA 1KNQA 2DR3A 3P4YA 3MFYA 2AD5A 4HZUA 4K81B 4MRNA 2H5EA 5FOSA 3X1ZA 5CDFE 3HPQA 3DEFA 3T15A 2H17A 4R2HA 1EWQA 1Z07A 1UKVY 4PPNA 1YQTA 4QXAA 1TAGA 4EFMA 4KFRA 1U99A 1GL7A 2F1IA 1ZW6A 2CL6X 2FX3A 1I2MA 3B1XA 4FCTA 4WAUA 5GVRA 4B2LA 2EVWX 3LLMA 4G3XA 5JJLA 4Z8XA 1N6LA 4B3CA 3HR8A 2OBMA 2OILA 2IYYA 1E2HA 4JT2A 5JWHA 4US2R 2C8VA 1SVMA 1KK1A 5FPTA 3ZIAD 3CRQA 1UDXA 3EPLA 5AK0A 1T0JB 2IYZA 3N2IA 5K8UA 3A6PC 1CF4A 1XTJA 2PZGA 1QHGA 1NVVR 2JA1A 3VKGA 1VCOA 4OQXA 3RWOA 2XZPA 1GNPA 3OEHD 3AF0A 5KHOC 3DKVA 3GLFE 2OFOA 2Q3FA 4QNMA 4K46A 4L16A 5D3MA 3UK6A 3T12A 1VECA 421PA 5BYJA 4Q1AA 2CVFA 4P32A 4UNRA 1GTVA 1H8HA 2DFKB 3I8SA 1N25A 1W4RA 1AA9A 1BYUA 5EE3A 2QP3A 1MT0A 4HB2A 1T3LA 3UWKA 1TPZA 1XJQA 2G9NA 4QL3A 5F2EA 5EE9A 1EK0A 5HCNA 1CU1A 1JXOA 1SHZA 2O0HA 5KTYA 4QJ3A 1AS0A 4BLOA 1NVWQ 4MYCA 1GM5A 1MRSA 1XD2B 3LQRA 2IYRA 5FL7D 4M1WA 1W0JA 2ONKA 2A30A 1XPUA 2BBWA 1KZGB 3F3YA 2HDNB 3IBGA 1M7GA 4HAXA 3A8TA 1CR0A 5G3YA 4D6PA 1JJ7A 1VTKA 3DDCA 2MSEB 1D2EA 1KOFA 1MO5A 1UJ2A 3D7MA 4PZYA 1LVGA 2ZVPX 1X86B 2Q3HA 3C7KA 3VQTA 1W44A 5EZ5A 5C18A 1A1VA 2H57A 3W9YA 4RZ2A 3THYA 2JLUA 4XTCS 1DBSA 1TQDA 2ZYWX 3R7WA 4OI1A 2QG6A 4PSAA 2IS2A 2F9LA 3PUZA 2DFTA 2BKEA 2ZJBA 2JAQA 4MDFA 3KQKA 4LHXA 1R7RA 3L0OA 2F1HA 4FINA 1NL3A 4RZUA 3CBQA 4A15A 3AP1A 3KKOA 1DARA 1A2KC 1U98A 1OJLA 3U2QA 2V1XA 1XX6A 3EG5A 1DG1G 2CCKA 3QKUA 4BFSA 2V8OA 1CKEA 2IYLD 4BFVA 2K5UA 3TSOA 4M1KA 4DZZA 3AVPA 2FGJA 1SVKA 3CPJB 4KAXA 5AJZA 1UBEA 3QF7A 1JEEA 1RJ9B 5L3VA 4M1TA 3W8RA 3ZVNA 4B73A 2WVJA 3PUWA 2AFIE 1P2VA 5BXQC 4Y0AA 4HATA 1GNRA 1CLUA 4DJTA 4A0HA 3N5CA 4M1OA 4MRVA 4TMVA 1XTQA 5EUQB 2VP4A 3LVQE 1MH1A 2I1VB 2WMNB 2XSZD 4B3FX 4G5SA 2XITA 1GOTA 2H8KA 4QBHA 2OFWA 4LX0A 4QOSA 2WMOB 1XCGB 3KXLA 3NBYC 4TMWA 1CJKC 4US1R 3S1AA 5B58C 3PR1A 2WBLC 3BB4A 3OIYA 2ZXUA 1MABB 2IYTA 3JVVA 1VPLA 4NONA 2NO0A 4TL6A 5P21A 1SGWA 1WMSA 4RFSB 5F9HA 1YJ5A 2A9KA 4AKEA 2F3RA 3AVVA 4GBMA 4GDFA 3EZ6A 2ZJYA 3L0IB 4FN5A 2J0SA 3W5JA 4PQRA 3PJRA 3SQXA 2Q3MA 1RW4A 4LZZA 2WJYA 3QEJA 1Z0IA
chains in the Genus database with same CATH superfamily
1PQYA 1GU7A 1KZ7B 1Q1GA 1B2RA 1W6UA 2XYHA 3G23A 3L8EA 4JJGA 2QAGA 3ORFA 2AG1A 4A91A 4B6EA 4EGAA 3QELA 1CEYA 4Q82A 5EKXA 4RHUA 4GOXA 1E3SA 2P4SA 3DLCA 3KYJB 5BV0A 2ZB4A 3CPEA 4FXPA 5GJVC 5JAZA 3GRYA 1IRIA 3ESDA 2D7JA 3MWYW 4M1YA 2R87A 2YINC 3T7AA 3UJ3X 1PSWA 1JBQA 4ALKA 1M6WA 1YA4A 5BN3B 1M9NA 1SCUA 1ZUNB 2VHQA 3JQBC 3QY9A 1G6Q1 3EG9B 2VYVA 4XIIA 5TMBA 2JG3A 1AKRA 3GJTA 3JQAB 3CZ9A 3P9CA 3R0VA 1M2OA 3R9IA 3DLBA 1U1FA 2HSGA 4DT1B 3SZLA 3CLUC 1W5EA 4RORA 3C3JA 3H8SA 5FWYB 1XVTA 1DRUA 2C77A 3D8BA 3IMEA 3Q40A 2O3TA 3DWEX 4K6KA 4U2GA 5DH9A 2DWCA 2R60A 3GRRA 2CF5A 3P9ZA 1R64A 2M32A 1G21E 3Q3HA 1JR3A 3GU3A 1D9ZA 3K35A 4P4LA 5FADA 2XW6A 2XLBA 3SF0A 4DTCA 3O3MB 5ADHA 2QKYA 3ANYB 3MW8A 4LBWA 2C04A 1NVKA 1A97A 2FN4A 2II6A 2R7KA 3DC2A 3ES9A 4ND5A 5C1DA 2FWJA 3OLXA 1LSSA 4CM9A 1RXWA 2X7XA 1R4NA 4JGBA 1WEKA 3ZV3A 1Q84A 3BREA 3C39A 4RMHA 5KSPA 3RSZA 3FCUB 5BSMA 3GDOA 3SHOA 1OXSC 4TQUS 3ZGVA 3ZLUA 4HNGA 3ICWA 5LYJF 4GWLA 2WZQA 5BW6B 1Y1KE 1XPJA 2QM7A 3IR7A 4N6GA 4AZVA 4L4RA 3K09C 3SHVA 1USUA 1SOWA 3WWDA 1QFZA 4BQQA 5FB3A 2VTBA 1WUTA 3AEKB 3MHTA 2EC5A 3I9V1 2EW8A 2FZWA 4GYYA 5IT0A 1QV6A 2YUIA 3DXXA 5KYWB 2AA3A 2OXTA 5F2OA 5CJJA 1RZUA 3DLPX 5FDFA 1ZC4A 2VDUE 1K75A 3NFYA 3MMZA 3N6VA 4J29A 2EHJA 3AM3A 1EJ6A 1NJ8A 5A6SA 1JH9A 3QI7A 3UANA 3U9LA 1NJ2A 3IAHA 4BWYA 1F2TA 4R8RA 3RB8A 3EGEA 2GPBA 3LXUX 3Q3GE 2DH6A 2Z2JA 1ADBA 4KW7A 5EXEA 1JP7A 4WEQA 2J5BA 4M0MA 2J6IA 5AM3A 3EMKA 4BFLA 3GJQA 1Q0TA 3EW9A 5ESXA 3WL3A 5AKGA 4ZYTA 4BLUA 4HRAA 3TTWA 4GIBA 1YACA 4B4KA 2CEAA 2BKVA 4FT4A 2INGX 4NEQA 1Q19A 1XEWX 1Z8HA 5TQ2B 2D0DA 4GWKA 2NQTA 3H4MA 1UMDB 1YFKA 4HUJA 2GJSA 2H9IA 3E9QA 1Q50A 4Y1EA 5SYNA 4CW7A 2EWVA 2PCLA 4M54A 2XF2A 5EJMA 4DILA 5KQSA 4J0IA 2Q21A 4M7WA 3GFQA 1G7CA 1H2HA 2PA3A 2VR1A 4JLJA 3C24A 2WKPA 2ZYDA 3ZE0B 3G1TA 3HCPA 3QXJA 4MO2A 4OA5A 5TARA 1SVNA 4D9GA 2MWMA 3CCFA 2J3DA 2E5LB 3CO0S 4HNHA 5HOEA 2QZZA 1XCOA 4CM4A 4I5EA 3DCNA 1A04A 4EWLA 4YRKA 3INRA 3WGKA 3PICA 1ABFA 4FDAA 1MO4A 1NJGA 2HA5A 4IINA 2P6MA 4CKWA 3K9QO 1V2HE 2P5YA 2C96A 1OC2A 4W7HA 3LQQA 5K09A 4HVLA 4DV7B 3AQIA 4I08A 1DWQA 1RHUA 4ND4A 1K92A 2AX4A 3ND7A 4TL7A 4YPFA 4C0HA 2E4VA 3QWBA 5CCEA 2IEDA 1BIFA 5KTNA 3IIMA 4Q7LA 5DYWA 4B84A 5E3HA 1PFYA 3R5HA 1QQBA 1P31A 3W90A 10MHA 5DXFA 3G0IA 2UYHA 1QHIA 1A9QA 1CYEA 4LVOA 1TMOA 2NG1A 4PLVA 3ZDYB 1KU6A 1OLSB 1UBGA 1A8QA 2Q8NA 4Y3UA 4AZSA 5BRJA 5LQNA 4JXZA 1SWWA 1K1EA 1UPUA 2CMKA 2QW1A 1HURA 5DISB 3TFQA 5AVUA 1N57A 1VL1A 2JLWA 4RY0A 1YRBA 2N42A 4URUR 1BE8A 1GHTA 1F7VA 2E37A 3RYCB 3A1UA 4MIOA 4PINA 4EI2A 4DV2B 5B7QA 3GUVA 3UHFA 3GH1A 5BUSA 2IS6A 1PDOA 1OH7A 4ZCMA 4G0WA 4MDHA 3CCBA 4BFCA 1S8NA 3HCRA 4TPKA 1VLZA 1X1CA 2IITA 3BPSA 3A6HA 4IICA 1NVMB 1RXEA 3PXCX 4MULA 3RG2A 3IVXA 4XGQA 4ZQHA 5BNIA 2OCLA 2Z6AA 4XWTA 1XD9A 2ZXFA 1U5BA 3DL0A 1NXOA 3PG5A 2VSQA 3V2HA 1XQXA 4AS3A 4D96A 3H5RA 5IWCA 3C3EA 4KOEC 1EP9A 2JEYA 4JKYA 4EPTA 2QRZA 1N2GA 5CB4A 3WB9A 4BFUA 2ONCA 3WIBA 1K98A 5KS2A 2XIQA 1UODA 2VPYA 2PRKA 4BNYA 4Q37A 2IZ1A 2QX8A 2ZUDA 4MRRA 4V24A 2BGTA 1CE8B 3GJXC 5I3CA 4H15A 1KK2A 1RYHA 1A9YA 4V38A 2ATIA 4ZT7A 1JSRA 3K70B 1N3LA 2NNWB 4YC7A 4BRWA 1RQNA 3I12A 3EEYA 4XOIA 4G01B 4X95A 3MCWA 4Z4QA 3GMTA 3W6PA 2WJPA 1P3JA 2I66A 2OY0A 2YMQA 4QTYA 4TYMA 4IQ8A 4C07A 1ND5A 3T0GA 2QN1A 3RFUA 1AURA 1UJNA 3COZA 3WK4A 2OHIA 2YV4A 2PKQP 2R84A 3QPAA 4AP9A 1ENYA 4I8IA 3AF5A 3QLVC 4QQRA 5JDCA 2HUNA 1ZH6A 4WW0A 5EXSA 2O4CA 3L8HA 4URHA 1WDMA 3LQ2A 1KI6A 4A6DA 4KE9A 2RHMA 4NY1A 4H0NA 4BV2A 4QEZA 4ND6A 2GF0A 3KC2A 1KEWA 3P9QA 3CINA 4R9UC 3DMTC 1R8QA 4OHCA 3ROPA 3TINA 3ILSA 1U1IA 1NM5C 3HZHA 1GRCA 1I32A 3KB8A 2BEKA 3LYLA 3DP7A 3PUYA 4NBLA 1YI1A 4X6XA 3BWVA 1DXYA 3HMKA 4LOKA 2CW5A 1GT6A 3ICCA 3KOWA 3N75A 2IEBA 2IXAA 3A4YA 4M55A 3TLGA 4A7PA 4AWBA 1H4SA 3DFUA 4OTZA 2P3QA 4IRMA 3SEFA 5C1BA 2AEEA 4CTJA 4ZK6A 5IAOA 1W4BA 2EJWA 1FXWF 5KMGA 1WHSA 3EMDA 5AHOA 3E5RA 1GNTA 1XZQA 2D1YA 2Q28A 4NPCA 3SNHA 4GBGA 1XD8A 5H9VA 5H80A 2PMDA 4EM6A 3DOHA 1UJ5A 2BEUB 2DTDA 4BVJA 2WKWA 3KLNA 2QBYB 1T9DA 2LV8A 1DXOA 1LDBA 1SC3A 2UYCA 4NEGA 5AUPB 2HBQA 1Z33A 3FAKA 4CM8A 4WLVA 1V39A 4RA6A 3SE7A 3I6ZA 4JP2A 1LLDA 1YBAA 4G1UC 3TB6A 2CJFA 1B73A 2A3NA 3R1IA 4KNWA 4FFOA 3IYLW 7REQA 1XV5A 3ADKA 2C58A 2B4TO 1EFRA 1VXOA 3CEPB 4PYMA 4UU8A 5F33A 3HNOA 1UC8A 4AMGA 4QT4A 1NR5A 1Y8RA 2FPMA 3NR2A 1EFKA 4ARCA 7GPBA 4ALLA 1ZA1A 1QG4A 4XFKA 3FPGA 1PWHA 1KDVA 1KL7A 4DR6B 2VXOA 2YHAA 5BWNA 4RVUA 1E4OA 5CT6A 3TIIA 4JJAA 1S2DA 3E81A 4D0GA 5A9SA 4ADSG 4BRSA 4TN5A 4TTTS 4FYPA 2Z4RA 3KR1A 3TIFA 3KQTA 1N6PA 3NH6A 4KK3A 4X6LA 4F1WA 3ONVA 5B1EA 2EAUA 3WRXC 2ZJ8A 1UBNA 3DV0B 3WYGA 1OWPA 3V33A 3PP8A 3RAJA 4BY9E 2Y05A 1YXMA 3HKCA 4HNQA 3UCXA 3W2EA 4C0BA 2ZUWA 5BUCA 1X3LA 1DZ3A 4GKVA 4WBSA 2ZSEA 1FSFA 3CNQS 3TBKA 4NZPA 1PSDA 4PO1A 1EEXB 5FTNA 3ESXA 1T26A 3GMSA 3NBFA 3CF6R 2YBEA 1NQTA 4RKWA 2QZ4A 4IW3B 1CNEA 1C9YA 1Z0FA 1R9GA 2YN4A 3RS7A 2VF2A 3PHGA 2FRVA 4NBVA 2WM2A 3RYFA 3WB0A 4AO8A 1Y6JA 4C14A 3D6UA 3L9WA 4B71A 4D6XA 3N6RA 3MYYA 4FOSA 3X3HA 4F7DA 1QMGA 3KL2A 2FNAA 1Z0SA 3CZRA 5BV2P 2NYAA 2R1VA 1KEZA 2AWOA 1U8YA 1H93A 5C80A 2GEUA 4GKBA 1DELA 2P90A 4XJXA 2EW1A 4DBVO 2VPWA 4L5JA 5E4TA 4MLZA 5CEEA 5K01A 1KTVA 4MPTA 2GEFA 5DLEA 16PKA 1CWUA 1XOIA 2F43B 2FPPB 3JRNA 1UM9A 4DB2A 1GPYA 1L4HA 2GO1A 1KZ1A 3CUSA 3GRVA 3MN1A 4MWSA 3KHUA 1MFPA 1V1RB 2AJCA 1U0HC 2RHBA 4HWTA 3OOEA 1GG2A 1Z28A 1ZIXA 2VSYA 4N9QA 2AXQA 3WYCA 2OMKA 2RK3A 1N9KA 2WU0A 2HOQA 3ZDEA 2ZB3A 1U4NA 4PC6A 2IGBA 3HP4A 4YJKA 3I39X 5J2UF 2OZLB 5LDGA 1NVTA 3G2NA 2YASA 3ZIDA 4YDHB 3QVUA 3AFGA 4WINA 5EJ6A 1I0IA 1E20A 4V1CA 1K8XB 1G21B 1NBEA 3V32A 1YL6A 4M8NE 1H1LB 3AEUB 1XTRA 1GV1A 3MS7A 4F5WA 2H48A 2NIPA 5HDQA 4EKEA 5AW5A 4Q9HA 3TG8A 2JFQA 2GRUA 3DOFA 2X1HA 1DVRA 3EWSA 3LP6A 2AG6A 2WIAA 5DBGA 2WSIA 4QOFA 4LK2A 3UMGA 3P71T 1NOIA 4ZK2A 3UTDA 3AY7A 1KJNA 2AN4A 5HX7A 4GPD1 1T36B 3BFJA 3NUQA 3VC1A 3CF4A 1ND6A 1S2MA 1U3UA 4I9HA 3H5AA 1WUKS 3NDRA 3GUCA 1QYIA 2AK3A 2CXTA 3CLRC 4JJ6A 4KKVA 5ER6A 1U0FA 3TIGA 1WMEA 4CI0B 4DA6A 3L40A 5HIMA 1QQ6A 3BTVA 2ZEJA 3DO5A 4CLOB 1AK1A 1QOPB 2VH2A 3NVKI 2ZTVA 5BMVB 3KB1A 5T8KC 1GDHA 2HSWA 1JDZA 3NVAA 2M98A 3G7UA 1COZA 3COJA 1X8JA 4FSDA 2QYHA 1YC2A 3OY2A 3CUWA 2PSHA 1JIJA 5LZ4A 3GJ8A 1ONSA 1AMUA 1WCWA 3KB6A 4K2AA 2OT3B 2XUDA 4A2CA 2UZIR 4YMSA 3EFBA 1E1QD 1J5XA 4P82A 3NWPA 4NE9A 5TGTA 4KLCA 3ZKWA 4F5EA 3IH5A 4NJEB 2XVZA 4QPCA 5K20A 2Q27A 1YO6A 3K09A 4XR9A 4NFYA 1X15A 1LC0A 2CEKA 1V35A 3IQXA 4PZCA 5G41A 5JMOA 2XE4A 2V4ZA 3LDUA 2A58A 5CURA 3N70A 5GGXA 1KAEA 3ROQA 3SC2A 4RPGA 5JQWA 5K8LA 2YZ2A 1O1YA 4U9HS 1KJJA 1EVKA 4MUIA 2ZAIA 4KQ2A 3UJBA 1QDEA 3ZTTA 4YWHA 3LF2A 1K63A 1N0HA 3LL4A 1Z0UA 2YWFA 4UXHA 3B3AA 2DECA 4LQDA 4XWGA 1W59A 4YQZA 4MZDA 3ACBA 1M2NA 5TMPA 3SFZA 1Y4AE 5T3YA 3WLNA 1TVKA 2I3BA 1E5LA 2KYRA 3QEMB 4LDNA 3PPYA 2NTYC 4MHTA 1KI2A 3Q5DA 1GKKA 4O59O 4PX2A 2Q5QA 3LCJA 4Z0PA 4RK1A 3EF1A 5JXHA 1OXBB 3K20A 4UFNA 3WNZA 5J47A 1V16A 4KYIB 2QU8A 3T7DA 1H2BA 1PEAA 2WG1A 4LE2A 4O6VA 4H1WA 4KPYA 1E6LA 1PF7E 4Z54A 2ZPTX 3BB3A 2E2WA 1N9ZA 1V3TA 1XRPA 3MJHA 4KFSA 3R7WB 5FTLA 3JS5A 1PLLA 4FFVA 4TL8A 4V02A 1YKGA 3VNRA 5IDXA 1VHQA 4QNNA 3CLVA 5CYPA 3U7FB 1I3NA 4TKUB 3AHFA 3STHA 3NVMB 2ODAA 4MGHA 4UE3S 2MSWA 4UUAA 3N2EA 3MS2A 3A04A 5CRIA 3AEQA 3PUXA 3BTOA 3UJNA 1G5QA 4JYCA 1AS3A 2G67A 1X8LA 5K3CA 2QTFA 1SCKA 2ZRKA 4IZOA 3V4LA 2AMFA 4OXXA 5BWBA 1ZNXA 5HJ7A 4KH1A 1BKSB 1L3IA 2QEQA 3P7MA 2Y1OA 4QASA 5H9WA 1TT5B 5FBQB 1UQTA 3T5BA 2I6QA 4JQOA 3OF5A 4AICA 1QFSA 3ORSA 2W90A 3C4JA 4K9SA 5F4BA 1H5UA 3NPAA 1NAHA 3U39A 1XZKA 1U7ZA 1Y9DA 3CB2A 2REQB 3DTYA 4NCHA 1V9SA 5DCLA 5FHQA 5IVPA 2ZSJA 2GGSA 4O2LA 3SC3A 1A7KA 4J0KA 1QNLA 4PWZA 4UVGA 3DHWC 3ABSB 3WXMA 1KYIA 1C7RA 3PYMA 5A2QA 2GKOA 1AKEA 2IYSA 2H92A 4JENA 4AYXA 4ER3A 4RMJA 4OQPA 4HP8A 1UZMA 1OF1A 5EZ6B 4FEAA 4A2PA 2IOFA 4CLHA 4XH9B 2AH5A 5HUHA 3W3AD 1U9JA 2JIRA 1UDAA 4Z51A 2X4DA 2EG5A 3TW8A 1VA4A 3DO8A 1X39A 2VT6A 2A0WA 3CLTC 4RV4A 4KQXA 3LE8A 4DIUA 1YOVA 2R6HA 3K53A 1ECFA 2CHFA 1Z2OX 4EHNA 5G3ZA 3EPJA 1BDIA 1HLGA 2CXOA 3B85A 3IBFA 3RSCA 1TJ5A 3A9VA 4C5AA 2P0YA 5J4LA 2O8DA 3LFTA 5HKAA 2FETA 2HIAA 2XADA 5DW3A 4S12A 3MTGA 1NHGA 4W5RA 1H2XA 5DN6D 4G9EA 2WJHA 4H1UA 4U5XA 3WLLA 5A4KA 3QJYA 4X66B 1N34B 2RAPA 3O5AA 2GEBA 3FNIA 1L8QA 5E4JA 3FVQA 4G0PA 1IJKA 2FP4A 2WHEA 3D6VA 4ZYYA 4ND2A 1EGMB 1GNLA 3LW7A 1SB8A 1EWYA 1J2TA 2BHTA 3BRWD 1C30B 1XRQA 5DP2A 5AOCA 2F8TA 3B5JA 3ONFA 2LTAA 4EEKA 3U7JA 1QDLB 1HDIA 1E1CB 1JKFA 1LA2A 4KQKA 3KT6A 4RV5A 3ZLBA 1G17A 3M6AA 1KGSA 2X5OA 2XYGA 4Q4JB 3ILVA 1DOHA 4H6XA 3OJCA 4FKBA 4ML3A 1VL6A 5HYVA 2E49A 3K9HA 2JFPA 5I9IA 5JNTA 2XMPA 3RQSA 1BXGA 2WDPA 1YCGA 5JFGA 2NZYA 5L3QA 3PRJA 2HF7A 1BHQ1 2QZPA 3HLKA 4CDRA 2WJWA 2VLBA 3RREA 4R0VA 1M1ZA 5KYKA 3L6UA 4TTVA 1U8TA 4O2AA 1L3BA 1YU9A 1ZH2A 3H65A 3EVTA 2EFEB 2B35A 2GNPA 5JJBA 5JMTA 2O8BA 5DHRA 4A0FA 3D0OA 1I0LA 1OZHA 3TSCA 4DQVA 4DMCA 3KOUA 1ZZGA 3IDOA 1YOVB 4YCDA 1Z6PA 3IJEB 4E2FA 3QRWA 1E18A 5L95A 4UHHA 3SVZA 1J0CA 2W4IA 3I01M 4J1QA 4Q1EA 3SKXA 2UZ3A 2XSZA 4YRBA 3C1UA 3LT5A 3P5BA 3X1XA 3ZCSA 2DTEA 5KTRA 1KY2A 1LV8A 3MT0A 3DE2X 4YMVA 4MS4A 1SQ6A 3WZMA 1QBGA 4JZYA 3D0QA 4KIWA 3SZUA 4MSUA 4NU6A 3NYWA 2QR3A 1XAIA 2FSFA 3GB9A 5IARA 1GT91 4YACA 3ZV7A 2JJMA 3OU7A 4C43A 4GI3A 2HEIA 4W5QA 4JJ4A 3BGDA 1XBTA 2HRZA 2BEWB 4C6TB 4OL9A 1U6JA 2H5JA 1MB9A 1E4YA 4RSMA 3RC2A 4HGQA 4JLDA 1UFQA 4A8JC 4RDHA 4NZ9A 3ICEA 1KHTA 2CZGA 1G64A 5IK2A 4AULA 4QXPA 1CEEA 2AJTA 2ZAOA 5JS1A 4NSNA 1AY0A 3A25A 4CMKA 1IXSB 4I2VA 2WK1A 4GT1A 5K7SA 2JIDA 1WEHA 1CE8A 3LY5A 3H5TA 5F3RA 4HDQB 1JKJB 2SKEA 2CHGA 1RE1A 1NKTA 1SBTA 1ZAKA 1N92A 3DBLA 1N8NA 1E7MA 1ONBA 4IIJF 3VR1A 3QEAZ 1N6RA 1ZR4A 3P94A 4QJ5A 5E8JA 4CM9D 3HBLA 1J0AA 4HDOB 4RKRA 4AUMA 2SKCA 1RC0A 4WOPA 3I32A 2JFYA 1NF2A 1OILA 3TLEA 3I05A 3DR5A 3CGWA 1P61B 1ZUHA 2NZWA 2HI0A 4GNRA 4XWYA 4OX9B 4YMTA 2DLDA 2GF2A 2QLFA 4I6GA 3U4QA 3IV9A 4PZPA 5LQJA 2DUWA 2ZI9A 1ODJA 3PC6A 1GPBA 2GK3A 3KFXA 2VP0A 2GFIA 3JV7A 1E92A 1NFRA 1QVRA 1KI6B 2NU7B 1KETA 1VKJA 2BUCA 1PJAA 2O2HA 3CLUD 3EGDA 3GEPA 4TZTA 4CLRA 1WB6A 3VYTB 4RS3A 5L3SB 4U7DA 1A77A 2HLDA 4IH4A 2PGXA 3U26A 1QYDA 4DR4B 3RCBA 2EEZA 2KLHA 3LPAA 2AOTA 3NIDB 1DTSA 1XFAA 1YCHA 3V9PA 2L2QA 2GD1O 2OB2A 2BIFA 2QRLA 1ID1A 4M0LA 3AUYA 1BGWA 1N6OA 1U2DA 3VAZA 3ABQB 3M8KA 3R5KA 4ZCRA 3EIQA 4QOIA 1I3MA 3T7TA 1LBTA 5DXAA 1YQGA 2ZWPA 4BMVA 2ZYRA 3KAQA 3C2QA 3TAUA 2ZIUB 8ADHA 4MWCA 1GTL1 1WUYA 1EBUA 2QL7A 2V3VA 5DM60 3CN9A 4AW9A 2RDMA 1PFUA 1UWVA 3EDMA 3KZ1E 3RRXA 5HF5A 4DQ0A 1JDTA 2Q6VA 4H08A 4ZQGA 1L5HA 1B0ZA 4YCMA 4WVFA 4HEQA 3EF0A 3AJRA 4HAYA 3DPUA 4EBBA 2VK1A 3HY3A 4H6WA 5JALA 2UVPA 5K6RA 1Y37A 1NW4A 5JNLA 5TT0A 1LTKA 2J0VA 4MYSA 2JAXA 4IFEA 4RH3A 3STUA 2K4MA 4PGMA 2ODBA 4L5BA 4QYMA 1R37A 3FR7A 3PLAE 1IWOA 3QVVA 4YLYA 2FDRA 5JZBA 1YKFA 1P1IA 4NFLA 3H8JA 1NE2A 2HRRA 5JG7A 1EB8A 4BO2A 3MZ0A 4JI5B 2V3CC 1OH5A 3B36A 4JR0A 3SYRA 3HV2A 4OAPA 2IT1A 3FKSA 4YAOA 2DKNA 3AHGA 2GAJA 1XJ0A 1G5TA 1JRLA 1O95C 4OHZA 3UMCA 4DDKA 1PZNA 5DNDA 3QYJA 4RY8A 3HJFA 4X90A 4ZDIA 4QGHA 1YF3A 4GRIA 3C43A 4PV7A 2CJXA 3GGSA 2QOEA 2GLXA 1FNMA 2XB2A 3LHIA 4OB7A 4I6JA 1ILWA 1YI8A 1XGKA 1BDBA 2ZRHA 3GVCA 2B9EA 4X3PA 3FMVA 1UPBA 4N47A 2JAUA 4OH1A 4BWFB 4FKZA 4LN1A 4ETWA 3ZWDA 3PQCA 1XL0A 4LOLA 5DHPA 1M6NA 2YW9A 2FA9A 3OT1B 4DHWA 3IO5A 3ETNA 2PVCA 2W2NA 3PTAA 4P0TA 2NXNA 3E48A 3Q1LA 3NO4A 3ZGNA 2O6HA 2B78A 4P4TA 3UA3A 5TEWA 1EA7A 3KCNA 5H1YA 2PUVA 1SVIA 2EFYA 2HFJA 2XF8A 4QVIA 1H9CA 4E5UA 2D4AA 2CLMB 3AYXB 3NC0C 2HYDA 1GAJA 1F0PA 2MR5A 2C1XA 1DAPA 1GKUB 3SICE 4XJTA 1BA2A 1C0LA 3FCOA 1I1QB 2GJAA 5IN4A 1ZNWA 2C4NA 4V0MA 1YUMA 3SM3A 1G3QA 4DLXA 3S4YA 2AVNA 4LV8B 3IOEA 4H18A 1E5QA 3ZW9A 2RGXA 4LK3A 3A6KA 3DV0A 4N9WA 4PR0A 3ETGA 4X6YA 4ESVA 4YAWA 5JBIA 4P6VF 4OEHA 1VMDA 3PA8A 4EY7A 4HNAB 2EQ5A 2H1IA 1H2YA 2BKAA 3I4FA 3JWHA 1PVDA 4JROA 5K2MA 1PBNA 3FHJA 4FB5A 5C5DA 1NLYA 2HY7A 5JC8A 3VTFA 2HSDA 3Q7RA 3N0VA 3QJGA 3EA4A 1G3IA 3K0KA 2GYVA 2QSYA 1D4OA 5IFKA 2Z83A 2E4ZA 1T5SA 3GRAA 1E69A 3FJOA 3MWDA 4HWGA 4XQ9A 5H68A 3SS7X 4ZGGA 2R00A 4O4JF 4PSVA 2CLLB 4OX9Y 3PENA 2W6IA 3JQ8B 3OLQA 4QFBA 1JDBC 4DRXB 4GLLA 4AP5A 4CLXA 2NP7A 1GLGA 3PR3A 2H6EA 4EW3A 5HE8A 4RL4A 1Y63A 1KY3A 3N58A 4JS0A 1G59A 4M60A 1NMXA 1JFLA 3T5MA 3INYA 4RZXA 3TOCA 4GX5A 2W6OA 3FRIA 2PD3A 3PJFA 1N78A 1U11A 3W1VA 4KBYA 5EJ9A 3R8CA 5EMNA 2UYGA 1HT2E 3HHPA 2IYWA 4KIJA 4WA7A 1BXRB 1PI3A 3HDGA 3QF4B 5IJXA 2PUBA 1XR3A 1GR1A 1P2UA 3D1JA 3NHAA 3CNEA 2BR5A 4OFXA 4JI7B 2OZLA 4PN3A 4J91A 4Y6LA 3AVYA 1JBEA 3FWKA 1FIUA 1K66A 1Y5IA 2YFKA 3LGXA 1HPLA 3E2PA 1PQWA 3NPMA 2CV0A 5IFLA 1TZ2A 1VP9A 2QTRA 3PNKA 1E9AA 3SI7A 1LLFA 2CLCX 4JWKA 4D97A 4A0GA 2UU9B 3GZTB 1GY8A 2J5RA 4Y2JA 2H85A 5DASA 4ZZ1A 4I19A 3IEXA 4NJMB 4PZZA 1YDGA 3CONA 3TSWA 3ENKA 3N7AA 3FVRA 5LA6B 1S3FA 4U6SA 4UMFA 3I6YA 1MH9A 5CPFA 3TSZA 3WAJA 1JJAA 3LX8A 3DLIA 3NHPA 4ZYWA 3L49A 1KC3A 3OU6A 3AI1A 5GOZA 1ESZA 1W4ZA 2ECOA 4NCNA 2WAAA 1ODIA 3ZGYA 2R4UA 3HSYA 1VB5A 4ZC8A 1AGYA 1BCSB 2HJHA 2I71A 5DTJA 3WRYC 4PHFA 1W75A 3E3NA 4GLOA 1MX9A 1ZJ4A 2A59A 3CLSC 4BYGA 1WSDA 1TW3A 4E08A 3ONDA 4OBWA 4JBYA 2XE6A 1K86A 3LRPA 4QHSA 2X19A 1P4JA 1Z4JA 2IBTA 4NHOA 2CXNA 2CXSA 2XGOA 5HWSA 2LKDA 4KN6A 5A3QA 2O59A 3MRSA 2VWPA 2OUKA 3UAGA 1ZI6A 3PEUA 4PQFA 1T24A 4LC0A 4TLCA 4X41A 4DJFC 4LG1A 5BVHB 1R3UA 1JQBA 4LCBA 4YJFB 2RMKA 3AV0B 3EFHA 4ZTBA 3O94A 2IVFA 1P2FA 3A1WA 2IC5A 4XFJA 1O57A 1ZD3A 4LNAA 3RK4A 1KH1A 2BD0A 4PG4A 3WLIA 2FPKA 5JCXA 2O8CB 1MQ8B 3A37A 1V1MB 1XDGA 5DTIA 1PKXA 1GFSA 1HDZA 5J40A 1RWKA 2X0EA 3LM8A 4Y1RB 1E8DA 3DVAA 4QHYA 2HMUA 2Q1YA 2VCYA 4PAMA 5D6OA 4LGYA 3HYTA 2UUPA 2AI2A 1H66A 1SFRA 1KOLA 2BI8A 2BGJA 4HUQA 3ZNNA 3O47A 1T8SA 4BJHB 1MBZA 1ML4A 3F47A 1UFRA 4HS9A 5KNCD 4Q3KA 2VDPB 4LJ7A 1UT8A 4U2DA 1ADFA 4LS3A 4BQNA 3GNLA 1CBUA 5ALXA 1KVRA 1PGJA 1SKAA 3IS3A 5DDIP 4ITRC 3P2JA 1X42A 1ZD1A 3HCCA 3ZOKA 2ZTLA 3HEBA 4PRKA 2E89A 4IFBA 4RF5A 2IF2A 1XDUA 1L7XA 4IOKA 3MAGA 3V80A 3FRHA 1JAIA 3IPLA 1GU1A 3B7PA 3UCEA 3VNSA 2HA4A 4YWJA 4C6SA 1GA4A 2PTHA 2DWPA 2C5LA 1EVZA 2QG9A 2YYZA 2M1XA 2HU8A 4LXXA 4G0VA 4J1NA 5TE9A 2D6FA 1C2TA 3EH1A 4P2BA 1XF9A 4LQCA 2ZUCA 1KAHA 2UYOA 2GKSA 1WQ3A 2WTNA 3ND6A 4TRRA 3U81A 5AXDA 4DAEA 1WMFA 4MAAA 2GR9A 2Z2XA 1P60A 1M74A 1XDDA 2Q7OE 5AP9A 4EY8A 2YC4C 4DCOA 1D1SA 5HNKA 2HGZA 1KR5A 1HY3A 1S2OA 1XDWA 2Q45A 2NAFA 3FLMA 3CZCA 4BJ1A 4HTFB 3BH0A 5CA1F 1FFSA 3ORHA 4Q12A 3Q7SA 4IQFA 3HBNA 2FPRA 4GSLA 3BA1A 3A3OA 3PX7A 1QYRA 4LJ5A 3HUEA 5LD2B 2ZS9A 4COKA 3C1OA 1Z6GA 3GR6A 5BQPA 5BQ5A 1E0AA 1I4OA 2GERA 2ZSHA 2R6JA 3B2NA 4IKPA 3HLYA 1YDMA 5FOQA 5JS8A 2QP4A 1IZZA 4QRIA 4BCDA 2GPTA 1D2MA 3H99A 5DM4A 2VNAA 4RSGA 3RAPR 3VX3A 3BL6A 4N18A 1KHHA 2GSDA 3TZCA 2OAGA 3N0XA 4EUFA 3VFDA 1H5QA 5KNCA 1KFKB 5JU6A 2B21A 2WA1A 3L4BC 2DTXA 2PZFA 5HCIA 3WL8A 4G81A 4X63A 2VJCA 3A4LA 3GT4A 3S28A 5EN4A 1I94B 1Z2EA 4UDXX 3IP6A 3SKYA 2WIDA 4PO8A 3KK0A 1FFGA 4O5AA 5LOVB 5U9CA 4W5WA 3BUSA 2HHAA 2FW7A 4D44A 5LQCA 1XN1A 2H16A 4I9FA 1PT7A 2NZJA 4RKEA 5E95A 5IHXA 1LXCA 2LCFA 1HH4A 1TVMA 4URFA 4ZOLB 4Q3DA 2HA0A 1R5OA 1A88A 2B6HA 1VOTA 2EJCA 3BJEA 3ORRA 3PPXA 4DEXA 1QCCA 5JY6A 1PJLA 5KOHA 4YRJA 3CX3A 3O9MA 1GZ7A 4OHRA 4YP1A 1AGXA 1OXKB 1E98A 1KVTA 1Y5MA 3U09A 3ZGLA 3SJZA 3O8NA 2NU8B 3UPTA 3AF3A 4EL0A 3G8CA 4DIDA 4KWCA 4JVNA 3K2BA 1QIKA 4K8OA 1ISHA 1EU1A 5GONA 2FI1A 2VJLA 2REBA 3QU7A 4KCGA 3BOSA 2H51A 2OP0A 1X1DA 3N9IA 5CNJA 1JZQA 1COWD 2BFCA 5FWNA 2EP8A 4ZO6A 4C0XA 4Y6QA 1CUHA 5DHTA 2R8YA 2DUJA 4WRRA 4ALNA 2XOEA 3URKA 1BHJA 1CHDA 4ARIA 1IZ9A 4XGRA 3ZG6A 1NFFA 2XTZA 3AB3A 2HCBA 1GGMA 2GEVA 3A36A 1EB9A 4DCJA 5J1SB 2W83A 3TEFA 3K1ZA 1H4QA 2ATEA 4MGZR 4FWTA 1MR3F 3SZRA 3EMBA 1FP4B 5JDCC 1T5HX 1VRVA 1YRLA 2G1KA 2DPHA 3QYFA 4OM7A 4QDXA 1NXVA 2ORVA 2ZTSA 4M37A 4A73A 1KTIA 4F6RB 2FTKE 2GJ4A 1XD2A 2VJDA 3FYHA 3U3MA 1TEXA 2R7AA 2GUWA 3K1YA 4LYAA 1KYZA 3LOPA 1BQEA 3DCYA 3LCMA 1T8PA 1UBKS 2AC2A 1KP3A 2CMGA 4G41A 1Z5VA 1KJIA 1TDJA 2B6NA 2ALJA 4MQEB 4KXWA 1WLYA 2GPNA 1IY0A 3ZE8A 3A1EA 1HLPA 1SVLA 2KBFA 1I30A 1W0KA 2J08A 2GO7A 3OX3A 4R40A 1MIOA 4ZT2A 2GJ8A 1CULC 2MYPA 4I9UA 1WXQA 4X54A 1M0WA 5TIIA 3O8CA 3HXOA 3BMXA 1RMYA 3HJUA 1VBNA 2WE8A 3HTXA 3TLXA 1XG5A 4AZ0A 2VHWA 1FZTA 4MQ4A 1HT0A 5FBVB 1JSCA 2Y0EA 1TTHA 1ZITA 2NUPB 1HLDA 1G5HA 1Y4ZA 2QPAA 3GEEA 4GH5A 4JVMA 3VDXA 3ISTA 5K3EA 3GMDA 3K9LA 1H8ED 2UZAA 5LXTB 4NJMA 4P08A 3EXG2 5JH7F 2QROA 4D0NA 1LPAB 5EPOA 3WI7A 2O2EA 5ICGA 3DDUA 4DBLE 2VDLB 2OD2A 1E7WA 3RSQA 3T1NA 1RYYA 1T9GR 3P9SA 4I6EA 2Q07A 1WZ2A 1YBHA 3WJ7A 5KQLA 2C98A 4GOND 1SUCA 1V1RA 2R6ZA 4JAVC 4TRJA 4WQMA 1PGNA 4ZVLA 3GLKA 2NSDA 2QJTA 1JFFA 1Y7IA 3AXSA 3KLMX 5CCDA 1QGED 4HDRB 4ZOBA 4C30A 3G0HA 2G9VA 3KYIB 3F1LA 3NGLA 1HYQA 1VE1A 3IAFA 2FMUA 3MGGA 1IPEA 2BOVA 2ECKA 3MAJA 3OWOA 1JJFA 3Q11A 4M0PA 2BLLA 2C3PA 1UBSB 5IAEA 3FYDA 4JELA 2ORYA 3R74A 1AKNA 4TT8A 4K6MA 1DKQA 3GFFA 5TGZA 1RPNA 3WFIA 3U1VA 1GAEO 3PA6A 4UU0A 1WB9A 1K7FB 3CMCO 3TZLA 1VI5A 2D1SA 1NTRA 3A1FA 1CZKA 1NRWA 1CQIB 1MX3A 2V7XA 2X2OA 3A70A 4RVGA 3SXUB 2PD4A 1RE0A 3K94A 1EFPB 2IHJA 3OTOB 4PONA 4J0GA 2XBUA 5H3LA 3JARB 4S1VA 1YVRA 1DAIA 3CA8A 3K30A 4I50A 1L4EA 1KFCB 2Y93A 5LQSA 3AEXA 4H31A 5I45A 2GNOA 3CXRA 2I1QA 2RHDA 2WSYB 3HQ4O 3PS9A 4D02A 4E4RA 2ZUEA 1MLDA 2YRXA 4DLAA 1ZEMA 3WA6A 1IULA 1R5BA 2B1JA 4ZVTA 4CM7A 5GTDA 4DVJA 2ZTMA 2FQXA 4OH7A 1QP8A 4KO8A 2XY4A 4XVUA 1DAHA 1PZGA 3MPOA 4KYUA 4S0XA 1VC2A 2I4IA 1CNFA 1RQ2A 1U4SA 2J31A 2ZIFA 3AUAA 5KAMA 2C0QA 4Y18A 1E6KA 1V0JA 3T6KA 4RAQA 2OGWA 3GG9A 4U2BA 3RHFA 4AJKA 3ZGXA 1AE1A 4EO9A 1EK6A 3ONNA 2QD3A 4HLNA 2QTNA 1EDOA 4I36A 2E3JA 2G70A 2HN9A 1MAHA 2JKZA 1A5ZA 2JJ1D 2X13A 3EZ2A 4R2XA 4RE5A 1G8JA 4KAAA 1QQ5A 4L2IB 1OIXA 4P58A 5LB4A 4MNTA 1XRLA 2YJNA 1DAEA 4TRNA 2W93A 5EQTA 3PFKA 5BMOA 4WY5A 4Y6RA 5CM2Z 2H4HA 3M1YA 1DDIA 5PNTA 2OFXA 1N2EA 1PJRA 3KOYA 4W5JA 4F85A 2PKWA 3WMGA 3EPHA 2XGJA 2Q3JA 2P7IA 4RHFA 5EXDA 4C3ZA 1FRFS 3BD9A 3DAPA 1W96A 1S1CA 5JV5A 5KIAA 1P19A