5HCIA

Gpn-loop gtpase npa3 in complex with gdp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
257
structure length
257
Chain Sequence
SLSTIICIGMAGSGKTTFMQRLNSHLRAEKTPPYVINLDPAVLRVPYGANIDIRDSIKYKKVMENYQLGPNGAIVTSLNLFSTKIDQVIRLVEQKKDKFQNCIIDTPGQIECFVWSASGAIITESFASSFPTVIAYIVDTPRNSSPTTFMSNMLYACSILYKTKLPMIVVFNKTDVCKADFAKEWMTDFESFQAAIKEDQDGYMSSLVNSMSLMLEEFYSQLDVVGVSSFTGDGFDEFMQCVDKKVDEYDQYYKKHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GPN-loop GTPase 1
publication title Structure of GPN-Loop GTPase Npa3 and Implications for RNA Polymerase II Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 104
structure length 257
sequence length 257
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.6.5.-:
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03029 ATP_bind_1 Conserved hypothetical ATP binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5hciA00
4E09A 3FE2A 3BE4A 3NBXX 3LY5A 5CITA 1IY2A 1ZRHA 4LY6A 2W2TA 3U7EB 3CZPA 1XMIA 1SVOA 1KDPA 2B8TA 3LLMA 4D6PA 4NCIA 2NPFA 4EFMA 4DT1B 1PUJA 1ZM2A 4PXAA 3M1IA 1T8TA 3IPXA 5EUMA 4NYJR 4IDQA 3S1AB 4A2QA 1RRGA 1RJ9A 1OIVA 1AS3A 4LJ8A 3D8BA 4B43A 2ZJYA 1NJGA 1VG9B 4YMUA 3I92A 1XZQA 3ZLJA 1G6OA 3JZAA 1M7HA 2C9CA 1Y63A 1QHHB 2BMEA 3VR5A 1FW6A 1DBSA 5CDFE 2VRWA 1G20E 3ZD6A 3EXAA 3BERA 1KO5A 4F4JA 2ZUDA 5FFMA 3K0EA 1CU1A 4MGYR 3SR0A 1XEXB 721PA 2OXCA 1ZBDA 5DH9A 1T5IA 1DO0A 2KI5A 3ADBA 3K0CC 2JLUA 2VLIA 1ONBA 2F1JA 5JI3E 4IOMA 4LK2A 1HUQA 2XXAA 5HE9A 4P4UA 1OYYA 2FZLA 4ON9A 4JVSB 2WWWA 1U9IA 4IVRA 1SXJD 1J2JA 1RFLA 1XTKA 2W0SA 4TMVA 3O8RA 4KODA 2CHGA 1X8JA 1KI1A 2H5EA 3QXHA 2ZRGA 4LJ4A 3A4MA 4RKEA 1G7CA 4GBMA 2O8DA 3FHOA 2FE4A 4A8JC 3GLFE 3OEHA 4TYWA 4ZCMA 4U7DA 4RFVA 5KYKA 3F8TA 3P32A 4KITB 3RYTC 4DSUA 4AY2A 4JYBA 4PPFA 3MWJA 4P31A 5A5GA 4CF7A 3NEYA 5JZVA 4MRVA 4LC1A 1S8FA 2C8VA 1XFAA 2IF2A 1ODFA 4GNKA 3SYNA 1GNQA 4TQUS 3DZDA 2F9MA 1NMXA 4NKRA 3ADKA 2KB0A 2EFCB 1AQYA 3THXA 2FG5A 1E4YA 3BFVA 1KY3A 1W2GA 3H0KA 1E3MA 3UWOA 2O0JA 3FGNA 2QEQA 3W90A 2OXRA 1PJRA 3FKQA 1KIMA 2ZRHA 3NEJA 1TUIA 1XEFA 3AVQA 2IYYA 5C4MA 4KFRA 2IYUA 2P65A 3I8XA 2X19A 2NG1A 4B44A 3AVVA 2ZRJA 4GL2A 1S3SA 5GVSA 1II9A 1XRJA 2AKYA 1G5TA 3P27A 3GFPA 4EJSB 3MLEA 4C30A 4LRWA 1VCMA 5LB2A 3QKRA 1PVOA 3G0HA 2GJSA 1A5TA 1TEXA 2C95A 3KQHA 3R9XA 3KTAB 3PUXA 4C0JA 3RC8A 4PZYA 3F5FA 4LJ5A 3GJ4A 4A0GA 4M1TA 1FFHA 3B13B 1KDRA 1XXHA 2AFIE 2OFWA 2ZEJA 4KU4A 1BMFD 2GETA 3HYTA 2X2FA 4TL9A 1LY1A 1ZCBA 4TLCA 1U99A 2ZYVX 2R2AA 2OBNA 4OQXA 3CZQA 3KJGA 2R6AA 2KBEA 1MV5A 1D9ZA 3GFOA 1E1QA 1Z2CA 4BE7B 3RSOA 4JVLA 3AM1A 2VHCA 3LBIA 5JHGB 2BOVA 4FMDF 1E2NA 2X8AA 4DLTA 1CF4A 3AP3A 2DWQA 5EP1A 3FYHA 1OV4A 1KKMA 1GFIA 4KBFA 1VIAA 2CEAA 4FINA 5GADl 4U00A 2CHVA 3W8NA 3UG6A 2WZQA 2PZEA 2NOAA 2BJWA 4PAQA 1KDTA 4HZIA 1C1YA 4BZXA 3AVWA 2J59A 1XX6A 4I1VA 4IXNA 4TMTA 4UXIA 3W6OA 3QEJA 2REOA 5EP3A 3U6KA 4B35A 2LCFA 2C04A 3EZ7A 2O8EA 1G6HA 4YXWA 1XB2A 1VTKA 5DO9A 1U81A 1RE0A 1XDBA 4OI0A 2B8WA 1DE0A 4RJLA 4I1OA 4BFYA 5CM8B 1DADA 1G18A 3LFUA 3T61A 1AGPA 1FNMA 1TF5A 3U3RA 1E94E 5FR2A 1RKBA 1X8LA 3AP2A 1BYIA 1K8RA 4HB2A 2DY1A 4TT3A 3BD9A 3BWDD 1S3GA 5JCPA 5DE3A 3NHBA 3LWNA 2WICA 1LB1B 1J70A 2IBMA 5K8UA 2ZU0C 1HEIA 2W6JD 2O8BA 2CMKA 1IHUA 3TJZA 2XZPA 4A0FA 2HJVA 4TYNA 1RC8A 2HUPA 2GEDA 2XSZA 1VPLA 2G6BA 2WMNB 3VMFA 3ZQJA 1YZTA 3F0TA 1ZUIA 5GVRA 3B6EA 1J99A 2IYXA 5FOUA 1GOTA 1ZC3A 3O47A 1B23P 3Q5EA 3A1VA 4JJZA 4QBGB 3TR5A 4BQSA 2F55A 2V6JA 1Q1ZA 3QNUA 4DZZA 2ZSFA 4ESVA 3WYFA 1NSFA 5LDDC 2KWIA 3HR8A 2OEPA 4F7WA 1IJEA 1BO6A 1W44A 3NBZC 1R5BA 1KO1A 5B57C 1N3BA 4U02A 5D3MB 2QPOA 4U5XA 5F98A 2FFQA 1Q21A 1S4QA 2F43B 4TL7A 1PZNA 3AVTA 4HAYA 4TYPA 3SJZA 2V6IA 3WYAA 2Z83A 2JLXA 2P6UA 1WP9A 3RVBA 3KQUA 4AC9A 1VYTA 3TUJC 2WJHA 1MRNA 1NL3A 3B9QA 5G41A 1R6BX 2JJ8A 4OL0A 2WJVA 1WF3A 1VKJA 4A6PA 4WXRA 4UQOA 3OIVA 1Z83A 5DHFA 2UZIR 2QTHA 2ONKA 2GRJA 2EVWX 2OESA 1YZUA 4AURA 2VH5R 3WHLA 2VQSA 2IS2A 4DLUA 4EJSC 1IY1A 4D0NA 4RSGA 1UF9A 3K09C 5TXGA 4W5JA 4F38A 3KKOA 4M1WA 4AG6A 3OEEA 3QVVA 4FXPA 1P4SA 1R4AA 1JALA 4M4SA 4QGHA 5ANRB 3SN6A 4Q5IA 3VNUA 3OEHD 4QL3A 4WIAA 1R2QA 2G88A 1NIJA 2A5DA 4OHWA 4A1FA 3RRYA 5C18A 4LUCA 1P9WA 4DIDA 4JSYA 5CB6A 1OXUA 3AB3A 4E5UA 2VHJA 3ZD7A 4HLCA 3Q72A 1KI2A 5EXXA 3T34A 1OH7A 1FTSA 4GDFA 5FTNA 4MGIR 1YRBA 4HLQB 2WTUA 2YWGA 2HJGA 3SFVA 4JVMA 3DKPA 3Q7PA 1EFTA 1W4AA 3MG9A 1DAGA 3U3JA 1NJFA 2GCNA 5JRJA 1M7GA 1X1RA 2GZAA 3AKEA 3ZH9B 4R71A 3LA6A 4IXMA 4Q1DA 3K9NA 3BXZA 4MGZR 1IAQA 1W4RA 2FPKA 4KVGA 4XSHA 4FMCB 4Q47A 3T35A 4C4PA 3PJRA 1S0UA 4RD2A 3LW8A 3TE6A 5JMTA 2C03A 3ZQ6A 1RIFA 3QKSA 4ZI2A 4YMSA 2IYVA 1E0JA 2QMHA 2ZR7A 4Q66C 5HKKA 3T1TA 1CP2A 4R2IA 1Z0KA 2H57A 2YINC 4QG7A 1E1RA 4GZLA 1GZSA 4PAOA 4QM7A 1XD9A 3R8FA 2C9OA 3ZZUA 1Z6TA 4GP6A 4IRUB 2N1BA 4XWOA 5BN3A 3REFA 2FZ4A 2VL7A 3A4NA 3IHWA 3QEOA 4NMMA 1DG1G 4Q19A 4D81A 821PA 2JAQA 1BYUA 4BFWA 3OE7D 4JBYA 4TN1A 1G7SA 4P4SB 1YVDA 3NVAA 1E1QD 2SHKA 3LDAA 3U3OA 3SU8A 2BKEA 1FZQA 2NO0A 4NZYA 1OIWA 1TL7C 3BIFA 1DEKA 2GBLA 3T1OA 5FPSA 2CNWA 3A37A 5JWOA 2XJ9A 3OESA 3VKHA 1AKYA 3K1JA 3R7WA 2D74A 3TW4A 4BEJA 5SZIA 3M4YA 2ZSEA 2O0HA 1PLJA 2OE2A 5AJWA 1CXZA 2BC9A 3LXXA 1U98A 2JJ2A 4IDHA 4ZIRB 3QPWA 3QBVA 2FA9A 3B78A 2QA5A 3TAHA 1E2KA 2H18A 3PQCA 5P21A 3VU9B 5HZKA 3KQNA 1E9BA 1KMHB 4GI7A 1VDZA 3PCRB 3I32A 3K0AA 4XIGS 4XVRA 1KSGA 4OHZA 2P5SA 2VF8A 4CZ2A 4YXWD 4EKDA 1S9HA 3SYKA 1KZ7B 3N2EA 3UPUA 1OKKA 2AHOA 3MRSA 3IDQA 4TTPA 3I8SA 4PZLA 2JIZA 3PFIA 3CRRA 2V8OA 1GTVA 1D2EA 5FPHA 2J5XA 4BLSA 2FH5B 1GDDA 4URUR 2IW3A 1XPRA 2G1KA 1XTSA 4TT3D 2WKRA 3D31A 4CT5A 2ZR0A 4OK5A 1ELOA 1UDXA 5FTLA 2OCPA 1CR4A 4W9MC 3T1QA 4PHTA 2ZRIA 4FMCF 1W36B 1E2PA 1W47A 3K0FA 3WNCA 3NKVA 1DAHA 2XSZD 3OIUA 2J0UB 2CL6X 1NY6A 1R0ZA 2ZJ8A 4LBYA 1YU9A 4IEEA 3I5XA 4RD3A 1M1YE 3CWQA 3HDTA 4RD1A 4C0BA 1AS2A 2QG6A 5TY0A 2P6RA 3DM5A 4YMTA 1H65A 2ATVA 521PA 4AD8A 4EFNA 4ARZA 4GSYA 3TQCA 5KDOA 1KNXA 1XTJA 2WAYA 2I1VB 2F3RA 3BJIC 1T4GA 2WJJA 3EZ9A 1JQJC 2ZAOA 1P3JA 2JLZA 4M21A 2DWOA 4LC0A 1G3IA 1E2IA 2H16A 2OCBA 4TZ0A 4BLQA 3U4QB 1P2VA 2BM0A 5E4FA 4XVUA 4BLOA 1KK0A 1RZ3A 2HEIA 2DFLA 1QDEA 2KSQA 2JGNA 1UPTA 4Q02A 1NVUQ 3CPHA 5B30A 4X8OA 1II8A 3IIKA 2IUSA 3LX8A 5K8TA 3HPQA 1CIPA 4GRAA 4Q9HA 3CUEF 2RGBA 2EFGA 5F2EA 4MUAA 2FF7A 1Q44A 3PUVA 1L4UA 1G17A 4A4DA 1E32A 1FPMA 3IUYA 5CDFA 3SQWA 4AKHA 2HYDA 4BRUA 2GCOB 2JLSA 5TMPA 2ZRMA 2OLJA 2AK2A 1AZSC 1XZPA 2FFHA 4Q1EA 2ZJ5A 2ZROA 4NH0A 2FSHA 2UZ3A 3QG1A 4Q9IA 1SXJA 3X1YA 2D2FA 4GT1A 4L15A 1T0HB 4ABYA 1HTWA 1OXXK 4JT4A 4OI1A 4OK6A 5J47A 3OEED 3NTUA 3EPHA 3K0CA 3TBKA 1UEIA 4C0LA 4QJ3A 1ANKA 2ORWA 4JLPA 4H1UA 4JMPA 4OJQA 5K8IA 1W0JA 1Z06A 3J81k 3E2IA 2B92A 4N0DA 1GNRA 2Q0HA 2Z6VA 4A36A 4N1AA 1AQUA 1KGDA 3C8UA 2IA5A 4A8JA 4QNRA 3SYLA 2VF7A 1FP6A 3BC1A 2JA1A 3THWB 2DB3A 2YWEA 4Q1CA 2QUZA 1QF9A 5SZHB 1E2EA 2V9PA 2F1IA 2QM7A 1COWA 4R98A 4IKEA 3EARA 1QHSA 2XTNA 3RAPR 4LV6A 4ACAA 1DVRA 4Z51A 2WIBA 1AM4D 1P75A 1TADA 5BW8A 4BZQA 2D7DA 4MRPA 3SJAA 2KBFA 4MYCA 1YZLA 2HXSA 3O8CA 3KKPA 1OXTA 3ZGXA 4Q9LA 1OFHA 4MKGA 5CJ2A 5AUOB 2ANCA 3K53A 1E9EA 4FD2A 4TQ9A 3N5CA 3CX8A 1H8EA 4MYTA 3JZMA 5HKKD 2GDJA 2QBYB 4KVAA 4BFVA 1VG8A 3KL4A 1US8B 3PITA 3VKGA 3QBTA 1II0A 5HCIA 1E1RD 4CW7A 1XTQA 1E9AA 2PLRA 2RHDA 4M8NE 1BMFA 1TQ6A 4C0AC 3IPYA 1SVLA 4IHQA 2AR7A 2ASEA 1E6CA 3CKLA 4JLKA 5AJVB 4HZUA 5AK0A 5EE1A 5EE3A 3EIQA 1RW4A 5HZHA 4QM6A 1GL6A 1W36C 2J46A 4PTLA 3GJ8A 1R5NA 5AWFC 3MMPA 3WMEA 1N5LA 5FI0B 3CPJB 2BBWA 2A5YB 2N42A 2WMOB 3AF1A 4KYUA 1W49A 2ODBA 1MO5A 4IOLA 3UKDA 2VA8A 1KI9A 3AH8A 3UXMA 2QE7D 1O87A 1J7KA 3PUYA 2K5UA 2C9YA 4Q4JA 1WQ1R 4D2IA 5JCZA 1QVRA 3FFBA 2JJ2D 3CRVA 3MWYW 1YR9A 3L0IB 3GLIB 3SE0A 3A1WA 1U90A 2IYRA 1E2JA 2CVHA 2HV8A 1LW7A 3PVSA 2CXXA 2W2XA 4PC3A 1VMAA 2D62A 3LBNA 5IT5A 4ZCLA 2H1LA 3K0SA 3SJCA 4XWKA 2VSOA 3A36A 2ODEA 1OKKD 4TYYA 2WJIA 2ZSAA 3BFKA 4S35A 4Z1MA 2JIZD 4B3XA 2ZVPX 4DLSA 4IOKA 1TU3A 4Q1BA 1OH8A 1E9RA 3WNDA 1A7JA 3MJRA 3KKNA 3R9IA 3THYB 1KI4A 4XJXA 4XTRA 1FX0A 1EG7A 4P3YA 3LV8A 3S1AA 3F3YA 2HYIC 4EQ6A 2JDIA 3TUZC 1YE8A 4ZDWA 1U0LA 1W2HA 1LV7A 4J0QA 4JKYA 4A92A 4B3BA 1Z0JA 3B8HA 2GXQA 2NTYC 4Q4HB 3TR0A 1OYWA 1G21E 4FWIB 3V4RA 1NLFA 2PEYA 4KJZA 5TDHA 3RS2A 1XWIA 4W5HA 2FEMA 4LPKA 4NTZA 3TRFA 3U44A 4M1YA 2OZEA 1IXSB 3ZVMA 2QAJA 5G40A 3FFAA 1OT3A 1F2TB 1M8PA 4LDJA 3HYRA 4LHXA 1ZUNB 1NBMD 4Q03A 2ZETA 2QSYA 2H7VA 2FSFA 2OG2A 4LJ7A 2JLRA 4HI0E 1GVNB 3FMOB 4DDUA 3U7GA 2QM8A 4BLPA 4C9BA 5BYJA 2G1JA 2CL0X 3DKVA 1R5OA 1W4BA 1KSFX 2QGZA 4OI4A 2RGCA 2V54A 4QHYA 2ERXA 2Q3HA 3BAFA 4US1R 5EXSA 5FL7A 1YR7A 2HXYA 3NDPA 2HT1A 4Y0AA 4QC2A 1D5CA 3DPUA 3UMRA 4S2EA 4QXAA 3RRMA 3SBDA 2VSXA 4UJ3A 3LVRE 1TMKA 2YVUA 5JLJA 3LX5A 4TL8A 2ORVA 4ZKEA 1DS6A 3LH5A 5TARA 4DLXA 1G41A 4UNPA 3WMFA 4BFZA 5UKDA 3K9HA 4L4UA 1N6HA 4BPBA 5KDLA 4FMDB 4ITRC 1W48A 3EA5A 4NU0A 3CBQA 3B7GA 3AEZA 1HT1E 1W0KA 2FFBA 1Z5ZA 3QUSA 1N2CE 2VP5A 4V0LA 1GSIA 2C2HA 4IOJA 2HLDA 5TV2A 4DWJA 1Z29A 3VQTA 3QG5A 1XJCA 3SNHA 3K09A 5TB5A 2ZRCA 3VR1A 1Z6XA 3AF0A 3EC1A 3EA0A 1IN5A 1W0JD 3EASA 4HDOB 3H84A 4CYMA 3GEIA 2CVFA 3U7FB 1G3QA 4Q7KA 4V0ME 3HP1A 4JL6A 1GG2A 4QJ5A 3IILA 2REXB 3TVTA 2IHYA 4EPXA 4DHEA 1NG9A 1Z07A 5HE8A 1GILA 4HLDA 3FHCB 2AFHE 2GZHA 3AP1A 1G3RA 2H92A 2OM2A 1XEWY 1G7TA 4LJYA 1LTQA 4F4CA 1ZINA 3I61A 1COWD 2QU8A 4PC2A 4PPNA 4GFDA 3VX3A 2ZJBA 4XD7A 1MH1A 5DGXA 1SHZA 2YZ2A 2P0EA 4F93B 1NSTA 2OCAA 4GOKA 4ZO4A 1XMJA 3GLIE 4IJMA 3GEHA 2Z5FA 3TGPA 3RNLA 6Q21A 1CJVC 3C41J 2CLSA 3JVUA 1L2TA 1BH2A 2CE2X 5J5CA 3CX7A 2RKOA 1ESNA 1H8ED 1AA9A 2WHXA 1P61B 1LFDB 1GP2A 5E95A 3X1XA 3L8YA 2ZXUA 1NNEA 3GJ6A 1SULA 2XXAB 1FOEB 1UKZA 2BKUA 3GJ5A 1KK3A 1TQ2A 3W3AA 1RYHA 3GJ0A 2GKSA 3H1TA 1QHGA 1JPJA 5L3QA 3IO3A 3ZJYA 3OE7A 4BWYA 4WBSA 2NO6A 3AGQA 3RDPA 2DBYA 2O8DB 3GD7A 5BN4A 1P73A 1OFUX 3MD0A 1XD2B 2ZJZA 2JJ1A 4K8OA 2OHFA 1V43A 3FPAA 4LI0A 1P5ZB 1XPUA 3LQQA 1GWNA 1MABA 2NZ8A 1ESMA 4OQFA 1KJYA 4Q9KA 1SHKA 1C9KA 2FFAA 2QZ4A 4HUQA 4L16A 1A1VA 4OQNA 4URVR 2MMCA 1MKYA 2ZAMA 4H9GA 3WRXC 4Z54A 1GM5A 1S96A 2P3SA 5JJIA 1G291 1N6LA 4OJKA 5JI2E 4B74A 3THXB 1GIAA 1C4OA 2XNSA 4R9UC 1N6KA 2NO7A 2VP6A 3WRYC 4TYQA 1VHLA 4DDTA 2D3WA 3KB1A 3AQ4A 1E2MA 2FEOA 2XGJA 4CEJA 2G3YA 3TLXA 1EFHA 2IX3A 4PQFA 1Z6GA 5M04A 3NDBB 3QXSA 1EFCA 1LS1A 1U8AA 2MSDB 3I4LA 4LCBA 3GFTA 3PEYA 1Z47A 4NCJA 1HH4A 1IN8A 4V02A 4Z1MD 2RGDA 3CF6R 5JFGA 1A4RA 4HSEA 5FOWA 5L3SA 2ZVQX 1RRPA 1K5DA 1LS6A 4K46A 5KSZA 3AVXA 4XTCS 1CJMA 3QKRB 3PEUA 2GILA 5HCNA 1HT2E 4RD4A 3U60B 1EX7A 2QP3A 2ZRKA 2JDID 3QVUA 3NWJA 4KBGA 3RS3A 2VP0A 3OZXA 2VBCA 2XB2A 1TF2A 2GESA 4B32A 4C0QC 3E5HA 2H8KA 1Z3IX 4AI6A 1KO4A 4GZMA 4TL6A 5JWHA 3L0SA 1DO2A 2RH5A 3EPKA 4AKEA 5JJKA 3WMGA 1PLKA 1L4YA 3AUXA 4NONA 2Q9CA 1ZUHA 3MFYA 1SKQA 4HLUA 4JL5A 1J90A 4MA4A 2QL6A 1E2LA 3NH9A 3CR8A 2QQEA 1BIFA 4B3CA 4RFSB 2WOOA 4ASUD 2ERYA 4LYAA 4TWZA 5FL7D 4A15A 2L0XA 2XITA 2WM9B 2DFTA 4K81B 2V1UA 2VSFA 1NN1A 3QF7A 2ZJOA 5SZKB 1ZNXA 5FPKA 4M53A 2HCBA 2QORA 2AD1A 2FGJA 3THOA 4D80A 1CR0A 5DNYB 2RCNA 4PANA 4X8HA 2AD5A 2IL1A 2OAP1 2XB4A 2WBLC 2FSIA 2R44A 3W5JA 5A4JA 5IRCD 1Q1EA 1E96A 1A82A 1SKYB 2V4ZA 3Q5DA 1E0KA 3VKWA 4RZUA 2PL3A 1U0HC 4IEIA 1E4VA 2X1VA 1N0UA 3NIBA 2PBRA 1G4UR 4LSGA 1R0XA 3KUDA 3K9LA 1Z28A 4Z8XA 2WWXA 3X1WA 4BRWA 5J4VA 2R6CA 4KI0A 4RCYA 3SJBA 2RAPA 2QPTA 2O8BB 1TUEA 2IYSA 4OHXA 4G01B 5H1YA 4KYIB 1QHIA 1W0KD 3O8BA 1N25A 4TLDA 5KOYA 5AUQA 2GJKA 1U9IC 2HLDD 2ZI5A 4LJ9A 1P2TA 4QFMA 3T5DA 4ZDJA 4M2LA 1KNQA 1KTVA 2F1RA 2ZRLA 4DCTA 1Q0UA 2J7KA 1EFUA 3RHFA 1W4CA 3BGWA 3UMFA 4KO8A 2WPDA 3ASYA 2RGNA 1JJ7A 4M1KA 5H8WA 1P2UA 1GNPA 1OXSC 4QOSA 1U2RA 4A0RA 1E79D 5HTKA 1HA3A 1NVVQ 3I72A 1OJLA 1NRJB 1YR6A 3QF4A 4P4SA 2ZS7A 4YDHB 2ODWA 5CJPA 3SQXA 2CBZA 1R10A 1YHNA 3ONWA 3Q3JB 3SHWA 1WDTA 3KZ1E 5BXQC 2IEZA 4XD7D 4JSTA 5GJWC 1KKLA 1MO6A 1Q57A 4ACBA 2A30A 1VHTA 4TQAA 1ZCAA 1GKYA 2YV5A 1XF9A 1QHXA 2PLFA 2PMKA 2DFKB 4IW3B 3CNOA 1ZJ6A 1WA5A 1KYIA 5CM9C 2EFEB 4V0NA 3A1SA 4E07A 1R0YA 5SZJA 3TNFA 5HR5A 4D4JA 4DLZA 1UBFA 2JASA 2WV9A 3VU9A 1QG4A 3ZZ0A 3PUZA 3U2QA 2ZRPA 2Z43A 3L43A 4B47A 1YZKA 4PO8A 3DMNA 5JSZB 1WE2A 5DIFA 2YC2C 2WWYA 2J3EA 1NI3A 4TTQA 4DLWA 4LHWA 4MRNA 3VFDA 4EDHA 1FQJA 1UJ2A 1HE8B 5B2ZA 4I1SA 4IDPA 1S2MA 3ZDQA 5FUWA 1IN4A 2ODNA 2QY9A 1P9RA 3W6PA 5KU1A 1GRRA 4BECA 1DAKA 1MO3A 2GAOA 2JJ1D 2UVQA 2N46A 1CJTC 2QE7A 4QGGA 1HQYE 1OE0A 5FL3A 3TMKA 2FWRA 2WWHA 1PV4A 4ERNA 4QNMA 2X77A 1NY5A 2ZE5A 2J0UA 3SEAA 4PAMA 2JLYA 3ZVNA 4MKFA 4G5OA 1OB2A 2QI9C 5FBVB 2GF9A 4IDOA 4WVFA 4GOXA 4RY2A 1AK2A 4QHTA 1UEJA 3ECCA 5BN5A 4LPSA 5IHPA 2UKDA 4DUGD 2QRNA 1ZM9A 1ZAKA 4C0KA 4HYYA 5E7MA 1T3LA 3TQFA 2OT3B 5LD2B 1WCV1 3CNNA 3QXXA 4RCZA 3BB4A 3RLFA 2PJRA 2YOGA 3NC1C 1TEVA 5EP2A 2ZJAA 3GEEA 3L8ZA 4CEIA 4NDZA 1UM8A 1T5LA 4PO1A 4AG5A 2WIAA 4FCWA 2R62A 1JBKA 2FSGA 2QAGA 4XVQA 3SC3A 2VO1A 5BWMA 1CJKC 1GKIA 3VR4A 3FOZA 3AVUA 3W8RA 1I4TD 4LGMA 1AIPA 1UADA 5L3VA 5H68A 1NVVR 1SKYE 2MSEB 4BFUA 4OHYA 4B33A 1F2UA 3OFND 1HY3A 3P1JA 3SHFA 4CRWB 1KO8A 4PHHA 4QBHA 3EX7C 3DO6A 1ZD9A 4ILEA 3CX6A 5DI3B 3T06B 3KB2A 4DC9A 4URXR 1Z2AA 3AV0B 2GCOA 4JZKA 1X8KA 2AXNA 2PZFA 1M7BA 3C14C 1ZU4A 5AJZA 5JWRA 1TTTA 1NBMA 4XOIA 2BEKA 2DFNA 2W58A 4IDNA 1EFRD 2J7PA 3FDIA 4II7A 4TMXA 1DELA 3GLHB 4B75A 4DRZA 2EQBA 2QGNA 4CIDA 4QJ4A 3R7WB 4EIWA 1JNYA 1UDWA 2Q9AA 3PV0A 2QP9X 2XTZA 1Q3HA 1AKEA 3RANA 2BMJA 1I4DD 3ND9A 5DISB 5EXPA 1JEDA 2GK6A 3KFVA 1QHYA 4DEXA 5FOSA 1U0JA 5ELXA 1G8PA 2R65A 1N0VC 3HU3A 3K0AB 3NHAA 4Y0VA 2GK7A 1T9HA 2XOKA 2ATXA 2B7CA 5JHHB 1ZMXA 5BQ5A 3GCGA 4P33A 4QBIA 5EZ5A 2R9VA 4HAUA 3FHTA 1KZGB 3THWA 1FUKA 4JVNA 4BLRA 5FOVA 5EQTA 4YLGA 4X8MA 4D4KA 3CM0A 4B76A 3N2IA 3Q9LA 4PX9A 5FOTA 3ZIAA 4TZ6A 4JLOA 5L8VA 2Z0MA 3WP1B 2VEDA 4G0NA 3CO5A 3U61B 3B1ZA 1P72A 1I4LD 2WWIA 1XCPA 3SS8A 1ZIPA 5FH9A 2EW1A 3K0FB 1F6BA 1KI6B 3MWLA 4PFSA 4YMWA 3VR3A 4D82A 3WY9A 1IN7A 5LPNA 4PPGA 3L0PA 5FTMA 3ICQB 3CPEA 2WSSA 2AX4A 3E70C 2EFHB 3T15A 3VHXA 1XU4A 3PENA 4PR0A 2E9SA 4KHZA 2BHRA 4ZPXA 1EESA 4ESHA 3GLFA 1NVWQ 1DAEA 3VR6A 2BM1A 3I62A 1IN6A 2WPDD 4LBVA 3KXLA 4PSKA 3RS5A 4LHYA 4ARZB 2HF9A 2ECKA 3BFXA 3DMDA 4B6FA 2FU5C 3EZ2A 1NN3A 5CIQA 4L5BA 5FR1A 3DOEA 3DM9B 4V0MA 2XEXA 4L8GA 5DYIA 1VG1A 4UNQA 1NN5A 1FTNA 5KDDA 4I1UA 2G0NA 4DLRA 1M6NA 1UKEA 2GTPA 3UG7A 1TF7A 2VHQA 1XBTA 5EE5B 2A2ZA 1TQDA 1HV8A 4N3NA 3A1TA 1JXOA 1X3SA 2F6RA 1II8B 4D4LA 4M1OA 1E69A 3DOFA 2C99A 121PA 2XJ4A 3B5JA 4Q4AB 2FMXA 2QT0A 2OBLA 8OHMA 3PR1A 2IUUA 5LD2C 5AUPB 2BIFA 3RWMB 1I2MA 3GLIA 3NBYC 2KE5A 1E2FA 1D9XA 4JIMA 2J45A 4CEHB 4QBFA 4HDCA 1M34E 2WAXA 1W7AA 1CR1A 4M9SA 3IEVA 2C78A 4Q01A 4TTRA 4D0LB 5IK2A 4OKSA 1RRCA 2W00A 1NKTA 2A7QA 4LYJA 3AF3A 1TU4A 1SXJB 3D3QA 3GMTA 4KSBA 2O8CB 1GRQA 3H2YA 5C2JB 2MMGA 2ZI4A 3JVVA 4LX0A 3CRQA 2IYTA 4DSTA 2O8FB 3THYA 2V1XA 2QNRA 4US0R 2LKDA 1KDOA 3LQRA 1QZXA 1G19A 3TAUA 2G0TA 3C4JA 1TQ4A 2EFDB 5EXTA 421PA 1W36D 4IFEA 1W5TA 2AKAB 2YWHA 4OK3A 3BB1A 1JR3E 1OXVA 2GBLC 1JAIA 4YONB 1ZM3A 2PT5A 4E22A 2WKQA 2I3BA 2F1HA 3PUWA 3GLHE 3Q85A 4A2WA 3QJYA 2OO7A 4JBWA 3KJIA 1F2TA 2ANBA 3QIAA 4FCTA 1EGAA 1CBUA 1HE1C 2R6GA 3BBPA 1TX4B 4WW0A 2IWHA 4MKHA 3DHWC 3EPLA 1FUUA 2CCKA 1Q1QA 4DXAA 5DHAA 3IBGA 3UMSA 4ZV4A 1FMJA 1KI8A 4DCVA 3NXSA 5AJYA 1N5IA 3NBFA 4M9QA 3GLGB 3RWOA 2H17A 4P32A 2Q6TA 4US2R 3ETLA 1ZD1A 3ASZA 4DT1A 3SBEA 4LYHA 1CLUA 1DTSA 2VP4A 3H86A 5EE9A 3Q7QA 1WBDA 2BDTA 1IXZA 4DCNA 3EAQA 3VHLB 4OI2A 1EX6A 3ZVRA 1IY0A 4GOJA 3CB4A 4BLTA 4PPQA 4QKQA 1NMZA 3KJEA 4MGKR 2ZITA 2A9KA 2PMDA 3B9PA 1RYFA 4DSOA 2JEOA 4BASA 1H8HA 2WWGA 1OF1A 1QHHA 3HWSA 2C96A 2HT6A 4GP7A 2ZRFA 2WOJA 3QOFA 1XEXA 3LW7A 4WA7A 4ZDIA 3AVYA 2GA8A 2HDNB 5LBIA 1XNJA 2IYWA 3BOSA 4KFTA 3ZVLA 4YC7A 2IXEA 2KJQA 1WRBA 2FV8A 4V0OA 3CH5A 4DKXA 3VAAA 2XZLA 2J9RA 3FMIA 2PCLA 4UNSA 2J7PD 2PX3A 3K70D 4O2LA 4HAWA 4BZPA 3SOPA 4ASUA 2LWIA 1V5WA 4BFXA 2CJWB 2DWPA 3U3KA 2P5TB 3QQ5A 2BJVA 1JR6A 1MO4A 2I1QA 3IIMA 1KOFA 1AZTA 1IM2A 3CRMA 1T8UA 1NG1A 4AYWA 1E2QA 2O0KA 1G4AE 4FMBB 1G64A 4PZZA 5KTYA 5C4GB 1UKYA 4C2UA 1XP8A 1YR8A 2XOKD 3HU1A 1G8GA 2ZI7A 2G77B 4A9AA 5DLQC 1CTQA 1G1MA 2QRZA 3P4YA 4LBWA 4CDGA 1G3MA 3CR7A 4F92B 4Q9JA 1GL9B 4LV5B 3UWKA 2OCYC 4C7OB 5EZ6B 3I3SR 3L0OA 4R2HA 3ZIAD 1D6JA 4NYMQ 5EE0A 5KNCA 1FX0B 1XJ0A 2ZRBA 1XD8A 1Z0IA 4B34A 2IWRA 4EQ6B 2D06A 3CNLA 4LJ6A 2CL7X 5JJLA 1E0AA 2G83A 2P6NA 3WXMA 1ZVQA 2FGKA 4B71A 4DDVA 2V7QA 1SXJC 4EUNA 3VNVA 4URYR 4EJSA 2ZUCA 1A2KC 4FWTA 2QMUA 2WSSD 3U44B 4JBXA 3HJNA 4NBSA 1FNNA 5KSPA 5KO2A 2O5VA 1SXJE 2NO1A 3SDZA 5KUTA 2ZRAA 3KTAA 4XWAA 3REGA 4AK9A 4RZXA 5DYGA 1KK2A 4Q1FA 2IEYA 2AN9A 5JBQA 5KHOC 2W83A 3V00A 4UXHA 2ZE8A 3IKJA 4GMXA 3W9YA 1QG2A 1G5RA 1E79A 1VCNA 2ZIAA 5J4YA 2VYFA 2YWFA 4JLJA 1GRNA 4UJ5A 4DB4A 1SZPA 2PEZA 1N5JA 3FWYA 2R6DA 3RS0A 4DJTA 1GUAA 1CRQA 1CRPA 4DB2A 1CULC 1XD2A 4GMDA 1W46A 2ORIA 1TAGA 5HPYB 1U8YA 4AYTA 2IYZA 2XX3A 2QTVB 4A2PA 1RJ9B 3BH7A 3ADDA 1G8YA 2NPIA 1DAFA 1KY2A 2NO9A 4Q4LA 3U5ZB 3OIYA 1E0SA 2FJUA 3GQBA 5JEEA 4B2PA 2BCGY 1E9SA 4URZR 1D2MA 3TW8B 3B1XA 1P60A 1EWRA 4EFLA 5AJXA 1T0JB 2IC5A 1YZNA 1B0UA 3B85A 5KPJA 2FDCA 3AKDA 5FBWB 4DCSA 2WVJA 4MDEA 1K6MA 2QMOA 1T91A 5IDVA 3UIEA 4D25A 2R6FA 1CEEA 1OIXA 5IK2D 3GLGE 2HF8A 4AYXA 4OBEA 4RZ3A 4POAA 4OHVA 4DSNA 4D0GA 2A5GA 2ONJA 3O8DA 4KAXA 2CDNA 3W5IA 621PA 2NMVA 3DL0A 3G5UA 5J40A 2F9LA 4DVGA 1SVKA 3K8YA 1P9NA 1XCGB 3WYGA 5G3ZA 3MSXA 2IYLD 5GJCA 2F7SA 1KHTA 2NZJA 4LWZA 1KSHA 1G7RA 4FN5A 3KDSE 2I4IA 3OAAA 4NCKA 4Q7JB 4C0SA 3QKUA 2PZGA 1KJWA 3BB3A 1E2GA 2IHBA 5KNBA 2LKCA 2OLKA 4NYMR 2FNAA 1E98A 4MRRA 1U8ZA 1YZGA 1DAMA 2FN4A 4V03A 4MYUA 4NCNA 3GJ7A 1KMQA 1XTIA 4KLZA 2YKGA 2DR3A 1X86B 2X2EA 3IO5A 5EP4A 4DUGA 2VP9A 2BCJQ 4NYIQ 4KSCA 1SVWA 1ZYUA 1FMLA 4PSAA 5H70A 4P4TA 3MUFA 3WHKA 4JLNA 2G9NA 4RFSA 2ZSDA 1NMYA 4C3ZA 1XTRA 2GEVA 3TUIC 2GCPA 2GNOA 5D3MA 5E7JA 4B3FX 3NG1A 5F3WB 2F43A 1FQKA 2P67A 3W6NA 4A82A 1CJUC 3FKSA 1CR2A 4URWR 1ZP6A 4HUTA 4WZ6A 1JI0A 2OFXA 1XXHB 1AJEA 4V0KA 1H8HD 3OFNA 2GF0A 2RB4A 1ZC4A 1RRFA 3TH5A 4NCHA 3TSOA 5L3QB 2J87A 3PG5A 4NHOA 1R7RA 1Z0AA 4XH9B 1ZM4A 1F60A 4DIEA 4M1SA 4DDWA 2Q9BA 1UBEA 3L2OB 2IXGA 4UXJA 1CS4C 4M9XA 4RVCA 3P20A 1M2OB 1KSJA 1E2DA 5KSOA 1EFRA 2JATA 1CKEA 1S1CA 2MSCB 1MABB 1TPZA 4UKDA 2YHSA 4HUQB 4O2RA 3X2SA 1NLZA 5JRZA 1F5NA 3B60A 3A6PC 3EWSA 4JLAA 1Q20A 2FPMA 2W0MA 2FOLA 3CONA 3T12A 4PC7A 2JLWA 1N6IA 3M0EA 4HB3A 3DEFA 5FOXA 3KXIA 1ZD8A 3ZS9A 2J41A 5TVKA 3EW9A 4P0TA 4Q00A 2RGEA 4B3GA 2GJ9A 1JEEA 2O8EB 1IONA 4CEJB 3A1UA 4AKGA 4EPTA 3BORA 5FPYA 2D4HA 4PC6A 4HAZA 4PO9A 5J4KA 2OBMA 4HB0A 2GAAA 3IHLA 5FUYA 2ZE6A 2CE7A 4WOPA 2QROA 1O3YA 1WBBA 1T3SA 2GWHA 5L3SB 3LBHA 1SQ5A 2BV3A 2A78A 3Q8XB 1T6NA 4EPWA 5KNDA 4F4IA 2Y8EA 4AKIA 1G8HA 3CWZA 4DLVA 1Z0FA 2CCJA 2P2LA 4RZ2A 2J0SA 1E9DA 3U6BA 4Z8YA 1NVXQ 2WKPA 2IS1A 3TK1A 3R20A 4G5QA 4ZI3A 2CCGA 3P4XA 1JXMA 2WJYA 3PEVA 4AWXA 3VTKA 1JAHA 1JJVA 2R8RA 1OFTA 2DHRA 3FTQA 5CIWA 2AWNA 5CB8A 4WAUA 1UBGA 2V7QD 2TMKA 4DBLC 3GP8A 4NYIR 4FCVA 2C98A 1SVMA 1WXQA 5C46F 3C5HA 4AIIA 5FUVA 2QN6A 1J8YF 3GJ3A 5JSZA 2CLDX 2DPXA 2E87A 4O0MA 4NE2A 1RPZA 4L9SA 2W2VA 4JJKA 2RGAA 5IF9A 4LV8B 1N6PA 3TVDA 3BH6A 4EPRA 1P7CA 4BEBA 2ZRNA 3LAWA 4MDFA 1W1WA 3RS7A 3T1VA 3EZFA 4MKIA 4Q1AA 1LVGA 3TIFA 4D4MA 1KK1A 2Q3FA 5BYKA 2JLQA 3UANA 3FMFA 2FX3A 1XJQA 4CT4B 3R9WA 1KO7A 4R7ZA 1KJZA 4GPTA 2GVZC 3G82C 1P6XA 1QBKC 1G16A 1ZIOA 2ZJ2A 4I81A 4B2IA 3CW2A 2B21A 4CGZA 2YOFA 4TSFA 2YC4C 4HDQB 1KI7A 4JLMA 4KFSA 4ZIRA 2ZU6A 3X1ZA 4BGDA 4M1MA 2B6HA 4TLAA 3PXGA 3QY0A 4LZZA 2C5LA 1UBCA 3C7KA 3DZ8A 1LNZA 4BFSA 2IUTA 1KMHA 4KCGA 4OQMA 4YDSA 1GITA 3AKCA 2Z4SA 2PH1A 4G1UC 3GPLA 1L7VC 1U94A 1YQTA 4H1VA 1OH5A 1MR3F 2QPAA 4DCUA 1DPFA 2XNDA 2C77A 3ND8A 4E03A 3B1WA 4UNRA 3LRPA 2JCSA 2OFOA 1BS1A 1OSNA 4FIDA 4QHSA 4F91B 1N6NA 2BMDA 1IXRC 3LNCA 3ZZTA 2CK3A 2J1LA 3AVOA 1L8QA 2EU8A 3QPUA 2JLVA 1XXHE 1E2HA 1N0WA 3KKQA 2VHTA 1ZNWA 5EUQB 2YJTD 1Q1BA 3IBYA 5CK5A 3MJHA 1NP6A 2AK3A 2CHQA 3I73A 3OAAD 2ZI6A 1VG0B 4BFTA 4UNNA 3NH6A 3CF2A 5FTKA 4MUBA 2OSBA 1UFQA 2ZYUX 5GJBA 3D6TB 4HB4A 3ZS8A 1JR3A 5DI3A 3QF4B 5J4LA 3LO5A 3V4FA 3UK6A 3QE0A 2IF0A 2ZI3A 3KX2A 2PCJA 4O25A 1Q12A 4TMZA 4HATA 2Z4RA 3WP0A 1IJFA 1N6RA 3GLHA 5L3RA 4DEYA 2ZM5A 3U7HB 2XZOA 2IYQA 3P26A 3LLUA 4Q7LA 3DVLA 4G5RA 5JS7A 2A5JA 1K5GA 1Z08A 2VHUA 2W6IA 4OQLA 3OF5A 2V55B 4JYCA 4TMWA 1R0WA 5G53C 4B3DA 3QKSB 4ZDKA 3U4QA 4KLNA 3A58B 2OUKA 2IS6A 3LVQE 1P2SA 4TLBA 3ICEA 2PT7A 4JKIA 3FKSD 4JL8A 2IT1A 1NN0A 1OHHA 3SFZA 1EK0A 4BUJA 1YKSA 5DN6A 4B6EA 4O3MA 2GZDA 1OFIA 1YJ5A 3W3ZB 3HR7A 4M0LA 3AVPA 3QI2A 5D3QA 4ZCIA 4XSGA 5AR1A 1LF0A 1E99A 4G5SA 1IOZA 2B7BA 3FVQA 5F9FA 2ZUBA 3OHMA 4LOAA 4IFBA 3U3MA 1VYUA 4JLDA 2GXUA 1W5SA 4WZBE 4NL4H 2QENA 1BKDR 3WNBA 221PA 4I4LA 2ZTSA 5GJVC 3QXCA 2EWVA 2REBA 2ZI9A 3HPRA 4C0HA 1KI6A 3R8CA 2ZE7A 1DOAA 3IQXA 3W34A 4HLUC 3FMPB 2EYUA 2ZPTX 3I1FA 3PIRA 2VP2A 2IS4A 1FL9A 1XEWX 1I2DA 2ZS8A 3BK7A 2VTKA 3QSYA 1SVSA 2DYKA 4IVQA 5FI1B 1HURA 1PLLA 3V9PA 1HYQA 3KQKA 4A6XA 2QT1A 4M22A 1N6OA 1HQCA 4JT2A 1GKUB 3B2EA 4JS0A 3QENA 2CLCX 4FW9A 2GHIA 4DLYA 1D8TA 1ZU5A 2A5FA 5JEDA 2RGXA 1XMSA 3MCAA 4CEIB 3IQWA 1E9CA 4QGAA 4LYFA 2AL7A 2Q3MA 3AKYA 1OH6A 1SVIA 4D26A 2QAGB 3KFXA 5E3HA 3QXJA 2QQ0A 5B64A 4IVPA 1ZNYA 2BVNA 1AN0A 3CLVA 4ZKDA 1Q3TA 1VIYA 3CH4B 3WBKA 1ETUA 3EZ6A 2O52A 4WXPA 1J8MF 1F2UB 4PHGA 4Q4AA 2NIPA 3RS4A 1GL7A 4A0HA 1R8QA 5K8LA 3ZYCA 1N5KA 1Z6YA 4B2LA 4M9ZA 1F3OA 1X1SA 4CEHA 5DSZA 2BEJA 2QBYA 3HU2A 4RD0A 1KI3A 1US8A 3H4MA 5G3YA 4RD6A 2J0QA 2EWWA 1OLOA 4HAXA 1A2BA 2GVDC 4C2TA 1JQLB 1XCMA 4LHVA 2RMKA 5CYPA 2XAUA 5FUXA 2WSMA 4OYHA 1Z22A 4EPVA 4LHZA 3K70B 2O8CA 1Z0DA 3IGFA 1Z63A 4RKFA 1GAJA 1QVAA 2XTMA 2RGNC 3B1YA 4I99A 3SZRA 5CK4A 4CVNA 5A0FA 4EAQA 2O8FA 1WB9A 5FBLB 2FPLA 2EYQA 4Q48A 3E1SA 3L82B 4NPHA 4FI3C 2NQ2C 3MAAC 1TNDA 1JB1A 3FB4A 3N70A 4NP6A 1DG3A 5FPTA 2ZYWX 3NC0C 4TSFD 1G9XA 3ADCA 3RC3A 3RRZA 3EC2A 3CRW1 3KUCA 1UAAA 4MITA 3QPVA 4B48A 2QTFA 2F3TA 3C5CA 3D7MA 3C16C 2GJAA 1KAGA 3B82A 3BS4A 2AWOA 2DCUA 3AGPA 1YRAA 2OV2A 5FTJA 1S1MA 2PX0A 2XNDD 4G5GA 1OB5A 1IQPA 1S9DA 1NLYA 4LBZA 3EIHA 3GLGA 1FP7A 3VX4A 5C1BA 4HAVA 2D7CA 5DI9A 5CLQA 5J4HA 1ZNZA 1QRAA 2GXSA 3KQLA 5F9HA 2CK3D 3KKMA 1D2NA 3AF2A 3AF4A 1Q22A 3GLFB 3B1VA 2BBOA 4Q21A 1AGRA 1PUIA 4PQYA 2RGGA 1G8FA 1MOZA 3EPJA 2A3RA 2BBTA 2ZS9A 3RSLA 2HCJB 5KPDA 4NYJQ 4A8JB 1P62B 2OILA 5FBQB 4YQFA 1YZQA 1Z6AA 2QP4A 2VPPA 4X8LA 4Q4HA 1OW3B 3LXRA 3VR2A 2ZYTX 4MRSA 4LJAA 1MT0A 3EIEA 3I5YA 1MRSA 1EWQA 4JLBA 4PSVA 4G3XA 1JR3D 3EWAA 2GEUA 3A8TA 3T5GA 1VECA 2ZRDA 2RHMA 5B58C 1E9FA 3C15C 1EXMA 2OAQ1 1AS0A 2E1RA 2ZREA 2CNWD 1XPOA 3TKLA 1NKSA 1VCOA 4WZAE 1ZW6A 2BMFA 2D2EA 5E7IA 3IEUA 3SI7A 2VIIA 1X6VA 4EPYA 1XMVA 2CJWA 1QHNA 1SGWA 2IK8A 2QSZA 2W6ID 4L9WA 3UATA 3EG5A 1WMSA 3CF0A 3DDCA 2ZR9A 4KFUA 1T3HA 4PQRA 1UKVY 3A4LA 3KJHA 1JECA 2IXFA 2BBSA 1LF5A 4YMVA 4W5WA 1OHHD 1F48A 2ZANA 2QAGC 3RRNA 3M6AA 4KV9A 4Q7MB 4Q18A 5DN6D 2YNMA 2Q21A 2V3CC 3BH0A 4MH0R 4N0EA 5JS8A 1KAOA 4HZUB 1G3UA 3BRWD 4QRHA 5CLLA 1R8SA 5CYOA 1VYVA 3CIOA 4KXFB 4C7OA 1DAIA 1G5PA 4HEJA 2WJGA 4MQBA 1IBRA 4TMKA 2WWFA 1RVDA 2NGRA 3RABA 5FBRB 1VCIA 1Z8FA 5AUNB 2W6JA 4W7SA 5JECA 4JLVA 3X1DA 2BWJA 4QGFA 1BOFA 5KSYA 3IIJA 1DARA 2PJZA 4Q4JB 1NF3A 1M74A 2YOHA 1JPNA 1ZM7A 1NIPA 2AXPA 2GJ8A 2ZQ5A 2QMEA 4PHFA 3GJXC 2J0VA 3OIWA 5LB4A 3TSZA 3K70C 3MWKA 3KXKA 5EJEA 1Y3AA 3LD9A 3WBJA 1NBME 3K9GA 3PEWA 1OPXA 2ZSBA 4TLEA 3QKTA 4PC1A 2GXAA 2YYZA 3TSWA 3MGCA 4MYHA 3AUYA 4B73A
chains in the Genus database with same CATH superfamily
1L8XA 1MCZA 4O1IA 3Q2OA 3LY5A 1ADGA 1JQEA 4JJFA 3REQB 1ZNQO 4NDAA 3A1FA 4R8KA 4OHRA 4D56A 2Y1FA 4B3IA 4XKJA 2MYUA 4Q34A 2NPFA 1V8ZA 4PXAA 2O5EA 1WXHA 3QLEA 4RQAA 5K0LA 3ZWNA 2Y6UA 2CLFB 3PHCA 5EUMA 7REQA 4HNTA 4HRXA 1N2IA 1R9GA 1RJ9A 1OIVA 1SU7A 1ZLXA 2VRCD 3BD6A 3P8ZA 3MW8A 3IQZA 3D8BA 3KKEA 4HSGA 4X95A 3VZDA 1VG9B 1XCOA 2CGEA 4LTMA 4YMUA 3I92A 3EXG1 3ZLJA 1G6OA 3S2YA 2KS6A 4LZNA 4LVCA 2N1MA 1GPNA 1FW6A 4NEQA 4DJJA 1DBSA 2VRWA 4AFNA 2XYRA 1M0TA 1U7DA 3EXAA 3WX0A 5KWIA 3K0EA 1OXKB 2FP4B 3R7AA 1XEXB 1ZKDA 2OXCA 3ED1A 2BELA 1UBMS 2QJFA 1DO0A 1WHTB 3E7XA 3NYIA 3ZJTA 1XYYA 3K0CC 4YRTA 3S1LA 2JLUA 3D8HA 1RKXA 2UZ1A 3PGKA 4LK2A 3H65A 1HUQA 3AJ8A 3WA7A 3KJQA 1XELA 1GZ3A 3NBUA 4FMPA 4AM8A 1SXJD 1NQAO 2QVYX 1G5IA 1XTKA 4HD8A 3SEQA 2J5RA 4TVBA 4KODA 3HA3A 1MPXA 3N8HA 1FRZA 1PNOA 1JI3A 4LJ4A 3A4MA 4RKEA 3RR2A 3GLFE 4PZUA 3CSSA 1Z33A 3JAMA 1S01A 4ZCMA 1HDGO 1TYEB 4M8IA 3MWEA 2Z95A 3DMYA 4JYBA 1CUHA 4LEIA 3ZE2B 3C6KA 4TX1A 1JV2B 2XXJA 4OATA 4PPFA 2NSLA 2QTCA 3NEYA 5FWYB 1TEZA 2C8VA 1Y8RA 1NOJA 1MW9X 2IF2A 3SQDA 1J8FA 1ODFA 4GNKA 3SZ3A 1DCTA 4NKRA 3ADKA 4CLRA 4IJVA 5LMUB 1AQYA 3OT1B 2G9VA 2ZIVB 3I0NA 3X2EA 5D84A 1E4YA 5AVOA 1E3MA 4JBHA 3AI3A 4M88A 4CLEA 5EHZA 1KWGA 2HA6A 1XQYA 2O48X 4QU9A 1PJRA 1KIMA 3IAM1 3NEJA 1TUIA 3SYTA 4O4LA 4EH1A 3COWA 5AYVA 5JD4A 4GUAA 5C80A 1GTJ1 5DCLA 1DEHA 2XW6A 3I8XA 2QW0X 2X19A 4JA0A 2P62A 3RYCA 3MXTA 5ITSA 4GL2A 4HEHA 1LPSA 1OGYA 1S3SA 3ICOA 1II9A 2AKYA 3CNHA 1G5TA 2EP8A 4FYHA 1NDUA 3A6FA 4C30A 4LS3A 3QKRA 4HMPA 3I34X 1PVOA 3I76A 4H08A 1TGVA 1K7FB 4KVZA 2X6QA 2CHEA 3ESRA 5BMVA 3WAGA 5FOQA 2IP2A 5JG7A 5CT6A 3GRCA 3B13B 4Y2JA 4W99A 2AFIE 2YIJA 2FHSA 5D6NA 4RMJA 1LI7A 1LY1A 1QV7A 1VJCA 1E3JA 2ZYVX 4QQ8A 3RYHB 2R2AA 2OBNA 3KJGA 2KBEA 4LYYA 5ALJA 3H6KA 4FLEA 3FOCA 1GTZA 2Y1XA 3FR7A 1VC2A 3CLUC 4UVDA 4ZCTA 3DAFA 4FQ7A 3HO8A 4HWOA 3UQYS 2QL7A 1ZMOA 3T3MB 4BX9A 4MA0A 1P9OA 1QS0B 1O58A 1XROA 2VI5A 4FZ3A 3VOTA 1N5RA 4BAUA 4EW2A 1R50A 1PJ2A 1YGPA 1E2UA 1CVIA 3N8IA 5JW6A 5LZ9A 1F1BA 1KKMA 2PMFA 3KHSA 4KBFA 3TS1A 1P1IA 1VIAA 2CEAA 1E6KA 3D3EA 4TT8A 4Q7QA 1NF9A 2CHVA 2QVZX 3W8NA 4CM6A 5M5BA 2JG3A 2WZQA 3WGGA 1PS8A 2WE8A 4PAQA 2QZZA 4BZXA 1R3DA 2J59A 3W6OA 3QEJA 5MFPA 3GH1A 1FVFA 4WMLA 4MW2A 2IHKA 3EZ7A 4YXWA 1JAYA 2WHYA 1XB2A 1PDVA 4ABTA 4DA4A 1N78A 5C1PA 4KXNA 1U81A 4OYLA 3OZIA 1V7PC 2UZAA 4PX5A 3M6XA 5EZSA 4FJ0A 1E92A 3A25A 5DNAA 4I1OA 3LGSA 4KW7A 3V6LA 1QU2A 1F0YA 2GZ2A 4JC4A 1CDZA 1W94A 5L4NA 4FSXA 5I9BA 3ZNOA 2BFOA 3KSZO 3U3RA 1X8LA 2M6LA 3JAKB 3C1AA 1K8RA 2OZVA 4HB2A 1P1BA 4R9VA 2EATA 1QRTA 3ZCUA 5KTKA 1U8CB 3BWDD 1BROA 4KIWA 4QUEA 2CNOA 3WADA 1IXYA 2OZLB 3NHBA 3DSRA 1K7XB 3KAQA 4LWQA 4UFPA 1RT9A 2Q07A 3TL2A 2RK3A 2CMKA 1IHUA 1FSPA 3TJZA 1JG1A 1TKAA 4RA6A 1Z5PA 2HJVA 3GFQA 3R3WA 4LXUA 4PZEA 4TYNA 1RU3A 2GEDA 5JXJA 3BFPA 5GV8A 3VMFA 2I2CA 3I6QA 3QFSA 2ID9A 4QDTA 3DTVA 2NT4A 5GVRA 4YX9A 4FE3A 1DEAA 2FPGB 2XWSA 1HSZA 4IAOA 1I0LA 4W6QA 4MV1A 3O47A 5FKJA 4LQCA 3TJMA 5K3EA 4JJZA 3A1VA 5T4BA 1B23P 4MO9A 4WY5A 4JI4B 2M6SA 1TEHA 1S7GA 4EVRA 3R3XA 3ZUGA 4DL9A 4FZRA 4L6AA 5BSUA 3MMNA 4H15A 1NSFA 2VJOA 2OEPA 4F7WA 3L01A 3OQBA 5CX1A 3JQEA 1DJNA 4Q1VA 1H6BA 3HZRA 3IQDB 1N3BA 1SIBE 2R8ZA 5B2EA 4BX3A 5B57C 5KYYA 5IU6A 4WK4B 5F98A 3WFIA 1Q21A 1S4QA 2A1TS 3TCKA 4EBFA 3G7NA 4IPTA 4H35A 4MZXA 3TEMA 3A3YA 4UUPA 3SJZA 2V6IA 1P0QA 3HXQA 1GDTA 1PJ4A 1VB3A 3H04A 4FFSA 1K5HA 2PNFA 2DXIA 4L85A 3UWMA 1C2YA 3ZDBA 3V2GA 5E3JA 2WJHA 5BSMA 4DMCA 3OCXA 4DANA 3HKEA 4P2BA 1MRNA 1T3TA 4D57A 4AN0A 4OHFA 5L40A 1R6BX 4CI9A 5JIBA 1NUPA 2WJVA 2Y93A 2O2DA 1WCIB 3C3XA 1ZGAA 4IHJB 1VKJA 4WXRA 4UQOA 1TLFA 3V2UA 1GPWB 4PNHA 5AK6A 2QTHA 1ZN9A 2GRJA 2JGIA 3FPLA 4BVEA 1YZUA 5IBRA 2VH5R 4AURA 5I7OA 3RSZA 4FSHA 2IS2A 2IEBA 4G24A 3W78A 5FFFA 2I67A 1M1YB 2HFKA 2YVLA 1UF9A 1PWYE 3Q6IA 4RDXA 1AB5A 2D1QA 3TLEA 4PU0A 3S68A 2YZNA 4GGOA 3S7ZA 3IOYA 4IJQA 9LDTA 4E4RA 1MQ9A 2ZAGA 1AMUA 2VZLA 2DKNA 2EEZA 4QWMA 5G1NA 4FXPA 2K2WA 4YP1A 3TINA 1GPUA 2J3JA 1JYEA 2B4TO 1W88B 4M4SA 1T0BA 2QVLA 2G76A 3NT4A 4Q5IA 1JUDA 3SN6A 1PTJC 4FFMA 1K0UA 2ISQA 3ABRB 1WDLA 1L4HA 1ZD3A 3IAS1 3PE4A 3EDQA 1PR0A 4D9MA 2QSJA 2XUKA 2AJBA 3RRYA 5LYJB 1WU8A 1DBQA 2UV8A 1E1DA 2PWPA 2IHZA 5CB6A 2VHJA 2RKWA 3UJBA 4HLCA 3Q72A 1JAXA 3ZD7A 2P2DA 4Z4GA 3T41A 1OH7A 5FTNA 4MGIR 3ERCA 1Z45A 4MLDA 2WTUA 2WF6A 2Z1MA 1OI2A 4KB5A 3SFVA 4BRSA 2B30A 5C5IA 2XVMA 5JFOA 4JUIA 1MTZA 1CUBA 3HCRA 3TEFA 3BVPA 4BNKA 3DKRA 1NJFA 5J2UF 2OXTA 4KXXA 5BV2P 4DILA 3FTCA 1M7GA 1WPXA 2ZBVA 5AKJA 2R00C 4BJHB 1N2OA 3OQMA 4PLVA 5CNMA 2Y1GA 2H48A 1BJKA 3GN2A 3GVCA 4IXMA 4Q1DA 1G42A 2GSDA 2WD9A 4YVFA 1E3EA 3R6DA 3T35A 4DV0B 3L79A 4DBZA 1E1MA 4WGFA 1V8PA 1ST2A 3BMQA 1EYZA 4XYGA 2HREA 1XNRB 1OCEA 2I2WA 3QOXA 4YMSA 1E0JA 4M8SA 3S7TA 3WK8A 4DG5A 3LLSA 2ZDGA 2YINC 3H75A 1SK9A 4QG7A 5FJJA 2REQA 5TMEA 4EHNA 1DCMA 4ARBA 4Z1OA 4Z7OB 1XUOA 1QPZA 3GT4A 3PDCA 3E27A 1G2QA 3STYA 5JSUA 1IJKA 2GFQA 2XVYA 3JALB 2QLTA 4PNPA 4DN6A 2CXTA 4DSAA 4UEKA 1EGVB 4ENQA 2VL7A 3IHWA 1U1CA 3RSQA 1TFUA 2RHTA 3N59A 1ZIYA 2AOXA 1BYUA 1T9ZA 3FNFA 2I3DA 4ZT5A 2P2NA 4AX4A 3HEBA 1G7SA 1T25A 3QVMA 2Z8YA 3NVAA 4ZCPA 2J3IA 3LDAA 4LE2A 4GOND 4TXMA 5J43A 2BKEA 1FZQA 2Q1TA 4NZYA 4KG7A 4PG4A 3WJ2A 2ZIUB 3SXPA 1DEKA 4LXYA 1N2GA 2RH9B 3PCTA 2B2XA 1RYDA 3K2IA 2PFSA 2ZPAA 5FRDA 2E5LB 2CNWA 2JFBA 3OTQA 1B00A 4X62B 2X86A 1S2OA 5IXJA 1H2ZA 3R7LA 3F5SA 2ZSEA 2ALJA 2JW5A 3NJ4A 2O0HA 4RKWA 2OE2A 2VYQA 2FX5A 4A10A 2O4CA 4BNVA 5C5DA 3M82A 3PSAA 4N5IX 3QPWA 1MOPA 3HVRA 4R1MA 2GOYA 2DULA 3DW3X 1CQIA 2H18A 1BX1A 4ZQGA 3MS2A 1NE7A 1KMHB 3KWFA 4Z0HO 4DLBA 4XIGS 4OHZA 5HQ3B 4YXWD 3K0KA 3OMLA 5IJ9B 2GYVA 3E03A 1FFBA 2FWMX 2F4NA 4OB7A 1N7HA 3FTEA 4BQRA 2AHOA 5E4TA 1CY2A 4P0PB 1ISFA 4N3BA 3K4QA 5F7JA 1SBHA 1K0FA 1P2FA 4JJ4A 4YT8A 2V8OA 4RM3A 2PD3A 3AZOA 4OMCA 3NIWA 4E2WA 2QV0A 3H2JA 3IKTA 1L7QA 4P7GA 4PZDA 3LO8A 1GUZA 2IW3A 1XPRA 2G1KA 1XTSA 2VUHB 2XLBA 4OA5A 5DWVA 2XNCA 2O2JA 4KRYA 1U0GA 4D02A 4OK5A 3WRVA 1ELOA 3BRQA 4P53A 1URPA 2OCPA 4W9MC 1AMNA 4ZYTA 1V71A 1A1SA 2EL9A 3I45A 3TRIA 5ICCA 4OUDB 3K0FA 3C1OA 2XTAA 4JI5B 1ZESA 3RS9A 4GBED 4N6NA 1WKVA 4LBYA 3DTVD 4LOKA 1M1YE 3N7AA 1KYVA 3P0FA 1WB4A 4BWVA 4F11A 3D7KA 3ZN2A 1AS2A 5KU7A 4DLNA 3MLBA 3QLVC 5DHTA 5HMMA 4MS3B 2XCIA 4Y8VA 2ATVA 4AD8A 3TQCA 2NXEA 2P2GA 3PFFA 3WE7A 4W82A 3HL0A 4MS1A 2I1VB 4KVFA 4E1AA 4NQRA 4BXOA 3GLQA 3IMKA 3BJIC 1KMCA 2ZCVA 4F3KA 3HHPA 1TVKB 4ME6A 1E6UA 3LTEA 4IDEA 3PWKA 1NUQA 1PQUA 2NUTA 2DWOA 3ZHQA 2FUNB 1D7OA 1OZAA 2D5AA 2OCBA 3FYUC 4KPUB 2QRJA 3RB8A 3UZUA 2QOEA 3HMQA 5HKBA 2B6NA 4MRMA 3U4QB 4JI0B 1GAQA 4XVUA 1RZ3A 3F9IA 3WXBA 4U7JA 1QDEA 5B7PA 1UPTA 2EWMA 1VE3A 3EGDB 4LHSA 1NVUQ 4Z7QB 4XWGA 3CVYA 3NW9A 3VRHA 4GP9A 3CPHA 4JASB 1C7JA 1QORA 1SQ6A 3BRSA 3HPQA 4Q9HA 4QSHA 4QOFA 5AXDA 5MN6A 2EFGA 5EIAA 3U4HA 3PUVA 1E3TA 1G17A 1VXOA 4G8BA 3TOVA 3HWX1 2PH5A 5KNDH 1A9SA 1FMTA 1QFZA 3IUYA 3O3CA 5CDFA 3WHPA 1WZIA 2HYDA 4BRUA 2GCOB 2JLSA 5A5DA 3G23A 4KRXA 4PG5A 5TMPA 5MHTA 1O5OA 4YECA 1AZSC 2ZJ5A 2ZROA 2QRMA 2JIRA 3X1YA 4EGQA 4GT1A 4L15A 1KGSA 3PVCA 3UUWA 5F2NA 4GECA 2Z6UA 3PYLA 4PYJA 3TFOA 3W1VA 4JT4A 1GGEA 4J1SA 5J47A 1B8NA 3EPHA 2C00A 3TBKA 3AI1A 1TCBA 1GLGA 1M2WA 4FK8A 2RHJA 4L74A 3WGNA 1ANKA 4QJ3A 4IYJA 4HGPA 5TQ0A 4MPTA 2X4DA 4H1UA 1C3VA 2YVKA 4XDYA 5K8JB 4JMPA 6PFKA 2NYUA 3CW9A 4OJQA 1X19A 1CFJA 2A6PA 1JH8A 1W0JA 4EMBA 5LZ4A 1X14A 4PQEA 1E6WA 4MR8B 1YXMA 2WKWA 6LDHA 4A36A 3HSYA 1EWVA 3PQEA 4JCCA 2VTBB 3E5MA 2J3MA 3R0QA 2DY0A 3WZLA 5AVVA 4QNRA 4DR4B 3FLBA 1VMKA 3H99A 3ZZ1A 1WWKA 3Q3GE 4CUKA 4HWRA 1GFSA 2YWEA 4OHOA 4Q1CA 1QF9A 5I6DA 5SZHB 1U0RA 4DMGA 8LDHA 5FBHA 3JZMA 2IOYA 4BY9E 2W2NA 2FK8A 3IT0A 4FOSA 4BBPA 5AFSA 1OLUA 1M5TA 1VKNA 3RAPR 2WQZA 1XCJA 4LV6A 5B4UA 1FBNA 3VSAA 4D4HA 1TADA 3NUZA 4XGIA 4RXUA 5EVCA 3JQ6A 1TIPA 4G1BA 4BC0A 1V3VA 5CCXA 1H1LB 2BFNA 2K7ZA 2HXSA 2VDKB 4PFKA 5C9ZA 3KKPA 1OXTA 1XZHA 3O5AA 3M34A 1UH5A 5B53A 4BNGA 5AUOB 3U26A 5CJ2A 4EQZA 1UBLS 1MGOA 4G0OA 4N8EA 2B5VA 3N39C 3SCZA 1N2XA 4BVFA 3JAWA 2L69A 1ZSNA 3CX8A 1SKBA 1X42A 4MYTA 1FNBA 1RQ2A 2F67A 2GDJA 2VPIA 2JKVA 1VG8A 2VUTA 3BX1A 2P2CA 1W75A 2Q62A 3CG4A 3JRNA 3KL4A 4TTSA 4Z3DA 3QBTA 5HCIA 1TJYA 4CW7A 1AXEA 1RYMA 3G17A 3MT9A 1Z6PA 1BMFA 1YUMA 1XJ5A 4C0AC 3IPYA 1SVLA 3FCAA 2PS0A 3ONEA 1VI5A 4I08A 4NS4A 5AJVB 4G0VA 3R5JA 4PZPA 3EIQA 3TDKA 5KTNA 1C9MA 3NGLA 4QM6A 5HSGA 1GL6A 1NX9A 4PPYA 4MHSA 1WHSA 3GJ8A 1O0CA 1X13A 5AWFC 5E1DA 3AKZA 3RSHA 4DPMA 3M6UA 4ZCRA 3KQVA 3CPJB 1UCFA 1ID8A 3WICA 2XMRA 1GPDG 4FFBA 1Y7IA 3QW2A 2YJNA 4WASA 3V8MA 3UKDA 2WTAA 3AH8A 3RK0A 5IDQA 2GSWA 1EQUA 2ZYDA 1A77A 3I04M 2K5UA 4D92A 2C9YA 4Q4JA 1EGQA 2JGMA 3MXOA 4M1EA 1WMDA 1V7CA 5ABPA 5JCZA 3Q3EA 1FFSA 4F5EA 5CNIA 4C7MA 2J6CA 3CRVA 2VTVA 3I52A 1RYEA 1DTWA 4TKUB 3A1WA 4XR9A 5F3RA 4PCVA 5BT9A 1NW8A 1DFIA 1E2JA 1Q6YA 1QKIA 2OK7A 4N18A 2Q3EA 1MN6A 2HCTA 2P9JA 3PVSA 3UOAB 3INNA 1K7SN 1DLJA 3ZHYA 2LVBA 1GSOA 2G67A 3QVGB 1DJQA 2H1LA 3BZBA 4DM3A 1FDTA 2Y0PA 2IPLA 3K0SA 2VSOA 4JP1A 4TKVB 1Y5MA 4E5NA 4TYYA 1MHTA 1THMA 2ZSAA 3KR0A 5JO9A 5TQJA 4M89A 3T9FA 3IJRA 4Z1MA 5ERXA 4H4DA 3BMCB 2QLBA 1Y4ZA 3O75A 3LF2A 3R9IA 3M9XA 1KI4A 3I1YA 1OWOA 1QZUA 4IGFA 4EW1A 4WEQA 2B3DA 3A9SA 1DKOA 4WNIA 1FNCA 1FX0A 3VJMA 3NX4A 4P3YA 2J30A 3C6MA 2TMGA 2JHAA 3W9UA 3VPGA 4D96A 3OPYA 1V25A 3F6YA 4LDPA 2GJ4A 2PM8A 1FLNA 2OQVA 4FU0A 4J0QA 3CJTA 4CKCA 4FCCA 2RKBA 3HCAA 4OFWA 3LE8A 4QQRA 1MG5A 2IEAA 1J2EA 5IM5A 3E35A 1PSDA 3CHYA 2HHLA 1NJ1A 4DLPA 3IT1A 1L1EA 1IWOA 4IIUA 4W5HA 5TDHA 4LPKA 1V1RB 4IV8A 5FWXA 3VPCA 2BFCB 2IQ5A 1R15A 3H19A 3OOYA 4M1YA 1YVEI 1QH1B 4UVGA 3R1IA 5J5AA 3QJGA 2X2OA 4MGHA 1J4AA 3EEBA 1M8PA 2SKCA 4LHXA 5E9AA 1NJ8A 1KETA 1SXQA 3D3NA 4LJ7A 4ZAFA 2JLRA 1B6SA 4Z4CA 4KNYA 2VTDA 3M9LA 3FMOB 3NHWA 4DDUA 4RQTA 2B4RO 3Q0EA 1JEQA 1K66A 3DFFA 4OLHA 2WINI 5BYJA 4C9BA 2G1JA 2QXTA 3WTBA 3IEXA 5JC8A 2DAPA 1KSFX 2PX8A 4DY6A 3BICA 5ADHA 5EXSA 1SCBA 4HDRA 1W5BA 1YR7A 3C4QA 4HRAA 4P7KA 1RPNA 3FN4A 3KELA 4S2EA 4U3JB 4XQGA 4RLHA 1AO3A 5B3AA 3ZXIA 1FYXA 1X7YA 2QTRA 3SBDA 1YB1A 5E1BA 1VMEA 3EMBA 3L7CA 4UJ3A 4KIUA 3OTGA 1TMKA 2YVUA 2H7YA 3T3OA 1FP2A 3N2GA 3KKLA 2OZPA 3BXPA 3DMTA 2PXCA 3KJFA 1DS6A 1JG6A 3PFBA 4KO4S 2NVUA 2GLXA 4R41A 1AQNA 4BFZA 1RXUA 3DDUA 4KAJA 3RU2A 5BSEA 5AH0A 5EIWA 5BSGA 1FF9A 2CLHB 2AEJA 3GK3A 1PGNA 1N6HA 5EIBC 3L05A 4JEMA 2FEKA 3U09A 3SY8A 1W48A 4ZU6X 3RIYA 4IMRA 3AEZA 4Y2YA 2LV8A 3SQMA 1DOHA 3QUSA 4B9AA 1L7EA 3F6EX 3H9GA 5T6BA 3W79A 4KPYA 3M2PA 2NU6B 3UAXA 1NMEA 1Z29A 2JNWA 3K9QO 4XIIA 3QG5A 1LH0A 2DX7A 1Z38A 3TF5A 1KEWA 2C4WA 3WIDA 4BPRA 4OREX 2HN9A 1TKBA 1XJCA 1O8CA 1R88A 2Q46A 2ZRCA 3I9FA 3MCVA 3N87A 2PT6A 3AF0A 3G1UA 3LZ6A 3VR1A 1IN5A 1W0JD 3EASA 1C50A 1GU7A 4O4JA 1QSGA 2XIQA 2VBIA 2YL2A 3H84A 3INTA 3LPDA 4NV0A 4MWGA 2WTXA 2V7VA 1G3QA 5DV9A 4V0ME 4NJOA 3HP1A 4JL6A 4R2JA 2C2GA 3M5CA 3DT6A 4XUCA 1FFXA 1GCAA 4MQUA 2REXB 4XM2A 2IHYA 1YKGA 3TZQA 4C89A 4EPXA 1Z07A 3DPSA 4Q3NA 2BFDB 5SY9A 5EGNA 3T3DA 2XQGA 5JCOC 1EBBA 1EJ0A 1PQWA 3FHCB 1H42A 2R96A 4YI5A 2DQSA 2OM2A 3DJYA 5ALIA 4FDAA 4EGJA 1IXKA 4U2DA 1WUHS 1EJ2A 2VNAA 4GFDA 5ICSA 4LY0A 4XD7A 2EX0A 1Y3CE 4B40A 2P0EA 1GU1A 3DBOB 1NSTA 2IXAA 2OCAA 1JJFA 2FQXA 4EGCB 4ZO4A 2W2PA 4IJMA 4MUKA 5J2TF 4F1WA 4ZVNA 1OX4B 1XLUA 3IDOA 4HDNB 2XHEA 3HH8A 3ECSA 1CJVC 3RNLA 1HLFA 6Q21A 4RDCA 1KIFA 2H65A 2LD4A 3QUAA 4YUYA 2P2YA 1K6JA 3D81A 5IYZF 2PUFA 1BH2A 3KR1A 2QL9A 4HPWA 4OBBA 2RKOA 2WYIA 2FCAA 3JQ9A 3QLJA 5E95A 4WY2A 2IIQA 3GJ6A 5SV2A 4BATA 1UKZA 1UBHS 2O1SA 4Y3UA 1HFWA 2XCUA 2WFLA 1B6GA 1DV2A 1UC5B 1UZNA 1ZG3A 4N39A 3KLBA 1AUXA 3WGIA 3F4LA 5JYEA 1QHGA 3UJ8A 1OGIA 4XZ3A 3CKYA 3IKVA 4F3TA 3AGQA 2AVNA 2ZWAA 3GD7A 5BN4A 3TB4A 5LMNB 4Y2XA 3WLIA 4EFLA 3ULKA 1U0FA 4YHBA 5FX2A 4LOJA 1OXMA 2C9DA 2EZ9A 4LI0A 1CUAA 1MQ8B 2G9UA 3KWJA 4CKZA 1XPUA 2CFOA 3KJZA 4EX6A 1MABA 2NZ8A 3B3JA 1SHKA 2P41A 4OQNA 1PK9A 1UK6A 2QTAA 2ZAMA 3DVSX 3ZCVA 4URVR 5EQFA 3AJEA 3FOFC 1ADYA 1S96A 1KXJA 2IJGX 4GC9A 1AGYA 2F48A 5BQPA 3GDFA 4KEAA 2GZMA 1RM5A 1T2VA 2DGDA 3O83A 2GD0A 1C4OA 4K2AA 4OJKA 4MAAA 4B74A 1I6MA 1QE5A 1T4CB 2EZ4A 3QYPA 4GM0A 3AFNA 5JV5A 6YASA 3G88A 1N7IA 4BNXA 2G3YA 3SHVA 1PF7E 2ACKA 2IX3A 3V8VA 3NDBB 1P7PA 4M83A 3WWYA 3I4LA 3KCQA 4RXTA 3OURA 4OYRA 3RBAA 1Z47A 1JNXX 2DEUA 1JIUA 1WLSA 3TNDA 4Z1MD 1A4RA 5FORA 5FOWA 3HI4A 1K5DA 3UKOA 2OGWA 1AT1A 4YAJA 2GQ0A 3WTCA 2CZQA 4NJEB 1TW3A 3OWXA 4CQMA 3K6SA 5IG2A 4Z9XA 4RD4A 4NBTA 5KQLA 1JKIA 4OMDA 2QP3A 1EK2A 2XMBA 2ZRKA 2BT4A 2X5KO 5DULA 2ZQYA 1AXGA 3JYLA 1NV9A 3ROPA 1NVGA 4D98A 1Y5IA 4WKCA 5IKOA 5EJ5A 3M4ZA 4WZBA 2GF2A 1ZICA 2IDZA 1OTXA 3OZXA 2QN2A 3F74A 1GN8A 3ESXA 4GI5A 1OQAA 1JX6A 2GPYA 1H0RA 2HDWA 5AK3A 5EHGA 5BSTA 3UHAA 5BR8B 5CA1F 2ZUVA 1Z3IX 1DC3A 4HN2A 3RU3A 3GT0A 3TSAA 1IRIA 4AI6A 3L8HA 3IBCA 4X93A 3ODPA 2QKYA 1GGKA 4XUDA 4Y67A 5JWHA 4UU8A 2W2MA 3EPKA 4FFRA 1T1JA 7ABPA 5AVKA 3AUXA 3L0BA 1LSOA 4PRKA 4E31A 1A9RA 3U37A 1M1XB 2EW2A 2BUCA 3WLQA 2GT1A 1B0AA 4IQFA 1E6EA 5CFQA 1C3OB 3NH9A 4CTKA 1BC5A 2QQEA 2BTQA 2G40A 3NKFA 1RLMA 4OLJA 1BIFA 3AHDA 1KEPA 1IOVA 1Q95A 1YQGA 3GP5A 3KE8A 2O2ZA 3P0RA 2JB9A 1LSUA 3C3PA 4RFSB 2MYTA 1SBIA 3M5WA 3A27A 4NPCA 1NBIA 1NAHA 4QTYA 5JJBA 3O6VA 4RIIA 3UAOA 2V1UA 4K81B 3T9AA 2WY2D 2IU3A 4NE7A 3VKVA 2VSFA 3F8WA 2XUHA 4ETWA 1NN1A 2PBZA 5SZKB 2VDJA 3DBLA 4C01A 1JHVA 3HJAA 3LSYA 3OPNA 2OM6A 3LCMA 4FYJA 2FGJA 4LJRA 1UJNA 3AESB 3LRTA 3A3PA 5KYWB 3BEOA 1QGED 3RGWS 4LFCB 4MMYB 3S29A 4EKNB 4RTRA 3OZWA 1A9TA 1QQ5A 2OAP1 2WBLC 2XB4A 2FSIA 2R44A 3PIIA 3QEMA 4PHCA 1NFRA 1Q1EA 1E96A 3F1LA 1SKYB 2V4ZA 1M33A 3IUPA 1MIOB 1V41E 3D9QX 4KHPB 2P4EA 5AP9A 4BMZA 3NIBA 4BNLA 4GH5A 2UUAB 1PG2A 3N53A 3H97A 4IX1A 3OLCX 3U9SA 4Z8XA 4D6XA 3X1WA 4W5QA 4F71A 1D0VA 1ZRMA 2R6CA 5BUSA 4X7PA 4K6FA 4BTEA 3TYXA 2QPTA 4QUGA 2O8BB 1SG6A 2IYSA 5EINA 5FAKA 4RTLA 2P3QA 2CXOA 5H1YA 3OJCA 3VR5H 3T9CA 1HNWB 4O4HB 1T5SA 1A0OA 3OZBA 4TLDA 1BE0A 1RWXA 4LJ9A 3EH2A 4QFMA 1MQAA 1A7AA 4AQYB 5HCUA 3AUTA 4ZDJA 1J9EA 3AZQA 4B5KA 5FP0A 2F1RA 1VOTA 2ZRLA 5TF4A 4HNAB 4H0NA 4DCTA 4DG9A 2F62A 4Y9SA 1CZLA 1OROA 1X94A 2ODQA 3L8FA 3OP4A 1K8ZB 3RIGA 3TQTA 4CMEA 2XVAA 2EP5A 1LK0A 1AVTA 1FUEA 2V6FA 5EIHA 1SZCA 2JRLA 1B0PA 4M1KA 1QZ3A 4X1KA 5LLDA 5H8WA 1GNPA 5KVAA 3EFOA 2P2SA 4WDQA 3ESQA 5AO9A 2NSDA 1NI4A 2YDYA 5CDYA 2H1OA 2OAGA 2Q5JA 2PQMA 3LOPA 3ORFA 4J0DA 1NVVQ 1Y1LA 2HPZA 2H1FA 2IDKA 4YDHB 5CPBA 2ZS7A 3HXTA 2CLLB 1GXSA 3SZLA 1G2OA 2WG0A 3AI2A 2H11A 3ZKAA 4H4EA 2QIPA 1SEVA 1ZPDA 2YMPA 2IEZA 1CRZA 4XD7D 1MAHA 4JSTA 5BXQC 1E7QA 3QE2A 4QYXA 2E4VA 3PX2A 4RQUA 1ODKA 3HA2A 3A6JA 3K3PA 4IIHA 4EW6A 4PFJA 1EVQA 2PLFA 4JP2A 3ZGLA 1USIA 2GBIA 2PRJA 4CLXA 4BO6A 2PMKA 2A9PA 1IM5A 3AB8A 4JN6B 1WA5A 1XZDA 5E0OA 3I2KA 3EFEA 3PSHA 4BWGA 4E07A 5FEUA 4RMIA 3UPTA 1Q0RA 3C39A 1P4GA 3NHYA 3W5VA 2IGBA 1C14A 1HL3A 2FN9A 2VKQA 2WV9A 1T0IA 3FPFA 3MZ0A 3OQJA 3CWCA 4QPNA 4QQKA 3ZZ0A 4N8DA 4ZK2A 4B47A 3IXQA 3L43A 3I9JA 3P9YA 1PBTA 1C8BA 4OFBA 5JSZB 2QYHA 1KFBB 4H6VA 2YC2C 1O89A 2G80A 4LMAA 5C7YA 2XF8A 4LHWA 5LQUA 1QX3A 1KEVA 1B1CA 3N7TA 4BO5A 4JBNA 3PA8A 3ZQ4A 4YT4A 5JOQA 4J8PA 4B81A 1K6EA 2BH9A 2P27A 4I1SA 3AUFA 1WMEA 4P98A 2O3RA 3MWDB 2YASA 3LPAA 2FEPA 2ODNA 5FUWA 3L4SO 4J91A 3TSYA 3W6PA 4C3UA 5KU1A 2IHVA 5EOVA 1QZZA 4JC0A 2HWKA 3BXEA 3TE7A 4YJFA 4JQSA 4C6HA 3AEYA 2BEWA 1TM1E 4J94A 4RMNA 5C8YF 2N46A 5E7QA 1CJTC 3DBHB 1ZGBA 2FZ5A 3V1TC 1TUBA 4AUEA 2PPVA 3CSDA 4K9SA 2XDWA 4CBVA 2F2TA 3ELWA 4AJEA 1HQYE 2FPUA 4AUNA 1FFCA 1VSQA 3TMKA 1QIDA 1E7MA 1PV4A 5AIAA 1Y37A 2X77A 2D1RA 2GA9A 2J0UA 3D8RA 4G4JA 4PAMA 4WGGA 5AJTA 1DC6A 4IHKA 2GF9A 3W8FA 1U7XA 4WVFA 4GOXA 2P75A 3L5KA 4QHTA 1UEJA 3QHPA 5F5XA 3GEPA 3ZDZB 4ZZ1A 2Q6LA 1J5PA 9ABPA 4BBZA 4LPSA 3B6KA 3KEMA 1NQ5A 3FG9A 4I4TF 2MWMA 3W1WA 3JWPA 4C87A 4E3WA 1M34B 1UJ4A 5LLSA 1T4DA 3U31A 4HYYA 4JYZA 2OT3B 1U28C 2VJCA 3NATA 2PJRA 1U9JA 3Q3CA 3CY6A 1Z62A 3PNPA 3O7MA 5AI9A 4EA7A 4G1FA 3ZJUA 4BVAA 4MHTA 3IT2A 3T7IA 2ZJAA 3GEEA 2X6RA 2VUIB 3L8ZA 2F8SA 8MHTA 1YONA 3FDFA 4FCWA 2R62A 3K9BA 1HKUA 5AW2A 2ECQA 1Y1SA 4YMHA 3OF2A 4S1NA 2VO1A 5FD8A 5BWMA 1V4BA 3VR4A 3AVUA 2EGHA 1PDOA 1AIPA 5L3VA 3FUCA 1X15A 2ET6A 4AMGA 4E2FA 3P2YA 1SKYE 1EUDB 1XOIA 3C3YA 2WNHA 5CA0F 4B33A 1UT8A 1EB8A 4GI2A 3IC5A 3OEYA 2OBBA 3P1JA 4L5AA 4MIYA 3P9QA 3PTLA 1KO8A 3E9MA 3O4RA 2TYSB 1P74A 3DLIA 4FHEA 1ZD9A 2AB0A 2JJQA 1PEAA 3C3EA 5TRTA 3T06B 1E3LA 3KB2A 2R4UA 1T0PA 4R84A 1RAHA 1QOPB 1VLVA 3O1LA 3R5TA 1R4MA 4CFYA 4D44A 1X9HA 2P9EA 3H7AA 2J7PA 4IDNA 2J3KA 1DQZA 1JIIA 4GKVA 1CUIA 1KZ4A 2EQBA 4QJ4A 4LNHA 4BNTA 2Q9AA 3C3JA 2QP9X 4R8RA 3C85A 2NU9A 4AZWA 4DA6A 3QELB 5IN4A 3ND9A 5EXPA 2FRXA 1JEDA 1P80A 2DUNA 2PLAA 3Q6NA 4DNXA 3KFVA 3FOEC 3O2SB 2ZBFA 4Q24A 1IG3A 4KR3A 2OYSA 3IAEA 3EMDA 3HU3A 4TSKA 2O2CA 3S27A 3OFSA 1Z74A 4Y6QA 1ZMXA 5CFLA 2I22A 4D0SA 1NVBA 1ZXBA 5F1YA 4HAUA 2OKGA 5DM2A 3W5DA 4ZOCA 3DE2X 3GRUA 4X85A 1VGQA 1UPXA 2RONA 2V8BA 4JVNA 4KWHA 4FI3F 1NX6A 4YLGA 3HCWA 1GQOA 3MTEA 2HGSA 3TDMA 5KTMA 3X43A 4LVOA 2P0YA 1G5QA 1ECFA 4PX9A 1YUBA 5EHIA 3ETNA 2AJCA 1V5GA 4TZ6A 1FJ2A 1XU9A 2R1VA 5HS4A 5T64A 2BHNA 4AICA 4G0NA 2C2WA 4ZANA 5FULA 3CO5A 5I7HA 3U61B 1O03A 1P5JA 4IIVA 1J24A 3MJEA 1AU9A 1QMPA 1XCPA 2I2DA 3GAFA 3O1IC 3EUFA 4MQEA 1FK8A 2OCLA 5FH9A 1MTOA 2EW1A 1F6BA 1I0IA 2TSYB 1CZKA 4YMWA 1GGJA 2HLHA 1A71A 3C45A 1IN7A 3VR3A 1WZ2A 3C74A 3L0PA 2AJTA 5K0JA 2HWWA 1K75A 3CPEA 2VG8A 5JFTA 3CSUA 3DFIA 1Q7EA 1GZUA 2QVXX 3H2IA 1XU4A 2VCYA 3PJFA 3QYJA 4ZPXA 1JFLA 4NICA 3L8EA 3RTAA 3GLFA 2PSDA 4C03A 6REQB 2W6CX 1DAEA 2BFBB 3MTIA 1ODTC 4FYXA 2IPNA 3GVHA 1QRRA 4MQFB 4CMAA 1H94A 1Q5PA 2EEPA 3RS5A 4DNPA 2ECKA 2PJDA 1BMDA 3BFXA 1ZD4A 1RHUA 3MOSA 5CW1A 2JGEA 5CIQA 5LA6F 1Z15A 4UBNA 2G08A 4OOFA 2Q3BA 1JTFA 4DDKA 2UZ4A 3X2FA 2X76A 5ADWA 1T3GA 4UNQA 1NN5A 3PR3A 4HCJA 4PBTA 1O5TA 1SUIA 1T5BA 2I6SA 2ZPUA 1TMOA 1NKVA 1XNHA 1NLMA 1XRMA 2B5OA 2D00A 4L8WB 5LQJA 1QH0A 4H4CA 1XWFA 1CRWG 1GGMA 1XBTA 2VHQA 4NZ9A 4DNFA 1I01A 3ZY4A 1HV8A