5HCIA

Gpn-loop gtpase npa3 in complex with gdp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
257
structure length
257
Chain Sequence
SLSTIICIGMAGSGKTTFMQRLNSHLRAEKTPPYVINLDPAVLRVPYGANIDIRDSIKYKKVMENYQLGPNGAIVTSLNLFSTKIDQVIRLVEQKKDKFQNCIIDTPGQIECFVWSASGAIITESFASSFPTVIAYIVDTPRNSSPTTFMSNMLYACSILYKTKLPMIVVFNKTDVCKADFAKEWMTDFESFQAAIKEDQDGYMSSLVNSMSLMLEEFYSQLDVVGVSSFTGDGFDEFMQCVDKKVDEYDQYYKKHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GPN-loop GTPase 1
publication title Structure of GPN-Loop GTPase Npa3 and Implications for RNA Polymerase II Assembly.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 104
structure length 257
sequence length 257
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.6.5.-:
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03029 ATP_bind_1 Conserved hypothetical ATP binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5hciA00
1PZNA 4E22A 2F6RA 4M1MA 4CVNA 2YVUA 4TLDA 4QFMA 121PA 1COWA 1ZNYA 4BZPA 3T1VA 3GFTA 1XTKA 3LDAA 1E2IA 1NJFA 2O8DB 5A4JA 3U3JA 3EG5A 4DRZA 1AKYA 4OI2A 2OFOA 5EUQB 1DADA 4GNKA 1VIYA 2DYKA 3B60A 2GZDA 3T1TA 1XZPA 3ZD6A 1OJLA 3G0HA 3RS3A 1FTNA 1IXZA 5JEDA 3VHXA 2CLSA 4BRUA 2WWXA 5FOXA 3U6BA 1US8B 4C9BA 2FN4A 1G18A 2QTVB 4K81B 4S2EA 4JJZA 2XB4A 2OM2A 2VEDA 5KSYA 3THWB 1FQKA 5FUWA 4URVR 2IS6A 4JBYA 2EW1A 3CUEF 4R2HA 5KU1A 4TSFD 3ZQJA 1IN5A 2QAGB 1ZD8A 5CM8B 3FMOB 5EE3A 4FMCB 2ODEA 1XEWY 1F48A 2BWJA 3B1YA 5FH9A 2BEJA 2HUPA 1U9IA 3EWSA 2P5TB 1BYUA 3A1VA 2Z83A 2GETA 4Z51A 1H8EA 1C9KA 2AD5A 1XD8A 4OYHA 4EQ6B 2VP0A 2FSGA 2V3CC 1QDEA 3KL4A 3NBFA 1M8PA 3U7HB 3D8BA 2OLKA 2K5UA 3M6AA 3B7GA 1E6CA 2BDTA 2WWFA 3QF7A 4ASUD 4GOXA 2F9MA 2WM9B 2PEZA 3U44A 1EK0A 1M34E 2D7CA 2ORIA 4HLUA 1P7CA 3LX5A 3A4NA 3RABA 1GL9B 4OQNA 3RVBA 3SFVA 2QY9A 2VL7A 5IT5A 1WXQA 3P4YA 1R0WA 2BV3A 3A1TA 2QE7D 2J9RA 2UVQA 3QXHA 3VU9B 3WP0A 4D81A 3TSOA 4S35A 2G6BA 1O87A 5BYKA 3AVWA 2R65A 4U5XA 2ZRGA 3ECCA 4PQFA 3VX3A 4BFYA 5DNYB 4UNSA 3UWOA 4D4JA 2QMOA 4MGYR 1A1VA 4RZUA 3ZQ6A 3W6OA 3P27A 1FTSA 2QP4A 4NKRA 4WVFA 4EPTA 2IS2A 1S4QA 4XWOA 1YR9A 2YC4C 4FMDF 4HAVA 4R2IA 4C0SA 4UNQA 3L8ZA 3LW8A 1F6BA 1HE8B 1JPNA 4F91B 3U44B 2H17A 3CO5A 4PTLA 4Q1FA 3B2EA 1JR3D 2OT3B 5KYKA 4CEJB 2IF2A 2Q21A 1UJ2A 3AV0B 3PG5A 5KPJA 2SHKA 3GP8A 4F4IA 5LD2B 1VPLA 1KTVA 4HB0A 2ATVA 1XPOA 2OLJA 3ZVNA 1HA3A 2VPPA 3BFXA 2ZSFA 4A2PA 4BLOA 3CRMA 3AVUA 4R7ZA 5DN6A 3SI7A 5CM9C 4Y0VA 2X2FA 1LTQA 2WJHA 3CF6R 4G5OA 1DPFA 1GL7A 4DZZA 1NL3A 4NZYA 3TVDA 5KSZA 1QVRA 4OQFA 2CNWA 3K1JA 2REBA 4PSAA 3GJ5A 2O8EB 5HTKA 4D0NA 1WP9A 4KFRA 5EP4A 1KIMA 4QBFA 2WSSD 1E1RA 3RDPA 1A5TA 2YWGA 3ADCA 4DLWA 4D25A 1Z06A 2QSZA 2FU5C 2WAYA 4RZXA 5J4VA 3EX7C 3V4FA 4DCTA 3AVQA 5CJPA 1DEKA 4EFLA 1V5WA 2ZR7A 3T12A 4G5GA 3L82B 2JIZD 5DGXA 4YONB 1XMJA 1XTRA 4ZDWA 5K8IA 1M74A 5DLQC 4Q4HB 1IHUA 1Z6XA 2OG2A 2ZI7A 1DAEA 2RAPA 3C7KA 3FKSA 3SU8A 5IF9A 1NIJA 4ZKDA 3SC3A 1SKYB 4F4CA 2J7PA 3D3QA 1ZBDA 4IDNA 4YDSA 4FD2A 4NH0A 3I5XA 1ZM2A 1N5IA 1ZD9A 1OV4A 3RS4A 4QC2A 5DI3A 1D6JA 4I1VA 2YC2C 3T35A 5J47A 2HCBA 2ZE5A 4W9MC 1Z07A 4QBIA 1FMJA 1SVSA 4ZDJA 1HV8A 1Z0DA 1GRNA 3MJRA 2ZRIA 3PXGA 1NRJB 4DLSA 1KO4A 2OXRA 4DB4A 1E9RA 3O8DA 4D6PA 4N0DA 1KY3A 2HYIC 1T3LA 2ZSDA 5C2JB 2ODBA 5FI1B 2OXCA 1TEVA 4C2TA 1ZM9A 1Z22A 4RD4A 1K6MA 4GZLA 3LQQA 2NIPA 4BGDA 1A2KC 3FHOA 2VO1A 3LVRE 4JYBA 4F38A 3FOZA 3EARA 3PR1A 1I2DA 2OHFA 4JT2A 4DLUA 1F3OA 1XB2A 2VHTA 1HQCA 4A8JB 4JLPA 3B9QA 3IHWA 3ND9A 1SVLA 1RW4A 4NDZA 4JBXA 4EPVA 4LBYA 4UQOA 1ZU5A 1S3SA 2Q3HA 4CZ2A 2ERXA 3QXCA 1COWD 4WZ6A 1GDDA 3AF2A 2ZJBA 4KBFA 3FFBA 3R20A 4IVQA 4ZDKA 1WMSA 1II0A 1YZGA 2QQEA 2O0KA 5UKDA 2F55A 3B1WA 4JBWA 2RGNA 1U0HC 4LBVA 2JLSA 1KJWA 2NO0A 2VRWA 3FE2A 3EZ7A 3E5HA 3NBXX 2R6DA 4M1SA 3REGA 4U02A 3VFDA 4DLTA 1ZINA 3GLIE 1R4AA 1GRQA 1AA9A 1ZNZA 1NJGA 2ODNA 1DG3A 3NBZC 4OHVA 4OQXA 3PJRA 3V00A 3IGFA 3MLEA 3NDPA 4AWXA 4B33A 3I73A 3R9IA 3GEIA 2F1JA 2HV8A 3DMDA 3RYTC 4N1AA 2V7QA 1P2UA 4JL6A 1M7GA 5FBRB 2X8AA 4CEHB 2LKDA 3B5JA 4R98A 1KI6A 4TLCA 1KOFA 1NMYA 1K8RA 1CIPA 2RGEA 3C8UA 2FPMA 3DOFA 4PPQA 5FOTA 5G3YA 3QUSA 721PA 2JASA 2C77A 1Q1EA 1UBGA 4PHFA 2XXAA 2FF7A 4Q02A 3QVVA 4XSGA 2NPFA 4ZCIA 4QM6A 4Q66C 4IOKA 2DFTA 1H8ED 5IRCD 1PLLA 3KQHA 3QG1A 4TMZA 4CEIA 1RJ9A 3SEAA 2IUSA 4PFSA 4AY2A 1G8PA 3WMEA 2H7VA 4UXIA 4JLBA 3HP1A 1E4VA 2A5GA 2BKEA 3U7EB 3CPHA 2A3RA 4BLRA 2IEYA 4DEXA 4ILEA 1M6NA 4AK9A 4BEJA 3G5UA 4O2RA 2EYQA 1ZCBA 3Q72A 1UDWA 4Q1DA 1G8HA 3CLVA 3ZH9B 1AZSC 4I1UA 1S1CA 3UMRA 4TZ0A 4K8OA 4DHEA 4NTZA 1ZP6A 1JJ7A 2QT1A 3CX6A 1Z8FA 2ZJ5A 1OLOA 1NLYA 2GJ9A 2VYFA 3EW9A 2CDNA 3ASYA 221PA 2XEXA 2XNSA 3K70B 2IYLD 4XJXA 5JSZA 1SXJE 1W0KD 2NGRA 2ZREA 3U6KA 1HQYE 2CJWA 1G1MA 3B1XA 3GLIA 1DS6A 1PLKA 2EFDB 1P61B 2OBLA 3CW2A 3F5FA 4ZIRA 2OFXA 3TUIC 2O52A 2Z43A 2VF7A 2RGAA 3MGCA 2GESA 2Z0MA 3BJIC 2PLRA 4FWIB 1N0VC 5LPNA 1FNNA 5JHHB 3UK6A 2W58A 4QJ5A 5KUTA 4CW7A 1OIVA 3H2YA 1HTWA 2YNMA 1R6BX 4NCIA 2I3BA 1W47A 4KSBA 1ZM7A 4QNRA 4QNMA 4A2WA 2ZROA 1QG4A 5DO9A 1NVWQ 3PEVA 4B34A 4D4KA 3ND8A 1Z83A 1VKJA 3DPUA 1T6NA 1PLJA 4RD0A 2O0JA 4GP6A 3W8NA 4EFMA 5AJYA 1L7VC 1G5PA 3TMKA 5DN6D 4LBZA 2GILA 4JSYA 1AN0A 2WZQA 2WJGA 2XTMA 3LVQE 1CTQA 2G0NA 3LX8A 3ZS9A 4YMTA 4CGZA 4AI6A 3QIAA 1GKIA 1S3GA 1U0LA 1YKSA 2FWRA 4IRUB 4M1KA 3AGQA 2XB2A 2UZ3A 1R0YA 3Q8XB 1R2QA 2CNWD 3AKDA 2J46A 2PCLA 4LV8B 1UEJA 4D4MA 4G5QA 5L3VA 1QF9A 1U98A 3PUXA 4AC9A 1EG7A 1E1RD 3NEJA 2DCUA 1S96A 2O0HA 4P4TA 4Q47A 4V02A 4E07A 3NC1C 1GKUB 2C03A 1E2DA 4KU4A 4NE2A 4QBHA 4QGGA 2R44A 3VTKA 2R6FA 1GRRA 1VYTA 4OK3A 1U99A 1B0UA 1SXJA 2ZQ5A 1GKYA 1OH7A 3QG5A 5FOVA 3GPLA 2JLQA 3BE4A 1XDBA 3GCGA 4DDWA 4CRWB 4EAQA 1RRGA 2AD1A 4DSTA 3IPXA 3GLHA 3FKSD 1IJFA 1IAQA 1OFHA 2GEVA 2RB4A 3RRNA 4AURA 3R8FA 4JLVA 3BAFA 4H1UA 1E4YA 2ANCA 4G1UC 1S9DA 4BRWA 1HUQA 1WDTA 2ZAMA 4GZMA 4V0NA 4ACAA 3AVVA 3BGWA 1XMIA 4HYYA 2GAOA 2ZE8A 1ZIPA 2GJSA 4EPRA 1ZVQA 3AKCA 1NG1A 2CCGA 1N0UA 1KZGB 3WMGA 3U5ZB 5AUPB 3PUWA 2J0VA 2OO7A 3MFYA 2GXQA 5EE1A 2W00A 5J4YA 3AVYA 3VKHA 1VG9B 2XZLA 1JR6A 3BH6A 1FP7A 2FOLA 3B82A 4MKFA 3DOEA 4RCZA 1KKLA 3EZ6A 3O47A 2D06A 4EJSB 3IO3A 3GLHB 1GITA 5C1BA 1JQLB 1HE1C 1E9BA 1TX4B 3MRSA 2IXGA 2V4ZA 3JZAA 2ZRAA 4PZZA 3RWOA 1RPZA 3OZXA 1NKSA 3CONA 3TR0A 2JLUA 1QRAA 2KI5A 2REOA 3BH0A 2WWIA 2J0QA 3CPJB 3K0FB 2PZGA 1AIPA 3EA0A 4NCJA 5JHGB 2JEOA 3N70A 3QOFA 3TGPA 4AKHA 1AM4D 4KHZA 1J2JA 2IYTA 5DH9A 3TNFA 4M21A 2P65A 4GP7A 3FPAA 3IUYA 2QROA 2Z4RA 2DPXA 1DVRA 1G17A 5DHFA 5SZIA 4A2QA 4M1TA 2FPKA 1P2TA 3THYA 1ELOA 1MKYA 2QAGC 1RYHA 1PV4A 5HZHA 3NTUA 1FMLA 1S2MA 4L5BA 2P67A 2CHGA 1UBEA 1Y3AA 2ZE7A 2ZRKA 4J0QA 2Q3MA 3U61B 1ZIOA 1Z28A 1F2TA 1ZUIA 2J7KA 2D7DA 1CBUA 4LHXA 2RGDA 1RZ3A 3FHCB 2J87A 2V9PA 4FN5A 5JI3E 1U0JA 3S1AB 3KUDA 4I1OA 2FFBA 3SQWA 1D2MA 3MAAC 3B1ZA 1UF9A 4B3BA 2BKUA 2ODWA 1Q0UA 4A82A 1FUUA 3LAWA 1SVOA 3ZDQA 1YQTA 1C4OA 3B9PA 3FFAA 1TAGA 1XTSA 2G1JA 5KSPA 2V7QD 1X86B 4KLNA 1BS1A 3PENA 4LYHA 5G53C 5KO2A 4RD1A 1XBTA 2AWOA 2ZUBA 3ZLJA 2WPDD 1XXHE 1R8SA 5L3QA 1L4UA 5P21A 4TLBA 2CXXA 2GCNA 3CPEA 2FE4A 5A0FA 5JWHA 1N3BA 3W3ZB 1G4UR 1W36D 4X8LA 1N6NA 3BK7A 3HDTA 1G3IA 2A2ZA 4MGZR 2WJVA 3T1OA 1N6IA 2FSFA 1KNQA 3W8RA 2GDJA 1M1YE 4XSHA 1NN1A 1MABA 1XD9A 1TPZA 2KB0A 1E69A 3MWLA 3GJXC 4ZCLA 1RIFA 4RSGA 2V1UA 4DLZA 1QHHA 2ZJ8A 3ZIAA 2BOVA 3IQXA 2IL1A 3AVPA 5H70A 4KCGA 5H8WA 3CH4B 4NPHA 4YXWA 2IWRA 5HZKA 3JVUA 2VH5R 2C9YA 4KYUA 2QI9C 4OK5A 2X1VA 2GA8A 4IEEA 3L2OB 4KVAA 5E4FA 3EPJA 5LD2C 2WICA 3PCRB 2QGZA 4KBGA 3KXIA 1EFHA 1KMHB 2FEMA 1J7KA 4LBWA 3IBGA 3UG7A 1I4TD 4BFZA 2NO6A 4RVCA 5TVKA 2W6JD 2NO9A 4Q4AB 1E2JA 2OEPA 4NP6A 2ZXUA 2JLZA 1J8MF 2ZPTX 4PQYA 4LCBA 2J3EA 3RAPR 4IVRA 4HDCA 2IEZA 2PMKA 2CCKA 5DI9A 1SHKA 3GJ8A 4MYCA 1ZM4A 1OXSC 4EFNA 4W5JA 1GIAA 4BQSA 2IYWA 1OIXA 4ZI2A 1KK0A 3EZFA 4PANA 3B1VA 1LW7A 2QSYA 4TMKA 2L0XA 3FMFA 5DIFA 2ZR0A 3WYFA 1E9CA 3B8HA 4FCWA 4XTRA 5KNCA 4P4UA 4WXRA 1VCNA 2WOOA 3Q3JB 2J5XA 2JAQA 2IUTA 2X19A 1Q3TA 3LWNA 1SGWA 2V55B 4FMCF 4DKXA 1JEDA 1XXHA 2PJZA 3DL0A 2D62A 1BO6A 4PR0A 4HAXA 3QEJA 1N5JA 3C5CA 2BVNA 4TZ6A 1IN8A 1BOFA 2HJGA 2ZI6A 3BOSA 5GADl 4HUQA 4QHSA 3OAAA 5CIWA 2J45A 2JLXA 4D0LB 1EXMA 1F5NA 3AVTA 3HYRA 5BN4A 1XJQA 4BLTA 1KAOA 3PFIA 5FI0B 1RYFA 2CVFA 4MRRA 3SDZA 1X8LA 2DWPA 1GZSA 1WBBA 4JLJA 2F1IA 2IYXA 3SYNA 2JDIA 2C99A 4ZPXA 5A5GA 3AVXA 1G41A 1CS4C 2J59A 3VHLB 2QBYB 1KZ7B 1Z6AA 3AF3A 1AK2A 3F0TA 4QG7A 4WOPA 3QXXA 2FMXA 4LC1A 4U00A 2BHRA 1S0UA 2HXSA 4CYMA 1ZYUA 5FBVB 3Q7PA 2QMEA 1UBCA 2Q9AA 4TL7A 1SXJD 1HEIA 3N2IA 4XH9B 2J0SA 1E0JA 1RKBA 1TNDA 2CE7A 1F2UA 2RGXA 4YMWA 4KFUA 5B57C 4DEYA 2BC9A 2FJUA 3PIRA 4L15A 5JS7A 1YE8A 1ZNXA 5TDHA 1HYQA 1R5NA 2VHJA 3NG1A 3PEYA 2O8BA 1EWRA 5EZ6B 4NL4H 421PA 4A8JC 1AS2A 4RFSB 1CF4A 2ZUDA 1VG8A 2GCOA 3HWSA 4PO8A 5HCNA 4A0FA 4TQ9A 1E2GA 2AKYA 4LJ9A 5CLQA 2C5LA 1T9HA 1FW6A 1P4SA 5FUYA 1LF0A 1Z5ZA 4V03A 2BIFA 4A4DA 4HUTA 1F60A 3QBTA 4TT3D 3KUCA 2F3RA 4UXJA 1J70A 1KAGA 1Z0IA 2ZE6A 1A2BA 3EPKA 2FV8A 4NYMQ 2GCPA 1NY5A 3FYHA 5JCZA 2Q9CA 4NCNA 3U60B 1OSNA 2A9KA 4JL5A 1KK2A 4TWZA 1S8FA 5FFMA 4D0GA 1FP6A 3FGNA 2RH5A 4JZKA 4II7A 5J4LA 2IYVA 4Q7JB 1XD2A 2DB3A 5AUOB 4QHTA 3HPQA 1OKKA 3FMPB 2P6RA 4L9WA 2WV9A 3Q85A 3CWQA 4DB2A 5G3ZA 3ZVLA 1TQ2A 3CF0A 3GLFE 5FPSA 3BB3A 2OILA 3F8TA 3VR2A 3ZGXA 3CNLA 2P0EA 3P26A 3ZS8A 1PUJA 1JQJC 3BRWD 3TR5A 1KDOA 2WIBA 5EE0A 4X8OA 2ZS8A 2GBLA 4HLDA 1N6LA 3SJBA 2V54A 4BZXA 4BASA 3KDSE 1KGDA 1ZUHA 1NP6A 1MO5A 3IHLA 3IDQA 3AEZA 4JLMA 2XITA 1AGPA 1IY1A 4M8NE 4DLXA 4ZDIA 5GJBA 1XZQA 5FTLA 1N25A 4TTRA 3I72A 3RS7A 1W2GA 1DE0A 5TV2A 3K0CC 3RSLA 4QHYA 3LA6A 1J90A 2GJAA 4Q1AA 3AH8A 1W0KA 1P60A 1FQJA 1GM5A 2IYQA 1KSGA 1U8YA 3N5CA 5BW8A 3K09C 4BFWA 3K70C 1Y63A 3TQCA 2Z5FA 5SZJA 1P9RA 3X1WA 4WA7A 5EP3A 4QM7A 2WVJA 1Z08A 4EUNA 2ZAOA 3PV0A 2NQ2C 1WE2A 3CF2A 1T0JB 5EZ5A 5TMPA 4XVUA 4B71A 2WOJA 1NN3A 2R6AA 1XMVA 3ZIAD 3OEHA 4AYWA 5CITA 3GLFA 4IVPA 3U2QA 4YXWD 2BBTA 3L43A 4B73A 3OESA 3CRW1 1YJ5A 4M1WA 2RGBA 3O8BA 4LJ6A 3GD7A 4BLPA 1HY3A 3VMFA 1J99A 5SZHB 2QT0A 4AYXA 3ZVMA 2BMDA 5DE3A 4EDHA 4DWJA 3SN6A 4YQFA 2EFEB 2FZ4A 2E87A 2KWIA 4PC6A 2DBYA 3CNNA 2OCYC 3C4JA 2JJ2A 2F3TA 1P75A 2KJQA 2Y8EA 4DBLC 3A36A 1E1QA 1KKMA 3D7MA 2CMKA 3UMSA 4O2LA 4QBGB 2RKOA 2XZOA 5KPDA 5E7MA 2GVDC 1LVGA 2BCJQ 2J0UA 2G1KA 3NHAA 5EUMA 2NOAA 3TJZA 2XJ9A 2AL7A 2VIIA 4BFXA 5EJEA 1OB2A 1XCPA 4OK6A 1D5CA 1DO2A 4B47A 3KB1A 1UBFA 2MSDB 2OCBA 2VA8A 4OHYA 4NMMA 4G5RA 4MGIR 2PT5A 2C96A 3RRYA 1AQUA 3OEEA 5G41A 2BMEA 3ICEA 3T06B 3BB1A 3UMFA 3EA5A 4A15A 1E9AA 3OAAD 1NKTA 3QXJA 1GNPA 2W6IA 2YHSA 4MUAA 3MWJA 4ZV4A 4RKFA 5H68A 4MYTA 3KKPA 4EIWA 2IXFA 3Q7QA 1QG2A 3KJGA 1X8KA 3SE0A 3BFKA 3OIUA 4JSTA 3WNCA 2JDID 3AP2A 4Q9IA 1GOTA 1TF2A 3R7WA 4TQUS 1W44A 3EIHA 1ZNWA 2IXEA 3D31A 4LYJA 4OI1A 5EXXA 4ESHA 1IY0A 4US2R 1W2HA 1D2EA 2XZPA 1OB5A 2I4IA 1T0HB 5DI3B 4EJSC 3WNDA 5M04A 5F9HA 3GJ6A 4ARZA 2JGNA 1JXOA 1E2FA 1YZTA 2BMJA 2QENA 3E70C 4IDPA 5BWMA 1W4AA 4LUCA 2NO1A 1L4YA 3SOPA 2X77A 3I92A 3E1SA 1TU4A 3T61A 2BM1A 4BZQA 1G7CA 2CK3A 2WSMA 4IJMA 3P20A 4FMDB 1AKEA 1E32A 4R9UC 4KLZA 1T5IA 2MMCA 3FMIA 3AVOA 5E95A 1W5SA 5JWOA 4QJ4A 3EPHA 4AD8A 4JLDA 3CRRA 1FFHA 2HEIA 3REFA 3L0IB 3DHWC 3FB4A 1KO7A 3RC3A 2ZRMA 3VR1A 1H8HD 1TMKA 2FG5A 2HLDD 5JECA 3THOA 1E79A 4LHVA 1RVDA 1CU1A 1T3HA 2ZITA 5EXSA 4O0MA 4DT1A 2VLIA 1OE0A 2P2LA 2ZRDA 3UPUA 4CEJA 1J8YF 1LFDB 1GNRA 2AK3A 4GMDA 2C2HA 3RC8A 5EQTA 1R5OA 1HT1E 4B75A 3DMNA 4BFTA 1OKKD 2QM7A 5EE5B 1YZUA 2J41A 1SVKA 2RHMA 3RHFA 4B6FA 1G7RA 3Q5DA 5FBQB 2JJ8A 2WPDA 3AKEA 4B3CA 4DC9A 3GJ3A 4DJTA 3KQUA 3CZPA 3FKQA 5CYPA 2EFHB 1LNZA 2ZS9A 4JVSB 4LI0A 2V6IA 1EX7A 4BECA 4MQBA 1I4LD 5KNDA 1FUKA 5GJVC 5C4MA 1Q44A 3GEHA 3DKPA 3CR7A 3EXAA 1WRBA 3DZDA 1Q3HA 4IEIA 1UKEA 5K8TA 2B92A 2XTNA 5FUVA 3I8SA 2QEQA 4B48A 3ZZ0A 4LRWA 3VR4A 5KSOA 3RS2A 5HE8A 5JRJA 2WWYA 4C2UA 2VBCA 5EXTA 4CT4B 1XX6A 3UANA 3D6TB 1ZD1A 3IPYA 1OXXK 3X1ZA 4LZZA 1KI6B 3EIQA 2KBEA 3U4QA 1FNMA 3BORA 4NYIR 1GSIA 1UKYA 2QNRA 2XOKD 2HYDA 3ZZTA 1GUAA 2ORWA 4O3MA 2XXAB 4LYAA 1W36B 3DVLA 3LRPA 2W6JA 4M9QA 2YINC 1BIFA 2HDNB 1KJYA 2W2VA 4CEIB 1QHIA 1RJ9B 2W0MA 4B6EA 2IA5A 1E2QA 4OJKA 1VHTA 4XTCS 1P62B 1RRPA 3VKWA 4RY2A 5BYJA 4HLQB 4TYPA 2ZJOA 2CBZA 4C7OA 4UJ3A 3DKVA 4W7SA 4MKIA 4DLYA 1VYVA 5KOYA 1W4RA 1DTSA 3RRZA 2BJVA 2HT6A 1WF3A 3DDCA 3QNUA 4KFSA 1CRPA 2MSCB 4Q00A 4MITA 2QP9X 5TY0A 2ECKA 1CLUA 2DFLA 3CZQA 1NN5A 2OCAA 1UKVY 1TTTA 2OESA 4Z1MA 3OEHD 1Q1BA 2IK8A 4ZI3A 5JSZB 3A4MA 1ONBA 4TMTA 1P2VA 1TADA 3GLIB 2CJWB 3BD9A 4NYMR 4RD3A 1KYIA 4ZIRB 1Z63A 1VHLA 3LBHA 2KBFA 1BYIA 2VP9A 1XU4A 3IIKA 4B44A 2ZSEA 1EESA 2B21A 3WRYC 2YWFA 1U8ZA 1VTKA 3DM9B 1XTIA 2F43A 5LB4A 1CJKC 1OHHA 1XTJA 4Q5IA 1G64A 3O8CA 3UXMA 3W6NA 1OXVA 1R0XA 1JEEA 2JJ2D 1DAKA 4PPNA 4A0RA 3PEWA 1E1QD 3PQCA 4JVNA 2VHQA 1T5LA 4HEJA 3KFXA 4P3YA 4YMVA 3QQ5A 3ONWA 1JI0A 2PX3A 3TKLA 1ESMA 2BBOA 4U7DA 3WMFA 2V8OA 3G82C 3LQRA 3LH5A 1FZQA 3TAUA 1X6VA 1V43A 3QKRA 1G20E 1X1RA 3BIFA 1QVAA 3QXSA 3KJHA 1R5BA 1NLZA 4PO1A 2WIAA 2ONJA 4F93B 4D26A 3I61A 4AKEA 1IJEA 3QPUA 3MMPA 4FCTA 3TSZA 4C0JA 2ZRJA 1D9XA 3ZJYA 3CKLA 1AZTA 1KY2A 2DY1A 2FFHA 4HZUA 4ITRC 2RHDA 3RSOA 3OEED 5AJXA 2DFKB 4OI4A 2GZHA 2VSOA 2EVWX 2W6ID 3KTAA 1II9A 1KK1A 1U81A 3GQBA 1PJRA 1VDZA 3GLGE 3QEOA 2QU8A 2A5YB 2IYRA 1GTVA 3CRQA 3PITA 2ZYTX 2AXPA 1EFCA 1LF5A 4F92B 1SXJB 4RD6A 2FSIA 1T8UA 4TT3A 2I1VB 3U3KA 2PX0A 4AKIA 3Q5EA 2OUKA 3WY9A 2ASEA 2PLFA 2Z6VA 5FTMA 3CWZA 4OHZA 4M9XA 4E5UA 4URWR 4PXAA 2C78A 1P2SA 2YWHA 4LJ5A 3RRMA 1XMSA 2IT1A 1UAAA 2XX3A 3KJIA 3JVVA 4PSKA 1ZW6A 4MGKR 3SJAA 1XEFA 2VF8A 5BXQC 1KI4A 3NHBA 2VTKA 4A92A 3KB2A 2A30A 3KQLA 4PAQA 4KYIB 3VNVA 4JMPA 2IX3A 2F1RA 3TUJC 2OBNA 1P9NA 2CK3D 2OV2A 1U90A 1IXSB 2DWOA 4ERNA 2CLCX 1AS0A 3R8CA 2FNAA 1ZAKA 4PZLA 2YZ2A 3R9XA 4B3GA 1IBRA 2IHYA 1G8YA 1LS1A 2PZFA 3CM0A 3C16C 3X1XA 5KNBA 1CXZA 1DARA 4E09A 1OH5A 3ETLA 1TEXA 3SYLA 4XWAA 4BLSA 5AUQA 4IW3B 2BCGY 5L3SA 4XOIA 2O8CA 1P9WA 1E79D 1JECA 1GG2A 4B2PA 2A78A 2BBWA 2QTFA 5JJIA 2Q9BA 1E2HA 2R9VA 4UJ5A 2JLVA 1NSTA 1XEXA 1YR8A 3C15C 2W83A 3GLGA 4PX9A 3NIBA 3THYB 1QHYA 4L8GA 2XNDA 2OZEA 2HCJB 2X2EA 2YYZA 3WYGA 1W7AA 4LPKA 4RD2A 3THXA 3QY0A 1S9HA 3AKYA 3SHFA 1P5ZB 1U9IC 4FMBB 2OAP1 3LBIA 1OF1A 3M0EA 2VHCA 1FOEB 2B6HA 1F2TB 4JVLA 1T4GA 2V1XA 4FW9A 2YKGA 3T1QA 4P4SA 5JCPA 2G88A 2QM8A 3A1SA 1QZXA 1DO0A 1VCOA 2EFCB 4CF7A 1QHSA 1W4CA 2IYUA 4GFDA 2EWVA 4L9SA 4RZ2A 1YZKA 1CJUC 1W1WA 3K9GA 3QF4A 3U3RA 2DR3A 3WP1B 1SVMA 1XEXB 1MRNA 2FX3A 2OE2A 1II8A 1N6HA 3QBVA 1G6OA 2AXNA 1KMQA 4HLUC 4D80A 1NLFA 3QKTA 2NZJA 4BWYA 1OW3B 1E99A 5GVRA 3A4LA 1OXTA 5AJWA 2UZIR 1EX6A 1EGAA 1JAIA 1W5TA 5L3QB 4MYUA 1A4RA 1NVVQ 3K53A 4JVMA 4A0HA 1P73A 2ZYUX 4JS0A 4IHQA 1VECA 4IXMA 2WTUA 1CKEA 5HCIA 4A6PA 5EXPA 5FPTA 4LWZA 4MUBA 1MABB 5FL3A 5JS8A 3NVAA 5AWFC 5C4GB 3X1YA 3MJHA 3AP3A 4HZIA 2XTZA 1QHHB 3NBYC 2B8WA 4URUR 1ZUNB 5JLJA 1XJCA 3FDIA 3KQKA 2WMNB 4KSCA 2GTPA 3CB4A 5DISB 5JI2E 1LS6A 2AK2A 4DIEA 2G0TA 1SULA 3CIOA 3B85A 1T8TA 5J5CA 4GPTA 3MWYW 5TARA 1QHGA 5IHPA 1GAJA 2QP3A 4BPBA 1GL6A 4Z1MD 3AF1A 1ZCAA 1M7HA 3WRXC 2A5FA 3HYTA 1CR0A 1U94A 3J81k 2LKCA 2GAAA 4XD7A 4Q01A 2O8FA 4WW0A 5B2ZA 3KXKA 2UKDA 3LLMA 1XCGB 1K5DA 1N6RA 1NG9A 3SR0A 2WKQA 3Q9LA 4P32A 2C8VA 1TF5A 5SZKB 1B23P 4NU0A 1P72A 1ZJ6A 3FVQA 4URXR 5TXGA 4LSGA 1OHHD 3KJEA 4KFTA 1Z0AA 2GXAA 4TLEA 2QGNA 3I3SR 3I1FA 4I81A 1NY6A 3L0PA 3A58B 4KO8A 1Q1ZA 5FTJA 4CT5A 4C0HA 1XXHB 1E2KA 2C98A 5JEEA 3QPVA 1E96A 4MA4A 4NYIQ 3KQNA 3LLUA 3QKSA 2C04A 3C14C 1XWIA 3TRFA 4QOSA 4HUQB 1YU9A 1AQYA 1FPMA 3K0SA 2PCJA 1BMFA 3WNBA 4POAA 2ONKA 5GJWC 1EFTA 2CCJA 5E3HA 3LO5A 4TN1A 5CLLA 1M7BA 4HI0E 3I5YA 1JALA 2FFAA 4B3XA 4XVQA 2O8DA 4V0OA 1VG1A 1KDPA 4KITB 4C0QC 2ZSAA 1VG0B 2ZJZA 2VP5A 3IQWA 4IOJA 3KKNA 1ODFA 2IW3A 4Q9HA 1N6KA 2ZJAA 4KV9A 4JT4A 4BFVA 1DELA 3L8YA 3MCAA 2ZU0C 3RWMB 4DLVA 2C9OA 2GZAA 2YOGA 1G21E 1Q57A 1RFLA 4DXAA 5J4HA 3HPRA 4H9GA 1DG1G 4F7WA 2R2AA 1H8HA 2HLDA 1JPJA 4MRNA 1O3YA 3H4MA 1F2UB 3L0OA 1KDRA 1CEEA 3THWA 5J40A 3LD9A 2G9NA 1G3UA 4FCVA 5JWRA 2GXUA 4TYQA 2HF9A 2O8BB 2QAGA 2LWIA 1E2MA 4XIGS 3L0SA 2ZEJA 4LHWA 2A7QA 3OIYA 5G40A 2HT1A 1NVUQ 4JLAA 4YMUA 1N2CE 2GCOB 2ZYVX 2ZVPX 2FA9A 1KO8A 1QHXA 2QL6A 4BUJA 2N42A 4M1OA 2D4HA 4TMWA 1OYYA 3PUVA 4LJ8A 3VNUA 3EASA 3KKMA 2PT7A 1JNYA 4HAWA 2VP2A 3K0AA 4I99A 4EQ6A 5B64A 5JJKA 2ZRFA 2P6NA 1I2MA 1Z0FA 5KDOA 2ZRCA 4JLNA 1ZM3A 2RGNC 3A1WA 2WJYA 4GDFA 4RKEA 2QPAA 4G5SA 1BH2A 3TQFA 1HH4A 4DUGA 3GMTA 4DDTA 1E2EA 2KE5A 4DSNA 4PO9A 3BH7A 1OH8A 1X3SA 2H16A 4TMXA 1A7JA 3HU2A 1P3JA 1Z6GA 4ON9A 1G5TA 5CB6A 1XD2B 5DYIA 2IYSA 3AUYA 3VU9A 3C41J 3U7FB 2FGJA 3EPLA 1SHZA 4B32A 3KFVA 4KJZA 4Q18A 1ANKA 2B7CA 2XOKA 4EPWA 3K0AB 1UDXA 2ZS7A 1YVDA 4PSVA 1DAFA 3UKDA 2CVHA 3OFNA 5FOWA 4Q9KA 2XNDD 1HURA 4JLOA 4URZR 4PHGA 3SBDA 1W48A 1R7RA 1SKYE 1KI8A 3NH9A 3U3OA 3H84A 3BC1A 2A5JA 4YDHB 3WBJA 2XSZA 4YLGA 2NPIA 1KSHA 4P33A 1IM2A 2JA1A 2EYUA 1W36C 2DWQA 1W4BA 2P3SA 3A37A 2KSQA 4ZKEA 3A8TA 3P4XA 2WKPA 3AP1A 5LB2A 2HXYA 1W49A 3BS4A 4HATA 5JMTA 5HPYB 3VR6A 1JJVA 3TK1A 2N46A 1OXUA 1MO3A 4PC3A 1E2LA 1Q12A 1OFIA 2VP6A 2GEDA 1UKZA 1N6PA 5HKKA 1NBME 2CEAA 2D74A 3CBQA 3IEVA 3VQTA 3V9PA 1E0KA 3LFUA 4Q1EA 4URYR 5FTNA 2NO7A 4UNNA 2AR7A 4LV5B 2V6JA 5CK5A 4K46A 2O8EA 2JATA 1W0JA 2EQBA 4JYCA 4M9SA 3K9NA 3B6EA 2BEKA 1U2RA 4PPGA 4TYYA 1NF3A 2ZI3A 3X2SA 4HB4A 1Z0JA 2P5SA 3LV8A 4IKEA 4MRSA 5KDDA 1RRCA 5CB8A 4WBSA 2IWHA 1UADA 4B3DA 3LY5A 4P0TA 1WA5A 2DHRA 2NMVA 1CJTC 1E2NA 4FIDA 2PH1A 2GWHA 1IONA 1Q22A 4A1FA 1NIPA 4Q9LA 4Q7LA 4G3XA 4Q4HA 3GLFB 1YRAA 1G5RA 2AN9A 3DO6A 3FWYA 3AGPA 4LPSA 4MRVA 4NCKA 4WZBE 4QGHA 3TW4A 4LJAA 1Z6YA 2AFIE 3OE7A 1LB1B 3KZ1E 2GVZC 2WKRA 2F9LA 5GJCA 2WWWA 4WZAE 1ZU4A 2H18A 3RLFA 3MUFA 5BN5A 3CH5A 2ATXA 2CE2X 1MV5A 1KI3A 2D2FA 2WHXA 4Q4JA 1VMAA 4XD7D 1QHNA 3OIWA 1T91A 4G01B 5K8UA 2ZANA 3WYAA 4P31A 4ESVA 3IIJA 1ZC3A 2JJ1A 4LJYA 4OKSA 1N0WA 3SJCA 3HR7A 1NBMA 4MKGA 2JLWA 5JBQA 2J0UB 2AHOA 4DLRA 4XVRA 4GOJA 2WAXA 4HB3A 5C18A 1KO5A 5FBLB 1R10A 2QORA 1E9FA 5DSZA 2ZI9A 1D9ZA 2ZU6A 4PHHA 1CJMA 3B78A 3K9HA 2QPOA 3T5GA 3O8RA 1PVOA 1SXJC 2Q6TA 3A1UA 4AIIA 1G3QA 5J4KA 4NONA 1WB9A 4IOMA 4Q4JB 1YZLA 3GFPA 1S1MA 1FL9A 1X8JA 4A8JA 5KHOC 3CX8A 3OHMA 4LX0A 3BXZA 4DIDA 2B8TA 1BMFD 4Y0AA 2A5DA 2D2EA 3FTQA 5H1YA 2ZJYA 4BE7B 2WWHA 1E2PA 2H57A 3WXMA 3IEUA 4GI7A 4I4LA 1CJVC 4B2IA 3TH5A 4CDGA 4N0EA 4C0LA 4C4PA 4OI0A 3BBPA 1RRFA 3TUZC 1TUEA 3ASZA 4TTQA 3W6PA 2ERYA 1IN4A 2W2XA 3R7WB 2EU8A 1NVVR 3MWKA 4A6XA 3TAHA 1IN7A 4HDQB 3B13B 1VCIA 3EWAA 4AG5A 5BN3A 2NTYC 2YWEA 3W90A 3DM5A 2ZR9A 2ZRPA 4C3ZA 4B74A 3HU3A 2W0SA 2WJJA 4ARZB 3SFZA 2TMKA 3EZ9A 2FGKA 1GNQA 2IYYA 4TMVA 1OIWA 4HDOB 3UWKA 2H1LA 1Z2CA 5E7IA 4C30A 2GJ8A 2VQSA 4CEHA 3A6PC 2XGJA 2IHBA 2ZSBA 3QVUA 4DCUA 2IS4A 3WBKA 4LDJA 5D3MA 3SHWA 4M22A 1TQ6A 2FEOA 1UM8A 4OQMA 4Q7KA 3QKUA 5FBWB 2HJVA 4B35A 2Q0HA 5KDLA 4DSOA 1CR1A 3SZRA 2PZEA 2ZIAA 4LV6A 4YC7A 5DHAA 3PUZA 4QGFA 1E9SA 1XEWX 5DYGA 3SNHA 4GMXA 5IDVA 5F98A 5F2EA 4TL8A 1G16A 4DSUA 4TTPA 2QRNA 4AYTA 1EWQA 2BJWA 3AF0A 4DT1B 3H1TA 1W46A 2ZYWX 3GFOA 3OF5A 2BM0A 3K0CA 2YV5A 4RJLA 4TQAA 5FL7A 3VR3A 1ETUA 4DUGD 4D2IA 1Q20A 2C9CA 2OFWA 2REXB 2FFQA 3GJ4A 4M9ZA 4MKHA 4PAMA 5CJ2A 4Q9JA 1SVWA 4BFUA 2G83A 3CX7A 1WBDA 3GEEA 4ZCMA 4TYNA 5L8VA 1PUIA 3TLXA 4A9AA 3PEUA 1KI9A 1Q21A 4NYJR 5D3MB 5LDDC 2ZETA 1JB1A 3K09A 4DCSA 1L2TA 1OPXA 3ADKA 1K5GA 4C0KA 4W5HA 2IF0A 4GOKA 1YHNA 4IDOA 2R8RA 4DCVA 1NVXQ 4NHOA 4Q48A 1TUIA 3ADDA 1KSFX 2E9SA 3AF4A 3OIVA 2R62A 4Q7MB 5ANRB 5FR1A 3UG6A 3MD0A 4O25A 5FR2A 3OFND 3EIEA 4B76A 4IDQA 2OAQ1 3BERA 4Q19A 3I4LA 1Z0KA 3QSYA 1L8QA 3HU1A 2GHIA 5BQ5A 2XSZD 2PMDA 1AS3A 5HE9A 2QUZA 4V0LA 3RS0A 1R8QA 2MMGA 3M1IA 3BFVA 3EAQA 3K8YA 1E94E 4YMSA 5E7JA 5C46F 4UXHA 1XPUA 1TQDA 4V0KA 3QPWA 4DVGA 4IFBA 4UNRA 3ICQB 2WMOB 2LCFA 1TL7C 1C1YA 2J1LA 2IBMA 5KTYA 5AK0A 1CR2A 4Q03A 2VSFA 2PJRA 3I8XA 3U4QB 3NWJA 2P6UA 1GFIA 4GL2A 1MT0A 2ORVA 4FINA 5HKKD 2IYZA 5F9FA 1VIAA 3GLHE 1XPRA 1D2NA 4DCNA 1G19A 1EFRA 4US1R 5AR1A 5D3QA 1NI3A 5CK4A 1YRBA 3NEYA 5FOUA 3I32A 3KX2A 4HAUA 2H8KA 3W9YA 2CHQA 2WJIA 2CL0X 1W0JD 5JRZA 4C7OB 4GT1A 4HLCA 4LJ4A 3T5DA 1E9DA 3AUXA 1OH6A 4TL6A 3C5HA 1G7TA 1G4AE 2CHVA 3ADBA 1IOZA 2PL3A 4BLQA 2GF0A 3MSXA 1LV7A 5FPKA 4L16A 2ZRLA 1G9XA 4V0ME 3U3MA 1XJ0A 5IK2A 4UKDA 1CR4A 1JXMA 3TIFA 1KI1A 5LBIA 4L4UA 2QTHA 2Z4SA 3EZ2A 1T3SA 3SJZA 2XJ4A 1CULC 1ESNA 3M4YA 2IC5A 1YR7A 4D82A 1RE0A 3KXLA 3OE7D 2QMHA 2QQ0A 3EC2A 3AM1A 4FXPA 3ZVRA 4IXNA 1VYUA 4LYFA 3VAAA 6Q21A 1UEIA 2FH5B 4R71A 2F43B 1YR6A 5CDFE 1CP2A 1UFQA 2QA5A 3HJNA 4WAUA 1GVNB 4GSYA 4JKIA 2O5VA 3TSWA 2BMFA 4FWTA 2GJKA 4X8HA 5AJZA 3ZD7A 2AKAB 1P6XA 4LOAA 4HAZA 1DAHA 2ZJ2A 1I4DD 3KKQA 4E03A 2JJ1D 4QKQA 1SQ5A 1MO6A 2D3WA 1NBMD 4LGMA 4LK2A 5EE9A 4EJSA 1VCMA 1AJEA 4NCHA 4CIDA 2R6GA 2RGCA 2I1QA 4LC0A 1Q1QA 2CL7X 3CRVA 2J7PD 4B43A 1Z29A 3FHTA 4Q21A 3QKRB 1ZC4A 3AQ4A 2QG6A 1NNEA 4JJKA 3QE0A 3W3AA 2ZRHA 1NSFA 4M0LA 4QL3A 1N5LA 4IOLA 2F7SA 3SYKA 3K0FA 1Z6TA 2AWNA 1KI7A 4OL0A 3H0KA 4HZUB 3WHKA 1NN0A 2ZVQX 4JIMA 2AX4A 3BB4A 1D8TA 2E1RA 2ANBA 2RMKA 1XNJA 1X1SA 3TBKA 2ZI4A 4N3NA 1SVIA 2H5EA 2H92A 3KTAB 4M1YA 2IUUA 3TVTA 2JLRA 2CL6X 2PBRA 4V0MA 1OYWA 4GBMA 1MR3F 4KAXA 5TB5A 4LY6A 3NC0C 1E9EA 1XTQA 3VKGA 2FDCA 1G3MA 1G7SA 4MRPA 4HB2A 3H86A 5FPHA 3K9LA 5AUNB 2GKSA 2IS1A 1OFUX 1YZQA 4OBEA 1JR3E 5K8LA 5FUXA 5EP1A 1KHTA 4C0AC 4TSFA 3S1AA 2ZM5A 4ZO4A 4TYWA 2QRZA 3TE6A 5CDFA 4DDVA 4A0GA 4F4JA 1MOZA 4UNPA 4H1VA 3R9WA 2JLYA 2YOHA 1G291 3SS8A 1WCV1 3W5IA 4AG6A 2C95A 4PPFA 2R6CA 2HF8A 4WXPA 2AFHE 3NH6A 3QJYA 5F3WB 4BEBA 4AKGA 2GF9A 3W5JA 1ZMXA 4M53A 4RZ3A 3UIEA 1GWNA 1KSJA 1TF7A 1JBKA 4PC2A 2FSHA 4M2LA 4MH0R 4PAOA 2GNOA 4ASUA 5FPYA 1SZPA 2RGGA 2W2TA 4IDHA 2GK7A 2F1HA 5CIQA 1BKDR 1N5KA 2ZTSA 821PA 4XWKA 1MH1A 4EPYA 3IBYA 4NBSA 4ABYA 2N1BA 4PHTA 3RNLA 5L3SB 2QE7A 1M2OB 1GILA 4M4SA 4MYHA 3T34A 2O8CB 2GBLC 4TLAA 2CLDX 3LNCA 3BWDD 5B58C 1OT3A 5B30A 2VHUA 2ZUCA 3HR8A 5FL7D 1IN6A 1TU3A 1SKQA 3JZMA 3CNOA 2GXSA 3GLGB 4W5WA 1G8GA 3DZ8A 1UPTA 5JJLA 3T15A 3LXRA 3U7GA 1KMHA 1XP8A 1GP2A 1NMZA 4LHYA 2QMUA 3THXB 2QZ4A 1DOAA 4OHWA 2FZLA 1YZNA 3K70D 4Q4AA 2EWWA 4JKYA 1JR3A 2NZ8A 3LW7A 3VX4A 3X1DA 4BFSA 3KKOA 4PZYA 4X8MA 1E0SA 5FTKA 2XAUA 3IIMA 2VSXA 4GRAA 4P4SB 1E0AA 1KI2A 2JCSA 3DEFA 1Z2AA 2ZI5A 3UATA 621PA 4RFVA 4Q4LA 4OHXA 2BBSA 1KJZA 4A36A 4EPXA 3QF4B 4G0NA 2GK6A 3AB3A 5EP2A 2PEYA 4C0BA 1N6OA 2G77B 3IILA 4US0R 8OHMA 1KNXA 4KXFB 1II8B 3PUYA 2YOFA 4Q1CA 5AJVB 4WIAA 1DAMA 2QN6A 3K0EA 2QAJA 1XF9A 2YJTD 1EFUA 2G3YA 4PC7A 5CYOA 1IY2A 4OJQA 1TQ4A 3RS5A 3NXSA 2RCNA 3SQXA 1AGRA 4HAYA 4JL8A 1FX0A 3NDBB 1G6HA 1H65A 2WWGA 3TW8B 3GJ0A 3EC1A 3RANA 2WSSA 1KDTA 2FPLA 1WQ1R 2ZRNA 4TL9A 1RC8A 1E98A 1EFRD 1LY1A 3N2EA 2GEUA 2QPTA 4QGAA 3ZYCA 5L3RA 4KVGA 4KODA 3P1JA 4B2LA 3E2IA 4OQLA 4PQRA 2OCPA 2JIZA 2MSEB 5GVSA 1Z47A 4Z54A 5ELXA 4JLKA 3P32A 2Q3FA 4EKDA 2QBYA 2OBMA 3SBEA 521PA 1KK3A 1DBSA 4MDFA 3I62A 3GJ7A 1ZRHA 1QBKC 2OSBA 2VP4A 1KO1A 4NYJQ 3NKVA 4Q1BA 4QRHA 1HT2E 4PC1A 4LHZA 1NMXA 1DAIA 1XFAA 1IXRC 1FX0B 3F3YA 3LBNA 5IK2D 4MDEA 4Z8XA 4QXAA 3V4RA 4I1SA 3QENA 3IO5A 1G3RA 2O8FB 3PVSA 4B3FX 4D4LA 1R0ZA 3IKJA 4FI3C 4HSEA 1Z3IX 3QI2A 4IFEA 2GRJA 2EFGA 1JAHA 1XCMA 1U8AA 1IQPA 4KI0A 4RFSA 4Z8YA 5HR5A 3WHLA 1MO4A 1OFTA 1DAGA 1MRSA 2ZRBA 1XRJA 3W34A 1G8FA 3MG9A 4LJ7A 4QJ3A 3CR8A 2B7BA 1A82A 5FOSA 5JZVA 3VR5A 4DDUA 2DFNA 4RCYA 1E3MA 2NG1A 4ACBA 3ZZUA 2WBLC 5JFGA 3QKSB 1CRQA 1US8A 3LXXA
chains in the Genus database with same CATH superfamily
2PMEA 4IQ0A 5BYAA 1GU0A 1V47A 1S5PA 2XCSB 2F6RA 2W2KA 4X84A 1RHQA 1W9MA 4TLDA 1S2GA 2Y9MB 1D1PA 1UIMA 2HR1A 2IELA 5KVVA 3PYLA 4RKQA 1OWMA 5TGTA 2UXCB 1R66A 4O29A 3ZI4A 5KKCA 3AHJA 1I0IA 1E2IA 3IC5A 2FPUA 1BGWA 2E4XA 2WLSA 2P6PA 3MIIA 3P5SA 4RBNA 2J4FA 3U3JA 3EXIB 3ZGNA 4DRZA 3U19A 3B20A 3Q9NA 1TM7E 3RKSA 2IU6A 1MN6A 3VKFA 1DC5A 1XZPA 1FFSA 2VKQA 5A04A 1PGJA 3T1TA 1QM5A 1Z4PX 4GG1A 3VJKA 4OAPA 3INTA 1OJLA 3KLNA 3OZUA 2G28A 3PQ2A 1UAGA 4KYTA 1D4AA 2AW3A 3LHDA 1IXZA 4WCDA 3RS3A 3T3HA 1NFRA 3PPVA 4JX9A 1JKJA 2V3WA 4BRUA 2ZB3A 1ODKA 3T3MB 2V4UA 3L5KA 2BLNA 3JARA 4JDPA 4NVRA 4B5KA 3H1AA 4JYZA 2QTVB 5K0TA 3S29A 2PS9A 3TQQA 5JSUA 3U1BA 3O8QB 2ZUEA 5EEHA 2OM2A 1HFEL 1ISSA 2VEDA 5F5NA 5KSYA 3HXKA 1AQJA 1FQKA 3JQCA 5T5QA 4LOJA 4F8YA 4URVR 1OV6A 1WMDA 4D97A 2PWZA 2EW1A 3QX7A 2JIRA 2C8KA 4TKVB 2Q3DA 3UXYA 3ET5A 5LLSA 4JA2A 2RH4A 2XDWA 3ONVA 3A27A 4QLOA 2XA9A 3FMOB 5EE3A 3I09A 1HR0B 3SD7A 1AVTA 2D5BA 1YU6A 3B1YA 4DNPA 2BEJA 2HUPA 3LWZA 3PZRA 2QQ5A 1HYHA 4DWVA 2GPYA 3NRBA 3WLEA 4P4NA 3EPJA 1UFKA 4AO7A 3R7AA 1G21A 3OU6A 2FSGA 2GYWA 1L7MA 2XDQA 4LE2A 2OLKA 1JW9B 3TRDA 2K5UA 3M6AA 3AIIA 5FWXB 3B7GA 1Y7IA 5H9WA 1FB5A 4FR0A 3V33A 2JCXA 4EUFA 3QF7A 4LY0A 4ASUD 5P8WA 3I45A 2SKCA 3QEMA 3AYZB 4UMEA 4WNAB 5KS2A 3U44A 3I2KA 1EPUA 4LXUA 1U0TA 1ECJA 1N7IA 2AVNA 5F23A 2D7CA 4AMYA 1P7CA 3LX5A 1YF3A 2QY9A 3VOAA 1RYNA 3P4YA 1G2QA 1ZZEA 4G09A 1P45A 2UVQA 1Y6ZA 2QN2A 3VU9B 4G0VA 4S35A 2G6BA 1Z16A 4XYGA 4Y2QA 3TECE 1PTKA 3VX3A 1OGYA 4BKUA 2X4LA 1O2DA 4HX2A 1KC1A 2JGIA 3P27A 2P2GA 3IOBA 2OCDA 1YMUA 2XPCA 4ZOBA 3OG9A 2F4VB 1HYGA 4IZOA 2NXCA 3DWIA 1S4QA 2YHBA 3O7WA 3PUIA 4L8VA 2HTEA 2EW8A 2ZAYA 4R2IA 1RLMA 1XMPA 2WG1A 2IU0A 3RTAA 4CG0A 3OLQA 2O6HA 5ARBA 1F6BA 3BZUA 4QPCA 5BQFA 1HE8B 5JNSA 3K09A 2O3SA 1JLKA 2LNDA 5H83A 1W75A 2H17A 3CO5A 3OBIA 4PTLA 3B2EA 5ECGC 3GF4A 4HPJB 2IF2A 2IDMA 4L5JA 4Y2VA 2X6QA 1UJ2A 3E7PA 4NIMA 4PR3A 4EX6A 4EY8A 3MZ0A 3PG5A 2QRUA 5KPJA 3GP8A 3F2VA 3JQAD 2G25A 1K9SA 5I7SA 3GVCA 2P11A 3OPYA 4BGIA 2ATVA 2OLJA 4I8DA 3ZUPA 3ZVNA 2AUMA 4DVJA 2WR8A 3VNRA 1DKOA 3BE8A 3WDKA 4BLOA 3SAJA 5DN6A 3E61A 1MC4A 3L0CA 5T64A 4NE7A 3UK1A 1Y7PA 4PICA 4C7JA 4KMRA 3GCWA 4B3MB 3LA8A 4MVJE 5JNVA 4E0BA 4G0UA 4G5OA 4H16A 3LUBA 1J8DA 2Z5LA 4NZYA 4IEFB 1RRKA 1T5OA 3TVDA 2VDPB 4Z9AA 1QVRA 3VV3A 2H07A 3K1JA 4TXMA 3ZLTA 1U8CB 1X1CA 2XUZA 3AEQA 4HPWA 4FK8A 3NGXA 2CNOA 1TECE 1G8MA 3WGOA 4BO7A 4U4AA 3FBTA 1WP9A 3FDJA 1UK9A 4G9BA 4KFRA 4UHCA 1KIMA 5EP4A 1T3ZA 4QBFA 5AVOA 3WQHA 1XZIA 2JAWA 4DA7A 3ADCA 2VDLB 3NAGA 2I8LA 2JVKA 3FLBA 4UPDA 3WHIA 2HGZA 5J4VA 2QS9A 3JYNA 3P19A 4OATA 1NGSA 5JOQA 1Q1AA 4EFLA 3AHIA 1NMQA 3OOEA 4LE1A 4JR0A 1E58A 1AGXA 2JIZD 3P2EA 4ZP1A 4YONB 3BXFA 1NXVA 2EJBA 4KJXA 5TR9A 4HDMA 5BT8A 1TI7A 2ZI7A 4IKOA 1DAEA 4ZOAA 4UDYX 4YN3A 2WSBA 2XA1A 3FWHA 3HXLA 5U1PA 2XCRB 3FKSA 1OZHA 3SU8A 4MJ3A 1DJOA 2CFSA 2YN0A 2AOTA 5FKJA 4ZKDA 1FFXA 3AL0C 1SKYB 2NU7B 1E62A 3JD3A 4JP2A 5TF4A 1DU4A 2COUA 4JBNA 3NRCA 4IDNA 2ZBUA 4NH0A 4AJKA 3DC2A 4I1VA 1XAGA 2YC2C 3GA7A 3K16A 5BN5B 1ZS9A 2IEAA 3IAM1 3DZIA 3KG2A 1ORIA 1M54A 4UOEA 1FMJA 1SVSA 1I2CA 1IG0A 3HCOA 3HJTA 5F76A 1HV8A 1DRKA 1LBTA 3MJRA 5JVDA 1A76A 3WLAA 4B4OA 2HA7A 1KO4A 1P1BA 3OC6A 1CUEA 2A57A 4YB8A 2FEXA 4N0DA 3V42A 3VGPA 1KY3A 3BZWA 1T3LA 1VHWA 1ZJ5A 2OG1A 2J4DA 1ZFNA 1R4MB 2GRUA 4KXWA 4Z0TA 5FI1B 5C2JB 2GM3A 4MVJA 4Z4QA 1TEVA 4FFDA 4J1NA 2H8GA 2X15A 1E5XA 1G2PA 1K6MA 1OWOA 3PNVA 4R2WA 2ECOA 4RDCA 4Q3OA 2PMWB 4ZO9A 4WN3A 4PZ9A 4ZZ3A 5DLPA 4M6WA 4DR4B 1EVEA 4NMWA 2OZLA 3ZQ4A 4Q3LA 2WFLB 3PR1A 3GZJA 3ZZNA 3K4QA 1XB2A 4Z3OA 1UFOA 3DCIA 5MF6A 4JLPA 4RDXA 1KMCA 3IHWA 2FQXA 1ZCZA 3Q7SA 1V39A 3QZUA 4NDZA 4WOCA 3ZY6A 4LBYA 1EGQA 4QAJA 1E0DA 2XUHA 2A4KA 3EUFA 2OA0A 3V7FA 2ORYA 1KOGA 4CZ2A 3G6WA 3QXCA 4PS1A 2INGX 3PNLA 3WVNA 5CYFA 4QA9A 5ALWA 3FFBA 3RJ5A 4Y6RA 4ZDKA 1NM5A 1WMSA 1II0A 1NUAA 2OYSA 1V96A 3MHTA 1F38A 2EBFX 3SSMA 1W6RA 2YN2A 4MKZA 2JLSA 1U1CA 3AEXA 3NBXX 3E5HA 1SRRA 2V65A 2G9QA 3AUAA 3EXEA 5BQ3A 5FJIA 3EDMA 2ZCVA 1H42A 1NI5A 4UAVA 2BEUA 1R4AA 4RSMA 2H4JA 4BNDA 1NI4B 1ZJYA 3IBTA 3IDZA 3THSA 3AR4A 4M98A 2X1LA 3EFHA 3KYCA 2DXIA 4ODIA 1KYVA 3NHWA 4EG4A 4AS1A 5A5VA 3RD5A 1KORA 4CKCA 2R86A 2REQA 4PNEA 3OCJA 4DKJA 1B7GO 3NDPA 3IJPA 4LVUA 4AZ3B 3TGLA 3U4MA 1XV5A 1FK8A 2EHDA 2B94A 2DJIA 2ENUA 1U8XX 3KPYA 4ND3A 2H48A 3GEIA 3IR5A 1IZ9A 3R9IA 1M6HA 5BY2A 2BPOA 3RYTC 4X1OA 3QOWA 1AOXA 5TMDA 3GFRA 1RMYA 5IBPA 1GGEA 2JGMA 3E3MA 4HX9A 4CEHB 2GPAA 3S3TA 2PLAA 3S1SA 1KOFA 1NMYA 4TSRA 4AECA 1CIPA 1J0CA 3DOFA 1DPGA 3VDMA 3OQJA 1YBVA 3N3BC 1K9VF 3HGQA 4J0FA 1ECPA 3PNKA 3UMBA 2FF7A 5HQTA 3QVVA 4QM6A 4Q66C 1VHDA 1H8ED 3PK0A 4BCCA 2V97A 2ZB8A 3QG1A 4TMZA 5KTSA 1JDVA 5IRCD 2GCGA 5EIXA 1BZYA 5ALGA 4CHGA 1XQ1A 1G8PA 2UYQA 4CIVA 2H7VA 1XO1A 1N33B 4JLBA 4Y2XA 1E6UA 1TO1E 1YB6A 3V1LA 2A5GA 1NDHA 3H99A 3U13A 4JGBA 2NVBA 2A3RA 2RHHA 3SM9A 1RYYA 5JRDS 3IEKA 1V11A 3GAFA 4BEJA 4U9IS 4IJVA 1WXEA 1Z34A 3ZH9B 2QTRA 4I1UA 3OZVA 4U6QA 2H2AA 4LDQA 3UMRA 4U2DA 4K8OA 4DHEA 3IESA 5JU6A 1OWNA 2ZIGA 1TA9A 4HNUA 3N75A 2QT1A 1NUHA 3DWEX 4ZT6A 3ZHRA 3Q41A 1TEHA 2P35A 4JP3A 2ZJ5A 1JJBA 4R9VA 3S0JA 2VYFA 2GJ9A 2QWXA 3U4AA 3DEYX 3HBNA 2PRZA 4GU5A 3HVRA 1CUZA 4KAFA 3AY3A 4DQKA 5DLYA 3ZWBA 1SXJE 3MOIA 4IWNA 3U4IA 1HZJA 4I4TA 1DJMA 2FEPA 2P9CA 4EGQA 5C80A 2DLDA 4ZIRA 1NE2A 3P0HA 3R24A 3WICA 2PUFA 3N2YA 7REQB 1QKJA 1KIFA 2Z0MA 4KE7A 1X13A 3NP7A 3ZTTA 4Q4CA 4CM4A 2EGHA 4L5CA 1GFSA 4KLRA 3RTCA 5JHHB 1I7NA 5KUTA 3BCSA 4CW7A 3H2YA 1NNSA 1R6BX 1TUGA 3OU7A 4CUKA 3JQGA 1ZM7A 4KSBA 2VBGA 4MI3A 4QU9A 4QNRA 1Q2XA 3HA5A 1QG4A 3CSDA 2X7XA 4C88A 3L4KA 3ZVKA 3LQYA 3ZBUA 1A1SA 3OCYA 3CNBA 2EKQA 5EWMB 3DPUA 5DTQA 2QX9A 2AC7A 1JEOA 1LQTA 4Q3EA 3QY9A 2NSDA 2YIMA 5CX1A 3WNZA 4UFPA 1RVV1 4WOKA 1YS9A 4DM7A 1F8UA 3IXLA 4UTXA 3ECSA 3LUFA 2H4WA 4JSYA 5HBGA 1PT5A 2J33A 2WJGA 1HPLA 1XAJA 2WQ6A 3G7NA 3UAVA 2I8AA 2WRZA 2O9JA 1U0LA 5H9VA 1EK6A 2B4TO 3AGQA 2PRIA 3AR5A 5ENZA 4N65A 4WE3A 1BCRA 1SCJA 5IDQA 1TZ2A 1RPTA 3EA4A 5HW0A 2GZ2A 2J46A 4JOSA 4N5IX 1J9EA 3OO1A 2QOEA 4QUKA 3EF3A 1U98A 1QYVA 4V02A 3DUFA 4Q47A 2VH1A 3NC1C 1R64A 3WOVA 1BX3A 1AKNA 1PT7A 2C03A 2VYQA 4QBHA 5IBRA 5JTTA 2BE9A 4HFRA 2R44A 5T4EA 3OOYA 3OZEA 1QIKA 2UUCB 2VOJA 4MUEA 3HRKA 1KYZA 1SQGA 1U99A 4DC0A 1B0UA 1SXJA 1T9KA 2B1JA 3R5XA 5BSHA 4LY9A 1OH7A 3IIEA 5FOVA 2C7GA 1PKXA 1ABBA 4ANFA 1LNSA 2W43A 1CEXA 3BE4A 4CRWB 5L4SA 1RXVA 1WKBA 1DTEA 1ZVJA 3MS7A 1Y1SA 3IPXA 4O1MA 3GLHA 1M2JA 5BNZA 2R87A 2GEVA 1V8FA 2IHZA 1KAHA 2RB4A 4WKGA 2F8TA 4JLVA 1J2TA 1GPUA 3BAFA 2LXNA 3D9QX 3DDNA 4WFQA 1AHHA 3PXCX 4OB7A 5JAUA 5IAJA 2CMDA 3RB8A 1U9YA 4H0CA 4PN7A 3BGWA 3QGMA 4J0JA 5DSTA 3Q5GA 4CV1A 3RFVA 2GJSA 3HCNA 1GHTA 4EHAA 5MFPA 5GIPE 1ZVQA 2GBIA 3AKCA 1TK3A 4EZBA 2HU7A 4ARUA 1SOWA 5AW7A 4YRQA 5I51A 4JCOA 4PW0A 5IVPA 2IEIA 3V2HA 3WKCA 5EUCA 1ATZA 2VUUA 1EDDA 3IXMA 4C6TB 5J4YA 2XZLA 4OLJA 5IASA 4V38A 3CZAA 1JHDA 5G4LA 1GXSB 1SY7A 5I7WA 1KKLA 3AYXB 3DBVO 1HQDA 2A9RA 1D7AA 1GQOA 2Z2JA 3WKEA 4EJSB 4ZZ1A 3PEFA 5BR4A 1GUBA 2O2YA 1V3VA 3EY4A 3ZKWA 3DQPA 4HNGA 2V4ZA 3RWOA 4HJXA 4X00A 1NKSA 1OLUB 5C37A 2LIVA 1OD6A 1RXIA 2REOA 4C1BA 5MGNA 3AK4A 3GFSA 1O5IA 1Z36A 3DBLA 3JX9A 1L4FA 3AM4A 4EG7A 2PZGA 2H5LA 4NCJA 1H5UA 2HA3A 2OGTA 4AKHA 1J2JA 2IYTA 3TNFA 4S1VA 1A0OA 5BRNA 4M21A 3P71T 4C20A 1QU3A 1JIUA 1GPMA 2H7CA 3NTOA 5FO0A 3L1HA 2Z4RA 1DWOA 3PFBA 4R8MA 4M1TA 2O3UA 2HDWA 3CGGA 1ELOA 3H8VA 3WLLA 2R00A 1PV4A 3G5AA 4M54A 1S2MA 2OV6A 3BRWA 4HJRA 4L5BA 1PVVA 5DFAA 1UC5B 4L2IB 5HUQA 2WTBA 3ACCA 1NVBA 2JK1A 2H4ZA 1ZD2P 1IH8A 4PYKA 1H2EA 4EYOA 1ZIOA 3PHGA 3R9KA 3WLFA 1AN9A 1ZH4A 3SLKA 3IFSA 3SYRA 3CVUA 2J7KA 2BFEA 2BFCB 3OPVA 4TKUA 5CDUA 1UQTA 2J87A 2QD3A 1C0KA 3NI2A 4FN5A 1NONA 3KUDA 3S1AB 4BCBA 1BE6A 1E7SA 1D2MA 1O0SA 1WPRA 3ABRB 1UF9A 3CIFA 4IIVA 3VBCA 5JSHA 2BKUA 4A82A 1Q0UA 1GU7A 1BG6A 3R3YA 3UJDA 1E3IA 1UKCA 2MYTA 1Z82A 2GPSA 1C4OA 1OLXB 3JZIA 5THQA 1LPPA 4NWIA 1RQLA 1XTSA 3G0GA 1GUYA 4RPKA 1F2VA 1ADYA 1QYIA 2VDKB 5KSPA 1X7XA 4N3AA 3WLHA 3J80A 4KLNA 4LYHA 2HJHA 4PAGA 2CUNA 3E9CA 4D6XA 3KQYA 2KPOA 3NWEA 2Z2XA 1GQYA 3IQFA 2D54A 2VH2A 3RLIA 5P21A 2HDHA 3LZ6A 1XXLA 4ZI7F 1TB4A 3N0WA 3C3BA 5IN5A 2BKXA 1GZ4A 3A1DA 3WWCA 4YRCA 3JQ9C 3LUDA 3HDTA 3W2FA 3ZQKA 2VT2A 3WL7A 4FFNA 1I3KA 2FSFA 3Q0EA 3R77A 1M1YE 1E3WA 2PU7A 1TPZA 2HQRA 3MWLA 4YLYA 2V1UA 1SXIA 3LDUA 1VMDA 1NU8A 1QHHA 3BCHA 3KJNA 1WBJB 3QTBA 5E6RB 2DHEA 1ZUNA 2DUNA 3IQXA 3EFOB 1XMQB 1D03A 2YRXA 4CMEC 4KCGA 2CVQA 3CH4B 3KHKA 1JFRA 4NPHA 5HZKA 3JVUA 2VH5R 3QMMA 2A0YA 2QI9C 2X1VA 3B6MA 1D2RA 3IQEA 1AKTA 1ULZA 1USUA 3IP1A 4IEEA 4LNUB 2X0FA 2HLNA 1XZCA 4O02B 2QGZA 4ZYXA 1K6XA 4QQRA 4Z49A 2KHZA 4N9QA 1KEEB 2QTLA 2NUBA 1P7YA 3JALB 4LBWA 3FSGA 1BQ4A 4MR7A 2EX1A 4CMHA 1V16A 5A6SB 4AUEA 4BX0A 1CQIB 2WFAA 4KPEC 2PXCA 2FUKA 1RU3A 1KR2A 2NO9A 2CHEA 2QLLA 3HDYA 4FD3A 4GGPA 1X7WB 1J8MF 1IHDA 1VSUA 4L6CA 4MV5A 5CCEA 4PQYA 4LCBA 3UJPA 4FFBB 2Q3EA 1QYXA 4CLOA 4F8JA 1SHKA 5TRTA 1FZTA 3VPBA 4BJ6A 1ZM4A 3NALA 4C7XA 4XUEA 4W5JA 2ARKA 3OPXA 3BXXA 1A4UA 1ZBQA 2VJDA 4MR8B 5AXBA 3QYJA 4BLUA 4FCWA 3CW9A 3BWCA 4R8SA 5G0SA 3WK7A 1PTJC 1PGQA 4WERA 1UQUA 1X87A 2X8WA 2YNMD 3CH6A 2I3AA 3TL6A 2WOOA 1XLTA 4FSDA 4JYAB 4KQ9A 3ZLBA 2IUTA 1V37A 2X19A 3LWNA 3K2QA 3QKIA 2UXDB 3VOTA 2PWPA 2AMJA 1P2GA 1R9NA 3DO5A 5IZ4A 2PJZA 1MUUA 3I9JA 3SQMA 3BTUA 4Y1GA 1QP7A 1KA9H 3C5CA 3ESZA 1IN8A 1BOFA 2CWWA 4FUQA 2ONYA 3PX3A 4Q39A 4EECA 4P84A 5AIBA 1T2DA 1G60A 1J8VA 1IDOA 3MRVA 4HUQA 1NOJA 1CD5A 3P2MA 3QITA 2Z8YA 2WA1A 1M1YA 4UAGA 4DJ5X 4LYGA 1Z2PX 2XVMA 3PSHA 1B1AA 2FN3A 2H08A 4UUNA 4CT0A 3HP4A 5B4TA 5KX5B 4H4DA 5C1PA 2C2WA 1RYFA 3OZWA 3E9YA 2DBRA 4KRGA 4MRRA 3P0EA 2EJWA 4ECEA 5AVUA 1UOOA 3CLRC 4MZDA 1L7EA 1WOYA 2Q5EA 1JTFA 4HF7A 2C99A 4ZPXA 4IP0A 4XUGB 4HS4A 5A5GA 2EERA 1AKWA 5C8XA 5LP6A 3TO5A 4K2HA 1KZ7B 4TS4A 4DAEA 4GYJA 2F3QA 4NC9A 3W8FA 2FMXA 4FFOA 4IDFA 1NW8A 3VAZA 1XN1A 2QD4A 3NTRA 5F5LA 5C8ZA 3ZCPA 2D0OB 1YZ3A 4CYMA 4AY5A 3LBFA 16PKA 5FBVB 2NZVG 4LWOA 3A4YA 1HEIA 3U1TA 3J81A 5CLHA 1TNDA 2CE7A 2FWBA 2RGXA 2VJMB 3O9VA 2AJLI 4MA5A 4QYWA 2IDJA 4YMWA 4EA6A 2X5OA 1KIAA 2QNBA 5CH8A 4YGYA 2PRKA 5M7EA 2C0PA 3H5IA 2H4YA 3PIRA 4GLFA 2PUHA 5AHWA 3KTFA 5BN4B 1YE8A 4KQGA 2RHCA 4YCJA 3UB2A 2ZXEA 1HYQA 1R5NA 2VHJA 3GJRA 3KU4A 4G4SP 4E5SA 3G7SA 3HXTA 3PGMA 2JA2A 2HHHB 2YTZA 2Q4BA 4LOKA 1T5BA 2R1VB 3B6ZA 3OJCA 5ALLA 4CMIB 4Q9NA 2C3MA 4WWHA 3V7UA 2RG1A 3NV9A 4IWYA 2P68A 4H4EA 3VVLA 2O07A 4LVCA 4YRIA 2R7KA 4PO8A 3T7KA 4ME6A 4E21A 5LNK1 3F9IA 1E2GA 3IT3A 3FOEC 5CLQA 5CMLA 4BXOB 1L5KA 4YRRA 3UW3A 1IDN1 3VNQA 1P4SA 1QC5A 1WUKS 2ILTA 2JIBA 3VNBA 3AUUA 4FFLA 4A4DA 4HUTA 2I3DA 1F60A 3MWDA 4G85A 3W6UA 2LVBA 3PU6A 2DF8A 2EKLA 3ZHXA 2OC4A 1L8AA 1Z0IA 3COWA 3O95A 1A2BA 1UXIA 1XALA 3SMVA 1RM3A 5LLTA 2PUEA 3ULKA 1EJ0A 2GKOA 2GO7A 5EINA 4NNJA 4D41A 2Q9CA 4O6VA 5JCZA 4NCNA 1SIBE 2NZWA 1CJSA 3FNBA 3ITEA 2W2KB 4ZXFA 2ZUTA 1KK2A 4G8JA 1S8FA 4C0XA 2BGMA 3WZ2A 5C81A 2W71A 1NQOA 2YBDA 1RD4A 5AM3A 3RGGA 5J4LA 2Y66A 4Q7JB 1CYEA 2QTMA 4MJ7A 1QVZA 1EUZA 3L1JA 1OKKA 1I33A 3FMPB 5EAIA 5EFOA 3ZIUA 1PW5A 3E1KA 4FTWA 3FTDA 1PJZA 4U2EA 3AHHA 3PYMA 1O8CA 3N0RA 3Q85A 3CWQA 3PHIA 3QE3A 2VJYA 5D00A 2DEUA 1WZCA 4IZ6A 2NLOA 3GLFE 3BB3A 2OILA 2SKDA 3BYZA 3F8TA 1Q7BA 3OJWA 4IIDA 3D64A 1MOQA 3P26A 1RWXA 1MMFB 1JQJC 2WDZA 2XTAA 3PD1A 5J1TB 2I7DA 3FLMA 1JKJB 3IR7A 3RO7A 4FCCA 3WFIA 4AULA 1ONNA 2GBLA 3JARB 4HLDA 2GERA 1QUEA 2BM9A 2O5CA 2V54A 1GCIA 5FORA 2JCGA 2D1RA 5DX0A 3KSBC 1TKCA 3ETHA 4WDQA 4J7XA 5K03A 4IUYA 1NP6A 3AWDA 4FYVA 1U0BB 3IDQA 3VYTB 3AEZA 1LCIA 2G76A 3QLUC 1IY1A 1Y82A 3IP8A 5B55A 2G1UA 5CCXA 6ABPA 1QIMA 3Q7EA 1VI5A 2YASA 1TTPB 2VSQA 3U49A 3WLTA 5JNWA 3JQQA 4BMDA 5K4AA 5TV2A 4FP9A 3K0CC 3L1UA 5IM4F 4BAUA 3LA6A 4N8DA 2O1EA 4G1BA 5HKOA 3VPFA 4EBBA 4UCQA 5IAEA 3IA2A 4HQNA 4ZN6A 3I01A 2AZDA 1GM5A 3HJUA 3UHJA 3KS9A 1PRYA 4HVAA 3PWTA 1KSGA 5GGXA 3P2KA 2CXTA 4G0ZA 1CF2O 4N4AA 1IE3A 5FLXA 4ZAWA 2RK3A 3T4UA 2X8JA 4G4SO 1GEEA 2Y2VA 3KV1A 1Y63A 2IE0A 3IURA 4ZXPA 2YFQA 1IM8A 1P9RA 2AKEA 4WA7A 5A1JA 1NR7A 3CVVA 5CR9A 5DCUA 2WVJA 1HNZB 1Z08A 5HDBB 3OP4A 2VC2B 3RUCA 2ZAOA 4EUNA 2JJMA 4A8HA 4F3KA 1R6XA 2JL1A 4Q3DA 5EZ5A 4WA8A 2O50A 2RSLA 4AZWA 4B71A 2RIRA 3LPCA 2TMDA 2Z5VA 3P0FA 5CT8A 3KZVA 2ZBQA 3DEJA 3QOXA 1KYYA 1QGZA 1AK9A 2I55A 4H7DA 3P9QA 3OVMA 3OEHA 1QZUA 5LZ9A 3HWWA 3IPRA 4LAFA 1F9AA 3GLFA 2YS7A 3B3FA 1XYYA 4LK3A 3IV6A 4JBLA 3AEKB 2RKWA 3KCQA 1K6EA 3MC1A 4UBIA 2VK4A 2R0QC 3H7IA 2R5FA 3TZLA 2YDYA 4J1TA 2QUIA 5D6OA 1YZYA 3NWBA 3O8BA 1SC4A 4K6KA 4L1KA 2A9OA 2B1IA 5CH5A 3O2QB 5HM6A 1LDGA 2ZT5A 3LCJA 4MB6A 1MPTA 3D0KA 3QUQA 2QT0A 3ZWWA 5JXWA 4AYXA 3EMKA 5CA0A 3BL6A 4RIEA 2QF7A 5D01A 2BHNA 2FZ4A 2VPWA 1AUOA 1T29A 2KWIA 1FFWA 5AM4A 2EARA 5M3BA 5HOEA 1F8XA 3D3JA 3PNBA 4JI3B 5EKUA 2ALJA 5IARA 3D1JA 3I9NA 2EKPA 2JJ2A 4B84A 2V58A 2DUMA 2KJQA 4HDKA 1O7JA 1RI3A 3OPYB 4QBGB 2RKOA 3NOXA 5KCZA 3Q2KA 5KPDA 2FWIA 3QFHA 2GVDC 5E7MA 3Q40A 4LF9B 1EWTA 2BCJQ 3NHAA 4RPJA 2GBPA 2HAEA 7MHTA 4K03A 1GT91 1QK4A 1T6ZA 2ISCA 1ZK1A 3W5UA 2A1TS 1B8VA 2G5PA 1OVMA 3S2IA 1F3LA 4BJ1A 2KLHA 1SVUA 3CF4G 2OCBA 1RRMA 5COBA 1OT5A 1U4SA 4GC5A 1FFGA 3TXXA 3V9AA 2BDEA 4NMMA 4OHYA 4PX5A 4C4SA 1AQUA 3AEQB 3WGNA 5EIBD 3OEEA 2QJOA 1R0LA 4BO0A 1CZUA 5JROA 1T2FA 4LOIA 3OURA 3QXJA 4LTMA 4GE3A 3SZMA 3DLHA 3OQPA 1BOOA 1DZ3A 1C7EA 4PGGA 3IVAA 4IX1A 1U8TA 3A1FA 3Q7QA 4KTTE 4CKCB 1VLQA 4HR7A 5KYWA 1L8OA 1X8KA 3NT5A 3OIUA 4JSTA 3I83A 3NHZA 3WNCA 3GLTA 2JDID 4JWTA 3CX3A 4YBZA 1RZVA 4HDMB 1ZR2A 3M4JA 4PFKA 4L51A 1EDOA 2ZYGA 3AY6A 3JXEA 2Z6AA 3RYIA 1SCQA 1UOEA 1YULA 2AOTB 1IY0A 4BO8A 4ESHA 1WL8A 1TVKB 1TLLA 2XKBA 2G1PA 2XZPA 4FHZA 3BIWA 4RWEA 1P1FA 4ZRMA 5EIFA 5EWJA 1Q14A 4EJSC 1T13A 1OFGA 3EJWA 1FMTA 4FQ5A 2XUFA 4QQNA 5M04A 1VBFA 3OIGA 1UMBA 4RPHA 1K1EA 3TBHA 1WCXA 2RHJA 1OROA 1S2DA 1YZTA 1ADCA 1DUVG 1H2HA 1JQKA 2BMJA 3PFKA 5BWMA 4H3KB 3FIUA 3MAJA 4HZGA 3CMCO 2NO1A 1ZA2A 4RHCA 4MQUA 1A8HA 2PSHA 2VCYA 3H1GA 3HB5X 4RYDA 1G7CA 3L01A 1C50A 2CK3A 3N2GB 3CUYA 4FDTA 4J03A 5K3SA 4ZAXA 3WFZA 2TYSB 2BHSA 3DEIA 3ZXSA 4KLZA 1T5IA 4D43A 2VR1A 4F9TA 2WM3A 4U2FA 3OFSA 1RBQA 4J7AA 4DEVA 1Z25A 1K7EB 2G9VA 5TNXA 3EPHA 3G49A 1CDDA 1MA0A 1Y3IA 5K0NA 5SY6A 3L0IB 1Y9ZA 4JBHA 3TOXA 1ISFA 4Z53A 3VR1A 3UMYA 3OSZA 3CCFA 4M6WB 3KOWA 4HH1A 3THOA 3CYFA 3GRCA 2OZLB 5DGTA 3UKOA 3KQVA 3PC7A 2ZK7A 2PSSA 4O0MA 3RG8A 1FRZA 2IEDA 5A4MS 4NBLA 4W9NA 3MNFA 1MFPA 1XZLA 4C4OA 4FZ5A 4G25A 3IJRA 3M4ZA 2CLFB 1NULA 2J6BA 1XG5A 1F17A 2C2HA 2HL6A 3RC8A 1R5OA 5AIAA 4JX8A 4B75A 4RTRA 1H85A 4YT5A 5FBKA 4FSXA 3AY0A 3RRXA 2CV1A 4RJIA 4TLMB 3GFVA 1PT9A 3DL7A 4QYIA 1OBFO 5AOAA 4ZYTA 4B4UA 5FBQB 2JJ8A 2OXEA 2WPDA 3OQMA 3CLTC 3KQUA 1R6DA 3K4PA 2QU7A 3EXEB 3FKQA 5PNTA 1NOIA 3AUSA 4L0DA 2IODA 2QVYX 2BEUB 1EX7A 5KAPA 5B7QA 2UZ0A 5CJJA 5KNDA 4ETIA 2QQFA 4MRMA 4BVFA 5LQRA 3KYCB 1AQ6A 3CR7A 4PLCA 5BVGA 3DZDA 3H87A 4IEIA 2FPOA 2WZDA 2REQB 4FOPA 4XCVA 3M89A 5LZ5A 2XTNA 3RVLA 4AX4A 1GFZA 2CXQA 3I8SA 1NQTA 1X1TA 5HNKA 4GRDA 3WFJA 4LRWA 5JISA 2C3OA 2X9GA 1MXHA 2Y4NA 3RS2A 1DV2A 5HE8A 2EHJA 1Q7RA 4AFNA 5DSXA 1OZGA 5AI5A 4RH1A 1CDEA 1V4VA 1XX6A 3UANA 2EATA 2OORC 1MHTA 5D2CA 5L7YA 3VR6H 4KWHA 4XVHA 1ENZA 2FW1A 1BA2A 3OIFA 4EG5A 3B1JA 2KBEA 3O3OB 3TLJA 4Q9DA 1J24A 2QNRA 4YWHA 5IDYA 1NAIA 1XLUA 1BCSA 2ZCJA 4M7RA 3RU7A 2W93A 5LKAA 5DYTA 2HDNB 5I8WA 3F74A 5AW9A 2XD4A 4BYMA 4DGSA 1PSZA 3MWGA 2YMPA 2GMWA 1TK9A 3VPAA 2C2XA 4S3MA 1TKBA 3VKWA 4TYPA 2OHGA 2ZJOA 1V11B 2WIGA 4UJ3A 3IBSA 1ZOLA 2BONA 3OCCA 3QWHA 4GWGA 4MKIA 5KOYA 1A8QA 3RQSA 4M9CA 1CRPA 3QNUA 4YJFA 4ALNA 4XJTA 4ZOEA 1XK7A 3IT1A 4MITA 1OAOC 2ECKA 1CLUA 3CZQA 3OJXA 1WZ2A 4E32A 5B6JA 1T5DX 2F4NA 1VL1A 4K6FA 4UOZA 1SBNE 1XEAA 4M8LA 4IDBA 2IK8A 3C85A 3O4FA 5EEGA 4I4TB 2O06A 2ZT7A 4NYMR 4RD3A 3MHPA 5KNLA 3DQQA 4ZIRB 5JUWA 1VHLA 4YVFA 1XQXA 2VP9A 1NQXA 3WV5A 3STHA 2YWFA 1U8ZA 3H2GA 1EVZA 3O1JC 3PR2B 4I6JA 1A3CA 2J9XB 3ICPA 4WLOA 4OBBA 2J9ZB 2OR3A 2BFBA 3EIFA 3O4GA 4TTSA 3V8BA 4CM4B 2P90A 5MHTA 2BHTA 1K97A 2ZR8A 1T4DA 2DHCA 3TPCA 2ID8A 4OM8A 5HCUA 2Q7XA 3LHIA 3A3KA 3K7EA 3JQGB 1E6MA 1FDTA 2CHFA 3EISA 4YCBA 3ESXA 1GUDA 1DAKA 4A0RA 1KRWA 2NU6B 4Y2GA 1T24A 3ZCVA 4J1QA 2VHQA 1T5LA 2DUJA 4G86A 3QK7A 2DERA 2OHXA 5HMMA 5CX1B 5LXTB 3QLTA 2V8OA 1ZXBA 3G82C 4QO8A 1LK7A 4YFYA 2VDMB 3SXUA 1PBTA 2PBFA 1X6VA 3DLPX 3JS5A 2HHAA 1QVAA 4FDVA 2J67A 3PT9A 4LI3X 2ONJA 2GTHA 4D26A 3WGIA 1ZD4A 2L82A 2OXTA 1Q7CA 4BNMA 3OLYA 3ZJYA 1JI3A 5JC1A 1V9CA 5HX7A 3EVEA 1WF6A 4DANA 3OY2A 4WEOA 3NYQA 3PXUA 1WY5A 5AJXA 4OI4A 5DCWA 4ZAGA 1DJLA 3EQ6A 2ZIWB 3RS9A 2EVWX 3KTAA 3DUFB 2E5WA 1U81A 3NX4A 3QLJA 4OD0A 3GQBA 5CIYA 2HA2A 1UBUS 1ZVKA 3BL8A 3GT7A 3RFUA 5K20A 5K0JA 3S99A 3GROA 2PUAA 2IYRA 2G1AA 3CRQA 3LG2A 1QLWA 5A4DA 1EFCA 3TNDA 2PS3A 1SXJB 2DP4E 4KWTA 2VK1A 4HNTA 2AHRA 3W5DA 1A9RA 3OZBA 3BMNA 4B81A 3ENWA 3ER9A 3WK5A 1OVGA 4NESA 3Q5EA 3WY9A 1PEAA 2PLFA 3JD2A 4QTZA 2V9ZA 4L57A 3CWZA 3JVIA 4JC0A 4KR3A 1UP6A 4F3YA 3EGXA 3NTXA 4DIBA 1P1KA 4P7BA 4LJ5A 4J3JA 5BSTA 4Y6LA 5EPOA 3AIOA 1SJ9A 3DNPA 3ED5A 1ZW6A 3CISA 5DYYA 4MLZA 2VF8A 4GMFA 2WUWE 1HLGA 3PXXA 4PLWA 3K2IA 3KB2A 1YB5A 4K9DA 4MEAA 3GJQA 4F6RA 4JMPA 3LT4A 3R23A 3HFSA 1FDWA 4L8LA 1ZRMA 4J7CA 4EKIA 5C1IA 3RVMA 1VKRA 4GX2A 2IXBA 4OGFA 4QASA 3ZUGA 1JDNA 1ESZA 4NMHA 2CLCX 1GVHA 1A9SA 2VCHA 1Q0PA 2H1SA 1QU2A 3WWOA 2GZ3A 1ZI9A 3R3VA 2N0SA 3MTBA 1QR2A 3K73O 4ALIA 5JYDA 4U7PB 1NASA 4BMNA 3ZKWB 1XL1A 4W1SA 3CM0A 2EC5A 3R0QA 2DUUA 1NXWA 1KETA 1IC6A 2HHLA 4OUDA 4ES6A 1YE3A 3BFPA 3ETLA 4NMXB 3RYHA 2JH3A 3QWIA 4BLSA 4XOUA 2BCGY 3FM9A 4MR9A 5HBRA 3DBLB 2G70A 1UM9A 2O8CA 3VRHA 1GG2A 3NTQA 2CC2A 2Q5CA 2XMRA 3PSAA 5D1HA 1RQNA 2A78A 5DDIP 4LWQA 5ETJA 2QZPA 1UEXC 5I4BA 5JJIA 2R9VA 1U1DA 1JEJA 2XYVA 5KX5F 1XEXA 5BRJA 4G5YA 3IEXA 4PX9A 3F8WA 4KQKA 4CQJA 5AVXA 2J48A 8ABPA 4L8GA 2GUGA 2XNDA 2OZEA 1RKXA 3O0TA 3L8HA 3PFFA 3IVMA 2PD4A 4I08A 3W1WA 2JW5A 4XWYA 3RFCA 1M1UA 1ZHOA 1S9HA 5C34B 3SKXA