1FUKA

Crystal structure of the carboxy terminal domain of yeast eif4a
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
162
structure length
157
Chain Sequence
b'IKQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGGVAINFVTNEDVGAMRELEKFYSTQIEELPSDIATLLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EUKARYOTIC INITIATION FACTOR 4A
publication title Crystal structure of yeast initiation factor 4A, a DEAD-box RNA helicase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 55
structure length 157
sequence length 162
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2000-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1fukA00
2R62A 4JLPA 4N0EA 2JLVA 4XTRA 1LS6A 1UBEA 5KNCA 4YMSA 1P9WA 2P65A 1QG2A 1NN3A 3DMDA 4B74A 4V0OA 2J41A 2VHTA 1P2SA 2ZRMA 2VBCA 2PEYA 3JVVA 4I1SA 4MGIR 4QL3A 2O8EB 1P2VA 1E6CA 2OCYC 4A8JB 5IDVA 3TUJC 1D2NA 1W0KD 1GM5A 4MA4A 1YKSA 1XRJA 1ANKA 1IN7A 1SVKA 2ZJOA 3IPYA 4IXNA 4TT3D 4CZ2A 2VP0A 4G5RA 1TTTA 3D31A 4PR0A 4YMVA 1Z5ZA 3OFNA 2BVNA 2I3BA 1XCGB 1H8EA 3P1JA 3N70A 1ZVQA 3THWB 2WSMA 3P4XA 1M74A 2ZJ2A 4E09A 5G3YA 3WBJA 4G01B 3EPKA 4K81B 1LTQA 1SGWA 5CDFA 2CK3D 2XJ4A 1DO2A 1VCOA 2ZYUX 3CNOA 4FMCF 3QOFA 4HB2A 1NVUQ 1U8YA 5CM8B 1LW7A 1XMSA 2Q9CA 3KB1A 3UWOA 2HJVA 1P7CA 2JJ2A 1RVDA 2X1VA 3LWNA 4HDCA 4QBIA 4TMTA 2FDCA 4DVGA 5KUTA 2D7CA 3SBEA 3P4YA 1UBFA 4YONB 5JWOA 1U9IA 1X1SA 1ZAKA 4HAYA 1Q22A 1IQPA 2GTPA 3DVLA 3EIQA 1DO0A 3QKTA 4M21A 4BRUA 2F9LA 4DCNA 1W36C 3B5JA 3JVUA 2ECKA 5EE3A 4UKDA 1Z0JA 1DG3A 4D2IA 5KPDA 5DHFA 5TARA 4JS0A 2DYKA 5JI3E 4MGYR 2FSFA 2ZRKA 1PLLA 3GLGA 2O8BA 4XWOA 3TJZA 5CYPA 4NCJA 4DRZA 2ZJAA 3WHKA 5FPTA 2WZQA 4B35A 3BH6A 3CWQA 4JBWA 3ZD6A 3A1SA 3HPRA 3WYGA 2XOKA 3UATA 3SFZA 4DXAA 4IDOA 2DCUA 2OSBA 2F3RA 1MV5A 1G8YA 2OHFA 3UMRA 4AIIA 6Q21A 3LW7A 1ZM4A 2ERYA 3TGPA 1FP6A 4IEEA 2R6CA 3MWLA 4PX9A 3NDBB 1PLJA 2QNRA 2C96A 2W83A 3C15C 1T5IA 2ZRDA 1KI9A 4LBZA 4EFMA 2O8EA 1GDDA 4TQAA 3QNUA 1S4QA 4GZLA 1BYUA 1IM2A 3AVQA 3CRRA 3OF5A 1S96A 5A4JA 4TLEA 1VYUA 1FMJA 1MH1A 4HUTA 5TXGA 4IXMA 1FMLA 1Q20A 4I99A 1ZD8A 1S1MA 1TNDA 1XEWY 2J45A 1N6RA 3UMSA 4XD7A 1NL3A 5JJLA 1SXJD 4UQOA 4C7OB 1X6VA 1UKZA 3EASA 5DSZA 3QKSB 3SHWA 3M6AA 4Q19A 3T35A 1W2GA 3MLEA 3DPUA 1BMFA 4LI0A 4CYMA 4JL5A 4BFTA 4PZZA 3LXRA 4OK5A 2YKGA 2VHUA 1G9XA 3FKSA 2JIZD 1XTIA 3NEYA 1ZD1A 2AXNA 2OG2A 2XSZD 2ZE7A 4IDNA 4B2PA 3WRYC 5EXXA 4MRPA 4DIEA 4UXIA 1QBKC 2FPLA 1VYVA 3MAAC 2EYUA 3LV8A 4EPVA 1L4YA 2CLSA 2IYWA 4D82A 2JGNA 3FMFA 4TQ9A 2C95A 1R0ZA 2FN4A 1JR3E 2VEDA 4TL6A 2R6GA 2IF0A 3E5HA 3EZ9A 3FMPB 3ZH9B 3K0CC 2R6AA 2KI5A 3PITA 1ZUHA 4MH0R 1G8PA 4URZR 1EFHA 2I4IA 4UNSA 1Q1EA 2IUUA 4MQBA 2ZM5A 4EFNA 5CJ2A 3I8SA 1G5PA 3DKPA 3LQRA 1AS0A 4LHYA 2BMDA 1S3SA 1E4VA 2NO7A 3QXSA 3A58B 4KFUA 3TVTA 4B73A 4BZXA 3LLUA 1X8LA 3AKDA 4A82A 2QI9C 5FPSA 3REFA 2REXB 5G53C 2QRNA 4CDGA 1AKYA 1OJLA 1A82A 3WHLA 2Z4RA 4JT4A 4YMTA 1NP6A 2E9SA 2PZEA 1T91A 5AK0A 4E22A 1IXZA 4A0HA 1T6NA 1ZCAA 2P3SA 4LHVA 3ICQB 1VIYA 4KFSA 2BIFA 4LJAA 2ZRCA 3L0IB 4AKHA 3AVYA 4DLWA 4IEIA 5CK5A 5J4LA 5JHGB 3PVSA 1HUQA 2C98A 1PUIA 1UBGA 2IYZA 4CIDA 2JLXA 3R8CA 4M9ZA 1ZRHA 2FFQA 4PC1A 2WICA 3OEEA 4RKEA 2ZAMA 1ESNA 2VO1A 3SC3A 3BB4A 5H8WA 1DVRA 2WTUA 2D7DA 4ABYA 3RANA 3MGCA 4II7A 2GXQA 3TAHA 5EP4A 1WQ1R 5FBQB 4LJYA 4PPNA 4C7OA 3E1SA 3QG1A 4NYJQ 5FR1A 1M2OB 2H57A 2V6JA 1IBRA 4DLUA 4GP6A 4HLUA 1YZKA 2ZI3A 2E87A 1E9FA 2A5YB 3EG5A 3QKSA 4KFTA 4LC1A 4QGHA 1AN0A 3VR3A 4TMKA 1JALA 1Y63A 3CBQA 1GRNA 2J0QA 3B8HA 1SXJB 3K8YA 3U3JA 3R8FA 1RC8A 5KOYA 2VPPA 3N5CA 1G17A 4HDOB 3SN6A 2GF9A 4AKGA 1BIFA 2FGJA 3CX6A 3ZZ0A 3H2YA 3IILA 1IN8A 2QT1A 4Z51A 1Z07A 2Y8EA 4LRWA 3W6OA 3WYAA 3KUCA 1O3YA 2XNDA 2FSIA 2O5VA 3B1WA 3HPQA 3NC0C 1BO6A 3DEFA 3QF4B 3QVUA 1DAEA 2J87A 3LBIA 2WAYA 2XITA 4WAUA 1DBSA 3QENA 4QM6A 3WXMA 4ZDJA 2IT1A 2G3YA 1MKYA 4GOJA 4RZ2A 2YVUA 1G7CA 2O8FB 3TLXA 3GP8A 3U61B 2C77A 1KMQA 3VX3A 2ZSEA 4P31A 2GETA 1IXRC 3VHLB 3Q7QA 4GL2A 2JATA 1Q21A 2F55A 2JLWA 3U44B 4ASUD 4BLTA 2ANBA 1DE0A 5JLJA 4KYUA 4CEJA 1KSGA 4B34A 2BBTA 3WNCA 4CEIB 1KI4A 1XMVA 2P6NA 4KVGA 1OIVA 2IHYA 5LBIA 3PEWA 3CH4B 2JASA 2NZJA 3BORA 1FTSA 2B21A 5JRJA 5A5GA 3FWYA 2OFXA 4JYBA 4EJSB 1E3MA 4ILEA 4AWXA 1OV4A 4JL6A 1PUJA 4ZDWA 4NCIA 3EWSA 1G4UR 4C0JA 3ADDA 1HY3A 1SULA 3GLIE 2RGCA 5B2ZA 3EIEA 2L0XA 3EC1A 2QSZA 3RWOA 4KCGA 3K9HA 2WPDA 3VKHA 1YRAA 2PJZA 1N6NA 2ZUBA 2C5LA 4KSCA 2FJUA 1VG0B 2B7CA 2QPOA 3RWMB 1GKIA 1E2PA 1H8HD 1YZLA 4A2QA 3HU1A 3VMFA 4LCBA 3X1YA 4Z8YA 5A0FA 5DH9A 4F7WA 1JNYA 4C0QC 1GP2A 2VYFA 2D62A 4MYHA 4BFVA 4BPBA 1E2KA 1XTKA 1JEEA 2IUSA 3AKYA 1HE1C 3T12A 5IHPA 2QMHA 2ZJ5A 1OHHD 3LQQA 2FZ4A 4Q7KA 2QMOA 2W6JA 3EZ6A 1NVVR 1YR6A 1XTJA 2ZSDA 4BFUA 5LB4A 3R7WB 2J7PA 3GEIA 4URXR 221PA 1JXMA 2FSGA 4M1MA 5LD2B 4FCWA 4ITRC 1YE8A 4NCNA 2ZEJA 3KKPA 3QF4A 3DO6A 1SVIA 2GJAA 3NBXX 4ZCLA 1J8MF 2RHDA 1HT1E 3K0SA 3GFTA 4IVQA 4BLOA 1N0UA 1W44A 1KNXA 3DL0A 2OCBA 4AK9A 3SJAA 1E96A 2O8FA 2PMKA 4C2TA 3TUIC 4KLZA 5FOSA 2QORA 4BWYA 5HCIA 3AVPA 1US8B 2QE7D 3RYTC 1Q57A 2RKOA 5FUWA 4MYTA 2FEOA 4PC7A 3CNNA 4O2LA 1YJ5A 3TVDA 3HYRA 3IDQA 3NBYC 3NKVA 4MGKR 2B7BA 2W2XA 3NXSA 4JLAA 4CEIA 1BKDR 1IY0A 2CL6X 1GAJA 1H65A 4ZKEA 4JZKA 4DDUA 1QZXA 2A5GA 2D4HA 4HATA 4Q4AB 4KFRA 2MMCA 4JLDA 1KI2A 1KY2A 4K8OA 1G6OA 4LJ4A 3SQWA 2CLDX 3CO5A 3I4LA 2QAGB 2WJJA 4D6PA 4RFSB 1OXXK 3WMEA 3M4YA 3SE0A 3I1FA 1LFDB 5GADl 4AC9A 3VU9B 3HU2A 1VHLA 2Q0HA 1E69A 5L8VA 1MR3F 2ODWA 4KJZA 4Q1FA 5EP1A 4URWR 3TQFA 5G3ZA 2ZVPX 5L3VA 4M1OA 3O8CA 5D3QA 3LVRE 1RW4A 4MDFA 2WKQA 2GJSA 4DCUA 3U7FB 1KKMA 2CHGA 1GRQA 1LV7A 1YR8A 4M1WA 5H1YA 2EYQA 4XIGS 2ZRPA 5HZKA 4TZ0A 2PEZA 1M34E 2FMXA 3NBZC 5HZHA 1VCMA 2AWNA 3T06B 1DAGA 3TR0A 2JLZA 2UKDA 4HLCA 4EKDA 2QQEA 4F4CA 1N6PA 4PHTA 3DDCA 4PSVA 5AWFC 2AFHE 1KMHB 1R8QA 4S2EA 1XXHB 4TTRA 4CW7A 3GQBA 3MUFA 1JJ7A 2RGDA 4LJ5A 2WSSD 3OEHD 3I5YA 3KXKA 1CJKC 1S2MA 3BH0A 1HYQA 1FP7A 4FW9A 4WA7A 4EFLA 2DFNA 1T0JB 3NIBA 3VR2A 1P60A 3CLVA 1Z0KA 4OYHA 1E2GA 4QNMA 4HZUB 2P6UA 1COWD 821PA 3OAAA 1MT0A 2V6IA 5SZIA 2DWQA 4NYIR 4ZDIA 2B8WA 2FWRA 4RZUA 3UG6A 3IQWA 2KE5A 2WMNB 1Q3TA 2BBOA 2GHIA 3KJEA 4L4UA 2IC5A 5AJVB 4XWKA 2OT3B 3PUVA 4KAXA 4IW3B 4MRVA 3QPUA 1WP9A 2HXSA 5FUYA 1Z28A 2ZSBA 2PLRA 3RSLA 4Q4AA 3RRNA 1D5CA 3GLFE 3EZ2A 5FL3A 4B48A 3GD7A 1J99A 5DHAA 2E1RA 4V0MA 4WZBE 3B1XA 2V54A 1IN6A 2QAGA 2BBWA 3E2IA 3MMPA 3OFND 4DC9A 1H8ED 5B57C 1SKYE 3GJ3A 2ORIA 4RFSA 4P4SB 4ERNA 5F3WB 1GL9B 1E94E 3N2EA 2RGNC 3I61A 3VU9A 2RGAA 2BM1A 2F6RA 3QXXA 2JJ8A 1WA5A 1KKLA 4C0HA 2IS1A 1RKBA 2Q9BA 3U6KA 3LAWA 2XB2A 3AVWA 1OYWA 2Q9AA 1HQCA 2DBYA 5GJWC 3TKLA 4PZYA 4RVCA 2JJ2D 2NG1A 1Z06A 3PUXA 1PZNA 1E2DA 1ZMXA 1GWNA 5E4FA 1FX0B 3BAFA 3QY0A 3WNDA 2F9MA 3KL4A 3ECCA 2WWHA 3AEZA 3BC1A 3SJZA 1NMZA 4ZCMA 4EAQA 4DEXA 1RZ3A 5DE3A 3BOSA 1II0A 3B7GA 4BEJA 1GG2A 4DSTA 1KMHA 1Q3HA 1XXHA 4P4TA 1KDOA 2Q3MA 4TWZA 1VDZA 1M7GA 1AIPA 1EFRA 1ZM9A 4DCSA 1XZQA 3AUYA 3FPAA 2QTFA 2XOKD 4G5OA 2ZI4A 3BWDD 1E2QA 3KXLA 4OHZA 4HZUA 2IA5A 3RS2A 1AGPA 4ACAA 3I8XA 5BN5A 2BMJA 2XXAB 2XTZA 4GMDA 3VKGA 4RD3A 2D2FA 2NO1A 2ZR9A 1OXVA 2GCPA 2QGNA 1F2TA 4EPWA 2CNWA 2RCNA 4NU0A 2OUKA 2YOFA 2FOLA 3LNCA 2PT5A 3AF1A 1P72A 4HB4A 1YZGA 5F9FA 3NHAA 5F2EA 1TAGA 3RS5A 1KYIA 3K0FB 2QE7A 3HR7A 3SJCA 3PEYA 1NLZA 1VCIA 5G40A 2BOVA 4LGMA 1ZM3A 1SKQA 4TYQA 5KDDA 3ZVNA 1MO6A 1Z6GA 4DDTA 1CKEA 4XD7D 3KFXA 1ZM7A 2OBNA 2AFIE 3NHBA 1E0JA 4KHZA 3BJIC 4N3NA 4JMPA 4P4SA 4HDQB 1X1RA 1KIMA 3O47A 3HJNA 1E2HA 2JEOA 4LJ6A 1BMFD 3VTKA 3MFYA 1XD8A 1UDWA 1KHTA 1S9DA 3FKSD 1P3JA 1HV8A 4LV5B 4QJ4A 4JSTA 4NYMQ 2BM0A 2ZPTX 3PEVA 4XVUA 1J2JA 3PEUA 3CZPA 4M9XA 3SYKA 1TX4B 1CULC 2V8OA 4OL0A 5L3SB 2WJHA 1FX0A 2QM7A 3L8YA 4FMBB 4Q9JA 1AJEA 4XTCS 1VG9B 4RY2A 1FQKA 4BECA 5JCPA 2ZYWX 3EPJA 2A7QA 1OH7A 2R8RA 3UK6A 2F3TA 1YQTA 1HURA 1U2RA 3GJ8A 3KQUA 2EFDB 1OFTA 3CWZA 3FYHA 1QHNA 3VR6A 2LKCA 4L15A 4O0MA 2LWIA 4B76A 3BXZA 3LW8A 2YOGA 4DLVA 1R5NA 1LVGA 3GCGA 4CEHB 1CR1A 1JXOA 1UEIA 4FD2A 4R9UC 3ND9A 5KTYA 4OQMA 3W34A 4AD8A 1DAKA 2ZITA 1EWRA 1Q1BA 3ADCA 1VTKA 1RE0A 1S8FA 4GPTA 2IYLD 3NC1C 1EWQA 2V9PA 2R2AA 3K09C 3OEHA 2CCGA 1S0UA 2R9VA 1FUKA 2XXAA 2R44A 3C5CA 5B30A 1L2TA 3W5IA 5F98A 1XCPA 3TK1A 1VCNA 3PENA 4TTPA 2CJWB 4D81A 2W6IA 1KSJA 2ZJ8A 5BYKA 3RNLA 1N0VC 2VRWA 2JCSA 4EUNA 3NEJA 1DELA 1NBME 2KWIA 4M9QA 1KNQA 1P5ZB 5FTNA 3BK7A 2ODBA 3K0FA 5P21A 2XX3A 2X2FA 1OH6A 1Z29A 3L0SA 4DLYA 4RD0A 1NG9A 4QHSA 3OEED 2WKPA 4O2RA 4PSKA 1MOZA 2KJQA 4NDZA 2JDIA 2EW1A 1VKJA 3DOFA 5UKDA 1CBUA 4C4PA 4LJ8A 5KDOA 1RRPA 2DFKB 5BW8A 4POAA 1U81A 4TSFA 5C4MA 5EUQB 1WE2A 5JWRA 3FKQA 2QMUA 3CUEF 5TDHA 5KO2A 3FVQA 3VR4A 2FNAA 1F60A 1MO5A 3BFXA 4S35A 4B3CA 3OIUA 1SHZA 1LB1B 2WM9B 3B9PA 4DLZA 3QJYA 1Q12A 4M0LA 3D6TB 5JRZA 2DY1A 1CXZA 1FNNA 4Q1CA 4YXWA 1W36B 4FMCB 4A2WA 3ZZTA 4DLRA 2LCFA 2ERXA 1ESMA 4QC2A 2WJYA 1ONBA 1XEFA 3GJ0A 4LDJA 4TYNA 1ZINA 2R6DA 1AS3A 1XB2A 5L3SA 3I3SR 3UXMA 1KZ7B 2XNDD 2WBLC 2ZS9A 2JJ1A 4D25A 3BERA 2UZIR 4FWTA 1U94A 1E2JA 2BHRA 3LRPA 1KO8A 1XBTA 4AY2A 2P5SA 1QHYA 3QEJA 1F5NA 3L2OB 1NSFA 2WJVA 1YVDA 2EWWA 4OQFA 4UJ3A 4P4UA 4QOSA 5GVRA 5L3QB 4A36A 1WMSA 4JLOA 1A4RA 2IYSA 3S1AB 5DN6A 1D9ZA 3W5JA 4C0BA 4D4LA 3U6BA 1A1VA 4CEHA 1C9KA 1QG4A 4EDHA 2ZI9A 2IL1A 2V4ZA 4Q02A 2P2LA 4MDEA 3SHFA 3BBPA 1ZNZA 1WXQA 2ZANA 4A8JC 2FA9A 2Z6VA 3A1TA 4LV8B 3RDPA 2W0SA 1RRGA 4JBXA 1CP2A 3ZGXA 2IYYA 4PC3A 2CJWA 2FF7A 1VMAA 4BFWA 1GL7A 1QRAA 1KSHA 4NE2A 4NONA 2WKRA 5TMPA 2OXCA 3ADBA 3C5HA 3PG5A 2ZS8A 3U4QB 3FHTA 4IOLA 2FFBA 4DIDA 3M0EA 4PHGA 5LDDC 3PR1A 1O87A 2FFHA 3THXB 1ZC4A 5FBLB 1R0WA 3K0EA 3B13B 1CU1A 3U3OA 2WPDD 3SZRA 4E5UA 5C2JB 3EXAA 4Q1AA 4TL8A 2OV2A 1N3BA 3B1YA 4TMWA 1G20E 3Q85A 4V02A 5CLLA 4JLMA 5EXSA 4ZI3A 3TUZC 3ICEA 5KDLA 3FMIA 3NBFA 2QA5A 1QDEA 2Q6TA 2XGJA 4D0LB 3C8UA 1CR0A 3V4FA 1W48A 4US2R 3GPLA 2VSFA 4Z1MA 4C0SA 4UNRA 2IS2A 1T3SA 1T0HB 3AV0B 3AP3A 1SXJE 2W6JD 1E2NA 2G0TA 1Q0UA 1K8RA 4C2UA 4JVLA 5EE9A 4B44A 1WDTA 4GMXA 2V1XA 1D6JA 4Q7JB 3X1XA 2J7PD 1YZNA 3SR0A 5K8UA 4A0FA 2WHXA 1EFUA 5FTJA 2QSYA 4U5XA 2CLCX 4RJLA 2PMDA 4V0LA 2QY9A 2FZLA 4L8GA 4GFDA 3RAPR 2H8KA 4A4DA 5FFMA 3W6PA 1ETUA 2PJRA 2CHVA 1N5JA 2BCGY 3QPWA 3WYFA 2J7KA 3HWSA 1W5TA 2IF2A 5L3QA 3CPJB 5HKKD 1WRBA 2C9CA 3S1AA 2NPFA 4GNKA 3GJXC 4JLNA 5FUVA 3SYLA 1R8SA 1CR4A 1T9HA 2GILA 3IBGA 1FNMA 4LBYA 4W5JA 1N6HA 4V0KA 3CZQA 1N6IA 3KQKA 3QSYA 4AYWA 3K53A 4PQFA 4E03A 2IYVA 4TLAA 4XVRA 2ZRHA 2OAP1 3L0PA 1XFAA 3V9PA 4YQFA 3BIFA 3CKLA 4HAXA 3GEEA 3RHFA 3QBTA 4CEJB 4OK6A 3GFPA 3AQ4A 3WP1B 4XWAA 1IY2A 4Q01A 4GZMA 2P0EA 2O8DB 3TBKA 3CRVA 3U4QA 3GJ4A 3X2SA 1D2EA 4PPQA 1XD9A 4B43A 2YYZA 3THXA 5FOVA 4RD2A 1M8PA 3GJ6A 3SNHA 2OEPA 2YC4C 4LPSA 4EPTA 1F3OA 1ZU4A 3LXXA 4M8NE 1GL6A 2HUPA 5FPKA 3FFBA 2CEAA 1P2UA 2I1QA 5JS7A 4DKXA 2IYTA 1J90A 1KI8A 1Z0IA 3A1UA 4GI7A 3K0CA 1PV4A 2BKUA 2EQBA 3G0HA 1FZQA 5DYIA 4TZ6A 1YR7A 1IONA 2GF0A 2X77A 4RD4A 4D4KA 2X19A 1JQLB 1U99A 3EPHA 2EFCB 4EPXA 5EJEA 2IXEA 1EX6A 1GZSA 4M2LA 1AQYA 4C0LA 3AM1A 4FI3C 4V03A 3L8ZA 5LPNA 2GEDA 5DNYB 3PUZA 1JAHA 2FV8A 2YWEA 4PSAA 3FDIA 4GBMA 3VKWA 1QHHB 1CF4A 1Z0AA 3AVVA 4I1VA 1E0KA 3HR8A 3K70D 4IDQA 2VP4A 1QHXA 3ND8A 3ASZA 4LPKA 2ZR0A 3CB4A 1N6KA 3C14C 4LOAA 4G3XA 1U98A 4ZKDA 4XVQA 2PZFA 3FE2A 3OAAD 2HT1A 3UIEA 5AJYA 4QJ5A 1XF9A 3N2IA 5E95A 1CRPA 1HEIA 3SYNA 5DI3A 4BLRA 4BZPA 2VP5A 4Q5IA 5FBWB 1CJTC 4U02A 4B3XA 5CB6A 3UKDA 2B6HA 2JLYA 2GZHA 3Q5EA 2N42A 4YC7A 3ZVLA 2OCAA 3K9LA 1JEDA 3LD9A 1GUAA 4KBGA 4HEJA 1NLYA 1DTSA 3TIFA 2PCLA 2OM2A 2HF9A 4Q1BA 4BGDA 5EE1A 2O8DA 2HJGA 3NDPA 4OQLA 1KO4A 2C8VA 1UKYA 2IYUA 1SXJC 1Z6TA 1V5WA 4Q21A 2VSOA 1E1QA 2BV3A 2EWVA 1AK2A 1IJFA 5TV2A 2JLUA 3BS4A 4WXRA 4RCYA 1NI3A 1P9NA 3PIRA 4KITB 1CJMA 1CJVC 2KSQA 3U3RA 3KKMA 2YC2C 3Q72A 3IIJA 1G8FA 2IXGA 4KO8A 2I1VB 2FPKA 1NVWQ 2A3RA 3LDAA 1G8GA 1Z08A 3O8RA 1Z0DA 4NBSA 4RD1A 5E7IA 4W5HA 1E9SA 1RJ9B 2ZUCA 2ZUDA 4BUJA 3GLHE 2JLQA 3TAUA 4QXAA 2TMKA 2J9RA 2RGXA 4IOMA 5KNDA 2QPAA 1AA9A 2WJGA 4MYCA 4HB3A 2GDJA 4HAUA 4RZXA 421PA 3ZJYA 3EZFA 1OXUA 2V7QA 3SU8A 2YWFA 4LHXA 1EFRD 1QHHA 3A4LA 2G83A 1UKEA 2Z4SA 4B3DA 2CCKA 1VG8A 2CHQA 2HLDA 2C03A 3B9QA 1XDBA 2J0SA 1OB2A 4UNNA 1NIJA 1ZJ6A 1T8TA 4Q9HA 5EXTA 1R5BA 1E2IA 3UANA 2ZTSA 3ZDQA 5HE8A 5FOTA 4IHQA 1HE8B 3K70B 1W5SA 4IFEA 3QF7A 3MD0A 1E9EA 3R9IA 2CNWD 4BQSA 4EJSC 4I4LA 3RC8A 2VP9A 3SQXA 4ARZB 2RB4A 4HAVA 2V3CC 3ZLJA 1VECA 4B3FX 5HKKA 1P4SA 3TQCA 1KAOA 1G3RA 2XNSA 4DWJA 1F6BA 2ZI7A 4DCVA 3IEUA 3QXCA 4C30A 1PLKA 3DZDA 2QUZA 1GOTA 3ZS8A 1T3LA 5DISB 1X86B 4NPHA 1JR3A 3P20A 2BEJA 2GRJA 3PUYA 1GNPA 4C0AC 2GBLC 5FOWA 1EK0A 3TSOA 1NVXQ 2YZ2A 5CIQA 1JJVA 4N1AA 1K6MA 1NVVQ 1OKKA 1Q1QA 1YRBA 3VR1A 4Q47A 1OE0A 4LSGA 4ESHA 1KK0A 2DHRA 2MSCB 3DHWC 4QGGA 4UXJA 4A1FA 2ATXA 5JHHB 3CX8A 1GNQA 4GOKA 5GJCA 5TY0A 1W0JD 3ETLA 1YZQA 2R65A 3BRWD 2GWHA 1SVOA 4P33A 1AKEA 3OE7A 3TMKA 4L16A 4W7SA 3SEAA 1UM8A 1RJ9A 4RZ3A 5SZKB 5BWMA 4RD6A 4X8HA 3ONWA 3C4JA 1WCV1 4AG5A 2REOA 1OFHA 4TL7A 1AZSC 1R2QA 3CF0A 4QBGB 1I4DD 3GEHA 1ZP6A 4B3GA 2VF8A 1RRCA 3TR5A 5GJBA 5DIFA 5CIWA 3FFAA 4Q9LA 1SHKA 2BDTA 3LY5A 1XEWX 1A2BA 2GAOA 4QRHA 3IPXA 1QVRA 4Q7LA 4XH9B 3GLIB 4I1UA 2VHQA 4QG7A 2PLFA 3RSOA 3GJ5A 2O0JA 4Q4HB 1G7RA 1NJFA 3T15A 1ZW6A 4ZI2A 4Q7MB 1FQJA 1N5LA 1VHTA 3EZ7A 5J4KA 4BASA 2QN6A 5C4GB 5DO9A 2IWRA 2DWOA 1L4UA 2XZPA 1FPMA 4TYYA 2QP9X 1KK1A 5J4YA 4AG6A 2QGZA 5JECA 1ZCBA 4NHOA 3U7GA 2ATVA 2W6ID 4R71A 1N2CE 2PL3A 5SZHB 1OPXA 2FU5C 3CF2A 5DLQC 4ARZA 1XPRA 3ZS9A 3FTQA 1JR6A 1KDRA 3PQCA 3W6NA 2GEVA 1F2TB 1XEXA 3H86A 2YHSA 4A6XA 2G77B 1F2UA 5ELXA 4DSUA 4MKFA 4EPYA 4PO8A 2G1KA 2CDNA 2Z0MA 4PQRA 4WZ6A 2JDID 2NGRA 5DGXA 5LB2A 2RHMA 2X2EA 1SVLA 2WWYA 4PZLA 4JSYA 2F1HA 4O3MA 1SVSA 2XEXA 4TSFD 1T8UA 3KDSE 2IYQA 2FG5A 1UKVY 5C18A 1NJGA 4PHFA 3BE4A 2IBMA 2BJWA 4X8LA 4GP7A 3FGNA 2P6RA 3K0AB 4LBWA 1UDXA 1VG1A 2J0UB 3AP2A 4OI0A 5EP2A 1S1CA 4FCVA 4YXWD 2AN9A 2FE4A 4H1UA 4MUAA 5HR5A 5E7JA 3PXGA 1FW6A 1R0YA 2H1LA 1NN0A 1P9RA 2C78A 1NF3A 2RH5A 2ZS7A 3LVQE 1Q44A 3BB3A 4JYCA 3UMFA 2BMEA 3BB1A 2JJ1D 5CDFE 2DFLA 4R2IA 2BBSA 4Y0AA 5FH9A 3AF3A 2DR3A 4B71A 1E9DA 4BEBA 4NYIQ 2ZRGA 3BFVA 2PZGA 4PANA 1DADA 1TF2A 1X8JA 3Q3JB 2ZRJA 1VIAA 2PBRA 4LJ7A 4FN5A 5F9HA 3QXJA 2ZROA 4IDHA 5DN6D 2GXAA 1KGDA 4BE7B 3GLIA 3RS0A 3VFDA 4C3ZA 3A6PC 4Q4HA 4HAZA 1OXSC 2IYRA 4J0QA 1E98A 3K9NA 4GT1A 3I92A 5JS8A 5AJZA 2CE2X 4BFSA 3G5UA 4KLNA 5L3RA 1MRSA 3VAAA 3KFVA 5JEDA 2J0VA 3GLGE 3OZXA 3RLFA 1DAHA 2A78A 4R2HA 3PCRB 2G1JA 4TMXA 4BFXA 2OLKA 3JZMA 4AKIA 3AVUA 4Q03A 4DLSA 1NN5A 2AR7A 2RGNA 4LK2A 4F38A 4D4MA 3KJGA 1RIFA 1XMJA 2GK7A 4JLJA 3RS3A 1E99A 4DBLC 1P75A 3WP0A 2NPIA 4PHHA 3TSZA 3B1VA 4AYTA 4KI0A 1NN1A 2ZI6A 1QF9A 4EPRA 3QG5A 1KJYA 2H92A 1V43A 2VH5R 4L5BA 1G21E 2CMKA 1N0WA 3AKEA 1JPJA 5JEEA 3ZQ6A 4N0DA 1TF5A 1LY1A 2J3EA 4QFMA 5E7MA 1TQ4A 4Q9IA 2P5TB 3MCAA 2UZ3A 2AK3A 3K0AA 4Z1MD 5JI2E 5BQ5A 2J0UA 2ONKA 1HQYE 2CL7X 5AJWA 4BFYA 4TN1A 1W36D 3K1JA 2QQ0A 3AKCA 2IHBA 2ZSFA 2ORVA 2QG6A 4M1KA 4ON9A 3FHCB 3SDZA 2QBYA 3DM9B 1KY3A 4IFBA 2LKDA 1OH8A 1N25A 5FL7A 1R0XA 3CH5A 2RGGA 4WZAE 1W0JA 2IWHA 2ZR7A 2OXRA 4UNPA 3F8TA 4U7DA 1A7JA 1OIWA 2EFEB 4PAMA 3T61A 4QHTA 4UXHA 3I72A 2ZVQX 3GLFB 4JKIA 4ESVA 5HPYB 1XJCA 2VF7A 1E2EA 2WWIA 1FFHA 1I2MA 1L7VC 4A92A 1GITA 4M53A 1NKSA 2OESA 1EESA 1SKYB 5FOXA 2ZRAA 4DB2A 2EFGA 2PX3A 3U60B 4HSEA 1RYHA 4IVRA 1SVWA 1XJQA 3L43A 1FL9A 4FWIB 4BLSA 1KOFA 4YLGA 4NP6A 3TH5A 1P61B 1G3QA 3U3KA 4BLPA 3ZIAA 3AUXA 2C04A 1YZUA 3T34A 4FINA 4ZPXA 3B82A 4HLDA 2JLRA 2KBFA 2QRZA 1T4GA 1AZTA 3CF6R 4BZQA 2FSHA 2O8CB 1U8ZA 2NO6A 2Z43A 4OHVA 4KV9A 4DSNA 2QAJA 1E9CA 4XSGA 4FMDF 1K5GA 2FPMA 1JBKA 4OI4A 1E0SA 2YWHA 2VHCA 1R4AA 1PJRA 4EQ6B 3AVOA 5CYOA 3SOPA 1TUIA 4P3YA 4JKYA 3R9WA 2H5EA 1CR2A 4F92B 1MO4A 4G5QA 4ZV4A 1OSNA 3Q7PA 3WY9A 1RFLA 2ZYVX 3EW9A 1LF0A 1OXTA 4TYPA 3VX4A 3B2EA 5J47A 4UJ5A 3IO5A 4TYWA 4RCZA 4EIWA 5JZVA 1YZTA 5B64A 1E79A 4BFZA 3TSWA 1ODFA 1CTQA 1G5RA 3T1OA 4DSOA 4K46A 2H16A 2GEUA 1Z3IX 2ZJZA 3CNLA 3TRFA 2PH1A 3UG7A 1G3MA 3VQTA 2OBLA 2VLIA 3A4NA 5IT5A 5BYJA 1GRRA 4LX0A 4PO9A 1K5DA 2GVZC 4Z8XA 1EX7A 1U9IC 3QBVA 2Q21A 5KYKA 4PXAA 1FUUA 3CW2A 3I5XA 2QMEA 1LS1A 4I81A 3EC2A 4QGFA 4RFVA 3DZ8A 5BXQC 2IW3A 3ZVMA 1I2DA 3SFVA 1U0JA 5AUQA 1XTQA 4O25A 1E2LA 5CLQA 1ZD9A 5G41A 1KDPA 2ZAOA 3C7KA 1NLFA 3IKJA 1M7HA 4G5SA 4DHEA 1KAGA 3K09A 3GLFA 1XD2B 1KI6B 4YDSA 2VHJA 4XSHA 5JSZB 2B8TA 4KODA 4A0RA 2QROA 4FIDA 3WNBA 3ADKA 3AP1A 1WBDA 2W2VA 3TW8B 2RAPA 5BN3A 4KSBA 4D80A 2PX0A 2ZQ5A 4KVAA 4OI2A 1TEVA 1G41A 2W2TA 3IHWA 3W3ZB 2OE2A 2QENA 4BLQA 2CVHA 1UBCA 1W4CA 2HT6A 1QVAA 4URVR 2VQSA 5KSOA 1G7SA 1OW3B 4KBFA 2A9KA 3DOEA 3E70C 1T5LA 2C2HA 2FEMA 5HCNA 2O8CA 4KU4A 1OF1A 3KKOA 1RPZA 4DB4A 1CS4C 3KZ1E 3FOZA 1U0HC 2QTVB 4PPFA 2ZJYA 1L8QA 3AGPA 4GRAA 1E1QD 2W58A 3F3YA 3K9GA 4EQ6A 5FTKA 4LHZA 3W90A 2H7VA 2BWJA 5KU1A 1X8KA 1CEEA 5AR1A 3LX8A 3QVVA 2ZE5A 3EAQA 4NL4H 2A2ZA 4DUGD 2O52A 2F1IA 1U8AA 1IJEA 1N6LA 4HLQB 4MYUA 4NCKA 5FTMA 2JAQA 2ODNA 3I32A 4DLTA 4QJ3A 1N5IA 3R20A 1E1RD 1RRFA 2QT0A 4JLBA 4G0NA 1CJUC 4C9BA 4DDWA 5KSZA 3AF2A 1G4AE 3ZVRA 5JBQA 1D8TA 1J8YF 5EQTA 3KTAA 2C99A 8OHMA 4P0TA 1AM4D 2ORWA 4LV6A 4IOJA 1TF7A 3FHOA 1MRNA 3DM5A 1G5TA 1M7BA 3PUWA 1QHIA 2MSDB 2R6FA 2V7QD 5TB5A 2A5DA 2QL6A 4JL8A 1R6BX 1Z6AA 4HYYA 4OQNA 5KPJA 1KK2A 1KO1A 1W4RA 1N6OA 4KXFB 1OT3A 2Q3HA 2WWGA 2ZE6A 3L82B 4A8JA 2HLDD 2Z83A 3D7MA 4YDHB 4QHYA 1XD2A 1KI6A 1JPNA 1I4LD 2N1BA 3VHXA 5JSZA 4X8MA 3MJRA 1W7AA 3BD9A 1TL7C 3H1TA 4QBHA 4GOXA 1IN4A 4B2IA 1M1YE 4TLBA 1TQ2A 3THWA 3DMNA 4HUQB 5FPYA 2GXUA 3CONA 3ASYA 4B47A 3Q5DA 5KSPA 1KI7A 2HEIA 2YWGA 1Z6XA 1OYYA 1GFIA 3REGA 3CRW1 4TTQA 2ZREA 2C9OA 3C16C 3QE0A 1ZYUA 4KYIB 5DI3B 2XTNA 4B2LA 121PA 1XU4A 1NG1A 2NQ2C 2IS6A 2IEZA 4WIAA 1JR3D 2DB3A 1I4TD 4G1UC 1E2FA 2QU8A 2JLSA 1GNRA 1BYIA 2GA8A 1Z47A 3HDTA 2FGKA 3LO5A 3PFIA 1NKTA 3RRYA 5JCZA 2H18A 1OKKD 4I1OA 4LC0A 4IRUB 4HLUC 5M04A 4TMVA 2FFAA 3U7HB 5EUMA 4R98A 4NYJR 3RRZA 1UADA 3NH6A 3W3AA 4CT4B 1UFQA 3MRSA 1OB5A 2XZLA 2CCJA 2CE7A 1C4OA 2D3WA 4MITA 521PA 3SJBA 3V4RA 2AHOA 1NY5A 1KK3A 4PAQA 3OE7D 1E9AA 5GJVC 1TU4A 4A2PA 5EZ6B 4Q66C 4PQYA 3EX7C 1W49A 2OAQ1 4JJZA 3U5ZB 4LYJA 2NTYC 3EPLA 2KBEA 4Q18A 4CT5A 2D74A 5CITA 1ZUIA 2GAAA 4Q4JB 5KHOC 3L0OA 1UJ2A 3KQHA 1NMYA 2GESA 4B33A 3HP1A 2GVDC 4JLKA 5J5CA 1CRQA 2ZU6A 1NBMA 1NNEA 2AK2A 5C1BA 1D9XA 5CK4A 1KDTA 1XPOA 5DYGA 4IKEA 3Q8XB 3EA5A 3EARA 4OKSA 1OH5A 4CF7A 2ONJA 2OCPA 4WVFA 3SBDA 4TQUS 3A1VA 4AYXA 4HI0E 3UWKA 4JVMA 2K5UA 4TL9A 2OZEA 3B85A 1W4BA 1ZBDA 1YU9A 1CLUA 3VNVA 3X1DA 1E0AA 1ZNWA 1W0KA 4US0R 4M22A 1U90A 1SZPA 4HUQA 2AKAB 4M1SA 4WBSA 3IEVA 2A5JA 3RVBA 4AKEA 1BOFA 1D2MA 1JI0A 2G6BA 3SS8A 4AURA 4TT3A 4E07A 5ANRB 5J4HA 2ZXUA 4C0KA 2O0HA 2YV5A 3LLMA 4D0GA 1G291 3ZD7A 1OFIA 1Z0FA 4LJ9A 5FR2A 4MUBA 1JB1A 4B75A 4MKIA 3KJIA 1SQ5A 4Q1EA 3KB2A 4Q4LA 2VTKA 5IRCD 4JVNA 2CK3A 5JMTA 1MABB 1NSTA 1A2KC 2C9YA 4ZDKA 2X8AA 2EFHB 3G82C 2WVJA 4HZIA 3P32A 4LWZA 3IIKA 5FTLA 1KJZA 1KJWA 2AX4A 2G9NA 3F0TA 3T5DA 2CXXA 2OBMA 1S9HA 5IK2D 2RGBA 4JJKA 5D3MB 3LBNA 3T1TA 4V0ME 2IUTA 3R9XA 4FXPA 1BS1A 1GKYA 1ZU5A 1R7RA 4MGZR 5E3HA 1LNZA 1B23P 3VR5A 4DUGA 2GNOA 3NVAA 2OFOA 1JECA 1NY6A 2DWPA 3MSXA 4LHWA 1DG1G 2WWXA 2Z5FA 2G0NA 4Q4JA 1UAAA 1P73A 5CJPA 1E1RA 3A4MA 4PC2A 1EGAA 2FX3A 1EFCA 2JA1A 4QNRA 3MJHA 3LX5A 3IO3A 4B32A 2IS4A 4JVSB 1DAIA 2YINC 4CVNA 1XX6A 3H0KA 2NO9A 4M9SA 2ZETA 2FH5B 4PTLA 1PVOA 2HCBA 4U00A 1QHSA 3P27A 2WAXA 1XXHE 3KX2A 5FBVB 3B78A 1G3UA 1ZNXA 3O8DA 1A5TA 2MSEB 3I62A 4QBFA 2ZIAA 4HB0A 4Q48A 2AD5A 4XOIA 2A30A 3PV0A 1SXJA 2J5XA 3D3QA 1KO5A 5SZJA 2WV9A 4A6PA 3AVXA 2H17A 1BH2A 4LYHA 4JLVA 4OQXA 2HYIC 3U7EB 4DLXA 3CR8A 1B0UA 4DT1B 3OESA 2JIZA 1XEXB 1MABA 1Z8FA 4Q00A 1F2UB 2ZRNA 2XSZA 4DCTA 5IF9A 1FTNA 2P67A 2BKEA 1IHUA 1IXSB 1W46A 1GILA 4PO1A 3ZYCA 2OILA 2IXFA 1ZIOA 2O0KA 3BFKA 2J1LA 1GTVA 5D3MA 1UF9A 4NZYA 4URUR 1EG7A 2GCOB 4M1TA 5FPHA 2XJ9A 4W5WA 4LYFA 1II9A 5C46F 2CVFA 3EWAA 3QUSA 2NOAA 1R10A 4M1YA 5FL7D 4OBEA 2NMVA 4A0GA 3U44A 4ZIRB 2QP4A 4H9GA 3B1ZA 4Q1DA 4DJTA 2G88A 2VP2A 4OK3A 4D0NA 4LBVA 4GSYA 4GDFA 5LD2C 2XAUA 1HH4A 2ZYTX 1J70A 1TU3A 4BRWA 1AGRA 1E4YA 1E9BA 3K70C 1KO7A 2QEQA 2HF8A 4G5GA 1OFUX 3AB3A 4JT2A 4TMZA 4CRWB 4EJSA 5K8LA 5JJKA 1M6NA 3NWJA 2F1JA 5FUXA 4OHYA 1AS2A 1Y3AA 3QKUA 1WF3A 1UEJA 2CBZA 1Z22A 5EZ5A 4JBYA 4DZZA 2NO0A 2ANCA 1DOAA 3A8TA 3ZIAD 4ACBA 2AXPA 1XZPA 3ZZUA 1F48A 3AF4A 1QHGA 1YR9A 4JIMA 5K8TA 1FOEB 3O8BA 4LUCA 4F4IA 1NMXA 1W2HA 3IQXA 1JQJC 3QPVA 2GBLA 2J46A 2D2EA 2CL0X 1IN5A 4UNQA 2QM8A 4PFSA 2GJ9A 3A36A 3CPHA 3GLHB 3THOA 4US1R 1TPZA 2ASEA 5CM9C 3AH8A 4X8OA 1MO3A 1GSIA 3H84A 1YHNA 2QAGC 3WMFA 1G6HA 2EVWX 2HYDA 3CIOA 5EP3A 3T1VA 4IVPA 5KSYA 2WOJA 3A37A 2VIIA 1Q1ZA 4D4JA 4DT1A 3R7WA 3HYTA 1SVMA 3QI2A 1G8HA 3CR7A 2ZU0C 1DPFA 1UPTA 4R7ZA 3CRQA 4NCHA 3BH7A 4F91B 2GZDA 3IUYA 3RRMA 5FBRB 3IIMA 4NTZA 1E79D 2IEYA 3THYB 2EU8A 4OHWA 4WOPA 2VP6A 1P2TA 4DDVA 1VPLA 4L9SA 1E9RA 4MRNA 1DARA 2BEKA 2GCOA 5GVSA 3F5FA 4L9WA 3QEOA 4LZZA 3CPEA 3SI7A 4AI6A 5AUNB 3TNFA 2YOHA 5AUPB 1US8A 5IK2A 3RS4A 1G18A 3C41J 4RSGA 4URYR 4ZIRA 4HAWA 2GK6A 4TLCA 2XZOA 1EFTA 1ZNYA 4NKRA 2QBYB 2V55B 2IYXA 4LYAA 5FI1B 5AUOB 4CGZA 5K8IA 2WIBA 1KI3A 3KKQA 1LF5A 1J7KA 3GMTA 4ASUA 2N46A 3IGFA 1NRJB 4W9MC 2F43B 3DKVA 2WWFA 2ODEA 1Z2AA 1P6XA 4F4JA 1XTRA 3AGQA 4IJMA 4YMUA 1TEXA 2YJTD 1G7TA 2HDNB 2ZRBA 1DEKA 3W8RA 1E2MA 2D06A 3KQLA 2F7SA 4FCTA 4ZCIA 1VYTA 1JAIA 1X3SA 3OIVA 2ZRFA 4F93B 3OIYA 4WXPA 1N5KA 2QPTA 4P32A 2GCNA 5H68A 4DEYA 3IBYA 4OJKA 5TVKA 5JFGA 2HCJB 2DPXA 3WMGA 1Z2CA 1U0LA 3NTUA 4B3BA 2BMFA 3GLHA 3KUDA 2OO7A 3T5GA 3FB4A 3WRXC 2NIPA 2HXYA 3NH9A 1IOZA 2WWWA 3MWYW 2GJKA 3AVTA 2XB4A 1H8HA 2WIAA 2BC9A 1W4AA 4PAOA 2QZ4A 1G64A 3BGWA 3GFOA 3KQNA 2BJVA 2AWOA 1E32A 1HA3A 1S3GA 3GJ7A 1KTVA 1XCMA 4ZO4A 5DI9A 1C1YA 3LH5A 1G16A 5J4VA 1OHHA 1ELOA 1R5OA 1HTWA 3KJHA 3U3MA 3MWJA 3D8BA 3THYA 1II8B 3UPUA 2YNMA 4NYMR 3PJRA 3J81k 3IHLA 3U2QA 1Z6YA 1Z83A 3JZAA 1GIAA 3QKRB 1XNJA 3I73A 3X1ZA 1NIPA 2VSXA 1T3HA 4B6EA 721PA 5KNBA 3QXHA 2NZ8A 3MG9A 4MRRA 3RABA 2GJ8A 2RMKA 3TW4A 2MMGA 3KXIA 5EXPA 2Q3FA 1DAFA 3OIWA 5B58C 5BN4A 3ZQJA 2IK8A 5FI0B 1CIPA 2W00A 4YMWA 2GZAA 4D26A 3Q9LA 1ZM2A 2AD1A 5H70A 1KZGB 4OJQA 3CRMA 2WJIA 2F1RA 3T1QA 4A15A 1WB9A 2F43A 2XTMA 2ZE8A 2VA8A 3A1WA 3WBKA 1OLOA 1W1WA 1IY1A 2ZJBA 2AL7A 2RGEA 2PT7A 1XWIA 3QIAA 1EXMA 2PCJA 2GXSA 2REBA 2ZI5A 3RC3A 3X1WA 1ZIPA 2KB0A 2UVQA 1XJ0A 5EE0A 1HT2E 2VL7A 5HE9A 3W8NA 5FOUA 1ZC3A 4A9AA 3CX7A 4PC6A 2J59A 1XPUA 1G19A 2SHKA 4TLDA 5EE5B 5HTKA 1TMKA 3M1IA 4NMMA 1G3IA 5J40A 4QKQA 621PA 2B92A 5JJIA 1IAQA 2GKSA 2ZRIA 4MRSA 2BCJQ 4OHXA 4H1VA 1TADA 2WMOB 1ZUNB 4IOKA 1TQDA 3LA6A 3MWKA 1AQUA 5AJXA 2ZRLA 4IDPA 1Z63A 3VNUA 2DFTA 3V00A 1XTSA 2W0MA 1WBBA 3AF0A 4XJXA 4FMDB 1G1MA 3TE6A 1W47A 2HV8A 1KI1A 1GVNB 4B6FA 3LBHA 2V1UA 3QQ5A 1GKUB 1XMIA 3B6EA 3OHMA 3KKNA 2ZSAA 4OI1A 4WW0A 3FMOB 1TUEA 4RKFA 2QP3A 4MKHA 3H4MA 4V0NA 2QTHA 3W9YA 4Z54A 1P62B 4LY6A 1II8A 3NG1A 4QGAA 4QM7A 2AKYA 1OIXA 1DAMA 3RS7A 4NH0A 2OLJA 1TQ6A 3GLGB 2O8BB 2WSSA 5CB8A 1KSFX 1XP8A 3HU3A 3B60A 3QKRA 1DS6A 3EA0A 2IX3A 5JWHA 2WOOA 4Q9KA 1NBMD 2OFWA 3P26A 3LFUA 4MKGA 4M4SA 1RYFA 3EIHA 1COWA 3KTAB 2A5FA 3CM0A 4PPGA 4Y0VA
chains in the Genus database with same CATH superfamily
3I76A 2JLVA 1Z7GA 4FC6A 1ZFNA 4KXWA 4XTRA 1HX7A 1A8QA 5HFNA 3LIIA 4ZCPA 4CIBA 3Q9NA 4HGOA 4IH1A 3TZCA 1KEUA 1AY0A 1AG9A 1CUWA 1XDDA 3AB8A 3B3QA 1O96B 2V0CA 4YMSA 3TX6A 1NN3A 3DMDA 1HETA 5JH7F 4LKOA 1GJRA 5AW2A 2ZRMA 2O8EB 3ZN2A 3JVVA 1O6ZA 4QL3A 2X0KA 3ACCA 4M7RA 3T0FA 3AF6A 3RT9A 1UOEA 3RB8A 4EA7A 5BVGA 1G6KA 2JIRA 1YL7A 3L7IA 4I8IA 2HRBA 3EDOA 2BEUB 4RA9A 4X66B 2WAAA 4M0CA 2BZGA 3PJFA 1DL5A 4S12A 1ZD2P 2ATEA 1UJBA 1I0ZA 2AG8A 2AFIB 1ANKA 1PP4A 1SVKA 2PM8A 4PCLA 5K05A 4IXNA 4K0RA 3ZGVA 4ZAXA 4DV0B 5K99A 1SJ9A 1X7WA 4YMVA 5FWYA 1Z5ZA 4GRIA 3MUNA 2I3BA 2Z2YA 5TS2A 5EHNA 3WGGA 4CM6A 1HO3A 3LP6A 2HK6A 4J0IA 3WGHA 4K6GA 4C05A 2Q1WA 3P9CA 1VFPA 4GAEA 4NBTA 5ESDA 2JK1A 2X5XA 3D7RA 3WGKA 2Q6IA 1LTQA 4W5TA 1T36A 2CK3D 2JCVA 3G3EA 3AETA 3FFXA 3P52A 3PYXA 3PQ3A 3QOFA 2X40A 2A7XA 4E2YA 5KJ1A 1NVUQ 1U8YA 5G1NA 5G1OA 1RXSA 2PH5A 1BXGB 4ARIA 2G71A 1LW7A 4XUDA 4KNVA 2XA1A 3UWOA 3V46A 4H0NA 5F4BA 1I80A 3H19A 3UBMA 1P7CA 2JJ2A 1E2BA 1SC9A 2X1VA 4CLXA 2C4HA 4QBIA 5BYAA 4JI4B 2EXXA 2D7CA 3P4YA 3VTZA 3P9IA 2XMCA 4L5CA 2Q62A 2Z58A 4DJJA 2YS6A 5JWOA 5TS3A 4Q3NA 1IQPA 1AVTA 3A27A 1DO0A 4M21A 3R8XA 1VP9A 3VNQA 5GOZA 3AJ9A 1SA0A 2P75A 4O29A 4YT2A 2YJ4A 3OQIB 4GEKA 2Q6KA 1DG3A 1I4OA 1NULA 2FPGB 2Q6VA 4ZOAA 3RFTA 4R01A 4AUKA 5JI3E 4UVEA 4MGYR 5EJ5A 2ZRKA 5CFNA 4XWOA 3LUPA 1XE3A 4Q34A 3VSEA 3DUFB 4EGSA 4XJTA 2PUVA 4QA9A 3SX2A 5FPTA 4Z4GA 1G8AA 2WZQA 2IIVA 4JBWA 2QM3A 3KPYA 3VPXA 4XB6B 5JT1A 4Z0TA 3O7MA 2FXIA 4QSHA 2JIBA 1GHTA 3QVMA 4RY0A 3BSFA 4IDOA 3L4JA 2Z3VA 2OSBA 5ENZA 5JH7A 3HWX1 4QOGA 2JIOA 1G8YA 1RWOA 1UJMA 1GPWB 2OHFA 2Y1WA 3KALA 4R9SA 3ZLUA 4B6PA 1DZIA 3TGPA 1M2JA 3TCNA 4TTJA 3C8ZA 3NDBB 2VDWA 5TE9A 4L6CA 2EF0A 2ERCA 5DDIP 3O6VA 1WXIA 3B20A 3R6DA 4ER5A 2C2KA 1KL7A 4GZLA 5I7SA 5JNLA 4C3VA 1JKIA 1G21A 1V5IA 3OF5A 4QRIA 4HADA 3W2TA 4TLEA 1QTNA 1VYUA 1UMCB 3D6AA 4M8LA 2FEPA 2YW9A 4WACA 3C43A 5K3DA 3H83A 2E5LB 1FMLA 4YGYA 2OKGA 3F6EX 2XUKA 1TNDA 3ZHSA 2FEWB 4BQPA 5TMEA 3PDWA 1KFBB 3OPXA 1NL3A 3HA2A 5I7AA 1KDVA 3VC3A 1L1EA 1SXJD 4UQOA 3ZGNA 5JJLA 4IGEA 5B1DA 4B45A 1UKZA 4TWZA 1KEWA 3EASA 1J9ZA 3GLUA 3MLBA 5DSZA 3K05A 1FJ2A 4ZU6X 3SEQA 3VV3A 3MLEA 1GTG1 2OHVA 4W4TA 4CG3A 1NDHA 4LI0A 4CYMA 5I5EA 4BFTA 1FNSA 1IE3A 3KUKA 4OK5A 3EDQA 5LSAA 5FYDA 2XGOA 3CRZA 4PVDA 3ZWQA 2XYPA 1XTIA 1BE0A 5K3EA 2C9MA 3NEYA 1K4YA 2XSZD 2ZE7A 1R16A 3WGVA 5LQDA 3WRYC 5EIBC 2HIHA 4MRPA 5JS2A 1YFLA 4WFIA 2GBGA 4UXIA 4GVPA 4BPRA 2EYUA 5CLFA 1FVOA 1L4YA 1YVPA 3PQDA 2XOEA 4KMMA 2CDCA 2H4FA 2JGNA 4TQ9A 5KAPA 5LA6A 1U1GA 1PZMA 4GQBA 1JR3E 3CUSA 3MQ4A 2Q7XA 1WOYA 2VOJA 4K6MA 4F1JA 2XUJA 4GOND 5HDBB 4RZSA 1TE2A 5K5EA 2R6AA 4JP5A 3LGAA 5JZBA 1H6AA 1ZZGA 3JR7A 1I4EB 5CBPA 3UB3A 2ZM5A 4LRYA 4L5IA 4L2IB 4L8WB 2OA0A 3BGVA 3E1GA 1XMXA 2Y0DA 3I8SA 5TQ2A 3LQRA 1RTTA 3UF0A 1KP3A 4TXMA 1XLUA 4MS1B 4ENVA 3Q8KA 3A7EA 4KFUA 3TVTA 4B73A 4BZXA 2J9FA 2PSHA 4ZVQA 4ND7A 1CY6A 4WFKA 5TPWB 3T4PA 3REFA 2OHIA 2BN4A 3AYXB 2Z57A 3PFWO 2QRNA 4CDGA 1ZW1A 2DBRA 4LZAA 1A82A 1W87A 4ZANA 5K0ZA 3JD2A 1JG3A 3U4DA 1ORIA 5TQJA 3CT6A 4JT4A 3JV7A 3TD6A 3WIDA 2PZEA 1T91A 2B8JA 5AK0A 4XGNA 4O2AB 3ETJA 1VM6A 2D2IA 5E1DA 2YDYA 1ZCAA 1P7PA 1JF8A 5AI4A 2IIPA 4GWKA 4KFSA 1U5CA 4MW0A 4C6SA 2XZTA 3INNA 3TRHA 2OO3A 2YY7A 2ZRCA 1X7YA 3GA0A 3L46A 3K9WA 1L4NA 3AVYA 4YRNA 1TJYA 4KXNA 1U7WA 5J4LA 4KN9S 2BGTA 2VHZA 2JW5A 1ZRHA 3V2IA 2Y27A 2HWXA 5F12A 4YAJA 2VO1A 3SC3A 2XDYA 1QV7A 4BL5A 2NZVG 1USGA 2JAWA 3E05A 4NOKA 4E7OA 2RJ3A 4LEIA 1EXWA 3USES 2GXQA 1ADJA 1WQ1R 4E4YA 3FBWA 4C7OA 1W94A 5FR1A 4RZQA 3MINA 4HLUA 1IBRA 4DLUA 3NOXA 3L7MA 1E9FA 5BRNA 4KFTA 4G0ZA 1XVAA 1WSAA 4TMKA 1I6LA 3CBQA 3A6JA 2DQ4A 2PL9A 3I52A 1F8UA 1RC8A 4PLGA 2Y1CA 4YP9A 5DTIA 5KOYA 3N5CA 1U2QA 4QPJC 4K87A 3KSAC 1JUDA 2AFRA 3EVFA 1W8IA 1G17A 3RVLA 4XLZA 2GF9A 3SN6A 4TYYA 3KT6A 2FTKE 3NHMA 4RY8A 3H2YA 1QIIA 2GX6A 4GLOA 3FVWA 3BJRA 3IILA 4YR7A 5KC9A 4A10A 4EF4A 1R0SA 5BV1A 2L17A 3HO1A 1YCDA 1FZTA 1JIIA 4EO4A 2FZ5A 3B1WA 2FSIA 1PVVA 3LY8A 2AI1A 3KCQA 4B3IA 1AQLA 2JFYA 1EPUA 1OFVA 3DEFA 5H7XA 5K6AA 1A9OA 3G2HA 1JR2A 1WTAA 1FU7A 1QYRA 4RV4A 5D6OA 3KLMX 1G2OA 2ZTHA 3QF4B 3M83A 3PLAE 3GPCA 3VR6H 2XE8A 3N28A 1ZMOA 1DBSA 5E3JA 4ZVTA 4QM6A 3WXMA 5IBCA 4KIUA 1GT91 2PRYA 4H7IA 3JALA 3TDKA 3FPCA 3FSRA 2LV8A 3W8EA 4ZRDA 4EEZA 1KMQA 5IWCA 1A9ZA 3TD9A 4R1PA 4Y1EA 5KOJA 3I23A 1S5PA 3QU2A 2O8NA 3KSUA 5HCUA 2F55A 2Z6QA 1ABEA 3KU4A 4BLTA 3U44B 5K51A 2LGJA 5CJJA 4IXTA 1DE0A 3IEXA 2BMVA 3OFJA 4TMFA 4CEJA 1VLLA 4IILA 3IOMA 3WNCA 4DC0A 1HDRA 3PEWA 3EPJA 1T9ZA 1FS4A 3CH4B 3LYUA 3MA0A 4A26A 3DVAB 1H93A 2EKZA 2E0IA 1I1OA 2G9UA 2F3QA 2Q3CA 4YRDA 2XOXA 1E7YA 5IABA 4ZT6A 1ZAYA 4AWXA 1E3MA 3AUSA 1J8FA 1C3XA 1PUJA 5I47A 5CVEA 4ZT7A 3BHJA 2F3PA 1K5HA 3KQVA 5DASA 3ZE9A 5HQTA 2GCIA 4D4IA 2HB6A 2R1VB 1DO8A 2XCIA 5GM1A 4V0SA 2V3WA 2PZBA 3E3MA 3FCUB 1RI1A 1JEQB 2WABA 3G0DA 1F8GA 4LZOA 4MQFB 4E5NA 4C07A 1MJGM 3HXLA 1ULBA 3B9RA 4KGDA 3ZNQA 4MHSA 2LCIA 1M2OA 1N6NA 2WJ3A 2C5LA 3R6LA 2JZCA 3BUSA 1GKIA 2H2HA 4DCCA 4N7JA 4DDMA 1NVBA 1KA9H 4PBTA 3VMFA 4LCBA 1TRKA 4Z8YA 5DH9A 5A0FA 1H5UA 3ET5A 1GP2A 3ZCQA 4C0QC 4GHWA 4BFVA 4BPBA 2IVZA 1JEEA 1OCEA 1Z4PX 3OFKA 3SMQA 4TVBA 1HNZB 3OHSX 5HF8A 2PWAA 1MNAA 5BUQA 1OHHD 4EL0A 1KBOA 2FZ4A 5LNK1 2QMOA 3G8YA 4F60A 1CCWA 5THQA 2ZSDA 2ZBFA 4ZVNA 1RYBA 3RHZA 4E14A 1LGYA 3QPCA 3L6OO 4UTOA 1NRWA 4LMBA 2VJAA 2ZTUA 4C03A 2R1UA 3GEIA 3ZXYA 4AECA 4QQ8A 4YAEA 2YNMD 1IM5A 221PA 1R27A 2FSGA 2Q5JA 3PDIA 3C1AA 4FCWA 4ITRC 4LF5B 3AI1A 2IP1A 1KFJB 3X44A 5EWLB 3PNQA 1W5AA 1SVIA 3DO6A 3NBXX 3DTYA 4FHFA 8ADHA 1M2HA 1BW9A 1J8MF 3FYCA 4YASA 3TRKA 3ZTYA 4EHBA 4EGQA 5DNUA 4HMPA 2OCBA 3CKYA 1TOAA 1E96A 4AK9A 4G8DA 2WHYA 4UD6A 4BWYA 4JROA 3R3UA 3AVPA 3RYTC 3EMDA 3IDAA 4CIXA 2RKOA 2VUTA 3OZUA 3V4LA 4WZZA 4MYTA 3TPZA 2JFVA 1QVZA 1SZDA 3EJ6A 3QGMA 3TVDA 3HYRA 1GPYA 3IDQA 4HRXA 4FFOA 2P1DA 1IG0A 3LUFA 3NXSA 1KC1A 1HMPA 1NX6A 4L8LA 1QU2A 4CL2A 3IULA 3LC0A 5AJHA 4A7PA 4BKPA 2GAJA 3VAZA 1T2EA 3IB3A 4PYKA 4ZKEA 1RBYA 4B79A 1FA9A 4C0WA 4RPGA 3WIOA 4U2FA 1BEEA 3MYYA 4GM4A 5AI5A 1ZWLA 1KI2A 4H3SA 5THXA 6AT1A 5K2MA 3CRNA 3DJFA 9LDTA 4FNOA 3UFXA 2JFUA 2JI4A 4C4TA 4PHCA 1L5QA 4I36A 4RFSB 3AONB 2I99A 3H6GA 1K88A 4Y2PA 4D74A 2H1OA 4AC9A 4H6XA 1BKSB 1VHLA 3NHRA 2Q0HA 5AKJA 5EJ8A 1L5RA 1MR3F 2ODWA 1ZOIA 2CJYA 4EW1A 4WV3A 5L8VA 4CV2A 4P4NA 5B55A 3JYLA 1C3JA 1YF3A 4B09A 3PK0A 4FEEA 3G1UA 4RDIA 2Q3JA 3ZZNA 4BEWA 4YAKA 2AZDA 5ULLA 1ODJA 1YJXA 2ZVPX 5G3ZA 5JYEA 3JQ8B 1IU9A 4ND4A 1ZMTA 5EKTA 2PYIA 2WKQA 2QQGA 3PC4A 3CH6A 4NABA 4DCUA 3U7FB 1KKMA 1N7HA 3PSHA 3RNOA 4LF9B 1CQXA 2PSEA 5JAOA 4XIGS 4KW7A 2NU8A 5LFAA 5HZKA 1ZVKA 2QMZA 1M34E 4ND6A 1H9CA 1MLDA 4U8HA 4JOQA 1YI8A 2AWNA 3GIDA 4RQAA 2DP4E 5JATA 2UKDA 3H5TA 5A06A 2LXNA 3CVJA 3MTDA 4TRNA 1GTSA 1H2YA 5EJAA 2XECA 2GUWA 5AWFC 4BX3A 1U2ZA 5A3VA 1A5SB 4EG8A 1F4PA 4HMOA 4Q93A 4S2EA 3GQBA 1NVFA 1MHPA 2ISQA 5JARA 4YRIA 4U7TB 4XYGA 1JFLA 2RGDA 2WSSD 3DNPA 3OEHD 4LCJA 4UMEA 3ZWOA 4C14A 3KXKA 4LXIA 2O20A 1CJKC 3NWPA 1HYQA 4GX5A 5D7BA 1T0JB 3KEMA 5AVWA 4CLOA 2F3UA 1YBFA 4IKPA 1XRRA 3E48A 3VR2A 4ALNA 4DKJA 3EIWA 3W8FA 5KZMB 2ZUFA 2SKEA 1ZK1A 3O90A 4HZUB 4TQGA 2P6UA 1COWD 3OAAA 1MT0A 4MUIA 2BFCB 4XI9A 2XQIA 3W7AA 4RDXA 4ZDIA 2B8WA 1CS0B 1UJNA 5KNCD 1IWOA 3KJNA 1CG6A 2XNHA 5IXJA 1MEOA 1N8TA 1NURA 4W8GA 3PQEA 3S0JA 4BVFA 1K8QA 1FJHA 1PYGA 5AJVB 4C29A 3H1FA 2Y76A 1JU3A 3HKDA 3PUVA 3UV7A 4HDRB 1X77A 1VSQA 4W7IA 1ZLYA 1JE0A 3D4BA 2FWBA 3R7BA 3NV7A 3B1KA 2K2QB 2XGGA 4ZT2A 1U28A 3RHTA 4CMEC 2JBAB 3ILHA 4Q4AA 5CXQA 3AI7A 3DTVA 3P0IA 2CFRA 4C1NA 3TG2A 1D5CA 3VR4D 3EGXA 4B48A 5DHAA 4YPFA 1T34A 1R9JA 2IYOA 1CZLA 2EEPA 3B1XA 4G1EB 2QAGA 5AHXA 1P7WA 3E2IA 2PQ2A 4DY6A 4F4HA 2EBWA 4RWZA 1VKRA 1XAHA 5JAQA 1YIDA 4GRDA 5IBQA 4OHOA 1EMDA 2RGNC 1X9GA 3M1LA 1KZHA 1GD1O 2IHTA 3TIVA 3IB6A 2BM1A 3VU9A 3PUHA 2PBZA 4NNOA 2JJ8A 1KKLA 2H6EA 1EP3B 2XT6A 1GQYA 2C4TA 2B98A 3LAWA 3ZHBA 3LDHA 4QO7A 4RSMA 3PXAA 4F46A 3O9MA 3AVWA 1JYEA 1O5TA 3FFWA 3F7OA 4HXGA 4LXHA 3CLUC 4KV7A 2R7LA 1Q0PA 4PZYA 4RVCA 4YY3B 1KEEB 1Z06A 2JH8A 3A9TA 3AHEA 3G2PA 2IZ1A 4IV8A 1PZNA 4RK1A 1ZMXA 4MR8A 3CLTD 3WNDA 4J1NA 3AOEA 2OTCA 2I87A 3ECCA 3BC1A 2C2GA 3NHJA 5GWXA 4DA8A 3PGJA 4W1PA 4BXOB 1NMZA 2OMKA 4V39A 1A71A 1NXVA 1SG6A 3A10A 3UPDA 1AGXA 1L8OA 4PIVA 4ZXFA 4BLUA 4MUGA 3C6QA 4YMIA 4Q3OA 3ULKA 5IDXA 3BOSA 4D9MA 4GDMA 3B7GA 1Y48E 2VJMB 2YZ7A 3WLAA 2JFOA 1GUBA 4CKWA 1XXHA 2ZBPA 4Y2HA 4MCHA 1HSOA 1ZVVA 4CQMD 4W1SA 3FDXA 5ARCA 4B4WA 3Q7SA 4KGZA 3TMYA 4YLYA 2XADA 1ISHA 3A9SA 4FONA 3FPAA 2QTFA 4DV2B 1H3FA 2J9XB 3ZU6A 3TEJA 3LGSA 1MHTA 1XCLA 3D6JA 1SO8A 3KOXA 1JJIA 1N3IA 1B76A 3DMTA 4OHZA 4TTVA 1AGPA 4K0KB 2ZUVA 1AXGA 3LPNA 1ODIA 2J4FA 2WT9A 4TXNA 1BDIA 5EZYA 2NO1A 2KMLA 2QGNA 1F12A 3SSNA 1F0PA 2OUKA 5A62A 3O84A 5AHWA 1RDFA 2FOLA 1L5HA 4YCNA 3LNCA 1XCBA 1S3IA 2PT5A 3NVKI 5HFAA 1FXUA 4HB4A 1YZGA 5F9FA 2VEOA 2RSLA 3NHAA 5F2EA 5JQWA 2QR5A 1ONSA 3K0FB 2QE7A 1QOQB 3IV6A 4RS3A 1C3EA 3MERA 4WN9B 4REQB 3MJTA 4EKNB 2EBUA 2AYYA 1U7DA 4KLRA 3VPAA 4M98A 3T7RA 3DDOA 5JIBA 4G5FA 4QUBA 3ZVNA 3HCRA 3L8MA 2O7SA 1B2RA 4RETA 4ATNA 4EA8A 4DDTA 3KFXA 5GONF 3QEBZ 1W25A 1ZSVA 3CBGA 4YCLA 3NHBA 3UMBA 3KBOA 3VKFA 4KHZA 4RA9B 3BJIC 5E6SB 1CFJA 3UK2A 4N3NA 4P4SA 1E2HA 3C7AA 3D4PA 1ZISA 5T57A 3ZJUA 3T99A 4RK0A 3CUYA 3MTEA 1IY8A 1CHDA 1S9DA 1Q16A 1W2WB 1HV8A 1OBFO 3FKSD 4GPIB 1V11A 4QJ4A 5FWYB 1JU4A 1HGXA 2IX9A 3BJEA 1WSBA 1W19A 4EF6A 4EX6A 5IM4F 4KPEC 1JN0A 1J2JA 4NS1A 4KVFA 4M9XA 3BRWA 3LCMA 3R5TA 1NF9A 1TX4B 1LSSA 4JAVC 1CULC 2A0YA 2QYSA 4MVJH 3M5CA 4PU0A 1GQRA 3O3CA 4X3OA 5J5AA 1Q7RA 1RXIA 3SICE 5L3SB 2JC3A 3M2TA 5LIPA 2W98A 1M6YA 3BXPA 3MMZA 3I8OA 2QZSA 1FX0A 1SCJA 3BMCA 1Y5IA 2RHLA 2ZULA 3WGJA 3WOVA 1HFWA 1POWA 1FQKA 4ZODA 2X9GA 3OT1B 3W5UA 2O05A 2ZYWX 5JCPA 1PFKA 1OH7A 3WGUA 1TVKA 4H1HA 2F3TA 1PT9A 2PKYX 1J0XO 1ESZA 1U6KA 3HHEA 2EERA 4OAQA 5K0GA 3NASA 3NJ4A 2QRUA 1PT7A 2LTAA 2JGEA 1TYCA 3BGIA 1JSZA 1J8DA 2FR1A 3LK6A 2O2DA 1QHNA 2C84A 2LKCA 3IAS1 4Q24A 4B76A 3RK0A 2NV2B 2YOGA 1RQRA 4O8ZA 3BN3A 1LVGA 5BO5A 2VP3A 3C3DA 4GVLA 3WC4A 3NBQA 1UEIA 4R9UC 3ND9A 2GBFA 5FCDA 5G02A 5JSKA 4OQMA 3W34A 1NP7A 4AD8A 1JHDA 3OCZA 4RVGA 4NCAA 4MTCA 1RE0A 1S8FA 4ALIA 5L4LA 5EWJB 3R3XA 4QT0A 1QIMA 1GZ7A 3ZCXA 4GKJB 2CCGA 2XXAA 2ICAA 5DZSA 4UAVA 1PGJA 4NBLA 3ZKWB 1L2TA 2HK7A 1AXEA 1VCNA 1Y1QA 4KGXA 2B8NA 3NHPA 2CJWB 4HDMA 4EWLA 1LJ8A 4GR5A 2Z04A 3L8EA 1N0VC 1E7QA 1OY1A 2H51A 3CE6A 4PZPA 1LLQA 5JH7B 1IXYA 5HKAA 3Q98A 4XDGA 5F1OA 1Z33A 3ZGYA 3INRA 3FNGA 3U7JA 1LDGA 3QX9A 5P21A 4F2PA 1XV5A 2WV7A 4WBNF 5IZCC 2XX3A 3AHFA 3VNBA 1OH6A 1Z5NA 1ORWA 2W71A 1GDHA 5GONA 2WKPA 4O2RA 5A7GA 4BNYA 4PSKA 2WUWE 3BD7A 4CDMA 4FHDA 1M2EA 2JDIA 2EW1A 5IZ4A 5A2QA 3P2JA 3IQIX 2Z8YA 3OJ0A 4L5JA 3JWEA 1G8MA 5ECDA 1YA4A 1RCUA 1ZNQO 5C35A 1RLUA 3EVDA 1RRPA 2DFKB 4X1IA 2C92A 3LHDA 4NBVA 2D7JA 4JQZA 4TSFA 3U7RA 4BAZA 5BW4A 5KIAA 1GNTA 4URHA 3ELDA 3TLMA 4OAPA 1OZFA 2DHQA 1SHZA 3CVVA 3QPBA 4N0QA 4DLZA 1Q12A 1XHEA 2BHTA 4KQFA 1FNNA 4WOBA 2APJA 4GLBA 4CLRB 4CKEA 3L1IA 5AVYA 1NT4A 4ER7A 2Q5EA 4RKWA 2ERXA 2WJYA 4HWTA 1PV1A 2YFQA 3KIPA 3GJ0A 3QVWA 4G81A 3TFQA 4LJRA 1TK2A 5KQMA 3I3SR 3GVHA 4QDTA 4R2WA 2M6LA 3UWDA 1YB4A 2Y1KA 1Y9JA 2HU5A 3OVMA 1MB3A 4LDAA 3TQOA 3UOGA 4MJ3A 1HLPA 1E2JA 2BHRA 1V9LA 2FPXA 3LRPA 4PLZA 4Q3KA 4AY2A 1Z5PA 2P5SA 2AJDA 3EFOA 1MA0A 2VZ8A 4ISCA 2YDXA 3SS7X 3U9SA 3L2OB 3FGOA 3P2YA 2ZB3A 4ZI7F 5GZ1A 3KDAA 2C88A 1AUXA 1D03A 4J0FA 3OX1A 4UJ3A 1DJLA 4ZVLA 2FPIA 5A1JA 1QH8A 1BFDA 2VRCD 2Q4TA 2ZAYA 4JLOA 5FFFA 2C9ZA 3UH0A 5DN6A 3OIFA 4DTIA 2VLBA 4OIFA 4DIUA 4EVRA 3KOUA 5CBPB 1QG4A 2OORA 5HX7A 4B6JA 1L5FA 2IL1A 1L3IA 3W2FA 2OCKA 4X90A 1Z74A 2AHRA 2P2LA 2PN1A 2EP8A 3CUUA 4RBNA 3GJZA 4UOEA 1D5WA 1ZNZA 2ZANA 3EEBA 5IHXA 3A4TA 1N5DA 2RCYA 4ND3A 5DEIA 1WMFA 3HJHA 3PRKE 3ZWNA 5CPBA 1RMQA 1Y8QA 3CGWA 3A9WA 1CP2A 2X8LA 1GRVA 3ZGXA 3NMUF 2LNDA 1P2GA 1VMAA 5A3SA 4LE2A 1X1QA 5TRTA 1QRAA 2QK4A 4NE2A 3HMQA 1ZR4A 4P3KA 1UBJS 1KE1A 4C76A 1VPDA 5KJEA 4BYMA 4N18A 5AP9A 4F9FA 4UMVA 3C5HA 3TDMA 3C85A 3H4IA 3WKEA 3N6VA 4MLCA 3OLCX 5CHEA 3FHTA 3AR3A 2IHJA 2MU1A 3RTAA 4R69A 2FFBA 5JDIA 5GAJA 5KYTA 1W5BA 3HXPA 5BSTA 3PR1A 1O87A 1NYQA 1URPA 1ZC4A 2FFHA 3D02A 4ZMRA 1W4LA 4DL9A 1O8BA 3PSAA 1CU1A 4KDCA 4YRAA 4RTKA 4B3TB 1TGYA 1IQRA 2FUKA 4WK6A 1L7BA 3R4VA 3TUZC 3Q85A 5CLLA 3IODA 3ZYZA 3QJGA 3DZIA 3UK7A 2PIDA 1YS2X 2BUCA 2IPNA 4G1MB 1T9KA 3E4CA 4IHJA 2Q6TA 2V45A 3KTDA 4X94A 1AKRA 1CR0A 3HJRA 1W48A 1DV2A 4C0SA 2GZSA 1T3SA 5FT9A 3ANLA 1NVAA 4BO7A 5KQPA 1Z12A 1HZJA 2G0TA 3JQQA 2DR2A 1N36B 1XWFA 1Q0UA 1C9MA 1K8RA 2ET6A 4C2UA 1ZEMA 1RQXA 1WDTA 4YQFA 1WULS 2J7PD 2HA2A 4M8IA 3GBSA 4A0FA 3AUJB 3UZUA 3X0DA 1B3BA 2OAGA 5JLAA 2FK7A 1GVHA 4WXYB 5LQMA 2BFPA 2FOXA 2ZWIA 4GWLA 5EFOA 4HDSB 3WQSB 1MC8A 2CLCX 4RJLA 4DJDC 2QY9A 3V1LA 2VJOA 4TVSA 3KQQA 5AVTA 3KKKA 2BEWA 3IAM6 4X20A 1OX6A 3KSZO 4YCJA 2DMRA 1ETUA 2H85A 3U4HA 3CWCA 3URKA 5C1PA 1ZSNA 5KWSA 5KCMA 1B3RA 1YBMA 3TOZA 2FLKA 4EENA 3ENZA 3F78A 3QFSA 5M3BA 1Y4AE 3HC7A 3GROA 1EZZA 3ODPA 1MT3A 2BKXA 4OQ4A 3A9UA 3S1AA 1QQ7A 3QW2A 4BQFA 3GJXC 2DUWA 3AM3A 4JLNA 4KVZA 1CR4A 3GT4A 2JFQA 4ZRNA 3JALB 2CXUA 1EWVA 2VJBA 1BQ3A 3ZQKA 4DRXA 5IAAA 3N3AC 3LUGA 3JQGA 2CSUA 2GAFA 2RHBA 4PQFA 4WLEA 4E03A 1YB5A 1LC0A 3JS5A 3OQHA 4TLAA 1AKUA 4XVRA 1L5NA 5KOJB 4KREA 1TM3E 2Z30A 3WWYA 1NTRA 1UBNA 4JLWA 1KH2A 3NPMA 4HAXA 4UBOA 4CEJB 5A2GA 2WLTA 4AP9A 1NT2A 4WT7A 1LBTA 3HN2A 5JSFA 4XWAA 3KK0A 4N5NA 3WWZA 2P0EA 3TBKA 3ANNA 1MMFB 3N8DA 4N8DA 2DUJA 1D2EA 2NSYA 2O57A 1XD9A 2IEIA 4PPQA 4HDNA 2ZWAA 4Q3BA 4B43A 2RK6A 4Q16A 4HGZA 5IEBA 4AZ3B 4PYRA 4H4EA 4CU2A 2EIXA 4RD2A 1M8PA 5D8DA 3FOEC 2OFPA 3ME5A 3QX7A 4ZQEA 5JZ9A 5L6LB 3O74A 4ZTZB 3DLAA 1QUEA 2QD1A 3ETNA 4NE7A 3ZDAA 5KVCA 1E18A 4B3MB 2IV3A 1P2UA 5LJIA 1EA7A 2YR0A 4DKXA 1FYFA 2IYTA 1C14A 1KI8A 3A1UA 4KNWA 3K0CA 3EMBA 3DEIA 4YJDA 2XA2A 3HDJA 5CT6A 3UAZA 3EPRA 3ITEA 3DCYA 1IATA 1Y3CE 2EQBA 4LF8B 1JXQA 4D5EA 2X4GA 3G0HA 4N5DA 1OI4A 2GF0A 2X77A 3L01A 3NM5A 4FCCA 4NEQA 3DMFA 4FEAA 2VXOA 3P9PA 5DTEA 4YO8A 3SQNA 3T5CA 4R0MA 1DKMA 3FGPA 3CEPB 3T94A 4EPXA 1PT8A 4YDRA 5L3ZA 2ENUA 3EVBA 4ZEOA 4G0WA 3QA3E 5DM4A 5T67A 3F4BA 4JUCA 5A1TA 1CK4A 3MGKA 5DB4A 4C0LA 1Z37A 5DNYB 2WR8A 3W78A 2FV8A 2YWEA 2HNKA 3VKWA 4IQFA 3EGOA 3AVVA 5A9RA 1PK7A 5HXAA 3B9BA 2Y05A 1FYWA 5K0FA 2XNJA 1DIOB 3UGKA 1J7JA 3W4JA 3EEFA 3K35A 5A5DA 2VPYA 5CXXA 1R9MA 4YUVA 3NTQA 4JWKA 1YZ3A 3F1KA 2HT1A 5JCJA 3UJ7A 5BSKA 4QJ5A 1OC4A 3ELBA 5MFZA 4I4CA 5LM3A 1DX4A 4OV6B 2IYPA 4R1QA 5JG7A 4BGEA 2D1SA 1PWEA 1Q7GA 5HRUA 3VUFA 3SYNA 5KWIA 1QNFA 1JKXA 4Q5IA 4EECA 1Z2DA 2I7DA 3TI9A 3DBRB 4Z4EA 3AHCA 3RASA 1E4EA 5JY6A 2G7ZA 1ISSA 2NAFA 1XAJA 3IT2A 1R4NB 1EWKA 2B5VA 5E0OA 1JSCA 4DQUA 4FKBA 1F8FA 3OPYI 1U7UA 3ZVLA 3ER6A 4HQNA 2P5YA 2VOEA 2RI0A 2XQFA 4MKXA 5FHQA 4FILA 1U0GA 4X93A 1E66A 5CT8A 3T52A 3QOWA 2PVPA 4XIYA 4FYKA 1PD1A 4LRXA 4YNBA 3DAFA 3ENKA 1GN9A 2JFFA 4AXBA 1PYOA 1U8UA 4GG1A 4Q1BA 2FVYA 4FBMA 4OB7A 3VPSA 2GBPA 3GCXA 2CFIA 4HXYA 4JXKA 2RB5A 4FYPA 4QVKA 3RFVA 2VSOA 1E1QA 4F86A 2BV3A 2EWVA 1IJFA 3ZZMA 1M6EX 1PWZA 4IBOA 3V4PB 1KR5A 1NI3A 3ABIA 2RKWA 1P45A 5E7QA 1CJVC 2NXWA 5HM6A 2IE0A 5ALWA 3NOOA 3V1MA 2HHJA 3L0YA 2LDXA 2YC2C 5E4TA 2IXGA 2R6R1 2AH5A 4KO8A 3CB2A 3JQCA 1PR6A 2FPKA 2A3RA 3JASB 3B2NA 1PEYA 5JSUA 1G8GA 3WQRA 4BNDA 1QVWA 2QZZA 2R6HA 1E9SA 5IANA 2ZUDA 1T3TA 4G8BA 3NALA 1I6MA 1N75A 3GLHE 5B7NA 3TAUA 4RIFA 2R4QA 2RGXA 2FPSA 4A6DA 3DFFA 3GV0A 1U3GA 3KO8A 3WYDA 3NAMA 3PE4A 4MYCA 5CLGA 4S2UA 4HAUA 2D2XA 5MHTA 3R6TA 3ETGA 3ZJYA 1MX9A 1N8NA 3GNLA 4IVNA 2QV0A 1SXHA 5T4EA 2H0QA 4LHXA 1EFRD 3GXOA 4LW8A 4ETIA 2G83A 4W99A 3BVPA 2QM0A 3GRRA 4B3DA 1EQUA 2DLDA 3LK7A 5BW5A 1D7AA 1S4MA 4YMHA 3B9QA 4WCFB 4RQUA 4G0VA 3GQBB 3A3OA 4QODA 1I94B 3IJEB 3ROKA 4UNNA 3OSZA 3W1VA 3CJQA 1HM5A 1T8TA 3V8RA 1R5BA 2QY6A 3TLEA 3UTDA 2ZTSA 3ZDQA 4BAGA 1M0EA 1VI6A 4X1KA 5F7OA 4IHQA 1JB9A 4YUWA 2Q49A 5IN5A 1J0EA 2IV7A 3ZGLA 3RC8A 1N9KA 2CNWD 4NBWA 3AIKA 2VP9A 2YN2A 2WM3A 3F96A 3JVEA 5CVJA 5ALXA 3SQXA 2RB4A 1VECA 4B3FX 4WNAA 4M99A 1G3RA 4CM8B 1TAHA 2WJZB 2ZI7A 3BT7A 5FEUA 5JAUA 4MUEA 2RGRA 2HI0A 2W2QA 3NGXA 2QUZA 1GOTA 2C5GA 4RFLA 5AICA 3GFSA 1K9SA 4F5WA 3B36A 4CU5A 4DIKA 1NVMB 1T5HX 1KYZA 2XYVA 4FFSA 2BEJA 3V2UA 4FP9A 4DCJA 1W73A 4ZP1A 2FUEA 2CHFA 4MVXA 4RH1A 1K86A 4QHSA 3HFJA 2O1WA 1NQTA 3JWJA 3TSOA 1JNXX 4LZJA 1TKRA 1B0ZA 1BX3A 4N1AA 3WSVA 1NVVQ 2R8BA 1YRBA 5DYTA 2XUHA 4YAOA 3VZRA 1Q1GA 2JGLA 3MSCA 4LZWA 4AZWA 5JHHB 1CRLA 1X19A 3JX9A 1W0JD 4KWCA 3UQZA 3NIDB 4DBLE 3HVRA 1E3QA 2ODAA 1TEHA 3C45A 3D1LA 2WK1A 3IIEA 2GWHA 4L4RA 4KXYA 1AKEA 1R4MA 4JT8A 1V16A 3AR6A 3KJQA 3TMKA 4L16A 3SEAA 1GPBA 1T6XA 1RJ9A 1V8ZA 3OP4A 5SZKB 3L6CA 5BWMA 1Z73A 3HYSA 4N3CA 4OCZA 2LUOA 3ONWA 1WCV1 4AG5A 4JX8A 3MCUA 4FTWA 1EDDA 1AZSC 5I8ZA 2FPOA 3O4VA 3SIXA 1IH8A 5I7FA 3HGMA 4RACA 4XM2A 5HF9A 4FNGA 2IHUA 3IAHA 2GK3A 3ZCPA 1C3LA 5KTTA 1CT9A 4GX0A 4PRLA 1QGED 3P0HA 3U13A 1V35A 4ZZ2A 4YRSA 3VR6D 1P3Y1 2BDTA 4GNRA 4KQCA 4RAOA 5C1DA 2NQTA 2PFSA 3BDVA 4QRHA 4TPKA 5GM2A 5LYJA 1VE7A 5C53B 4XH9B 4ETNA 4BO6A 1FXWA 1OLUA 4QG7A 1LBSA 4E1AA 2QLNA 1U65A 4BUCA 1MAUA 1Z13A 1ODKA 2DE0X 3II6X 3VTAA 4BV9A 4PAGA 1FQJA 1N5LA 2QN6A 4FX5A 3AFHA 2DWOA 3UTCA 4Z5XA 1L4UA 2FEKA 1Z4IA 2K87A 3JQBC 1AQNA 2G07A 2W6CX 3RQSA 4AG6A 1JWAB 2Q4RA 4X44A 1ZCBA 1ZN9A 3U7GA 2W6ID 4H7EA 1BRMA 2PL3A 1M1ZA 2FU5C 4KTVE 5DLQC 5BWNA 1JR6A 3FTQA 4UC0A 4BMCA 2VAVA 3KV1A 3H9GA 1SG9A 3O5AA 2BLLA 3JYHA 3H86A 1X7GA 3LL4A 4R3NA 5ALIA 2IZ7A 3QVTA 3JQ9A 1CUDA 4EPYA 3ES9A 2G1KA 2IPLA 4ZQCB 4JA0A 3MM4A 5E1BA 1W29A 3F46A 3QYFA 1O1YA 4IDDA 5FV7A 4ZVOA 5H81A 3U3XA 3ZWVA 5CMLA 3Q3VA 5DNCA 2EC5A 1SVLA 1X74A 3DZFA 4PZLA 4I6JA 3C8DA 4O3MA 1F4VA 3UK0A 1J56A 1ZD3A 3PHHA 1GA6A 1WQ3A 2AR0A 1UKVY 5C18A 5AKXA 3DWIA 4PHFA 2RHWA 2WF8A 2YV4A 2IBMA 3UWMA 4OD0A 3W3AH 1J2EA 4X8LA 4RK5A 1ZITA 3K0AB 1UDXA 3SLRA 1ZICA 3CV3A 1NFQA 4UUNA 1C8KA 1S1CA 4FCVA 5A9TA 4H1UA 2ADMA 4MUAA 1C29B 2ISCA 4Y2RA 3N1UA 1O95A 4OBWA 3WADA 3EVNA 1NN0A 3GZTB 4BNFA 1NF3A 1M72A 4UU7A