1FUKA

Crystal structure of the carboxy terminal domain of yeast eif4a
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
162
structure length
157
Chain Sequence
IKQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGGVAINFVTNEDVGAMRELEKFYSTQIEELPSDIATLLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EUKARYOTIC INITIATION FACTOR 4A
publication title Crystal structure of yeast initiation factor 4A, a DEAD-box RNA helicase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 55
structure length 157
sequence length 162
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2000-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1fukA00
1MABB 3MAAC 2ZYWX 1J8MF 2FWRA 3UIEA 3KTAB 2JATA 4DRZA 4XD7A 4FIDA 1GL7A 1K6MA 1E2IA 2EQBA 4EQ6B 3H4MA 3T15A 2W0MA 5GJVC 2IS6A 1CTQA 1KO1A 1NG1A 4NKRA 4QNMA 3O47A 2IWRA 3U3JA 2J0SA 3T1VA 2ZJZA 4A9AA 3SFZA 1UDWA 4C0QC 5L3VA 3CB4A 4CGZA 4DLUA 1CRPA 2QMEA 2ZSDA 1JEDA 4I81A 2JLQA 2VEDA 4Q4AA 1T3SA 3W8NA 2N1BA 3CZPA 4HAVA 1U94A 1QHHB 3L2OB 4NPHA 3HU3A 1TU3A 3M4YA 3SE0A 4H1UA 3N2EA 2ZR0A 1P61B 2ZU6A 2O52A 1HURA 3X1YA 4DCTA 1YRBA 4P3YA 2RH5A 3NHAA 4EAQA 4D2IA 2G88A 2QUZA 3WHLA 4Y0AA 3W8RA 2BVNA 2CXXA 1OIWA 3P4YA 2PT7A 2QN6A 4HLQB 3EPHA 3FHTA 4E03A 1GILA 1DE0A 4URUR 4U5XA 4URWR 4MDEA 1Q57A 1E2FA 4EFLA 2OO7A 5K8TA 2ZE8A 3QXCA 2AD5A 3UXMA 4LPSA 4FD2A 2REXB 2CCKA 4G5SA 5AUQA 1GKUB 2HXSA 3B7GA 4FMCF 4URXR 4CF7A 3AF2A 4PO8A 3QKTA 1FUUA 5J4HA 2OHFA 4NU0A 3OEHD 3A1SA 3FHOA 4IW3B 4GBMA 1BYIA 2ZRGA 5JLJA 2AK3A 4JLKA 4RZ3A 3W6OA 2YWHA 1FX0A 5FR2A 1FOEB 1S2MA 1DVRA 2WMOB 2V7QA 2YV5A 5F98A 1GNQA 2J59A 2NOAA 1NP6A 2IYSA 5C4GB 5L3SB 4D0LB 4QJ3A 5KNDA 3ZQJA 3AVQA 1TPZA 3UKDA 4DCNA 3MG9A 4ARZB 5IRCD 2SHKA 3NKVA 3AF4A 1G17A 3LBHA 2WWFA 1R10A 2VP2A 4MQBA 3TR5A 3AUXA 5FPSA 2R2AA 2R6CA 1WXQA 2Q3HA 3DOFA 3MJRA 4B3GA 4TZ6A 3CIOA 1V43A 2AFHE 2OBLA 4FMDB 1CS4C 4PX9A 1E9FA 1KI6B 2B7BA 1KHTA 4BZQA 2JLUA 2IYQA 3RSOA 4JSYA 2GF0A 2PMKA 4JKYA 4U00A 3A8TA 1MO4A 4TYNA 2IUUA 2JIZD 4LZZA 5IF9A 2QU8A 2FMXA 4QGGA 1XTJA 3A4MA 4ZKEA 1S1MA 1F2UA 3AF3A 3VTKA 5JEDA 1N3BA 2JA1A 3LWNA 3U4QA 3NBXX 3RSLA 4MITA 2HEIA 3CNOA 1CF4A 3TMKA 1ZM9A 3RDPA 2XSZD 2NPFA 3K0CC 4TL8A 1XNJA 3SI7A 1XRJA 1GTVA 2VLIA 5E7IA 5FOVA 2V9PA 1IN8A 3IO5A 2WWYA 2FZLA 2ZRCA 2VQSA 4ESHA 5F9FA 4EDHA 3K0EA 4RKEA 3KQLA 3U7GA 1G5PA 2ZS8A 2KI5A 2BMJA 2XZLA 4BFSA 4BRWA 4OHZA 1E2GA 3E2IA 2OUKA 3FPAA 1XX6A 1KMHA 2ZRIA 4L8GA 1P7CA 2W00A 2ZE7A 3U44B 4M1WA 5FPKA 2CE2X 3BH0A 4G5QA 4QJ4A 5DLQC 2QP4A 4ZIRA 1JXOA 2CDNA 2WBLC 1DADA 3TGPA 3FKSD 1ZU4A 1RVDA 3X2SA 1Z0DA 4LJ7A 4Y0VA 4D25A 3LY5A 1E2PA 4QGAA 1F2TA 1KOFA 3MWLA 1E79A 4DT1B 4CEHA 2B8TA 2HLDD 1G8HA 1XTRA 3VR1A 1KJYA 4U7DA 3AVTA 1HTWA 2ZYUX 1DG3A 2CK3D 3QNUA 4LDJA 5C18A 4PAOA 3AKCA 2O0KA 3B1XA 2GJ9A 4MKIA 1JXMA 1U0HC 4LHYA 3BH7A 4MYHA 4Q02A 4BLTA 1SZPA 2D4HA 1XF9A 4PC1A 2CHVA 1Z22A 2ZSBA 2AXNA 4ITRC 2XAUA 5AK0A 3SBDA 2ZETA 2J7PD 1EFRA 4CVNA 4YXWA 3FDIA 3K9NA 1HUQA 3DKVA 5G41A 2AKAB 3FVQA 1MO3A 1N6NA 4ASUA 2O8CB 1X1RA 5DH9A 3K70D 3L0PA 3C5CA 3GJXC 2HYIC 4TMKA 2QE7A 3MMPA 2O8FB 2R65A 2F1IA 2IEZA 1KY2A 3L82B 5JCZA 3CLVA 1XZPA 2A78A 2VP6A 2B7CA 3FMFA 2FF7A 4TYQA 4LHWA 2ATVA 3K09C 2VHTA 5EE0A 2YKGA 4C0JA 3GLGE 2QAJA 1NN5A 1KO8A 2QP3A 2V55B 1P62B 2OE2A 2OFXA 3I5XA 1H8EA 2JLXA 3RRMA 1CR1A 5LB4A 4TL6A 5DN6D 5FOTA 3W3AA 2PX3A 3IILA 3LO5A 4OBEA 4QHTA 1U9IA 1WRBA 4DZZA 4HZIA 1WBDA 2ZVPX 3CZQA 5HKKA 2E87A 1OIVA 3MSXA 3KKMA 4B2LA 4LBYA 2FOLA 5DISB 3GLHB 4KXFB 5BN4A 1DAGA 2BBOA 2YOFA 1W0JD 1ZNXA 5K8IA 3RRYA 1GL6A 2W2XA 3DO6A 3GJ5A 3KKQA 1VIAA 4PR0A 2A9KA 1A1VA 3ZS9A 1S0UA 3W34A 3UMRA 4A36A 4C2TA 2I4IA 3OEEA 2JJ2A 3GLHE 4XIGS 2WPDD 1JPNA 4G5GA 3IO3A 3I5YA 3UPUA 1N2CE 2RCNA 2QP9X 5JS8A 1R0XA 3MLEA 4HZUB 4DLZA 3VKHA 1LVGA 1D5CA 1T0HB 4MGZR 2PT5A 4DC9A 1GRRA 1NJGA 5FUWA 4E07A 4D6PA 2QMHA 5KNBA 4BFWA 2PZEA 5FUYA 2FSHA 1TX4B 2QY9A 3ICQB 1KDTA 1Z63A 1NBMD 2IX3A 3GJ7A 1G5TA 1LB1B 3PUVA 2IEYA 5FTLA 4MGYR 4TYYA 4JLVA 2G83A 1N5KA 4B6EA 5JJIA 1R6BX 3MUFA 4HI0E 4HUQA 5EP2A 5L3QA 1M74A 3D3QA 1OH8A 1BMFA 2DWOA 1VG1A 1LFDB 5EQTA 4V0KA 5HE8A 4MDFA 5EE9A 1VMAA 2JAQA 3DM5A 3ZVRA 4DJTA 4CRWB 3T61A 3CM0A 3SQXA 3C4JA 1SQ5A 3GFPA 2C9YA 4KVGA 4O2RA 2W6JA 3RRZA 4B75A 1Q1QA 5BXQC 5IHPA 1SKYB 5KYKA 3ASYA 4IOMA 2C96A 2J9RA 4OHXA 4IHQA 4ON9A 4PQYA 5CM9C 5KUTA 1O87A 5FFMA 2X8AA 5KDLA 2ZI3A 1ZU5A 2JLVA 5CLLA 2WJIA 2ONKA 2XTMA 2YC2C 1QBKC 2ZM5A 1JJ7A 1GWNA 2IUSA 2REBA 3TSWA 4KITB 3QIAA 4PZLA 5FPYA 2BJWA 1TQ2A 3B60A 1H8HD 5B64A 1LF5A 2MSCB 2F6RA 1A7JA 2IYZA 4UNSA 2ONJA 5JFGA 1TU4A 3QPWA 5D3MB 1DAFA 3CRRA 1W0KD 1CR0A 3NBFA 1G6HA 3GLIA 1E0SA 2BHRA 4P4UA 1FTNA 1NBME 2YWFA 1EX6A 4RFSB 3U7EB 4FCTA 2PEYA 2VIIA 3PEWA 2WWHA 4TLCA 4CW7A 1E9EA 3OESA 3SYKA 2F1HA 2GETA 1G5RA 2BIFA 4D4KA 3AGPA 1AS3A 1UAAA 5IK2A 3KDSE 4RD3A 3GLFE 1S9DA 2A5DA 5EXSA 3S1AA 3B1ZA 2J87A 4F93B 3PEYA 4TYWA 2QI9C 2CL0X 1QHNA 4R98A 4OQNA 1KJWA 3T1QA 1YR8A 2DFLA 2OM2A 1OPXA 4QHYA 4LOAA 1UM8A 3I4LA 4F91B 2CVFA 5EXXA 1I2DA 3A1WA 3EWSA 1D8TA 1LTQA 3TJZA 1O3YA 4XWKA 2VP9A 1CEEA 3BERA 2YWEA 3CNNA 2W6ID 1W36D 3BD9A 2FGKA 5CIWA 1R7RA 1W4RA 2FE4A 3SS8A 2VHUA 1II8A 1IOZA 1ZM2A 1XMIA 4FMCB 2VF7A 1J8YF 1X86B 4IOJA 2P6NA 1VYUA 1FP7A 4BPBA 4B76A 2GZAA 4TQ9A 2ZRNA 1P72A 1NKSA 4IEIA 2LCFA 2Z5FA 1G21E 2WWGA 2WKRA 4QBIA 2D7CA 1CJUC 3EASA 4E09A 2KBFA 3GEEA 5HCIA 1AGRA 4OI1A 1Z0IA 1XEXB 5B58C 1Z29A 1P3JA 4K46A 3GJ6A 4Q4HA 4P31A 4DSNA 1G7CA 1P75A 1UADA 1JAIA 3OE7A 3I32A 5D3QA 4DUGD 1E96A 4WA7A 1RYHA 1QG4A 3PQCA 4M1MA 5C1BA 4LBVA 2Z43A 2QTHA 1ZP6A 2NZ8A 1UF9A 4HLUC 4IVPA 5FL3A 4HAUA 3QF4A 3J81k 3VNVA 2AK2A 2LKCA 3FB4A 3CRVA 4TT3D 4PXAA 4YMWA 2PCJA 4LJ8A 5HR5A 1N6HA 1N0UA 4RD1A 2N42A 2XZOA 4D0GA 4MKGA 2RAPA 3SHFA 1W36B 2QSZA 2JDID 1ZINA 1YZUA 2X77A 1R8QA 4KU4A 2QPTA 2GXQA 4Q21A 1OLOA 4Q7MB 1KI1A 2ODWA 2RGNA 3VFDA 5JMTA 4O3MA 1CJMA 2WKQA 1ZIPA 1NVXQ 2J0UA 1SXJA 1RKBA 1XTKA 1Z06A 1OF1A 2G6BA 4O2LA 1IJFA 4ACAA 1I4DD 3IIMA 5KPDA 1OE0A 5HCNA 3FMPB 1ZJ6A 3C16C 4AIIA 2GA8A 2ZI6A 1KO7A 4JSTA 2XGJA 4BFXA 3EIHA 1Q0UA 3QVUA 1AQUA 2FG5A 3K9LA 4OL0A 4W9MC 1VTKA 2GK6A 2KBEA 2Q21A 3WBJA 4W5WA 5LD2B 1ZYUA 4KV9A 1WF3A 3ZD6A 3BS4A 1H65A 4KFUA 1EGAA 2C8VA 1KK2A 3NC0C 3NBZC 3A1VA 3TK1A 4C0AC 3NG1A 1R0ZA 5DYGA 3QPVA 2ZJ5A 3O8CA 2IYWA 1ETUA 2NMVA 1NLZA 4KBGA 1N0VC 1T0JB 3P27A 4A0HA 5KDDA 2GWHA 2XNDA 3IIJA 1G64A 1XP8A 3IPYA 1UBGA 1E2LA 4NE2A 3PXGA 1XB2A 2BMDA 1VCIA 4WXPA 3OFND 2A5JA 1E2EA 1PUJA 2AFIE 1RRPA 3GFOA 4QBHA 5EP1A 3DMDA 3DM9B 3TUIC 4A92A 3FHCB 1GITA 1MO6A 4GPTA 1QDEA 1QHSA 4TQUS 3V4RA 5IDVA 2HCJB 2W0SA 4B3DA 2X19A 1SVLA 3EZFA 1WA5A 3X1XA 4AKGA 1CKEA 3QXHA 3AUYA 4NYMQ 4F4CA 2OBMA 4D4JA 4MUAA 2FSFA 1U0JA 3TW8B 3UMSA 1AQYA 5FOSA 1HT2E 2GXAA 4KLNA 4GP7A 1VHLA 2AKYA 1W5TA 1TQDA 4IDPA 4NYJQ 4PZZA 2IL1A 2OCBA 4JKIA 1ZCAA 4NYIR 2HT1A 4AKIA 3OZXA 1EK0A 1ZNZA 4LBWA 4QHSA 1ZAKA 3QG5A 3GLGA 3GP8A 3NTUA 3NVAA 1I2MA 2BBSA 3C7KA 2A5FA 1F2TB 5CB8A 4QM7A 3PUWA 4IDNA 4YMUA 1EFHA 4CEHB 1XMSA 5F3WB 2D2EA 4GMDA 5FBQB 5FBRB 3W6PA 3FGNA 1M7BA 3KJEA 3IUYA 3KX2A 2F43B 4C3ZA 1G4UR 1GZSA 1J70A 1Q20A 3NIBA 1OT3A 1U8YA 3I62A 2XXAB 1D2MA 3OHMA 3DHWC 3AVXA 4V0ME 3HYTA 2QAGA 4QJ5A 1G4AE 4DEYA 4DBLC 3OIUA 3BC1A 2ZYVX 4Q19A 4YMVA 2G1KA 4US2R 3UANA 3NH6A 4EPRA 3UG7A 1AKYA 4KSBA 2Z4RA 3PUZA 5JEEA 4IVQA 4GOXA 5AJZA 2C95A 4PHGA 4DVGA 5KDOA 1E4YA 1VG0B 1YZGA 3B1WA 1XXHB 1OXSC 4K81B 3B82A 4MGIR 1OJLA 1KK0A 1GOTA 1FL9A 1QHXA 2HCBA 3FFBA 3VU9A 1CJKC 1SVSA 4C0HA 1KYIA 2O0HA 3TQFA 3WNDA 4Q1FA 3H1TA 2PL3A 2ZRFA 4C2UA 3CW2A 3LAWA 1G18A 2O8DA 1N5JA 4JLMA 1UDXA 1BKDR 1XFAA 5B57C 4O0MA 3WMFA 5CLQA 4B3CA 4Q9KA 1IXRC 4DLRA 2L0XA 1ELOA 3C5HA 1G20E 3ZJYA 2O5VA 4TWZA 1W36C 2DPXA 2MMGA 4NCNA 5J5CA 2QROA 2DB3A 5JJKA 3DKPA 2P0EA 5EE5B 4NZYA 5J40A 3D7MA 4JYBA 5DN6A 1M1YE 1GKIA 3N5CA 4CEIA 2IF0A 1NL3A 2WZQA 3WHKA 2R6AA 4AYTA 1W0JA 3QPUA 1G7RA 1VPLA 1Z2AA 1E94E 4BLRA 3IQWA 4OHWA 1OH7A 4B71A 2QGZA 2IXGA 5EP3A 2OFOA 2VP0A 3PEVA 1UKVY 5EXPA 1QHIA 3U3MA 2NO6A 2WPDA 4TSFD 4JBYA 3U6BA 3VX3A 1FQKA 2C98A 4KFSA 5LD2C 4LV6A 5G53C 1RE0A 1XPOA 1LY1A 1ANKA 1OB5A 4RD0A 5SZJA 1EFTA 1GNRA 2FFQA 2YJTD 2LWIA 4ILEA 1T6NA 2EFEB 4BLPA 2CLSA 1MR3F 4DLTA 3H2YA 4EJSA 1JEEA 1KK3A 3L0IB 1F48A 1XD2A 3LBIA 4MGKR 1GG2A 2ERYA 3IDQA 2UZ3A 3I8SA 2D06A 3QKSB 1NBMA 4PQRA 4NONA 3RS2A 2ZAOA 2ZE6A 3IEVA 4Z51A 3PJRA 3LXXA 3TVDA 5IT5A 2CHGA 5SZHB 3KJGA 4RZ2A 2A5YB 3VR3A 2JJ1A 1K8RA 3LH5A 3GJ3A 3THWA 1WMSA 3BFKA 4LJYA 5G40A 4JT2A 5EXTA 3CBQA 3IPXA 1P73A 4CT5A 4GZLA 1US8B 1XJ0A 1HA3A 2IYTA 4EIWA 4RFVA 3GLFA 3VX4A 3B6EA 3BWDD 4Q5IA 4W5JA 4JMPA 1QHGA 1TF7A 5LBIA 1NSFA 1Q22A 2W83A 4LCBA 1C9KA 4I1OA 4PHTA 4DSTA 1Z0JA 4EPXA 5FUVA 3C15C 3PCRB 2JEOA 1AM4D 1HV8A 4NBSA 2ZR9A 3SYNA 1LNZA 1KO5A 1W5SA 4KFTA 1ESMA 2F7SA 1HY3A 4Q1AA 4F4IA 3A36A 2QBYA 3K1JA 4KJZA 5P21A 5J4KA 5CM8B 3BH6A 3PUXA 1BOFA 1KSGA 1DARA 1Z28A 2J5XA 2WMNB 4JYCA 1E9DA 4RCZA 3TUJC 4EFMA 4FN5A 2GXSA 2ZRLA 4D82A 4EFNA 1NVVR 1UEIA 3CR7A 2EFDB 1H8HA 4NYMR 1E9RA 1PUIA 3K8YA 5FTMA 1NRJB 2ATXA 3RS0A 3CR8A 3HDTA 2BWJA 2J45A 4M9SA 4M1SA 5CK4A 1N5IA 1Q1ZA 1OFHA 2ZAMA 4R9UC 2FPMA 1TTTA 3AVPA 2P5SA 4LX0A 2A3RA 1GM5A 1R2QA 5FOWA 1R5BA 2FFHA 3C14C 2GEDA 1UJ2A 3MWJA 1T8UA 4B47A 1G3QA 2GJAA 1G3MA 2GBLA 4A1FA 3NDBB 3H86A 1IN5A 5CDFE 2ZI9A 2CJWA 2OILA 4X8HA 2ZRAA 5C2JB 1DAEA 3AP3A 1S96A 4BQSA 4FMBB 2A2ZA 3THXA 3A4LA 1AZSC 1TL7C 2O8EA 2W58A 4MYCA 5DI3B 1W4CA 2QSYA 1RC8A 1UFQA 4DB4A 1FFHA 2XITA 3WRXC 1KDRA 3R7WB 4DXAA 3HPQA 2H8KA 4D80A 4ZDJA 5JRJA 1IM2A 1IN4A 2OLJA 3RC3A 3TQCA 3QY0A 1XEFA 1IHUA 3LQQA 1YZKA 4URYR 2W6IA 4BEJA 3W6NA 5AUNB 5K8UA 2ZS9A 1CR2A 3SJBA 3LVQE 4EPTA 3TIFA 1KI7A 5H1YA 1E69A 1JNYA 2DWPA 2VHCA 1E2JA 4KFRA 3IHLA 2H18A 3QXJA 4P4TA 3SFVA 4Q1CA 3N70A 2QA5A 4KO8A 1RW4A 3Q5DA 4FXPA 2WAXA 4LSGA 3EW9A 4ZI3A 1FPMA 3TKLA 1IBRA 2QTVB 5KSOA 4XVUA 3A1TA 1JB1A 1OKKD 4N1AA 1QZXA 2OBNA 4JJZA 2IA5A 3X1DA 5B30A 1YR6A 1J2JA 4WIAA 1RPZA 4DUGA 4LBZA 3K0AA 1K5GA 1OXXK 1TF5A 1U81A 2AXPA 5SZKB 4XWOA 5CB6A 1SHKA 5JI3E 2V1UA 3EX7C 1P9RA 1II0A 1NVUQ 2FPKA 5TXGA 1DAHA 2ASEA 3EZ2A 4JLNA 2N46A 1XCGB 4B3FX 4Q1DA 5E95A 4LY6A 1AJEA 4TT3A 1DEKA 5DI9A 1MOZA 1SULA 2H57A 4V0OA 1OHHA 1KKLA 4Q9IA 4IRUB 4KSCA 4DSOA 1XCMA 4M1YA 2JDIA 3ADDA 4F38A 2VHQA 5LB2A 2NO9A 1FP6A 1P2VA 5AJXA 3B9QA 3UG6A 2Q3MA 1Z6AA 1W1WA 1EG7A 4DWJA 5HTKA 2HJGA 4HUTA 1CJVC 1ZM3A 1G3IA 1MRSA 2BCJQ 3BXZA 4PQFA 2ANBA 1XPRA 1KAOA 3THYA 3ZZTA 1G19A 4YMSA 4H9GA 4B2IA 3ZIAA 5JSZB 2IHBA 5KNCA 2JJ8A 1UBFA 3JZAA 3D8BA 5KU1A 1XTQA 2HXYA 4NH0A 1DPFA 5K8LA 3MCAA 5JWRA 2ZI4A 2JLRA 1MKYA 4QFMA 3LNCA 4RD6A 1NLYA 1XU4A 3UATA 2WSSD 5EUMA 3Q7QA 2QGNA 1J99A 5G3YA 2C77A 4AD8A 4Z54A 2ZXUA 4V0MA 2ZS7A 3V4FA 3K0FB 4CDGA 5J4VA 1OIXA 2DHRA 2JLYA 1AZTA 4UQOA 1JR3D 4TTRA 2QMOA 5DHFA 1IN7A 3F5FA 3LXRA 2IUTA 3P26A 2OCAA 4Q4JA 4HATA 3W5IA 1DOAA 3OFNA 4HDOB 4Q1EA 1KKMA 2WOJA 4ZDIA 2RGCA 3KXLA 2XOKD 1HE8B 4G0NA 1YZLA 3AGQA 3G0HA 2D2FA 5J4YA 4MRVA 5E7MA 1Z6GA 3AVYA 3A37A 3A4NA 5FI0B 2ZJYA 3KZ1E 3SQWA 4MYUA 3BK7A 3T34A 4HEJA 2QMUA 4V0NA 4B33A 4GT1A 1EWQA 1ODFA 1E2NA 2EYUA 4IDHA 3NWJA 3TNFA 2ZJAA 2GKSA 2FFAA 3GQBA 4JLAA 3AVUA 4RZUA 2FDCA 2R44A 3T35A 2RGBA 4JJKA 3ZZUA 1XDBA 4ZI2A 5GJCA 1X6VA 4K8OA 4YDSA 4A2QA 3GPLA 2A7QA 2UVQA 1S9HA 2PEZA 4IDOA 3U5ZB 3WYFA 3D6TB 2PH1A 1FMLA 3THOA 1NIJA 5FL7D 3SHWA 4C7OA 4WOPA 2BCGY 2DFKB 3O8BA 5AJYA 1U98A 2DFTA 1T9HA 2LKDA 1ZBDA 1E0AA 1KJZA 2H7VA 4P0TA 1G16A 1OFIA 4Z8XA 1JR3E 2OG2A 2WSMA 5LDDC 1VG9B 1N0WA 5TDHA 4HAZA 1COWD 2I1QA 2IC5A 1RJ9A 3HR8A 4PC3A 3CPEA 1GL9B 2XB2A 1N6PA 2R6GA 1D2EA 1MT0A 2HF9A 2GJSA 4YMTA 3SC3A 6Q21A 2C99A 1EWRA 2GCOA 2ZQ5A 4FCVA 4JLOA 2RGDA 2GZHA 1ZRHA 3UWOA 2GVZC 1T91A 2GDJA 2GVDC 4V02A 2CVHA 2DFNA 1KDPA 4A8JB 1JALA 3WP1B 4DLXA 2RGNC 1M2OB 4ZCLA 3T5DA 4QGFA 4DCVA 5JI2E 4G3XA 1SXJC 5A0FA 4HAWA 1JECA 1QVAA 4TMZA 3B2EA 3W5JA 1P9WA 3E70C 4B3BA 4AI6A 4N0EA 3HP1A 4GOKA 4P4SB 1MABA 1SKYE 2DYKA 3MD0A 2EFCB 2HJVA 3ZYCA 2F55A 2RB4A 3ADCA 3KTAA 1A2KC 1HH4A 2C03A 2QQEA 3UMFA 1NI3A 1UKEA 4LYAA 5FOXA 2GJ8A 4EQ6A 4XVRA 2BKEA 1TMKA 4IXNA 3F0TA 2FA9A 4KYUA 3OIYA 4A6PA 2ZRDA 3ZS8A 1KAGA 3EG5A 3DL0A 3EARA 1YR9A 2O8BB 4TLBA 3G5UA 3R9IA 4Q47A 1KI8A 2AWOA 4CEJB 4OI4A 4JIMA 4B43A 4JLJA 4XWAA 1BO6A 4I1VA 3VAAA 2V8OA 2X1VA 3PFIA 1S1CA 4TSFA 2DCUA 2Q0HA 1T8TA 2RGXA 1QHHA 1TF2A 1OYYA 1G9XA 3EIEA 3LDAA 2NPIA 5JECA 4LYFA 4WXRA 2ZIAA 2HT6A 1CR4A 1S3SA 4HLDA 3TRFA 1E2KA 2WJGA 3SBEA 4AYWA 2VF8A 4A2PA 3R9WA 4B6FA 1D6JA 1XMJA 4OQMA 1JJVA 1XD9A 4Q7KA 3CWZA 3SEAA 3KXKA 1GIAA 4DSUA 5BW8A 2KSQA 1P5ZB 3K09A 4P32A 3SU8A 721PA 4Z1MD 5C4MA 4QL3A 3RNLA 1I4LD 2UZIR 2FX3A 4Q4AB 1W49A 2VA8A 3A6PC 1RZ3A 5DE3A 4A15A 4HB3A 3AQ4A 2D3WA 3FTQA 2B6HA 3UK6A 4M22A 3AM1A 3B85A 1K5DA 2QM7A 3BJIC 5KTYA 3AB3A 1KSJA 4XOIA 5JZVA 1Q21A 3SJCA 3PVSA 1Z47A 4HSEA 3PITA 3W90A 4A6XA 3A58B 5L3SA 2DR3A 4PPGA 3KQHA 4RKFA 3V9PA 3ZD7A 1OW3B 3B1YA 2CEAA 4QM6A 1XJQA 4ARZA 1CU1A 4DLVA 3QQ5A 2J41A 3F8TA 4LHXA 3WXMA 2C2HA 1R0YA 1XPUA 3B1VA 2G0NA 4UNRA 4NMMA 4AC9A 4GL2A 2FN4A 1KY3A 2Q9BA 4X8LA 1KI6A 1KK1A 3CO5A 5EZ5A 2H92A 1YHNA 3SOPA 4B73A 5JHHB 2VH5R 4JBWA 5AR1A 4N3NA 2ZRJA 1GSIA 4PPQA 1HE1C 2EVWX 3ZDQA 2C78A 1NSTA 1EXMA 1FX0B 4XTCS 2Q3FA 2QM8A 2Z4SA 1Z8FA 3HWSA 1KI2A 1TUEA 3DOEA 3VR6A 2P65A 3DMNA 2NQ2C 4NCHA 3OEHA 4B74A 1E9CA 2BM1A 2E9SA 2WIAA 4XTRA 1CXZA 2VPPA 3TVTA 3HU1A 1XCPA 4FINA 4KHZA 4LYHA 1JR6A 4C30A 1TQ4A 3GJ8A 3K0SA 1CULC 2IWHA 4RZXA 4BLOA 4A8JC 4ZCMA 1IQPA 3QG1A 5FTNA 2WAYA 4BE7B 1WP9A 4PSAA 2BKUA 2PLRA 4R7ZA 4UNPA 2ORWA 1AIPA 4XSHA 3Q7PA 1DS6A 5ELXA 4G5OA 2NZJA 2ZU0C 3LLUA 4QOSA 2GEVA 2GNOA 4ESVA 4BLQA 4M9QA 3FWYA 1N6OA 3K53A 1SGWA 2QL6A 3U44A 4IOLA 1HT1E 4JL6A 1C4OA 5HE9A 4IJMA 2BJVA 3EPKA 1VIYA 1UBCA 1F2UB 3L0OA 1E0JA 3L0SA 3I3SR 1X8LA 4DDVA 1P2SA 2FPLA 3U4QB 4QRHA 5FPTA 4BFZA 4TQAA 2GESA 3AVVA 1WBBA 4DT1A 2ZTSA 2JIZA 1FMJA 4LHZA 3KB2A 4PSVA 3LD9A 2UKDA 2Q9AA 3Q5EA 4JVSB 3FFAA 4L9WA 4NDZA 1UBEA 4Q9LA 4MKHA 1YVDA 1Z0AA 2WKPA 3H0KA 1F60A 3RWMB 4MYTA 1OKKA 4QBFA 4ASUD 2G1JA 5DO9A 2C04A 2XSZA 2YZ2A 2OT3B 2QE7D 1E1QD 1NKTA 3REGA 3MJHA 1BIFA 2ZVQX 1E3MA 1KMHB 1E6CA 3CF2A 4RY2A 4AG6A 4BEBA 1ZUIA 2RGGA 1Y3AA 1Z07A 3CH4B 2RKOA 3JVVA 2O8CA 1VCMA 5FOUA 3ZZ0A 4DKXA 4IXMA 4ZIRB 2O8FA 5AWFC 2HDNB 2QORA 3TE6A 2GJKA 2ZRMA 4URVR 2EFGA 4Q01A 3GJ0A 1HEIA 5H8WA 3QOFA 4PPNA 2IS2A 1IXZA 1KI4A 1GRNA 4TTQA 2P6RA 4BRUA 5HKKD 1WCV1 3RWOA 3O8DA 3VKGA 4JL5A 2ORVA 4FI3C 3FKSA 3C41J 5GADl 3EPLA 3WP0A 1IY2A 1YE8A 1ZD8A 2IT1A 2QT0A 4DEXA 1FNMA 4M0LA 4B48A 2H17A 2Z0MA 2HLDA 1GNPA 2O0JA 1QF9A 3SJAA 3KKOA 2QEQA 3N2IA 2CHQA 1EESA 2CK3A 2H16A 2WM9B 3RVBA 2OCYC 2YVUA 3FYHA 1KDOA 3GLHA 4KCGA 1P60A 4LJ5A 3O8RA 2JGNA 4JL8A 4PSKA 3KQNA 5F2EA 3PIRA 4QXAA 4PANA 3K9HA 2KB0A 3NH9A 1E4VA 4GMXA 1VDZA 4OI0A 3B13B 5GJBA 2J7PA 1TAGA 4LUCA 2GCNA 1OYWA 5HZHA 4OJQA 1DO2A 3U7FB 1W2GA 4HZUA 3PR1A 4TLEA 2VO1A 4I4LA 1XXHE 1FNNA 2FH5B 621PA 3QBTA 3EC1A 5AUOB 2P3SA 2FZ4A 2QPAA 1G8GA 4HDCA 3C8UA 2HV8A 2VP5A 4XJXA 4HLUA 4WZAE 2OXCA 4GZMA 2FU5C 2AWNA 2QRNA 2XOKA 3QKUA 4I1SA 4LJ4A 5CK5A 1BMFD 4E22A 4M2LA 2C9OA 3AF0A 3EZ7A 4UNQA 4OJKA 1PZNA 1GUAA 1G8FA 1VCNA 2G77B 4FW9A 5J4LA 3GCGA 1DG1G 1JPJA 3AKDA 3W9YA 1F6BA 2W6JD 3ZLJA 3VNUA 1WE2A 1EX7A 2BC9A 1MH1A 2MSDB 1OH6A 2XZPA 3I73A 3CF6R 2CL7X 1OV4A 4MRRA 2VL7A 2CLDX 3SZRA 3UWKA 3BB3A 1E2QA 2QNRA 4M21A 4JZKA 1R0WA 4TMTA 1LS6A 5J47A 2JLZA 2GXUA 2IYVA 4RCYA 2IW3A 1L2TA 2WICA 3LBNA 3OF5A 5FTKA 5CIQA 2P2LA 1SVIA 5FL7A 2CNWD 3EZ9A 5LPNA 1PVOA 2D62A 2IXFA 421PA 2V4ZA 3U3KA 3NBYC 3U2QA 4QC2A 1NY5A 4HUQB 5L3QB 1G8YA 3GFTA 4IDQA 1AN0A 4US0R 1TEVA 1W4BA 5D3MA 2R6DA 3BFXA 4JBXA 4PC6A 2B92A 2VTKA 2H5EA 2FEMA 4DDUA 3BORA 1U8ZA 4RFSA 5IK2D 1IXSB 4NCIA 2RMKA 2ZEJA 3U6KA 4AYXA 3BAFA 2YC4C 4BFVA 2H1LA 5BN3A 4HAYA 1N6IA 4D26A 4JVMA 1C1YA 3BIFA 4LC0A 3L8ZA 4UXIA 1NMZA 4AY2A 3EXAA 4BFUA 1DO0A 3QUSA 1L8QA 3CH5A 3EWAA 3KUCA 4OHYA 2WOOA 3EA5A 1NJFA 1UKYA 3BB4A 3AKYA 2GHIA 1MV5A 4LRWA 3QEOA 2IYLD 1S3GA 3EZ6A 1NY6A 2A5GA 4JLDA 4TLAA 5AUPB 5L8VA 3WY9A 4ERNA 4OQLA 3VMFA 3K70C 1ZCBA 3GLIB 3AV0B 4CZ2A 4ZDWA 1IJEA 2WV9A 2FFBA 5L3RA 4ZO4A 1Z6TA 1V5WA 2FNAA 3CRMA 5EP4A 4M9ZA 1R8SA 1CRQA 1IONA 1YU9A 3BRWD 1NMXA 2OCPA 3QSYA 5KO2A 4NYJR 5FPHA 1W0KA 2AL7A 2QG6A 2VP4A 3GLIE 1GDDA 1SKQA 4CIDA 1E2HA 2IK8A 3LFUA 3CKLA 4MA4A 2CLCX 3IHWA 2F1RA 3CX7A 4TMVA 3OE7D 3P32A 4NCJA 3P1JA 4KI0A 3S1AB 4L9SA 2IS1A 4AWXA 5CJPA 1Z6YA 1W4AA 2CE7A 4BFYA 1XEXA 1FW6A 1Q3HA 1M34E 1XD8A 1TUIA 2G3YA 2OXRA 2IHYA 2J3EA 3KB1A 5TMPA 3AEZA 3I72A 3LLMA 2ODNA 2CCGA 1J7KA 4N0DA 5KSZA 5FBLB 1KIMA 4TZ0A 3B8HA 2J7KA 4URZR 2YOGA 4PHFA 1L7VC 221PA 3IBGA 2ZSAA 4X8MA 2BV3A 3QJYA 2BDTA 1QHYA 2B21A 4IVRA 1HQCA 1U9IC 1FUKA 1NVWQ 4A0FA 4DB2A 3LX8A 1WQ1R 4NHOA 1AKEA 4Q00A 1II8B 1SXJD 2ZSEA 2KJQA 4V0LA 1ZNWA 5CJ2A 1MRNA 2PCLA 2QQ0A 4Z1MA 1RFLA 4QG7A 1YQTA 4PO9A 3U61B 4BLSA 3T1TA 1SVWA 1KZGB 4DCSA 2E1RA 1E99A 2ZI7A 3KFXA 3OIVA 2IBMA 5JWHA 4UKDA 5DIFA 4LI0A 2DY1A 1X1SA 1Z08A 4W7SA 4Q4HB 1AA9A 1NN0A 4L4UA 4TN1A 1CJTC 4KBFA 2NIPA 4BZPA 3QE0A 2W2TA 1E98A 3KFVA 4WVFA 2V1XA 1YZNA 5HZKA 2ECKA 3BBPA 4GRAA 4XSGA 3ETLA 1E2MA 4C0LA 3SNHA 3ZVMA 2PJRA 4TMWA 4B35A 4QKQA 1B0UA 2ZE5A 3QF4B 1ESNA 1XEWY 1ZUNB 3ND8A 1E9SA 1QVRA 1G7TA 3EAQA 2XNDD 1JBKA 1YZQA 2P6UA 1JQLB 1II9A 1KGDA 4TLDA 1GVNB 1BYUA 4BGDA 5H68A 1E9AA 2OEPA 1Z0KA 5E7JA 3BE4A 2X2FA 3RS3A 2Q6TA 3MWKA 4HAXA 2J0UB 1SXJB 1T5LA 2QRZA 3BFVA 4A0RA 1ZC3A 2F9MA 3G82C 4M9XA 4OKSA 5JRZA 4EUNA 2QENA 2ZUDA 2Z6VA 1SXJE 2FGJA 4D4MA 2I1VB 4D81A 2CL6X 2WHXA 2MSEB 4PAMA 5A4JA 1M7HA 3LQRA 5JWOA 2AHOA 2W2VA 3M6AA 5KSYA 4LC1A 4NCKA 1KI9A 3QBVA 3DZ8A 4A2WA 1W48A 1SVKA 1MO5A 2EU8A 2WVJA 2GAAA 3VKWA 1Q3TA 1XWIA 3P4XA 3PEUA 3ONWA 3NC1C 1OXVA 1P9NA 1SHZA 3Q9LA 4DCUA 4BZXA 4ZV4A 5GVRA 5CYOA 3TAHA 3D31A 1PLKA 1D9XA 3NDPA 2OLKA 3KKPA 1EFUA 2OAP1 4PHHA 1AK2A 4A82A 1NF3A 2D74A 4H1VA 2IXEA 2F43A 5FBWB 4BWYA 2CMKA 1GAJA 1GRQA 4ZDKA 3CX6A 3EC2A 2GF9A 3ND9A 2XXAA 3QENA 1F5NA 1OB2A 2XJ9A 3I1FA 4LV8B 2WIBA 4RD2A 1G8PA 1ZW6A 1XZQA 3QF7A 4FWTA 4DLWA 1ZM7A 4S2EA 3QKRA 2PBRA 4OQFA 1LW7A 3RAPR 3WMEA 3HPRA 3P20A 2IF2A 2P67A 2BMEA 5BYKA 1E1QA 3NEJA 1XXHA 3GLGB 4EKDA 2REOA 4A4DA 2C9CA 1D2NA 4RD4A 1YZTA 1W7AA 3QEJA 2NO1A 4KVAA 4BECA 3MGCA 3B9PA 1PLLA 2ODEA 1PJRA 3OAAD 4AKEA 4MRSA 3RANA 2JLSA 2WJVA 4B3XA 4QNRA 2WJHA 1KSFX 4TMXA 4G5RA 5HPYB 5DGXA 2A30A 3QI2A 3GEHA 3LW8A 4IOKA 4KODA 3F3YA 3X1ZA 2HF8A 1X3SA 1U2RA 2QAGB 3MRSA 4PO1A 3RS4A 4MKFA 3EA0A 2ZROA 1CP2A 3KJHA 1ZIOA 2YHSA 2PX0A 3VHLB 4QBGB 3WMGA 4G1UC 3BOSA 4M1OA 4FWIB 3BB1A 1W46A 4II7A 5E4FA 5TVKA 2EW1A 3R20A 4GNKA 4RJLA 3VU9B 1ZC4A 5TV2A 1NNEA 1M8PA 1AGPA 2PZFA 1FQJA 4S35A 5G3ZA 1PLJA 2HUPA 2ZJ8A 2G9NA 3K70B 3M1IA 1E1RD 1NMYA 1T3HA 2F9LA 3IBYA 3L43A 4AKHA 3X1WA 4GDFA 2J0VA 3FMOB 1VKJA 1OXUA 3NEYA 5JHGB 2O8DB 3TSOA 3OIWA 1P2TA 2V6JA 1OFUX 4HB0A 1N25A 1Z2CA 2ERXA 3K0CA 4LK2A 4YDHB 4EPYA 1ZMXA 1KO4A 1FTSA 3CPHA 2OESA 3CRW1 1RIFA 1GKYA 5GJWC 4HYYA 3KUDA 1VG8A 4X8OA 3JZMA 3U3OA 3AP1A 3R8CA 2JJ1D 2ZPTX 4XD7D 2R6FA 4UXHA 5F9HA 3LV8A 4KYIB 5EE1A 1KTVA 4CEIB 3QKSA 3U3RA 4GI7A 3RS5A 4JLPA 2RGAA 4QGHA 3LVRE 1VYVA 1P6XA 2GILA 3PV0A 2GK7A 1X8JA 2FSGA 5BN5A 3QVVA 3T12A 4C9BA 4GOJA 3SYLA 5FBVB 3RRNA 1US8A 4UJ5A 1BH2A 4M4SA 3TBKA 4XH9B 1HQYE 1Z0FA 3QXXA 1T4GA 3IGFA 1Z3IX 3EIQA 4HDQB 3T06B 3SN6A 2GEUA 4Q03A 8OHMA 4IKEA 2VBCA 4LWZA 4JVLA 4EJSB 4Q9HA 2VYFA 2ZANA 2ZJ2A 1XD2B 4LJ9A 4PPFA 4WZBE 3KJIA 2IS4A 1YJ5A 2PMDA 1E9BA 1RYFA 4MRNA 4D0NA 4HB4A 4NYIQ 3IEUA 3L8YA 2EYQA 2CNWA 3RS7A 4DIDA 3ADBA 2RGEA 1N5LA 2XB4A 3K9GA 3H84A 4IFEA 4Q7LA 3B5JA 1W47A 1NLFA 4TTPA 2YYZA 1S4QA 3GJ4A 3THWB 1F3OA 4LJ6A 5TB5A 3U7HB 2BMFA 3TR0A 3VR5A 3TAUA 3R9XA 3CF0A 2QZ4A 3LW7A 2ZRPA 3GLFB 1HYQA 1N6LA 3RLFA 2TMKA 4AK9A 4A0GA 4KLZA 1AS0A 2AN9A 2BOVA 1BS1A 5CITA 2NO7A 1E32A 5CDFA 1JQJC 2ZREA 2ZRKA 4C0KA 3R8FA 4JT4A 3TUZC 5JJLA 2ZJBA 2V7QD 4ZKDA 4GP6A 5DYIA 1QRAA 2PLFA 4ZCIA 1G1MA 1PV4A 2QTFA 2QBYB 4OI2A 5SZIA 4EPVA 1GFIA 2GCPA 3CNLA 3T5GA 4DIEA 3PG5A 3TSZA 5C46F 4LPKA 4BFTA 4Q1BA 5DHAA 5JSZA 4UNNA 4HLCA 4RSGA 4B32A 1TADA 1CLUA 5DI3A 521PA 1DELA 2BM0A 2QAGC 2NG1A 3Q8XB 3NHBA 2JASA 3R7WA 4Z8YA 3IQXA 1RRCA 4ZPXA 5GVSA 1XTIA 4IEEA 2FSIA 1XMVA 4AURA 5EE3A 3WNCA 1U90A 1ZM4A 3HYRA 1KSHA 4FCWA 1G41A 4ACBA 4NTZA 2F3TA 1DBSA 1GP2A 1G6OA 4JLBA 2C5LA 3FE2A 4Q4LA 1YRAA 2D7DA 3WBKA 4TL9A 4F92B 4M1TA 4WBSA 2CJWB 3LRPA 3WNBA 1DAIA 2J1LA 1DAMA 3AVOA 1A2BA 1Q44A 2ZYTX 3DDCA 5ANRB 1J90A 3ASZA 3WYGA 5M04A 3CUEF 1WDTA 2AR7A 3AH8A 4KAXA 2IYYA 2YNMA 3THXB 1OH5A 2O8EB 5B2ZA 2OAQ1 1TNDA 2GZDA 1RRGA 2ZITA 1VCOA 4PFSA 3TW4A 1M6NA 1NG9A 4TL7A 1Z5ZA 2GTPA 2XEXA 2ZRBA 2ZSFA 3GEIA 1A4RA 4UXJA 4DDTA 2KE5A 1G7SA 4FMDF 1OHHD 3AKEA 3NXSA 2DBYA 2ODBA 5KPJA 4Q48A 4V03A 3VHXA 1E0KA 1M7GA 1U99A 2WJYA 4TYPA 1VYTA 4RVCA 4M1KA 5CYPA 3B78A 3I8XA 2HYDA 2V3CC 4B2PA 1OXTA 2IYRA 2MMCA 3SDZA 3LA6A 2RHDA 5BYJA 1N6RA 1E79D 5FTJA 3HJNA 3ZH9B 4MRPA 3RHFA 2AD1A 1EFCA 4R2IA 2V54A 3WYAA 3ZQ6A 1OSNA 3CPJB 3ZIAD 121PA 2EFHB 4Q9JA 1Q1EA 1YR7A 5UKDA 5FR1A 2JLWA 2X2EA 1WB9A 1UEJA 4IFBA 2ZJOA 5EZ6B 3IKJA 4EPWA 3K0AB 3GD7A 3ECCA 1EFRD 4OYHA 4DDWA 1TEXA 3FMIA 4LV5B 3KXIA 2ZUBA 4NL4H 1SVOA 4EJSC 4YXWD 5FUXA 5KSPA 1JI0A 2F3RA 2PZGA 4G01B 1OFTA 4LHVA 1JAHA 3IIKA 4I99A 1G3UA 2NTYC 4L16A 4MUBA 3AVWA 3CX8A 3MWYW 2JCSA 2Q9CA 2R9VA 4PTLA 5EUQB 1Y63A 5FI1B 4PC2A 4YLGA 2IYUA 1Q1BA 2G0TA 2ZR7A 3CRQA 4M8NE 1ZVQA 3E5HA 3K0FA 4B34A 1LS1A 4BUJA 1LV7A 1XBTA 2F1JA 2XX3A 5E3HA 2OSBA 1H8ED 2XNSA 2XTNA 2BEJA 3EPJA 3LX5A 1R5OA 4C0BA 4R71A 5JBQA 1G3RA 1T3LA 1Z6XA 2Y8EA 3ADKA 3M0EA 1A5TA 1RRFA 4U02A 1IN6A 1NVVQ 1VECA 1W44A 1ZD9A 2K5UA 5DNYB 3THYB 2FV8A 2PJZA 4PZYA 3ICEA 5FH9A 1S8FA 4Q7JB 3TLXA 1L4YA 1W2HA 1ZUHA 2XTZA 1P4SA 4JS0A 4P33A 1LF0A 2OFWA 2VHJA 3RC8A 1YKSA 4J0QA 1R4AA 3OEED 2JJ2D 2OV2A 1TQ6A 3AF1A 3BGWA 4M53A 2NGRA 4WW0A 3T1OA 3A1UA 4OQXA 3VQTA 4OK5A 3RABA 1P2UA 2KWIA 1VHTA 4B44A 1ONBA 3ZVNA 2FJUA 3FOZA 2I3BA 4C0SA 1KNXA 1ZD1A 3REFA 2ANCA 2OZEA 4OK3A 4WAUA 4R2HA 5H70A 4DHEA 4DLSA 2VSFA 1DAKA 4NP6A 1UKZA 2R62A 4DLYA 1IAQA 1ZNYA 4Q4JB 5KOYA 4O25A 2WSSA 4CYMA 4L5BA 1Q12A 1KMQA 2IYXA 3E1SA 3QKRB 5A5GA 2BBTA 1JR3A 2VRWA 5AJVB 3KQKA 4GSYA 4W5HA 3GMTA 2V6IA 2Z83A 2ZRHA 3FKQA 1UPTA 1XJCA 2GBLC 4CT4B 4YQFA 2WWIA 3PUYA 1E2DA 3CWQA 4C4PA 3PENA 4ABYA 2ORIA 4D4LA 3HU2A 2RHMA 2QT1A 4UJ3A 3HR7A 3DPUA 2B8WA 3ZVLA 5TY0A 2WTUA 4AG5A 3Q72A 3TH5A 1U8AA 2WWWA 3JVUA 3Q85A 4Q66C 4F7WA 1B23P 3I92A 3DVLA 4PC7A 1N6KA 4E5UA 1X8KA 3DEFA 4US1R 2ZI5A 5BQ5A 5BWMA 2NO0A 4LGMA 1NN3A 4JVNA 1XTSA 2P5TB 3OAAA 2EWVA 4OK6A 3SJZA 2GAOA 1I4TD 4OHVA 1FZQA 1Z83A 2CBZA 4HB2A 4PAQA 5DSZA 4YONB 3VR4A 2R8RA 4A8JA 3ZGXA 4C7OB 2VSXA 2J0QA 3KL4A 1AS2A 2BBWA 1KZ7B 3CONA 4LJAA 2WWXA 4GFDA 5TARA 1IY1A 3MFYA 3U60B 4Q18A 4P4SA 1SVMA 3KKNA 3Q3JB 5JCPA 5EJEA 2GRJA 1KNQA 2YINC 4POAA 4I1UA 5JS7A 1RJ9B 2EWWA 3DZDA 3I61A 2DWQA 3QXSA 1A82A 1IY0A 4BASA 1CBUA 2J46A 1DTSA 2FEOA 4WZ6A 3RYTC 2BEKA 2GCOB 3KQUA 1COWA 2O8BA 3VR2A 2ZUCA 1E1RA 821PA 4CEJA 2CCJA 1T5IA 2XJ4A 4YC7A 3SR0A 4L15A 1QG2A 5KHOC 4F4JA 1KI3A 3W3ZB 1CIPA 1G291 3AP2A 2QPOA 3V00A 2WJJA 2AX4A 1R5NA 2YWGA 4LYJA 2YOHA 1NIPA 2VSOA 4MH0R 5AJWA 1NN1A 1D9ZA 1XEWX 3WRYC 1U0LA 4XVQA 1L4UA
chains in the Genus database with same CATH superfamily
3PCXA 3USCS 4D4IA 1IVSA 2OGZA 1J8MF 2FWRA 1M2WA 2IHKA 3MSCA 4FIDA 1GL7A 1K6MA 5HFNA 4QJBA 1RHKA 2FEWB 2IYNA 5GJVC 5A2GA 3ETDA 1IOWA 4XCXA 1QU3A 5LP1A 2C20A 2RIPA 4NKRA 2VT3A 5MN4A 3U3JA 2J0SA 5EWLB 2IU0A 4RIHA 2FTKE 3NXKA 2PR2A 4G9GA 1LJUA 2UZAA 3GU3A 3WQRA 1UZLA 2MSLA 5HM8A 4UPVA 1JEDA 1PGJA 2II6A 4Q05A 3O26A 2JLQA 2YV3A 3K1AA 4Q4AA 2XCOA 3G8YA 1T3SA 1Z3CA 3A10A 3W8NA 5TVGA 3ZY6A 1FP4A 4AN4A 1ZK1A 4FEAA 1RP1A 3ZHBA 5HZMA 3M4YA 4X7RA 1H4QA 3H5RA 3OZSA 5JFOA 1P61B 2I2WA 2ZU6A 1I7PA 1V6CA 3QOWA 4F72A 3EFEA 3L7BA 3VVBA 5CIYA 2RH5A 1SVUA 2LW7A 3RAGA 3GFSA 5E1MA 3VYUB 1LBHA 3I01A 1B2RA 2OGSA 3LIPA 3W8RA 2BVNA 1AV6A 2CXXA 2JW5A 3R5TA 4YMGA 1QCDA 3LOPA 1OIWA 4X1OA 1ULZA 3EPHA 2X13A 3FHTA 3OLVA 4XFKA 2XT9A 4JROA 5GZ1A 4PCVA 2AJ8A 3LOQA 5KX5B 2OO7A 5K20A 1MXHA 4R8MA 5K8TA 4GR9A 2QRQA 5B58T 3NMUF 4HYTA 4PEVA 1UIMA 5I8ZA 2X8WA 4LOJA 4ZYYA 1QIHA 3B7GA 5CDHA 1NZFA 2BFMA 1DC5A 3AF2A 3ZIDA 1C30B 2OHFA 3AHJA 2FUNB 4NU0A 4RNCA 4TTAA 5TPZD 1BYIA 1HYGA 1TCBA 3W6OA 1QK3A 1NR7A 1Y7IA 3ELWA 3GA0A 2YWHA 1FX0A 4MRAA 4BU0A 2V7QA 1LSSA 5F98A 3TLMA 4HWOA 2J59A 3T3IA 4ZC8A 3G0DA 4MLCA 4OPMA 1GCOA 1P5JA 5EL0A 3ZQJA 6REQB 3AVQA 1TPZA 2JL1A 1YRLA 2ZK7A 4R7TA 1KAMA 1T1EA 2NWQA 3KVNA 3OPYI 5ALRA 4C4ZA 4EB8A 2SHKA 4Q6BA 6NULA 1G17A 3F96A 1R10A 3F2IA 3L7DA 4UM9D 1PDVA 2BCEA 4W5RA 3OJCA 3MIZA 4D46A 2R6CA 4TUYA 3MHTA 3KOZA 3LKBA 2MR5A 3MB8A 4DV4B 3CIOA 1MBZA 4PX9A 2WRZA 4CTNA 4BZQA 1V4BA 4WMLA 3C4QA 4JSYA 2HUNA 3L77A 4JKYA 3EHEA 4UBMA 4L8LA 5LUAA 3BWEA 4JSRA 4W99A 5KVQA 1MC1A 1T35A 1YAHA 2NYRA 3U4AA 4BQEA 2XBMA 4MS4A 1JHVA 5L7TA 3ER6A 3KIPA 2FMXA 3B1KA 4NS1A 4QGGA 1K7FB 3RC9A 4BX2A 3AF3A 4O4LB 4EX6A 4MW9A 5CVUA 1TW2A 3PC8A 3FWNA 4NG4A 4D8XA 1MOPA 4DWVA 2HRBA 3I6YA 3PC6A 3RSLA 5KTNA 4RETA 3RIYA 2VPWA 2PQMA 2JHCA 1XRSB 5GQSA 1ZM9A 1JPUA 4CODB 2FSPA 3MTAA 2NPFA 2GTIA 3JQCA 1E6LA 4EUEA 5LOVF 4GWLA 4NR0A 1F06A 3SPXA 3UMCA 4AU1A 4XA8A 1IN8A 4YJ3A 3SC4A 3MT9A 4JYZA 1JFSA 2CB0A 1TMYA 2BJHA 2JARA 2VQSA 1R6TA 4XM1A 3RVLA 3UA3A 3BGDA 4ESHA 3DNMA 5JTTA 4XX0B 3KQLA 3UMYA 2WPNA 1P0CA 1FMCA 1QMGA 2V6FA 3LCJA 1UP4A 4CIAA 3CLSD 4ARBA 4EA6A 1RQPA 2EQ5A 2WU3A 3OD1A 2OUKA 3BGIA 3R41A 1XX6A 2VHXA 1Y3HA 1WPXA 2OHGA 3DBRB 3NYIA 5IC5A 2ZRIA 4NSNA 4L8GA 4KWTA 4RQBA 4TV8F 5DM2A 3T0FA 2OZVA 2W00A 2IZ7A 3FR7A 1M2FA 3ZY5A 1YI8A 3UUFA 5LLDA 5IAKA 1PP4A 2XQJA 1WZCA 3P2JA 4LEIA 3RGWS 1Y8CA 3VJLA 3HG7A 3FTFA 3IE0A 2YJ6A 1NXTA 3FKSD 3X2SA 4D25A 5J2TF 4E88A 1MB9A 4P38A 1F2TA 2FG7C 2OV8A 3HSKA 4J0KA 1E79A 3AUTA 2LUOA 1UBLS 5DX0A 4I6EA 3K20A 4WL0A 3SQOA 2ZYUX 3EFBA 5GIOE 1C2YA 4AZ3A 3KT3A 2GJ9A 1DCTA 2IKQA 4TSRA 2C7VA 1AHHA 4OSEA 1ECBA 2M6RA 1W9MA 2B4AA 4Q21A 4RF2A 3VOAA 2ZSBA 5A9SA 3LC0A 2F3SA 3NASA 5GOZA 3B5IA 1X7YA 2ZETA 1QYIA 3JWEA 1ZI6A 3RYCB 3W7VA 4CVNA 1HRDA 4WBXC 3KOUA 3FDIA 3RBAA 4M0UA 1FBNA 1R4ZA 2AKAB 3DKVA 1FYWA 1MO3A 3FVQA 4IG4A 1AKRA 4MJXA 5DH9A 4G1MB 2R7MA 3LK7A 3L0PA 5ECGC 4YUZA 3C5CA 2Q3EA 5IG2A 1EFPB 3N28A 4KNYA 3H3JA 2QE7A 3MMPA 5ICFA 3N2NA 4F6RB 2C5SA 2F1IA 3T5BA 3ITKA 3LPMA 4LXYA 1U9CA 2IZZA 4C01A 3CF4A 2VP6A 4GZ3A 2B7CA 1LSOA 3FMFA 3QVXA 3LF1A 2QTTA 1PR0A 3CLKA 4TWJA 5BSUA 2XIQA 2BRUA 2QP3A 1P62B 1RQNA 1GTRA 3A9CA 2JRCA 1A5SB 3I04A 3PD0A 5AVUA 2CZGA 4KAJA 1E3WB 1P4JA 3BHMA 3MPOA 4IIJB 3HVJA 1A4UA 3OM8A 3IILA 3LO5A 4WRRA 2I3DA 4H3VA 1U9IA 4PZUA 3AYZB 1ZFNA 4DZZA 3ENKA 3M49A 5AJHA 3RU2A 4B2LA 2C7OA 5E2BA 2QTNA 3GLHB 1HFEL 1ORRA 5DRYA 2BBOA 4BQOA 3KVRA 1T43A 1WKBA 1XVVA 4BRSA 4D3XA 1IIRA 1GL6A 2O2XA 3DO6A 4OBXA 4O4JB 1VIAA 4PR0A 1WDLA 2A9KA 3ZS9A 1YR1A 5EI5A 4BMPB 3UMRA 3PGLA 1YKFA 3IDZA 4EY6A 5SY6A 5I7VA 4CQMA 4CMHA 1E3QA 3C5VA 3P0JA 4WQMA 4TKLA 4XIGS 5CA0A 1JPNA 4UAJA 2PO5A 5ICGA 1G8JA 2XE7A 4E2FA 4RMIA 2RCNA 4XR4A 2QP9X 1Y4ZA 4UZFA 4KDEA 4X60A 2ZB3A 4D3ZA 2DWUA 3ITNA 4DLZA 4E1BA 5EZQA 1Q5PA 4M0EA 3SZMA 1E18A 3MT8A 3KT8A 1NFRA 4FX2A 1ZD4A 5AKEA 3E9CA 1EHIA 3RVMA 4H6WA 4P54A 4B7UA 1OZFA 2B2CA 5FUWA 3PVZA 2QMHA 3NV7A 2PUJA 4YRQA 1CVLA 2AI1A 3OSUA 2LXNA 1TX4B 4EAAA 2QY9A 4HPJB 4N5NA 1KDTA 4XUEA 1ZH0A 3VPAA 2G40A 2ZT7A 4P4LA 1F1BA 1Q95A 1P2GA 2CLIB 4L02A 3OZTA 3JS5A 2IEYA 2QQ5A 3FMGA 4MS1B 4OCZA 1E4EB 2F1OA 4MGYR 5AK5A 4CKWB 4JLVA 3K15A 5E38A 3BN3A 3QHAA 5L3ZA 1JA9A 2EZTA 3QI7A 4B6EA 1YRWA 5EJGA 4D9CA 5AMXA 2P68A 4YRLA 1G0OA 4HUQA 1VBKA 1UT8A 3RJ5A 1M74A 2XV1A 1P7VA 1KVSA 2J4DA 3STTA 1OH8A 1KEUA 5H4HA 1VG1A 1LFDB 1PSDA 3FH0A 3OT4A 1B8UA 4HN4B 1FP1D 4V0KA 5T57A 1VMAA 5JR3A 4ZJUA 4MDFA 3FZYA 1CQIB 1JL3A 2PR7A 5KQLA 2GWRA 1Y3FE 2J3LA 2AXEA 4H7HA 4WINA 1KRXA 3O84A 3MJVA 5J2UF 3N0VA 3CM0A 5FWNA 1CE8A 1DC6A 1RI2A 2XF8A 3JQ8A 2YQZA 3PIIA 1NI4B 1CYDA 4NS4A 1RYNA 4O2RA 2X5NA 3WRWA 3EFHA 4B75A 5F2NA 1I36A 1JIUA 2F3QA 3ASYA 3L4JA 1YQQA 2PE5A 4OHXA 4H6PA 1M2NA 4BATA 4ON9A 4PQYA 1QKKA 5HJEA 1F1JA 1OXBB 5KUTA 1O87A 1Q77A 3L6UA 3D6HA 5LDGA 3FYTA 2V7UA 2K6GA 5CLLA 2WJIA 3WFJA 2ONKA 2XTMA 4EB6A 1QBKC 5HUQA 4CM8A 2OV3A 2REBA 1Y1PA 3JCZA 3PQFA 3TCXB 4TRRA 2H4YA 2N47A 1PSZA 3HEMA 3QIAA 4KITB 5IKPA 4MKXA 3RPEA 2CYCA 3DZJA 4W5NA 3KV1A 4ZA2A 1XZJA 2CSUA 1H8HD 4O2AA 4FQ8A 4AQDA 2MSCB 4G37A 3AFGA 3EB9A 3ACCA 1EX1A 4UNSA 1HLGA 1CFZA 5JFGA 4U8HA 2ZB8A 1XWFA 5D3MB 2BFBB 2ZPUA 1EP9A 4RMHA 3T95A 4EW2A 1G6HA 1JDTA 3I28A 1JQEA 5DTIA 5EHIA 4F9TA 5AI4A 3ZBQA 1Y6FA 2I9PA 4ROTA 3DQPA 1NBME 1T5BA 2OV1A 5JAQA 1LQTA 2J9YB 2Y77A 1J33A 2HMAA 3HBMA 3HBAA 2UU9B 1QO0A 1MCZA 1NBWB 3K8ZA 3D59A 4REQA 2BPOA 4UDOA 4YK7A 2WWHA 4XPZA 4EZIA 4MZXA 2P30A 1GJRA 1E9EA 2RK6A 4Z0TA 2Z1MA 1ORIA 2ZUSA 1NXXA 2AW5A 1JSXA 1R9NA 3FJ1A 4K9NA 3RE1A 5AVRA 1RXWA 2FPGA 1VJRA 1RJEA 2WE8A 2Z2KA 3RSCA 1PF7E 1N2BA 3Q5GA 2YIDA 5IK2A 3ESAA 3NONA 5ISMA 3MB5A 5EXSA 1RWBA 3T7JA 1JHYA 2J87A 2PKQP 4TYWA 3CNEA 4K0RA 3UFXB 5I7WA 3RJTA 1XOIA 4R98A 4IV0A 4ZJPA 4HWTA 5LZ4A 4AJ2A 3T1QA 2IUEA 1E6EA 2IIBA 3NALA 1OPXA 4QHYA 3K5PA 3CCCA 1T4BA 3HB4X 4MR8A 4F91B 3QLTA 4QPZA 3EH1A 4IH4A 1PEKE 2JJYA 3I76A 3R0QA 4PGGA 1JN0A 3A1WA 2Q1XA 4B4KA 2AE1A 2UVPB 3TJZA 3ILVA 3PHGA 3CSDA 4MVJG 1KU6A 1T26A 2PSSA 2N0SA 2YWEA 3A9TA 1ISHA 4JY7A 1FPQA 2W6ID 1VIVA 2C2MA 2QL7A 1FSGA 3BD9A 3KUXA 3VSEA 2WP0A 3K1AB 3UJ3X 1PG5A 1W4RA 5IFLA 4NPAA 2Y05A 1UBNA 1KMIY 1WY5A 1II8A 1IOZA 1RCTE 1VIDA 3INTA 4FMCB 1J8YF 3C3AA 1WO8A 4CF3A 5CVTA 2Q0SA 1GYQA 2VDRB 2WHPB 3GFQA 4TQ9A 1C9DB 5IYZB 4BPBA 4AJ9A 2ZRNA 2YWCA 5EVCA 1RQ2A 5CDTA 2Z5FA 2WKRA 3EGXA 5HF9A 1CJUC 3TKAA 1N9GB 2GBFA 2KBFA 2V7GA 3GXBA 1QKJA 3GEEA 5HCIA 3DSRA 4DMGA 1JRLA 1D6MA 3MGKA 3WLPA 2XWSA 2BFFB 1Z29A 2AFHA 4K46A 1PT5A 1QCCA 5IZCC 1NSYA 1YCGA 5D3QA 1S5PA 4BMDA 1IZ0A 3LPDA 1E96A 4RK1A 3RTBA 3N7AA 1QIEA 2ZYAA 4NBLA 3PQCA 3I9FA 2MHCA 3ZWAA 5C1BA 3VSBA 4EG1A 2I4NA 4WD3A 1UF9A 3FWKA 1FYDA 3A6GA 5ALTA 3VPHA 3VNVA 3ILSA 4GQIA 1DWUA 1CB7A 2AK2A 2I1WA 2LKCA 2WABA 2W71A 3CUUA 5LA6F 2ZCUA 2QRKA 3NWPA 4HN9A 4QBTA 2NU9B 4YT4A 5JV5A 5JBNA 2N42A 3SMQA 3HHPA 1A4XA 2FR8C 3BICA 3GHHA 3MOGA 2D1QA 2JDID 1ZINA 2POQX 1R8QA 3C70A 3EYAA 4KU4A 4LDZA 9ATCA 2VWQA 4QODA 5CBPA 4OIMA 1KI1A 4LOKA 5TQ0A 3T5CA 3P7MA 1ZIPA 3SLRA 2J0UA 1SXJA 1VE5A 4DABA 3VA7A 1RKBA 1ESDA 4BQRA 1F5SA 1D8AA 2FPPA 1UIRA 2G6BA 3O82A 1YNOA 4BKOA 2QTGA 1S02A 4YRFA 4LF7B 1I4DD 3C7CB 4WKPA 4G2TA 4WY2A 1ZJ6A 3O3MB 4L57A 2GA8A 4JSTA 4N65A 2P9JA 5LIPA 2R8XA 4EHJA 1JQBA 1KYWA 4GGPA 4IUYA 4XW2A 4JXKA 4KN8A 5CT9A 3K9LA 4RCVA 1JMVA 1VTKA 2Q21A 1FFBA 2JGEA 3JQGA 4XQGA 1X1EA 3IUQA 5CGQB 3HCAA 2GX6A 2G67A 4ZZ1A 2FW6A 3DBHB 2H4FA 1TAHA 3NC0C 2YRFA 1QYXA 2H1IA 3GMIA 3VDNB 3N0RA 1ZL0A 1XTPA 3NG1A 4GBGA 2GPWA 4FDTA 4QU9A 2IYWA 3EVCA 1VRCA 4YACA 1EUDA 5ELMA 1XMQB 2X40A 1T0JB 1LPMA 2J30A 1ZMOA 2WC1A 1VL6A 3OJWA 3ANLA 4NE2A 4YUYA 1VCIA 3GFFA 3L7KA 4M49A 2JLBA 3ZDCA 5JXIA 1WHTA 3PNPA 2AFIE 2VJDA 4A92A 1XVLA 3I37X 2VSYA 2LD4A 4A73A 1KZ1A 1MO6A 4HDKB 1EVLA 1DKUA 1M2JA 3CT6A 5J9FA 2GZSA 1T2EA 3T7CA 3U7IA 4B3DA 1JLMA 1UC8A 3EZFA 4R5MA 3X1XA 1DKLA 4NMLA 3OOSA 5BVGA 4HDMA 4KGZA 4U7JA 3GNSA 4MUAA 1SOUA 2VKTA 3AU9A 3QHQA 3V6MA 1AQYA 1C9MA 1PJAA 2HU5A 1P8AA 3QMPA 1BQ3A 4RVHA 5F73A 4IR7A 2XUJA 2ODTX 4DCGA 4KL8S 2IL1A 4JKIA 2EW8A 3D0KA 5KWIA 1AXEA 1HZJA 1EK0A 3HDQA 1CHDA 3D3WB 3OZXA 4MEBA 4KC0A 5D7BA 1QCZA 4KYVA 5ER6A 1QQBA 3A9UA 1DP4A 1I2MA 3C7KA 3I8OA 4GQBA 5JDIA 1F2TB 1DBPA 3PUWA 3TF5A 3AIKA 3OCUA 5K0SA 2A14A 2NX2A 3ZI4A 1K7CA 3MJFA 3UK1A 3BSWA 1DGQA 3IJEB 4PSUA 3DAGA 3RSGA 1QDUA 3UC9A 4WLNA 5FBRB 3W6PA 4E3ZA 1CUJA 3IUYA 3G02A 3KJEA 3KX2A 5KYGA 2F43B 3B2NA 4GKBA 3ITDA 1NNLA 2EJCA 1XCOA 4D9MA 3HDJA 1Q20A 3NIBA 4FFMA 5K8CA 5IUKC 3ZCVA 3OHMA 5CNMA 4QZVA 2X7JA 3EUEA 1X7GA 4ZK2A 2MYUA 4QJ5A 3HYLA 4DBLC 4DEYA 3FSRA 4BMVA 2Y67A 4IDAA 2YFYA 4C4XA 1UC9A 3KFLA 3NH6A 3TJRA 5HQJA 5ICCA 1Q2UA 1L4KA 4FUTA 2JH9A 2CZQA 1AXRA 5AJZA 1TTHA 4PHGA 1N1DA 2DUJA 2I3GA 3H1PA 2XW6A 3GCDA 1TB4A 3TNLA 2KYRA 3ZLTA 2CZCA 1N9KA 4YRMA 1IU9A 4BX3A 4MGIR 4RQTA 4BS9A 1FTQA 1QHXA 2W2KB 1FL9A 4KVZA 4Y30A 1BW9B 4C0HA 3OUTA 1SCUA 3WB2A 1VXOA 4QDJA 4G24A 1PNRA 3MUOA 2UYOA 3BQNB 5D3KA 2H08A 1T3TA 4LXXA 4V0RA 3W2TA 3WNDA 3OOWA 1M76A 2JGAA 5LXTA 4ENPA 2PL3A 1G20B 2ZRFA 3BSFA 3HKEB 4AMVA 3ZJVA 4XCQA 2SKDA 3OQNA 3C0KA 4V39A 2Z5LA 4FHZA 4N5HX 1BKDR 1MAVA 2FZVA 4MYRA 10MHA 4LISA 5B57C 1A7UA 4RVSA 4G1EB 4H7KA 4Q9KA 4LRTB 3IEKA 1WW2A 4HS9A 3NHRA 4QDKA 3ZHVA 2AOTA 4MVJP 1O5IA 1QF7A 2O5VA 1W36C 2DPXA 2MMGA 2AN4A 2IOFA 1HM5A 2OQIA 2Q4EA 2QROA 5HS4A 1R16A 1U2GA 1WZUA 4RAOA 5EE5B 1Y80A 2I7XA 4DSAA 4XWTA 5G1OA 2OP0A 3CG4A 4O4IF 5EIWA 3ZV3A 3ZU4A 3MOSA 1IUOA 2IF0A 1NRXA 2FP4B 3Q0TA 2P8SA 1NL3A 3WHKA 2IEBA 4GYKA 1L7PA 2R6AA 4B0PA 5DFAA 4P0PB 2EWMA 1SK8A 2EGHA 5CLJA 1BJRE 4BLRA 3EE6A 3QHPA 2JH3A 4GWGA 2OFOA 3NRBA 5BY2A 2VP0A 3AEUB 1UKVY 3SZOA 2IIQA 3ZQ4A 4I36A 3L02A 4JBYA 2ZZKA 3LPNA 1BGXT 3VX3A 1F0NA 4PZ9A 3L1HA 1XT6A 3ISTA 3WLLA 3WGLA 4B40A 1G55A 1QS0B 4LV6A 4ETNA 2FXIA 1RE0A 4XARA 5CUQA 5CXXA 4KLAA 5F52A 1ANKA 4UQLA 1RI1A 2YJTD 4BLPA 4RC9A 3UJ6A 2B36A 2CLSA 4A16A 2B3TA 1LD3A 2Y9PB 4EJSA 1RKUA 3KUKA 3E3LA 4LQDA 1LGYA 1F48A 4FGJA 1L4EA 3PWKA 4N9QA 1XD2A 2G1UA 4F3NA 3LBIA 2XCTB 3GWZA 1IJBA 4QSMA 3IYLW 5I3ZA 1SU6A 1NW8A 2D06A 3O0TA 3QKSB 3REQA 3VR5D 1CP3A 2ZAOA 2PKXA 3WDSA 3EH2A 2XIJA 1PK8A 3A6ZA 3PIDA 2R79A 3QPAA 3TM4A 3AMVA 3DVSX 2ZXEA 2QLBA 2CHGA 4FYVA 3TVDA 4BCCA 4K86A 5IT5A 4RZ2A 2A5YB 4HQ0A 3TZEA 1EP1B 1WEKA 2QRGA 3RT9A 5BN5B 3QMVA 3INNA 4LJYA 5AKGA 3ISJA 4OHPA 3IPXA 4HKTA 1HI9A 1ORHA 4DJ5X 5REQA 1XJ0A 1HA3A 4W8HA 4PFQA 2WTBA 4CV3A 1XRLA 5AW1A 2QIOA 3B6EA 3BWDD 2Q5LA 2ZIVB 4Q5IA 4JMPA 4W5JA 3PC7A 1QHGA 5LBIA 1XNGA 5L4LA 2VF2A 2W83A 4LCBA 2V03A 2ILTA 2P6OA 3CW9A 4I1OA 3VTZA 4DSTA 2A9JA 4EPXA 3C3BA 3RSZA 5HK9A 4HDSA 1FSZA 3PCRB 4L3OA 1EXDA 3IKLA 5DK4A 2HNAA 1AM4D 1HV8A 4LG1A 4H77A 4GBJA 3B3AA 1DI0A 1GN8A 1Z0ZA 1ESMA 5CW2A 5JJBA 1U5BA 1WPGA 3KEQA 4O2AB 4E5YA 1LRLA 4KJZA 2FZKA 3LQ1A 2WV7A 3KLNA 4U9IS 3Q12A 3G89A 2A0KA 4DMKA 3BH6A 3PUXA 1BOFA 4OHUA 1GAWA 5ERGB 3D2AA 4BJ3A 4QVIA 5JS6A 3FW1A 4JYCA 4RCZA 4EFMA 3WBBA 1JX6A 1RRMA 1Y1TA 3CSUA 2B1QA 3HCBA 3KTDA 4EFNA 1E5TA 4AQ7A 4ZCSA 2EFDB 1H8HA 4NYMR 3QV2A 1E9RA 1PUIA 3K8YA 3PGA1 1ABFA 2AR9A 2HQRA 3R9XB 2PGOA 4M46A 2BWJA 1EFVA 4M1SA 4IS3A 5CK4A 1Q1ZA 1YB7A 1BE6A 1OFHA 2HBRA 5TT0A 1QPZA 3W7AA 4HFNA 4OLJA 3E9DA 5FOWA 1R5BA 3NAMA 2I5PO 4EY7A 3PUKA 1UJ2A 3MWJA 4KAFA 3DEHA 1CD5A 3JWGA 5AI9A 2VAMA 2YNMD 1DLJA 3V3TA 3PS9A 3QEMB 4XJTA 4EMTA 2LDBA 5BQ3A 1O9BA 3FNBA 1GYRA 2OILA 2QTLA 3L93A 2X9VA 1Z9BA 4GBED 4IDFA 2HA4A 1S96A 2IOFK 1OWOA 1DAPA 2JI9A 3ESDA 3JD3A 3EG9B 3KYDB 4GS5A 4P80A 4PLPA 2A2ZA 2CWDA 3THXA 1BFUA 3A4LA 3B3FA 4LRSB 4GE3A 1IB6A 1ZK2A 1J4AA 4JJ4A 1ZIDA 3IEIA 4Z4QA 1UFQA 1VDMA 5JSHA 3U0VA 1C3LA 3QLVA 2AG0A 1X7ZA 2QS9A 2XYRA 4M8LA 3TTTA 3LSYA 4AX4A 2WI8A 5H4GA 4LE2A 4ZDJA 5JFTA 5JRJA 2UXDB 4IQ0A 2P4UA 4YR7A 2YHIB 2WFLB 4L8FA 1IHUA 4CN8A 5K2OA 2O1EA 1YZKA 1GPMA 2W6IA 3M6FA 3UQYS 2H63A 5AUNB 3AHHA 5K8UA 4FDLA 1CR2A 2IYPA 3RRJA 4HQNA 3TIFA 3UCXA 5H1YA 3USES 1JNYA 1VLVA 2AEFA 4KFRA 4MIYA 3IHLA 5I7EA 1T1GA 2AH5A 2P78A 1Z13A 5MDHA 1RW4A 3ORHA 4S1TA 4FXPA 4F60A 3TSAA 4RMJA 1QE0A 3EW9A 5DOVA 1IBRA 2QTVB 4I9GA 4KOAA 4XVUA 3JVIA 2I2DA 4PAGA 4C20A 1JB1A 4NXNB 3IFSA 3L4KA 2VLBA 2FMFA 4OQPA 2JHFA 1IM8A 2NXJA 4TUYF 2P2CA 3BUSA 1NXQA 2V59A 3CH7A 4NNJA 1MQ8B 4WIAA 3KSBC 3T1HB 4MPRA 3ERCA 3GLKA 2X0DA 3HKDA 4V1CA 2XUFA 3NCHA 1YULA 5HW0A 5BR7A 1G9TA 1SO8A 5JI3E 4PLZA 1YOVB 1C8VB 3M7IA 2ZOSA 1NVUQ 1RZVA 5TXGA 1DAHA 1FXSA 1HBJA 2ASEA 3EZ2A 4JLNA 1GV0A 1M1UA 4B3FX 2O3JA 3UPTA 2DWCA 1BG6A 1PNOA 2JC3A 3UT5A 2H1WA 5C8YA 2Q8PA 3SBXA 2Z3ZA 4IWYA 2HHJA 3Q6NA 5SICE 4CMCA 4DDMA 1KKLA 1RPJA 4IRUB 1XHLA 2DTXA 3OCXA 4MVJM 5AKZA 5DTQA 1L1FA 1PE0A 1UQRA 3C85A 4M1YA 4YPOA 2JDIA 2RGRA 1GV1A 4KDCA 3DVQX 5LB2A 4O0LA 1RWMA 3ROXA 2BKAA 5AJXA 1XF1A 4B6JA 2PVSA 1PBTA 4Y3UA 4JU9A 1JLLB 2VNJA 5FWYB 4DWJA 1KP2A 4G25A 4L95C 2EZ9A 2RJOA 3EDQA 1ZM3A 4YJ3F 5HILA 1JR4A 2BCJQ 1E2UA 4PQFA 1CY8A 1K3FA 1S8AA 2XRYA 1KAOA 3GJSA 3EULA 3DFUA 1X1AA 4PZAA 4Q1VA 3FNFA 3MVEA 5H16A 3RFCA 3VU0A 1ZK3A 4ADSG 1BNCA 1CVRA 4H9GA 4HGPA 2XA2A 3ZIAA 5JSZB 2WYWA 2IHJA 1PGOA 2VPIA 5LBTA 3NUZA 1MAAA 4J2TA 1OZHA 1VCHA 1Z7BA 3KXDA 4CM4B 4EK9A 1LQUA 4N48A 1DPFA 4ZHSA 1V26A 4E46A 3V80A 4B17A 2C7PA 4GI3A 4OKIA 5JWRA 1F8YA 3ZGZA 1T2NA 2FWMX 3AILA 1ZGHA 4H7FA 5D01A 1TZ2A 1NYRA 2WU0A 1LUAA 2C2KA 3GDWA 3KLMX 4RD6A 1XU4A 5EVJA 4FX5A 1U7DA 1J99A 1V7QA 5G3YA 4YA6A 4AQYB 4C6TA 4FDUA 4V0MA 3JQDA 1G38A 4J0DA 1WCYA 1XEAA 1OIXA 4X94A 3W5UA 2C2XA 2Y93A 3DR5A 2HIMA 3PDIB 5KNCH 4DM7A 5LQAA 4TTRA 2QMOA 3IR5A 3OY2A 4E2YA 3LLSA 1L6IA 2ZIEA 3SX4A 3A6HA 4Q4JA 5FX2A 1MNQA 5BVGB 4ZDIA 3I5AA 3LUGA 4H1HA 4FYJA 4S04A 2H3HA 3GFGA 4N03A 1V7ZA 2D2FA 2I7VA 1LC3A 5TQJA 1WB5A 2HA5A 1N0IA 4MRVA 5E7MA 1Z6GA 3ROQA 3SK0A 3EEBA 4JYPA 4FXOA 5L7YA 5DCYA 4O8ZA 2A9PA 1A96A 4ZAZA 3NIDB 4UTNA 2LV8A 2OENG 3ADPA 4RULA 3GO4A 3C8DA 3UOAB 3IULA 5ALLA 3UWDA 5JROA 1JAZA 4WXYB 1WPQA 4HEJA 2PRIA 3ED1A 3GBPA 1H1DA 3U09A 4OJTA 2EYUA 5ADWA 1Z6QA 2C4UA 3LZCA 1DLIA 1SU7A 4RE6A 1ENZA 4JLAA 3GQBA 3AVUA 2HWWA 1W1IA 1OREA 2PWZA 3SHQA 3DQZA 3T1YB 1ADYA 5ILGA 3T35A 5K6RA 4W5OA 3ZZUA 1XDBA 3BVPA 4R01A 3RVSA 1X6VA 5AVYA 1RAIA 4JR2A 4YDSA 3UENA 2Z1NA 3HDHA 4CKBB 1P4RA 4C6HA 3IURA 1L5RA 2JAWA 4RADA 4XB2A 1BX1A 3QZUA 4IDOA 4P3PA 3R3WA 3EXIB 1MQ9A 1NBEA 3THOA 3KQOA 1MLDA 4OM8A 3RFXA 2HRDA 1BEZA 4PXSA 4BUCA 3PTAA 4JB0A 4C7OA 4R84A 4RMNA 4BNIA 3D7LA 5F5XA 2FAXA 4BO1A 4HOYA 3GROA 1N7IA 1E0AA 2H7VA 3IAS6 1NW5A 2Z5VA 2ZUFA 3JATB 3HM9A 2R1VB 4XX1A 5H0IA 2Z6QA 1JR3E 4MS3B 4J29A 4Q24A 1W30A 1EZ4A 2WVGA 5ECYA 1V3QE 2UZ1A 2MIIA 3IP6A 5TDHA 4OX9Y 2OD7A 4F5DA 3IVAA 5IM4A 1RAGA 4FOLA 1VPTA 4UMDA 1KDYA 3L0DA 3IODA 3NGLA 3ZH2A 5LXTB 3OTWA 3CPEA 1P45A 1IHDA 1X3LA 1M2KA 2O7RA 3KKKA 4P93A 1N6PA 5JD5A 2XB2A 1MA3A 3U3ZA 1MT0A 2GJSA 4DR1B 3SC3A 3DW3X 2C99A 1EWRA 3N2KA 4U9HS 2ZQ5A 4W1QA 2G04A 1XJWA 5DW3A 4FCVA 1XALA 1I94B 1ZRHA 1VKOA 4HQLA 1LDEA 4R51A 1T91A 4MW7A 4V02A 2VT2A 1XRNA 2H9IA 4JIGA 1XLVA 1M2OB 2RGNC 1ENYA 2XI4A 3MJTA 4QGFA 3AZQA 3L4SO 3IQFA 4OYYA 2X9NA 5AVJA 1UANA 1QVAA 4HAWA 1VP3A 1D6NA 3B2EA 4AVYA 1RQ7A 3DTVB 2X5JO 3L7YA 4YCNA 1MABA 3MD0A 4R40A 2HJVA 2Q4TA 1LPAB 3GELA 4KZPA 4X45A 3ADCA 4CG0A 1F4LA 2C03A 4UTPA 4OVKA 1NI3A 2OV6A 4Y9TA 1UKEA 1NU8A 2GHRA 4TVBA 4XVRA 5CAEA 2HWYA 4YPFA 3C6BA 5BMVB 2YIJA 4KYUA 1BKSB 1QVZA 3PPVA 1WXIA 3VPFA 3CT4A 1XR3A 3HP7A 3NVDA 4BJHB 4EGQA 5EHXA 3GL9A 2JK1A 3KPJA 1X42A 4LJSA 1EG2A 4P83A 2DQ4A 2Q4DA 1V11A 1C1XB 3G5UA 2AJDA 4MROA 4D9BA 1EDZA 2WFZA 4LE1A 4JLJA 4DJAA 1QJ4A 2E49A 5G2OA 3ROFA 3VAAA 4ISCA 2D00A 2V8OA 2X1VA 3PFIA 4G5FA 3D8UA 2ZJ1A 4ZTBA 4C22A 2JCYA 2ATEA 2Q0HA 2UYHA 1AX9A 1T8TA 2QR5A 1TF2A 1NC1A 2NTJA 3EIEA 3HCFA 4PBRA 4QGBA 2TS1A 3B53X 3H9GA 4II2A 5K0EA 2HT6A 3ILXA 1B6GA 2ZQYA 3ETGA 4PS0A 1QB8A 1ZGZA 2YXEA 4PLCA 1FUYB 4IHJA 1E0DA 4DIOA 4ZMBA 1FDTA 4WJLA 5I7FA 4I9FA 2VDMB 4X1IA 1BMQA 3F9RA 3FWZA 4Q3EA 1XDDA 4MLZA 5DHTA 2XMZA 2QLTA 1LH0A 3RU7A 4BOYA 4QOJA 1MP0A 4Y67A 5HF8A 5LZ5A 1IH8A 2OCGA 2RHHA 5AI5A 3NO4A 1GIAA 3O38A 2HCFA 4LKRA 1SBIA 1XTTA 4E51A 3H0EA 3HRIA 2P3QA 1CX9B 2WA1A 2AMJA 3BWCA 5I9SA 3ER9A 1P5ZB 3SE7A 4ZYVA 3QVGA 4P32A 3ZY2A 4I0WB 4OUDB 3HI6A 3QUAA 5JAZA 2Z95A 3PWTA 1U0FA 1OWLA 1UJMA 4UMVA 5EY5B 2PUFA 1L5YA 2Y1WA 2O2DA 4RPHA 4LCEA 4A15A 3AQ4A 1P1CA 3AZOA 3FTQA 2EJUA 1NI5A 1FJGB 3OU6A 3E03A 2QLLA 2ERCA 1FIUA 4QPJC 2FZEA 4FC7A 3COZA 3EOZA 5JZVA 2BHLA 1Q21A 2YY5A 4OREX 3LY8A 2VJQA 4FLEA 3K6SA 4HSEA 4YAFA 3PITA 4A6XA 3GGCA 2DR3A 4CETA 1BSVA 1FXWA 1ATIA 3ILHA 2Y68A 3V9PA 4BBPA 1BVHA 1BXZA 4YREA 1MORA 2I99A 2B5VA 2HDHA 5DW0A 4OA5A 5EJ8A 2IQIA 4KW7A 4L8VA 3M1YA 2A9QA 2PMBA 3F8TA 3WXMA 4K6HA 5JAMA 2JBWA 1DTWB 2LVBA 4K28A 5CVDA 1EVYA 4HEA6 1XPUA 5LP6B 1E1DA 5JAIA 2G0NA 4UNRA 1EI9A 4TN5A 5I4CA 1I5RA 1N77A 1NNUA 4X8LA 4CQNA 3C5WP 3OPMA 4KNVA 1EINA 4B73A 1GPKA 2UZ0A 2E5WA 4QO8A 5BOVA 4JBWA 5GAJA 5IBPA 1YMUA 1J1IA 2VSNA 2XH8A 2J9GA 3W4KA 1KH1A 1HE1C 4EW1A 4YQYA 1NSTA 1EXMA 3KWJA 2MSNA 3CZ9A 3MQ2A 4NAHA 4XTCS 1EXVA 3G2NA 4MWZA 1U0SY 4I5GA 2CNOA 3HXTA 1TUEA 4CUKA 1W6RA 3NEPX 1AO0A 5JTUA 2BSAA 4D3DA 2QW1A 1L4HA 1USWA 1MC4A 3LUJA 1GG8A 4FINA 5IN5A 1VPDA 1JR6A 2CKDA 1K4MA 3TLZA 4XB6B 1NT4A 3GJ8A 1Q0QA 4Z53A 1PU2A 5ICEA 2PH3A 4PYQA 2JB9A 5AKHA 3KYBA 4A8JC 4BVFA 2QUJA 3R0JA 1POXA 2PLRA 3DTTA 4R7ZA 4UNPA 1R15A 3UOWA 4MV8A 2A8YA 1PS0A 1J42A 3Q7PA 1DS6A 5ELXA 3LUKA 4G5OA 3QYPA 1RD4A 1YQGA 2NZJA 1PL6A 3HM2A 3LLUA 1CS0A 3T7TA 4YLYA 3N1UA 2PZ8A 2AOWA 4BLQA 1N6OA 1U5CA 1VA4A 4N3BA 3U44A 5A9RA 3MWEA 1HT1E 4JL6A 1C4OA 1Y48E 5HE9A 3X44A 3KYCA 2LTAA 3G5LA 1F2UB 2K2QB 3GRPA 3L0OA 3L0SA 4KEAA 2HRCA 3ZJ5A 4BNDB 2BFDA 3M9WA 4MXDA 4DDVA 4KR2A 2G9UA 4QRHA 2D1TA 5FPTA 3RF6A 5CNIA 4TQAA 4H2DA 2ON6A 3ZIAD 5CDSA 2E4UA 3AVVA 3ANYB 1NYTA 3DMTC 1JQ3A 1FMTA 1OGJA 3Q5EA 4DM4A 5HKLA 4OHCA 4JUIA 4AF6A 4PAWA 3L06A 2P41A 2W22A 1PW7A 1HEYA 1YVDA 2XECA 3PNVA 3OFJA 4HFJA 4LXTA 5EGSA 5TRTA 3T0IA 4DQLA 1F60A 3DDZX 4MW0A 2XGOA 1SUCA 1FA9A 1VFNA 2G1JA 2NZUG 2O1WA 2XMQA 1NT2A 3AHCA 2DHCA 2NADA 3FCSB 1A7KA 2CLKB 4IH9A 2V6BA 1Z0SA 5H02A 3U31A 3G7SA 4HQ6A 1U4NA 1JEQB 5BW5A 2B82A