1FUKA

Crystal structure of the carboxy terminal domain of yeast eif4a
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
162
structure length
157
Chain Sequence
IKQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGGVAINFVTNEDVGAMRELEKFYSTQIEELPSDIATLLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Translation
molecule keywords EUKARYOTIC INITIATION FACTOR 4A
publication title Crystal structure of yeast initiation factor 4A, a DEAD-box RNA helicase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 55
structure length 157
sequence length 162
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2000-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1fukA00
1E98A 1KO4A 1FW6A 2VIIA 3DPUA 1Y3AA 2H8KA 2R65A 3K0CC 2FSIA 4DCSA 4LZZA 4MRVA 5CDFE 1OIXA 1N0VC 5C2JB 1E9DA 5EUQB 3CF6R 3PUZA 1X3SA 3NIBA 3WBKA 1KAOA 3QE0A 3PIRA 2FMXA 4YC7A 5FR2A 4FD2A 4AKHA 2J1LA 1E2QA 1AS2A 1DEKA 2NPIA 2YOHA 1Q22A 4ITRC 3RABA 2CMKA 4M9SA 4Q9IA 3J81k 3OFNA 1GNPA 2FEMA 1LV7A 4LCBA 4NP6A 3OESA 1ZNZA 4D4JA 2PLFA 1Q20A 5DHAA 2ZAOA 3C41J 1E79D 3MWYW 3A1TA 3KKMA 3GJ7A 3SNHA 2GJ9A 3SOPA 1XPOA 2ZRNA 4KU4A 1JQJC 2PL3A 4D25A 3AKEA 4LV6A 5DI3B 5FR1A 5FBRB 3X1YA 2HV8A 2GEVA 1YR6A 1DPFA 3AM1A 4BFYA 1FQJA 4FCTA 2VYFA 2PT5A 2FFQA 2YC2C 4HAUA 1W1WA 5G3YA 4TQ9A 4EJSC 4LYHA 1AQYA 1CJMA 3TAUA 4RD0A 2JATA 4Q7JB 2WJJA 4LBYA 3KKQA 4ARZA 4F4IA 1Z83A 2RGGA 2P6NA 3L43A 1WF3A 2ZRJA 4A8JC 1M7GA 3ADKA 3REGA 1ZBDA 4LHXA 3EWAA 4P0TA 2ZRAA 2ASEA 3L8YA 4HB3A 3CM0A 4DLVA 5EQTA 3FB4A 2X19A 3T1TA 3CNLA 1XCGB 2JCSA 2ZR7A 1MO4A 3ND9A 2QORA 1JJVA 4OYHA 1OIWA 2D7CA 4YMWA 5GADl 4Q02A 2Q3FA 3UWOA 4HUTA 2O8BA 4IKEA 1EX6A 3W34A 2PEYA 4Z1MA 1CEEA 4OK6A 2DB3A 3NBYC 2XGJA 5H70A 3OIWA 4IEEA 2G83A 1RIFA 2QPAA 1I4TD 4ZCIA 4DDWA 2O8BB 3HU3A 4M9QA 2Q21A 4CVNA 2DR3A 1G8HA 1W49A 4HI0E 1JEDA 4P3YA 4P33A 1F6BA 5HKKA 3U3KA 4D82A 1UM8A 4AKIA 1YZLA 5SZJA 2VEDA 3TQFA 4PAOA 4B2LA 1M7BA 1DAHA 1FNMA 2V55B 3U6KA 1XD8A 4YDHB 1P3JA 2IYYA 2BMDA 2QROA 3DZDA 2J0QA 3SYKA 5IK2D 2GXAA 3IDQA 1KOFA 1Q1QA 2ERYA 3KZ1E 1OH5A 2FSGA 1VG9B 1E2NA 4PO8A 5JSZB 3NDPA 1UKEA 2FN4A 1QDEA 4RVCA 4IXNA 4KYUA 2OBNA 5H8WA 2QAJA 1JR3A 5FL7A 5JEDA 4HUQA 4QRHA 4A2WA 3ZZTA 1II8A 1E2DA 1TF5A 2QRNA 2WBLC 5CJPA 4RZUA 1G5PA 1R0ZA 1SVKA 1Z0IA 3B7GA 4TL7A 3ETLA 4YMTA 5L8VA 3DOFA 3UATA 2F6RA 1KDTA 2A30A 2ZI7A 1W36C 3K09A 2A2ZA 3KQNA 4ACAA 2GJAA 1NY5A 2REBA 3MUFA 2XSZD 4HUQB 4Q00A 3UG6A 3EPKA 1X8LA 1G4UR 5TB5A 1XD2B 4TMWA 2WWIA 4O2LA 3KFXA 3VKGA 3BFKA 1FNNA 3ZS9A 5A5GA 1ESMA 1HA3A 1Q3HA 2AHOA 4EPVA 1MOZA 4M53A 3DZ8A 5JWRA 2GXUA 2QE7D 1T6NA 2G0TA 1X1RA 1K5GA 1LVGA 4LDJA 5BQ5A 1XXHE 1FZQA 3A1VA 3SYLA 1U8ZA 3Q8XB 3VR3A 2PJRA 1P60A 4LJ5A 3E2IA 3PJRA 4KSBA 4MKGA 3IBYA 2W6ID 2Z0MA 1I2DA 1C4OA 2E9SA 3VNVA 2QU8A 3U7HB 3AUYA 1LB1B 1NMYA 1G5TA 4BLTA 1XMIA 1KSJA 5UKDA 3U3MA 3WRYC 1DVRA 1YRAA 3B1XA 2C95A 1Q0UA 4JLJA 4Z8XA 4C0JA 1VHTA 2QSZA 2GCPA 3FFAA 3T12A 4C7OB 4HDCA 4B3FX 1TEXA 1EXMA 4XOIA 1G8GA 1W2HA 4QBHA 4LJAA 4NMMA 4XSGA 1CU1A 3GLIE 2OZEA 3EZ9A 2P3SA 4Q18A 1G3RA 2FZLA 3EAQA 1UAAA 5BW8A 3U61B 3C4JA 4D0NA 4ESHA 1YQTA 4JLDA 1SVLA 3EZFA 4JT2A 4CT5A 4UQOA 4Q9JA 3KQLA 1GOTA 5EXXA 1KK0A 4YMVA 2AWNA 4LV5B 1NBMD 3TSZA 1ODFA 2JIZD 2GZAA 4EKDA 3VU9A 5K8UA 5LPNA 2IYXA 2JLZA 5E7MA 2X8AA 1KMHA 1IXSB 1UBCA 5JS8A 2ZROA 4A4DA 2BJWA 1EG7A 2RKOA 4UJ5A 3BIFA 1XB2A 3QG1A 2ZQ5A 4FINA 2NOAA 3LLUA 3VU9B 721PA 3ICQB 4LRWA 3CPJB 5DO9A 1G8YA 4F4JA 2CK3D 5F2EA 1QHYA 5EE9A 4E5UA 3V00A 1M6NA 1E9BA 2P2LA 4G5GA 4JSTA 2GHIA 2RGNC 4BUJA 4MITA 2R6AA 4ZIRA 4M1MA 1ZIPA 4TMZA 2XNDD 1DAIA 1AA9A 1E9EA 3SJCA 3LBNA 3SE0A 1YR9A 4LY6A 3PG5A 1VYUA 2YNMA 3W6OA 2FX3A 3SFZA 4B32A 3PVSA 1E2LA 4N1AA 1G8FA 2O8FB 3UXMA 2CCJA 2DHRA 2QP3A 5HCNA 1B0UA 3FTQA 4B35A 2UKDA 2OUKA 2CCKA 2RH5A 2UVQA 3LVQE 3BRWD 1D2MA 1FP7A 3MGCA 4P32A 3GJ6A 1DO2A 2F43A 2D3WA 2WJYA 3TIFA 1W4CA 2B8WA 3GEEA 3U6BA 1N5KA 1N6HA 4V0OA 3X1WA 3LQQA 4G5QA 3X1XA 1JAIA 4HLUC 4BZPA 3GLGA 2OV2A 3UG7A 1XTJA 4P31A 2ZETA 1SHZA 2C2HA 2ANBA 1P9NA 4C0BA 3HU2A 4TMXA 5FI0B 2ZI4A 2FJUA 2F43B 5CITA 3PXGA 1ZC4A 2ZE5A 1N25A 3JVUA 4LPKA 3HP1A 5G40A 1NVVR 4D6PA 3CW2A 4YXWD 4NPHA 4QFMA 5EZ6B 3PEYA 2CL7X 1E0KA 2O0JA 2E87A 2WTUA 1NN3A 4LC1A 1GNQA 1US8A 2B8TA 2IC5A 5E95A 2ZI9A 4C0KA 3MD0A 2N46A 2WJHA 1QG4A 2HXYA 4KVGA 4P4TA 2D06A 4PHFA 4BZXA 1YJ5A 2CE7A 3AF3A 3AB3A 3WYFA 4EPWA 5IT5A 5LB2A 1FUKA 1VCNA 4AYTA 1LTQA 1N6RA 1XP8A 2SHKA 2WIBA 3EA0A 1VG8A 1CULC 2V7QA 2WIAA 3AP2A 4XVUA 1E2MA 4NYJR 1TQ2A 2PLRA 4F92B 4Q4JA 1JXOA 4S2EA 4E09A 4FW9A 1SKQA 3IIJA 2WZQA 1GL7A 3GLHE 1D9ZA 5KO2A 2IW3A 2BIFA 3AUXA 1Z47A 3CNOA 2AK3A 1GKUB 3MJHA 4ZCLA 1NRJB 4BRWA 4G3XA 2ATVA 1Z0DA 5BN5A 3TJZA 2Z4SA 2C03A 2O0KA 1GSIA 2EFEB 5BXQC 3A4LA 3BWDD 2NZJA 1W4AA 3QIAA 1G41A 2I4IA 2PBRA 4JLKA 4PZYA 2IYSA 4TYNA 4TYQA 1Q57A 4RCYA 1GWNA 3KJHA 4KI0A 3CLVA 1G7CA 2IUUA 1S9DA 2ORWA 1GAJA 4K8OA 5AJZA 4FI3C 3L2OB 2Z4RA 3I73A 1K5DA 1P75A 1AGPA 1KDPA 4XH9B 1BOFA 1GM5A 4JS0A 4LSGA 3GMTA 3LW8A 4KHZA 4UKDA 4RZ3A 2ZU6A 3TKLA 1FFHA 2C78A 4CZ2A 2FPKA 3I3SR 5LDDC 3TUIC 3SR0A 5JHGB 1ZUIA 2A9KA 1HT1E 2G77B 2QUZA 3FVQA 3QJYA 2GBLA 1SVSA 1T0HB 1KKMA 1GIAA 3KB2A 4DSUA 2ZREA 1G6OA 1QZXA 4B2PA 3WP1B 1KY2A 2TMKA 2LKDA 4W5HA 4ZDKA 1PUJA 2ODBA 1E2GA 2C9CA 1NLYA 4RZ2A 3DO6A 2XB4A 4NBSA 3CR8A 5B2ZA 3VKWA 4YONB 4B6EA 1R2QA 4HLQB 3DDCA 3BD9A 4NCJA 2O8DA 3R8CA 4Q1DA 4EQ6B 4DHEA 1NN1A 3N5CA 4LHYA 3VTKA 5JFGA 2XB2A 2Q3HA 1COWA 2ZYVX 4RD3A 2HJVA 4PC3A 4IHQA 5FOSA 4Q48A 5TVKA 2IS6A 2QPOA 4PZZA 1CKEA 4AG6A 4DSNA 2VRWA 4QG7A 1IBRA 4HB0A 4IEIA 2Z6VA 2NO6A 4B3GA 3I61A 4QOSA 1Z0KA 1T9HA 2WKQA 4WXRA 221PA 1DAGA 2PJZA 2XTZA 4ESVA 3THXA 1KIMA 3I8SA 1S0UA 4L4UA 3GEHA 5HKKD 3AGQA 3WHKA 4CIDA 1D6JA 1ZNYA 4HSEA 3RLFA 5C1BA 3U44A 1Q12A 4JLPA 3FMFA 2W0MA 4NCKA 4DCUA 2G0NA 4LUCA 4OI4A 3THXB 1SHKA 1OB5A 4C2UA 1Z0FA 4GMXA 4RKEA 2OLJA 4RY2A 3KFVA 1EWQA 1W0JA 1X1SA 2R2AA 2FSHA 3CNNA 5HZHA 2VP5A 5C18A 1OYWA 4DUGA 621PA 2BM1A 4Q47A 1Z6YA 1U0JA 4JJZA 5FBLB 5BN4A 4NKRA 1JR3D 1WMSA 5FL7D 4V0NA 4DLSA 2GZHA 4RKFA 2ZE6A 5HR5A 1H8HD 4EFMA 1P6XA 2OESA 4BEJA 5JEEA 1KZGB 2KE5A 5SZKB 2CVFA 3PV0A 3OE7A 5EP2A 2NPFA 1U0LA 2GDJA 8OHMA 4U7DA 2WICA 1P62B 2PZFA 1ZM4A 4BFUA 3OHMA 2WAYA 3RS3A 2FNAA 2QP4A 2ZJOA 5JHHB 2HYDA 3ZJYA 2JLUA 3B9PA 3QVVA 2VTKA 3U7EB 4BLSA 4CEJB 4GRAA 4M1OA 4BFXA 3ZQ6A 4F91B 2J7PA 1G8PA 4GBMA 3D7MA 2GA8A 3EA5A 3PQCA 3V4RA 2ZXUA 1M34E 3NTUA 4MDFA 3TNFA 3IQXA 1TQDA 3EPJA 1CLUA 1TMKA 3GFTA 4QXAA 3HYTA 5KUTA 4MDEA 2JA1A 3LWNA 1CS4C 4WOPA 1N5JA 1U90A 3KL4A 3QBTA 5C4MA 3ICEA 1BMFA 4NONA 3U4QA 4HAYA 1TX4B 2AFHE 5AUNB 3GLFA 3CPEA 3SBEA 2F1HA 4EJSB 2ZYUX 2W2VA 4PFSA 4AURA 1I2MA 3MJRA 4JBXA 4DC9A 3L8ZA 3QENA 4QHYA 1NVXQ 1T3HA 2JLYA 2QTFA 5TY0A 2VP4A 3GLHB 3IGFA 3I5YA 3U4QB 3ZD6A 4MRPA 4FIDA 2X2FA 4V03A 4ZPXA 4BLRA 5CB6A 3VHXA 4QM7A 1BH2A 4TQUS 4F4CA 1Q1BA 5FOWA 4RFSA 1TADA 2VHCA 3K8YA 1EGAA 1QHNA 1KY3A 4DBLC 4US2R 2FWRA 3I5XA 4PX9A 5F9FA 4LI0A 2EFGA 4RSGA 2QSYA 2AWOA 4A0FA 2XXAA 3QXSA 1MH1A 2CHVA 2QENA 4GOKA 3RRZA 1TQ4A 1KDRA 1Z2AA 1X6VA 2B21A 1G3MA 1QHHA 3EW9A 2ZRIA 3ZIAA 2NQ2C 3QPUA 1KJYA 4LBWA 1P2SA 1E1QA 3W9YA 4XSHA 2FPMA 4H1VA 4A92A 2XXAB 1SXJB 2ZUDA 2D4HA 4O25A 2VHTA 1LW7A 1HY3A 4Z54A 5FOUA 4AG5A 1QHHB 4KLNA 1V43A 2FFAA 1IJEA 2WOOA 3BERA 3L0IB 2DPXA 1L7VC 5DGXA 4N0EA 2BC9A 5L3QB 3IO3A 4NL4H 3P20A 4ILEA 3CR7A 4ASUA 3TSOA 4TT3A 3H86A 2JEOA 3VFDA 3B9QA 4TSFA 3G82C 1DAMA 2V54A 1ZCBA 3T1VA 1FMJA 3E1SA 4HAXA 2JLQA 3RWOA 1IM2A 4OL0A 1FP6A 2IF2A 3PITA 4DDTA 3R9XA 5B30A 3R8FA 3O8DA 4EFLA 5EZ5A 3LXRA 5KSYA 1VYVA 4OQFA 3HR8A 2UZIR 3BAFA 2AKAB 3AF2A 1JJ7A 3EPHA 3NBFA 4LWZA 3QXCA 1TNDA 1TUEA 5KPJA 4JL5A 3MG9A 3UIEA 4ZKEA 4KFUA 5L3RA 2QRZA 1G4AE 5JMTA 2B6HA 2ZRPA 2OHFA 1Z63A 1VIYA 3KKPA 3QSYA 1CR1A 4B33A 3TW4A 5CJ2A 4IRUB 4JLAA 3LV8A 2R9VA 1RFLA 2A78A 3QG5A 2MSDB 1PJRA 2WSMA 4CEIB 1YRBA 3AVYA 4Z51A 1W0KD 2ZRLA 2CE2X 2GBLC 4GI7A 1W7AA 1S4QA 1BYIA 1TQ6A 1OH6A 1UKZA 2R6CA 4B76A 1F3OA 3TAHA 4RZXA 2MSEB 1KI8A 2O5VA 2IS1A 1GDDA 4A6PA 2WSSA 1XDBA 1I4DD 4D80A 1JXMA 4GT1A 1QHSA 2YC4C 1G17A 1E2FA 3THWA 1KI1A 5FTMA 4B3CA 3P26A 4DWJA 1OSNA 2B92A 2QP9X 2ZANA 3B2EA 3LBIA 3LY5A 4GNKA 4ABYA 3GQBA 3I1FA 1J2JA 1KGDA 1OHHA 2OFWA 2A3RA 1J70A 4JSYA 3IIKA 2IEYA 2VF8A 4CDGA 3THWB 2VQSA 2CDNA 1Q3TA 3Q7QA 4GFDA 5AUQA 3TSWA 5K8LA 4OI2A 4X8LA 4B34A 1DE0A 4TL9A 1WB9A 1R8QA 2X2EA 3VR4A 2HUPA 3AVOA 3TMKA 2GK6A 2VP9A 4A2QA 1FX0B 4JVNA 5FI1B 2ZSDA 2HJGA 3R9WA 4URUR 1E2KA 5FUWA 1JEEA 2H16A 4OQMA 3L0OA 4ZI3A 4WZ6A 4OI0A 4D0GA 3OIYA 4X8HA 5DI3A 1AZTA 3AVUA 1P72A 4G1UC 5HE9A 2FEOA 3MLEA 2WAXA 3QBVA 1QRAA 4HAWA 1WP9A 2EFDB 3W6NA 5HPYB 2ATXA 4BFVA 3D31A 1SVMA 2ZRMA 3LRPA 1BO6A 1CP2A 1RW4A 2XZLA 4O0MA 1NIJA 4QJ3A 2VF7A 2ZUBA 2IS2A 2REXB 3PENA 1XPRA 1CIPA 3LFUA 5HZKA 4I1VA 2AD1A 2MMCA 2NZ8A 3A4NA 5KYKA 4Q7MB 2QG6A 3LQRA 1VCMA 2QNRA 3LO5A 1XRJA 4A0HA 4A36A 5TDHA 2ZS7A 4E22A 1U98A 4QJ4A 2XAUA 3AKYA 1U94A 1L4YA 2EU8A 5JCZA 1ZD1A 1COWD 1KK3A 2BV3A 2OXCA 3GJ0A 5GJWC 3FPAA 4GZLA 2BM0A 1Z6TA 2JJ8A 4G01B 5KDDA 4KLZA 2QQEA 5GVSA 3TVDA 4R7ZA 3GFPA 4Q19A 3VMFA 1T8UA 1Z2CA 2WHXA 3RS0A 1OH7A 3I4LA 3NBXX 3VR1A 4MA4A 1ZIOA 1CJUC 2GWHA 2JGNA 5A4JA 1P7CA 2K5UA 3B5JA 4Q4AB 4URWR 2WMNB 4PC7A 5J47A 1QVRA 3EIEA 3QEJA 4NU0A 1XCMA 1WXQA 4FMCF 1RC8A 1SVIA 3A6PC 4Q1AA 3BH6A 3CPHA 3FHOA 5JSZA 1YR8A 1DS6A 1GZSA 4DUGD 3C7KA 2ZSBA 2QN6A 3MWKA 2ONKA 4B3BA 2ZRDA 5KNDA 3NC1C 4IW3B 1ZM9A 4M0LA 2BMFA 3LLMA 4C4PA 2OCBA 1T5IA 3E5HA 3OE7D 2VPPA 1UEJA 4W7SA 4WVFA 2IX3A 2Z5FA 3GEIA 1ZUNB 1Z6XA 5BYJA 1SULA 2QTVB 4WXPA 1J90A 4EPXA 1EK0A 4M1TA 4Q7KA 4YMUA 3PEWA 1XD2A 4UNPA 4JBYA 4MYUA 3THYB 3U7GA 4C0LA 2J7PD 2GF9A 3Q85A 2P0EA 4FCVA 1DO0A 2KBFA 3NH9A 2CJWA 2ERXA 3Q5EA 5DYIA 1ZD8A 4TTPA 4BWYA 1KO7A 1UDXA 2ZITA 3BB3A 3CX6A 1S2MA 3DMDA 4M2LA 4PPQA 6Q21A 3NEYA 3QPWA 2ZJBA 3L82B 5AR1A 5JJLA 1S3SA 1OJLA 1CF4A 1DG3A 1N3BA 2BCJQ 1XEWX 3KXKA 1JECA 1P2TA 3A8TA 3IUYA 3I72A 4LJ4A 2CJWB 4B3DA 4R2HA 4V0KA 1BMFD 3CRVA 5F98A 4BFTA 4MGZR 2KB0A 3CRRA 3KDSE 5D3MB 2EYQA 2IYLD 2AL7A 2CLDX 4UNNA 1XEXB 4QJ5A 5TXGA 1IONA 1J7KA 1JALA 3BC1A 4JL8A 4V0MA 4CEHB 3CWQA 4JBWA 4J0QA 4PXAA 4Z8YA 2JLSA 1N6LA 2QI9C 3IO5A 3OZXA 3IPXA 4C7OA 1TTTA 3MWJA 3A36A 4B44A 1G291 1R5NA 3ADCA 4HZIA 3IBGA 2QA5A 4UNSA 4PPFA 1W46A 3NXSA 4TMKA 1BS1A 4IDHA 4URZR 1R7RA 1NJFA 1YU9A 1D9XA 2F9LA 3I32A 4KV9A 2I3BA 4XD7A 1W2GA 2G9NA 4ZI2A 3HPRA 4PHGA 2XZPA 3B1ZA 1E2HA 5LD2B 4I1UA 3AF4A 4KCGA 3TUZC 4DLRA 1Z0AA 2A5DA 4Q9LA 4C30A 1OB2A 1HUQA 2H92A 2AK2A 1KKLA 3FKSA 2IS4A 5JZVA 4B48A 1G3UA 1KZ7B 3SJZA 3ZIAD 1FQKA 2BJVA 2WJVA 4TLEA 1E1QD 2QL6A 1KI2A 3QUSA 3BJIC 4HYYA 2W83A 3ZQJA 5A0FA 1ELOA 4JT4A 1O3YA 2HCJB 2VSFA 1XMSA 4Q4LA 2IYUA 4JVMA 3X1DA 5CM9C 4LBZA 3H4MA 1AQUA 2C96A 5C46F 1RRPA 4EUNA 4DEYA 2DBYA 2VH5R 1E6CA 2G88A 3SQXA 3OEHD 3P1JA 1UF9A 2Q3MA 3GJ4A 5DYGA 4D4KA 4ASUD 121PA 4TT3D 3WYGA 1A4RA 3IIMA 4TSFD 2BHRA 1FOEB 4DB4A 1XBTA 1UEIA 2QT1A 3QXXA 1KI4A 1W4BA 2OO7A 1ZM3A 3GJ5A 3RSLA 1Z6AA 2J46A 4EPYA 3AGPA 5FPKA 2A5GA 5DLQC 2O8FA 2F7SA 1E0JA 4YQFA 3G0HA 4PAMA 3AKDA 3Q9LA 3ZZUA 1XJQA 2WOJA 4Q1CA 2VSOA 3TVTA 3RAPR 1TF2A 5JRZA 5FPTA 2IWRA 3KQHA 4FMDF 2HLDA 1V5WA 2J45A 3BH7A 4DLUA 4HLDA 3ONWA 1ZP6A 4KYIB 4XVRA 2IK8A 3QKRB 1PV4A 2R44A 1GRNA 3WMGA 1KDOA 1LF0A 5F9HA 5CIQA 1A7JA 1CR2A 2NO9A 4PTLA 1ZM7A 3JZAA 2O8CA 3NC0C 3DKPA 4LJ7A 1Z6GA 4BFWA 2YJTD 1UPTA 3W90A 1R6BX 4CF7A 3WMFA 3K70D 2ZYWX 3WP0A 3FOZA 4HDOB 1LF5A 4NDZA 5CYOA 3CH5A 1EFRD 2ZU0C 1MO6A 2OM2A 3T5DA 3ZGXA 4URVR 2GILA 4MUAA 3ZVLA 2QEQA 2O8CB 2GXSA 3BS4A 1YZNA 1J99A 3EIQA 4Q1FA 3VX4A 5D3QA 4OJKA 5JRJA 1KO5A 2B7CA 2DWOA 5FL3A 5TMPA 2EQBA 2YINC 5CIWA 1Y63A 2W58A 3K1JA 5KPDA 2GVZC 4TTRA 3UWKA 1KSGA 1LY1A 1HT2E 2J0UB 2A5YB 4MUBA 5CYPA 1NKTA 2AXNA 2FH5B 3NVAA 3WNCA 1OFUX 1OHHD 1UJ2A 1YHNA 4CRWB 3H84A 5SZHB 2W2TA 2WWWA 3DM9B 3LDAA 3FYHA 4PZLA 1EX7A 1U2RA 5AJVB 3UKDA 1YZUA 1UDWA 2OE2A 4F38A 1Q21A 4LV8B 4TZ6A 3LD9A 5HTKA 4PO1A 2OFOA 3P4XA 3RYTC 1JB1A 1XXHB 5JI2E 4KO8A 1T8TA 1DAEA 3MMPA 2C9OA 1Z5ZA 2YVUA 3OFND 5KNCA 4PSVA 4YDSA 4M8NE 3KUDA 3ZH9B 1S1MA 1VG0B 2A5FA 1E99A 3AQ4A 1RJ9A 3SN6A 2ZJYA 1R0YA 3K0AA 4JZKA 3UK6A 3AP1A 4KODA 2ZRBA 4G5SA 1RRCA 3RS7A 2OFXA 2FFBA 3KJGA 3GLIA 2ZIAA 2AKYA 1UADA 2OCPA 3THOA 1A1VA 1RJ9B 2FZ4A 4NYIQ 3U7FB 1E94E 3QEOA 3A1SA 1QBKC 1XX6A 1MR3F 3K0AB 3RS4A 2GEUA 2RAPA 3IPYA 4JJKA 1KHTA 2IYZA 3H2YA 3CIOA 4E03A 3D3QA 1IHUA 3GLIB 1YR7A 2ZR9A 5L3SA 5JJIA 1GP2A 2LKCA 3GD7A 3BB1A 1KK2A 3BOSA 1F2UB 4WZBE 3CZQA 4NCIA 3K09C 821PA 2XX3A 4TLCA 3BBPA 3CX8A 4EQ6A 1W47A 2OXRA 1TAGA 4POAA 3SI7A 5L3SB 3IHLA 3KB1A 4MKHA 5B58C 4RFVA 2X1VA 1EFCA 1Z29A 1KJZA 2DFNA 1U9IA 3FMPB 1NL3A 4HAVA 4CYMA 3O8RA 1G16A 3D8BA 2BWJA 1B23P 1GTVA 2J3EA 3F0TA 3FKQA 5H68A 2C77A 2IT1A 2F3RA 3FDIA 3K9HA 2VP0A 3CF0A 3ZDQA 4Z1MD 1VDZA 2FF7A 3S1AB 2ZE7A 3REFA 4JLOA 4NYMQ 1XTRA 3B1WA 1NBME 4RD1A 1XZPA 3U3RA 2HDNB 2ZI3A 2QTHA 4Q4HA 4MKFA 1RYHA 1PVOA 4G5OA 4ACBA 4XVQA 3WHLA 1IJFA 4QGHA 3EC2A 3CB4A 2V6JA 4Y0AA 1E0AA 4WBSA 4PANA 5EJEA 1M2OB 4FCWA 2V6IA 3KKNA 4GDFA 5FOXA 4Q4HB 1XJCA 4RCZA 5DN6A 3ZVMA 5TARA 2GAOA 4FWIB 4IDQA 2QMEA 2OG2A 4W9MC 2QAGB 2HF9A 3LW7A 1TUIA 1A2BA 4MGIR 1HEIA 4C3ZA 3K0CA 2N42A 4A6XA 1OE0A 1NG1A 1UBEA 2MMGA 4DCTA 1UBGA 2VA8A 1OF1A 3AH8A 4Y0VA 1S8FA 2OAQ1 1MABA 4NE2A 5GJCA 3OEEA 3QKUA 1VTKA 1WE2A 4AD8A 4HAZA 4JLVA 2DWQA 4CEJA 3EIHA 1Z06A 3QXJA 1KI6B 4X8OA 3T5GA 4L15A 4A9AA 3SEAA 4ZKDA 4OBEA 1AKYA 2BBSA 3AV0B 1ZJ6A 4MQBA 3TR0A 4NHOA 1MABB 2RGEA 2J59A 4U02A 3ZD7A 4GOXA 3TE6A 2D7DA 4OJQA 4DLXA 3WYAA 3DOEA 1Q1ZA 2R6GA 1IXRC 3MWLA 1LNZA 4OKSA 1ZINA 4DSOA 1NN5A 1NMZA 4JIMA 5KSOA 2V8OA 4JKIA 2W2XA 4UXIA 4URXR 2ZVQX 4LOAA 2A7QA 2CL6X 4DLZA 3KQUA 2F55A 3P4YA 1R8SA 3F5FA 4EJSA 4OQNA 2RB4A 2DWPA 2JLVA 3GJ8A 1CJKC 4FXPA 1XTSA 4DIEA 5JWHA 1D2NA 5J4YA 3GLHA 1QG2A 1KSFX 4AKEA 1AS3A 4NZYA 1E96A 4A8JA 2NO1A 1ONBA 1P2UA 1WDTA 3NHAA 4IJMA 1T5LA 1XFAA 1J8YF 3CBQA 1KMQA 3PEUA 5FFMA 4HB4A 3M6AA 2FA9A 2XSZA 4A1FA 3QOFA 4XIGS 2CLCX 3M0EA 3ZS8A 1KYIA 4A82A 3VR2A 3KX2A 2F1IA 4FMBB 1U8YA 3C5HA 5GJVC 4A8JB 3CO5A 2WWYA 2ZTSA 2ZJ8A 4XWKA 2VHQA 3TGPA 2F1RA 2QE7A 4KFSA 5AJXA 2VO1A 3ASYA 4AY2A 4NCHA 2B7BA 3IHWA 4JLNA 1XWIA 4LYFA 4OHZA 4IOKA 1JPJA 1XNJA 4OI1A 2EFCB 3LX5A 4IDPA 4A15A 4R2IA 3Q72A 1N0UA 5J4LA 5CM8B 5E4FA 4PSKA 2ZPTX 1XMJA 4A0GA 3RC8A 1AS0A 1JPNA 5FBVB 1SXJA 3A58B 5CLLA 2IEZA 4W5JA 4AWXA 3H1TA 1G3IA 3CZPA 4B74A 3NEJA 4GSYA 4UNQA 5EXPA 1SGWA 5P21A 2AFIE 1JQLB 2ANCA 2JJ2A 4LJ8A 4DT1A 5L3QA 5FTKA 5DI9A 3EZ2A 2C98A 3DEFA 2GJ8A 4K46A 3SU8A 5JWOA 1KNXA 1E2JA 1GRQA 2EW1A 4TLBA 2ZSAA 1OKKA 1E4VA 2RGXA 3JVVA 4ZDIA 2IYTA 2BDTA 2HF8A 2RGDA 4DT1B 2IHBA 4ZO4A 1GKIA 1AKEA 2EFHB 1K6MA 3TK1A 1GVNB 2RGBA 2WWFA 4K81B 4BRUA 1C9KA 1HURA 3IEUA 2HLDD 3PUXA 2GKSA 1GITA 5G53C 1FTNA 1ZC3A 3NBZC 1XU4A 4UJ3A 2V1UA 4OK5A 3WNDA 3BGWA 1WA5A 2BVNA 1TEVA 1DAFA 4JYBA 3IQWA 3NHBA 1SZPA 2OAP1 4OK3A 3WXMA 4ZDJA 4B2IA 2NGRA 4H1UA 3BK7A 2YOGA 4M9ZA 1W36B 4L9SA 4S35A 4DCNA 3RRNA 3UPUA 4I81A 5FOVA 3AVPA 3QKTA 1NVUQ 1ZM2A 3X1ZA 4CEIA 3MAAC 4I4LA 3CRW1 2CHGA 2ZSFA 4B43A 2O8EB 1WBDA 2XOKA 3GJ3A 1NN0A 4JMPA 4M4SA 1NF3A 2XJ9A 3EARA 3W8NA 3PUVA 1YZGA 4XTCS 4QBFA 1XPUA 5KNBA 1CRQA 2KWIA 2EWWA 1OIVA 2BBWA 2XJ4A 1T0JB 4BLQA 1RKBA 2GCNA 1ZVQA 2EYUA 5IRCD 1S1CA 3I92A 3AVVA 4LHVA 3SC3A 1AIPA 3B13B 3T35A 3H0KA 3RC3A 3OIVA 2OSBA 3BFVA 2PX3A 4JYCA 4WIAA 5AUOB 1N5LA 1H65A 3ZVRA 1SVWA 2QPTA 2CCGA 1F48A 1AJEA 1EFUA 1U9IC 1OH8A 2R6FA 2WKPA 4QHSA 4JVLA 1VCIA 2V7QD 2Q9BA 2J41A 2WM9B 4C0HA 2BMJA 5FPHA 3MSXA 1N0WA 1PUIA 3R7WB 4PC6A 1IN6A 3PR1A 4M22A 4B3XA 1JR3E 2QM7A 2ZRGA 3UANA 1DTSA 4KVAA 4RJLA 5FBWB 1XD9A 5AWFC 2F3TA 2CHQA 3TH5A 3U5ZB 4AI6A 3G5UA 1FX0A 2GNOA 1M8PA 3N2IA 3FE2A 4EPRA 2P65A 2R62A 4YXWA 1ETUA 2IHYA 2AR7A 3W5IA 4QGAA 2LWIA 3A4MA 2ZRHA 3W8RA 4JVSB 4U5XA 3RSOA 3K9NA 1NSFA 4BEBA 4MGKR 5JI3E 3IKJA 4KBGA 5LBIA 4BZQA 2BKEA 2H18A 3R20A 2OT3B 5IF9A 3SDZA 1NSTA 2GTPA 3W3AA 4OHWA 3W5JA 2JJ1A 2RGNA 1VIAA 2FOLA 2G6BA 2ZVPX 4GZMA 3K0FB 2Y8EA 4KJZA 4V0ME 1DARA 2X77A 2VP6A 2GJKA 1DADA 3RHFA 1G1MA 1OW3B 2C8VA 2IF0A 2HEIA 1ZMXA 3DL0A 2EVWX 2JDIA 1T3LA 4N0DA 4QGGA 3SBDA 5JJKA 3NWJA 4QBGB 1IY1A 4QNMA 5JCPA 4XTRA 2DFTA 3A37A 1E9AA 1XF9A 2J87A 2XNSA 2WVJA 3DM5A 3JZMA 2CLSA 2OILA 4GP6A 2AN9A 2IYVA 2DFKB 4XJXA 4DZZA 3K0SA 4V02A 1II9A 2Q9AA 4DCVA 4EFNA 3M4YA 2PZGA 1E3MA 2QT0A 1XMVA 5JLJA 1EESA 1IOZA 5EE5B 2CBZA 1ZUHA 2QGNA 1CXZA 1E1RA 3EZ6A 2ZRKA 1BYUA 4D26A 4QM6A 4HLUA 3SQWA 3DVLA 4AK9A 4DLTA 5G3ZA 3B78A 3TLXA 1DBSA 2GESA 3KJIA 3TUJC 4ZV4A 3KQKA 3PCRB 421PA 5ELXA 1D5CA 4IFBA 1F5NA 3VR6A 2IYQA 4C0QC 4EAQA 2RGAA 4Q4AA 2ZJZA 1LFDB 4PQYA 2FGKA 3U60B 3LNCA 3IILA 1SQ5A 4TYWA 2FU5C 5CK5A 3RDPA 1R0WA 4L16A 1X86B 5DSZA 3EXAA 3QVUA 2H7VA 2OEPA 3P27A 1WRBA 2ZI5A 4GOJA 4B73A 1X8KA 3FHTA 2Q6TA 5DN6D 5TV2A 1R4AA 2GK7A 4ARZB 3C5CA 2IUTA 3DMNA 1VECA 4BPBA 1W0JD 2NO0A 5H1YA 2DY1A 4WW0A 1VCOA 4D2IA 2BEJA 1G5RA 4CGZA 1KJWA 2C9YA 2E1RA 2FPLA 3B60A 4BECA 1TL7C 2PZEA 5JS7A 1G64A 3AP3A 1N6KA 4OQLA 3ADDA 2N1BA 1OYYA 3FMOB 4C0SA 3MCAA 1UKVY 4RD4A 3Q5DA 1L4UA 3V4FA 1KNQA 2Z43A 1W5TA 1FTSA 4LJ6A 2ONJA 3OEED 4IDOA 4TYYA 4IVQA 1ZRHA 2FFHA 1GG2A 3N2EA 3THYA 1HE8B 1S9HA 3NH6A 2P6RA 4FMCB 2RHDA 3AVWA 1W48A 2BKUA 3ADBA 1SXJC 3VX3A 1FUUA 3QI2A 1NMXA 3ECCA 3HDTA 1DAKA 4Q1BA 4IVPA 4TN1A 2PCLA 3I62A 3NG1A 1NLFA 4Q01A 5E7IA 4DXAA 1ZYUA 3TQCA 1NVWQ 5FTNA 2QGZA 3GLGE 5D3MA 1NVVQ 4A2PA 1HYQA 1YKSA 1XJ0A 4KFTA 3W3ZB 3EZ7A 5GJBA 2QM8A 1XEXA 4N3NA 4CEHA 4B75A 4I99A 5FUXA 4CT4B 3BB4A 5LB4A 4L8GA 4GP7A 3SS8A 1RRGA 3FWYA 1H8HA 2JLXA 3AVTA 5B57C 2W00A 1IAQA 2ODNA 1CR0A 2VBCA 2L0XA 3A1UA 2C04A 1DOAA 4NCNA 1E4YA 3V9PA 5CDFA 3ZLJA 4US0R 1Q1EA 3L0SA 1HE1C 1VKJA 2IXGA 2WPDA 1NG9A 1NLZA 1II8B 4YMSA 2QMOA 2CNWA 3N70A 1JNYA 4TYPA 4NYJQ 2J0VA 2H57A 2ZS8A 1P9RA 2OCYC 2FV8A 3EPLA 3VR5A 1OXXK 1M74A 3OF5A 3RS2A 4D4MA 5EE3A 4Q03A 4DEXA 1J8MF 1LS6A 2ZYTX 2OBMA 2ZS9A 4IVRA 2REOA 2BCGY 3AF1A 1UFQA 3SYNA 5AUPB 2ZJ2A 2D2EA 4F7WA 3HPQA 1RVDA 3U3OA 2G1JA 4B6FA 4DKXA 2A5JA 2HCBA 2QMUA 1IQPA 4MYHA 4DLWA 1ZU5A 4BLOA 1KI7A 3K70C 1XTKA 4M9XA 1SXJD 2IL1A 2GF0A 2ODWA 1XTQA 3B82A 1NI3A 1TU3A 1WCV1 2DFLA 3AF0A 1KO1A 2IWHA 1E32A 1WQ1R 2ZRFA 2YZ2A 4TMTA 3RANA 1E69A 3KJEA 3KUCA 2JJ2D 1KAGA 3PFIA 1P2VA 3QF4A 4PPNA 1IY2A 5FUYA 3W6PA 5KSZA 1A2KC 3K53A 1G20E 3BXZA 1P5ZB 4YLGA 3T61A 2BEKA 1OKKD 1G21E 4GPTA 4WZAE 1QF9A 1BIFA 4UNRA 2ZI6A 3AKCA 3QF4B 1QHIA 5K8TA 1IN7A 3C16C 4TWZA 1Z0JA 1S3GA 1SVOA 1W36D 4R98A 2ZM5A 1NJGA 4BGDA 4OHYA 1XEFA 4GMDA 4TTQA 3NDBB 1S96A 2VP2A 1AN0A 1E9FA 4C0AC 3SFVA 3QKRA 5EP1A 4ERNA 1P61B 1Z28A 3FHCB 3VNUA 1KMHB 1RPZA 1IXZA 3TBKA 4QKQA 5FTLA 2Q0HA 521PA 5BYKA 1G3QA 4P4SA 1U99A 3B1VA 2D74A 3U3JA 3ZZ0A 1F2TA 4V0LA 1L2TA 3LH5A 4IDNA 2XOKD 2ECKA 1D8TA 5CLQA 1G7TA 4MRSA 1TU4A 1MRNA 2PH1A 3CF2A 2QMHA 4P4SB 4PPGA 1QHGA 3NKVA 3VAAA 1EFHA 3T34A 3TRFA 1IN5A 3MRSA 1F2TB 4WA7A 1DELA 5HCIA 1Z08A 2PMKA 4FMDB 4ZIRB 3GJXC 3QQ5A 5ANRB 4EIWA 1KI9A 4M1KA 5DNYB 5FUVA 2BBOA 4FN5A 2WSSD 5KDLA 2J0UA 3CRQA 4MH0R 4DVGA 2YKGA 1CJVC 2NTYC 5CK4A 3ASZA 3QPVA 4LX0A 4AYWA 1OT3A 4KXFB 4Q5IA 1D2EA 4F93B 2KSQA 4IOLA 5E3HA 2HYIC 3KKOA 1A82A 3KTAA 5EP4A 3DHWC 4US1R 2CL0X 4DLYA 1PLJA 4D0LB 2C5LA 2H5EA 5L3VA 1XXHA 3HYRA 1XCPA 3MFYA 1YZQA 2VSXA 3X2SA 3GLGB 2GVDC 4Q7LA 4DDVA 3OAAA 1W0KA 1ZCAA 4JLBA 1H8EA 1KO8A 1R5OA 3KTAB 4TMVA 2P5TB 2GETA 4PQRA 2DCUA 1MRSA 2GZDA 4PAQA 1K8RA 1E2EA 2H17A 3RNLA 2W6JA 4C9BA 3E70C 2IBMA 3TW8B 1CJTC 2JJ1D 5EXTA 2YWFA 4EDHA 1YZTA 1US8B 4ZDWA 2GRJA 2FG5A 4AYXA 1UBFA 4D4LA 3FMIA 2CXXA 3O8BA 4QNRA 4TLAA 4HDQB 2JDID 1GRRA 1N6OA 1G18A 1YZKA 1OFTA 1R5BA 3GLFE 4XWAA 2R6DA 5DISB 1F2UA 1MO5A 3KXLA 2YHSA 1ANKA 4PC2A 2WWGA 1ZD9A 2NIPA 1M7HA 4ON9A 2IXFA 4Q4JB 2JLWA 3D6TB 3T06B 1JR6A 1ZNXA 5KTYA 1GFIA 5BWMA 5SZIA 5CB8A 1TPZA 3RS5A 2ZR0A 1DG1G 1QVAA 1AM4D 2O52A 3RRMA 4LYJA 4JLMA 2YOFA 2GCOA 1HTWA 1GL9B 2P5SA 1E1RD 1OXTA 5DH9A 3EG5A 1EFTA 5IHPA 4H9GA 2AD5A 4MRRA 4BASA 4DJTA 3S1AA 1E79A 1IY0A 2XTNA 4PSAA 2ODEA 4IFEA 4TLDA 4QBIA 5DIFA 1F60A 1PLKA 3B8HA 1W5SA 1NY6A 2GCOB 1KTVA 4C2TA 2WKRA 2WWXA 2P6UA 3O47A 4A0RA 4MGYR 5FPYA 3AEZA 2ZAMA 1SXJE 5C4GB 1NKSA 3BE4A 3FFBA 5F3WB 3K9LA 3SJAA 2I1QA 1AGRA 2D2FA 2PEZA 1KI3A 2NO7A 3BORA 1II0A 1GKYA 4HB2A 5FPSA 1MO3A 5EUMA 1G7SA 1ZAKA 2ZSEA 3SJBA 2OBLA 1E9SA 1BKDR 2OLKA 2QAGA 2EWVA 3UMFA 1HQYE 2KBEA 4TL6A 3B1YA 4I1OA 5EP3A 4AIIA 4CW7A 2CVHA 3CH4B 2IXEA 5LD2C 4LGMA 3BFXA 1OFIA 1UKYA 1NNEA 4DDUA 4LJ9A 2IYWA 5KHOC 1XEWY 4G0NA 1JBKA 2YYZA 5FTJA 1T91A 2AXPA 1TF7A 2GJSA 5KU1A 4MYTA 2RCNA 2O8DB 2G3YA 4IOMA 1SKYE 1R10A 2XTMA 3M1IA 2C99A 2J9RA 1KI6A 1QHXA 3QNUA 1XTIA 3GP8A 2BBTA 1G19A 1W44A 3EASA 3WBJA 2HXSA 2YWGA 3LX8A 1T4GA 1Z22A 1L8QA 4TZ0A 2P67A 3R9IA 4QC2A 5J5CA 4UXJA 4B71A 2VL7A 1OXUA 3A1WA 1N6NA 1WBBA 4PHHA 1U0HC 1CBUA 4HZUA 4BFZA 3VKHA 1XZQA 5JECA 2QZ4A 5KOYA 1VHLA 4Q66C 4GL2A 3U44B 2ZE8A 1HH4A 2WWHA 4JKYA 4LYAA 1MT0A 2CEAA 2IYRA 5JBQA 4MKIA 3ND8A 3UMSA 4KSCA 5IK2A 1M1YE 4HZUB 4TL8A 3LXXA 3T1OA 1X8JA 3C8UA 4G5RA 4AKGA 1N6IA 1FMLA 4QHTA 3QKSA 1RZ3A 1P9WA 5IDVA 4BE7B 2WPDD 1CRPA 2PT7A 1KSHA 2MSCB 2CNWD 4PR0A 1ZNWA 1YE8A 3CWZA 4W5WA 4U00A 4TQAA 3I8XA 2HT6A 1IN8A 1E0SA 2YWEA 4M1YA 2BMEA 2JLRA 3LA6A 3QKSB 3CRMA 4DIDA 1E9CA 3K0EA 5J40A 4OHXA 3T15A 1U8AA 1P73A 4PHTA 3PEVA 2GXQA 3C14C 3F8TA 3L0PA 2WV9A 4X8MA 4XD7D 1N5IA 2PMDA 2FDCA 2UZ3A 1GILA 2H1LA 1VPLA 2DYKA 1ZU4A 4LJYA 2KI5A 4II7A 5BN3A 2AX4A 1HQCA 1GUAA 1E2IA 1FL9A 1CR4A 2W0SA 3QY0A 1EWRA 1R0XA 1IN4A 2R8RA 3GCGA 1G9XA 4MYCA 5G41A 4KBFA 4E07A 2RGCA 2ZJAA 3LVRE 3FKSD 4Q1EA 5HE8A 2IUSA 4LPSA 3WY9A 2W6IA 3AVQA 4LHWA 3BH0A 4Q21A 5K8IA 1VYTA 1YVDA 4NYIR 4Q9HA 4LK2A 3GLFB 1PZNA 3C15C 2NMVA 2PCJA 4NH0A 1ESNA 4HEJA 4O3MA 1I4LD 4R71A 1U81A 2NG1A 5FBQB 4NTZA 2FE4A 2J7KA 2IA5A 3CX7A 2VHUA 3UMRA 2V4ZA 4BQSA 3WRXC 5J4VA 5KSPA 1G6HA 2VLIA 1Z8FA 4PO9A 4I1SA 2G1KA 5EE0A 3Q7PA 2WJGA 4QL3A 4M21A 2O0HA 3P32A 2J5XA 3CONA 3EX7C 5EE1A 2V3CC 3F3YA 4L9WA 1OLOA 4RFSB 1OV4A 4UXHA 1E2PA 3FGNA 1FPMA 3PUWA 1A5TA 1G7RA 1NIPA 3EWSA 1NBMA 4Q9KA 1RE0A 1Z3IX 2JIZA 1C1YA 3CUEF 3WMEA 2I1VB 1HV8A 2BOVA 2XZOA 2JASA 2GEDA 4IXMA 4BLPA 1N6PA 1OPXA 2XITA 1CTQA 4OQXA 4NYMR 1OXVA 2YWHA 3QXHA 3HU1A 4HLCA 4DRZA 1RRFA 3B85A 2WJIA 2ZUCA 4M1SA 2O8EA 4ZCMA 2QBYA 5E7JA 4KITB 1VMAA 4OHVA 2D62A 2RHMA 2ZRCA 1AZSC 4PQFA 3O8CA 2CK3A 4M1WA 1P4SA 3K9GA 2QQ0A 1MV5A 4KAXA 1JAHA 4URYR 4EPTA 3OEHA 1RYFA 3ZVNA 1OXSC 4L5BA 1E9RA 3TR5A 1ZW6A 3HJNA 3B6EA 3PUYA 2QBYB 3SHFA 4LBVA 2ORVA 5AK0A 3RVBA 1GL6A 1JI0A 2XNDA 2QY9A 2YV5A 4PC1A 3HR7A 2J0SA 2HT1A 1Q44A 4XWOA 2LCFA 4AC9A 1SKYB 2ZEJA 1NP6A 1N2CE 3SZRA 4IOJA 2JAQA 5DHFA 4LC0A 3RRYA 3WNBA 2WMOB 4HATA 5EXSA 2F9MA 3LAWA 3GFOA 2FGJA 2RMKA 1T3SA 3R7WA 5GVRA 1AK2A 3QF7A 2OCAA 5FH9A 1Z07A 4LHZA 3KXIA 1GNRA 1O87A 2Z83A 2XEXA 5KDOA 4FWTA 2FSFA 5AJWA 3AVXA 2ORIA 2GAAA 4QGFA 4DSTA 4R9UC 2KJQA 3CKLA 4DB2A 1LS1A 3OAAD 2PX0A 2V1XA 4O2RA 1H8ED 5DE3A 1EFRA 5AJYA 2F1JA 4KFRA 5J4HA 1VG1A 2Q9CA 4WAUA 1KK1A 2W6JD 5M04A 3LBHA 4MRNA 3OIUA 4RD2A 3K70B 1W4RA 5B64A 3RWMB 2QAGC 2ZJ5A 3EC1A 3Q3JB 1MKYA 3DKVA 4JL6A 2VHJA 3VHLB 5J4KA 3IEVA 3K0FA 3SHWA 1PLLA 5FOTA 4P4UA 3GPLA 3U2QA 2V9PA 4B47A 3T1QA 4D81A 3ZYCA 1OFHA 3VQTA 3HWSA 4BFSA 4RD6A
chains in the Genus database with same CATH superfamily
1SVNA 1FW6A 3VO9A 1ID1A 3DPUA 3C5WP 4OHRA 2H8KA 3K0CC 4UHKA 4DA7A 4DCSA 3TVYA 2Z8YA 1JL3A 1O0SA 1OIXA 5AJHA 4PONA 4GO1A 5C2JB 1TU0A 4DILA 2D59A 5BQXA 4ZYLA 5KREA 1JLSA 2ZSKA 2WHQA 3PUZA 3LKVA 2O7NA 3DLCA 1R1DA 1Q15A 3NYIA 9ATCA 1CLEA 4JA0A 2J3HA 1Q22A 4OYLA 5FBZA 4F5EA 4KPEC 3HO1A 2CMKA 3NDJA 4O29A 4D5GA 3VU3A 3I83A 4F85A 3NDRA 3NFRA 4EEXA 1ZSNA 1ZNZA 4L50A 2ECPA 3PYLA 4P83A 5DHAA 1U2GC 4RWZA 4KR0A 2KM1A 3PXAA 1J09A 5CFPA 3ED1A 3D6AA 1BFUA 1JTFA 3BSYA 3TG2A 1XWWA 1XPOA 4L5JA 2AEEA 2AFIA 3R3XA 1JQJC 4EW3A 2PL3A 2IBSA 1SPXA 2CHEA 3AFIA 5COAA 1SURA 2HV8A 1IYZA 2GEVA 2WT4A 4TVKA 1DPFA 5ED0A 2UZ0A 1CUWA 3AM1A 1FQJA 1YAHA 3OZBA 4FCTA 4R68A 2VYFA 4HAUA 5CTAA 2Q41A 4TQ9A 4ZK6A 1ZESA 3EGCA 1ZS9A 1CJMA 3BMQA 3TAUA 2WTAA 4XFDA 3AQIA 3A3YA 4Y1FA 3WWPA 5CD9A 3PD7A 3QLEA 2JATA 4Q7JB 2WJJA 4LBYA 5D1NA 4F4IA 5CW2A 1GFZA 1FFCA 5BNIA 1U0FA 1WF3A 2JCYA 1B8UA 1SOAA 4HNRA 3T9FA 4DJEC 5CAEA 4ZI5A 1M7GA 2IHZA 2LV8A 4F8YA 3ERCA 3IAXA 1I9CA 2DE0X 1Y80A 2QSJA 3I9NA 1TYDE 3OIGA 2A84A 1I33A 2XZDA 3ND5A 4GQIA 5HZMA 2ASEA 2FQWA 4HB3A 4W1RA 4ZV4A 1SUDA 3DEKA 1JIXA 2ZJ1A 1NW3A 5EQTA 3MJTA 1JF8A 3N1UA 1LLCA 3KD3A 4F21A 4W6ZA 5CAEB 4UPEA 1XCGB 4C4SA 2D5BA 4O0LA 1H3NA 3F1KA 3WE7A 3ND9A 3X1MA 4MW0A 1EBBA 1XZMA 1SBCA 5ICFA 2EQ5A 4G89A 3TOVA 5GADl 3MXTA 1YBVA 2Q3FA 1K8YB 2QKYA 2H2WA 3D9QX 4JD5A 3UWOA 4HUTA 1R88A 2ACVA 3ISJA 4DQDA 1P7PA 4P80A 4ODIA 1CEEA 2YWCA 1OJ7A 4WV3A 1BVRA 3MWFA 4GWKA 4G5YA 3WXBA 4HNUA 1ZN8A 4N6NA 2PKEA 2QPAA 3L1IA 4FMPA 3A6EA 1ZOOA 4MPRA 1B1CA 4LYEA 4ZCIA 2J6IA 3IB6A 1RI5A 3UK7A 4RXUA 4OL9A 2FPWA 4M9QA 4CVNA 2DR3A 1G8HA 2GN0A 4Q24A 2JCVA 4XUGB 4Y9TA 2V7XA 5JYEA 2JFXA 1F6BA 1IG3A 1VSQA 5HKKA 4D82A 2G5CA 3WIDA 5ITWA 3H3XA 2VEDA 3HS3A 3VNRA 1DAHA 4KX5A 4D6XA 1G8MA 1XD8A 4R3UC 5AW4A 1DFIA 1P3JA 3JD0A 2IYYA 2PSJA 3PDJA 4KZPA 3RT9A 2HPZA 2C88A 3ZU2A 1Q1QA 3KLPX 3UJDA 3LOUA 4FSHA 4U2CA 3RG2A 1Y8QA 1NDHA 2FSGA 3AINA 1VXOA 3HA2A 5DCLA 2NO5A 1OZ0A 4RWEA 3NDPA 1UKEA 4O4LA 5IW8A 2C5HA 2X13A 4IJ5A 1T4MA 4IXNA 4AROA 1L4MA 4TRNA 2BDUA 3IR7A 3VV3A 3V2UA 2VDUE 1II8A 1E2DA 2QRNA 2WUWE 1Y8QB 3DE5X 3WLOA 4RZUA 1R0ZA 1BDBA 1WDLA 2PT6A 3B7GA 4EK9A 1KH3A 2JFGA 4O4LB 3UATA 1SUAA 2YXNA 1W36C 2R85A 2ST1A 3KHKA 2DBZA 3PGXA 4MVJH 3ABZA 3K5PA 2ODQA 2XSZD 4LRYA 3HGTA 4J0KA 4Q00A 3UG6A 3EPKA 4EW2A 1G4UR 5CURA 1XD2B 5TB5A 3U9LA 2WWIA 3KFXA 3HCDA 5EIAA 5JXWA 1BEEA 4EPVA 5CA0F 2AHOA 5JWRA 4M53A 1OWNA 3U4HA 4Y2VA 1YZ3A 1T6NA 3TG8A 5BQ5A 1DWPA 4QUKA 4WTOA 1H2XA 1EUZA 3E3LA 2JIRA 4P7BA 1U8ZA 3Q8XB 4KRYA 2D2IA 4R2XA 3A14A 5GM2A 4XWWA 2BFBA 2XF8A 2ZAYA 2PJRA 1UAYA 3EF3A 1PJBA 4HYEA 4K6FA 3MTAA 4BO6A 5DBGA 3Q2KA 4FYKA 3SC2A 3IBYA 1JMYA 2Z0MA 4UM8B 1I3KA 1I2DA 1B74A 1T5BA 4JC4A 2ID8A 3ZPXA 2H9IA 4AW9A 5JQGF 4MS4A 2ODAA 4JB0A 4RUKA 4O2BA 2PUDA 3VZDA 4MB2A 2BFBB 3L7MA 5UKDA 3U3MA 2PRIA 4JP2A 4OATA 3VDNB 1FDWA 3E81A 4U0KA 3B1XA 1WWKA 4IZIA 1Q0UA 1KGSA 4Z8XA 1UIMA 3SC2B 5I9IA 1FVHA 2XV1A 1Y7TA 4FZ5A 2OA0A 1BROA 3T12A 3QM1A 2BSXA 5IPFA 2CN1A 4G2TA 3IB3A 5EHQA 1CUUA 4MS4B 4B3FX 5HFJA 1L5QA 1G8GA 4FS8A 3I12A 2J9ZB 5BQPA 3A9SA 4B83A 2G9VA 4CNBA 4ZYYA 4Q18A 3FI0A 3EAQA 1ISJA 3C4JA 1TGYA 4ESHA 2XD9A 4YRJA 1Q0ZA 4N0QA 1DDGA 3GDOA 1DRWA 4LJKA 1RQ7A 1GNSA 3T4XA 1EJ0A 1GOTA 3FROA 1G63A 1LCIA 3ETCA 5KHLB 3KQLA 1EJ6A 4F04A 5H7XA 2WFAA 3RVQA 1IY8A 4BIMA 5CLJA 3TSZA 1ODFA 3OZEA 4R9SA 2JLZA 4ZGGA 5E7MA 3HEBA 5IKEA 3D3EA 1UBCA 4DQLA 3LPMA 2JLCA 1KS2A 1Y9DA 3AFMA 3LCRA 4CNQA 4CV1A 5TMBA 3MMXA 2BJWA 2QG9A 2M9MA 2W8BA 2A4KA 4TV9A 3BIFA 1XB2A 3QG1A 1H4VB 1F2VA 2Y0DA 4AF8A 3KSRA 3GU3A 4NNPA 3ICQB 1LNQA 1YB2A 1K1EA 3C7DB 4KLCA 4O2AF 2OL4A 3I6BA 3KYBA 1SBHA 2PXHA 4N18A 5F2EA 3ZV4A 1JLMA 2QJFA 3JQ7B 5L40A 3DDOA 2R6ZA 5EE9A 3DZJA 4TV9B 1M6NA 1LUAA 2P2LA 2V59A 3GVPA 1EHYA 2TECE 3JQAD 4G5GA 4H6VA 4BNUA 4BUJA 1A7KA 1PF7E 1DFGA 2BZ0A 4MJLA 3VDQA 8GPBA 1JG6A 2CDCA 3DG9A 2GPNA 1GSHA 1P81A 3WICA 4INJA 4UHDA 3QBEA 4C4RA 2O59A 1USVA 3V4SA 2J0EA 3LBNA 4PS1A 1YR9A 3UWDA 3T7CA 3WYNA 1YCFA 2NXEA 4L75A 5K3DA 1VYUA 4AFNA 2IU4A 1RQLA 3BWBA 4PICA 3SE7A 4RETA 3SFZA 1N8TA 2ZLBA 4PSCA 3Q0IA 4B32A 3PVSA 2FP4B 3CIFA 1YE3A 3P9IA 1P0CA 4YRAA 2UV8A 4GGOA 1OREA 1R9NA 2Q46A 3UXMA 5DM1A 2CW5A 2QP3A 1B0UA 1CY6A 3DSRA 4K6HA 4TWJA 3BVPA 4D79A 1GNLA 2UKDA 1NXOA 4QUBA 1KFKB 3OF3A 1XLTA 4ZOAA 3BRWD 1D2MA 3HACA 3MGCA 4IDFA 3DDUA 4P32A 1H4QA 3FYSA 1DO2A 2A9PA 2R7NA 3WWOA 1PEDA 2Q5IA 4GAEA 5H5JA 5HVNA 3U6BA 2O8VA 1UEXC 3WFIA 1N5KA 1N6HA 4V0OA 1IPEA 3X1WA 1ISSA 4HLUC 1EK2A 3NIDB 1GYPA 3H6GA 1QS0B 1KYYA 1SHZA 4KH0A 2HFJA 4YT8A 4C0BA 4TMXA 3E0XA 2ZI4A 5FI0B 4F06A 3E18A 5HKOA 3EW7A 5CITA 3SYRA 1MXHA 4BTEA 1ZC4A 4YX9A 3MNFA 2P6MA 1RWBA 5LJLA 2W8ZA 1EE9A 3DMFA 4FQ7A 3UAVA 2I67A 1N4DA 2E87A 3OEYA 3LBAA 4C6RA 2WIFA 4M0EA 3QYJA 2E7ZA 1LU9A 2BRUA 2N46A 4EB6B 4P4TA 1RYNA 2XQIA 2Z4TA 3BAZA 3EFOA 3IAUA 3K4PA 4CQLB 2H4JA 1I2ZA 3AF3A 3AB3A 3HJCA 2VJOA 3WYFA 1AN9A 4EPWA 4G1VA 1FUKA 1USIA 1AQIA 1LTQA 2Y1FA 3I4CA 3K8OE 4X71A 2SHKA 3ELDA 3H0EA 3DZIA 4KO1S 4NFLA 4WBXC 4BFCA 1ZVMA 2YIVX 3EA0A 3GRYA 1SZJG 3IPCA 4JI8B 1VG8A 2P9QA 2V7QA 1MQAA 3SJ7A 3MA0A 1A9TA 1Z38A 3D3KA 2WIAA 3AP2A 3SZLA 3PUIA 3TM4A 1EDBA 4L4YA 4NYJR 3CX3A 1A5AB 1HNXB 1QP8A 4EX6A 4HFRA 4NY1A 1SKQA 1J1UA 3PPIA 4YTEA 2VF5X 1Q19A 2I7VA 3FFXA 5KO2A 2IW3A 1Z9BA 1LBQA 1X7WB 2HRDA 3L93A 1NRJB 4G3XA 2FJ0A 2Z4SA 1HE4A 4FJ1A 4BY9E 5JVDB 2EFEB 4QT0A 1GEEA 4XRRA 2L19A 5AHXA 1Z4KA 2I4IA 4JLKA 1M8JA 1UBJS 3SS9X 2IYSA 4TYNA 2JANA 3BJRA 3DGEC 1AGXA 1B8OA 1NAIA 3KJHA 4KMMA 3KWMA 4RCYA 3M2TA 3CLVA 3MWGA 3I58A 1G7CA 1TEHA 4HWKA 4M55A 2IUUA 4B6OA 1V4BA 3I73A 4XLLA 2XRMA 3HM2A 4ND1A 2Z6QA 4F9GA 4WINA 3Q15C 5CLHA 3U80A 4BLVA 4JS0A 4LSGA 3GMTA 3LW8A 4IJWA 4KHZA 4K26A 4RFLA 3VO2A 2LIPA 3ENZA 5DNDA 2DHQA 2C5SA 5IP5A 3EDMA 3TKLA 1FFHA 3SZ3A 5H82A 4GGMX 3JV7A 2FPKA 1T2AA 5DCWA 4D3SA 2CXSA 2VJBA 2ZBUA 4D0RA 2GFIA 1UBTS 1L0BA 2BEWA 1COZA 2A9KA 1YI8A 1THTA 2G77B 4CIAA 2WF5A 2C94A 3K6SA 2DUUA 2GBLA 2H7XA 4GMFA 4KAJA 4ER6A 5JCXA 3UMYA 1OZHA 2BMWA 1G21B 1G6OA 1QZXA 2DBVO 2QOEA 4GEGA 2VYQA 2W22A 3WP1B 2LKDA 5LZ9A 2PSEA 4TTAA 2C9CA 1EI9A 2GYWA 3QYAA 5B7GA 3JRWA 4P7FA 5CG2A 2OQVA 2FZVA 2HMAA 3VKWA 1S01A 3K6SB 3VKUA 3OP1A 1CF2O 1H22A 4DXDA 2ZKLA 1NT2A 3MUNA 1K6XA 4EQ6B 5AM4A 1OXKB 4YREA 3UUEA 1WJGA 4L8WB 3MMNA 1U5CA 2PKQO 3IQGX 1ZHFA 3MFQA 5TVKA 1VIVA 3EGDB 2NNWB 1NATA 2VRWA 5THXA 3AY0A 2OTCA 2VTVA 3CN7A 4QG7A 5EVCA 3U39A 3PGMA 4MVJA 3L6DA 2P1ZA 1FYXA 2GI4A 3C3XA 1OBCA 4ZVSA 1IQUA 1O96A 221PA 1DAGA 1WZUA 3FX2A 3GJRA 4ESVA 4WFKA 3I8SA 5MFPA 1SCJA 5MGNA 2K4MA 2ZZMA 4CIDA 1D6JA 1QYDA 5K8CA 4KWHA 1ZNYA 2W2LA 1SHJA 4MJ3A 3M6WA 4TRJA 5TF0A 2Z6UA 5IXJA 4HSEA 4NENA 2HX1A 3TW0A 1V96A 1C7RA 1Q12A 4PVCA 4BMYA 5KSPA 1Y5IA 1OB5A 3AONB 2P4SA 1Z0FA 2AI3A 3AUKA 3PC7A 3ET4A 2R2AA 1RYDA 4UQLA 3CNNA 3NHJA 3NO4A 2PZJA 4PQEA 5AHKA 5HZHA 1D7OA 1NW9B 1X13A 5KIAA 1QORA 1T2CA 2UZAA 3R0IA 2V6MA 2CJXA 4LE2A 4DUGA 621PA 3EEFA 4JJZA 1PG5A 5FBLB 2W37A 4CR8A 4IGAA 1JR3D 1K6JA 1I1OA 3LYHA 3P7MA 3W9UA 1Q1GA 2GZHA 1U2SA 3H87A 1THMA 4YAOA 3ZCSA 2FP3A 1P6XA 4QARA 1K0UA 2CFOA 2WTXA 4UHJA 1WQ4A 1SC4A 1LRJA 1M2KA 1VB5A 1W35A 2CVFA 3HBJA 2PKCA 2NPFA 4BMSA 1PG0A 1J06A 4NBLA 2X4IA 3FDZB 2WICA 2IDJA 3OTHA 1D03A 4HGQA 2WAYA 4JA2A 3LWBA 3VYUB 4F71A 1YIOA 3AUUA 3BKXA 2ZJOA 3O3NB 3R8XA 3RUDA 5JHHB 5BSWA 4YUAA 1DXYA 4CM6A 3B9PA 3H2IA 1GKKA 3H1BA 5J5AA 4R1LA 4BLSA 3HNOA 3KTOA 1ETHA 1OBFO 2HK9A 4LS3A 4ZC1A 3L7CA 1N1DA 2DUWA 2Q4RA 5B3AA 4DYVA 2Y0CA 3CNHA 2QN9A 5CDTA 2ZUFA 4ZVNA 3CLSC 1BMDA 3DAHA 3KAKA 3N05A 5BP7A 1VJ5A 3NTUA 4RO0A 4MDFA 3IQXA 1TQDA 1C80A 4I50F 3M82A 1W5BA 4DEVA 3HYTA 3B3FA 3TTVA 3LWNA 1SCKA 3UTDA 3MC1A 1M1NB 3I4FA 1PEKE 3ZGZA 3DZFA 1BMFA 4M76B 4X94A 1C8VB 1XJWA 2AFHE 5AUNB 3GLFA 1MVOA 3QI7A 1UJBA 3BWYA 2W2VA 4AURA 1U0BB 1MB2A 3D7KA 3VPDA 1XE3A 1JVSA 5I3CA 3KSUA 4YS6A 3KJNA 3QENA 4X20B 4MWGA 5TX7A 4QPPA 1DLIA 1Y8AA 3NCHA 2VP4A 3GLHB 3VDRA 5CGZA 3N0WA 1P1RA 1ZHHA 3DXZA 4LCEA 4MEAA 4AO8A 5FX2A 3HXPA 4FIDA 5DCYA 3QFSA 4V03A 4FBMA 1H6AA 3LHIA 3NTLA 4RKYA 1NNSA 1R5JA 1S2DA 1UMKA 1QFZA 1TM5E 1U5AA 1PK9A 3KT3A 4TQUS 3UWSA 3AF6A 5FOWA 3WQSB 4RFSA 1TADA 2HGZA 1DSSG 3FRJA 4OLBA 4YCSA 1ISPA 2C92A 2DVMA 3FG9A 2BUAA 2J32A 2X9LA 4BBPA 1U4NA 1Q0PA 2I34A 4BVEA 3T41A 1MA0A 1HE5A 5MF6A 3M9WA 2PUEA 4DBLC 1MENA 4BIIA 1DJMA 3I1YA 3HFSA 4K9QA 4J90A 3BGSA 2SKEA 4ZRMA 5E7QA 2X23A 1WB6A 2R1VA 4GYYA 4HGZA 1JEQB 5H0IA 1MH1A 4D43A 4YAFA 3R5JA 4TM7A 4B6SA 1TQ4A 3V2IA 3CU5A 4BQEA 4AZ0B 4C3OB 3N8GA 1JHUA 5CMLA 3QPUA 3CFYA 3PJDA 1LTHR 1RXSA 3W9YA 1RAFA 4H59A 4XSHA 2EX4A 3CLSD 2Y77A 5KC8A 3H2JA 1BKYA 4KKXB 4LHEA 3UT0A 4JX9A 4NK4A 4OHMA 4ERXA 4S04A 1VLZA 2PPVA 1ZD3A 4HFMA 3KQWA 4KLNA 1KR2A 5HGXA 1AGYA 2TMDA 2BM9A 1P0MA 3IV7A 2FK8A 4NMXB 1GDTA 1UODA 3PF8A 3TEJA 5GV8A 2DPXA 2XXJA 2VJNA 4AJNA 5G0SA 4LZAA 4WK2B 5DRTA 2YNMD 5JSQA 1E61A 1F12A 1MTZA 2DUJA 3AJ8A 4Q3CA 5L7TA 1LPSA 1T1GA 2RK4A 4XQGA 3SY8A 4FE4A 1K5HA 3RK0A 1KVRA 3P2OA 4UE3S 1SUBA 1ZCBA 3C98A 3OZFA 3PLNA 2Z3ZA 1SR8A 3RWOA 5JNTA 3C6MA 1Y4SA 5CLGA 5JD3A 1IM2A 1FU8A 1NF2A 1I6MA 4EFLA 3T8YA 1E6UA 2XODA 3K31A 3HR8A 3O3OB 1GFWA 3JQBA 3E7PA 3N75A 3AF2A 3WK8A 4AJHA 2ZB4A 2GLXA 1Y1TA 3QXCA 4PWYA 3IQDB 3VH1A 4JODA 4U7PB 2QRZA 4RQUA 1G4AE 3JYLA 2B4RO 4E70A 5JMTA 3OQPA 1Z25A 3PX2A 2OHFA 5K99A 1Z63A 1U2PA 3DGFC 1CR1A 2YUTA 3EDQA 4U7HA 4DANA 3GUCA 2E85A 1B15A 2YY5A 2YXDA 3TW4A 3S2FA 1M1YA 1XQVA 3HA5A 2FXVA 1JG3A 2FWMX 5F7JA 5K01A 1AY0A 2WSMA 1VJTA 1CFJA 1PNQA 3VC7A 1Y6FA 3BSWA 1W0KD 2O2XA 2CE2X 4ETIA 3MIIA 4GI7A 3W8DA 1W7AA 4GLLA 2G7ZA 3EHDA 1UKZA 2R6CA 4B0OA 1M1YB 4B76A 3PFNA 3SHQA 5E4YA 1KI8A 3SVTA 1KKUA 3E5RA 2WSSA 3RGGA 1SCDA 3PX7A 1U65A 1T6BY 2F3SA 3N0XA 1DU4A 2G4VA 5BOVA 3B38A 4RPCA 2P75A 3LPNA 4D3FA 2D0OB 1F6WA 2DQSA 3FWHA 4UDNA 4J7AA 3GX1A 4UMFA 4EELA 1YQQA 1YJBA 4D3DA 5FTMA 1X80A 4KRGA 3FCXA 2COKA 2F2TA 2QP9X 1A1SA 1E92A 3CZAA 3MLAA 4HDNA 1D1QA 1V6SA 4MLZA 1X7ZA 1I3OA 4Y6QA 3ZU5A 2R6R1 1TIPA 5DBHX 3U4MA 4PLZA 1OHHA 2OFWA 1ZA2A 1DIBA 1NURA 3P2YA 2IEYA 1QP7A 1PFYA 2XCIA 3HU5A 4RULA 2CDNA 4H0FA 1X80B 3CISA 2IH5A 4X8LA 4Z53A 2SNIE 4BNYA 1SXQA 1X7ZB 4UOEA 3A6KA 5KOIA 1WB9A 2BTOA 3M9XA 3OE5A 5A4IS 3OM1A 1NSYA 2ADOA 2B1IA 3C3YA 2XVAA 3N2LA 4UEJA 1J0AA 5FI1B 2ZSDA 4Q0MA 4LG1A 2ZUSA 4A2QA 4DZRA 1U6KA 4Q15A 3CEMA 4G8DA 5FULA 4RDXA 4ZI3A 3L0OA 2D5CA 1NTRA 3I2FA 1Y34E 3OIYA 4D0GA 3AVUA 1P72A 2D5IA 4JN6B 4G1UC 3G8YA 3MLEA 16PKA 1QRAA 1BS9A 1VPWA 3BRCA 4OA8A 5HPYB 3BHMA 2ATXA 2MU1A 3SZUA 2IY8A 3D31A 5F21A 4H7DA 1CP2A 1RW4A 5L4LA 5I5EA 3I76A 3ZCTA 1FS5A 1XZCA 3OX1A 5ENDA 1GTSA 4GW3A 4PG4A 2C3OA 1DKQA 3ZXSA 4Z7NB 3EXHA 4ZOLF 4IF4A 1JAZA 3UHPA 1J5PA 4N03A 2PUJA 2QG6A 2NTEA 1YULA 2JFOA 3LO5A 1OI2A 3M70A 3E9QA 1XRJA 4KNVA 4OAPA 4PE5B 2H9YA 4ZEWA 3RFVA 3V5NA 4A0HA 4CUJA 3ECAA 1ISHA 4M0UA 2ZS7A 3Q2OA 1WMFA 2OHHA 4PWZA 1U98A 4E22A 1PYGA 2XAUA 4PCUA 1L4YA 5IABA 1C30B 2ON6A 3IT0A 3KTDA 4HN4B 3WYCA 1QLHA 3ZZ1A 2QLBA 4CMBA 2FRDC 1AQNA 4DCGA 4N65A 3GJ0A 3FPAA 2JI7A 5M34A 3I23A 2V5UA 3FCCA 3G9ZA 2R1UA 3IA2A 4Y6GB 3U3ZA 3Q7SA 2QQEA 4EUKA 3CCCA 3KQVA 1M83A 5GVSA 1HDXA 4R7ZA 2O5CA 5KWVA 2QK4A 1WVGA 2AUTA 1R27A 4Q19A 1T8UA 3RS0A 5HXAA 1OH7A 3PXXA 1QF7A 3G79A 4XUDA 1G5IA 4XLTA 1RAEA 1GUBA 2VJCA 3E7WA 4MTLA 4PGHA 3K9QO 2G76A 3KYIB 4R1SA 3DOIA 4P86A 3LHSA 1CJUC 3I6IA 3TR6A 5A4JA 1YDWA 3DAYA 2K5UA 4B80A 1V16B 4D99A 1T8PA 3B5JA 1DZIA 1P7WA 4Q4AB 2XIJA 3C5EA 3K2EA 4PC7A 4I4TA 4HUJA 2ZBGA 1WCIA 4MV9A 2AZMA 5HEKA 1MIOA 1JFFA 1CSEE 1RC8A 1J0BA 3I04A 3A6PC 1SOWA 2PXCA 3CPHA 4MW2A 5JSZA 3INNA 5FPQA 3WSWA 1BWPA 3EISA 4B3SB 2CLOB 3ILXA 3N86A 2NNLD 3C7KA 1M2HA 3RJMA 2LCQA 4XASA 2C2OA 2ONKA 2CLFB 5KNDA 3T7KA 1DL5A 1VL8A 2BGKA 3DR3A 1SCBA 3ZWNA 3GA7A 2BMFA 3TZ6A 2WFLA 3VYVA 5IVKA 1N36B 3E5HA 1EP1B 2AOWA 2G17A 4G0XA 4W7SA 4WVFA 3UGTA 4YRBA 1RFGE 3FVWA 3VOTA 2VNKA 1ZUNB 3ZCUA 2M1XA 5BYJA 4FNMA 1SULA 2A9OA 3PBKA 4OGLA 4CFSA 4WXPA 3RVNA 3CG0A 4QUJA 4HPJB 4YMUA 3AR4A 1DI0A 5LZ4A 1GRVA 2EHDA 4UNPA 1TFUA 3FPJA 2GZRA 2YS6A 6Q21A 5JXJA 4C0LA 6GPBA 1ZXBA 1ZJ4A 4GI3A 4KPUB 4DSAA 4FCVA 1DO0A 1LSSA 3AR7A 4KACA 5IDWA 2VA9A 5E6UA 2XKJE 4OGKA 2O3RA 1DWUA 2ZITA 1L5SA 3BB3A 3G0GA 4M2LA 3DMDA 4TTPA 4DPMA 2HKIA 1LDYA 3QPWA 1X9HA 2C5EA 2ZJBA 3LUHA 3VH4A 5AR1A 5JJLA 3FUVA 5KVCA 1CF4A 1JE1A 1YFKA 1DG3A 1N3BA 3IESA 3SZMA 1CJCA 1QVZA 2I6GA 1XEWX 2P3LA 1N1GA 1C9MA 3IQEA 2Q7XA 4R8RA 4B3DA 4QYSA 1OFGA 2JD2A 2NV0A 2AUNA 4V0KA 1RJEA 2H31A 4IFTA 5T6BA 5T8KC 4RKWA 5HF6A 2NO4A 3THSA 4AY4A 5FORA 3DE6X 4UNNA 1XEXB 3BXEA 4QJ5A 5TXGA 1J7KA 4UPVA 1JALA 2P9CA 2BZ1A 4V0MA 4UOQA 4PF1A 3S7ZA 3ZI4A 3BG5A 4Z8YA 1N6LA 3BF7A 2FFRA 3FOEC 4KB5A 4C7OA 5DLYA 5D6NA 1BCSA 3A36A 2L42A 2HWWA 5EIBD 3SM9A 4Y2RA 4B44A 1G291 1O2DA 1LBTA 2AR0A 2VDVE 2GD0A 1T24A 2VOJA 4W4TA 3ZWCA 1PWHA 2Q50A 1A9SA 4PPFA 2DRIA 2B8NA 4XJVA 3JQQA 4IDHA 3KPWA 1YU9A 4KV9A 3O9ZA 1JR4A 3N53A 2ENUA 3DH0A 5MGBA 1KYWA 2RAFA 3M4NA 1YQWA 3DXYA 1L7OA 4HYTA 4YFVA 4PHGA 2XZPA 2XDQA 1HOXA 4V1CA 5CFRA 1TTHA 1VE1A 3AF4A 3HY6A 1HO3A 3CVUA 3TUZC 4L4ZA 3WK9A 3DZCA 2ZPAA 5K6AC 1SUIA 1ORHA 3DKKA 2H92A 4HH3C 3WFZA 2IEIA 5BVGB 2Q8NA 4J0FA 3WL7A 2LPMA 3O38A 1Q77A 4HMQA 1YZYA 4B48A 3PPXA 4NS4A 1KZ7B 2M6RA 3TLAA 4LWPA 3QXGA 1NE7A 4V2UA 2XYGA 2A14A 1H2EA 1FQKA 2BJVA 2JI8A 3TB4A 4GPBA 2KS6A 1H4SA 2NZXA 4NQRA 3BJIC 3LXUX 4K28A 3KQPA 4RVGA 2VXYA 3KPJA 1Q2UA 1HBJA 2HCJB 2VSFA 3CKKA 5JZBA 3C87A 1IWOA 1KOJA 1ORDA 4IX1A 5DJ5A 4RYLA 4YMHA 1EFAA 1GPWB 3ZHUA 3H4MA 3QFHA 1AQUA 4L3WA 3M83A 4WDRA 4IJUA 2DBYA 5E8RA 1DJPA 3HNRA 2I62A 1IWPB 1F8YA 3OEHD 4R6XA 3F6BX 4ASUD 1X9IA 2G72A 2VDMB 1W96A 3LZ6A 4DB4A 5FA6A 5K4HA 3MINA 2QT1A 2CT8A 4G2NA 4ZTUB 2OO7A 4MW5A 5FPKA 1UJCA 3AGPA 1PRYA 1TZ2A 5DLQC 5DK6A 3H11A 2BW0A 1E0JA 4RA6A 5DU2A 2WHRA 3H9UA 5A02A 1IG0A 2I1LA 5DXJA 3DMTA 2QLMA 5GOTA 1XJQA 2WOJA 2YBEA 4FGSA 4Q1CA 2XVYA 3MINB 1HSZA 1ZA1A 3G2MA 3RFCA 1ISGA 3AEYA 3A10A 4IIJA 2YHAA 2HC9A 3AIOA 3F96A 4XVRA 1TRHA 3H11B 5AQEA 1GRNA 2GPJA 1VE6A 3NR2A 3Q3CA 4KVZA 1IH8A 4OIFA 2FN3A 4AG3A 3AHDA 3TQTA 1CR2A 4Y9UA 2GCIA 3EH1A 3U0VA 4PTLA 3TPCA 1ZM7A 1IDN1 2O8CA 2ERCA 3NC0C 1X94A 1L5RA 2YJTD 1AXGA 3K0BA 3RNOA 3WGIA 1K75A 2CNNA 3FLMA 3QVOA 4OFBA 3K70D 4EBBA 3FOZA 3FTEA 4C88A 1CUBA 1QV9A 1FTGA 1YVEI 1EFRD 5TT1A 2OM2A 4HQKA 4URVR 2GILA 3HCBA 3ZVLA 2GO1A 4BVHA 2O8CB 4FEYA 3CEAA 2GXSA 3U13A 2FG6C 3CBGA 3MPUA 2CMDA 1RC1A 4F9TA 4HH0A 1J39A 1J99A 2QLNA 3IXQA 4H0NA 4WASA 8OHMA 3B51X 4KOAA 2AQIA 5D3QA 1T10A 2B7CA 3A3KA 1WOMA 1JIJA 4I46A 2EQBA 3L7OA 1Y63A 3MT9A 2JGMA 2WP0A 2POCA 4L0CA 5KPDA 4TTRA 5JCJA 5I7AA 4R41A 1LY1A 1VL5A 4AJLA 1YXMA 4BZWA 1HT2E 1NKTA 4HKTA 4B4DA 4DJDC 5BWNA 2B25A 3H05A 4FUTA 4GX1A 3EY9A 3ZLVA 1R6AA 4BCDA 1JKMA 1UJ2A 2IHJA 4IIEA 4TQGA 1Y1SA 5E4TA 1P0FA 4D9CA 1U2RA 2X1HA 5FA5A 5I01A 5JBNA 2X9NA 1JQ3A 1Q21A 2WUFA 2ACWA 3FVTA 4TZ6A 2PFSA 2WMDA 2GEKA 4QREA 1SEVA 1XXHB 1NJ5A 2PZLA 3DLPX 2XA9A 3DF9A 1C8BA 1MXFA 2YVUA 1O7JA 1ZEMA 2BYTA 3P9ZA 3N0VA 4GYJA 5L6LB 3D02A 4FFOA 3B6JA 4C04A 2Q4BA 3SN6A 1DUSA 3PUKA 2NYAA 3UH1A 3D2LA 2XKBA 2AOUB 4HEHA 5A4MS 1NYLA 4WPGA 3UK6A 1V9CA 4Q4CA 1E7RA 2WE8A 2X9QA 1M8GA 5FIUA 5JSYA 3RS7A 3GLIA 2X8LA 3PNKA 1YB1A 3ZBQA 3SX0A 3ZWXA 1QBGA 3FSEA 2OCPA 3IT2A 5FT9A 3THOA 1SUCA 4YMLA 4NYIQ 1OAOC 1J0XO 2H1RA 4RGYA 5BW6B 2PYIA 2G06A 3MUOA 5TEWA 2PGDA 5U1PA 1DEXA 1N92A 2PZBA 2VR1A 4I9UA 3IHTA 3NJ4A 3R0QA 4OHUA 1YDHA 3VVLA 3IEMA 1I6KA 1QGOA 1GZ3A 2F9FA 3D3QA 3DDHA 1YR7A 5T4BA 4G85A 5CFZA 5L3SA 3CXUA 4YRFA 1GP2A 2H1VA 2LKCA 3CLTC 1WUTA 2Q3JA 5T4EA 3DXXA 3KKLA 1OAKA 2FWPA 5IAEA 1F14A 2WSIA 3CZQA 4NCIA 1XDDA 4KBYA 5CUQA 5DP1A 1LX7A 1O5IA 2PTHA 3CX8A 4JQYA 3JQ6A 1V37A 2GOYA 5L3SB 3IHLA 2HBRA 2JC3A 4AJIA 5L7YA 4BEWA 2FQ1A 3GQVA 4FYYA 2B3DA 2HLPA 4U4AA 5KVAA 1FTWA 1AF7A 1Z5NA 2VHEA 1NL3A 3RS8A 4C7MA 4DF3A 2JGDB 1LLDA 2CNLA 2CKDA 3AI3A 4CYMA 3IAFA 4ZYXA 3NAGA 1G16A 3D8BA 2CXTA 1B23P 2VQ3A 3M1YA 5LA6F 1LBSA 3FKQA 5I9SA 2IT1A 4L9RA 1FFBA 4PG5A 3UFXB 4Z1MD 1W581 3F3SA 1PO7A 5M3BA 3S1AB 2E37A 1A8SA 4JYAB 3B1WA 1XI2A 1NBME 4MCHA 3U3RA 4INPA 4J2OA 4Q4HA 2GEJA 5EXDA 1SC9A 4DARA 4G5OA 1E5TA 1QG0A 4XVQA 3WHLA 2ONZA 3WLMA 3CB4A 2V6JA 4Y0AA 1U28C 2WWVD 1AVTA 1ZD5A 5E0OA 1FFGA 2Z9DA 2CFRA 2X7XA 4FCWA 5FOXA 2WIGA 3HA3A 4QDJA 4R1OA 8AT1A 4Q4HB 1XJCA 4RCZA 5EMLA 1SCUB 3ZVMA 2JVIA 1ORTA 3TNDA 4N7MA 1QGDA 2HLHA 2OG2A 4I55B 2K7FA 5TGTA 3P5BA 2KQUA 4MA5A 1I1HA 2DPMA 1N7HA 5BVHA 1HXHA 4EECA 1K7XB 1DOZA 3K0CA 4JX8A 2I2AA 2B1QA 2WU0A 5D5PA 4K2HA 3RIHA 3UOWA 1NG1A 1DKUA 1UBEA 2YFYA 3AILA 4N3AA 4TTSA 5EXEA 1OF1A 3UK1A 2CFIA 2WILA 1S8FA 4TUYF 1K4MA 5MN6A 2OHIA 1Y7LA 2HBYA 2A58A 1SIBE 5BVHB 3DLHA 1I7PA 2DWQA 3RTEA 5EMHA 1YCHA 1SQ6A 3EIHA 3QXJA 4E88A 4L15A 4AMYA 2P77A 4WFJA 1ND6A 1Q1AA 1AKYA 2BBSA 3GEDA 3QFRA 5FHQA 2HMYB 1WKVA 3ZR4B 1JHVA 2FSPA 1O08A 2RGEA 2J59A 4PLYA 3RRBA 3TZKA 3I1JA 1T2EA 2AVDA 5E2IA 5HF9A 3WYAA 4AP6A 2R6GA 4GKAA 1HRKA 1ABEA 1LNZA 3OPXA 1TE2A 4DSOA 1NN5A 4YJ2A 3PXUA 3H75A 3A2KA 2V8OA 3UGQA 2P11A 2FWBA 5EWMB 4LOAA 2HCFA 3EUEA 4GECA 3P4YA 3WRVA 3CNQS 1SBTA 5DM0A 3IALA 3O2QB 3W2EA 3IV6A 3F5FA 4O1HA 4B1FA 4X66B 2RB4A 2Y9PB 2H4XA 3OIFA 5TPZD 1F8UA 4IKOA 4B87A 1XTSA 3E9DA 5JTTA 1TD9A 3WK6A 4W8GA 4X3OA 1D2CA 3TINA 4Z1OA 1AGNA 4Z0PA 3HCEA 4P0QB 2H59A 3ZXUB 5AQ1A 3NMUF 1P2UA 1WDTA 4KDCA 1T5LA 1V3QE 1XFAA 3CBQA 4QDZA 1BGXT 3UJAA 3ULKA 4EEZA 2I2DA 4BTVA 2XSZA 4V24A 1EFKA 1MAUA 2NXNA 2CLCX 2RI0A 4YO7A 3ZS8A 1OLSA 1QH1A 3HO8A 4DYDA 4DUZB 3KX2A 1E3DA 1FDUA 2CJFA 2F1IA 2LW7A 4BHTA 3C5HA 3D4LA 1QVVA 1H1TA 3CO5A 5GJVC 4HGYA 2GYVA 4EA7A 1KVTA 4MV3A 3LGAA 5JADA 3T9DA 3WGZA 2F1RA 4KFSA 1EUCA 2ZB2A 5CT9A 4Y7CA 5I51A 4L3VA 4HF7A 3ESZA 5K0LA 2VO1A 3WVNA 4QXRA 4IHJA 3X3HA 4EMBA 4QOFA 3ITKA 4LYFA 1ZUWA 3ROXA 4IOKA 3I8OA 2FR1A 3L79A 1RSZA 4JDUA 3AEUA 4ALNA 2WJ3A 3JARA 4RQTA 3S2UA 3UT5A 3WADA 3OZRA 3WKAA 2GJ4A 1N0UA 4FFRA 5J4LA 1LZKA 2VAXA 2Z58A 4IHJB 4K1LA 1MPTA 5H3LA 3RREA 1AMUA 5FBVB 1SXJA 5BORA 2ZR8A 4XGNA 3T52A 3JD1A 1Q74A 2IEZA 4DV6B 3AEUB 1K7CA 3JARB 2Z1NA 3H1TA 4AWXA 3NEJA 1XZKA 2HPVA 1JKFA 1C4XA 3FRHA 3A1CA 5EXPA 3T1HB 1YFL<