2G7MC

Crystal structure of b. fragilis n-succinylornithine transcarbamylase p90e mutant complexed with carbamoyl phosphate and n-acetylnorvaline
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
Knots found
sequence length
320
structure length
320
Chain Sequence
SHMKKFTCVQDIGDLKSALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRLSTQKAALNLGMNVIVLDINQGAWKLETERGVIMDGDKEEHLLEAIPVMGCYCDIIGVRSFARFENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTARPKVVMTWAPHPRPLPQAVPNSFAEWMNATDYEFVITHPEGYELDPKFVGNARVEYDQMKAFEGADFIYAKNWAAYLGDNYGQILSTDRNWTVGDRQMAVTNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLLENLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords putative ornithine carbamoyltransferase
publication title A single mutation in the active site swaps the substrate specificity of N-acetyl-L-ornithine transcarbamylase and N-succinyl-L-ornithine transcarbamylase.
pubmed doi rcsb
source organism Bacteroides fragilis
total genus 114
structure length 320
sequence length 320
chains with identical sequence D, E, X, Y, Z
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.3.-:
pdb deposition date 2006-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
C PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 2g7mC02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 2g7mC01
1XJWA 3L04A 4KGZA 1R0BA 6AT1A 4KWTA 2QGFA 4KH1A 2BE7A 3R7LA 1PG5A 1SKUA 3R7FA 9ATCA 4KGXA 2QG9A 2BE9A 4A8PA 1EKXA 2ATCA 1EP9A 1TUGA 2HSEA 4EKNB 4A8TA 4FYVA 3D6NB 1C9YA 2P2GA 2W37A 3L06A 1PVVA 1RACA 1EZZA 1ZA1A 4AT1A 2FG7C 2IPOA 1RAFA 3LXMA 4H31A 1RADA 3KZOA 4ANFA 4OH7A 4FYWA 4F04A 1RAGA 3GD5A 2FZGA 3M5CA 2FG6C 4JFRA 5ILQA 1R0CA 3CSUA 2FZKA 3GRFA 2H3EA 3Q98A 4AM8A 3KZCA 1RAHA 2EF0A 3KZMA 1RAIA 4KGVA 1JS1X 3MPUA 4AMUA 1RAEA 1FB5A 3D7SA 1DXHA 5G1NA 3L05A 1OTHA 4FYYA 4EP1A 7AT1A 3AT1A 3TPFA 2FZCA 4NF2A 4JQOA 4IV5A 5G1PA 4E2FA 1FVOA 1ACMA 3L02A 1Q95A 2AT1A 1AKMA 4KH0A 2I6UA 1AT1A 1ZA2A 5G1OA 4A8HA 3TXXA 3M4NA 1D09A 8ATCA 1I5OA 3SDSA 3R7DA 4BJHB 2RGWA 3E2PA 1TU0A 3M4JA 3KZNA 2OTCA 4JHXA 1VLVA 1ORTA 2AIRA 4FYXA 1RAAA 3M5DA 3UPDA 5AT1A 1RABA 2G7MC 3NPMA 1ML4A 1TTHA 4WTOA 2YFKA 3KZKA 1A1SA 1DUVG 1F1BA 4F2GA 2A0FA 8AT1A 1NBEA
chains in the Genus database with same CATH superfamily
1GZ6A 4WKBA 2W6CX 5KYYB 1JIIA 4KGZA 2QSYA 2IC5A 1PJQA 2HPVA 4RMGA 2BSQA 5ESXA 1PFVA 1RYDA 1RLTA 1JKIA 1YJAA 4EK9A 1NW6A 3RG8A 3VJKA 3FHTA 2BEWB 4QXQA 3U3RA 2H52A 1W9MA 2QX9A 1PQUA 3RAGA 4B2IA 1EG7A 2DFLA 4TM7A 5A1TA 1GGFA 4GE0A 5JS7A 3E3MA 1A4XA 3O74A 2CHGA 1JJFA 1Q0PA 1F0KA 2ZRCA 4DB4A 3M9LA 3U17A 2B69A 1E1RD 2F1IA 4L0MA 1JHRA 2A9OA 4MR9B 5AI9A 5K8LA 2R87A 4KQ6A 3IV6A 2C4WA 2MMGA 3JSAA 1TEHA 3B52X 2VZ9A 5DBIA 3Q8KA 1G4HA 1L5YA 1X13A 5EXTA 4ZVNA 4LQDA 2XCQA 4OSPA 3CNNA 3OLVA 2Z30A 2GJ9A 1E9DA 2X4GA 2ZYDA 4WLOA 2SNIE 5DI3B 1TX4B 1X7GA 1BD4A 1JFLA 4MQMA 1PU2A 1IK6A 2QMUA 1NLUA 4CQMD 1TW3A 2PL5A 3DKIA 5CA0A 3T3IA 3KTAA 1FNNA 4Y2GA 4DMKA 1SC1A 3QFTA 1NHGA 1O9HA 2WILA 1FSGA 3H18A 2JASA 2L82A 3VNAA 1DV1A 2I5PO 4XYLA 3HXOA 4EHIA 3RT1A 1QFJA 3I9LA 4GG1A 1DOAA 4YJ2B 2BKLA 4E5VA 1QH8B 3JVDA 4EHHA 5K09A 4ZAWA 2MU1A 4OBWA 3WSVA 2NTYC 2DEUA 3RS4A 4Y1GA 4PNHA 4V2UA 1U5AA 2XXBA 3MWFA 1BJRE 1QS0B 2QR5A 4GHWA 3CUWA 3LU1A 1FLAA 2ID4A 4H7DA 4P9NA 2VDLB 1K68A 1R37A 1VKNA 1XTZA 3H86A 4P36A 5DLQC 1EM8B 1GLGA 1PFQA 3E5MA 2GD6A 4LVNA 5TF0A 4B9AA 1TAUA 2FZCA 1PT8A 1F0NA 4KYVA 4WQMA 4ZVVA 1XRLA 4ZCPA 2FEWB 2YV4A 5K3FA 2WB2A 3VR6A 1DC6A 2O8CA 2A3RA 1QIFA 1R16A 4K7JA 5HX7A 1Q15A 3Q5EA 4PQEA 3GBPA 1KKUA 1OXTA 4BP3A 4DMRA 4P31A 1IY8A 2IX9A 4IWYA 4JR1A 4YPVA 5BXYA 1XFDA 5L4SA 1ZR4A 1OIXA 3RG2A 4C0AC 4XWKA 3NJ8A 1A82A 2CNLA 3C87A 3FWKA 3GUZA 1I4EB 3OJOA 4RM2A 5DNCA 3EMVA 1PJLA 2F59A 2H2GA 2HPZA 3A1SA 3C3XA 2SCUA 1MV5A 2CXOA 2UYGA 3PVZA 3H5OA 2Q27A 1II0A 4TQ9A 5EIEA 2CZCA 2E6UX 1PSZA 2ZCUA 4BV8A 1JE1A 1P7ZA 2PKQP 4BWYA 2BR3A 1U3DA 2GO7A 5DNUA 1AUQA 3GT4A 4MPTA 1VHJA 1ZEMA 1UT5A 4KN9S 2W00A 4HG2A 4M8SA 4ETIA 4DC0A 3RVDA 3WLHA 2MR6A 4EUSA 1RAAA 4EJ0A 1E1QD 4ARCA 3HU1A 4IQ4A 1Q12A 3G5LA 4H15A 4C6RA 4CUZA 2HT1A 2YN4A 4RPHA 4FU0A 4NKRA 2X0JA 3UWMA 2QI9C 1SIUA 1OU4A 2PO7A 3B7WA 3KETA 5KWSA 1UXIA 2C5LA 2GVZC 3I53A 5EHIA 1IDN1 3CRMA 6AT1A 1MTOA 2M6LA 1YI0A 3ACCA 1I7DA 2I2BA 1CS0A 4MO2A 1I7PA 1PFGA 1UH5A 3ZHXA 2KHZA 2HI0A 2P68A 2BFFA 3E1GA 1Y4DE 4G5YA 1A72A 3G2JA 3PX7A 1ZN2A 4HL6A 4QJ5A 4QO7A 3HP7A 5CVTA 5KYKA 4IS3A 1CJVC 1YK1A 3QU9A 1CVRA 4DR1B 4MQUA 4XPZA 5DGIA 1CERA 3C5VA 4NSNA 2VHZA 1DRJA 2EU8A 4UVHA 4D4KA 1RZRA 5CNJA 4I4TB 4OYLA 2ISQA 4TUYB 3RIGA 3X44A 4CKBA 1USKA 2BDTA 3LGXA 2O2GA 5ALEA 2RI1A 3KCQA 3NAGA 2FUG1 4A10A 1J49A 4DKJA 5B12A 4FB5A 2NVWA 3PNPA 4NV1A 3RKUA 3W4JA 3GEEA 3U7FB 2QLLA 1H0HA 4W1SA 3I2IA 1RSZA 3REQA 4E7PA 5LUAA 3H05A 5K6TA 3C41J 1JPUA 3ZJ4A 2NYRA 5ITVA 2CVZA 3HKCB 4I36A 1ESMA 5FTJA 4AFNA 4S2EA 1H2HA 2BY4A 1JG7A 4PQFA 1NVWQ 2XHEA 5HMLA 5JI3E 4V1CI 3SOZA 1BDJA 1KYYA 4LC0A 5G4LA 2Z6VA 4CLXA 1EVZA 4IIBA 1X1SA 3R09A 3O3CA 2H4HA 3IDOA 3SEZA 3M6MD 1ZGCA 1OPRA 3OQVA 2FTKE 2B94A 4IHQA 2WYWA 2BJWA 1ISPA 1Q0RA 3SKYA 1M10A 3AEUA 2VLBA 3GEDA 3JQFA 1DX9A 3FMOB 4HDMB 3T9EA 3ZU5A 4DLVA 3U3JA 1FNMA 1QC5A 1YOVB 3ZWVA 5EJEA 1B00A 4J7XA 4LF9B 2GGSA 1CYDA 3D2LA 4JLDA 4Z1OA 3EIFA 1Y9ZA 3ONNA 3IQWA 4CDNA 2QLBA 4MKGA 1W93A 3H2IA 4U4AA 3AWIA 4XVHA 1YGPA 2EW1A 1MC4A 4KXXA 2RGRA 3R9KA 1Z45A 5H9WA 3ZWAA 3IUMA 4LOIA 1PR4A 4UQLA 2F8LA 4Z53A 3A06A 1I0IA 3OX2A 1JT9A 2GWHA 4MITA 1UXHA 4M9SA 4LMPA 4P84A 3TSAA 4WY8A 4KO8A 3N28A 1H1TA 1JR4A 1MXFA 3D7NA 3H0EA 3HU2A 2ZT5A 4FOOA 3RRJA 2MWMA 3K0CA 3SMQA 3UK1A 1G3RA 2WLSA 5B1YA 3EA4A 1LPAB 2HQBA 2GJ4A 4DDWA 1Y8RB 4WKPA 5TMPA 2C3UA 4Q01A 4NDAA 3TX2A 1DO0A 1SXHA 3AUKA 1AMUA 4AD8A 4U7DA 4E07A 5B3AA 2P2ZA 5E2IA 1YE3A 3K05A 3OP1A 3G17A 1ZCAA 3JATB 4U7HA 2EFDB 4HDNB 1LK0A 4OA5A 5JISA 4YY3B 2QUHA 3NS7A 4YRBA 5K4GA 1VKHA 5K3OA 1YQGA 3BXGA 1PF7E 4PRYA 3AKYA 3NETA 1UANA 4JCCA 4EGFA 4A0SA 4C2TA 4DEXA 2BFBA 3MJTA 1TADA 3OOHA 3TTTA 2AR7A 4CEHB 3HR4A 3WY9A 1BWRA 2P9TA 3L46A 3KR9A 5FOSA 4QZVA 4WTOA 5HPYB 3M82A 5KWVA 4X93A 1CZUA 2FPGB 1YC2A 4CM8A 1ZXBA 1RI5A 2HCJB 1PN3A 4NR0A 1OBHA 1SZPA 4K9RA 3OC6A 1R0WA 3GJTA 4NICA 3NEYA 4RGVA 1G3UA 4A91A 5F78A 5BYJA 4A0FA 1C14A 5DN6D 4Z9XA 3ANMA 1M2OB 1UBGA 1W34A 2EVWX 1PG2A 1L4MA 3PFWO 5JEDA 3SLKA 3Q0EA 3SSOA 3ZU3A 2NO4A 3M1IA 5COQA 3Q40A 1WCIA 5A5VA 3OOJA 3L0CA 2C5SA 4CKWB 2CVQA 2H6EA 5H16A 4RS3A 3RM3A 1K88A 2CJPA 4FYMA 4H7HA 1JLSA 2QJTA 5G3YA 4NY1A 3EN0A 3AQ4A 1JHXA 1IHXA 3G8CA 3VR5H 1YJ5A 1GYRA 2AFHB 9ATCA 4C08A 5B58T 2Q7DA 1BW9B 3VR6D 1XROA 4KRXA 2ZJ8A 1YDEA 2HBRA 2JIZD 5KTPA 5AH0A 1WHTA 2AOTA 2H0RA 4ACAA 2ODPA 1US8B 4GGPA 4IVQA 5FUWA 4OH7A 1G5QA 5DLYA 4KO2S 3VPFA 4HQNA 5A7FA 5BYAA 1GSAA 2XZTA 4LK2A 4M8KA 4O8CA 3VR4H 2EEZA 2HMTA 1KKMA 1J0BA 3REOA 2PH1A 2PZFA 2DSTA 4R8VA 5IT9A 4RCZA 1KMNA 2PS0A 3Q7TA 1LFAA 4AZ3A 4LXTA 1QPBA 4UVDA 1VB3A 2PPVA 1J2TA 4Q1AA 4R7TA 2C94A 1F9EA 4PYJA 4AWBA 1GLVA 1TNDA 3IHLA 3Q87B 3UWOA 3IDFA 4EEKA 1NW5A 4E5DA 3HCFA 1MAVA 4AJHA 4D9KA 1WZEA 3AEZA 4D41A 4CM3A 2Y6UA 2XECA 3HVHA 3GVIA 1XL0A 4HN9A 1LDMA 5D1HA 1I36A 3JQ8A 2V8BA 1KEWA 4CL8A 4Q39A 1TKAA 1EAYA 2H2WA 3A25A 5D5QA 1L5KA 4X1IB 4CL2A 5L7WA 3UJ6A 1AZWA 4JUBA 4JK3A 3R8CA 3RT9A 5IJWA 1XZKA 3A8TA 2B92A 4UJ3A 1QO0D 4C30A 4QFBA 3TW8B 4Y1RB 2VNJA 3VMMA 4D4GA 3LDUA 1SBQA 5TB5A 4ITRC 3FKJA 3V4LA 4L16A 1H4QA 4HJXA 1GCOA 1NV9A 3CRNA 3MCAA 1ULAA 2ZVJA 2CLHB 2XUIA 1IL0A 3N2IA 4FWIB 1QR2A 1XA0A 4WNYA 4B1FA 1L1FA 4D81A 1U5BA 5KX5F 2P40A 2VSNA 4IUDS 5DFAA 4PLGA 2TECE 1H1LA 1P39A 221PA 4WUTA 1ODFA 1I9CA 2ZUDA 5BQOA 4BUJA 4YCSA 4B7ZA 3EIQA 5K0JA 4Q21A 3HB4X 3WYNA 3AVVA 5G0SA 2EIHA 3FOBA 3NO4A 3HM2A 2O1EA 4UU8A 3W8RA 2H06A 2I7VA 3PQEA 1GKYA 5DU2A 4CKEA 1J2JA 4K8OA 2XWSA 3AESB 1NQOA 1XELA 5KJ1A 3M5PA 1Q1EA 3SDSA 4DJFC 4X5OA 1KNQA 2R1TB 3TM4A 3ABRB 3PL1A 4KE7A 1C7IA 3ZDCA 2ZSUA 3QFFA 2HPHA 1UC8A 4FBMA 5F2KA 3QEAZ 3UTDA 2I4RA 2NMVA 4UEOA 4D42A 1QR6A 2FFBA 2JLXA 1XZGA 2YZ7A 5P21A 5F2EA 2D5AA 1GUAA 3FY4A 5A3VA 4DMUB 3P4XA 4X1OA 2I71A 1ZIYA 4Z8YA 2H9AA 3RRBA 1ODSA 5IJ9B 1WVGA 1PBNA 3W7AA 3ZVKA 2ZRFA 4UVGA 3LUAA 1T13A 3QVGA 3I12A 3VPSA 5KJEA 1HDZA 2A0FA 3QRWA 2OZLA 4PIMA 1KEUA 1C1XA 1L4BA 1MOQA 4I9GA 3W5IA 4ZYTA 5BUSA 3TOXA 3WTCA 3ZHTA 1E3SA 2CMDA 2ZUCA 1CJSA 2VH2A 3BMQB 3KXDA 4D8TA 1JDPA 3WWZA 3FRHA 4D4JA 1KYXA 4N3GA 1EYZA 2C1ZA 4EA8A 4POAA 1C8KA 3BTUA 2ODQA 1WU7A 1DVRA 2F62A 4J3JA 3ZJYA 5HK9A 4MWCA 4J16A 3BJRA 1L5FA 3CUVA 3E18A 4FHEA 5C18A 1IC6A 1N0VC 2PAAA 2VFAA 2VT6A 1NNSA 3FTPA 4LVUA 4XDZA 4EGCB 1E9SA 4P1ZA 2Y1LA 1X1BA 1GCUA 1LW6E 3OM8A 3UJHA 1OYOA 1NKVA 4O4JB 1DI0A 5LL6P 3HEMA 4HXEB 4DC9A 1ZIPA 4YJHA 4FYVA 1TJPB 2J9YB 2XMGA 1E58A 5AJYA 5F21A 5T64A 3VMFA 2IZ7A 1X94A 2UYHA 2FN3A 1TZJA 4R1OA 3DUFA 2IS1A 1WR8A 1J5PA 2XWPA 1IMOA 4KU4A 4D9NA 4N3AA 1Y33E 3DO8A 3S68A 1NNI1 1GT6A 4C29A 5AM3A 4HDRA 2EDCA 1V8DA 3IHKA 3C8UA 3DAOA 3IOMA 4DBZA 5LOVF 3IUQA 2UYCA 3J81A 1JHQA 2X7HA 4Q1CA 4D6PA 4RF3A 2AZ4A 5AKYA 5LZ5A 4A0QA 2Z2IA 3L0BA 1IHOA 3MXTA 4Q19A 1REQB 3F7OA 3ZN2A 1RLUA 2REBA 3UAOA 3T12A 3WKEA 2D2VA 3THOA 3A10A 2F43A 3RVNA 3MGBA 4W9MC 2FWIA 3ZD6A 1JE0A 2R1VB 1Z4LA 1OGJA 1TOAA 1WSBA 2GLUA 5D5PA 4MSUA 1NUAA 2Q1WA 1J5EB 4W1RA 5CT8A 3CLHA 2L0XA 4BFYA 4C4PA 2ZB3A 1B23P 1CUWA 2XBUA 3EZLA 4G5FA 4KTVE 4QXOA 3R9WA 4GBJA 4LFBB 2ZU0C 1A04A 3MS2A 4GP7A 4RVUA 3VJMA 3B6MA 3INNA 3N9IA 3MSCA 3O1IC 1PJBA 3LYHA 4IDDA 4BNDB 4CUJA 1AIPA 3KB6A 3F3YA 3CISA 1XEXA 3ASYA 4L15A 2QRJA 3WV5A 4YCCA 1EJ6A 1QCDA 1YDMA 1Z4PX 3NT4A 2O8FA 2ZP1A 1AK2A 5KYYA 1W4RA 4O33A 3RANA 3SEFA 2N3ZA 3LKVA 1VE5A 4O02B 4QYMA 5BV8A 4YRGA 1GSOA 2OQ2A 2BEWA 3R0JA 2HQOA 3IQDB 1MVNA 3AF2A 3RIHA 3TDKA 3T4XA 2E4ZA 3CGGA 3STUA 4EFDA 1Y1SA 1K06A 2ZREA 3S8YA 1WA5A 3RWOA 3CZRA 5FA8A 1OFGA 3UTCA 4J1TC 2RGWA 3FE2A 4TYPA 4QEDA 1C1DB 2IWRA 4M54A 4XX0B 1NA5A 4OHCA 1WCV1 2HLPA 4KNWA 4X44A 4ZCLA 5KWEA 2V3CC 3DH0A 1LS6A 5CP8A 3TECE 4TZ0A 3KT8A 2GBGA 5DNYB 5DI3A 2NGRA 4Q0MA 5EIXA 3C16C 4A2QA 1E60A 2V4ZA 1RWKA 1T4CB 3RODA 1MO5A 4YNBA 3O92A 3A37A 4AF7A 1M76A 3RUAA 1X86B 1OAKA 3KEQA 4O2BB 3FAZA 1MB2A 3A9VA 4LBYA 1XRMA 2QUIA 2VYVD 3DMRA 4YUVA 1A1SA 2JLBA 3W90A 2V4MA 2GUWA 1LTHR 2HYIC 2IPAB 2H4FA 1A9RA 1T43A 1H8HA 3NHBA 4JLJA 4YJGB 1QHIA 1XPJA 4KQMA 4YCMA 4YJ2A 1TI7A 2BZ1A 3G8AA 3IMGA 4NARA 2IUUA 1QH8A 1K7YA 3OZEA 4A03A 3NG1A 5JSQA 5K9ZA 1TF2A 5CNIA 1EIZA 1ZOPA 5EY5B 3BGOS 4AK9A 3OU7A 3WDMA 1QYCA 1C9DB 3CB2A 1NVGA 1BX0A 2IW1A 2PUHA 3GMIA 4XLLA 1RWOA 3IBSA 5TQJA 1BX1A 3L7OA 2NAFA 4KV7A 4AY3A 1EM8A 1AK1A 1KFEB 1K08A 1HEUA 3H99A 1NVEA 1MW8X 3DL0A 3NANA 4DLBA 3G0BA 4EJ2A 3NGLA 5G0VA 1YRAA 4ZPXA 1NW3A 3VO2A 2C77A 1L8LA 2WIFA 4DLRA 4PQYA 3ANNA 2BRUC 3D8BA 3NC4A 3OE4A 3K09C 5DGTA 4DN6A 4JZYA 4XARA 2BTQB 2UZIR 5C80A 1GZ5A 2POCA 3GRKA 2DQYA 4NDNE 4B6FA 2O5CA 4RHUA 1KFJB 2HA0A 2QTLA 1R0CA 2L18A 3QEOA 4JOQA 3RPEA 3QHQA 5C8XA 1KIFA 2HO4A 2G5TA 3FA2A 1AGXA 1YUNA 2BGNA 1YR2A 3DTYA 3H1EA 1TK2A 2A0XA 1E2GA 5BMVF 4RH1A 2R47A 3WDSA 2O6HA 5A3RA 2WUWE 1RAIA 1AC5A 5CYFA 4H6XA 2AX4A 2C5HA 2GBCA 2DFKB 3DVAB 1QYIA 2BPOA 2WM3A 3TTUA 4HVCA 1U1EA 4F45A 2GPBA 3SFTA 4Y6SA 1WU8A 4MTCA 4F8JA 1TYEB 1DJLA 2P9BA 1NJSA 5K01A 1F1JA 5DYYA 2A1TR 3UUGA 3QBVA 5H68A 2N42A 3KBOA 4JT9A 1YRQA 4CMCA 2R96A 4KYUA 4GKJB 1WBBA 1AKQA 4D79A 5ALIA 2Q6VA 3KVNA 4WXPA 1M6EX 4MOWA 3W5BA 1LDGA 1RLMA 4YRPA 1K6IA 1SQFA 4IKOA 5HIJA 2GPAA 4LRWA 3STTA 3W78A 3CKLA 1LWOA 3KTOA 4XVQA 2BELA 3E9RA 3P9ZA 3E22B 4JC5A 2OZKA 1L8OA 4ZK2A 2WJVA 1ZK3A 2IJGX 2ZJ2A 3CS3A 2JGDA 2GZDA 3II6X 4NV3A 3RU2A 1GZ7A 2BGRA 1L3CA 3V7NA 1ZA2A 3VH3A 3LYLA 2C9YA 3TPCA 2RG1A 4X61A 1TUEA 3OIUA 2QRGA 4BNFA 5DHPA 1TC1A 4OXKA 1E7MA 1KEVA 1JJ7A 1IZ9A 4BJHB 5GOZA 2ZIVB 5JW6A 4I4TA 2H4ZA 1EXVA 3QLVA 2OYCA 3T1TA 4QSMA 3C7AA 3I01A 4OQNA 1M6YA 2KPOA 1BFUA 4IQ8A 3ZZ0A 5CBPB 2PMWB 2X8BA 3PIRA 1PIWA 2AFIE 2A2ZA 3GOHA 1E96A 2C2XA 2DUUA 2WFZA 1L4YA 3MTEA 4XUGB 3EAFA 3WQSB 3D0KA 1DELA 2HWYA 4RTNA 5I01A 1ZOSA 5IX8A 3GRYA 3FI0A 2C29D 4IJMA 4JSTA 1A9QA 1UBJS 2H7VA 5AM0A 3HKCA 5BNFA 4TKUB 3ROTA 4DDMA 4OK3A 4FFDA 1NLYA 4EHFA 1PWXA 3A11A 4Y6RA 1JFRA 4TL8A 4IMJB 3W4IA 3PPVA 1A8UA 4MIYA 4M88A 3MB5A 4D26A 4NOKA 3KAKA 1QMPA 4YUYA 4KDRA 2PUWA 1KFCB 4L8LA 5BUCA 2R7NA 2D5IA 3JTEA 4ZP1A 2ASEA 4AF6A 3S8EA 1Y1RA 1RQ2A 2D2IA 4HDMA 2P5YA 4HI0E 4QUIA 5HSGA 3WL4A 4J75A 1H2ZA 1VJ0A 2MR5A 3O2QB 3ZGYA 1SIBE 1YOVA 1XJQA 5BV0A 4UC0A 5KYXA 1N6PA 3A1TA 3D7LA 1UWKA 1Y81A 1E2UA 1PJTA 2P6NA 4HC4A 1GJRA 5LB4A 3TDMA 3T7DA 4RJIA 2VDKB 2NUPA 2BUCA 1IZ8A 2V4UA 2ZRMA 3RS9A 1QQAA 3OCVA 1JMYA 2FJPA 2Y93A 4P2BA 2JGJA 2WZQA 2I3GA 4DE5A 4DIOA 5F23A 3NR2A 3L43A 3WADA 3NTXA 3JX9A 4JLWA 2GZAA 2W83A 4NU6A 1C29B 9ABPA 1EFVB 1V7QA 4MNTA 4DBLE 2EAUA 4BQNA 2XWBF 5CA0B 2I3DA 3AJ9A 2DFPA 1P8JA 3IPXA 3P9RA 4R1MA 1T8UA 4LA4A 4BVEA 1CQIB 2ZSIA 1NVXQ 5CCEA 5IEBA 4ZQBA 2NV0A 4DARA 4GM1A 1JR2A 1UODA 2C84A 4E5UA 1EWYA 2ZSHA 1JTVA 5FKJA 5B1HA 5BSVA 1XNGA 3FHCB 2J48A 5I8ZA 4COKA 4BZWA 2H07A 2ETXA 3I34X 4GMKA 3JATA 1ETHA 5LLSA 3ZD9A 5IVPA 1X80A 4HDNA 4R1PA 1P2TA 2VWHA 3N8IA 4MMZB 1ONPA 5M29A 3LDHA 2P11A 2EG9A 2F17A 2VBIA 1OV6A 4TXHA 3V8NA 3OMXA 1HZJA 3F2IA 2DFTA 3OM1A 4MQFB 4YHBA 3VI4B 1XD8A 2ZANA 1YKSA 5IFKA 2NXWA 1CY7A 2GYWA 4ZO6A 5BSUA 2ORYA 3ASVA 3BGIA 3QVTA 1GAJA 1QIKA 2JAXA 2WSMA 2JFNA 4ND2A 3T95A 5AI4A 1MX3A 3S28A 4CG3A 1NMEA 5C7YA 5THXA 3UT6A 5B36A 3JD3A 1R5OA 2D4AA 1U0NA 3JQ9C 1DMSA 1DQZA 2C98A 5FPYA 2YOHA 4XUEA 4U3JB 3V9PA 2QUJA 3RYHB 4CRWB 1M2OA 2A9VA 2CYAA 2FZEA 4V0QA 3IUYA 3L4BC 4C4AA 4UZEA 4V2IA 5JCJA 5AVTA 3ZCXA 2EHDA 4DCPA 3NATA 4CKWA 1T9GR 4URVR 4JOCA 5DK6A 1T1RA 3O75A 2JCYA 2C7GA 2MSEB 1XLWA 1I5OA 1D9XA 2R0QC 1QGOA 1XMIA 2AFHA 2XRMA 3MCZA 1CP3A 5SYAA 3TJMA 1BW9A 1TU0A 3HEBA 3M4JA 1OIVA 4FOSA 5IAKA 3TJRA 4M3NA 4CETA 5EHZA 3O95A 1N2CB 1I7LA 3OLQA 1US8A 3N8DA 1XJ5A 3OHPA 2JIDA 1JXMA 1M2FA 2JI7A 2P9EA 3VBEA 4P3PA 3ICPA 1GG5A 2ZUSA 1JKJB 1POXA 5KAMA 2ZI5A 3OPVA 5K2OA 2H4JA 1V3VA 3BFKA 4IGEA 4Z4IA 1A7KA 2ATVA 2XIJA 1UBFA 2FE1A 4RIHA 1I80A 4F4IA 4UPVA 3IE2A 3NV9A 3QENA 4F2GA 5KTYA 3LDAA 4QQRA 4UUQA 3X2EA 1N3LA 1VGRA 2G72A 1CR1A 1OE0A 2R751 3CPSA 3FBTA 3Q3VA 4M49A 3WLOA 5KJ6A 4N48A 3D7RA 4QUBA 4HDCA 2KWIA 2ZYUX 3O90A 2OFXA 4IDPA 2H7YA 2C42A 4JB8A 2X3YA 2JJQA 3ELBA 1VHLA 1MXHA 1ZRHA 1MX5A 3A9SA 4G4GA 1NWHA 3U1VA 2YYSA 1G2OA 1P9WA 3CWZA 4WZZA 3B12A 1IE3A 1KZYC 3OEHA 4JJIA 4WWHA 5AVWA 3BOSA 3ETHA 4X1IA 1GT91 4XM2A 2RGBA 3IV7A 3OTQA 4JC0A 4RMIA 4WJLA 2Y1EA 4JLSA 4Q1VA 4YT5A 4ZXPA 2I6TA 3MSXA 3TW8A 4Y1RA 1N4DA 3IUSA 1RI4A 1XP5A 2JIMA 1P6XA 2A0WA 4HAOA 4WZAE 4DQDA 1J24A 3NPAA 5IM5A 2YTZA 4DKXA 4K6GA 2GNAA 4K9PA 5CGZA 1TFUA 3VGPA 1FOEB 1B8NA 2YRFA 1WPGA 2Y2VA 3GRCA 2VHYA 4R9RA 4ESHA 2ZE7A 2CHUA 3FCSB 2QNIA 3JZAA 5TVKA 5KHOC 2Q6IA 4JI0B 1LNSA 4WZ6A 3DP7A 2HIMA 2PT9A 4JEUA 4JUCA 4OXQA 2HNBA 4PLYA 3M5CA 3ZGZA 2PDAA 4IIGA 5AOCA 1IN7A 2VDOB 5DT2A 3IYLW 3GT3A 4ID9A 1CXZA 5F12A 1VHQA 2YXNA 5JG7A 2EATA 2IHBA 3AESA 4LRXA 1GTRA 1HTBA 1UBKS 1YVDA 2WAYA 1SZJG 1IWPB 4BO1A 2R1TA 2ZSDA 4KREA 3UN1A 1Y5RA 5J3JA 3WR5A 4HRXA 1ADCA 5L3QB 2IOFK 4FSXA 1GQRA 1Y7TA 2DR0A 4XYGA 3UWDA 1MHTA 1RNLA 3GG2A 2WTXA 3HSYA 4A9AA 2IRWA 3OLZA 3VC1A 5K4HA 5TT0A 1W2WB 4GYYA 1DIBA 4JVOA 1TM3E 4A82A 1EGAA 1U0LA 1N2XA 1VLHA 1O5IA 3L7AA 4JYPA 2XKJE 4PBSA 5JJ5A 3S1AB 4LMAA 4YVFA 3JYLA 5KVQA 2CBZA 5C34B 3RUPA 5A1JA 5IJ9A 4QGFA 5EIAA 5J2UF 2HA4A 1XNJA 3AILA 1WSDA 4NPCA 2L42A 4OJTA 2G9NA 2EP7A 4RTLA 3E61A 4W5TA 3BMQA 2ILTA 4E3WA 4YGXB 1UJ2A 1QGED 1Y1TA 2Q9AA 4X64B 2PEYA 3U2QA 2GH1A 4MUIA 3ZW8A 4YMLA 2WVHA 3FGZA 1EA7A 3NNSA 3DULA 3V7WA 3Q2KA 3UWSA 3WDLA 5I7HA 1YVUA 1NXPA 1YA4A 2W90A 1ADBA 5L45A 4JJGA 4X65B 3QKRB 4Y2XA 1YS1X 4PX9A 4Y6PA 2NO1A 2MCFA 4MS4B 4O4JA 1M5UA 1H22A 1XSEA 1R4AA 2C5GA 4BCDA 3JAMA 3QE0A 1JAXA 2AVDA 3R41A 3EQ2A 3RCBA 1XGKA 4MINA 5AJZA 2I4NA 4GEKA 4J0QA 1RFLA 3TZLA 3O4RA 3RH0A 3OZ7A 2B3DA 4M86A 4PZZA 3OTWA 3T1VA 3PGMA 3AZQA 3O03A 4EMBA 5F5LA 1HLDA 5K3CA 4L85A 1OH8A 1ZSNA 4HBZA 1VIAA 1XAIA 1V2HE 2C4VA 4ZMBA 1DWUA 4P5DA 1AN9A 3RRFA 1RXYA 2X2PA 4GLBA 5K0NA 5IAOA 1LBQA 2CD9A 1K0UA 4AROA 1EGQA 4RVSA 5KOHA 1IFXA 1K63A 2I76A 2RDMA 3CUTA 4U7WA 1O5OA 2PS3A 3B2NA 3P9CA 2E85A 1QYXA 2ZQ5A 4M37A 5A62A 5AO9A 2VRCA 2CLLB 2R1VA 2RGNC 1BVHA 1FFGA 4LSGA 3JVIA 4YA6A 2VHQA 2EARA 1S2OA 1Q50A 1PJCA 1XZAA 1V2GA 4GMGA 4R4JA 3PFBA 1XHFA 4I9NA 4KODA 5EINA 4EL5A 5A5FA 4NMMA 1E1MA 1SQ5A 1IPEA 2J9GA 3H1GA 1EP9A 1RVV1 3O82A 1G5HA 2PWZA 3NCTA 4HWGA 5KTNA 3OD1A 2A4KA 2UAGA 3JZFA 2N0SA 4PSKA 4UAJA 4BNDA 1BFKA 3X2SA 1T2FA 1ORDA 1E1NA 1UDXA 3PGLA 3WGYA 1GA6A 3OTIA 2IGTA 2VF2A 3GFRA 5AKJA 1OFVA 2V7BA 1BD3A 2AK2A 2VCHA 5TSDA 3NIBA 1A9XB 2ZR0A 1NTRA 1OXBB 3PLNA 2VPPA 3EJWA 3GRRA 3H2GA 3UA3A 3UC5A 2E55A 1CJMA 3QE2A 3VVMA 3F4LA 2AC7A 3KB2A 1CY1A 3OP4A 4QDTA 4K3VA 4R0VA 4EUKA 3GLSA 3QXSA 4RF4A 3ONEA 2VSFA 3CSUA 3E15A 1G59A 1CJUC 1E6UA 2PH3A 2HB6A 4AM8A 1XNHA 5KYGA 5EMJA 4JLAA 1BNCA 3DBIA 2E5WA 3ETEA 1ZBQA 5KTSA 2VP2A 1ODJA 3HBLA 1RM3A 1I7SB 1XO1A 2WF7A 1C1DA 1CUDA 5AKKA 3F5DA 4E14A 1D6JA 3VR4A 2JD0A 2ISCA 1BN7A 3WE7A 4X3OA 5EWMA 3GUVA 1TAHA 1X6VA 4BKOA 2IYOA 3FHOA 4EX6A 1YIAA 1DQYA 1T0HB 1VMDA 1F2UB 2C2MA 1QZUA 2XYHA 3TXYA 3F97A 3HKDA 3GZ4A 3TLZA 1G8GA 1C9JA 3T1OA 2ZK7A 1RLIA 3OQIB 1T4CA 4C0LA 3LXRA 2OLEA 4QAQA 3KELA 1I24A 4E15A 2WVGA 3R23A 2WLTA 3K1YA 4I5DA 2QPLA 4O2BA 4R9VA 3TRFA 1TTTA 1TC2A 1IOLA 3DDUA 1XD2B 3AFOA 1P72A 4OQYA 3HRIA 3PSHA 1P80A 1QTQA 3BMCB 4RHXA 3JWHA 3L18A 3OMWA 4YJGA 4HPXB 5EWJB 4YRJA 3RFVA 3WO0A 2OV6A 4KB5A 4EITA 4IUBS 4JX8A 3VZBA 4F97A 3OTOB 1XZIA 1XZQA 3P0FA 5D5HA 2I78A 1UFKA 4BNZA 5CB0A 1T91A 5DYTA 1XMOB 2GEKA 2H0QA 1QE3A 4A16A 3VKWA 4UNPA 3RVRA 2PZBA 2GZMA 1O94A 3KTDA 3PR1A 4RADA 4FIDA 1NY5A 3IE0A 3EZ7A 4FT4A 2QVCA 2V54A 1X8LA 5ECYA 5LNK1 5AI0A 2RHOA 3E48A 3SBDA 1I7NA 4OD0A 1UBHS 4F84A 3CRRA 3ANLA 3T5TA 4OH1A 1WULS 1PLLA 1SVKA 3ZUGA 2R5FA 3JYPA 4I46A 5IT4A 3ZIAD 1V96A 4LYEA 3MWYW 3G2KA 3E1SA 4E5NA 4MDEA 1G4AE 5D8DA 3AF4A 2MSNA 3KJIA 3QBEA 3GD7A 3KVRA 3WGJA 2ST1A 4N65A 3S5UA 4AY4A 5I8PA 1CY0A 1K4MA 2BTQA 4N7JA 4ZEXA 4ZD6A 4F3KA 2IXGA 3HG7A 5AD1A 1Z4IA 2PMDA 5HMMA 2ZUFA 1QYWA 1XZEA 1IUPA 5EJ6A 2N75A 4F9EA 3HVJA 4QOFA 2WM2A 3A3YA 4FMDB 1Y89A 2VJOA 4OJQA 3A2MA 1RRMA 4CLOB 2GHIA 2VDNB 2H17A 2YWFA 3IX7A 3DVAA 3LGAA 5BUZA 4Z54A 4Z9YA 1Y80A 1M6VB 3FSJX 5IYZA 2W4IA 4RTOA 4UPDA 1I32A 1LY1A 1UWLA 4KVFA 2PRSA 1BMFA 3FFAA 2C5BA 2V3VA 3RNOA 2BE9A 1BOFA 3VISA 3OPXA 2BRUA 4HFMA 1K8ZB 2R6JA 3K09A 3R0QA 4FFMA 4QECA 4RZSA 2Z2ZA 1X7XB 2OQVA 1Z34A 4B6RA 1I3MA 1NPYA 3HRHA 3UCXA 4IO0A 4TRRA 1EZZA 1YOBA 1QKJA 1G7CA 1R8YA 1XQ1A 1YKGA 3OFVA 4BNWA 5K0ZA 2EFJA 5FFFA 1EESA 2WUGA 1U7TA 3IQGX 1GADO 4HQLA 5FAKA 3E22A 5I4BA 3ZWDA 7MHTA 1CR6A 1G8YA 1OWNA 3NH9A 1VG1A 3CUUA 6CHYA 3VSAA 2ZTHA 2ZRJA 2CXXA 2HSZA 3DG9A 3DHVA 2VJBA 1ZM3A 4IIJB 4KDCA 4IIHA 4HSGA 1SC3A 1ZMRA 3A1EA 3MN1A 5A9SB 3PFNA 4E4TA 5AVQA 2W9XA 3ZBTA 4IZHA 3T3GA 2PUJA 4WACA 2FFJA 5FRDA 1YZHA 2P9QA 2ZIGA 5DRTA 4BMCA 5HJEA 4KN8A 1WZCA 4LOKA 3HCWA 5CBPA 4CCWA 3WNBA 2DXIA 4R9UC 3PNBA 3A27A 1F6WA 1KHHA 4QBFA 1RM4A 1Y7IA 3M6IA 3PUWA 1EFKA 1HYHA 2FX3A 5IBPA 4KR7A 2PSJA 2BSXA 3AJ8A 3ITKA 3KALA 4KSBA 4OHRA 2Z4TA 1XMVA 4DJ5X 4TKUA 2C3YA 2ZYAA 4MUGA 1PSDA 2QR3A 4TX1A 4EG3A 1O6GA 2H7CA 5F3WB 3LC2O 2IDMA 2CE7A 5E1BA 1ORHA 2J8ZA 1KI4A 2IYLD 4TN1A 5K7SA 2AMJA 1YXMA 3AYXB 1TZMA 3GRVA 2HKIA 4HN2A 1CUGA 2NYAA 1S1CA 2IHJA 2P35A 2VPYA 4ZKDA 2RH4A 2QRUA 4EM6A 1LJUA 1P1FA 3PFKA 4JITA 3CZQA 4B3XA 2PSEA 2ZIUB 3AY0A 4D82A 4MCIA 4MS1B 3UMMA 1H9CA 4Q6WA 4G07A 3E2PA 3N0XA 2GO1A 1NZDA 2QTWB 1PT5A 3AWDA 3NW9A 1GG8A 4PYOA 5ER6A 2KLHA 3TD6A 3LP5A 5AMXA 4I5IA 4PLTA 4ZDIA 2IIVA 1EFVA 2ZM6B 2C8VA 3TPZA 1KYTA 2NACA 2YIVX 3JALB 1J8MF 2WEKA 1JIXA 3ZDXB 1OKKA 2G28A 4G5RA 1EEHA 4JC8A 4N5LA 1CQIA 1KYIA 1L7QA 3R4CA 4URUR 2O8BB 3PHBE 3A6HA 3AXSA 4BMYA 4WOBA 2QXYA 4CMGA 4Y2SA 4CQLB 3O8QB 2JLUA 3FYCA 1KO8A 4XSGA 4GS5A 1AQNA 4MYHA 4UCWA 4MYUA 1W44A 2D8MA 3RVOA 1GARA 3OQOA 1KYVA 3FPJA 3GCXA 1CIJA 5CXQA 2RJOA 4CHGA 1HMPA 3RSFA 2J3MA 2IH5A 2QTCA 5D51S 4DGSA 1D07A 4MQFA 2FFHA 3MIZA 3TCKA 3ILHA 1M1YB 3FZQA 1E5XA 3HJNA 5HE9A 2IYXA 4YAUA 5HF8A 2WFMA 4TLCA 5AW3A 4IDGA 2WMOB 1OGIA 5CCBA 1FS6A 4Q4LA 1XTTA 2H5IA 1H2XA 4RMNA 5CJJA 4AY2A 4LS3A 3BTOA 3SIWA 1O8BA 1BE0A 1P17A 3A4VA 3D0RA 1RADA 4BMXA 4BQPA 4D3DA 1HQCA 3FR7A 4U3JA 1L6RA 4LFCB 1LNQA 1XYGA 3DM9B 5SICE 3RYHA 4NYJR 3HLTA 2HA7A 1P2SA 4BV3A 5LWHA 3D4BA 1FA9A 5AKGA 4OJMX 1QE5A 1X7DA 3GJXC 4GRDA 1P4GA 2RK6A 4INOA 3PSAA 3N59A 4KAJA 4G01B 4UEQA 3ZE2B 1P0FA 1CETA 2G9UA 2ZIFA 4AN1A 4H1VA 3FGPA 3O26A 1NQUA 5SYNA 3CXRA 1LBHA 3PQ6A 4HVAA 3KV1A 4ZCRA 3WLLA 1HURA 1P5FA 1N2CA 3QJGA 1IN8A 3BFPA 4OQPA 4E94A 4K9OA 1H66A 2GK7A 2NZWA 4RYDA 4Q9HA 1Y4SA 4EVSA 3LNCA 4R2LA 4OX9Y 5IM4A 1MNAA 4QNRA 4MV5A 1G21B 5AVRA 2GESA 4WEOA 2JGIA 3R74A 3HVKA 1XVTA 1JHOA 3CXUA 4ZYUA 3BCHA 1E1DA 1AXGA 3W05A 4DBVO 1Q0TA 4D0GA 4URHA 4CLEA 4CI9A 1D03A 3DGFC 3G2HA 1V25A 1E6WA 4HNHA 2OXTA 2D2XA 1D7OA 2VJQA 1SOAA 1U0SY 1PTKA 3PA8A 4UBNA 4AJIA 2W6IA 1I6MA 2WQ7A 1Y42X 4HH1A 5AXBA 3HZRA 5B3JC 1XZNA 2QTBA 3ZZMA 2X5JO 3U3OA 4C1NA 1M6NA 2I4MA 1TL7C 3ZLUA 2W2KB 5BSFA 4NRDA 4U39A 4F9FA 4KKXB 1OB5A 4HB2A 1VLZA 2GN1A 2WPDD 4XR9A 2JI6A 3EUFA 2OHFA 1C7FA 3L93A 4YEDA 5KIAA 3FHJA 5H59A 2OLKA 3MJFA 3TR6A 4MK4A 3E0QA 4Q9NA 2QE7A 3A26A 4L6CA 2O05A 3ZTWA 1TGVA 1QAMA 2CLIB 5HKLA 5HVNA 9LDBA 2HRQA 2Y1OA 1EEXB 3F90A 1HH4A 2VJAA 3IBCA 2ZKIA 3N8HA 3UFBA 2OCPA 4LX0A 4X84A 1T9AA 2HRCA 3WAKA 1SXJD 4G4SP 4OB8A 1LW7A 4RK1A 2W98A 1JAYA 1UM9B 1H6AA 1TZ2A 2AEEA 2V1XA 2WKSA 2WOJA 3MJEA 3P32A 2C07A 4FFNA 1CUUA 5CHEA 5LMNB 4F1JA 3EVGA 3EXEB 3IO5A 2BISA 1K97A 2QAIA 4ACBA 4I6EA 4MKFA 1NBMD 2Z58A 3ANTA 2LPMA 3OVMA 1GPH1 5L3QA 2ECKA 2QLJA 1XVUA 2C0CA 1KR2A 5LZ2A 2AKEA 3TQHA 4M21A 4KWIA 1L7OA 3BSWA 4XIIA 1YMUA 4RK4A 1TGYA 3VPGA 4F3YA 1U2EA 1YZLA 3DJFA 2X14A 4BNJA 5HIMA 1QZTA 2QG4A 2IODA 3HQ4O 1MA3A 4PANA 1W36D 4RELA 3CEPB 3W8FA 2NG1A 5F7OA 1VE1A 2GCGA 2R4UA 5HUJA 3TG8A 4RTMA 1SU4A 4MW1A 3S55A 4S1VA 2VT7A 3L06A 4XYBA 1HSOA 3HJTA 2RC6A 3HDHA 5DWDA 1DADA 4LJKA 4TWZA 4CG0A 1GZSA 1J25A 4YO7A 5FWXB 3KZ1E 4I6GA 3BWEA 3VR3A 4D9GA 4DQ0A 4DEVA 2ZLBA 3BULA 4R0NA 1VMAA 1OGYA 1U8CB 1QAOA 4EX7A 2VQEB 1P0PA 3L8DA 2KB0A 2ZRDA 3TOVA 1ZQ9A 5F2NA 2C4MA 4R81A 5B6PA 3QKRA 4HF7A 4XB1A 4OXXA 1LQTA 1QJ4A 1H2YA 4DNXA 3PG5A 3F6PA 4MS4A 3OLYA 1UAAA 1ECCA 3LPLA 5D3KA 2IIBA 4LGCA 2BGKA 2D5CA 2JGRA 2OYRA 3AVPA 3ON5A 1T5OA 7REQB 3HGTA 3DJYA 2HEIA 2HZBA 5EHNA 3LY9A 1KJ9A 2QDXA 1RQRA 5DDIP 1DMRA 1RKXA 2GN8A 3TBFA 1AHPA 1KDTA 4LOAA 1WQ4A 3MHTA 4YMVA 1XDZA 4O1HA 1TRHA 4QKQA 1A2BA 2IZ5A 1Q20A 2KYRA 4W7HA 4AG5A 2WJYA 5LYJF 3QTLA 4ERXA 1XJ0A 4QEZA 4GI2A 3LYUA 4HXYA 3X1ZA 3B48A 1SCAA 2Y66A 3S5JA 4E1BA 3SQWA 4ED9A 3LW7A 1U9YA 3C6QA 4CEJB 1WBDA 3WGGA 2QTMA 2BR5A 2INGX 4K81B 3KQUA 4IZIA 4FGWA 2C4UA 4QOGA 4GLFA 3KB1A 3LHSA 4BZQA 4EGQA 3PDJA 1XTKA 3QELB 2JGKA 1BGXT 3WBJA 2QB5A 5A4DA 5FEUA 1DC5A 3I64A 2P91A 1Y7HA 2QE6A 3C7KA 3F4BA 4IMPA 5CDYA 3N70A 1JH9A 3PLAE 3ETLA 2F55A 4JWKA 1R6UA 2Y71A 2Z08A 4FYJA 2X4LA 3LI2A 3RQSA 5ALJA 3TKYA 4ZGWA 4K05A 3EVZA 3NHYA 1UJ5A 2GF9A 3IMEA 1QRTA 2QXUA 1OXUA 2V7QD 2BHLA 3FFTA 1R9JA 3WBBA 1A9XA 1DAIA 4B47A 1OMOA 2WJZB 4WXMA 3ORYA 3T8YA 1RU3A 2NYVA 4IMRA 1B8UA 3FSGA 3R3JA 4KUEA 4TUYF 5DWVA 2GHTA 1E32A 2Q62A 3HYTA 3IEIA 3LXUX 2XNDA 4TMWA 2O8EB 3RGGA 4RBNA 5BR1A 1Z6ZA 2RGNA 2AXQA 5E2BA 4NC9A 8AT1A 3Q1KA 1FP1D 1MG5A 1AZLA 4RSRA 5ER9A 3PL5A 5HKKA 5BW6B 2IYAA 3VBCA 5JAOA 4EI9A 3B9RA 5JNVA 2BTEA 4QUAA 3S2UA 3LAWA 3DTVB 3O2JA 4BJ1A 4YMIA 4R3NA 2QL9A 2CLSA 1F2UA 4UBIA 1E1LA 1PHPA 3U4GA 5BWNA 2G1UA 3DVRX 5FOUA 4ZTBA 2ZPTX 4LQCA 3OQIA 5K99A 3F6YA 3COVA 1IQ0A 1SVWA 1V3QE 1X3SA 1GGKA 3O3MB 2AMLA 3PJFA 5FB3A 5BR4A 1AUPA 1C4KA 4GKAA 4O1MA 1DAEA 3CE6A 2P7IA 3B9BA 1IJEA 3JU3A 1PVVA 1OB2A 1IXYA 1PSWA 3C74A 4UUBA 5B1EA 3BMCA 5EWJA 1VP3A 3QNWA 4JLNA 4UM5A 1F0YA 4DM7A 5GGYA 5CURA 1B16A 2F8MA 4MP6A 3RBVA 5ILQA 3NNDA 4OJNA 3JD2A 4L9WA 1FSPA 1Z75A 1RWNA 2ZT6A 2YJGA 3GQVA 3NAQA 4HRVA 5AXCA 3T3MB 4A27A 4E33A 4M0PA 2FFQA 4K2HA 2IKSA 2Q4TA 1RI2A 1R2QA 3PKIA 1RHMA 1WMEA 4X7MA 1F7UA 4JXZA 1M2VB 2HSGA 3QX9A 4HYYA 5JVDF 3C6ZA 1CZHA 3IPYA 3L7IA 5DHFA 4DA9A 2ZYIA 4DJEC 2HD4A 1D0IA 1YACA 3H2BA 4NMHA 2IUEA 4QJ4A 1R6AA 1KJQA 3HUFA 4UXIA 5DEOA 3VNBA 4Q4JB 4EA9A 1U2GC 3LX6A 3IIMA 4YRFA 2BF7A 4GUAA 3ADCA 3AKCA 5H4GA 1KI9A 1EXNA 2HJGA 2ZVPX 1X7WB 3WKAA 2Z56A 1U2QA 1KO5A 1XLUA 3D3NA 4OI1A 3T5BA 1JJBA 2A0UA 3D7KA 5GAJA 2PYIA 2I1WA 3PRKE 4MPPA 5JJKA 3NRBA 2X0NA 3WLTA 4NYMQ 3PPXA 4ENPA 2FOIA 2H92A 2EWVA 3HHEA 4U9HS 4OAOA 5EZYB 3TR5A 4CLOA 4RXTA 2W58A 1IHUA 2ZBUA 1QK5A 3COWA 1R1DA 5CVDA 3UIEA 4X62B 1EUQA 4FQ8A 4CJXA 3L2OB 1WY7A 4OYHA 2YZMA 1O6ZA 5HIAA 5B4UA 1A27A 3NHRA 4DJDC 2AI1A 4FEYA 3ZVMA 1LDEA 1ZYUA 1DIRA 1T9CA 4J43A 1E3JA 4IBOA 1X7XA 5G2OA 3BXZA 3R5JA 5AKXA 4R16A 2OR3A 4Q3NA 5EIOA 4WGFA 3CONA 1H8EA 1GTMA 1O6FA 3VFDA 1NVMB 4G4SO 4UBJA 1L9KA 4UHEA 1W19A 3V4SA 2Z5GA 4Z4CA 1FFXB 1SC4A 1SUBA 3VV3A 4F06A 5KTRA 2PX3A 1OH6A 3HXMA 3D6HA 3CH7A 2R6FA 4M46A 2G77B 3ILXA 2E89A 5LQUA 2QTGA 2XLBA 5KKAA 3N39C 4BNTA 3AHEA 1YZVA 3EDMA 2VAXA 1XXHB 4MB0A 5A9SA 3F67A 3OE5A 3DFZA 3TRJA 2QN8A 2IELA 1SUIA 4BGEA 2O52A 3ZHQA 4JBXA 4AX8A 1DKLA 2PGXA 3GRPA 4Z7JA 2HA5A 2O20A 5I8WA 1JEJA 2YHBA 4KE9A 4CYMA 4MWDA 2PKYX 3MJ4A 5C1IA 3VYTB 4IJ6A 1BVYF 1LLUA 4Q7EA 5BR8B 5LD2C 3O3OB 1PS0A 4MLDA 3UWKA 3G7UA 3CF4G 4LWOA 4U6NA 1L7NA 4LCJA 4RLFA 1OFUX 2CMFA 4OXYA 1I1HA 3TMAA 1EPUA 2VP9A 3SR0A 2NU8B 4MTLA 2PU5A 5DBHX 1RCFA 2H4XA 1QIIA 1IXSB 3N2KB 5LP6C 5AW5A 5CEEA 3L1KA 2W6ZA 1GFWA 2PTHA 5DLDA 5GADl 1PJSA 1E7YA 4OFWA 5DP1A 1ESEA 1FRNA 2YQZA 3BC1A 1L5WA 3UKDA 4L95C 1TK9A 3HY6A 1T2CA 2GPYA 1GYQA 5ALWA 4DWVA 1J2YA 1E2HA 3LPDA 4F5YA 2O14A 2R68A 1KI3A 1J4AA 1NBME 2OHHA 1GU0A 1GEEA 2C8KA 1BE6A 1JF8A 3HCEA 1TAGA 4EGJA 5HA5A 1CULC 1GKLA 3AF0A 4JI4B 5K3SA 4QUJA 1BRTA 3RAEC 2W6NA 3HR7A 821PA 4MPDA 2AEMA 3EMBA 1NW7A 2JFPA 2QVGA 1U04A 3HACA 1QGYA 5UKDA 2EEPA 2F3SA 4UDYX 1YJXA 3WNCA 2FRXA 5LP6B 1GGJA 1LC3A 1P91A 2UVDA 4I2VA 5LUBA 5FWAA 5CX1B 3W04A 3GNLA 1F4PA 3LCMA 4GSKA 4EVIA 4D43A 1Z16A 3IT0A 4Y98A 2WD8A 2BTOA 5AM1A 3JALA 3MHPA 1EU1A 2VHVA 3N07A 4RL4A 4MGZR 2XE6A 2LKDA 4PLVA 1NAHA 3MC1A 3HDYA 3DPSA 1H2RS 5EQDA 2E18A 2IP4A 2O8BA 1PG0A 3NWJA 4Y1FA 4FM9A 4YRMA 2PUVA 3HSSA 4YJDA 1ZC4A 1GTVA 4EELA 4GQAA 1KJIA 2WBLC 3L1UA 3O8QA 2IYFA 4HLUA 4HH3C 4YAEA 4L5CA 3DFMA 3MELA 3OT5A 3N74A 4BFUA 4UDNA 1JDVA 5KVCA 4K0RA 1VKRA 3I6QA 1F4VA 4MVJF 1P33A 2FQXA 3A6KA 2AFRA 1LPBB 4UCXA 3KB8A 1P7CA 1R4ZA 4UTXA 4AJNA 3CEMA 4N7BA 2AQHA 2X15A 1M1YA 4Y1EA 2IXAA 4IV0A 2J6IA 2VYCA 3AV3A 3BWXA 1SRQA 4Y9SA 5KDDA 1L8XA 4QDZA 1ZQ1A 1KU6A 4Z49A 4BX8A 1XRNA 1UZUA 3GO4A 3ZHSA 3E53A 4CEIB 3IEVA 3R7NA 2OV1A 1ZJWA 3K9FC 2YQ5A 3BWCA 3CH6A 5J2TF 1SVIA 2HWUA 4XWYA 4CV2A 2H16A 1ILWA 1GNVA 2BBOA 4H2DA 4CDMA 3DDZX 3CRVA 3FFXA 2G5PA 3TVTA 2HXGA 3OOEA 2H29A 2Q2WA 3KR2A 4K1LA 3W6OA 2CXHA 3PCXA 1IEVA 3MMSA 5EJ8A 3T5AA 2RGCA 3OMLA 4Q9JA 5BT9A 1FDOA 4EY6A 5DNDA 4OGLA 3PX2A 3ZKWB 2HR1A 5KKCA 3VPXA 1HE8B 1IDOA 3ZWPA 4I1SA 4ER0A 3RFCA 3PGVA 3D6UA 4M9CA 1JSCA 5JJLA 1MPXA 3AOGA 4J6FA 5CDHA 5AJTA 3B1XA 1C41A 1ZMOA 2VDRB 3KE8A 3AR8A 5I48A 1T1GA 4L4UA 2JFQA 2P3SA 3IT2A 1MN6A 3R7BA 1NGSA 2JB9A 2OE2A 4ZC8A 3C5HA 4IXMA 3NHKA 1ADFA 4K3UA 3ZY5A 4ER6A 1JHUA 3A4NA 3DE4X 3CX4A 2PGLA 2JH3A 5EIFA 3BJEA 1EQ2A 3GYGA 3DBVO 4GSLA 621PA 2WFAA 4CW7A 1CUXA 3LHFA 5IVDA 1RYFA 2P3LA 3KEGA 2FW1A 5JJCA 2WIKA 4GX2A 3C6MA 1I3CA 3ZU4A 1GAWA 2J9ZB 2Z5FA 3EVAA 3UK0A 3L4SO 2E4AA 2FSVA 4JGBA 4IIDA 3UPUA 1Z8FA 2VNKA 2F67A 2B7BA 2AN3A 3O4FA 2XOXA 4PCVA 4DMMA 5DYIA 5KSYA 2ONZA 1IH8A 3LOUA 2QMOA 3ZLJA 2Y99A 3BPSA 2W2KA 3ZWCA 4AWXA 1G41A 3KZCA 1KSHA 4F3TA 2GB4A 1ONBA 3GJ3A 4MWSA 1RM0A 2P2NA 3U9TA 1Y3FE 1IXKA 2LCQA 3ZWXA 3OPQA 2ONCA 4AXBA 2HYDA 2DQSA 2RKOA 2X1MA 3X2FA 4PRKA 1KAHA 4ZTUB 1SZCA 4TKMA 4FYKA 5GJCA 2RHMA 5BVGB 3RVBA 3DTNA 2XSZA 1OTHA 2XI4A 1U1IA 3EA5A 3ETGA 5FL7A 4P32A 3BA1A 4NS1A 3WLRA 4QX6A 4MA5A 4AWAA 3DP9A 3JQBA 4YAKA 5ARCA 3RYIA 1PRYA 2Y0DA 1GNTA 1UM9A 3M6UA 4IQ0A 2SKDA 2AG1A 1NYRA 3KJGA 2JAQA 3PPWA 3ZY4A 2G3YA 4D8UA 1T9HA 2OILA 2OT3B 3EXEA 3LPNA 3RFUA 4JIMA 1JR3D 4J7AA 2WG0A 4L08A 2IPXA 3DOEA 4WD3A 1FFYA 2RE8A 4PN3A 5CB8A 4G5GA 1E69A 1JPJA 3VGJA 3STWA 4OYYA 3NUQA 2O0KA 1O95C 1W52X 3ND7A 1YI8A 3CGWA 3K4QA 3M4NA 1QVVA 1N8TA 2P4HX 3QWHA 3PWSA 3R44A 2X23A 4TKVB 1V3UA 2BGWA 3W9YA 5JIBA 2XZOA 4CODB 5JMPA 2GQ0A 3UVEA 3W2TA 2FDCA 2ZB2A 2FN8A 1FTSA 4ZYZA 3FLMA 4BLSA 2OHXA 5BT8A 3IT1A 1DRUA 5TNXA 2A59A 3AF3A 2R25B 3ROPA 5U9CA 5LXTB 2AI3A 4D6YA 1LBEA 1OZGA 5FWXA 2NNLD 1EHCA 1IBRA 4MQ5A 5LZ8A 1OLUB 4EAQA 3A9TA 2V9PA 4AZTA 2XTNA 1E5VA 2PA3A 3BHNA 1PWZA 3KD3A 3N8NA 4NJOA 1AUXA 2B83A 3NVKI 2H63A 4B09A 5G40A 3B6JA 3SX0A 2FMIA 1E3TA 1PR9A 2NU6B 3BXPA 4MHOA 1BA2A 1GPKA 2CVPA 3HZZA 1JDNA 2EKPA 3MUEA 2ZUUA 2YVKA 3I9V1 5GONB 4YRZA 3E8MA 4AKHA 2MHCA 2Q2NA 2RAPA 1Z2OX 5ALZA 1PWYE 3CT6A 3R7LA 4FS8A 5CDUA 3HNRA 7REQA 1T8SA 1RFGE 3RBAA 1P19A 3UUWA 4TTAA 1RMQA 2J30A 4ZAVA 3ILYA 1EFUA 3E7PA 3TZQA 5BQ3A 3OY7A 3QE9Y 4URZR 2ZBEA 3GOQA 4CV3A 1ETUA 4QEKA 3U6BA 3U56A 1XWIA 5HBRA 3PRHA 1Z22A 2HU7A 5E9AA 2XDYA 1H6DA 1ECJA 2BBSA 4N5MA 1QO9A 2JLZA 5KVVA 1J00A 1Q77A 3ZDZB 1O08A 3DBLB 3LZDA 3Q5DA 2BI8A 1NZFA 2LV8A 4QPZA 5HF5A 4C0KA 2JAUA 2UZ1B 3G0DA 4EW3A 4CEJA 2XCRB 1FQJA 4GI3A 4KR2A 5BWLA 2RD2A 4HR7A 1ZKDA 3BB3A 4G8JA 5A4MS 1U90A 4HT3B 2RK4A 2ZAMA 3GVPA 1SK9A 3A1UA 2IYUA 3OPYI 1ZNZA 4LE0A 4N49A 2AXEA 1MABB 1L9XA 2FAXA 1N5LA 1G8HA 1E64A 1R74A 1M2HA 1VI5A 3CSSA 3DXXA 1V5WA 1DFIA 2H1FA 3MLEA 3SEQA 2QQFA 4FOPA 1Z35A 4XJVA 3GB9A 4XVCA 2OPHA 2I3ZA 4YECA 1XRJA 1J99A 5KYNA 4URYR 3MWKA 5BVHB 3ZHYA 5HGJA 1IHPA 1OTXA 2V7WA 2V98A 1P74A 3D6VA 3K0SA 5K0FA 1VBKA 3E3LA 3UZUA 5KSWB 5MN6A 2MT9A 1FTWA 1UADA 3MT0A 1OYYA 1VKOA 2Q3HA 3Q2IA 4PXYA 4AIIA 2QZSA 4H7KA 1CEQA 4XPIB 5BWCA 1JVNA 4FYYA 2O8EA 1Y9DA 4X90A 4EHBA 1VG0B 2OXEA 1DXQA 3VDXA 2WT9A 3NBQA 4EBBA 4HQ6A 1T15A 5L3VA 3A6DA 4WOPA 4OUKX 2FPUA 3E3AA 3FPLA 5DM0A 3UGQA 5EGNA 2BBWA 2QRLA 2JG3A 4BKMA 2P0YA 2EJWA 4RIIA 3UB4A 1NL3A 2A78A 3UBTA 1AF7A 2YJ5A 3DTVA 1SOUA 1YQXA 1Z7EA 3FTQA 3HCPA 4OHKA 4A2PA 1JIJA 4MS3B 4BDSA 4D45A 4KPYA 1OAOC 4I7EA 5JYEA 2X5NA 3S29A 1U98A 1Y4UA 3FN4A 3E8XA 3ESAA 4BFZA 4RJJA 4BAGA 4UTRA 3GZTB 4B3BA 1NOKA 1JYFA 2JVIA 2WA2A 3GH1A 3B53X 4P81A 1NXVA 3R7DA 3L4KA 4ABTA 4LRYA 1NMXA 1ZK2A 1UAGA 3GLFE 4EG7A 4O6VA 5TPWB 1ZLYA 2QBYA 3L6EA 1U11A 3STYA 4DYVA 3B78A 4LSZA 5F64A 1KXJA 3ROKA 4ZYYA 2QV7A 2IVZA 2I8CA 3L79A 4GBED 4JP3A 1A5AB 3T15A 4NEQA 1YC5A 2RH5A 4OI4A 1QM5A 2J32A 1I4DD 3C4JA 1HK7A 3OECA 4E13A 2RHRA 4B40A 4TQAA 3F6EX 4HZGA 1P1KA 1DIHA 1LDBA 2MTBA 3JQAB 4OF4A 4TTQA 1VCHA 4ND8B 1JJVA 2G17A 5HZKA 5I7UA 1M2VA 1AH2A 2CB9A 4IIYA 3JWEA 4D9CA 4QGGA 4YGYA 5AVJA 2WHPB 4OG2A 2CXQA 2ZUEA 1UK8A 1AHHA 1JA9A 2FW0A 3OEYA 2WHXA 4N8SA 2VDWB 1K7SN 4NH0A 4Q4JA 4UXHA 4GOLD 3IEKA 1YJQA 3QOXA 5TJ9A 1VP9A 3WIBA 2Q3DA 1XQ6A 3A14A 3J80A 3FPGA 2BD0A 3TYXA 3TIGA 3TOCA 4D9BA 3ZX4A 1X7WA 2ZBVA 1PLKA 1AZSC 3JQQA 4RZHA 1OLXB 1A7AA 1OQAA 4UFNA 4ZEWA 1AS3A 4AQ7A 1CLEA 1SK8A 2HBZA 4OKNA 3VR2A 1YASA 3H1FA 3NFRA 4LZOA 3I83A 3GEIA 1N8NA 1ZI8A 1EDDA 4EL0A 2RHWA 3BIXA 3KKKA 1R0YA 1NONA 3GFBA 2HQSA 5EZ6B 5EZYA 4TSFA 2HA2A 2NVOA 4FMBB 1IG3A 3FCAA 2C0PA 1YZUA 2WA1A 4GEGA 4ZDWA 5LB2A 1DV2A 3QUCA 3JW8A 2KLBA 3GXBA 5FNZA 3WP1B 3K70D 3NYIA 2V65A 3C8ZA 2BMFA 3KO8A 2WT8A 1NI4B 3LBYA 2PWPA 1I4TD 4TV8B 4I3FA 4YQEA 3ROGA 5H70A 1JUDA 3PHHA 2OPBA 1FDRA 3F71A 3IJ5A 5HF9A 1MB0A 3MQ4A 2FRDC 1KPIA 2YHIB 3CWCA 3IUPA 3E9NA 4HATA 3TD9A 4B2PA 5BWOA 3B3FA 1BJKA 1TA9A 3RFXA 4AP5A 4L02A 4TWBA 4FNAA 5FCDA 1J8YF 3T7TA 1MV8A 1KIMA 2FZLA 2QJFA 4KQJA 5LA6B 3KSAC 3K2QA 1N77A 1G0OA 1OF1A 4DZZA 3B38A 4FTWA 1SMKA 1KFBB 2IIQA 1SPXA 2AXNA 1FFXA 2IY8A 3SQDA 2X3FA 1K0FA 1UQRA 1DS6A 1T2EA 2YWHA 1BQ4A 3BHJA 1SA0B 3HJUA 1GOTA 1GQYA 3MJSA 4BYGA 1LEHA 2O06A 1A96A 4R3WA 1RTTA 5DXFA 1T2AA 2WP0A 4KMRA 3BEOA 2IHYA 1XXHA 3PDWA 1A77A 2JLRA 3V6LA 1QVAA 1WQ1R 4M1QA 4M98A 3TW4A 3W8DA 1L8QA 2A9FA 3R1IA 3KQQA 4N9WA 1DBQA 3BKWA 3N6XA 4JODA 4BGIA 1MENA 2WU3A 3H9BA 3H8JA 2VJMB 1VECA 3NU1A 2CEAA 3QUSA 1HDEA 1KSGA 4B84A 1H4SA 2AHRA 3AIKA 5I6DA 4H4CA 4S24A 4PONA 4B4KA 4BMDA 5KNBD 2CMGA 3BRQA 1V7CA 2HMUA 5KJFA 3AJEA 4DWJA 5CTJA 3P0IA 3QW4B 4BQOA 1T2DA 3B85A 1FE8A 4OBXA 2NU8A 4YLYA 5F98A 4LDQA 3WJ2A 3PUKA 4AQDA 5BNZA 3AF6A 3VVLA 3L7NA 3N2KA 1HLPA 2OD9A 4MLZA 3SSMA 2GYUA 2K7FA 5BP7A 4KFUA 3OURA 1WPXA 3GI1A 4LBZA 2Q2VA 1ZVMA 3L6CA 4FI3F 2IOYA 5CLIA 4IDHA 1JSXA 4DF3A 1N8KA 2YMQA 3A04A 3CO0S 2E4XA 3SXPA 3K5IA 3OFND 3DEJA 3G6KA 1WS6A 4KSCA 1O97D 3O4GA 4TTVA 1G8PA 2H2DA 5E95A 3QQ5A 3EHEA 4WXRA 1P7PA 4ZCSA 2WNHA 4IMIB 4LYAA 2OXIA 3SVLA 5EIBC 4C04A 1DWOA 2HMVA 2JCSA 1RXVA 1YRYE 1TQ2A 2G0AA 2WD7B 3OE1A 4RD2A 5LC1A 3CKYA 4QLOA 3VOSA 3WNQA 3PT9A 2GS9A 3V1LA 4DOMA 3GFVA 2WUFA 4GDMA 3TQTA 5TQ0B 5LP6A 2MIIA 4AX4A 1U3UA 3A1WA 1GLNA 5JH7B 1M75A 2EX4A 4BNMA 1XU9A 5CX1A 5IC5A 4B4VA 1HZZC 2WZCA 3KOWA 4DCSA 4B32A 3AETB 1J97A 1PDOA 2GEVA 3SR3A 2SKCA 3TE6A 3VHXB 4KDEA 4R1TA 1S0UA 3ENWA 3LBNA 5LQJA 3VNVA 1WV0A 2JGEA 4ESOA 1IJFA 2R00C 1A2OA 1MG0A 5TC4A 1XAGA 1BXZA 2ZPUA 1OPXA 3I4FA 4FCVA 4LJ8A 1U81A 3TH5A 4C87A 2ZRKA 1TTPB 2H1HA 3NGXA 2X41A 4ON9A 2IBSA 1Z68A 4CCAA 3FB4A 1ZK4A 4INAA 3HWRA 5JU6A 1CHDA 1YZGA 4RNDB 4XR4A 2FPPB 2Q5QA 4JXKA 1Z0UA 1AV6A 2IV7A 3UK2A 5E38A 5FTKA 3ZWNA 4MAFA 4BKQA 5CM9C 4CTMA 4R69A 3MTJA 4R8MA 4B73A 3PEWA 1J2EA 1E66A 3EZNA 4KTTE 4Y2YA 1CYEA 4X7BA 2GXAA 4RKWA 1VCMA 2C3PA 2VQSA 4FE3A 3MZ0A 4NLLA 5AXDA 4IG4A 1TM4E 5EYPB 3WGHA 1V8BA 3LF1A 2FPIB 2V03A 4HDQB 4P0QB 3CYFA 3HUUA 3BJZA 4V1CA 5JFTA 1T1IA 2O7QA 5D7NA 3U7IA 4RHEA 1SEVA 2GVDC 4QODA 5EP4A 3NTVA 3WMRA 2TRSB 3Q3JB 3WKDA 4CEIA 3I76A 1IVNA 4MQ4A 5FYQA 2WSIA 4KWCA 3H11B 2W6OA 2BW0A 4MKIA 1BWSA 1MA0A 2GD2A 5CRIA 1QJCA 3NUGA 4C2UA 1ISRA 3A1VA 4HFNA 2GZ1A 4P7GA 1W4LA 2P77A 3AEYA 1UMBB 2XYVA 3WYCA 4Z51A 4FW8A 1N6HA 2I67A 4B85A 4Y6LA 1IULA 1F8FA 1X9GA 2DHQA 4JJ6A 1XTQA 3AV0B 4JLVA 1DBVO 2NZYA 3ZKWA 2FP3A 2NQTA 2OORC 3OA2A 5C5CA 4BQFA 4Y30A 4RKYA 1CS4C 3NC0C 3NLLA 4FNOA 4Q9AA 1NF3A 3REFA 4RVHA 1G6KA 3DEFA 5D87A 1TD9A 1ZICA 2CK3D 3K20A 3Q12A 1JEEA 7ADHA 5HIIA 2DAPA 4K9DA 1NF8A 4BL5A 1VI6A 3KQOA 2QUKA 3X1DA 1ECGA 2QY6A 4O0MA 4DUPA 1ZH0A 2YJNA 2GXUA 4DC1A 3HYRA 1ODCA 2OUIA 4LWQA 3T99A 4G1BA 1F51E 1CF2O 3BL5A 3T4EA 1XDBA 3NT2A 4MVCA 4LQ4A 1IN4A 4GZ6A 4IQGA 3BL8A 1AMNA 5FWYB 1CG6A 1I6WA 2J07A 5H3CA 2FF7A 2X40A 1A95A 4DLUA 2XBMA 1D3AA 4O4LF 3CJQA 5LLDA 3LCRA 1IPFA 1UT6A 2X0FA 5B1DA 3G1UA 3TQFA 1EVJA 2R7MA 3UH1A 1OI4A 4OY3A 5HR5A 4JI2B 2CW5A 2H18A 4PYKA 3SD7A 5A4AA 3FGNA 4ZYVA 1N0UA 2B1RA 3PUIA 2QW1A 2PLRA 2IEIA 4ZI7B 4J0HA 4C0HA 4FKZA 3WGZA 2EC5A 2H85A 3GVXA 2VQFB 4KEAA 1Q0SA 1MRZA 1ZU5A 2I4IA 3D59A 3EISA 2PGOA 2FQWA 5AHRA 4ZDJA 4ARZB 3TQRA 5EXPA 1VG9B 7YASA 4G97A 1I2BA 4PE5B 2ORIA 3L84A 2R6AA 2PT7A 2R4QA 1JQJC 3NRJA 4P80A 2WKWA 4V0NA 5BVGA 3N6RA 4GNRA 3O4HA 4HX2A 2W8BB 4BO6A 3RR2A 2ZAYA 3D2AA 2Q1UA 4IEFB 3D6NB 1CZKA 4JR0A 4QL3A 2PQ0A 5JYCA 3MTBA 4I1IA 2VNHA 3BM5A 1SKAA 1KJZA 1R3DA 2CKMA 1GCIA 3EGIA 3HBMA 3Q85A 4MW7A 4V3CA 2Z43A 1YQWA 1RXSA 3EFHA 4JDPA 4WT7A 4ZI5A 1LTKA 4MKZA 4K6FA 3WLQA 1YFJA 1MB9A 1PE0A 2WUEA 3DNMA 2GKOA 3T94A 2EBUA 3PIDA 3VYRB 2C7RA 3IA2A 4P2GA 5A9TA 1YVPA 1XVIA 3H19A 1HNZB 2G1AA 3IP3A 5FIUA 4FGSA 1X38A 4K26A 4TKVA 2FGJA 3MGCA 1J9EA 1FU7A 2J33A 3G23A 3IOBA 1R7RA 2Q7OE 4A6EA 3FDFA 4BFTA 2Z1DA 2VDPB 4NENB 2C0QA 1I8TA 1PR5A 4Z5XA 1HFEL 1J23A 4KXVA 4IIEA 2IBMA 2GD1O 4ER3A 4R51A 5LXTA 4JGIA 1X9HA 2E6KA 1NVDA 5IDXA 4YXWD 1HT3A 2HDOA 2YX1A 1OLUA 1AKEA 3SQLA 2K2QB 3TMKA 1ZESA 1GUFA 3I30X 5SZHB 4GU5A 3MJCA 3Q41A 4KN5A 3F9RA 7AT1A 3SE0A 1QG2A 4P34A 1DQPA 2GBLC 2ENUA 1V47A 3TLCA 2NU6A 5IXJA 1IHYA 1O95A 3NHAA 2RI0A 1P0MA 1N7GA 4L74A 4RVDA 3RJTA 3WHLA 2E87A 3DEKA 3LOPA 3C6XA 1TEZA 1I2AA 3WK6A 2H1RA 2AXPA 2C2HA 4JLKA 3MW8A 4PEVA 4JYAB 3IKLA 5J40A 2AOVA 2XB6A 1U6JA 2QRQA 2XKBA 1V9CA 2RCNA 3HB9A 4WFIA 4RK5A 4LDJA 5JAHA 3IULA 4D4IA 2IPMA 1UPUA 5DGHA 3DEYX 3I92A 3QVOA 4K9QA 4BTVA 3HXPA 4IF4A 4INJA 4DCOA 5DASA 3K8ZA 4MUXA 2EDAA 2PXXA 1FXUA 4OHUA 3BE4A 2O8NA 2Q21A 3GJ4A 3USES 1XAJA 3VZPA 2VZEA 1Q3HA 1VKJA 3PF8A 2JH9A 3DBLA 1NUSA 3ZE9A 4F2WA 5M2QA 2CB0A 4WZBE 1KAMA 2UZ3A 3I23A 2H51A 2UZ1A 3GGOA 3U44B 3RS8A 5C7OO 2VYNA 4RIFA 3WYEA 1IUOA 1QCZA 3LVRE 1UP7A 3IEPA 3QKWA 5DF1A 3KEMA 1KWGA 4ZVMA 1DU4A 2NZ8A 3WGIA 1MABA 2PFSA 5CYGA 1IY0A 4QU8A 3QJYA 5TRTA 4Q4AB 4C7XA 4LGMA 3K5HA 5B57C 1EK6A 1CZRA 4W9NC 3N0VA 4MO9A 4W7SA 2P9GA 3VZQA 1JNXX 1R27A 3RLFA 1D4ZA 1U8UA 4FDLA 3SC6A 2COKA 2REOA 3U4DA 1P61B 5EZ5A 4IIJF 4EUFA 2F9LA 5BVHA 2F1HA 1M7HA 3PWKA 5FDFA 1ZFNA 3HI6A 4BBJA 4TVKA 3F6SA 4NESA 3OO1A 1QLJA 3FRIA 4OOFA 5CH8A 5COBA 2XUJA 4XPIA 5JZBA 4FR5A 1DG3A 4X00A 4JC4A 1PGPA 4RNCA 3T5PA 2WTBA 1M8JA 4G1FA 4NU0A 1JGTA 1FP7A 1ZGBA 4ZARA 2DULA 2BGJA 3HJRA 1Q7CA 1COWA 4WH0A 4X6YA 3PNMA 1POWA 1CK4A 3EXIB 3KKLA 4OXIA 3U0BA 1ZVJA 1H05A 4YRIA 5AVUA 3U4MA 1WMSA 3OZIA 1M0EA 2Q3EA 4EI2A 1C7RA 1KF0A 3ABZA 3IURA 1MIHA 4Y6QA 1GPJA 3WIEA 4B43A 2JFWA 2XT0A 1AGYA 1BYUA 1QNLA 1BKYA 3C7DB 2FUG6 3DOHA 2HCRA 3M1YA 1D8AA 3LL7A 4AU1A 1U9ZA 4TV9B 1E9CA 1FFEA 5BYBA 2LCFA 1XMSA 2Y4OA 1OY1A 4ZOCA 1KSJA 3T5MA 1SVOA 3WICA 3KHSA 4XQGA 2C7OA 1OBOA 5SY4A 4LHEA 1FK8A 1NQ5A 2JFYA 3PNYA 1C0IA 3OT1A 3F49S 3HLKA 2CXRA 3FPCA 1VJDA 3M3HA 1K5DA 1M72A 5TPWA 1UIMA 3HN6A 4QASA 1L7XA 4MULA 3T34A 2P0EA 2AFIB 1ZWLA 2WFLB 5G1NA 3HEAA 4KFRA 4LECA 2PZAA 1OJ7A 3SZUA 2ZRLA 2EGHA 3E8SA 2IEDA 1DIAA 3H8SA 4BMZA 1Q19A 3V9AA 4QT4A 4FQ7A 2R8ZA 3H4VA 5CT4A 1PR0A 2RI6A 2QT1A 4YRCA 2AS0A 1OAOA 2OFOA 5IJAA 4MAMA 3JQAA 3QBTA 4A2WA 1Z7YA 5AIBA 2FPRA 4ND8A 2ZULA 3GAZA 5GZ3A 2V97A 3EPLA 4BNLA 4XXHA 1E2JA 5KTMA 2QW0X 1UKYA 3QIVA 4YALA 2WHPA 1RYNA 1VE6A 4JUAA 3NNNA 4B8ZA 2VDWA 5CU7A 3P26A 4TS4A 3ZWBA 1DHRA 1JXOA 1ST2A 1UEJA 2P2LA 3AK4A 3CMMA 3H5TA 3LRXA 4OHXA 4PIPA 4RFLA 3RROA 1PWEA 4C14A 1Y6GA 1D09A 1P4RA 1HV8A 3BB4A 1OLXA 2AE1A 1HUQA 3STHA 1ODKA 2L69A 3ONVA 4O08A 3W2IA 3WGKA 4EVRA 3G6WA 3DNPA 4H59A 2BC9A 1EGVB 2D3WA 3WTBA 1HDYA 2YQ4A 3KEOA 1TM5E 2GTHA 2ZIZA 3HBNA 3S7TA 4CKZA 2ZUWA 1L4LA 2PL1A 4LJYA 2QM8A 5CYOA 4E2YA 1HRKA 5HFNA 2VUSA 4RTPA 3AP2A 1RZRD 4IILA 4BP1A 4YTEA 2P78A 3QX8A 4RD6A 4UEJA 3ICCA 4JJ4A 5FLXA 2IPLA 3FVRA 5H7XA 5CIYA 1HNXB 3C70A 3JQEA 1IM5A 3GLVA 4FWBA 1Q1BA 3G0GA 3W34A 1DUVG 4BYMA 3ZV3A 5KOJA 1NI4A 4TV8A 2W2MA 3DQQA 2R6HA 4U5QA 5LU9A 4WBNF 4HNSA 1AQJA 4ZVLA 2WHEA 1BKDR 2L2QA 3I1FA 2YHIA 5HHTA 4N9QA 1PZNA 1VB5A 1V1MB 1XMXA 2R6CA 4DV1B 2RGEA 2GN2A 1A1VA 2QN6A 3LX4A 5LA6A 2ZAIA 1KZ4A 1V0JA 4BWGA 1WMFA 2M2IA 3ANXA 5I7RA 2D2EA 4N6GA 4BMOB 4CR6A 3K9LA 3DBOB 4NMLA 2EGGA 4W4TA 2JIOA 1XYVA 2XUFA 3D4PA 3KJFA 5C37A 1YR9A 5ICGA 5J43A 1SA0A 2AYZA 5EC8A 1S3GA 3OCYA 4FR0A 1WM1A 2MSKA 3EQ9A 3TIIA 2A5DA 2PX2A 5IKMA 1T8YA 5C8VA 3UJ3X 1X7ZB 1XRPA 2QWXA 4F72A 2LDXA 2XEXA 1PGNA 3VU8A 4C20A 2IS6A 2IPOA 2GXSA 4H31A 3GDWA 3ZDYB 4EG8A 4LCBA 4PPFA 3ZR4B 1HNWB 1G8FA 2DCMA 2B30A 2PWBA 3DE0X 2FRDA 2MINA 2VJMA 1MJGA 2HRBA 3QTTA 3SBEA 1J1ZA 1JDTA 3CUEF 2ZSJA 4QARA 1RC8A 4JN6B 3OA0A 5HF6A 3M8KA 1WDMA 4CG1A 5C35A 2HADA 1EX9A 3PEVA 3IAM1 4K03A 5JDIC 1RJEA 3OPMA 5J58A 2XGOA 2J3HA 1AV7A 1Q0LA 3I1JA 1X1DA 2BKVA 2FCRA 3MRSA 2WU8A 2YHAA 3N7TA 3TAUA 4CVNA 3HVRA 1B15A 1G8AA 2E3JA 2R86A 3QSYA 4MMXB 5EZSA 4C88A 1GY8A 1YMQA 4TT3A 3JY6A 4G6ZA 4HUJA 1RHJA 2DRIA 3UMYA 5JXGA 3F3SA 4IIUA 4EECA 3EQ6A 5KNCA 3E82A 3VTZA 3VDRA 3OQ1A 2DETA 1MH1A 3DKRA 1OTYA 5L3ZA 4CT4B 3TQOA 4BFXA 1JRLA 1I30A 2WYIA 2HU2A 2YWDA 4NDZA 2AD1A 3ONDA 2EBHX 4GPD1 5ANRB 5EKXA 1UC4B 1UXKA 2OKGA 1UPFA 5AJUA 2OK7A 2H7XA 4OK5A 2WD7A 3G0OA 4NBNA 5I3ZA 4EKIA 1R0LA 3IH5A 4FDVA 2ZI7A 1DIGA 3IJEB 4DHEA 3VX4A 1VM6A 2XGGA 4LZJA 2UXDB 4BQIA 1YS2X 1SXQA 4XFJA 1ORRA 5TQ0A 1VSVA 5L51A 3GPIA 3GUHA 3QV1A 2C59A 4EABA 3GG9A 1M8FA 5JH7A 5K0EA 2IE8A 2OAEA 1FNBA 3G9XA 4J1NA 4ZANA 3ZVNA 1FRQA 4U2KA 4KPUB 3AETA 1UDAA 1CB0A 1NNLA 1O9BA 4ZN6A 1KETA 3VHXA 1QHEA 2ZJYA 8ATCA 2XQFA 4RTSA 2PM8A 2PSSA 4L4RA 5F77A 3IA7A 4UVIA 1OWLA 2Z6AA 3KC2A 4B80A 4WZAB 1EP3B 2HPAA 2OWEA 3E4CA 2MYNA 4G89A 3D8RA 1J1UA 2ZSEA 1DDOA 3WG9A 3GN1A 1DKOA 2FPPA 4L5JA 5JJBA 4AKGA 4L78A 1NIJA 3AVTA 1ORIA 3ZXIA 4AYTA 3DL7A 1RKBA 1TCCA 1W87A 4MV0A 4DQVA 4TZ6A 2CNWA 2PRKA 3GC6A 1HZZA 4PGGA 1SBYA 1F8GA 4Q15A 5CB4B 1QQTA 3CG0A 2FVYA 1HDRA 1D04A 3HI4A 2J0UB 2IYSA 2DOKA 3KPVA 3ZV7A 4C3ZA 5EYPA 3PC8C 1O6CA 2CNDA 1KTVA 3FRJA 2FPIA 2QX6A 3GW8A 1SZDA 1BDIA 1Z4NA 2OHVA 3CFYA 1HORA 2JJ1D 4Q9DA 5AQ1A 4NCAA 2JK0A 3BH7A 3HLYA 5AI8A 3RRMA 3ODPA 3RHZA 1BH2A 1Y4ZA 2DCUA 2EL7A 2KI5A 4HXFB 3K31A 5J63A 1WTCA 3U9LA 2Z1MA 2ZJ3A 3EGCA 3H11A 2MDTA 4P4TA 3P9PA 4KWHA 2QTVB 4DSAA 1PV1A 5LIRA 2AJBA 3N2YA 3KOZA 3PTZA 2VYFA 3B8HA 4MJXA 2WKQA 2ASVA 5LWQA 1RYYA 5T4EA 1FFCA 2Z83A 1UMBA 2QN1A 5TQ2A 4ZJYA 1ISGA 1H65A 3QMVA 3IQIX 5AK0A 4D8WA 1DT5A 4ZOLB 2IU4A 2POQX 4P4LA 1PEYA 3GA0A 3HCDA 1YQEA 2OXRA 2QPTA 1EJ2A 2O2JA 2XZPA 3EIUA 4HDAA 1NVKA 5CM2Z 5AOBA 1XNRB 1JDSA 2BFMA 4EFNA 2JJYA 3QYPA 1H94A 2D2FA 3AJAA 3Q10A 2PT6A 3GA5A 5E6SA 5IKXA 4IZ6A 3WIVA 3AL0C 3JQCA 2C7PA 1C30B 1NAIA 5EUQB 3P9SA 3RS2A 1E2QA 1I2DA 2R6ZA 5E9QA 4BNUA 3DZJA 4PAOA 1L7BA 5IRCD 2DUMA 1T3GA 4BX9A 1T0UA 1WSAA 4JJ8A 3C3EA 3IAEA 3WLMA 1IATA 4IOLA 4J49A 4OHWA 1X74A 1GNPA 1NXXA 5FWYA 1MF7A 2V6IA 1H85A 4R8LA 2VRBA 4NBVA 4FSDA 3S4YA 2JKYA 4RETA 3WNVA 5D3MB 1GZVA 1JVSA 3ZQUA 5CJPA 1HYBA 4B44A 4ZAGA 2F90A 4OU5A 2QOEA 3E7FA 3I4CA 1UINA 4CIYA 4ZWNA 4QRHA 2DYKA 1OZAA 3PITA 3V8RA 1XNQB 2H48A 1T1SA 2GKSA 2BF4A 3L7YA 4LC1A 3SM9A 1YCDA 3LWBA 4GFDA 1FVOA 3QLUC 1DIOB 4ZI7A 4D92A 3ER9A 1KORA 4DL9A 3OBBA 1KAQA 5JZOA 5IASA 4R31A 2AZXA 3FKQA 2CL5A 2CN1A 2P0AA 2WT4A 4ARZA 3TQSA