2G7MC

Crystal structure of b. fragilis n-succinylornithine transcarbamylase p90e mutant complexed with carbamoyl phosphate and n-acetylnorvaline
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
Knots found
sequence length
320
structure length
320
Chain Sequence
SHMKKFTCVQDIGDLKSALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRLSTQKAALNLGMNVIVLDINQGAWKLETERGVIMDGDKEEHLLEAIPVMGCYCDIIGVRSFARFENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTARPKVVMTWAPHPRPLPQAVPNSFAEWMNATDYEFVITHPEGYELDPKFVGNARVEYDQMKAFEGADFIYAKNWAAYLGDNYGQILSTDRNWTVGDRQMAVTNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLLENLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative ornithine carbamoyltransferase
publication title A single mutation in the active site swaps the substrate specificity of N-acetyl-L-ornithine transcarbamylase and N-succinyl-L-ornithine transcarbamylase.
pubmed doi rcsb
source organism Bacteroides fragilis
molecule tags Transferase
total genus 114
structure length 320
sequence length 320
chains with identical sequence D, E, X, Y, Z
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.3.-:
pdb deposition date 2006-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
C PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 2g7mC02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 2g7mC01
4KGZA 1RACA 1XJWA 3TPFA 2YFKA 2RGWA 3GRFA 2P2GA 4A8HA 4EKNB 1FB5A 3KZCA 5G1OA 2HSEA 1ACMA 4FYWA 3L02A 1D09A 4IV5A 3L05A 1F1BA 2QG9A 4WTOA 2BE7A 1R0BA 1RAFA 3CSUA 2W37A 3KZKA 5ILQA 1ORTA 2EF0A 1ZA1A 1TTHA 4A8PA 1DXHA 4KH1A 4FYYA 4FYVA 1C9YA 1TU0A 8AT1A 1I5OA 2OTCA 1ML4A 4KWTA 1RAHA 4KGVA 4AMUA 1NBEA 3L04A 3UPDA 3LXMA 4A8TA 6AT1A 3R7DA 1RAEA 3Q98A 4OH7A 4ANFA 3D7SA 2FG6C 1OTHA 4FYXA 1AKMA 3TXXA 2BE9A 4KH0A 4F04A 4JFRA 7AT1A 1RAGA 3E2PA 3M5DA 4EP1A 1RAAA 1RABA 3AT1A 1RAIA 1DUVG 3KZMA 9ATCA 3GD5A 2AIRA 3R7LA 3L06A 4E2FA 3D6NB 1FVOA 1ZA2A 1AT1A 3NPMA 4NF2A 5G1NA 2FZGA 4H31A 2IPOA 1SKUA 5G1PA 2FZKA 3R7FA 4KGXA 1TUGA 2FG7C 2I6UA 1EZZA 4JHXA 1PVVA 2A0FA 1EKXA 2AT1A 3M5CA 8ATCA 3KZNA 4JQOA 1A1SA 1PG5A 1EP9A 1Q95A 4BJHB 3MPUA 4F2GA 5AT1A 4AT1A 2QGFA 2G7MC 4AM8A 3SDSA 2H3EA 3KZOA 1RADA 1JS1X 3M4JA 2ATCA 2FZCA 3M4NA 1VLVA 1R0CA
chains in the Genus database with same CATH superfamily
1E1CA 2Q27A 4X85A 3WLSA 1Q6ZA 1V6AA 2Q28A 2GZ2A 2VQSA 2F9LA 3HXLA 5E6UB 3U44A 1KVSA 3LCUA 3OCVA 5FJJA 5H82A 3PNMA 4DYDA 1AF4A 2HF9A 2FPSA 1R5JA 3A4TA 3OIYA 1TA9A 4L5YA 3D8NA 3WXBA 1P19A 4CRWB 1PIWA 3H86A 2OFFA 5LZ4A 2BMWA 1N2CE 1UFKA 4TVKA 3D5EA 4IIVA 3TTWA 2GZRA 5SZHB 2IXBA 1Y3HA 3P2MA 3T06B 3INYA 3GLGE 3K1JA 1SHTX 1U3FA 4DM7A 4Q7LA 1VHJA 2GEDA 4L50A 5INTA 4QU0A 3R5XA 4MRPA 1Q57A 3OQ6A 2VFAA 2C9MA 4PZZA 1EK1A 2DHRA 1YNSA 2HXSA 3O38A 2J3EA 4P93A 1T6YA 1IULA 4DR6B 4ZEVA 1GUAA 1H4QA 3NKVA 4K86A 2W70A 3HI6A 4EI8A 3DCYA 3C6BA 2ONYA 1GADO 3CISA 3MS2A 4A6EA 1XZJA 3CUUA 1N2HA 1CB7A 1PGPA 2ID8A 3U4CA 4CMHA 3RJZA 4HGRA 4GLFA 4HH3C 4HZGA 3AESA 4RZSA 4Y2UA 3W3AA 3IEMA 3UKJA 2FZLA 1P6XA 3AW9A 1QZUA 4DBVO 3AG5A 3D7SA 1EX9A 4K8OA 5KTOA 4C6TA 2EJVA 1G5TA 4WN9A 3VKGA 3C8HA 5CYGA 1HT0A 3G5TA 4QQ8A 2OSBA 1E66A 2OCLA 4ACAA 1IL0A 1G6OA 3CLTC 3W79A 4ZOLA 2EWWA 2QVZX 1TQHA 1J49A 1JZTA 3SIXA 3CCCA 1LPOA 2WQZA 1B16A 2IEZA 4GF5A 4Y0AA 3P0IA 5CA1A 1ZRMA 4P7FA 2RK6A 3LU1A 3WFZA 3ZW9A 1P33A 1YDGA 4IKPA 2VHXA 3PF9A 1M76A 1NFQA 2Z09A 3P9RA 5JXIA 4WCFC 3FCCA 4XVQA 5LDHA 4XQGA 4DR7B 1DTSA 4YJ3B 4DLSA 1XDBA 3OAAD 2IV3A 4LVOA 5KWVA 3V97A 1LFDB 2J5XA 4MIKA 3O95A 3T94A 5KYXB 1E1NA 1IBLB 5BUZA 1ZMXA 3VZQA 2FE1A 1AK9A 1W4LA 3OIVA 1WXIA 2AMJA 4K88A 5HBRA 2LW7A 7GPBA 2ZUCA 1X7XA 1XJQA 5GINE 3OJOA 5BRAA 4J07A 2JLAA 1YRLA 1C3OB 4RSHA 3NM4A 2FPMA 3ETEA 5L3VA 3GJXC 4O1IA 3UC5A 1QOZA 1N9ZA 5ALEA 3MC1A 2DYKA 1X3LA 1SIBE 1EK2A 2O2DA 4X7PA 1QFZA 3KB8A 2XYPA 2QG4A 2YJNA 3A6ZA 4UBNA 2BI7A 3VPHA 3GJSA 1JTEA 1YB4A 5KAPA 4EGFA 1DHTA 4C4RA 1GYRA 1YVRA 4REOA 3KJNA 1E9CA 1XG5A 1D4AA 3ILYA 3T9DA 2PTHA 4JLAA 2FMHA 4PVCA 2Y2VA 1R6AA 1Y1KE 2F9FA 4LW8A 1FPMA 3GRVA 4LYAA 4OTZA 2QIOA 1JQ5A 1LDBA 1Z06A 4UE6A 5ULLA 3S2UA 3KZCA 3TJMA 5KWEA 1CNMA 2F3PA 3HEAA 3I1FA 1PKXA 3GL9A 3BD7A 1GO2A 2A33A 2CBGA 1NTRA 4ER5A 3L05A 3HTXA 1R8JA 1XLVA 5FLEX 1JKFA 2CL5A 3HXOA 1OX6A 3BRSA 1VRCA 4JSTA 3BMOA 2PWZA 2NO6A 1COWA 3CYFA 2AW3A 2HHHB 2PHZA 2VJNA 5FYDA 4RTJA 2ZE7A 1XA3A 1YR3A 5CAEA 3BIXA 2H06A 3IDSA 4P22A 1SVNA 1KOGA 4GG1A 5FB3A 3GVPA 1QE0A 3ZDQA 2VJCA 2NP7A 1IM8A 3M9XA 1Q3KA 1HETA 3O8NA 3ROFA 1ETHA 3JQBA 4JJIA 3D3QA 4UC0A 4WKOA 4Z5XA 2FSHA 1SRRA 3H0KA 3ODPA 4GE0A 3C74A 4PHGA 5A9SB 1MJNA 2I9PA 2WF6A 1YDFA 1H42A 2PQMA 3VBEA 5BN3B 2XRYA 3LYAA 5JJBA 3RYHA 1I9GA 3CX6A 2WM9B 2Y9MB 5I9IA 4E21A 1F2TA 3UHJA 1E1CB 4LX8A 3BL8A 3ETCA 4YXWD 4FNAA 2IW3A 1T4DA 1AUQA 1UBHS 1VSQA 2EWMA 4ZV9A 2P5SA 4TLCA 3S7TA 4DMRA 5EJIA 1AKQA 4MUHA 1SXJC 4MQ6A 1JLSA 1HE1C 3KKNA 3HCDA 4JLOA 1LRJA 3GLTA 3M6FA 2EFJA 3G59A 1A9SA 4G97A 4EX6A 4JJ8A 2R6JA 5FPYA 3RFFA 5B64A 4I3HA 2XLCA 4NYIQ 1H6DA 2NUBA 2VDNB 4NAVA 4OXYA 2G70A 1FF9A 1RWKA 1AS2A 2RGYA 3INNA 4W1SA 1CC1S 5C5EA 3TOCA 1T3GA 1IAQA 2JGDA 5CT9A 2J9XB 2A9QA 3UWMA 3REQA 4D9FA 5K0EA 1I1QB 4IOLA 1NY5A 3EIXA 3QX8A 3CT4A 5E6RA 2IPLA 1Y1QA 3M6LA 2IXTA 5FPQA 3KPWA 3RAGA 3PFKA 3ZGNA 5FUQA 2P4EA 3ETHA 1MKYA 1KYZA 5AKLA 3R5TA 3OCCA 5JR3A 2YNMD 3UXYA 1I1NA 1NRWA 2G1PA 2XB2A 2VWQA 2Y68A 2Q3MA 3AESB 3DDNA 3PEEA 4F4IA 3E23A 4QO8A 3QEAZ 2YL2A 4F4FA 4TTSA 3U1TA 1IXYA 2ZSBA 3P4YA 1NT4A 4JBWA 4QIHA 4WN9B 4C6TB 1FMJA 4DV2B 2DETA 2W2OA 2O0JA 2QRLA 5GV8A 3ZDBA 2ACVA 4ZZIA 4IXWA 4HDOB 4M55A 3Q15C 1ZAYA 3A7DA 2POQX 4GLBA 5HS4A 2I33A 4XEHA 3O1JC 3F6BX 2NXWA 2Q5HA 1BGVA 2WV9A 3FD8A 3HABA 2RHLA 1LJLA 2C1XA 3OI7A 4G1UC 2VO1A 1NR7A 1MP0A 4I9UA 2VYQA 3U26A 4ZU1X 3SDBA 1NE2A 4P98A 2R751 3CZMA 1G3IA 3VFDA 1HX7A 4WI1A 2QX9A 4XSHA 2XBMA 1FFHA 4PGFA 5CPBA 5CFLA 2AR7A 4AJIA 2YFQA 1DKLA 2GN1A 3RVKA 1G98A 3M4JA 2VJPA 1H0RA 2CXXA 4PCLA 2XYGA 1L4HA 3HDVA 5FWYB 1N1DA 1Q22A 1AXEA 1YRHA 4BP9A 3SYKA 3I42A 1GXSA 5HE9A 4YCNA 2IE0A 1IC6A 1W1WA 2GTIA 4XQCA 2PJRA 3C5CA 4PF1A 3LLUA 4AJ1A 3EUFA 1YD7A 1UWVA 3ZZ1A 4FCTA 3MRTA 2ADOA 1Z33A 3LBYA 3FPEA 1SUDA 2ZR7A 2P1RA 4HD8A 1L7PA 4AXXA 6ADHA 1UPTA 4NU0A 4OA8A 1E2QA 1NSTA 3LPCA 5EFOA 2C5LA 2D3WA 2R7LA 4ZA2A 3DLBA 4EW3A 4EUKA 1L4GA 2Q6TA 4YAGA 2C8VA 2EGGA 3RS4A 1E1QA 2H4YA 5CCDA 3MUOA 3VZDA 3IUMA 3BXEA 1U8FO 4HQRA 4YRNA 1BQ3A 3FPBA 5B7PA 4PZEA 4Q3LA 4U7FA 3UV6A 1NLUA 2VI5A 4P7JA 3W4JA 3LDHA 4DIDA 1QHHA 5I47A 5JQGA 2QROA 5IKXA 1JFLA 1VOTA 1M34A 2VAMA 3HR4A 2GBPA 1IUKA 5TXGA 2A59A 3A0UA 3STUA 3VAYA 3VXKA 1R4AA 1TI7A 1G63A 1UBLS 3ZC3A 3D7LA 2GPBA 2ZRHA 3T7TA 2GRJA 3DBLA 4CTOA 5B2EA 1SXIA 1RXEA 3GN2A 4J4TA 4YCLA 2Y1OA 1OOEA 2ECQA 1OPXA 1QQ5A 2RJ3A 4D1YA 1S3GA 3A2KA 5AQEA 4BLTA 1Y48E 3EN0A 4F5ZA 1XGKA 2ZZMA 2R8YA 1WKVA 2Q3DA 3N2EA 4D98A 2B8TA 2NNWB 3MAGA 1OLUB 1H4SA 3OZDA 1HEYA 4LOAA 2O8DB 3HN2A 4PEVA 3BFKA 4KO1S 5JS6A 4C4YA 2O8EB 2XECA 3GDOA 1P3DA 4MRAA 1LI4A 1NVBA 1TAGA 4HNQA 5CCEA 4LRSB 1TJ3A 3TAHA 2IF2A 1EK6A 2JHCA 5L4SA 3R9XB 3V4SA 2J3DA 5CAEB 2NYRA 3EDCA 1CUDA 3ABZA 3GLVA 4PC3A 1QM5A 1Q44A 4S2UA 4W5JA 5FFMA 3ZX4A 4AMZA 3EPJA 1OAOA 2H7CA 4MWOA 3STWA 1OI7A 1ZQ9A 3O3NB 4RJ2A 3IDOA 2ZDHA 4K8RB 1BFKA 2HFJA 4UOEA 3BXOA 1L6RA 1V26A 3AEUA 2C5SA 3D6UA 1EVQA 4BVKA 2KPOA 2XNDD 4XB1A 1D4OA 2XUDA 2VTBA 2Z5FA 3AV0B 4JJEA 1S6YA 3RFUA 4GRAA 5ALJA 4EGQA 2O7SA 3BJMA 3VAAA 1QRSA 1TJ5A 1TTTA 2GUGA 2H9AA 1MO5A 2XYHA 3K0KA 3KT6A 1Z5VA 3BE6A 3ZDFA 3D4IA 2ZKLA 3P9CA 1P3JA 2P9HA 2PM8A 2I3AA 1U2DC 2IHBA 3GBPA 4I1YA 4JEUA 4R1UA 5TDHA 3G13A 3PD7A 5AW8A 3NM6B 3KTAA 4MINA 3M5CA 3T6KA 1DX6A 2NU9A 4UZSA 1HSZA 1QDUA 4YP0A 4BLUA 3OQVA 1S8FA 5F76A 1RJDA 3HUUA 3MJ4A 5F21A 3ILXA 3UB4A 2JGMA 3ZLUA 4P92A 5C34B 3REQB 3HPQA 4HFRA 4OXXA 2G1UA 4PLHA 1WW8A 5BSGA 5FOVA 3VV3A 5HS6A 1T29A 2QN8A 4M7WA 1KJYA 3X2EA 1NVWQ 3GFFA 3KG2A 1E9AA 5EGNA 4HSEA 1WY5A 4CMJA 1TW3A 2WEKA 1T9AA 2GK4A 1A9YA 4RIGA 4BKMA 1DAHA 2IYTA 3DXYA 1VHLA 3BIJA 2D0DA 5LYYA 3RIHA 5KOHA 3IO3A 3JAWA 2EEPA 1G21A 3PA6A 4UU8A 4RD6A 3ZD8A 3A37A 5B1DA 1PJ4A 1FMFA 4QAJA 3WISA 3NIBA 4FDUA 3WIEA 1M6VA 1X1TA 1LBQA 3ZHOA 5CFZA 3OE7A 1S3IA 1R0BA 3P4UA 3TW8B 2BGLA 3SLGA 4N49A 1K8YB 1R5BA 1VLMA 2QI9C 4RF3A 2NZWA 3IE1A 1S2OA 2ORED 2RH4A 4PCAA 4HUJA 3AHJA 3ODGA 5EINA 1BTOA 5BV1A 5IHXA 4RCVA 2H1WA 1QIGA 2HJ9A 2HCRA 2XYRA 2XZDA 3FDFA 1E9VA 4M8LA 3TZHA 3V4PB 5HUQA 4PO1A 5CD9A 2O5CA 4MI9A 4WOJA 4H1VA 2QU7A 1VBFA 1XTSA 5C31A 2FW6A 4LOHA 1XQYA 4ERNA 5MN4A 3FKSD 4FMCB 4AMYA 1QDEA 1EWVA 2QJRA 2BCJQ 1C9DB 2DQZA 3OQHA 1Z4QA 3HYRA 5E4YA 1B74A 5TMBA 2OOSA 2FLWA 2ILVA 3HDGA 121PA 1CUHA 3L7CA 3NI2A 5EKUA 3WNBA 1T1RA 5IN5A 5HQ3B 4M21A 2ZI6A 3AWDA 1QFYA 2HU2A 2W90A 2YIJA 3B6IA 3E7FA 4TKUB 3ES9A 4U8HA 1P5JA 5DULA 1CF4A 2XQKA 2W8ZA 4L4YA 2ENWA 4HN9A 4ZT7A 4FUQA 2MSWA 1ECBA 3EVTA 1K9SA 3L0DA 3D2LA 4JOSA 3THRA 4EI7A 3R9WA 2FRDA 2GAFA 1GFIA 1H2WA 4HB0A 2NO1A 3EDMA 1EVLA 2BBOA 2H1LA 2IGBA 3H1BA 2DC1A 4P4TA 5AH0A 4Q9JA 1A2QA 5L6LB 4EMUA 4DG8A 2JL1A 4JNCA 3RSFA 1M34B 3I39X 5B3LA 4QUIA 4HTAA 4G1BA 2HZ7A 3LZCA 3RUEA 4OMFG 2A9RA 5FL3A 2PMKA 4D5GA 4R7GA 1DO8A 2BD0A 1EP1B 1U2ZA 2NZ2A 3VKFA 4LDQA 4P3KA 5I01A 1FW8A 3E27A 4AJ2A 4WSOA 5F2OA 3TL2A 4R69A 4JR0A 1U2QA 5CG1A 3AF3A 5GGYA 4RH0A 3I1JA 5C1BA 2WWXA 1OLSA 3DBVO 2CDBA 4NABA 3LF2A 5AXAA 4BFXA 2IX3A 3ZY4A 4KWIA 4XQEA 4E5VA 2WIDA 1NRXA 2HMVA 4K81B 4E46A 2VDVE 1JHUA 1WDWB 1DC8A 3AILA 4XWYA 1ELOA 3PKIA 4CMEC 4MARA 1Y5IA 1R0WA 2AHRA 4INZA 2HDNB 3DAYA 2I3ZA 1E89A 5KTTA 3RUAA 3TJZA 3TZQA 4F21A 1C8VB 3HNOA 3BE4A 4RA9A 5T3YA 5CRIA 1ISHA 1RRVA 2JLVA 4P7KA 3PJRA 1CEXA 2VNHA 1RZVA 4MV1A 1X1DA 2QTGA 3AW8A 3JQDA 3HYSA 5BQ5A 2WD9A 4IJWA 2YBDA 2JAPA 3BK7A 1X7WA 2FW7A 2C4KA 3D2BA 2VDKB 2YWBA 2HRZA 1JFFA 3K2QA 4KIFA 2J30A 4LXXA 3H6HA 3VZSA 4JLBA 1KMCA 2W6MA 4BMZA 3LX6A 3AEUB 3ORSA 4EO4A 3WIUA 1DHRA 3PUKA 4FBGA 2OV4A 2WFMA 3NYQA 1SOVA 4GBJA 2V8OA 4K9RA 4OHFA 2HJSA 3TEMA 2VTBB 3AHCA 4DJ5X 1SBNE 2XE7A 1P4GA 2O8DA 3ONWA 1IDN1 4QHYA 1P72A 4KYIB 3DAGA 2R9VA 5LWQA 2PSFA 4I9HA 4JKOA 4CQJA 1OX4A 4CN8A 2YN4A 2W2TA 3AEKB 4U4AA 2EKZA 1ID8A 1B43A 1HE8B 5AKJA 1PR3A 3DLAA 2PK3A 2BFCA 3FUXA 5REQB 1ORWA 2W11A 1ZA1A 3H2SA 2PUCA 3PUWA 3KTAB 4IUYA 3GA5A 1NP6A 2IOFA 2QTLA 2UVPA 1IOZA 1QYCA 3FR7A 5FPSA 5BXQC 1E2LA 1Y1LA 5E7QA 1RDFA 4G5HA 1QG0A 3R7NA 3UY4A 4URXR 4GPBA 3D4LA 4QC2A 1QC5A 3SQDA 3A04A 3UGTA 4RQBA 4QOHA 1JP7A 2VT7A 1M83A 3KHUA 1YACA 4DBZA 4YRGA 5LQDA 5DLEA 4WLFA 1XALA 1OMOA 2B83A 4B6EA 2WTUA 4BGDA 4AXBA 3O03A 4S1NA 4B9EA 3GJYA 3G2IA 3VU9B 1DWUA 4BNVA 4RK4A 4AO7A 1Y1PA 5CCXA 3R75A 1RZRA 3CNNA 4XDHA 3ZWAA 3PX7A 3H5NA 5KOHB 1UADA 1VA4A 1G21B 2JFZA 3BS4A 1FDWA 4EJSC 4LGMA 5KSZA 4WXMA 1LBHA 2CGEA 1XUOA 2R1ZA 2OP1A 3UK0A 3HM9A 1M6VB 1OFGA 3QXCA 4XPIB 1NQOA 1ODLA 3OZXA 4GKVA 4LZLA 2XVMA 3CG4A 1RRMA 1JH8A 1G6Q1 2YHAA 1SC6A 2QQ5A 1DAMA 2E4ZA 4E07A 1MU0A 3ZHZA 3AVUA 5BV8A 3KDPA 4QNRA 2E48A 3U61B 2XGJA 4U6SA 1LDGA 4LJRA 2NAFA 3AEYA 3DBRB 3AKZA 1QONA 1ZRSA 2NO0A 4EPRA 5ARDA 3QPDA 3WK9A 2O1SA 1EIZA 3KXLA 2X58A 4MV7A 4B8YA 1E20A 3U1VA 3GP8A 2HL6A 1BE0A 4FLEA 3PUYA 4BO4A 2EDCA 1QWOA 3W5VA 3T4UA 1GQSA 3H87A 3OU7A 1AKWA 3RK1A 4D44A 2J0VA 3K2BA 1Y37A 2H2IA 2JIPA 4GYJA 3DPIA 1AC5A 4WKBA 2Z9BA 5FLYA 2GPSA 4QJ4A 3VKWA 1IBKB 3O2QB 3BWYA 1M34E 1WMFA 4XIIA 1VJTA 1A5SB 2L82A 4M83A 1RKUA 3UMVA 1GOTA 4AO8A 2W2XA 4ZFNA 2X86A 1V8FA 2EP7A 3MGGA 3P1JA 5HYVA 5EJAA 3QI2A 1PGNA 1K75A 1NONA 2EJTA 5DI9A 3WLQA 4I4TB 3OM8A 2VPTA 1N2ZA 3RBXA 5LYJB 4P83A 3CX4A 4UHBA 1D6SA 4YH1A 3LXRA 2JFGA 3I5XA 2ZTUA 2A67A 1Z47A 3LKDA 1F7UA 1LLQA 3MPUA 4NOMA 1SAYA 3KQHA 2ARKA 3TIVA 5J63A 2NQTA 2VZ9A 1Y5RA 2CW5A 1S8OA 2R1VB 3ND8A 3QF7A 4YV0A 4MKGA 3GZNA 2QTNA 3E3MA 1RHRA 2PLRA 4IYJA 3S8MA 3STVA 2FQ1A 2HKIA 3DMGA 2FRVA 3OEHA 1DT3A 4CL0A 3PE4A 3EQ6A 3PC4A 3HDYA 3O21A 4RKFA 1JI0A 1QWSA 2XCLA 4KQMA 5CH8A 5DYYA 2GVDC 3LV8A 4CM5A 3JQFC 2IIBA 3KVNA 1V37A 5E3HA 1OLSB 1WDMA 3CKLA 5DLQC 4Q9NA 2OXRA 1RPAA 3JYHA 3G23A 1I3LA 2QVCA 2QS9A 3IERA 3AUKA 3OEYA 4NZYA 1SA0B 3O6VA 2JJQA 4C2UA 1NR1A 2JLCA 2QN1A 3MTEA 2OV8A 4P5DA 3J7TA 4PGGA 1J9ZA 4H1UA 1JLKA 3UQYS 4YT2A 3K0CC 2IBMA 5E1MA 2ZROA 3Q10A 1XTJA 1XYYA 5AI8A 5JXGA 3NO4A 1QMPA 4OM8A 4KMMA 4PFKA 3WLKX 4X7RA 1LQTA 4G8BA 2DPXA 2J4DA 3VR4A 3EE6A 3AV3A 3ZDEA 1M0TA 1LW7A 1YVUA 3CEHA 1C1YA 1FYVA 1JFFB 1HFJA 1PEYA 1PZHA 2VRCD 2W6OA 3BHMA 4MI6A 4IXMA 4P53A 4A8JC 1PJLA 4YGYA 2V45A 2Z9DA 3EZGA 4C2BA 3HGTA 3UV3A 2A5DA 2R4QA 1WCV1 4DMFA 2VJMA 4ANFA 2H5JA 4EJMA 1G3UA 2REQA 2Z3VA 1M2VA 3F6YA 4HFNA 4WY5A 4BU0A 1L4MA 4LK3A 3DLPX 3FWZA 3WX0A 4QYMA 4RZXA 3VZPA 3G17A 4FOLA 2CLIB 3RVRA 4V1CA 1O5IA 4BCBA 2JZOA 3EQ8A 2D5LA 3DEIA 1DAFA 5I9NA 3E5MA 2PH7A 2RGEA 2QTFA 2ZP1A 3EGDA 1E5LA 1T0HB 4EPTA 7REQB 1RHMA 3PC6A 3TG2A 3D6HA 2UVPB 4FYPA 3S44A 1R6TA 2HIMA 5DT2A 1QP7A 1G21E 1Z2EA 2FSVC 1LZKA 4TLMB 4PHFA 2QEQA 5ARBA 3GFPA 1QVAA 4QOGA 2XZOA 2N42A 3QWAA 4HNAB 2WNIA 1DG9A 4LOIA 1PFUA 3NAZA 1TL7C 4ABTA 2QD5A 4CM8A 1WZCA 3BAFA 4Z7NB 5T4EA 2XIQA 3OUTA 3K1ZA 3KT3A 4UJ5A 3TR6A 2HLDD 2KLBA 2VHZA 4ZARA 3V1YA 1P4SA 3DZHA 4YJ2F 2WU4A 2A7QA 1TYDE 4KO3S 5AWFC 3ZLJA 2VYVA 4FIZA 3TFOA 2YY7A 1VG8A 4O5OA 2ODTX 4TT8A 2WIKA 1MX9A 3KE9A 5DEOA 4EWLA 4OHXA 2FUEA 3Q87B 4LRTB 4LECA 3EWAA 3ZDXB 4B3MB 1T2NA 4LHXA 2QI9F 4JYZA 3LQ1A 4FFOA 4LYYA 2AFHA 4ALKA 4UUAA 3E05A 4C07A 1H1LB 2GN9A 2WVAA 4Q02A 1ZMOA 3ADCA 4YMWA 4TV8F 4DNFA 4I9NA 2PKRA 1CQJA 4GZLA 4C7VA 1AKVA 2WC1A 3IAUA 3RTCA 4YRBA 4TYNA 2CK3D 2VP9A 4N54A 1GKIA 1V41E 2FRXA 1IN7A 3TB4A 4OLAA 4D56A 5GM1A 5C7OO 1KNQA 1DKOA 5CDTA 4L4ZA 2PX5A 1RIFA 2EBUA 4GPZA 1RXSA 4YDRA 5K3DA 3STHA 3ROPA 1QBKC 4NZNA 1O87A 4DB4A 4K6MA 3FPCA 1I4LD 2OQ2A 5HIAA 5KUTA 2CLOB 1E2BA 3BTUA 5AVQA 2YYAA 1JX6A 2A5FA 3PFNA 4HRXA 4L4RA 3A06A 3HU2A 5BSFA 4CQNA 1SG6A 3C87A 2G7ZA 2JKVA 5JSHA 3RF6A 5DNYB 2FMUA 3AK4A 3ZD9A 3CVWA 3OQOA 2EAUA 3QEMA 3EXIB 4GC5A 2RMKA 4KIJA 4OUDA 4YROA 2C57A 5KBYA 3CNHA 2XEXA 3IKVA 3KIPA 5I6DA 1BD4A 4KXUA 2H1IA 2IEGA 1TFUA 2O7NA 1QYWA 5TQ0A 3EXHA 3PC8C 4J03A 4D2IA 1YQTA 8AT1A 2E6KA 1PV1A 1FXUA 2JANA 2WHYA 4G9EA 1K0FA 1NHWA 1I51A 3KNZA 3RKSA 4Y9UA 4UPEA 1UFVA 4US1R 2GPJA 4LQ4A 4W9NC 5FT9A 2AE1A 2EOAA 3BERA 1BD3A 1WXDA 2AI1A 4YP7A 5LBUA 3ITEA 3QBEA 4YMGA 5A62A 2X23A 3RUCA 4L51A 2ZB8A 3QH4A 4CTNA 2EW8A 2ZBGA 3AF2A 5IVIA 3G9UA 3AUTA 4Q93A 3T7AA 2DUJA 3T7IA 1B7GO 5ICGA 5LQUA 2P9FA 1SURA 2EVWX 4UTOA 3VZBA 1NHGA 2Z1DA 3QJGA 2AFIA 4RV9A 3MVEA 4U7DA 5F12A 5JQWA 4HWPA 3R8FA 3B12A 4OHKA 2AG1A 4HT3B 5IEBA 1NVFA 1U1IA 2QUKA 1E4YA 3ROEA 4EF6A 2J0SA 1THGA 1Y3FE 1K7SN 1MX1A 1N6RA 4KQIA 3RS0A 3WKBA 4CR8A 1PTJC 1JQAA 4RDXA 3GAFA 1EXWA 1K68A 5J4YA 1KQFA 4LF4B 2JFBA 2QL9A 4A2WA 1EESA 5HXAA 4S1WA 2A1UA 3NBFA 3PI6A 1XVUA 1NAIA 3OMWA 1W88A 4ND8A 3WMEA 4ARIA 5BW5A 4YIHA 3GEDA 3VVBA 3CE6A 1U0SY 2TMDA 4J4BA 4RHYA 1EGHA 3U4DA 4Z3KA 4P34A 4G26A 2RCYA 3TRJA 3TZBA 4ERXA 3D6NB 4JUFA 2YOFA 4GBGA 5I51A 3M4YA 1GGKA 3U16A 4GYKA 2RAUA 3F6PA 4QT0A 1I8TA 1MHPA 3QLUA 4KIUA 3RNLA 4CDNA 1KY2A 4F4JA 3KTDA 3SWWA 4AKHA 4CJXA 2DY0A 2OCXA 3HU3A 1P45A 5DXAA 1W4BA 3T1NA 2C3YA 1R9GA 1CJTC 1ZR4A 2OP0A 2RARA 4RE6A 4JYAB 2H1RA 2VJMB 3ZD7A 4URUR 3JTMA 3TDNA 1T5DX 5SYNA 3VYWA 2ZYVX 1W8IA 2QGNA 2IOHA 2ZT6A 3GUVA 1UBUS 5KJEA 4Y3UA 3SBOA 4R2WA 1KH2A 2YXNA 1P2VA 4ONEA 5FUWA 3TTSA 4B43A 2VCHA 1VKJA 3F6SA 1VJ5A 5IM4F 2J1LA 4V1CB 3GW8A 4MQFA 4KQXA 1HNZB 1DELA 1I7NA 1PYGA 4GRDA 2GR9A 1N4AA 1E98A 4MKIA 3C1AA 1GRNA 5BSEA 2PUBA 4ZWNA 1KZ9A 2I1QA 4IDOA 2G0NA 4E5UA 4RVCA 2MYNA 3QOXA 1UWCA 2C07A 5JDIC 4YASA 1HYQA 1OBFO 4RD2A 3M3DA 2VRWA 5SYAA 3LDUA 3AFOA 7YASA 2I6SA 1BX1A 3P45A 4CHTA 4CM8B 1ZVKA 4FKZA 5ALTA 1Y6JA 5AHOA 2H8GA 2XLBA 3QP9A 3ZE0B 3F49S 4RH1A 5AR1A 4EPWA 4I55A 2X1MA 1H2EA 2RGCA 3N8DA 1X77A 4FILA 1Z2AA 1NLZA 2ZITA 3QU2A 3B9RA 1BH6A 3HLTA 3KDAA 4QODA 3RRJA 4BB5A 2ADFA 2OWDA 3O0TA 4JLSA 5ALGA 1V6SA 3A9WA 1J2UA 5K6AA 3I0ZA 4XM1A 1YJXA 2F8MA 2A4MA 2ZYWX 1JLHA 2GBCA 3KK0A 4AP9A 2IYYA 4DLTA 4US2R 1VGRA 3DD1A 4HDMB 4Y0NA 2GAJA 2PWAA 4ENVA 1TIPA 2HGZA 1U0HC 3D4OA 2OD9A 3Q6NA 521PA 2I34A 5JO0A 3WK4A 3BB3A 4TZTA 1RWPA 1J0DA 2J5KA 2QU8A 3LOPA 4HAIA 4S1PA 5B37A 3A1FA 3RVMA 2V03A 1YTUA 1WLSA 4BMYA 2EJCA 1NG1A 4XYMA 4MRNA 3O8QB 2O3QA 2YZKA 3HBAA 4FOSA 3H5VA 4GX5A 4TWAA 4LISA 5E2AA 2XCOA 1SXPA 3NEJA 1KOJA 1PK8A 3V8NA 4C3ZA 2I0FA 2R8EA 2Q7DA 3T7DA 1CVLA 2QLBA 1QUFA 3OAAA 3IEUA 4IFBA 4Q19A 4L22A 3RD5A 5BNTA 3FPJA 2VQDA 1M2JA 1MEJA 1YR6A 4IVNA 4OH7A 3PZBA 2FR1A 5JAUA 3UAVA 1V7QA 1GTG1 4PZCA 4DCMA 4EG8A 4EMTA 3HDHA 5EP3A 2FWPA 2C83A 5D00A 5C8YA 2X1LA 3R7BA 1QRUA 4L8FA 2E85A 5CM9C 2IEDA 3N2IA 1FUUA 2IL1A 3TQSA 1O97D 3MQ2A 1MO3A 1EWYA 1ST3A 2X9GA 3GZ4A 4UEJA 3ZYZA 3I52A 2VT6A 4G84A 3DHVA 4L02A 1VSVA 5GZ1A 4XI9A 3DOHA 4NAHA 2NTVA 4OUDB 1OB2A 3BN3A 3ZJTA 2PANA 5TT1A 4EAAA 3MGCA 5EKXA 1N5IA 4XWTA 5IASA 2VDOB 5A4FS 2OG1A 3ELBA 1G0OA 3EXHB 1C4OA 1E3WB 3ICCA 2PRIA 4GHWA 4PHCA 5DZSA 3DHEA 1XVVA 1QV7A 3K5HA 3GLQA 2GARA 1SQGA 3QWBA 4TTTS 3OZRA 4DSNA 2O5EA 2HF2A 4CBVA 4ZRMA 3MJSA 4E12A 1F14A 2ZTHA 2V0CA 3OUZA 4K6GA 5D1NA 5JZ9A 1ZI8A 2BIFA 1UPBA 4DQKA 2GDZA 2JVIA 2EIHA 1KYYA 3E82A 2BJVA 2VUSA 3PRHA 5TQJA 4PXYA 3TBFA 3NMUF 1CY0A 3FYHA 3HZRA 1ISRA 4TM7A 4DSTA 5A7HA 3ORFA 4P32A 1SHLA 2A14A 2ZAYA 3A7EA 3BMXA 5GJVC 4EABA 1U3VA 3AF6A 1Q92A 3GJ4A 2WF8A 4C0BA 1UC8A 3T15A 5AJVB 2X5NA 2GERA 3UWKA 3WYEA 1C80A 1Y8ZA 3B36A 1HSOA 1KJ9A 4PICA 4HN4B 3C6ZA 3KZNA 1KEEB 1KQGA 1UKEA 1ZW1A 2A1UB 1ZCZA 1RTKA 4ND8B 1W88B 1YJ5A 2ZXFA 3F71A 1FTNA 3VDXA 1L5VA 1AHHA 4JC4A 5DGCA 4JU8A 3RVPA 5J3JA 3WLTA 4B85A 3PF8A 1QOPB 1GZDA 5A7GA 4I4NA 3A9SA 5DF1A 3DMYA 4BNWA 2WHPA 4G5FA 1P1RA 3S68A 2Q8NA 5FBVB 3I92A 2ZJ0A 3BJEA 4DIEA 1IOWA 3PE3A 4L4SA 4MZXA 4QJBA 1T5LA 4JA2A 2FX5A 3LX8A 3WTCA 2RK3A 5LOVF 1HNWB 5LZ9A 4NEHB 4NZPA 4B46A 3MWDB 2IXFA 5A0TA 2ZSFA 4YXWA 1Y80A 1PEDA 4B6RA 4CWAA 1FU7A 1JDTA 3JSAA 1KYIA 1KJZA 1FFGA 2BEJA 3NHYA 3U9SA 2CDNA 5E3IA 4GXNA 4C03A 1CTQA 5IPFA 4MQFB 3IKJA 2V59A 1A5AB 5K03A 3AOEC 3HNPA 3I9NA 1I7QB 2BY4A 3UJ3X 2MJLA 3ESBA 3BQNB 1CK4A 1OXKB 3BTOA 1GP2A 5DRYA 2VDJA 2NSJA 4V0MA 4EEXA 4P4NA 3HJGA 4N01A 3C8DA 1MQAA 1TXGA 4F5DA 2PRKA 3WVNA 5B53A 4ZYWA 1SGWA 3U7IA 3AXSA 4YCMA 3B5EA 5BWBA 1ZYUA 1WXFA 2YN0A 1HOTA 4O2RA 4CKXA 3W06A 1HDYA 5B5SA 3DPSA 1E7QA 2EKQA 4RTNA 1E2MA 1KEZA 2YY6A 3AUYA 4GBED 2YNMA 4OA5A 4A2QA 1RM4A 3OZCA 4LSGA 2A9PA 3IUJA 1I0LA 4DN6A 1J25A 2BE9A 1GN8A 4KH0A 1ADJA 1TYAE 1V39A 3TXXA 1ID1A 2SCUA 1CDZA 1LC0A 3KU4A 1QO9A 3R41A 4N5DA 2QVBA 3R7WB 3IKLA 4RY9A 2XUFA 3OPYI 5JLAA 3S1LA 4G0UA 1E2JA 3FFAA 1NYRA 2XRFA 3O4JA 4JYPA 4CE6A 5CFQA 2Q4RA 1RJ9A 4BFLA 2V7GA 1I7SB 3CVYA 3F9RA 2H4ZA 1R0KA 4D02A 3I72A 4LHEA 1E79D 2B1IA 5F51A 1J9GA 3R0VA 1KMQA 3C7KA 3SXPA 5GIPE 1J0XO 4FFVA 2JHFA 2XZLA 1RJGA 3BH0A 3VUEA 3D02A 3RH0A 4YRSA 1PJRA 3EGXA 1V3VA 2JJMA 2NW6A 1YDWA 1EHIA 2Q4TA 1R4NA 3SC4A 4G1MB 2F64A 3W34A 3SKYA 2GAIA 3WYDA 3M9LA 2DFNA 3QU9A 3FOFC 2HCTA 3TG8A 2DPMA 5EWJB 1C8KA 1F2UA 4KRFA 1BW9A 1N5RA 3L43A 1TUGA 3GJRA 1R37A 2EX4A 3TXYA 5GVSA 5C8YB 2ZR0A 2ZSAA 3BF8A 4X93A 4CLOA 2Y2UA 5IKPA 4IIDA 1FQJA 1S9DA 1XKQA 4MPDA 3WLIA 4QLBA 1V9SA 3L6EA 3GT4A 1XWFA 1PZFA 3P2EA 1PHRA 4FDLA 4W8HA 4HMPA 1PR1A 4M1MA 4AUEA 3ZV3A 1N36B 2QQEA 2AZDA 2ZUWA 1BVUA 3TCKA 3PHJA 5F23A 5L8VA 4KQ1A 4LA4A 3NHBA 5ALKA 3ETLA 1KRHA 3K8OE 1IY8A 4LF6B 4MXDA 3B52X 3NTUA 4DSOA 3EPRA 3LLSA 1WQ4A 4R1OA 1KAGA 4D6XA 5U4XA 3E5HA 4NARA 3EULA 2WIGA 1AMNA 2JARA 1BHO1 1KXJA 1R5OA 2NV6A 2GMWA 1B1AA 3N8IA 2AQIA 1IQRA 5A06A 2F1JA 2RHJA 4Q1FA 2O0KA 3PWSA 4D9KA 2R48A 1SWVA 4O4JA 1ZD1A 4YCAA 4WXRA 2ZRAA 3U2QA 2RAFA 1JEQA 4KX5A 3TOVA 4DTCA 4ETNA 1TYBE 2XDQA 1ZKDA 3KWJA 2MSLA 2OCYC 3F8TA 3AIOA 3R1IA 5DYWA 4PBTA 1JIXA 3BMCA 1OGIA 4YUAA 3ASUA 2B6NA 1NXWA 3MIZA 2IH2A 2HLHA 4F6LA 4CLXA 2MWMA 1HT2E 2WU1A 3EUAA 3CLHA 2O19A 4FDTA 3L6BA 3R3XA 3R09A 3UWPA 3FGPA 3JCZA 4M60A 3ITDA 3VR6A 1OBCA 2ZRIA 3HCWA 4L9SA 3R20A 2WHPB 3OJWA 1IXSB 3L1IA 4NBTA 4C88A 3DO6A 3NKFA 3LWBA 1ZO8A 3PBKA 4LQDA 1NQAO 3FPHA 4KRGA 1BHQ1 4WK6A 5K0LA 2B8JA 1P73A 4C08A 5LIPA 1EFCA 2ZRNA 4E2ZA 4QVIA 1O95D 1QANA 4YAWA 1ANKA 3Q1LA 2IZ5A 4YP9A 4KUEA 4Z86A 5JRDS 4AZ3B 3MT9A 4KR3A 1O5TA 2ZJ1A 3DZCA 3OWHA 3IOMA 1E62A 1UJ6A 1IPEA 1CY4A 4IMPA 4KQKA 4PWYA 4DEXA 1U99A 5IEJA 4C4PA 4I66A 1A96A 4ARBA 1YVPA 1BX0A 1L5SA 2G17A 3OQIB 4ZVMA 3KZVA 3NBKA 1V8DA 2HIHA 3M1YA 2GN0A 4Y9RA 4OAQA 5FTKA 5TMEA 3RABA 4PX9A 3RC8A 1VIVA 5DHSA 2L19A 1UPCA 3HKBA 2GN6A 2OM2A 4DV5B 3QG1A 1JQBA 3WXMA 4C4XA 4Q1AA 3L06A 4MDHA 1NI4A 4D43A 4D9CA 1RTTA 1YC5A 2DSTA 4X1KA 3ZY2A 5JHHB 1VHTA 3GF4A 3IEPA 4JLJA 4BO5A 1OA1A 4WCDA 2O4UX 4GWKA 2B25A 2GBGA 4OYRA 3VHXB 3OC0A 3ZHTA 3LCRA 1ILWA 2BISA 5AM0A 3RHFA 3GHYA 4I9GA 4RF2A 3U48A 3V3TA 2W5UA 4IOMA 5BVHA 1WKBA 5EMJA 3FJ1A 4XB2A 5DM2A 2YASA 2BPOA 2VRNA 3R7FA 2BFFA 3DFZA 5GY7A 1N7GA 2SCUB 4QXMA 5JD4A 1KYTA 4BLPA 1ISJA 1X39A 2ZBEA 1RWXA 1UFOA 4LJYA 2R65A 3MFYA 2I7CA 3DJFA 4UD6A 2EGUA 2HF7A 5DM60 4OK5A 4P8RA 3NT2A 1UBJS 4K9QA 5IXJA 3LDFA 1CJCA 1Q0UA 1RJ9B 1HEIA 5F52A 1J8DA 1K8XB 3F5SA 3AVWA 3HO6A 4LRWA 2Q2NA 1V71A 1BGWA 1C30A 4WFIA 3TTVA 2WKPA 5TJ9A 1ZISA 3WWPA 3IHKA 1P7ZA 2RC5A 4R2HA 3OKCA 3CFYA 1W4CA 2VSOA 3QPBA 2OWEA 1ZOIA 3GGPA 4K9LA 1OHHD 4ZHSA 3JASA 3QU7A 3INRA 5IJWA 4XSVA 3FKSA 5IS2A 1TECE 2ENUA 1Z83A 3KDSE 1DTWB 1SVOA 2OPBA 3HDJA 3FUCA 3NORA 4RCZA 3BJRA 4IEEA 1KI1A 4JODA 5ESWA 2IV7A 2GN8A 4ADSG 1QKJA 4F9GA 3QOWA 1ZKMA 1RCUA 1BW9B 1WVIA 3FRIA 1S0UA 3RK4A 13PKA 5EQJB 1VGVA 4CI0B 4PAGA 1JMKC 5I7OA 1TQ2A 3A31A 3DC7A 5AW2A 2WUDA 4CLOB 4BNNA 1QQBA 3G5UA 1Q0SA 4ZVTA 4WLOA 1KI6B 3LT2A 4IFEA 1ODSA 1L4KA 4IINA 2J3QA 3MHPA 1DXHA 1RYZA 5EJMA 5D3KA 3A4IA 3SGLA 1BMTA 3I4CA 1L7DA 2YX1A 3T5DA 3RSLA 1PDOA 5EFZA 4QYIB 2WHEA 1GGEA 2A7XA 1KA9H 1A97A 1DBWA 1P39A 3DP9A 1CIPA 4S0ZA 1H94A 2F8TA 2I78A 3OEED 1NZDA 1H3FA 5HKBA 3RUHA 5EN4A 4PC6A 4MVJD 4YRJA 3J80A 3LW8A 3CKMA 1NAHA 3ZV5A 3MT0A 4Z0HO 2TS1A 1H2FA 2C84A 2JFVA 2WTAA 3BGIA 4G5QA 4HLQB 3T0IA 3WA7A 5B4TA 1YCFA 5AM1A 4R9RA 3RIXA 3W78A 1Q1EA 1ZD5A 3IUNA 2BLNA 2ZWIA 4C76A 1V4VA 4HX9A 4O4JB 3FPLA 3L9WA 3EUWA 9LDTA 3MCAA 5DIFA 5HK9A 1JEQB 1U94A 2CE7A 2GPNA 2XQJA 2DXIA 3AVYA 4I1SA 5BQPA 5LZ7A 1CULC 1PAUA 1VFPA 3HXMA 2XDQB 2FP4B 4X9XA 2HDHA 5FBZA 2RGBA 1ZM2A 4YJ3F 3BMCB 1S1CA 3OX2A 4M9XA 2FQQA 1Z4IA 2GWHA 3BJIC 3GDFA 4Q7KA 4R9UC 5JOQA 3C5WP 3ABOB 2ZYIA 4L3WA 2G4LA 4PBRA 1G291 2R87A 2ZCUA 3A32A 4R5HA 4NY1A 4NMWA 4V03A 3EEOA 1L4BA 3N75A 1CP2A 3FI0A 3PEUA 3QK7A 4UOQA 2HHAA 3SK0A 3VDRA 2JLUA 3IC5A 2OZKA 3R6WA 2VT3A 3RRNA 1RM0A 2C2BA 4NFYA 2OAQ1 1XTPA 2A0WA 2D74A 2ZTMA 1KK2A 2F1HA 1ULZA 1ZSNA 2QRZA 3SYRA 5KYWA 4YP1A 3I5YA 1OT3A 5KJ1A 2CFIA 1KTVA 3HCOA 4OGLA 3VAZA 5DEIA 1ZGGA 4G24A 4IDBA 1VLHA 1XCJA 3JTEA 5FWXA 2B7BA 4ZIRA 3U1BA 2QR3A 4IHJA 4P82A 4RPIA 4ZVSA 3SBDA 4E1AA 3KOZA 3ENQA 3UWOA 2A0FA 3W2FA 1FFEA 1IHYA 1OE0A 3I01A 1LX6A 2Y1CA 3G1WA 3ICPA 4HL6A 4Z9AA 3ZCRA 5K4HA 2XOEA 3R77A 4M88A 1KMHA 2UAGA 4L28A 3ZHVA 2WIAA 3FM9A 5CFMA 1YQWA 3OLQA 3PB3A 1ECJA 3SG0A 5J4LA 2Y4NA 5J47A 4Z0NA 3SPXA 3R3JA 1EUYA 3UGKA 3ZIAD 1Y6RA 1PS0A 1NI4B 2WLTA 1P74A 3NVKI 1FUKA 3HBMA 1QVVA 3NW9A 2HUPA 4R1MA 6LDHA 4PS0A 1T0UA 2G3YA 3KOWA 4C4SA 2BTOA 1ZWLA 4Q1CA 5LMUB 3NFRA 1CUSA 4BHTA 5BVHB 4DGQA 1ZNYA 4GOJA 5DMXA 3C3WA 4AJJA 4B4OA 1KRXA 3WJAA 4X6UA 1I6KA 2XCSB 1SXQA 2KSQA 3OQJA 2BZ0A 4KLZA 4NG5A 5CW1A 1X9GA 3CONA 4EITA 2ZVJA 3W7BA 2BFFB 4D5EA 4FHDA 2ZPUA 4AUMA 1ZVJA 3ZXYA 3GU3A 1U1EA 4D3DA 1W6RA 3I2IA 2WIJA 3MF4A 5LQSA 1CHNA 3STXA 5FX2A 2ZYUX 1OAOC 5CB4A 3MCVA 3RSZA 2PS1A 1Q17A 2QRHA 4WVFA 3V1LA 3OM9A 4G0OA 3RVDA 4X1IB 2BEKA 5KI6A 2YRXA 3CUTA 3RROA 1C30B 1GG9A 2Y66A 2O2EA 3T4XA 3QVJA 1H69A 2F3SA 1YRWA 1ZX1A 4ND3A 4R4JA 3I4LA 3ONFA 4ON9A 5FTJA 4CIVA 3EX7C 5KNBD 1EE2A 3CPSA 1F9EA 3JASB 1Z6AA 3DOJA 2C42A 1CLUA 4XH9B 1FFXA 2ZIVB 2GZHA 4YRLA 3WLLA 2A84A 2VPPA 3AF4A 5M34A 1E8DA 2NN3C 3K0BA 4ESEA 4UNNA 4HDCA 3T61A 3WQSB 1GTZA 3C3AA 3WK8A 4KHPB 1OQAA 3E4CA 1XO1A 3AGQA 1GTRA 2RHGB 1RNLA 1F20A 3G0CA 4RESA 4ENTA 1CQXA 4N65A 4RVOA 1RQNA 5EPOA 1MIOA 2PWYA 4ND7A 2P78A 2WZBA 5HJ5A 1KXZA 1JVBA 2ZCVA 4PC1A 1Z63A 4ALMA 1XTKA 4LWOA 5AVXA 2IC5A 1D2RA 3IOYA 3MJTA 4IOJA 1B8PA 1SCUA 1DRVA 3ZOZA 1XJ5A 2R7NA 1S89A 3FWKA 1IZ7A 3I5MA 1GZ6A 3ZNQA 5LLSA 3UN1A 1RWQA 2PKEA 2ZUFA 1HL3A 4ILEA 4O4HB 4P84A 1P5ZB 4J0HA 5T6BA 2XR1A 4QEDA 1U7HA 2IYOA 4MK4A 5DYNA 1NBMD 4N40A 4HUQA 1QP0A 1AO3A 2ID4A 2HRDA 1G1MA 1DU4A 1NBWB 2R86A 1WV1A 3DXXA 4FZJA 4NF2A 4Q4CA 1B73A 1GFWA 4YAUA 3IJ5A 4MQ4A 2H4WA 3IA2A 3OH8A 3RC7A 1Z2NX 2DPHA 4J91A 3ZBUA 1OR8A 1Q1GA 3ZEAA 5C4MA 1ZD8A 2QLMA 3BTSA 5FOWA 1RIIA 4BS9A 1TU4A 1UK7A 4FEEA 4RPKA 3KUKA 2VBGA 4H08A 5CA0A 3U3JA 5H80A 1XWWA 3RYCA 1JE0A 4R2LA 3OLCX 3QBVA 1XMPA 1EM6A 3D6VA 3B6JA 1LPBB 2KI5A 2PA0A 2V8BA 2VYCA 3Q9LA 3AVQA 2WJGA 4LK2A 3OP1A 3NHJA 3QEOA 4ZD6A 4MVJH 5JDCA 1KWKA 4ZT4A 4WLVA 2VJLA 2G63A 5JPIA 2ET6A 5EEHA 3BYZA 3GCZA 3O4HA 4E3ZA 5FO0A 2JF0A 1ONPA 1E3DA 2ICAA 1JHRA 4OB6A 1MJFA 4Q3EA 4WEQA 2Y1DA 5TGDA 3I9OA 4LZPA 1G41A 3DV0A 3O3MB 5TS3A 1EXMA 3II6X 3C3XA 5HJEA 3CIFA 2QUZA 5F7JA 3OBBA 1Q1NA 1XZAA 2NWQA 3KALA 3LCCA 3DMTA 3IV6A 4I4IA 2WI8A 1UDBA 2PMCA 2VOEA 3G9QA 3JATB 1KFEB 4O8CA 4R40A 2YJ5A 3O8DA 5HZKA 4MKHA 3RTEA 2ZVDA 3UO8B 3LHIA 5FCDA 5SY6A 4RXTA 4UEWA 1II9A 5KYWB 2J3KA 1ENZA 3SQNA 5E4TA 3WGQA 1ACMA 2WMDA 2ISCA 4L8WB 2G67A 2P68A 1WHTA 3T12A 2RBGA 3CRQA 5FWXB 4B3TB 3LA8A 4XUCA 4ZIRB 4L2IB 5IMSA 5IT5A 4IHJB 1R0ZA 5CURA 4D80A 2BKEA 1ST2A 4P2BA 2XT0A 4N8DA 4BYMA 3AR9A 3GLIB 3FYTA 2IS6A 3T3OA 5ITZB 1UL1X 3L6DA 3M6WA 4K1XA 5FULA 1Z8FA 1HUQA 2RGUA 3EPKA 3PUVA 4PCUA 4EF5A 2QLTA 2MR6A 2HU8A 5BMOA 2HLPA 4JWKA 1Y7TA 2QRKA 4Y18A 4BVEA 1THMA 4DCJA 3E9RA 4DARA 3L7DA 4OM7A 3GJ8A 4X3PA 2ZW9A 1M66A 4NYMR 3WBBA 4UDOA 4IEFB 4NYJR 4MW6A 4RFVA 4HP8A 4BZXA 1PZEA 1PP4A 4R8MA 5FAXA 1GA6A 4BVLA 1MXHA 4OJQA 5FTLA 5ES3A 5FD8A 5K6TA 4RFSB 4P2GA 1G8MA 1WPXA 3KLPX 1G6HA 4RXUA 1XZQA 2ZYDA 4CKCA 5E95A 721PA 4LY6A 4NBKA 2J7PD 1W75A 3TKLA 4I6GA 4OBWA 1PF7E 1LH0A 4WLEA 2P91A 4PX2A 2EC5A 4I81A 2Y3IA 3QIVA 5ICMA 3GJ6A 4EB3A 3EAFA 4U7TB 3ZHYA 5DWDA 3PRKE 1E3LA 3QE2A 4QUKA 4QRDA 5J4KA 1T15A 2OHIA 3DMNA 3LLCA 4OQQA 3LK7A 4CCYA 1XZ8A 2GTPA 4Y2RA 3Q1KA 2IDZA 3FB4A 1IDOA 4EJFA 4XWKA 3NWBA 3U49A 2ODWA 4UQOA 4J0DA 1GR1A 4PYOA 2QRQA 3IBFA 1ODFA 3L5OA 1OZFA 4GDFA 1KI7A 2JD0A 1PR9A 4ER6A 1P1CA 3F73A 1BSVA 2YVQA 3MWLA 3P9SA 1FFXB 3OLYA 4R8RA 4UTRA 3ZHXA 5LQMA 4B4KA 2PH3A 3KSAC 2F62A 5DYGA 3RFTA 4E5PA 3CX3A 3WSWA 1M6YA 5ENDA 1WHSA 3OT1B 3ZEIA 1G8KA 1U5CA 5JAOA 2IZ1A 3GROA 2G1KA 4NS1A 4UCFA 4LUCA 4AP5A 5I7FA 2PU5A 1XTZA 1FC0A 5FI0B 1JI3A 1I9CA 1W2HA 2JGFA 2QMQA 3CBGA 1RLUA 5K3FB 1QGZA 3AC0A 1E2EA 4M1TA 4C22A 1C0KA 4KITB 5KNBH 2YWJA 621PA 2OHVA 4LZNA 1LD3A 4JI4B 4S0XA 3EVGA 4KQ2A 1E9FA 2QIPA 4GQIA 5IULC 4LMAA 3AQ4A 4I8IA 2EX1A 2HK8A 1EA5A 1OFUX 1YNOA 2XRZA 3OCZA 4PPYA 2X40A 2XNCA 3P20A 2R1TB 1VG0B 3N2YA 4YB8A 4BU1A 2IBTA 2ZI9A 1QP8A 1JF8A 3L8GA 2BM1A 3Q88A 4AYWA 1A98A 1Z6TA 2A94A 3H5OA 4D3SA 4LRQA 5CDHA 1NDUA 3BRWD 5JNVA 4AJ4A 6Q21A 1TZ2A 1RXIA 3TSWA 4ZQHA 3W2TA 3CCBA 3EEQA 4IS2A 1BQEA 2QUHA 1RVDA 4P81A 1P2TA 3WICA 3I6QA 5BWMA 5CA0B 3MCWA 3VVCA 3ZCQA 5MGNA 4TYWA 3WLHA 3B20A 1U0FA 3HRHA 2X0DA 2Z8YA 5G40A 5EIXA 4REQB 3VH4A 5GTDA 3DL0A 2AVDA 1ZCFA 4FMCF 3UAOA 3OT5A 5KVAA 1A8HA 4ASUD 1KJIA 1W9MA 4QAQA 4UJ3A 3PJEA 3IODA 2WFAA 2EATA 4NZMA 3CC8A 2GM3A 3NNNA 4PXAA 1RPNA 2KMLA 5IMBA 1G5PA 4XZ3A 2W9XA 4BQPA 5LWHA 3ETNA 4LTNA 3I9LA 1VPDA 1W48A 1XRLA 1JB9A 3A9RA 4DRYA 3I1YA 2ZJOA 1KI4A 4RQTA 3OTOB 1I6MA 3GLIE 3T1VA 1GKLA 2O9JA 2VH5R 2CL6X 1YFZA 2IYPA 2WA2A 1VHDA 3DO8A 4H4EA 1H0HA 2J9FB 3L7NA 2RCNA 4H0NA 4MUGA 4LVCA 5ALFA 4W9MC 1JG6A 2B82A 3PK0A 4BV2A 3OOJA 1LBSA 2A57A 2H59A 3P32A 4J75A 2NV0A 4RK1A 1Y6FA 3EIQA 4QNNA 1IZ9A 1P44A 1Q7TA 1E1LA 1JBEA 2O14A 1PQUA 2WAYA 5HF5A 4DCOA 1F5NA 5FBWB 3TM4A 1Z0UA 3M5PA 1WHTB 2H8KA 2O2XA 4DJEC 5A7FA 1Z5OA 4C4TA 4G5OA 3UUGA 3ZHSA 4QGFA 1KPIA 4ZZ0A 1DMSA 5BWNA 1SZCA 4PTZA 4PR3A 3PFWO 3BWXA 5DGHA 1ECCA 3JQQA 1AZSC 2HU7A 4R1SA 1T3HA 3HZZA 5ICCA 2G1AA 3O7WA 2V7EA 3OZWA 1SQ5A 4B2YA 2C7BA 4GC9A 3OZGA 1WKCA 3W8RA 4J0KA 2DPYA 1Y7LA 2O2ZA 3TLZA 3QE0A 5EE1A 1QR6A 5AXCA 3SHQA 3IO5A 1HRKA 1XL1A 3JWGA 3JQGA 4X1YB 5HKLA 5KOJA 1SBIA 4A36A 3KVRA 1FXWA 4BFUA 3NATA 5F5XA 1X9IA 3FSGD 1LWOA 4R71A 4EHHA 3O94A 4QWMA 4AVYA 1Q1AA 2I2BA 4LDNA 3S2EA 4R0MA 4ZKDA 4L6CA 3A26A 1DQPA 3I6YA 2J08A 4HPXB 4WASA 2SECE 1BKSB 2ASEA 1XEFA 2Q2QA 5HX7A 2I4MA 4JOCA 2JLWA 4KGXA 5FL7D 1PFWA 1YZQA 2BHRA 2ACWA 3HVJA 3ND6A 3MMXA 4CTMA 2O2JA 3CA8A 5TEVA 1DZIA 3LP6A 1CQZA 4JJ6A 3WFIA 4DMLA 1NXTA 1PFKA 2SKDA 1FRFS 2JVKA 5CT6A 5HMMA 3LX4A 4XSGA 1M9NA 2R5WA 3MELA 4CCYB 4MQLA 3DFMA 3FSJX 4TS3A 2H92A 1ULBA 4LC0A 4ZVLA 3I5UA 1QHYA 2IYXA 1ML3A 2ZIWB 1SKYB 4JT4A 4IGFA 4EW1A 2O06A 2Y27A 3E81A 3NJRA 5JYEA 1GL6A 4DABA 5JJKA 1Z68A 5ELXA 2GYVA 1BE1A 3QF4A 4ZI2A 4CKWB 3H9QA 2C20A 4AD8A 1NVXQ 1NF8A 2FN9A 1GVHA 3MB8A 5HRAA 1QHNA 4CTKA 3QNMA 1HR0B 1C4KA 1S2DA 3UQZA 3PCRB 4CM7A 2WUVA 2ZYGA 4IVQA 2BSQA 1BMFD 1A5TA 1DRKA 1SR8A 1QHIA 3BMQA 2O50A 2WWWA 2FA9A 2OAP1 4WRRA 4KK3A 5BVGA 2EQ5A 5CDSA 1O96A 4IV5A 5AKKA 2OQRA 3STYA 2HN9A 2XQIA 5CVCA 5JNLA 1DDGA 5JTUA 2OMEA 3P26A 2VIIA 4FS8A 1Z6XA 2BKVA 2WG2A 3AYXB 4IDQA 1A8IA 1EVEA 1L7NA 1ZXXA 2N46A 5JAIA 3IA7A 4DPLA 2YV3A 3Q8MA 4ECAA 4I5EA 1M10A 2QENA 5JSYA 3BDVA 5FDFA 2IYQA 2QVYX 4OU4A 4GECA 1SCAA 1U9IA 4MW5A 3DKPA 4OFXA 2R8XA 2FUG1 2OOKA 2FLKA 3CZ9A 3IIMA 5B36A 3G0HA 4QUGA 3QA9A 2DF8A 3OHSX 4DLYA 4ROTA 3VPSA 2ZT7A 1JEAA 5CNJA 5L3SB 2W6ZA 1NP7A 4PIPA 9GPBA 5C2JB 1T36B 3CY6A 1R1DA 3RV4A 1QTQA 1I3MA 3R4CA 1A27A 4BNTA 5EJ9A 5J43A 5J2UA 4BJ5A 3FDJA 3SDZA 2GD1O 3M1AA 2WFLB 3O7MA 4H7IA 3VRHA 2WT8A 4D79A 1V35A 2IFTA 3HHPA 1ZS9A 5AJYA 1XK7A 4BVFA 5KJFA 5TPWA 4CLRA 4KW7A 3D3KA 2H18A 3V5NA 4RHCA 2H52A 1KIAA 3QXJA 4BLOA 2FTKE 2WJIA 3EW9A 3PFHA 1KJNA 2MMGA 4Z7OB 2FYTA 2WMOB 5F35A 2GWRA 3TLGA 4AWBA 3SFVA 2FZ4A 2Q29A 5E9WA 1F8YA 1L4LA 1C0PA 2AIRA 2V9ZA 3UFXA 4HQKA 3FCSB 3JXEA 1L4FA 1ZP6A 3SJAA 5EXSA 2XQFA 1FW6A 5H4HA 5BUCA 3E9NA 1CXZA 4BNKA 1IM5A 1EVKA 2HA4A 1I1OA 4J7AA 1GSHA 3N8GA 4DM3A 4K1LA 4EUNA 1NXOA 3FVRA 3TVYA 4ALNA 1P2BA 4GD3Q 1Z0ZA 1NW3A 2XMZA 4I4TF 2JFYA 5F9MA 1SNYA 3DE0X 4MZDA 5JANA 4Q9LA 2Q5EA 5A1JA 4AJ9A 1BHJA 1TIKA 4XUEA 3KJFA 4MWGA 1OAAA 1IXKA 1JSRA 1Z5NA 1BOFA 3EXHC 4KPUA 3V55A 5LP6B 1TCAA 3R5HA 5JAQA 1XAIA 4ICIA 1LNSA 3U5ZB 1ULSA 3QVMA 4BC0A 2QE6A 3B70A 3QUAA 2JATA 3WHLA 2GX6A 4OQFA 4E5DA 5BMVB 4XGKA 4EHAA 2Y71A 2ODNA 1E5XA 2WU3A 1U65A 4YFYA 1UPFA 2EFYA 3CVVA 4CIDA 2KLHA 3U7RA 2XAAA 3EXEB 1L9XA 4D3ZA 4LCEA 3QFCA 3HG7A 2Y4OA 1FYEA 3IT3A 4UBIA 1FTGA 4GOND 3JQGB 1O3YA 1JDVA 3VNRA 1DI0A 3I23A 4MV9A 3ESAA 5F1KA 4KKXB 4EOGA 4BWFB 5AW4A 4FD2A 2EEZA 4TQGA 4GEGA 1OUMA 1Z36A 3Q6IA 3BKWA 4HDAA 3VU3A 4FSHA 4B7AA 3LGAA 1D9ZA 2X8JA 4KNYA 4XXHA 1SKYE 3MW8A 3OX3A 1LUAA 1TYZA 1YASA 4OQ4A 4NNJA 2I6TA 4RLFA 4ZDJA 5D6OA 5DHPA 3FWYA 4DQUA 3KOXA 3HB7A 1EX6A 1SD5A 3QV1A 3FJYA 3O93A 5K3SA 5CM8B 4Q21A 1JSZA 2ZBDA 1E59A 1T91A 3HYNA 3WDMA 1SUSA 3QJ5A 4L27A 4K6CA 4AN0A 1EXDA 4JUIA 4QD3A 4RACA 1P2GA 2FPPB 2Q5IA 2Z83A 4E4YA 3NBZC 4WNAB 2HIGA 2YV4A 4JI6B 5EAIA 1QRTA 1E61A 3T95A 1PU2A 4B73A 2H2DA 3K9LA 4NICA 1EUCA 1GYQA 2UUCB 4FR0A 1U1CA 3EC7A 3CUVA 2D0PB 2YUTA 1TPYA 4R9VA 1SHKA 1SJ9A 1XK6A 2NSHA 1MD9A 4I4CA 4CEIB 4GMFA 1TCBA 3OHMA 3HBJA 2VAPA 4HTFA 1ONNA 1P4JA 3H9UA 4Y67A 4HNSA 2IK8A 3USZA 1JHVA 3INGA 4PZPA 4TYPA 4L8LA 1DCTA 4AS2A 1UXGA 5JYCA 3L7KA 1J39A 4UUPA 3KQVA 4HV4A 4IIUA 5BVGB 5JCOC 1OZAA 1E9DA 1O96B 1YZNA 3PHCA 5HZGA 2I2XB 4IZHA 3RYCB 3AM5A 5LZ2A 4QECA 1T1JA 4NECA 3EEIA 3M5DA 3L5KA 1UM9A 1D2EA 3PCTA 4JDUA 3IQDB 1M1ZA 3IDFA 2BF4A 1JWBB 3K5PA 1VL0A 5MN5A 4DMUB 1OD6A 4PLFA 1J2EA 1OASA 3WZMA 1WIWA 1MV5A 1CJSA 1RI1A 2VNIA 3EBLA 3N6RA 1GJRA 4RVDA 2FR0A 3G5LA 5SV2A 1JT9A 1LU9A 3LPMA 5FI1B 3GXOA 4B2LA 4CF6A 2D2XA 2XMDA 1E3MA 3W5SA 2WUFA 5C37A 3KU1A 4M0UA 1JEOA 1CQIB 4Q4JB 2P9GA 3G2JA 1GU7A 1UKZA 4RZ3A 3GDGA 4RE5A 1XKTA 1G0NA 4FE3A 1PL6A 4IH4A 4EKIA 3N7UA 4FD3A 3PGA1 3V42A 5B2FA 5HIKA 2ZYHA 3LBAA 5IZCC 4CV0A 4DRXB 5AI9A 1ZJ5A 5AJTA 1R4MB 2OGWA 1IE3A 4Z7JA 1ZVMA 3KVYA 5AIBA 3LD9A 5K6AC 2Z95A 2DCUA 4CM6A 1W85B 5JBNA 1E6CA 1JEYA 1CEEA 1XHLA 1ZVVA 2QRGA 5AKGA 1V5WA 3F5DA 3AR5A 4LE1A 5IXYA 2CZCA 4XM0A 5J2UB 1T2AA 1ZMRA 4X90A 4DLXA 5HQTA 2NYVA 4LX0A 2DU8A 5IARA 3GB9A 1ZM9A 4EUSA 1F3OA 1Z4OA 1U6JA 3CNLA 1P77A 4BDSA 5JEDA 1J5PA 5I5GA 4I5GA 3TNJA 4E6EA 1LZLA 1BXRB 3UJ6A 2XUQA 4ZO8A 5FI3A 4C0AC 2GNAA 4HOYA 1NLFA 4AZ0A 5DTRA 1MA3A 1WCYA 1P7PA 2JH9A 3E4DA 3ZX5A 4FYKA 5JECA 5JASA 2JBAA 1P1BA 2WBLC 3FMPB 1OI4A 5E3JA 3HA5A 4UUOA 1Q0LA 3H11A 4EHJA 4GI5A 3GYBA 3CLUC 1MAHA 2GN4A 2PXXA 2RDMA 3B8HA 2Q3FA 2O1WA 3B1ZA 3GFGA 3HXKA 3IDZA 3HCRA 4WDQA 5EMLA 5BUQA 1YHZA 5ICEA 4TGLA 1FFWA 3AERA 5IHPA 3N2GB 1NVAA 3IAS1 2D3TA 1OTXA 2AQKA 2ZUBA 3NR2A 3U60B 2W58A 1GPMA 4QUEA 2GFHA 3E0QA 1X80B 3B1FA 3L7YA 3X3HA 3PUXA 5EWMA 1MZVA 2QTHA 1YS2X 2XKAA 1O95A 3OMXA 1W8DA 1U6KA 4KPYA 3OY2A 3WKCA 1D04A 1SD1A 3TD9A 3UMRA 2SKCA 1UIMA 3NHKA 1ZH0A 4XPZA 2GF2A 4QPZA 3EIFA 3D6JA 4H7EA 1D2NA 1UCFA 2BBWA 3RM3A 3UXMA 1EP2B 1VB3A 2WIFA 1X15A 3DZIA 1AIPA 3DR3A 3HYTA 2NSYA 2BVNA 3NPAA 1HLFA 4ZVOA 4CG1A 3P96A 5MGBA 4KPGA 1B3RA 4FU0A 4EG0A 1FIUA 3FCEA 1O8CA 4UVDA 1QCCA 3O3CA 2CUKA 2TMGA 4JXJA 4BUCA 5K3OA 1T2UA 5FO1A 4M87A 4BVBA 2P4UA 2X77A 3IR7A 5AVZA 1I1HA 4Y6SA 3RUPA 4QATA 4UBJA 3V8VA 4MW4A 1RMTA 4UNPA 4NL4H 4AC9A 1IUOA 2VTKA 3GOQA 5U9CA 3ZY3A 1NVDA 1PFVA 1XI2A 3U7QA 4B83A 4LXGA 2EFHB 1R6BX 1ZK3A 2I4OA 2NTNA 4C7BA 1DO2A 3DGEC 2RJNA 1BN7A 4WUTA 2C3MA 1XWIA 3I09A 3P9NA 1OV4A 3U3OA 3ZNNA 4LHZA 2FFAA 4ZVRA 4E7PA 2C4TA 1VP3A 4FGWA 4XWWA 1XKXA 3LQRA 2IE8A 5ADWA 2A0YA 4IPTA 3KTFA 4HYYA 2W6CX 4KUHA 1YBVA 1Z22A 2WM2A 3ROKA 4IGEA 1N6LA 4WOCA 5DNCA 4NCIA 1SBTA 2E7ZA 1W4RA 1EUCB 4XX0A 3ZBTA 4TMTA 1QIFA 1MAWA 3GBSA 1BKDR 2C2OA 2E2WA 2O3JA 3EZFA 3QNUA 4OFBA 4HNVA 4WXEA 4ZKEA 1DRWA 5F77A 1PWZA 1Z7EA 1Z13A 2VF4X 3GAMA 3D3JA 5H1YA 1M74A 4IGIA 4TKLA 1U7OA 4MUFA 5KYVA 4A2CA 1CY2A 2WUGA 3PFCA 3QKIA 4IFTA 1KVRA 4LG1A 1BDIA 1U7XA 4DF3A 2X6QA 4FONA 1JDBB 4RGBA 1NBIA 2WWHA 4M53A 5PNTA 2D4HA 3C6MA 4GQAA 3E9MA 3UOGA 4NHOA 5CBKA 1F1JA 1FDSA 2NQ2C 1WUYA 1UM8A 1T9BA 3K9WA 1KFJB 3PITA 5F64A 1IAVA 5C81A 1WDTA 2X0EA 1FXSA 4B81A 1ZJ6A 5DK4A 5DXFA 1XEAA 3LUHA 1CZOA 1AM4D 1JR3A 2AEEA 3OLZA 3NIWA 3OURA 2BHSA 2WJVA 3MMZA 2CXTA 3FF4A 4XVCA 2FW9A 3DKKA 2P2YA 4B76A 1SVMA 4C05A 1DZ3A 1DOAA 1DFHA 2QVGA 2AFVA 4Z9XA 4ZO6A 1YGYA 1A7JA 3WLMA 1JDSA 1NU8A 1G2PA 4HADA 3OEEA 5CTAA 3FHLA 3W1WA 4LXYA 1V4BA 1JBQA 1ZN7A 1MNQA 2QRPA 3C6YA 2BGKA 3LO5A 1XEWY 2Z5GA 3HACA 4MVJA 4CKBB 1U7PA 2OFWA 4JJGA 1P4RA 5ELLA 3W7AA 1H2BA 4TKZA 4FLMA 3N8HA 1JU9A 3HJAA 5A4MS 3KB1A 1RXCA 2GLXA 2ZB4A 5A05A 4CN9A 1MB0A 3IUSA 1SKMA 5BRJA 1YB1A 2PSSA 4KI7A 4PSKA 3A28A 1XCMA 4M89A 4JY7A 4GUAA 1AK1A 2R7AA 3MWEA 5E1DA 3ZJVA 4NXNB 2X6TA 1ZD4A 2ZREA 2CLCX 4ZT2A 4H4CA 4ZPXA 5KSOA 1DOHA 5H0IA 3W9BA 1D6MA 2XV1A 1T8YA 4LNUA 1RCFA 4Q9HA 4P36A 5I7EA 3W5DA 4ZCRA 3FRJA 4AZ0B 1T6XA 4M1WA 3WBFA 1Y9JA 4XTCS 2ZG6A 3P9KA 3RHZA 4CIYA 1KMIY 2WA1A 3SYNA 3H11B 4PHHA 4JQSA 3K2EA 4WK2B 2AR9A 5KYUA 2G28A 4QYXA 4EW2A 5K2MA 2WTEA 1QMGA 1Z0DA 3CWZA 1IM2A 3GJ5A 4IBOA 4N7RA 1RWMA 4ALIA 4L72A 1PJSA 3PVCA 1C29B 1R16A 1W94A 3QVXA 5EE0A 1M33A 3EVBA 1IJFA 2CNDA 3JD4A 1XRNA 3EOBI 5KQRA 1W5SA 2O8BA 3WL5A 1NATA 1N5JA 3C41J 5SZIA 3CMMA 1E6EA 1TCUA 2ZDQA 3HRKA 5EWMB 2OA0A 4LV8B 3ICEA 5AJZA 2YW2A 2V1UA 1U3WA 2FN3A 1YQGA 1T8TA 2PKQP 4OQPA 5K3EA 1GYPA 2DBYA 1TTQB 2JGEA 2YWHA 1IZ0A 3SJUA 3HVHA 2Q6LA 4HEA1 3O8OB 4RIFA 2JCXA 5LQRA 2Q1YA 1DSSG 4JFAA 1Y6GA 4HDRA 3IEXA 4NZOA 4N7MA 1J7KA 1T9GR 5CNKA 1T5TA 4UDNA 5DJ5A 3RRBA 3X44A 2X5XA 3GRPA 3IRVA 4WL0A 4X41A 3CNOA 3OMLA 4MR7A 3G9TA 4ZZ2A 3LG2A 2GJ4A 3LQ2A 4JLWA 4E2FA 1M67A 3M89A 4D82A 2CFOA 2QQ0A 2RGDA 2H2GA 2UYCA 2DGDA 3LLMA 2I55A 1UOQA 2GBLC 2Q0QA 2NSLA 3NPMA 3V6LA 3ZIAA 1GQFA 4AKSA 4B71A 1AXGA 4D8TA 4ZYYA 1DS6A 3BD8A 2IYUA 1F38A 3L92A 4IJ6A 3FZEA 2GSWA 1A77A 2RKBA 4U2EA 5C18A 2RGNA 2QX8A 5H81A 5EMNA 4IS3A 2RFLA 4L4XA 4E5SA 2VBIA 4HK4A 3BX1A 4M0CA 3F9CA 4IHKA 3P2IA 5AKHA 1RLIA 1BYUA 1RZ3A 1VI2A 2DM6A 1V8OA 3FZYA 1TT5A 1ZIOA 2Q2WA 3G8YA 3DMRA 4INOA 4ZCTA 3M34A 2ZSJA 3OCYA 3DLIA 4MWTA 4NENB 3QVKA 3S2ZA 3VX4A 2PAFA 2BFWA 5IF9A 1IZYA 1XJCA 3K6SB 4FB5A 5E38A 5AIAA 5B3JA 4P0PB 2MSEB 2AD5A 2XRMA 3UBMA 1TNDA 3DCNA 4DV0B 3IALA 3UICA 4XX0B 3LUDA 3TD6A 3GFTA 3FBGA 3D31A 5JC1A 1NYQA 5IRCD 2R6FA 1OXUA 3ZWNA 4NS4A 4WQMA 2B3TA 2RHMA 3A3OA 5BQFA 1OT5A 1ZXLA 1DWOA 5KNBA 2FMIA 1B8VA 3BC1A 4YFVA 3D3NA 5CVDA 3IPLA 5K8LA 2VUIB 2V54A 5AMXA 1WB5A 4M54A 2IZ7A 4OY3A 2BGIA 5TR9A 4RA6A 1N57A 3MGAA 3TRIA 2PMWB 3UJCA 3WJ1A 4BJ1A 5COAA 5JJLA 3KO8A 1B0PA 5KMGA 4FMBB 4BQFA 2H31A 5LR6A 4E70A 1YQUA 3T8YA 2PBLA 4F3CA 1NOKA 2CLFB 3OOWA 3K9HA 2DPLA 1HLPA 3DOOA 1M6WA 2BE7A 1EU1A 1D1SA 3CW9A 3PXDA 5EHZA 4PX3A 1TJPB 4DWWA 2J9YB 5AW0A 4DIOA 1OREA 4O2LA 1KJJA 3MNFA 1D0SA 4BTVA 3W5CA 1J0EA 2EWVA 1QF7A 4IEIA 1LI7A 2P3SA 2V9PA 2ASVA 3A6KA 3O83A 2F3TA 3DAHA 3NTOA 3QLEA 4MI3A 4R01A 1J0CA 3F1KA 4KGVA 4B31A 5E6SA 1QYDA 2EYQA 4BX9A 4ZODA 1LGYA 2FGJA 3IAHA 1DLIA 3V4VB 2H2HA 5F4BA 1FZTA 2YS6A 3W2GA 3HP1A 1O4WA 3PRYA 1NBMA 3EH1A 4GLLA 1F4PA 4QDOA 2Q4OA 4XOIA 4EYKA 3LE8A 4RJTA 3LFUA 2XMBA 2XOKD 3HFJA 3V48A 3N2ZB 4X6XA 1RWVA 1NW8A 5A71A 3DCJA 2XUAA 5DW3A 2VXOA 3O4VA 4ZI7A 1Z12A 4RSMA 1WPRA 5IH7A 1JHZA 4JLPA 2FVYA 4JJFA 2VSQA 4IVPA 3UWSA 4E2WA 3QMWA 5JRJA 5F3WB 3BMNA 5K0CA 4ARZA 5EJFA 3MWEB 2YMQA 4PLYA 3KXKA 3UEOA 2HEIA 3FLAA 4RY2A 4I1OA 4LNAA 2CHVA 1DP4A 3DTYA 4XCVA 4LNUB 1A9TA 1TF7A 1NDHA 1XPJA 4M8IA 4D9BA 1CJMA 1F4VA 2D2VA 3COPA 2JFQA 3KD3A 1UBFA 5DNDA 1Z45A 2XBLA 2PD6A 3WRYA 2J3HA 5T57A 4LEIA 1ORIA 1YQEA 1QG6A 4FMPA 2I87A 5C8YF 2C82A 1FTQA 1DIBA 3BFVA 1LK5A 3KS9A 1M8KA 2FEPA 2QTMA 1J8MF 4F5WA 2DR0A 1C7ZA 5AM2A 3D1JA 1U2RA 2LPMA 4I99A 3QYPA 1ZC3A 2P6RA 2F4NA 3ZVMA 5G1PA 2O8BB 3IT0A 1T2CA 1O8BA 3MT8A 3SXJA 1Y4AE 1JKXA 4V39A 4Y30A 3PGMA 4BFVA 3A1NA 4G07A 4LV6A 1C7FA 4QXRA 2PX2A 1JTVA 4Y6OA 1A4XA 4YK7A 1GFZA 3COJA 1CZUA 3EY9A 3FLEA 2J33A 1CDDA 1SY7A 3SXUB 4HDRB 1FP1D 4HGPA 2XADA 1GPKA 4JJ7A 4Q12A 2PFGA 3ZWQA 2IHJA 3FBWA 3V1TC 3WBJA 3CEPB 3AR4A 5GJWC 1FS6A 4BPRA 1E5QA 2C95A 2F00A 3TTXA 1FTWA 5JS1A 4B45A 1BG6A 4MO9A 1QTIA 1O6CA 1ZOLA 1KO8A 3GRAA 2J7KA 2MOKA 1X3SA 1ZH2A 3AXTA 4RLHA 3WK6A 4PN7A 3B9PA 4TWIA 1SUCA 4HJXA 4W5WA 5ALNA 3DFKA 2WKWA 3IYLW 3PXBA 3VI3B 4DDHA 3LVRE 3EF0A 4YVFA 3JAMA 3M6UA 1VPEA 3D0RA 3QEJA 3A25A 3SN6A 2J6IA 1H8HD 3M6AA 1ISIA 1V9CA 2BM9A 1VZ3A 3L1UA 4QBIA 3SY8A 3VTKA 3S81A 5ITSA 2J7PA 4RJIA 3LDAA 1QIEA 3EFEA 3LKVA 3A36A 3D7NA 3PSHA 4OOEA 4XR9A 5LUBA 3M5WA 3T9AA 1GGHA 5THQA 2NT3A 3TQRA 3ECAA 2CDCA 2GK7A 4NBVA 1JPUA 1GFSA 4OSEA 4I1UA 1EQUA 4OI1A 4BBZA 5KNCD 5F1YA 2CNOA 2AF4C 3ECSA 2FMKA 3KEFA 5BR4A 3VSEA 3E6AA 3CLVA 1YI0A 5KVVA 1BIFA 4JITA 2QD3A 1P0CA 3S2SA 2FP3A 2L2QA 4C21A 1YMVA 1AE1A 2C9ZA 2Y0DA 3P9XA 1CB0A 2XSZA 3SNHA 5HWSA 1L8LA 1WS6A 1BHSA 5HF9A 1P80A 3DHNA 5AOBA 2C7OA 4OFZA 1QRRA 2PZLA 4UMDA 5HBGA 2RHWA 3BXPA 1C1XB 1JR3E 1RQ2A 2Y1GA 3NP7A 3QXHA 4U7HA 5ALUA 2VRBA 2APJA 1I6LA 3I73A 4JDPA 2Z8ZA 4Q0MA 1A8QA 2FPGA 3FWNA 5EZ6B 4DLBA 3LHDA 5E0KB 4RA6B 5AJWA 5AW3A 4IX1A 3ZN2A 3AHEA 3BH6A 2RHTA 3M6VA 4L9RA 2PRJA 5KMGB 2Q1WA 1X8LA 1V7PC 1HYEA 1PNOA 3L93A 3O4IA 3SEQA 3ZV4A 1GTMA 3BXXA 4QU9A 2ZRLA 1U9JA 2B7CA 3TDKA 3U56A 4B7CA 1RM5A 5IT9A 2HWUA 9LDBA 3KJEA 2VK1A 3A1DA 1BCSB 1AHPA 2FJ0A 4NI5A 3NJ8A 5A0FA 1DIRA 1E9SA 3CWCA 5DSZA 2WNSA 3SICE 3TL3A 2IP1A 4YT4A 4AWAA 3NVMB 4OK6A 1O0SA 4TSRA 3K0FA 3KWMA 1AKTA 4RK6A 4M0LA 1E3TA 4PSUA 4W6ZA 4DCTA 4TTAA 2AQ8A 5DTEA 4NYMQ 3W9SA 3LW7A 4BQQA 1KDTA 3LHSA 4NYJQ 4H7HA 1UBSB 2D1QA 4BGIA 4C0LA 3NDBB 3E9QA 1DAKA 3NYIA 4O6VA 1UBRS 3I6ZA 1EFVA 4WZ6A 2EDAA 4MDYA 5F5NA 3SYTA 2DKNA 2YWDA 3H0CA 2B34A 3HY3A 4Q03A 1KVQA 4CMKA 4LF8B 1UDWA 1NX9A 2FWMX 2BAGA 3M6IA 2Z9CA 4CDMA 4EHKA 3U3DA 3UH1A 4YMHA 4ZI7B 1QQAA 2R44A 2YJ4A 3KKOA 3OG9A 1TM2A 3L1HA 1N3IA 4JP2A 2CXRA 1AQUA 3BMNB 5IBPA 1OYWA 3EBPA 4JUAA 1OIVA 1YL7A 2FFJA 2JGJA 2P8JA 3HC7A 4MUAA 5IVHA 4IUDS 4AKIA 2EX0A 3L0SA 3ECCA 2WWRA 2X0FA 4NCNA 2CJYA 5HKAA 5HA5A 1W1IA 4OXKA 3NV9A 5KHOC 5K8JB 4NONA 5HILA 2BM0A 3VUFA 4ETWA 4GVLA 3DNMA 3K30A 5T8KA 2RHRA 5A04A 5DHFA 2HWWA 4LAFA 1RYEA 2BYTA 2BFBA 2PX6A 3H0EA 3O74A 3TUZC 2HYDA 1XA0A 3HB5X 2CXUA 1NNI1 1I4EB 1XDSA 3DFUA 3ZCPA 2CDRA 4EYEA 3MRVA 4GYWA 3EGIA 4K40A 3G49A 1T4CB 3SSMA 4GOXA 2YY5A 5JPCA 3AM1A 2E4AA 1KEWA 3P5BA 3QW2A 2R3SA 1Y9DA 4L8VA 4QRHA 1U31A 4UTZA 1NVTA 2QT0A 3V7FA 4CEHA 5KOIA 1TEXA 3FOZA 1ZLXA 4M9QA 1AQYA 2IUSA 3DE5X 3PNYA 1KAMA 2AN4A 3JQAD 5KREA 1YZKA 1C0EA 3IAM1 4CMIB 1OPRA 3NC1C 4JENA 4DOMA 5IX8A 2EW1A 1NNSA 5BN1A 1C9YA 4JHLA 1L5QA 3W6PA 4BNGA 2FZVA 1M5RA 3VHQA 3O1IC 3IKMB 4LOKA 4F6RA 3SJBA 1IN6A 5GONB 3ROXA 4EB8A 5JAHA 5AD1A 3PQ7A 3TNLA 5ISMA 1EFPB 2JA1A 3Q8WA 2F90A 4N76A 3EVFA 3FW1A 2NUAB 3HJTA 4E15A 4O4JF 1AGNA 4HPWA 2GEBA 4JT8A 4NJOA 3RBVA 3CO5A 2D2EA 1D6JA 3VPBA 1U2SA 1KETA 1NM5A 1RYNA 4KQWA 4NFHA 2DHEA 5AVOA 5CDFE 3FKQA 4B3FX 3OD5A 1NVVR 3N0TA 3SF8A 4I50B 1GA1A 4G65A 1J8VA 5JWOA 3JY6A 10MHA 2AG8A 4KHZA 4BCDA 1BVHA 1Y7HA 3BEDA 1KQOA 3NC4A 4KXXA 1SKQA 3VU0A 5FL7A 1M72A 3GDHA 3N5KA 4RDIA 1XHFA 2ZI5A 4MYTA 4EG1A 5JWRA 1ZXBA 4XX1A 3ZCSA 1GNPA 4EPVA 1ZU5A 2E82A 3SR4A 3F2IA 3QW4B 1ZZEA 3PNLA 3T3GA 1GL3A 4I8DA 1LPNA 1JW9B 3DMTC 3N3AC 2OY0A 2ZRDA 3ANMA 2OXTA 4D8YA 3FF1A 4S3MA 3T1OA 2QL6A 2JLXA 4PYRA 2HA5A 3CEMA 3AUSA 2CD7A 3HI4A 4YUWA 2F43A 2M1ZA 2I9KA 3QU5A 4V2IA 3ADOA 3H4IA 1VJ1A 5BW8A 4ZT6A 1W35A 3VR2D 1DINA 1PUIA 1J00A 1U8UA 4IGKA 3VM6A 2G25A 2RH9B 2W2MA 6CHYA 2QVXX 5EMHA 2ON6A 3PCXA 5EG5A 4MVJP 5KNCH 5JWHA 2QJTA 3NNDA 4ZQCB 4C9BA 5I3ZA 2WSSA 2P6MA 4GR4A 1WNTA 1R7RA 4FT2A 1Z2OX 2HSGA 1BMFA 1KDPA 3AOGA 3U3MA