5DYNA

B. fragilis cysteine protease
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
118
structure length
118
Chain Sequence
VGSRTVLVYMIAQNSLAPLASADIEEMKEGMRQVDATSGNLLVYIDDYSAPRLIRLGKDKKGKVVEETIENYPEQNSADANVMKKVISTAFNQYKAEKYGMVFWSHGEGWIPSPAKTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative peptidase
publication title Activation of Bacteroides fragilis toxin by a novel bacterial protease contributes to anaerobic sepsis in mice.
pubmed doi rcsb
source organism Bacteroides fragilis
total genus 38
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2015-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dynA01
3UWSA 5DYNA 4YECA
chains in the Genus database with same CATH superfamily
1N5RA 3GO4A 2QP3A 1QK5A 2NO9A 4ND8A 4N3GA 4MYHA 1EK1A 3CPEA 4TX1A 1CV2A 4P5DA 3EVCA 1AQ6A 3RRZA 3D8SA 3RSZA 5BMVF 3I5XA 5AXAA 1JJAA 3QWHA 2QU7A 4KDRA 4UUNA 1YR9A 2VAXA 1LX6A 2F1KA 4GICA 3KBBA 4NK4A 3TZHA 3WLEA 3ESBA 4DW8A 3VDNB 3KPJA 1JXMA 4PCUA 2R7KA 5ALXA 4XTCS 4I8XA 4RWEA 1AKTA 1JJ7A 2XKJE 4FS8A 4N0QA 3MFYA 4Q4HA 2JZCA 3V8EA 3AFNA 5C81A 3R9XA 2J9FB 4H27A 2UYOA 4QPZA 2I5PO 3KPWA 2YV3A 4RKYA 3STTA 3TL6A 3V8BA 3OPNA 1VHTA 3UB3A 5I9BA 2PS9A 3AUSA 4JC5A 4TKZA 3QF4B 4YJFA 5T7BA 1FDIA 3FTPA 1RWWA 1QGAA 3RJ9A 2KS6A 2ZPTX 3H3JA 4Z49A 3D3KA 3LCRA 2Z8YA 4NCNA 1L4LA 1GTL1 3AUYA 3NYIA 4NBLA 1IMOA 1DC3A 3DBHA 5E6SA 1CUDA 4RTNA 2RGNA 1JRLA 5AWFC 2SCUB 4TUYA 2QSYA 3QVOA 1R0KA 3X1YA 3JAKA 2VRNA 3CNEA 3N75A 5EL0A 3VVMA 2A7XA 4I6EA 1JPUA 2OLKA 1FXUA 1N3LA 1OLUA 2WIKA 3PB3A 3N53A 2HEIA 4INOA 4R3NA 5D6NA 4CM5A 4IILA 2CXNA 1UBRS 2BOVA 2WTAA 3AVQA 3TR0A 1R5BA 2C4VA 1X7DA 1S9DA 1KQ3A 3DLTA 3O9ZA 1QVVA 3HUEA 3R75A 2VXOA 1QB7A 4DVJA 4DWVA 5H9WA 1KEEA 3U4MA 3FHOA 4PQEA 1MDBA 3KB6A 4MQEB 4RM2A 1U3WA 5EA2A 4PRKA 4UTPA 3KYBA 3PT9A 1WXFA 5G0VA 2XF8A 3ETJA 4KNWA 5B58T 3KOUA 3UATA 1WCV1 1XZGA 2QPOA 2IJGX 2JGFA 1QIMA 1GAEO 2FJ0A 3K0KA 3AF2A 1SVWA 4MUYA 1D2HA 1BMDA 2VDVE 3RSFA 1E3QA 1HLPA 1QIDA 2J45A 4KXFB 4QLAA 3FROA 5HZGA 3K1AA 4PX3A 2GZ1A 3IAXA 3WKCA 1IWPB 2ZAYA 4I4TA 4KO1S 2Z2IA 4MQ5A 2YHBA 3SXJA 1GFIA 2YRXA 2ZIUB 4IO0A 3ILHA 3KTDA 5I7AA 2DVMA 2QYOA 1E5VA 3KUDA 3ORHA 4QRDA 2V3CC 1TL7C 3E48A 1Q12A 1C50A 1IHYA 1WUHS 2VZ9A 2X9QA 3QV1A 4LV8B 5EZYF 3BE6A 4WOPA 1EX6A 2C2MA 4AMGA 1RXWA 3PQFA 1JHXA 3NDPA 1QHYA 2LIPA 3ZE7A 3FN4A 3JYQA 3VAAA 1QAOA 1JQBA 2GDJA 3G3EA 3L7AA 4L74A 1NW5A 3PWKA 3PC3A 4E6PA 1U0JA 3UHOA 2Y1FA 5LU8A 1UM8A 4YI5A 1LDYA 2ID4A 3QIAA 4DIMA 4WXPA 3EDCA 2BCEA 4QQRA 1YJCA 1KAEA 4DY6A 2ZTLA 4F84A 1GNPA 5FTWA 4GGMX 4HWSA 1WB9A 4IKPA 3HJTA 2A9JA 1I3NA 1PJRA 1ZUHA 1YI1A 5JASA 1Q21A 1XQ9A 2R86A 2BLNA 3G7NA 4FHZA 1H9BA 2ODQA 4RZIA 4DE5A 5FV4A 1DZ3A 1GNLA 3B70A 4MV8A 1QV6A 3CG0A 3VGJA 1COWA 1OFGA 2VTEA 2Y4OA 5B12A 1Q14A 3NKVA 4GF5A 3SX2A 1CLEA 1YCGA 3WWOA 1JHPA 3ZGOA 1SCQA 1AKMA 3DE0X 1VJ0A 3H0KA 4HLUA 3AM5A 4M89A 1IY8A 2I78A 1L4MA 3HB1A 1O54A 3Q3GE 4FHEA 3RBVA 3R9IA 2YJTD 4F93B 2B8WA 3BZUA 4QICA 4DNPA 4F1KA 3E7PA 1RKXA 3GT0A 2WSBA 3FSJX 4L8VA 4PIPA 2IWHA 4URVR 4YV1A 2MJLA 3Q8LA 1R6UA 2ZP1A 1M0WA 3G13A 1B8UA 1R64A 3NHLA 4GOMD 1M1NA 4G5OA 1KOFA 3N70A 4NU5A 4CM8B 1N0IA 4EY7A 4IGEA 1O87A 3I28A 3OZBA 4X63A 5AVOA 3AB7A 3KHTA 4XQEA 2IYQA 4XX1A 3G2OA 2QX9A 2GRUA 1WV1A 2Y67A 1SVKA 4LOIA 2DAPA 4Q39A 3T1VA 1G3RA 1J1ZA 2GEUA 3DFUA 3T61A 4ID3A 1SVIA 2BFWA 4DA6A 4KQMA 2X7XA 1U6JA 1ECCA 2EFJA 1ES9A 3CE6A 5C4GB 4A8JC 3GDWA 2W6ZA 4JIGA 5EQFA 2ATVA 3COZA 2ZE5A 4ALNA 4FWTA 3UEOA 4PGMA 2CK3D 5EJIA 1NOIA 4DYVA 3PFIA 3K9LA 5LDHA 4UNQA 2D2EA 4XYLA 5IKPA 1ETHA 2OCIA 1JSRA 4N0PA 5F7ZA 1Z15A 3EK2A 3SOZA 2VO1A 4PAOA 2XQKA 4LXQA 1KYXA 1NV8A 1G3UA 3EBPA 4WD3A 3WLNA 5L3VA 1RVV1 3L18A 2YC2C 4GWGA 1Y8RA 1OTHA 3EEIA 1Z17A 2PYIA 4PC2A 3FYDA 2CB9A 4GIBA 3WSVA 3PXXA 1JQ3A 2VAVA 4HPWA 4HP8A 5F3DA 5HF9A 4LHSA 4C7MA 4V1CI 2OO5C 2QXUA 3P9CA 4OKSA 4RK6A 1BOFA 4BEVA 1GPAA 1CK4A 2IGBA 3H2KA 3HL4A 2P2DA 1KNXA 4ZU3A 5D00A 1VMEA 2PGNA 2JCYA 2OWDA 1C1HA 1VLHA 4OU4A 3GGCA 4MAFA 1JPVA 3CF4A 3FTDA 2GZSA 4MKGA 5EZYB 4DCVA 3V33A 2AN1A 4B3GA 4B87A 1N6NA 3C6YA 1M74A 1Q7TA 3P26A 1WEHA 2DM6A 2GYWA 2XODA 5EGNA 4DDHA 1U28C 2BZSA 4FW9A 4G4SP 3HM9A 2K87A 3CX8A 4JT2A 1KI6B 4HWOA 4YRFA 1STOA 4ZVTA 1KZHA 4BVKA 1DKQA 3CUTA 3KDPA 4DR7B 1I4DD 4RL4A 3G0CA 4E03A 1LK0A 1SBZA 2JPDA 1KO5A 1M7BA 1BIFA 4Y2VA 5JFOA 5JQWA 3VR2A 3JQAB 2Z43A 3EMBA 3IIMA 1Y8QA 4NCHA 3PQ8A 1Q91A 4B0OA 1I0ZA 4E13A 1P44A 4K86A 1VFPA 1GM5A 4HGPA 5EQTA 7YASA 4KPGA 5C1BA 1Z7GA 2Q7OE 2XH8A 4BKRA 4QBGB 3LYHA 3NBZC 5FWNA 2QUJA 3HNOA 4WEQA 2DG2A 5JD4A 1E3JA 2AWNA 5AI9A 2QKYA 2WFLA 3DWGA 3IAEA 3CO0S 4W63A 4IJQA 2BM0A 4MWDA 1CXZA 4MV5A 3UIEA 4QYTA 2ZYDA 2JFOA 4Y2SA 4KG7A 2EX1A 2IP1A 5IPFA 3KT8A 5LQDA 4TTAA 3F98A 4UU0A 3TTSA 4NY1A 3ZHYA 3PEUA 4ZC1A 4EY5A 2SKCA 2PZ8A 1VGQA 2D1SA 2VDOB 4CKEA 5JJBA 5D3MA 1HMYA 5MFPA 1K9SA 3RGWS 1YR1A 4AWXA 3W1VA 4X3PA 1Z88A 2C2KA 4A26A 4EYSA 5A9RA 5T41A 3JZAA 4BV2A 1RPTA 2IUUA 2D0PB 2J3IA 4YQZA 2ZJ1A 1XZPA 5CP8A 1KVUA 1BJKA 5JSYA 3EHEA 4US1R 3VHXA 5CITA 1S8NA 4DCGA 4F8JA 3O8RA 4P7KA 1IJEA 4PRZA 4Z9AA 1RYYA 1X19A 1GTVA 4JB2A 3MRVA 4ZI3A 1HYGA 5TT0A 3HJFA 2IYPA 3H5AA 1GQSA 4KVFA 2QYTA 3OZUA 4ND4A 4UBLA 3SQNA 4BPRA 1SXQA 3K70B 2XXAB 1Y0BA 3OX1A 4BNWA 1IDN1 5KMGA 2JFYA 4RQTA 1ZBDA 4RY8A 3AEQA 2QN6A 4ZO8A 4DSZA 1YDEA 5CJ2A 3U4AA 2PS3A 1IN6A 2QPAA 1XP8A 1K6IA 2JLSA 4CV3A 3T4EA 3IH5A 4DM4A 4E70A 3HSYA 2NQTA 4MZDA 4MUKA 3URMA 2ZTHA 4OHMA 3N2GA 1U0NA 2I7XA 3MWLA 3KSAC 1J20A 1ONBA 2GAJA 2XB4A 4GWLA 3TW6A 5HJ2A 5KSPA 3F46A 3TX6A 3PWZA 1T0HB 4JLPA 5MN4A 4HNRA 4G5RA 1JLLB 3EH1A 2I6TA 3P9SA 4D44A 4E3ZA 1PDVA 1BO6A 2E6UX 5ICFA 3MJTA 3FZGA 4PSCA 1SXJA 4V0MA 2XJ9A 3NALA 4UXHA 3VJLA 3TBKA 3OCCA 5ALIA 1VPWA 2CFOA 3CJQA 1E79A 3DKVA 2FQXA 4ZANA 1XLWA 2BYTA 3V5NA 4OFWA 5D3KA 4AKTA 1Y9JA 2WUFA 4Y9RA 3RJTA 2PMKA 3QPVA 1YZHA 4FWIB 4BO7A 2D6FA 3H0EA 2V6IA 2VNJA 4RVUA 4UC0A 3W5AA 1WMBA 3I73A 4LDZA 4MWZA 4PLWA 2GJKA 4I3HA 3MWJA 3U3DA 4AJIA 4QYIB 1NI3A 3P9ZA 1SEVA 4B3BA 5KSOA 3DDNA 3JY6A 4D4KA 1D4AA 4U2FA 3QVWA 2QTVB 1QDUA 2B0JA 2B37A 2I65A 2OD2A 2WM2A 5JVDF 4BZWA 4YAIA 1Q0QA 2B1GA 4YCAA 5E4FA 5EPUA 3UQYS 4A1OA 5LWQA 4B73A 5CDYA 1V5IA 2PPLA 3O82A 3MMPA 1PFQA 4TTRA 1QNLA 3DR3A 4Q4CA 3B3QA 1JPJA 1PFWA 3BL5A 1JKIA 5TE9A 5DM70 1CZKA 4YDSA 3U7EB 4CQMB 1VL0A 2GO1A 1I3CA 1JLHA 5F52A 5CA1B 5MN5A 4TYYA 3NTLA 4IKEA 2IXAA 2ZWPA 4FHGA 4TWIA 1C3JA 5CA0A 3Q5EA 1H4SA 4ZO4A 5BOSB 2VHCA 3L4BC 2VJYA 3VPFA 3BTUA 1A0OA 1IFXA 1MOZA 2Q6OA 3AJ8A 4KQEA 4WX2B 1XPJA 3IEUA 2Z09A 4BX9A 3LUCA 2JVIA 1IRXA 1Q2UA 1RABA 3AY0A 4OJMX 4Q21A 1N8NA 2G1AA 4Q9NA 2XA2A 3TLZA 1DQPA 1RLTA 1UEJA 1PUIA 4NYIQ 4YIKA 5HIJA 3RS3A 3SC3A 3ZCSA 4ZO7A 4XWYA 3MA0A 2NACA 1NRIA 1HH4A 3MGGA 5ED0A 1J0CA 4PVCA 3VYVA 1UZNA 4GI1A 3SHVA 3VVCA 4YEDA 5B3JC 5KPDA 1WMFA 2CLIB 1WZNA 2KW5A 1QRSA 1ML4A 2RBGA 4RPGA 1ZXLA 1VKOA 2OXIA 1VI6A 2WJZB 1M2VB 3HS3A 3TSCA 1E8DA 2GD2A 4AP6A 4C22A 1HDOA 1H6AA 1OFVA 1G20A 4LY3A 4D9EA 1XNRB 3SYNA 1A71A 4YMHA 2AQHA 3HJUA 3T5MA 3R3UA 2I6SA 3JVDA 5E9AA 3SBOA 2PZMA 3IEMA 4AY2A 2C5GA 1T35A 1U7WA 3UKJA 3QM1A 5IT4A 1EUYA 2II6A 1SBIA 1TW2A 4KKXB 4ZQCB 4JYMA 1G42A 4BDTA 3W5CA 2EU8A 1G8PA 3GVHA 1Z4NA 4B2YA 3VPCA 2LTAA 5C1OA 4WECA 1GKKA 3WL8A 1PNOA 5IJZA 3C7KA 4QGHA 1X7ZA 2NW6A 2GFQA 3ST7A 3VR4D 2HF2A 4ZI5A 3F5FA 5TARA 3V4OA 1G9SA 3PCXA 1Q3KA 2A5FA 3A2MA 3FPKA 2PD4A 5JJKA 1WD5A 1O9HA 2H1CA 2NXCA 3BGVA 3E9EA 4I5EA 5H4HA 1KZYC 3PRJA 3KQSA 2BKAA 4GBED 3GEBA 4TXLA 4A23A 221PA 5BWMA 3NC4A 1TQHA 3UO8B 4HQ0A 4PLTA 3KTFA 2XUAA 4MR9A 1TVCA 5JZMA 2JFZA 2VP5A 3KQNA 1EVKA 3LHSA 2G09A 3R74A 3OHMA 2N46A 3UMFA 2H52A 4GX0A 4DBVO 3E5RA 3GFOA 1C7IA 2NZYA 1DBQA 2G0TA 4BAZA 3K5HA 1G2IA 4AN1A 2AKYA 4M83A 2G28A 3H2SA 4V2UA 3EXHC 4MB2A 1J9GA 2QLMA 3Q6IA 3ZS8A 3ZWBA 1QUFA 3HEBA 2NV2B 3P9IA 3M6VA 1E9DA 2OAQ1 2ONKA 3CW2A 4FYHA 1KQGA 1QS0B 2GZRA 5DHTA 2P6MA 5EMHA 4C3OB 2N1BA 4D45A 3G85A 4CXMA 2VQSA 4MRMA 5CLLA 5K6AA 4MWBA 2KJQA 4M46A 2CDAA 1P61B 4DA7A 2R00A 3ZWXA 1ZRNA 4G5XA 1KMIY 5CNKA 4BRSA 3SF0A 3M1IA 2JI9A 3HO8A 4IW3B 2XNJA 1BS1A 1Q2XA 3FCAA 5DZSA 1O0CA 3GFTA 2QRUA 1EEXB 3PGA1 4YBRA 4QUGA 1D0SA 4EHAA 2FWJA 2H5LA 3C8DA 3R7WB 1TU4A 4CF6A 3B89A 2P2GA 3T6KA 4GLOA 4UEWA 1F3LA 2ZXEA 1MRSA 1ZK0A 5FPPA 3RHSA 1YRWA 2HA5A 3BM5A 4L3WA 1VCOA 1DUVG 1NYQA 3VH3A 1QIKA 4R5HA 1XQXA 5E6UB 2RG1A 4I81A 4CLEA 4G89A 4A36A 3EASA 5SY6A 1E3IA 1YTUA 4U7GA 2ZSAA 3IBSA 1YB5A 2HN9A 3WK4A 5KTNA 2VPTA 5KOHB 5ETJA 3PTAA 3H42B 1CUZA 3DE2X 1EYZA 3JV7A 3N05A 4J9VA 4RVHA 4LIPD 1FNNA 3WP0A 2WWTA 2ZAMA 4JITA 1G7TA 5CPBA 1W2WB 1IY9A 1P2BA 4IRMA 3DC2A 3EVTA 4NBKA 4PZ0A 5DW3A 3S2ZA 3W05A 5C53B 2E4AA 3TQQA 3TR6A 3GK3A 5KNCA 1M76A 2BAGA 1Q1AA 3LFTA 1W5SA 2EAUA 2NNLD 3COWA 3PYXA 3MVEA 5ALHA 4AROA 4CTKA 2PIAA 3TDKA 1TT5A 4P4SA 4B4UA 3TZLA 5C5EA 1QZTA 1S8AA 5CMLA 3O9VA 4TVKA 5EWJA 4BV3A 3G88A 3DVAA 4UE2A 4G9BA 1C7EA 1Q17A 2E3JA 1HE3A 3VJKA 2C2XA 1A9PA 1G3MA 2J3EA 2REBA 1V7QA 4D4MA 1H42A 1NQAO 4IEFB 4UFNA 1E4EA 1U8FO 2R8YA 5JXHA 3BGDA 4DMKA 2F1RA 4MKZA 4YXWD 4DA8A 5JLJA 1XZQA 3OIGA 4KFTA 1U4SA 5KYGA 5HKKD 1GGVA 1BH2A 3E8XA 5KTOA 1H3EA 1M5UA 2PGDA 3ROGA 4JYZA 1SFRA 4DLTA 1JA0A 3G8YA 4I7EA 3VVLA 4OJNA 3N86A 5T5QA 5FL7D 2OB1A 2D7CA 3EIQA 5TRTA 4ZYWA 5DXAA 3MAJA 4GR5A 1JMVA 4FB4A 4X84A 3T7DA 1XPOA 1VKRA 4FSXA 4MVJI 3CUEF 1X42A 2YC4C 4KQFA 4S1OA 2PLFA 1SK9A 3I04A 1CEYA 1K98A 1T3GA 3Q7PA 3WLQA 1OBVA 3W8NA 1Q15A 4B80A 3IBTA 1GPJA 2XOXA 4HRXA 1OC2A 3C7TA 5HA5A 3PEYA 5M2QA 4KJZA 2Q3HA 5BW5A 3OZXA 1EH5A 3DL2A 3LT0A 2JD2A 1ABFA 4EGFA 3HBMA 2C07A 3HLKA 1U8TA 1R8XA 1YMQA 4JJEA 4TWRA 4B33A 4Z4GA 2KWIA 2WMNB 1GPBA 2AKAB 2EWMA 3ZC3A 4KN9S 1WU7A 2J5XA 2GCGA 2GK4A 2O2YA 3HV2A 6REQB 4F2HA 1W87A 2ZQYA 2ZSDA 1TRHA 3EC1A 4LZAA 4YFVA 1JIJA 3F8TA 3AV3A 1R27A 4HDRB 5IW8A 4RYDA 4WXMA 5ALOA 3ABQB 2ZJFA 3I5YA 4EW1A 2P3LA 3AFIA 4PO3X 3WR5A 2D1TA 3FVRA 4ALKA 1QHNA 4G9EA 1TJ5A 1D2RA 4A0GA 1MF7A 3L6UA 5DNUA 4JOSA 3BX1A 1G8GA 4AZWA 5PNTA 3I2HA 4ZN6A 1BOOA 1NL3A 1RJDA 3WKEA 4QAJA 3RS5A 1X7WA 4JQYA 2XUFA 5DYIA 1U7UA 1DI0A 5A9TA 3PJEA 2O59A 2RJ3A 1T3LA 3TM4A 4D0GA 1E6MA 3ASVA 3U7QA 1CJBA 1U9IC 1W5AA 3W5IA 2BI4A 1AQYA 3CJTA 3W5VA 2VHXA 3M6MD 1VHDA 2GXUA 3DMTA 1KOGA 3H4MA 3SP1A 4YIHA 4CG1A 2O2CA 5F9HA 2JVKA 2WUWE 3ZLTA 4EFMA 4MRNA 4I4LA 5TGTA 3U19A 1KOLA 3ELUA 2QEQA 2I99A 1T9KA 3DZFA 4PYKA 1E0SA 4EFKA 5AUNB 3GLVA 4KR7A 2BKVA 4GMFA 3V55A 4UEJA 1EEHA 2AMYA 2WHXA 1CB7A 3CY6A 4PZZA 1NVVQ 5EIWA 5CH8A 5FKJA 2V9ZA 3ICCA 3E81A 1GNSA 3KSDO 2Y0DA 1R7RA 3ZVLA 5L8VA 3RT9A 4X1IA 3L8MA 3INGA 2JLZA 4M8LA 3IVAA 5DT2A 1JWLA 4OP2A 5HJ5A 1V35A 1VRWA 1BE0A 1U0GA 2R1VB 5EXEA 5EHGA 1QOPB 2HK9A 1W49A 3G17A 1IC6A 4XARA 1T4DA 3IXLA 4QPNA 1CQIA 3FVVA 1ZSYA 4S24A 2Y71A 1PLJA 3C7AA 4M1ZA 3DC7A 4Q66C 2OSVA 2V7BA 3EOZA 4WI1A 5JD6A 5L7TA 4YMWA 3S8YA 2UZ0A 1V4BA 2B2XA 3FDJA 4MCIA 2PJZA 3AHDA 3P9NA 4O4HF 4XR9A 4Z0NA 3ZX5A 3H9QA 4CVNA 4ESHA 1CPYA 1PZGA 3ZE1B 2BEWA 4GLBA 3DWIA 1UFOA 3LAWA 2BCJQ 4QDJA 4XR4A 2XCOA 4HJRA 1WDLA 4LXTA 2JLQA 3KFLA 4N0DA 2DY1A 4PPYA 5AVVA 5K8TA 1Z4QA 5CCBA 1QE3A 5IG2A 3IMKA 4LHXA 2CBZA 3BC1A 5BN3A 4O4JA 3B60A 4I4IA 1O1YA 3H97A 3IOYA 4D43A 5B30A 4WMLA 3EBOA 1JYEA 2GB4A 4JYBA 1C0EA 3QG5A 2D59A 4JJIA 4M1MA 3TAUA 5A2GA 1J00A 4DCNA 5CVCA 1ESZA 1M8PA 3VKHA 4OGKA 3LHKA 4J03A 5I9IA 4L95C 1TQDA 1RJGA 3AVPA 1HE1C 2W9XA 2Q0XA 2FFRA 3BAZA 3EJ6A 3IE2A 1SCUA 3P9XA 5AJUA 3I09A 5F7OA 3L5KA 3RAPR 4IV8A 4YX9A 4CKWA 3EB9A 2GTIA 2V74B 4HL6A 1A9ZA 1ZH4A 1T2EA 1I33A 3EXFB 4JLNA 4OH1A 4PHGA 4UTZA 4WOJA 6Q21A 5JJ5A 3RYFA 1XVLA 4LRSB 4QVIA 2ID8A 4XD7A 3W2EA 2EOAA 4P7GA 4J49A 4JJZA 4GKJB 3OD1A 3HYCA 1JILA 4IGAA 1ZD8A 4M0CA 2YS6A 2YZ2A 4PYLA 1TF7A 4TS1A 4KLAA 4REQB 1PR9A 3ONEA 4F12A 2G7ZA 3EODA 2C57A 3OPYA 3WGKA 4FCVA 1U63A 3FPAA 3C1OA 1ZOIA 2QRVA 4XUDA 4EWLA 4A6EA 3IGFA 1EUCA 2V54A 4AUNA 4RWZA 1F8UA 3SR4A 3UXEA 3V00A 4J1NA 1PTJA 5FJJA 4AZSA 4E94A 1WLSA 1WDKA 3BGSA 1T29A 1P9OA 1Y4AE 1RWPA 2H2FA 4I50B 2ZANA 5HQJA 2DPMA 1TMYA 1NF8A 3EGWA 2ZPAA 5EKDA 3LECA 3BRWA 4UVGA 1F9EA 1S3GA 4MI6A 5FTLA 5JG7A 5KNBD 3KSRA 4YRKA 2DECA 4KL8S 4Q18A 4BGVA 3AVTA 2I7TA 4I1SA 4DIUA 5KTKA 1QOQB 3BGWA 4M3NA 1KVSA 2BGNA 4FOOA 2IYVA 2PDAA 2Q3CA 3E27A 2CNKA 4MLZA 2BSXA 2LUOA 2W2LD 1NYLA 4PPFA 3OCZA 3GVXA 3ZW8A 4DUYB 1A96A 3F5SA 3GUYA 4NV3A 3EXEB 1QP4A 1IOZA 1NKSA 3TL3A 4EEZA 1TU0A 1V1MA 2X0IA 3HV0A 4OB7A 3SR3A 3HBJA 2V7XA 2YWCA 3K0BA 4J3JA 3QBTA 5GWXA 2JJ2D 3R3YA 4LY6A 5HRCA 1NMSA 3A9VA 3UJPA 1KVTA 4CHTA 3RUDA 4RD1A 3FTFA 4TYWA 5GVRA 2EJBA 4NFHA 4J6FA 3RHTA 3DD5A 1V11B 1Y63A 4KTTE 1JKJB 5B2FA 4ND3A 3WZ2A 3H8VA 4RKRA 3LVRE 1KWKA 4ARIA 3IT1A 5KTYA 1T34A 2I2AA 1UJ6A 3GWZA 4U6SA 2F59A 5DFAA 1FYXA 2DHEA 1O5IA 2WDZA 5KWSA 5JDIC 3V1KA 3AONB 4OHPA 4NXMB 1XVAA 2YMQA 5JMOA 5AESA 2D2XA 2FZKA 3ENZA 4ROTA 3WYCA 4B40A 2DHRA 2QX6A 5T4HA 3DMGA 3NM6B 3CYFA 3QVJA 4TUYF 4JSRA 1XYGA 4ZJYA 4XIYA 4JP1A 2C4UA 4YMUA 4RTSA 5T57A 1PV4A 1M0TA 4PRYA 5JNLA 1IG3A 2HOQA 4HGZA 2G76A 4ZEXA 3UB4A 3UAZA 2ATXA 3PLAE 4ZHQB 4R1QA 1ZC3A 1XVTA 1D2NA 1P4SA 1HZJA 4P4UA 3GP5A 4TV9B 2NPIA 3RU7A 4BVAA 3L01A 4ZCSA 1SB8A 1ADCA 2BCGY 2P4SA 5CXQA 3QEMB 1XA3A 2A58A 1N5JA 5KVCA 1N5IA 4Y9TA 3AHJA 1GGMA 3OLXA 2QLJA 4H77A 4RQAA 1FUUA 3CMMA 3ED5A 4MCAA 3PUHA 5CUQA 1NURA 3FWYA 4G0QA 4YCSA 3BF7A 5IYZB 3VYRB 4J7CA 3T99A 4ND6A 3W3AH 1Q1BA 2ZSJA 4Y2JA 1WLYA 4LZZA 4X3OA 2M6RA 4LVOA 3IBYA 2JGNA 2PLRA 2VL7A 4RAQA 5D7NA 3REOA 4ER7A 2Y0PA 5MHTA 1GPDG 3I4FA 4K6MA 2EP5A 2BMVA 4W6QA 3HI6A 3OZRA 1TIKA 4TMFA 1WZUA 5A6SB 5BY2A 1APBA 3FUTA 3INRA 5DW0A 2ZROA 4EG7A 1QM5A 2AV6A 3Q15C 4RELA 4ZT7A 4I4TF 1Z6XA 4LF5B 4HNHA 4KR3A 3UICA 1WHTB 3NHKA 5JFTA 1GTZA 3UBTA 1GUAA 4NCIA 1HDGO 3QRWA 4F4FA 2ZBVA 2A1TS 4JDUA 1AS3A 4DJJA 3SVTA 4WJZA 2AXQA 3RARA 3B7PA 3KYDA 1CETA 5B5SA 4K6CA 1J0DA 3AHGA 3OOHA 2VP6A 5B1EA 1ECJA 4X1KA 4DPLA 5BRAA 5LOVB 4DLXA 1PS0A 4BNYA 4V1CB 5H8WA 1NG9A 4A2QA 3PXCX 3KJXA 4X7BA 4ZMBA 3K73O 4YH1A 3H84A 4BWYA 4CEJA 4LC1A 4R54A 4C0XA 3D8BA 4G84A 4HB2A 4DARA 1TAUA 1SOUA 4BQOA 2ZYHA 4INJA 2CJXA 3H2HA 2DCUA 3UFXA 3HB0A 4I9HA 3N39C 4G26A 4TS9A 3G1TA 5EESA 2G83A 4ZOQI 4H4DA 5ECDA 3LFHA 2VTBB 1U3DA 2W37A 3L7JA 2VNKA 5ES3A 3MTQA 4D0RA 4JR1A 5M29A 2X3UA 1FMFA 2FPMA 2OESA 4QJBA 3IHTA 1CZHA 4MUIA 1I36A 4L15A 1VI5A 2WHRA 4QUAA 3FUCA 1KEZA 1ZJWA 2A92A 2UXBB 2YVQA 2O0LA 3Q9UA 5L6LB 2DLNA 4U1RA 1ZK2A 3BSSA 5C8YB 2W6JA 3L4SO 3FYUC 1QU2A 2I4OA 1KEKA 1S01A 3I30X 2XAAA 3MUNA 1HNXB 3S2EA 3W9YA 4B0PA 1QDEA 4Z6KA 4M8KA 4S1WA 3QUCA 4FUQA 1N75A 1YE5A 1T36B 1REQA 3STWA 1AA6A 2GPJA 2JLXA 1RAGA 1R3UA 1U8EA 1XA4A 4ZEVA 4LDNA 3K9BA 3ADDA 5KU1A 3UUWA 3PE6A 3D5EA 4XVUA 1H05A 1AGXA 3OIVA 4QHSA 3UOAB 1AUQA 1Z3CA 4TUYB 3VAYA 5KVAA 4LPKA 5JHGB 3HKCA 4QHTA 5JMPA 2AG0A 5DPMA 4HFJA 4AS1A 3NBQA 3ZNPA 1GEEA 5G4LA 5F64A 2E21A 3QQPA 1Y6GA 5I9TA 4KFUA 3WLJA 3VA7A 3Q7QA 5IN4A 2Q6LA 1JZSA 5A1JA 1X2BA 4IIGA 4LTNA 3FI0A 3U16A 4DV0B 1QKIA 2FPIA 2H2AA 2JA1A 3DBRB 3DM9B 4MUJA 3FGOA 1YJXA 2ECKA 2CY0A 1QFZA 5FR1A 2ZBQA 4MUNA 2P9EA 4A8JB 1JEAA 2HA7A 1L6RA 2E4VA 3E7FA 3KVVA 4DMMA 1G5PA 2WJAA 5ALQA 4LXXA 1AC5A 3F49S 1IXZA 3I1FA 2H9AA 3QHQA 1TU3A 4C0BA 4I46A 4E5UA 1KGDA 1ZN2A 5EUQB 2FEAA 4GZMA 2VQFB 3S5JA 5LMUB 1PEYA 4Y9DA 1Y5LA 2R6GA 4QIHA 1QC5B 3ILVA 1ABEA 1N7GA 3PEFA 3ESRA 5FJIA 5BW4A 4AG6A 4JH0A 4HQLA 2GRJA 5COBA 3PNLA 1OHHA 1NI5A 5E95A 4RLQA 3GEEA 3Q1LA 4AYTA 4GOKA 4WY5A 2NOAA 2QN8A 3QKIA 5EKTA 2TMDA 4KIJA 3EWSA 5GV7A 1OIXA 1TADA 3CZ5A 1YZYA 3GRFA 4RUKA 4DSUA 4E2XA 4YP9A 2QUIA 4U7TB 3ILXA 1H4TA 2CDNA 2XNKA 5FBHA 4X7PA 3ZH9B 2QUHA 1X38A 3MWFA 3RQSA 4Q4JA 3OQPA 2QSUA 3I1YA 4P92A 1MENA 1TLLA 2E85A 1ZXXA 1K3TA 2PSDA 3LHIA 5HW0A 4GPZA 2HBZA 4L22A 4GEKA 3PIRA 3IUMA 3USES 4J3FA 3LC1O 4MULA 3ZTYA 2VP3A 3DTVD 2L0XA 4CW7A 3SS8A 5DB4A 2X0EA 2GEDA 3NUZA 1SC1A 1NUQA 4EHFA 4GLFA 4P80A 1PJ4A 2VDLB 4YJGA 3ENQA 2X2OA 1I4WA 4FWBA 4EFLA 3CEJA 2WA1A 2CF6A 4NF2A 4K9MA 1OKKD 5AICA 2PUEA 2B6HA 1D8AA 3QA9A 3GWGA 4NR0A 4ZDKA 1HE8B 1T5HX 5DHSA 1WUIS 1C3LA 4G63A 3HJRA 2DR0A 1AM4D 3MEQA 1ONPA 2ISSD 4GOLD 5EMLA 3PNPA 2HUNA 4RKEA 1C9KA 1N77A 1F20A 2IIPA 4RF3A 2CCJA 2XMSA 2FN4A 3B3GA 4KZPA 1P39A 3D1LA 3HKEB 3PHCA 4HLDA 4Y67A 5J5AA 4ZIRB 1GPYA 2VYVA 1I1OA 1WHSA 3KTOA 3A4YA 1CY1A 4P22A 4ZOCA 5HX7A 3QFRA 1E3WA 4BFUA 3PQ2A 2QD5A 3SC2B 4X9XA 1IHOA 1F8FA 3GY0A 2AEFA 4IDPA 2EJWA 2ZYUX 2L82A 1QVWA 3E2IA 4DUGA 1A82A 1BRMA 3LA6A 1C4OA 1XQYA 4LOJA 1DAKA 1P0FA 1WDWB 1QJ4A 3E0XA 4HY3A 4B6FA 3S2GA 3ZU3A 3CVWA 3HEMA 3OM0A 2OZLB 3D3EA 4NYIR 3IDAA 1EFAA 1EWVA 2FWRA 3I0MA 4NJEA 3DQQA 2HXSA 3UK7A 3MF4A 3JU3A 4Q16A 3RIXA 1N1DA 1W94A 1F3OA 2IE0A 2LNDA 2QMYA 3PXAA 4KYUA 4EGJA 1UXKA 4EGCB 4HC4A 2QZJA 4G85A 4M7OA 4NU6A 3WGZA 1M1ZA 1O9BA 2H16A 3OAAD 3Q9SA 4LUCA 5CW2A 1ZINA 3TI9A 3V4VB 2O5EA 4ETNA 4DUZB 5CCDA 4LOLA 2YWFA 4QOEA 1Z37A 2C78A 1K4YA 1SGWA 4HXYA 4TT3A 3VPSA 1KMMA 2BFCA 2O0MA 2G1UA 4RTLA 1CULC 1V41E 1D8TA 2ILVA 2WTXA 2CE2X 3NJRA 2CZGA 3CONA 4GMXA 5AJYA 4BLVA 4RDXA 2QM7A 2FB9A 1TYZA 2NN3C 3LKDA 4DR3B 4C4AA 1DXQA 1NRXA 1ESEA 3Q3JB 3FWHA 4DIKA 1XZNA 3MJSA 4E1BA 3A4IA 4RHTA 5J47A 2GUWA 4OHWA 4GUDA 2ZDHA 3KKEA 1CBUA 1QPGA 2D1QA 4I2VA 2ISQA 3DMNA 2VZEA 4K9SA 2ZUTA 3VU8A 1GKLA 2OGTA 3DB2A 4W9NC 1J5PA 5DM1A 1YDHA 1ZAKA 2ZJ3A 4A4DA 4LECA 2M98A 3PI6A 1E6EA 1RE1A 4DILA 4I4NA 3QKUA 3C7DB 3S40A 3GYBA 4I6JA 5KEIA 4ARCA 2HQOA 1UXHA 4KR6A 3NHFA 2RSLA 1IHUA 2XOKD 3AKEA 1VMKA 3DF9A 2FPLA 5BWCA 2H4JA 4B2PA 3SHWA 3NIWA 2XA9A 2VLIA 4FJ1A 4X8LA 2IDZA 3CW8X 5E1BA 2G17A 3TLGB 3WZMA 2PH5A 3I05A 2MSWA 5EUMA 3GOHA 4R41A 2CLMB 3MXOA 1W0CA 5DTRA 3TIGA 2E5LB 1HXHA 2HLDD 4XYMA 3EXG2 1GSIA 2J9GA 3QLVA 4F4HA 1EGMB 1F51E 1GYPA 3KZOA 3O4GA 1L5YA 1V8ZA 1GQQA 3OOEA 3RK0A 3IP3A 3WRYA 3OQIB 4JXJA 1YV9A 1MXHA 2ZJOA 5ALTA 4CWAA 3NCHA 5LA6B 1XEWX 1YGPA 1B1AA 2N3ZA 3A6FA 4DCCA 1PGPA 4FFLA 5CYOA 1AQUA 3UWMA 3F6EX 3DHYA 5DI3B 1R5NA 2H1LA 1U9ZA 2IOFA 5LP6C 3N2NA 2CJFA 4BYGA 1W36D 3JCZA 3CRVA 3QVKA 3ZEIA 3I9KA 5G1OA 3TCNA 3DT8A 3VMFA 3EFOB 1TD1A 3M8KA 4CUJA 3AI7A 3H1AA 1MO6A 5KYWA 2Z04A 5FUMA 2OQ2A 3DEJA 3OQ1A 3PEEA 1XR3A 4IH1A 6LDHA 3BSWA 4ZVSA 2MINA 3DUFB 5EIAA 4CKEB 2BTEA 4TRMA 4AXBA 1NJ8A 2J59A 2O6LA 3EJWA 4B83A 2RAFA 1L5SA 1TM2A 4U8GA 4AJ1A 1ML3A 1ISIA 1NNI1 3KTAB 1SG9A 5EJ5A 4K3VA 3HDTA 4ML3A 4AF8A 4BNKA 2XYVA 3NDIA 3OM1A 2ZR0A 5EP1A 4H1VA 1UBFA 3R41A 3ZXYA 1X1CA 3WSTA 1YQTA 4LWPA 2X8AA 3C1TA 3WB2A 3NANA 3RR2A 5J59A 1J07A 1W581 4KQGA 2P91A 4M8NE 4P8RA 1P4AA 2HRZA 2H8KA 3PXUA 1P5HA 3OZCA 3G5LA 4MLDA 3VDQA 3FLEA 1E1CB 4LAFA 2GK7A 4AIIA 1RQ7A 5LNK1 2JAHA 2J7PA 4UW9A 5KZMB 4FHDA 3FHTA 3ISVA 3I8OA 3MTGA 4YRZA 2P35A 4LMRA 1UC8A 1EDDA 4QG7A 3ROPA 3W7AA 1R0ZA 3LJKA 4MS4A 1X39A 4KW7A 2J3JA 5DO9A 2HJHA 1DTSA 2Z57A 1I14A 2OBBA 4JFRA 1ST3A 5E7MA 4RDCA 1N2ZA 2PUJA 5FR2A 3AK4A 4QTXA 4B3MB 1P80A 2MYTA 2VH1A 1BDJA 4HNQA 5KNDD 2V7UA 1SHTX 1O4WA 4GBGA 4MVJH 1KRXA 2QNIA 5B7NA 1MAUA 1CYDA 4DGQA 4NZMA 5AVTA 4DIBA 1FOEB 1S3IA 3C5WP 4FNOA 1YU9A 1LDEA 2ZS9A 3EVGA 1W0KA 1RACA 4XCQA 3DEHA 3DO8A 2IU6A 1A8QA 2JHPA 2BFAA 4JBHA 4EJMA 3I3OA 5HVNA 5B7QA 1F6DA 1S1CA 2HT6A 2IYFA 4D4GA 4AUKA 4H7DA 5LP1A 1I9CA 1XXHA 2YCBA 3ET4A 1B74A 2QGFA 3VSEA 1JFRA 3A1FA 1IJFA 2VATA 1NW6A 2XRFA 3HNRA 1M6NA 3GPBA 1PWZA 1CZLA 3WLKX 2P0YA 4HG2A 5EWLB 1V71A 2J3HA 3K0SA 1OROA 5BVHA 4BCCA 2PKQP 4CMIA 3KOOA 3KLOA 1QIGA 2AJTA 3R8FA 3RBZA 4BX0A 1R88A 3B6JA 4HHEA 3VSCA 1GDTA 2RK4A 2NG1A 4NIMA 2C77A 4XGQA 5EIOA 1N92A 3EXHB 3CEHA 3MRSA 2JD0A 4WNAA 4EHDA 2IS2A 1ISGA 1LC0A 2ATEA 3QP9A 5E7IA 4Q5IA 3G8BA 4Q93A 1Z2OX 1XZCA 3H2YA 4IM7A 3SX0A 5LWHA 4F96A 1BG6A 1AO0A 3LX8A 4FFWA 1KQPA 4WHMA 4LOKA 4QOFA 4ER3A 1GRRA 2UUAB 4DC0A 2XIJA 3O95A 1RCTE 2MMCA 4Y3UA 3F6PA 4DADA 1QK4A 3Q0EA 4TQ9A 5CTAA 4V0SA 1OXUA 3EIWA 3GA5A 4LX8A 1EFKA 4OXXA 4RSRA 4DDMA 2PV7A 1O2DA 4MW0A 2HU5A 4HN4B 1CZNA 2WP8J 4FQ8A 2GBLC 4N3BA 4L8GA 4OLAA 2F4VB 4M54A 4ETWA 3GZNA 2C3UA 3HDQA 4L7VA 3SSNA 3QU7A 5ICMA 3OT5A 2R60A 4TXJA 4O8ZA 2NSDA 3TIIA 1O0SA 3ISJA 2W2MA 1GR0A 1SBCA 4UDOA 4MQ4A 4BVBA 4MW6A 4CMAA 4NZZA 5JPDA 1GITA 4U3JB 4YRNA 1OPRA 2FKAA 2Y1OA 4JU8A 4M1TA 3WLRA 1CKEA 1N0VC 4ZJZA 1T0PA 3B78A 2WU4A 3R3WA 5GJBA 4YRAA 1MA3A 4ZVVA 3KUCA 1THMA 3AC0A 3OLYA 4G5GA 5TGZA 2AR0A 1DAIA 3ZIAD 4D0SA 1QG0A 2FX3A 2NYAA 3LKVA 2CZCA 3HVHA 3JQFA 3PDCA 4PPNA 5AHXA 4R83A 1J8DA 3GLSA 2R3SA 2VC2B 1B8OA 4KO2S 1X15A 1WCYA 1GADO 1TI7A 2B5VA 2NU8B 1XU9A 3R8CA 3O21A 4BLPA 4DWOA 2PJDA 5DVZA 3FOEC 3BMNB 1H6BA 2AL7A 1RQ2A 2WRZA 2JGMA 4EUSA 3AI2A 1TYDE 3OC0A 4YUXA 1IK6A 3DVQX 2Q5OA 2H1FA 3PRKE 3AEKA 1F2VA 5K3DA 1YBHA 1BXRA 5TQJA 4Y7DA 3ZDDA 1Q1GA 1QWSA 4UM7A 3SS9X 5A4MS 4B8ZA 1XGKA 4DCTA 3TX2A 4NBRA 2A9VA 1TCAA 1GTG1 1TD9A 2VRCA 2XZTA 5JEEA 3KL2A 1U3CA 3P27A 1T9AA 2YMLA 2AG8A 1OXVA 2Y9MB 4A2WA 1M6EX 1GXSB 1J97A 1PYDA 3FOWA 3JX9A 2BFDB 1YFKA 2NQ2C 2H9IA 4HNAA 4N0EA 5CVUA 5ALRA 3SGLA 5SICE 1KSGA 1JJBA 2ZYVX 1T9BA 4NMLA 3MAGA 4JS0A 1T1EA 4JT8A 3T7IA 1N5KA 2AFIB 2EZUA 2Q2NA 4KQ2A 3TW8B 4CLRB 1H4QA 1W88B 2DX7A 1HDIA 1HOXA 1SQ0A 4PAQA 4PFJA 3CN7A 4LGYA 4AP9A 4P7JA 1NBMA 3G7UA 3X1DA 2V0NA 3R7NA 4GGOA 4OREX 4IIJA 2QVGA 4EY6A 3U7FB 1TRKA 1B14A 4W1PA 4CT5A 1EFPA 2WHYA 3FNIA 3ZZ0A 3FPCA 4JLDA 1U2DC 2Q4EA 2NV6A 1M7GA 3AERB 4BMVA 3NBYC 1JWBB 5C8ZA 1YXMA 4ZRMA 3IA7A 3KQHA 1RWBA 4HUQA 4I6GA 2VJMB 3QU5A 2BISA 3V4LA 2FOIA 1J9EA 4PF1A 2BFEB 5IJ9B 4MP8A 1FL9A 2HV8A 4OD0A 4RD2A 5JAZA 3I62A 4NL4H 2AQ8A 3BG5A 4HGNA 1RPJA 3QUTA 4GRIA 1XDWA 1Q0ZA 1KA9H 1TAHA 4C76A 4IDQA 3B9BA 5AI8A 2WQZA 4XH9B 3PF9A 3F3MA 4OH7A 5LU9A 1CR2A 4L9SA 1I0IA 3B9QA 1H8EA 4TGLA 1KDZA 4CFSA 3DOIA 3EBLA 4KU4A 1CS0A 1WZIA 2EGUA 4MICA 4JYCA 1Z39A 4GZ5A 4KYVA 3WB1A 3I0NA 3NEPX 4BMDA 2D74A 4YLGA 1E2HA 1LS6A 3D6UA 4AMVA 2VTKA 3MS4A 2PYZA 3CW9A 2Q6VA 1P6QA 3C3PA 3CCBA 3VNBA 1D03A 4NZ9A 3TE7A 5KYYB 4B48A 3HR7A 4BC0A 5IKXA 1QTRA 5E2AA 3ZZUA 4H6XA 5HJEA 5HOQA 4OL0A 4EB6B 2OFFA 2WM9B 1K6XA 4R8SA 4MR8B 4B3TB 1WQ3A 3ZTTA 4HPXB 1KEUA 2XYGA 2ZUFA 1YNSA 4GLJA 4WBXC 2WNHA 4UM8B 2Z4TA 3ZWQA 3PHGA 1AUXA 4TSKA 1SQSA 4L4RA 2YINC 4MKIA 1GYRA 1ILEA 4PSKA 2XUJA 4R8LA 1NOJA 1P4GA 3REGA 1JUDA 2D2VA 5FNVF 3UJAA 3OE7A 2R8RA 4U7DA 3MJ4A 4IJVA 1JHUA 3WV4A 1NJFA 2R6JA 3OJOA 4B8YA 4DY4A 1U0LA 3GL9A 1J0EA 4QDTA 4IO1A 4HTAA 4BWFB 4YT2A 4DYHA 1LUAA 3KO8A 4Y2RA 3ROFA 5FHQA 1OH6A 2EEZA 4W7IA 4YROA 3U4HA 3UMRA 4HAVA 2JEYA 5JAHA 1GVNB 4NYJQ 2H31A 3KT6A 4D9BA 3VR5H 1ISPA 3DUWA 3GH1A 3MIIA 3KZCA 3K9GA 1LRKA 3FB1A 1F2TA 3RS4A 3WGIA 1YA6A 2AE1A 3LFUA 5IH3A 1XVVA 3AMVA 1W4BA 3IQFA 4G2TA 3UWPA 1I4TD 3H9BA 4B6PA 4CMGA 4O0LA 3QGMA 2JLBA 3SU8A 1QH1A 3IXMA 3VV2A 2E4WA 5FBRB 1F1JA 4XM1A 4TLLB 4N48A 4HRVA 1Q19A 3TTYA 5BPHA 2C20A 1EDEA 4WCFC 3C4QA 3ZHCA 3IB3A 4O4JF 3KHKA 3MSCA 2GJ9A 5GGXA 3F3YA 1MO4A 2V3WA 2XXBA 3FNBA 5E6RB 4F60A 4KBFA 3VR6A 2BY4A 4OOFA 1RT9A 3WDSA 5J4VA 5JY1A 1YIAA 2X5JO 3KSMA 5K3FB 1MHTA 1RBQA 1P3JA 1TNDA 3C15C 5DGDA 3ZU5A 2HA2A 4LF8B 3U13A 1EKXA 1T8SA 1OGIA 5J2TA 4FGJA 4KBGA 3UMCA 3N2IA 1VJ5A 1XEXA 4WTOA 1HM5A 2QW0X 1IM5A 5DNVA 2XCSB 2PQ0A 3MPUA 2FZCA 1Y33E 1NNUA 2EX4A 2KQUA 4H6VA 4EG0A 3UJ6A 4IKOA 3JQ7A 3OF3A 2Z1MA 1JFVA 1RP7A 1VHQA 3GAMA 3M81A 4FW8A 4GRAA 5EJ2A 3UK2A 1XRNA 1R4MB 2C7BA 2H85A 3OPXA 1SKUA 3P2YA 4NNJA 3KZMA 5CYGA 3OI7A 1SUCA 4ZP1A 2YRWA 1DHRA 1FDWA 1Z5VA 4AWBA 2VA8A 2ERYA 4JSYA 2D7JA 3NAQA 4B3HA 4EHBA 4X65B 2FPWA 4LQLA 1N5DA 1NX6A 1PGOA 1TCVA 3D6VA 2IK8A 3DNFA 3ZN2A 3IXQA 1OI3A 5I8PA 2QB5A 3KEQA 5ALJA 2O8FA 4ZCPA 1FLAA 4DR6B 2OCYC 1M33A 5IARA 3TSOA 2HHJA 4LZPA 4I1PA 3C3YA 4LNUB 1ADYA 2CHUA 3VTFA 4KIGA 2A0UA 3K2IA 3A9TA 1L7QA 2WDPA 3MPOA 4PAMA 7MHTA 1U6IA 2I87A 3U7QB 1MRNA 3QNUA 3RTEA 1Q5PA 1YVUA 3B5JA 1FNCA 2J32A 1T1IA 3GCZA 4RVDA 4FYKA 5D85A 2JH8A 5B7PA 1KSFX 4H7PA 4DEYA 4L0QA 3T5PA 1K68A 1A4UA 3ECAA 3A7EA 3NYQA 2MWMA 1KC3A 2WWFA 4LXHA 4UUBA 3MWDB 2QI9C 2W6ID 5JSUA 3EVZA 2FQWA 1YQQA 2ABWA 3FDZA 4YT5A 5TDHA 3LF2A 4WK6A 2XB2A 1ICEA 3ITNA 3JXEA 4L73A 5AW2A 1NBAA 4V0QA 1CD5A 4Z99A 5EMMA 1QE0A 1DIGA 4DFDA 1L4BA 4RZUA 3ZD6A 4JJFA 4J7UA 1NLZA 1YHNA 1NE7A 3ODPA 2CVPA 4EUEA 3RUEA 1BVYF 4BBZA 3IQXA 2DTDA 1L5HB 2BBOA 4NMXB 3WMEA 2AEEA 1H9AA 2WY2D 1M2JA 1XAHA 3H1BA 4OLBA 2Q5LA 3IODA 3JYHA 4O25A 5UKDA 2VDWB 5DM4A 1IYZA 4Y7CA 2UUOA 4AZVA 4UMFA 1B6GA 1WMSA 2Z4SA 1PQPA 3C4VA 4CMEC 4EY4A 3N3BC 4QQKA 4B5KA 1C1XA 4QOSA 4S12A 3BREA 4PLHA 1O6FA 3WGYA 1IOVA 5JALA 3BBPA 4AS3A 1J0BA 1GAWA 4C1NA 2PPVA 2ZS8A 3AB3A 5EYPB 1KJJA 1DKLA 2C0QA 1AHPA 1ZJ4A 2JS7A 4Z7JA 3GCDA 2IYNA 4D8YA 2LD4A 2OXEA 3OT1A 5AYVA 2HR1A 2W6QA 3GJYA 3K0HA 3NTVA 3TZEA 4OIMA 4M9SA 3BF8A 1UJBA 3AEUA 4XYEA 2QV7A 4JX8A 4NECA 4TS3A 2VPIA 5C52B 4D97A 2OFWA 3H4VA 1H2YA 1QANA 4K81B 4G0VA 4KB5A 5JANA 2JGRA 4RK1A 3WDLA 3CUVA 3ZLVA 3TLBA 5BPFA 1P29A 2C9DA 1TK2A 3EDMA 3CRQA 4UBIA 2Q0HA 5ALZA 2SKEA 4CCYA 5KDOA 2SBTA 4LGVA 4NDNE 4JOCA 3E9NA 1RC8A 2EBHX 3AX6A 3UGKA 3KR1A 1U0EA 2M1ZA 4Y2HA 5BW8A 4P83A 5KSZA 4UJ3A 3KQKA 4AKSA 2P4EA 1RRMA 1GAJA 2J5RA 1G5IA 2BGKA 3F0TA 4ZTBA 4XAQA 2VJNA 4W5RA 1ISRA 1G7CA 1WVMA 5DT9A 1EUCB 3BJIC 4L8LA 4N8EA 4MI9A 4UDNA 3CVUA 1KMNA 2XZOA 4CKYA 1GA4A 4X66B 5JPIA 3BD9A 2IV2X 4DLBA 1VQ1A 1XCBA 2IHJA 2WWRA 3BMQA 2NUPA 3LLMA 3Q7EA 5F5LA 3ZI7A 1IK4A 1NAHA 4BVEA 4Z1OA 3UAGA 1IAVA 4MR7A 1A5AB 1JIIA 1YDGA 4GSLA 2G5PA 4Q7EA 4J07A 2FFAA 5BYBA 2XWBF 4CEHA 1PHPA 4GKAA 2Y92A 4Z8YA 4AYWA 3WQRA 1ZHOA 2TSYB 5JS1A 2QE6A 1SU8A 3H7AA 4IUYA 3VO9A 1E62A 1II8B 2CGEA 1VE6A 1GILA 2FMKA 2FNAA 2QTTA 2QN2A 3DLPX 3K32A 3M6WA 4UPEA 1HZZC 1T8UA 3VNRA 3CUKA 2G5CA 2H4YA 2PXCA 2ZAOA 4QFCA 1UM9A 3IHWA 4BC1A 2AEJA 3KKPA 2IRWA 3PKIA 4BXOA 1UBNA 4I1UA 3TIXB 4LFAB 2ISCA 1E2IA 1SR8A 5LFAA 4I9FA 4BTVA 4GKKB 2PL1A 4OHRA 9ABPA 2B34A 2VNAA 2AQKA 3HRHA 3GZ4A 2J33A 2QLFA 3NHWA 2ONJA 5YASA 1JQDA 4HN2A 1E8NA 4FDTA 3L46A 2A2ZA 1FDVA 3ANNA 4ZVLA 3GJXC 4QWMA 3ODGA 4C1BA 1U1GA 2ATCA 3LPDA 4UBNA 3TGLA 1GGJA 4FEEA 4WK0B 4DA4A 2HPHA 2VIIA 3R09A 5EWMA 3DZGA 1E2BA 2HSDA 2V1UA 2Q2OA 4L6AA 1HEUA 4B47A 4BX2A 3O75A 2IY7A 4NYMQ 1DJQA 2OG1A 3FYUB 1K8QA 2HJWA 2IYLD 3KWJA 4Q1VA 3SQMA 2CJPA 4K6GA 4RANA 3MOSA 1IN1A 5KIAA 2GF0A 2V4MA 2UZ1A 4J8PA 1Q74A 3U0BA 4KMMA 1NYRA 2E48A 1KRWA 3EC2A 2C2OA 3FTCA 1FXSA 4G97A 4JBGA 3V3KA 4JQOA 2Y05A 1YS6A 3HRKA 3ITKA 1ULTA 2WWHA 4ZPJA 1N2HA 3L1HA 4DV2B 3QEBZ 3IQDB 3LSYA 3AR9A 3A70A 4PRLA 1JNXX 3W9SA 4EO4A 3N3AC 3FDIA 2XNDA 4HDNB 4MGEA 3Q5GA 2IT1A 2QUKA 5FCDA 3T94A 2C4NA 2OK7A 5FEMA 1ZRHA 1Y8ZA 3DMFA 2C3YA 2A9QA 3RUHA 1R0WA 2JAWA 2L18A 1Y1RA 4LTMA 1DXOA 1IBRA 2EWWA 2VK8A 2CNNA 4PCAA 1K5GA 2IOQA 2AFHE 1K8ZB 2ES4A 2VKTA 4IJKA 3WIEA 2P2ZA 4X6LA 1KY3A 2FVXA 2WEKA 2Z2ZA 2F2TA 2G71A 4FEGA 2IITA 4MRSA 2JGJA 4BVFA 2QS9A 3N2KA 5TMPA 2O2GA 3P9YA 1UK6A 2NTNA 4NFLA 3KZ1E 3DMPA 2WIFA 3HG7A 2GSDA 4QXMA 1GVHA 3GLHA 5JROA 4B43A 3MERA 2Y1XA 3F2VA 3SVZA 2NZ8A 3BULA 4RLHA 4KLCA 5AKIA 4XXHA 2Z5VA 5TVGA 3WNVA 4RDHA 4YRIA 2Y1LA 3FFBA 4MWOA 4KGDA 1FU4A 1FDUA 3PC6A 4ENTA 4RZXA 4QNMA 2ASVA 2VG8A 1POXA 4ZOAA 1JEDA 3OTIA 3VOTA 1WETA 5JFGA 1QO9A 3BE4A 1C1DA 2EKDA 1SA0B 3AU8A 3G89A 4GE0A 1CEXA 2GAIA 2SECE 1QNFA 3EVBA 3L4EA 3O31A 3P9PA 3QPWA 3NC0C 4LYDA 3GFFA 2GRAA 2WJ4A 4F56A 2C9YA 1FPMA 2Y1CA 4BNDB 3NIGB 4DV5B 4EBFA 1OB5A 1BDIA 2J7KA 3ZWYA 4XDGA 5E1OA 2VT3A 3ZQ4A 1FQWA 2XNSA 3GD7A 1A27A 1U3FA 3AP3A 2A57A 4J3NA 3PUWA 1O0BA 3UANA 3UXYA 2C3PA 3D1JA 3EZNA 4EH1A 4CLXA 1XMOB 5IAKA 1XZEA 3GLFB 1KHTA 1DIRA 4C0AC 2NO0A 5KSWB 5KX5B 1JEQA 5HEKA 3SZRA 2GHRA 2VZLA 3MILA 1K92A 4DCPA 4QU0A 3ACDA 3DE3X 2QLLA 4ABTA 4BMSA 1DX4A 3JQ9A 1HWYA 1JR4A 1IJKA 1UIRA 1XWWA 1U5CA 5FLYA 3DDUA 1R9JA 1TA9A 3X0DA 1J7KA 2J0EA 2YOHA 3Q2OA 4LXYA 4FD2A 2C00A 1K0FA 2QQGA 3JASB 5JJLA 1LPSA 1EG2A 1J70A 1W1IA 3A1WA 3GT4A 2VDPB 3ABZA 3IQZA 1SKQA 4OM8A 4BL5A 1HYQA 1Y7IA 3EYWA 5IXSA 1PJ8A 3GR6A 3OU2A 2K4MA 4IH4A 4OYLA 1ZWLA 1RIIA 4DRZA 1GGKA 3VHLB 3RSCA 5CT4A 1REQB 5I48A 1M1UA 3SEQA 2CNBA 4M55A 1NXWA 5EFOA 1A9RA 4L5JA 3HVRA 2CHGA 3PCRB 1EGHA 5C8DA 1UJ2A 2M9MA 2WUEA 1ZESA 1CR6A 3CG4A 4OL9A 3HBFA 5LVAA 2HIGA 3A7DA 1NBHA 5JXWA 3GLUA 5I7OA 4HYTA 3S81A 2DR2A 3CX4A 4P3PA 1BAPA 2JANA 2Z6QA 2C5FA 1FFYA 1QQTA 4Q12A 2ARKA 3AJAA 2O2EA 1K7XB 2BFMA 1YOVA 1XHFA 1Z4LA 5JTTA 3NZEA 1LVHA 3FKQA 4UAVA 1OMOA 3L43A 4GYJA 2C4HA 5F4ZA 2GARA 2PNJA 3RYCA 1OLSB 2AEMA 4RTOA 3DEAA 4KO4S 1F4PA 5BV7A 1A9XB 4E5MA 4QGFA 5EUBA 1ZUD1 2JH3A 5CLFA 3H87A 2FCAA 1O94A 3R7AA 2OTCA 4RVSA 3IVGA 4UULA 1IHXA 2BFBA 2K7ZA 4KOAA 2D0IA 4UQOA 4MW2A 4I2NA 2B8EA 1RS0A 3VNSA 4BNHA 4XPIA 3KUKA 2Q9BA 1P0CA 2O8NA 3RBAA 3MIZA 4WPGA 3UJ7A 2E6KA 1F4VA 1W4ZA 1QHIA 3IT2A 4JT9A 4F3TA 3RJZA 1FFXA 2I6FA 3IBFA 3T3NA 2Z4RA 1PUXA 4WJKB 4JMLA 4Y0AA 1XOIA 1OLOA 4LVCA 3WV5A 4EA8A 4RNDB 4NG5A 1IY0A 2BSAA 4J43A 5CYFA 5HM8A 2O0JA 4RADA 1ODLA 3QI2A 2B7LA 2XSZA 2AQIA 1WQ4A 1GOTA 2EJCA 3GDOA 1MABA 2OV8A 3KB1A 3QVMA 3ZYCA 3LWZA 2ODAA 3O1LA 3OEED 2TMKA 5IM4A 4EA6A 1SY7A 1Y3IA 5JPCA 5FAKA 1LH0A 1MFPA 2DUUA 3LU1A 1MZVA 1ZNYA 1W1UA 3Q1KA 3ZJVA 2A7QA 4X97A 2P3OA 4ME6A 3BPSA 3NS7A 4KVAA 3CZAA 2CHFA 2R7NA 5TGDA 4TM8A 3NIFB 4XEHA 1J2YA 3RYTC 4DTCA 3NUGA 1Z56C 3A37A 2JJQA 1NUUA 2LXNA 3CR8A 5DYWA 5KKAA 4KV7A 3LL7A 1CDZA 3ID6C 4P4LA 5TY0A 4EECA 4RPKA 1JN0A 4R0MA 2AN4A 4KXVA 3E22A 2WYIA 5BSRA 5DLDA 1A8PA 3RANA 1UKVY 2B82A 4DS3A 2QY6A 3TF5A 3WFJA 1MEJA 1J8YF 2ZDGA 3D5QA 4KGVA 1R10A 5K3EA 3GC6A 1JIXA 3RUCA 3ZCXA 2PMEA 2VCEA 3RVOA 2HQRA 4DR5B 1AG9A 1R0CA 3JALB 2DWOA 4EB0A 1TCBA 4HF7A 2I3ZA 5SY4A 4KR0A 4A82A 5JYBA 3QPCA 3PU6A 1FS6A 1MO3A 2HJSA 5LMNB 3HR8A 1FFEA 1GPKA 4UOEA 3T4PA 1RI4A 4Q4AA 1E4OA 3OA0A 5HNKA 1JEOA 1T25A 3LP8A 4C2UA 5IKMA 2I76A 4ZV4A 2OGSA 4KPYA 2GN0A 4BKMA 1WHSB 1Z4JA 4OHXA 4UU1A 5LP6B 2I1VB 3WQBA 1T6YA 4AJEA 4L1KA 3TCXB 4E5SA 2C8LA 1CR4A 4B44A 3ZPXA 4L7QA 4D56A 4NFYA 4WKNA 4ZZ3A 3R7SA 4AICA 2ILTA 3I0ZA 3LBNA 2W00A 4Q3LA 4G8JA 2FRDC 1R8SA 4RLFA 4K2HA 3P9RA 4L75A 5CLJA 5JWRA 3EGEA 3B1YA 1SJ9A 3KQMA 2JBWA 3EZLA 4LYGA 1E9SA 3QVLA 5EPEA 1VMIA 3GHYA 4P33A 1RZRA 2JFVA 4XX0B 1F6WA 1GGFA 1LW6E 3RUPA 3ZVNA 1YJAA 4U7HA 5GY7A 2WR8A 1WTAA 3ASYA 3M2TA 4FEYA 5ALMA 4OA8A 3IVRA 1YNOA 2B36A 2XTNA 3FWPA 2WINI 3C6QA 1O96A 1LZKA 3CRZA 1MOPA 3OH8A 4PNZA 3D7RA 1UWVA 5GMOA 4GZ6A 4LRXA 5ALSA 2AYXA 1XLTA 1EESA 4LRQA 1V45E 2G07A 2J0SA 4XUEA 3D7NA 1F6BA 2C5HA 1JQJC 2OCXA 3VR4H 4ETIA 2X1VA 5A5DA 3SF8A 2CT8A 4L8FA 3MINB 2A9RA 4O4LA 4CKBB 3L1KA 3AFMA 3U44B 2CV2A 2RHBA 2VF5X 1ACMA 4JLJA 2PZLA 3NBFA 2V97A 4ZRNA 4DC9A 2YL2A 2O48X 1U1DA 3AW9A 3GV0A 1Z5UA 5FFNA 5LKAA 4NOJA 3VI3B 5CFMA 2VVTA 2NVBA 1UMBA 4H7IA 3TQRA 3L7IA 1PG2A 5C46F 1E5LA 3GAAA 1X1SA 5FI5A 3FNRA 3DLHA 1EJ6A 1XDBA 2V7QD 5P8WA 1XEAA 1C8BA 1ZN9A 2J0UB 1YFJA 3HADA 4GZLA 3VDMA 4BLWA 3SXUB 1EGAA 1YCDA 1P31A 4Q7KA 1RJWA 1LI5A 2GPSA 4YALA 2VAMA 3UNXA 3PDJA 1X13A 1FQOA 1OWNA 1V96A 1TTHA 1E98A 2WWIA 4K03A 1E1RA 4RZSA 3AJRA 4CUZA 1TZCA 1DG3A 3VUEA 2H2HA 3TRKA 1WCIB 4UHCA 5L4NA 2HCFA 3JPYA 1RMTA 2G7MC 3H5OA 4WOKA 1NM5C 2UXDB 1PKEA 1KY5A 4CFYA 5C1DA 1FJHA 1BFUA 4JC4A 4GL2A 3A6KA 3LPCA 4JB0A 4R5MA 3X1ZA 1NW9B 2AOTB 4BVHA 5K0SA 3SVLA 1A3CA 4ENRA 1FTYA 1VBFA 1UBCA 1W35A 2WWGA 2ID9A 4LC9A 1D6SA 1ZO8A 2FR1A 3RE1A 3QE2A 4IS3A 4BN4A 1XYVA 4A8TA 5JNWA 2C58A 4ON9A 1BEEA 4CI9A 3EVDA 1VXOA 4KC0A 2Q2WA 1UXOA 1N9GA 3C3JA 5J2UB 3BQ9A 4S05A 1R50A 1GRCA 4DAEA 1B4DA 2NNWB 3BWXA 2A5DA 2I7DA 4PCLA 2UXCB 2ACVA 5BMOA 4HSEA 1AD2A 1NULA 1OFUA 2D1RA 5AI0A 4CIVA 1T4BA 3LBYA 5BR7A 1QQAA 1E8MA 4OXNA 1WAMA 2W48A 4NCKA 1ILWA 2CVFA 4L0MA 4OQMA 3VOBA 5LYJF 2DCMA 3HSKA 5HG0A 4MAAA 5KNCH 1XNGA 1LLDA 4CJXA 1FDTA 1FBTA 2X4LA 1MT0A 2MINB 2PWZA 4UHEA 1WB6A 4NDZA 4ED9A 3TQIA 5K0EA 1R5JA 2GXSA 1BHJA 2OC9A 3EGXB 3MCAA 3FYHA 4I55A 4PZUA 5JCJD 3GIDA 4DLAA 4F3NA 4H1UA 2WG0A 4MGKR 3K1YA 3TVYA 2PS0A 3FYTA 1OFTA 4IJMA 1KOJA 1TC1A 3QQ5A 2FI1A 2BZ0A 4OI4A 3S1LA 3OPQA 3CUUA 2INGX 5FPQA 2DT5A 5HTOA 2B2NA 1U5AA 3GJTA 5IMBA 4QOIA 2QLTA 1LPAB 1BMTA 2POQX 1IXYA 1LVUA 2WIBA 2XV1A 3AUKA 3Q6MA 4DHEA 3QVSA 3ZCPA 5BSVA 1MQAA 3CKLA 3EWAA 4BATA 3ER9A 4RPLA 2NZUG 3T52A 2QNRA 1W85B 3SQLA 2HA0A 2Q5JA 3GT7A 4YP6A 3BL6A 1E0JA 1PZFA 2Q45A 4QFMA 1B16A 4KRFA 5AM0A 4DBLE 2WLTA 5KI6A 3TB6A 1UOOA 2OCKA 1YQXA 5BNWA 2BR5A 2QR5A 2YVUA 3TYXA 1X0XA 1DJNA 1T3SA 1ZK4A 4R0VA 4BLTA 4EHNA 1ZHHA 4A2CA 2ERXA 2FP4A 4PPGA 4OI0A 1MG0A 1D9ZA 2TECE 5IH7A 2I4NA 3GT3A 2XCLA 1QHHA 3IMEA 2ACWA 3C5HA 3CZMA 5TC4A 3WWEA 1R3DA 1SD5A 2UYGA 4NSNA 4CM4A 2ZU0C 2WJVA 2B21A 1P2TA 2WJYA 3NI2A 2O7NA 3ZWCA 5K8LA 3GP8A 2AZXA 1ZHFA 4PHHA 4DLLA 1ENYA 1MAAA 3MWKA 4IX9A 4ACBA 4BMCA 3ASUA 2JIDA 3DOOA 2Z9DA 4NOMA 1KSJA 3AR7A 3EARA 3LBIA 4ES6A 5CB0A 5CB4A 3TTUA 4BFTA 1VGRA 2ZZKA 4Q1AA 3JQQA 3UK0A 5DBEX 3O90A 1JGTA 3VTAA 1PJSA 1Y1SA 1L5KA 2AG5A 1NZFA 3MUEA 3AVWA 16PKA 4L9RA 1EFDN 1VXRA 2I6UA 3COSA 4EDHA 5HKOA 2Q0SA 1G3QA 1M8GA 4N03A 4QSHA 4PSVA 2BI8A 4B3FX 5JMTA 1VP3A 2V7PA 2VNSA 3EAFA 1GHTA 2CBXA 2QP9X 2O2SA 3UAXA 5B57C 1V2HE 2G8LA 2JCXA 2XUKA 4IIJF 1G8AA 3QA3E 4TMWA 4XOIA 3K72B 3TPZA 2DFDA 3G0IA 2J6HA 3LCMA 3PPYA 5BVHB 3JRNA 5D3ZA 3D6HA 3DWEX 2H07A 4YMSA 4R40A 1JB1A 1GJRA 5EGSA 4AJHA 1GEGA 4RA6A 4YRJA 2WSIA 4A16A 5I3CA 3W5SA 4A10A 1MZPA 4FFOA 3Q88A 5M5BA 1FBNA 3FGZA 3B1WA 2ZWAA 2NU9A 1VL8A 3C3CA 4QBIA 5L3QB 3HEAA 1XDZA 2QYSA 4YAWA 2CFIA 2J5KA 1BMFD 1MJGM 2HU2A 1KH1A 3I72A 2IY8A 1KQNA 3OE5A 2WD7A 2FQQA 1XTBA 3WRXA 1CVIA 4OLFA 3PG5A 5D51S 1QWOA 1L4EA 2AC7A 2JDIA 2OLJA 3UPTA 3IE1A 3ZWWA 2O7QA 1U1CA 4CV0A 1GAQA 1H1LB 5LYJB 2Q8PA 5ENVA 4C7OA 2J9ZB 5ADUS 1UDCA 5E3IA 5B2EA 1AHHA 3DZ8A 3L6BA 1I3OA 3EDQA 4LZJA 5I8WA 1AUPA 1PGNA 1LNSA 4YONB 4FD3A 3TUJC 2YASA 3I61A 3EQ7A 1OX4A 3ZOKA 4X0EA 1NE2A 1L4FA 4RJIA 5DMXA 4DEXA 1CQJA 2EDCA 5CT8A 2RONA 1VHWA 1ZJ6A 4PX2A 2AGVA 2XE7A 4AFNA 2PV0A 3JD3A 2I71A 1SZPA 1D1PA 3TPFA 1BEUB 5AM5A 4IIDA 4OSEA 3M33A 4Z9YA 2HDOA 4KITB 3HCDA 3H11B 2VPZA 2HCTA 3C3BA 4MMYB 4XB2A 2X1HA 5FL3A 5GM2A 3VQTA 4EPRA 2ZKLA 3JATA 1K6EA 5AK4A 1GFWA 3KXKA 5A9SB 5J9FA 4KACA 3T7SA 4A9AA 3FLMA 1A4RA 1XZAA 3ZY3A 4M9XA 3RC3A 2DKFA 3BQNB 5CEEA 1Z4MA 3ADOA 3G2MA 1V8FA 2A67A 2F62A 3G49A 3TJZA 3F5DA 2ZUWA 1EM8B 3VYWA 4G0XA 1K86A 3H18A 5EXXA 1J0AA 1PKXA 4OJQA 4QD3A 2QAGA 3BXPA 3UAYA 1NBIA 3QE4A 4DV6B 4FKMA 5J1SB 4TTIA 2YDYA 3L1IA 1JVBA 2R8ZA 4MP6A 3JD4A 4MUEA 1NPTO 3ACCA 3M5PA 3ZY5A 5A4IS 4RMIA 2PNFA 1JEJA 1JI0A 3W7BA 2UAGA 4W82A 4D8WA 1AT1A 2HRCA 2ZXFA 2QQEA 4ITRC 2RHMA 4LHWA 5E0OA 4ZHSA 2YHIB 1PFKA 3OO1A 2I91A 3PYMA 4W5HA 4PIVA 3EZ6A 2EQ5A 2XQFA 3CU5A 3UHPA 1V3QE 2WD8A 1P1HA 3IUBA 4WXEA 3BRQA 3UXHA 3VUFA 2BFFA 4A6DA 5I7SA 1JXOA 1TCCA 2CCKA 4OQLA 2ATIA 5ILQA 2QD4A 1UKAA 1XBTA 1K6JA 2NYVA 5AK6A 2SKDA 4K5QA 4O5OA 2IOHA 4HKTA 4K9RA 3PT5A 4ODIA 1DKNA 4WKCA 2PX2A 4G8CA 4KUEA 4WCFB 2PEYA 5GONB 3S4YA 4DKJA 4KGXA 2EKQA 3LH5A 4GYKA 2VYNA 4X20A 1DEAA 3FH0A 3FGPA 5BSEA 3QIVA 1SG6A 2GN6A 4INPA 5ESWA 3L77A 4I66A 4QZVA 3CT6A 4AY3A 3F71A 3GLRA 5J2TF 4BMXA 3TDMA 3AR2A 1MFZA 2O8BB 3STVA 3RSSA 1GU1A 3EA0A 4RBNA 1XTJA 1QO0A 2HK7A 2OG2A 1UK7A 3AIMA 3IBGA 4Q3KA 3WICA 1U1EA 3WGLA 3E9DA 3PWTA 5EE3A 3ZBTA 3MC1A 1GA1A 2UZIR 3H2GA 3A1SA 3AI3A 3MG9A 3Q0TA 4H2DA 4JXKA 3F4LA 4QXRA 4C0JA 3F4KA 3VKWA 3WGUA 1NTOA 2CSUA 4ARZB 3TSAA 3DFMA 2ZVQX 4WZ6A 1R4NB 1OZAA 2RH4A 3I12A 2QTHA 2AZ4A 1G64A 2BMFA 3H4IA 5BWLA 4GI2A 1BCRB 4IDNA 2D2FA 5KNBH 3ZHBA 4OHOA 8ABPA 1E18A 3DBLA 4YJ3A 2BT4A 3WOHA 4B7ZA 3DJFA 4L2IA 1UODA 4TRNA 4JK3A 3GLIE 1YJ8A 1TA4A 4HXFB 4WRRA 3VZCA 4WUTA 5B6IA 3LUGA 2FFHA 3C6XA 3VYTB 3T9FA 3O03A 4MW9A 3MUOA 3IUPA 3V4ZA 4P9NA 4B35A 4EW6A 1G6Q1 5PGMA 1GTRA 1HX7A 1N7HA 2IYUA 3K92A 4PGHA 2Q1SA 5CLIA 2O1SA 4FOLA 5M34A 2G1JA 5CX1B 5ECYA 1OAOC 4DL9A 2B3DA 3HFGA 1XJWA 5AOAA 2KYRA 1F2DA 4XWAA 3UQZA 3DKPA 4M38A 4XSVA 3V2UA 2H1WA 4NULA 1RQNA 4U7PB 1QGOA 4HAWA 1RAEA 1KL7A 1ONNA 3QEAZ 2XMZA 1DDIA 1B2RA 1S3FA 1U7PA 3E6AA 3HMQA 2XLCA 3BMXA 3BHMA 1X8XA 2GKSA 4HDSB 5FWXB 3TFWA 1T6XA 2GTPA 3DSRA 4KAJA 1CC1S 2H4ZA 2NZWA 3VDXA 3AZOA 5CFNA 4OP1A 2I6QA 4FYJA 4MCJA 4RC9A 2PUHA 3OUZA 4NS4A 2XX3A 1G5QA 2IE8A 3K8ZA 3P2EA 3JS5A 1QLJA 3K1TA 4QJ4A 3WGVA 1TXGA 2VEOA 3ESAA 2WFZA 4GVPA 5HZMA 1URPA 4EJ6A 3R7LA 5KTSA 1RAHA 2IX3A 3KJNA 4O08A 1U0FA 3I4LA 4R1UA 2VXBA 4HAZA 2RCNA 1Q6ZA 1MD9A 4N5HX 4WE3A 1FC0A 5DISB 4JVOA 1H65A 2DY0A 3BB4A 4ZPXA 3E03A 3ZVKA 1T3TA 1FNDA 2OOKA 3EDOA 4YS6A 3WXMA 5LQAA 3OZ7A 2B99A 3GEDA 1DZIA 3O2JA 3SHTA 3KALA 4WESB 4HX5A 1OH5A 1DT3A 2CCGA 4PSDA 4JYPA 1SU4A 3CF2A 4QPJC 2B78A 3K09C 2IDJA 1ZCJA 3CF6R 3FOBA 4HWKA 3RG8A 4I5DA 5FPTA 4MV1A 4AS2A 2QUAA 4C3UA 2BGUA 3N59A 4OGLA 4OK5A 2REXB 2XUDA 2GESA 5L53A 1CRPA 4V3BA 2KM1A 3REQA 2VSXA 1THZA 1NC1A 4JLWA 2R48A 3U39A 2CEAA 2X8BA 3QVTA 3KEFA 1B41A 1E94E 4R2WA 3UK6A 5J2TB 1NN1A 1WR8A 1UOQA 1OBOA 2A4MA 2QN1A 3CKKA 1RC0A 3I9V6 3I01M 3PHBE 3PPXA 4JAVC 4TYNA 2O3TA 2CN1A 4DPMA 2X8JA 5AVKA 1WOYA 3FNFA 1NHWA 4DSNA 4B3IA 3EIHA 1N6KA 4P6VF 2AH5A 2IOYA 1BCSB 1TJ3A 5JQGF 1H5NA 5BV2P 4Y2QA 5K99A 4BO5A 1E1MA 1ADFA 2PUBA 3D3QA 1E92A 3PC4A 3NTRA 4TMZA 5IDVA 3RTCA 4ZZ1A 5ELMA 4FILA 4IOKA 4F4DA 4R84A 1L5RA 2A3RA 3AG6A 1Z6YA 1GRQA 2WTEA 3NBKA 3GJ8A 3ESCA 4YGYA 4BO9A 5D5HA 5I7HA 4C4ZA 5ICEA 1HK7A 4DOMA 1DTWA 3TFOA 3RSGA 1USWA 2QQ0A 1Y3BE 4IIVA 3KLNA 3GPDG 3NASA 1X7XA 5AVZA 2O8DB 4C2AA 3KKMA 5B4TA 3L0DA 4CQLB 2VF7A 3KOYA 1D1TA 3I6ZA 4UHFA 4C7BA 4C20A 2BMWA 2C1ZA 2PQMA 1KU6A 1AB5A 1N7JA 2IVFA 3A27A 1H2WA 1GZUA 3Q9NA 3RYHA 2FSHA 2W2PA 4UDYX 4B4KA 1WJGA 5L4LA 2P0EA 1S4QA 2ECFA 2FUNB 1NBWB 4IMIB 5CRIA 1CEEA 1LD3A 2XYQA 4EX7A 3GH3A 4X44A 2FA9A 5MFZA 4UBJA 4FYXA 4CEIA 1E2KA 2Z8YM 2PG3A 1HQYE 3OM9A 4N5DA 2P3QA 5JCOA 4KLZA 2C3MA 4H60A 1EWRA 3RUFA 4UTRA 4OHFA 5GOTA 2BRUC 4D92A 4UE3S 3KJIA 2QDXA 3N7UA 1SVLA 2O3JA 5DASA 2Q4BA 1DRJA 4DNOA 5EJ6A 5J3JA 1EPUA 4R1LA 2O3UA 1ZD2P 4C2BA 1BYIA 4MUBA 2EVWX 4JI5B 4BVGA 4L6IA 2FEMA 4LRTB 4ZT3A 4HDKA 1XE3A 4DWWA 2GF2A 3V1MA 1Z38A 4ICIA 4RV4A 2QT9A 3O8QA 3RV4A 4UFPA 2I67A 2PZBA 2YNMA 3E5NA 5I7FA 2MSCB 5FQOA 5G0UA 3MTAA 4W5QA 3LOUA 1SELA 4FFRA 2XB8A 5ED4A 5A7GA 1HDCA 2WF5A 4CM7A 2BP7A 4D9NA 1W0JA 1P2VA 2R65A 2H0QA 4NCXA 2Y93A 4AZ3B 4JI8B 4YJKA 1RAIA 3SG0A 5F76A 2ZJBA 5D7BA 3TQFA 1CZUA 4EPWA 2BEVB 3UT5A 4EITA 1X80B 4NBTA 4PGAA 2TYSB 1EK2A 3NWBA 5GQSA 3F5MA 1UH5A 1WMAA 4RENA 4ZDWA 3LKZA 2VP9A 1M2OA 3AB8A 3PD0A 4DVGA 4HYEA 1QP0A 1P1RA 2Z2YA 4K9OA 3BAFA 4MQFA 2GOYA 3KK0A 3COYA 4WA7A 3WWPA 5HR5A 2RGAA 1GWNA 3UMGA 1E1QD 4YY3B 4QNRA 1GP2A 3X1XA 3CEMA 3GLGB 1XDUA 2R8BA 3VXKA 2R2AA 3GG2A 3U9TA 1Y4SA 2V6FA 3AF4A 4QT0A 5FOXA 1DNPA 5H9VA 1WXHA 2DKOA 2FWIA 1YB7A 2VOEA 4LZNA 1M7HA 3H5NA 3N28A 1K1EA 3CX6A 1AIPA 2PL5A 1V1RA 3IALA 4G6ZA 2ENUA 3DVSX 3QVGA 2EKLA 4X1YA 3SFTA 1N36B 2I8AA 1P1IA 4Q37A 2RHOA 1L8QA 1SUWA 5DWQA 2DZDA 3ZD7A 3QWBA 2CLFB 1NGSA 4PYRA 2QX8A 1ND6A 1G1AA 4DMHA 2Z1DA 5JQGB 3O8OB 3GXOA 4PZYA 1XP5A 1OT5A 3AY6A 5EIBD 5FI0B 1O7JA 4FC7A 2ZRNA 3T34A 3CZPA 3B2NA 3H5TA 3ME5A 4FN5A 2JHFA 1GPH1 1T5LA 4FC6A 4C3ZA 3ZHUA 3AL0C 2YWJA 1YMVA 4NJMB 1XHLA 1HSZA 1T5SA 4Q4LA 4P7FA 3RKRA 1VSQA 2AOUB 3E4CA 1DAGA 1C0IA 2I62A 1S2NA 4JI3B 5JISA 4LJAA 3UT0A 5FTNA 1X1EA 4BCDA 4FFBA 4P81A 4YRCA 5BR8B 4B46A 2WF7A 3K2BA 2JFBA 3IO3A 1YS9A 2R6FA 5SZJA 1FRFS 3SIWA 2RMKA 2O2IA 1DKRA 4IGIA 1N2IA 2NZXA 3TOZA 3ZGZA 2OWEA 2HLHA 3F6SA 2WSYB 2VTVA 1PV1A 5DNEA 3GYGA 3EUFA 4XYGA 1M6VA 2GLXA 1I6MA 5CDFA 3OBBA 2Z3VA 5AHOA 2VDNB 1PQ4A 2C2BA 4L78A 1ZH2A 4ZODA 4ZDIA 5HWSA 1OXXK 4KQIA 1EAMA 4KDEA 3OA2A 3NFYA 4LOHA 1Y1KE 3NGMA 4OHVA 1M67A 2FDXA 1OF1A 4XVRA 2PU7A 3TTVA 3NVKI 3CX7A 3L7CA 1EI9A 1WW3A 3A6JA 1K5DA 3E9MA 3H9CA 3QTBA 3JYPA 4TTJA 5DYNA 2E37A 4OU5A 2NXWA 3R4VA 1B8NA 2B1RA 5ERGB 3OU7A 1BU5A 1CNMA 2FPGB 1DIAA 2IEYA 5HBRA 1KHHA 1BGXT 1N57A 2XVAA 4W8GA 1FMJA 2OCGA 3DTVB 3G5MA 3PGXA 3QV2A 3TW4A 4E5PA 2WYUA 3N7TA 1ADGA 1JHRA 2IUEA 3PYLA 5AKZA 4TWBA 1Y5RA 1NXOA 3HB7A 2HW8A 2YXDA 3BWBA 4PG4A 3WLMA 4KIFA 1B0UA 5EWMB 2BH9A 3QTTA 3V48A 1VZ3A 4LXIA 1D4FA 1ENOA 1MPXA 2C29D 3ZE6A 3G9TA 3OICA 2VS1A 5HK9A 4UCWA 5AHWA 1IPEA 4YQEA 1WY5A 4G3XA 3ZGNA 5HUJA 4JVLA 1DWPA 2VJBA 1PD0A 1YD7A 5DYGA 1L7AA 4PLZA 5HS4A 5DBFA 2QMOA 3FCOA 4JC8A 2CF5A 1JLRA 4JUIA 2O7VA 1V1JA 1WZEA 1W73A 3HDGA 3U9LA 2OHIA 2XGOA 3P5SA 1OLXB 3C0KA 5A7HA 3M34A 3TTTA 3UMSA 1ESMA 3IKJA 1J0XO 2J3LA 4YECA 5E1DA 3RPEA 1MDFA 1YRYE 4CGYA 4QBKA 4JNCA 5DX1A 4BECA 2RH9B 3R8XA 3HB4X 3IAHA 1N0HA 3R9WA 2XBMA 3BORA 4FU0A 3PJRA 2Q49A 2XYPA 5HF6A 1Z7EA 4ENUA 1Z2PX 1OUMA 2OZKA 3D0KA 1BXGA 1H8HA 1YDMA 2FX5A 1EVIA 1SKYB 2EC5A 2JIZA 3IAAA 4YWJA 4ABYA 1B6RA 2CSXA 1G291 2P6OA 4G8BA 1V3VA 2ZI3A 1J2UA 1GZVA 3DKKA 4TMYA 5CNJA 1BKYA 1OX5A 1C4WA 3MJDA 1ZI8A 2LV8A 4ZYLA 3UB2A 1IEXA 2HLPA 2PR2A 4IL5A 1DP4A 3S6JA 2NVOA 4MA4A 2JFQA 2BBTA 2G77B 1US8A 1WF3A 2XIQA 2Z3WA 2ZT6A 3T1YB 2GZMA 3PUIA 2PKYX 3UAVA 4M4SA 4YHHB 3B9PA 1T2CA 2OVFA 5JBNA 2FG7C 1KC1A 1PR3A 2YWHA 1NOKA 4B45A 3A58B 5CCEA 1AMNA 2OBYA 1OD6A 3HKBA 3LLCA 4PN7A 3D3JA 1N33B 3B52X 1VLQA 1GL7A 1ZL0A 3G8AA 3WG9A 5IM4F 3ZE0B 5G4KB 3P32A 2K7FA 2AR7A 3RC2A 5L9AA 2OHVA 2Y1DA 3WYNA 1ZXBA 3WLHA 4P31A 1I01A 2X7JA 1T3HA 3PE3A 2ADFA 2H5IA 3ECCA 3JVIA 4CLDA 3PHJA 1J2TA 1EBUA 3IUQA 4MEBA 1FS4A 1U8AA 5C80A 3RU3A 4C4TA 1CERA 2CV0A 1JPNA 5ERXA 1KYWA 2DUMA 3VFDA 5ARBA 1EJ2A 1ANKA 2A33A 3PRHA 4RXTA 5CLHA 2ZR9A 1TLTA 3UJ3X 3IL2A 2ZRMA 3LYUA 1LPPA 3E0QA 2B5OA 3C3EA 4YV2A 2BKEA 2XECA 4G1MB 1X14A 4GP7A 3N5KA 4R1OA 5ILGA 3ZX4A 2Z6UA 4BJ6A 1GNTA 1MB9A 4RIHA 2ADMA 1H69A 1Q3HA 3TXYA 1G8JA 1PGJA 1XFDA 1Y1PA 5LIRA 3V1YA 1SUIA 3E53A 3W2IA 4RTMA 4QFBA 4PLVA 3FLBA 4LZWA 3ND8A 4QJ3A 4O3MA