5DYNA

B. fragilis cysteine protease
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
118
structure length
118
Chain Sequence
VGSRTVLVYMIAQNSLAPLASADIEEMKEGMRQVDATSGNLLVYIDDYSAPRLIRLGKDKKGKVVEETIENYPEQNSADANVMKKVISTAFNQYKAEKYGMVFWSHGEGWIPSPAKTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative peptidase
publication title Activation of Bacteroides fragilis toxin by a novel bacterial protease contributes to anaerobic sepsis in mice.
pubmed doi rcsb
source organism Bacteroides fragilis
molecule tags Hydrolase
total genus 38
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2015-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dynA01
5DYNA 4YECA 3UWSA
chains in the Genus database with same CATH superfamily
3ZWPA 4N0DA 1Q2XA 1EP2B 4JP3A 4NYIQ 5KYYB 2AFIE 1CULC 3K1JA 4QEDA 4UMFA 5DU2A 4NE9A 1TFUA 2VDKB 1N0VC 2MYNA 2X0NA 3CA8A 2QD3A 1Y7TA 4MNTA 3S44A 2NO9A 5B1IA 3EIXA 3TQRA 3UBMA 1SN7A 3IR5A 1YGPA 1ZHHA 3QVJA 1KDPA 1ODKA 1QLJA 3V1TC 5KTRA 1QVVA 2FPXA 1A04A 2CVQA 5EGSA 3LFTA 1PWXA 3WKEA 2SHKA 3LYAA 3GG2A 4G5YA 1PUJA 1V8OA 3DE5X 2QD2A 1RI3A 5JAIA 1RQGA 1GNRA 1VP3A 1X3LA 4P1ZA 3BHIA 1N2HA 3LYLA 2WG0A 1JAXA 2WAAA 1P75A 4FFWA 4I4TF 2X1LA 5GZ3A 4U7FA 1UAAA 2DPXA 2DT8A 4PF1A 2C54A 5CA0A 5B1YA 3K73O 3RVMA 1C0IA 1WD5A 4FN5A 1J42A 4JLSA 4W7IA 2J31A 3CUEF 2NSLA 3IAS6 4KMMA 2A7QA 1RM5A 1PSZA 3D3NA 3EXIB 1ID8A 3NH6A 2QSYA 4CMCA 2XNSA 2ZCUA 2R00C 3M5WA 4DJ5X 1GEEA 1ODTC 3VPAA 3WLTA 3VDNB 2O7NA 3CRQA 4YRMA 1QZ3A 3GAAA 1U1EA 2W0SA 4CLRB 4Z4CA 2Q9CA 4Y67A 5BVGA 1XD2A 1DQRA 1ECPA 2F3RA 3HA2A 2DH5A 3IUMA 3HKBB 3SQOA 5KC9A 1PDVA 4KGVA 5F73A 4KBGA 4BNFA 2BGKA 2IOFK 4MRMA 4PINA 5FLEX 2KJQA 2VH2A 3FYSA 3SZUA 3O4RA 4FHFA 5TVGA 4BC1A 1OXKB 4CFSA 3H5TA 3LH5A 1RHMA 2QAIA 3HY4A 4OSEA 2O57A 3OQ1A 1P1FA 2G6BA 2OYSA 5TNXA 4D9FA 1J33A 4U8GA 2B5OA 2GPNA 4I3HA 4YCLA 3N07A 3SE0A 2IIPA 2O3QA 5DBEX 4C4SA 1CEYA 4KRFA 3IMKA 3I73A 1FXWF 1ZRNA 1UZMA 1XNRB 3L6DA 3U7EB 1UJ6A 3JYLA 3PHHA 1P7VA 1WB4A 2JHFA 4QBHA 5DYIA 1YDEA 3W6OA 1VMEA 1G2QA 4BMDA 3CUYA 1L7MA 4HDAA 4KI7A 4Q6WA 3TOCA 2V5AA 3D0RA 1XMOB 2SCUA 4MINA 2CD9A 3U81A 2I8AA 1PFYA 4F4IA 2WZBA 1H9AA 2K2WA 2NXNA 3BAFA 4BFUA 4CTJA 3MJHA 2ZE5A 3CNNA 4EY5A 3TTYA 2P8SA 2QE7D 2Y0PA 2PZBA 1KK2A 5EJMA 1I6MA 2ORYA 3IPLA 3PQ3A 3VZSA 1CUIA 4FFLA 1LI7A 4P0PB 2OCXA 1F4PA 2GN9A 4G84A 3OOYA 1FFEA 1T3SA 2G9UA 4GZ3A 4RWEA 4ZT4A 1L5LA 3SIXA 3PPVA 5F7JA 4E12A 3BIWA 1HY3A 2PKXA 3SF8B 1BRTA 4DZRA 5DHUA 1FX0B 1D2MA 2A35A 3WGMA 2EJTA 1QLWA 3W8DA 5HKKD 4H6WA 2ZIVB 1KO7A 4BX3A 2ZAIA 1RHKA 2RGNA 4QA9A 2AVDA 1HE3A 4KXXA 1CJTC 1T5DX 1IPFA 1XKLA 1PU2A 1YQXA 5KOJB 1YTUA 2NTYC 2WD7B 3I32A 3V8VA 1F48A 1JZTA 3EJWA 5BV2P 2ZTUA 2V96A 3QKSA 3X3HA 4CTOA 1Z28A 2XYPA 1Q77A 1PNQA 2XBLA 2WT4A 5IAEA 2BM1A 1ULUA 3R0VA 1NQTA 2J5RA 4BO0A 1U9IA 3ER8A 2Q3HA 3K2QA 1E2BA 1SHUX 4FD3A 2YHAA 1Y4ZA 1PWEA 1LPAB 2BKUA 3W0LB 3AP1A 1YQTA 3GQVA 1E7SA 3SJCA 5DCUA 3SR0A 1SKUA 2P2NA 2ZYWX 3ES9A 3H42B 1UC8A 1W9MA 1NC1A 3M3PA 1P74A 4KUHA 3HPRA 1RQNA 1RAHA 3K0EA 4QVIA 3DV0B 3COWA 3IO3A 4NNOA 4OP1A 3ZYCA 2XMQA 3L5OA 3RF7A 3UFXB 2NO0A 2UDPA 1KK0A 4IDCA 2OECA 4RANA 2HADA 1VM6A 1QK5A 1A4RA 1SZCA 2WD8A 521PA 3NGLA 1HC7A 4PYNA 2QDXA 1GWNA 3K4QA 4MGHA 5IVDA 4IF4A 3FPLA 4NWIA 5AWFC 4IH4A 3DT8A 4E09A 1PQWA 4IR7A 1ZP6A 3MW8A 3O9VA 4OQYA 2M1XA 2F64A 2P4HX 3AJAA 3NWJA 4L9RA 1GSAA 4ZVVA 2VJYA 2C31A 2QSUA 3S6JA 1QX4A 1X74A 1YKFA 4IKOA 2IP2A 3PQ7A 1RCUA 4ZANA 3RD5A 4FSDA 1F2VA 2WPDD 1CJCA 3HVKA 4H6XA 4L5CA 4UEJA 3VNQA 3MHPA 4S2UA 5DYNA 1YUBA 1ZN9A 2R8PA 1CT9A 3UMYA 2CNBA 4CV0A 2V1UA 1P81A 1R9NA 2OP1A 3B1JA 3OZTA 2F90A 4EG1A 3QA3E 4E03A 5H9WA 1LZLA 1I5OA 2KLBA 1KI4A 1I8TA 2VJNA 3PE3A 3SG0A 2DFLA 2HJ9A 1KPIA 1NI3A 3KQKA 1WUYA 4R7TA 1LC3A 2IZ5A 4FYVA 3DLTA 1QFMA 2BFBA 2J5KA 1WQ1R 2UVPA 1F1BA 3E81A 3N8IA 4JN6B 1WUIS 2DPLA 4JZKA 4RZHA 2G3YA 4Y1EA 3E3OA 1GPLA 1W47A 4GPAA 1AXRA 4U4AA 4KTTE 5JATA 2XUDA 1VBMA 3LPNA 3S2SA 2W2LD 1V6SA 2WVAA 4RTPA 1W4BA 1QS0B 3NOQA 2P69A 1FLNA 1NNSA 2QEQA 4HTAA 1IPHA 2O0KA 1XTRA 3SHQA 3A6HA 4C7JA 1XXHB 2VIIA 3QW2A 4J90A 4Q3EA 4X6YA 3WWOA 2ZUWA 4HPJB 4LXTA 2PWBA 1TFRA 3TQTA 4UU8A 1KMQA 2NZXA 4FMDF 3NJRA 4J91A 3A7DA 3PA8A 2O3SA 3PPXA 3R9IA 3O83A 1VL1A 4DGQA 3T8YA 5BQ5A 1VCNA 4ZT6A 4RTRA 5FBZA 1JIKA 5KX5F 2M9MA 2J41A 1BOOA 4MQMA 1G8SA 1EFUA 3IDAA 1Z17A 1ONNA 2DTDA 2IYRA 2YWHA 3NNSA 4I1RA 3SF8A 2Q07A 1DQNA 4BNZA 2FE1A 3CRVA 3PUXA 1FX0A 4PSKA 5ELXA 2YUIA 3E9MA 2C5EA 1GT6A 4LTMA 4Y6QA 3RS2A 3VJRA 5TJHA 2XR1A 4TTRA 1BIFA 5KOJA 1YQQA 1OU0A 3WGVA 3OZBA 5CDFE 4GPTA 2YOFA 3X1DA 3T1HB 3JQFA 3WV5A 2XF2A 3LDHA 4MUYA 4N3AA 4WNIA 3TRJA 5A4IS 2IYPA 3PGKA 2ZI6A 5FOWA 5B3LA 1N34B 3PLAE 2M6SA 3S55A 3IBCA 2H65A 2WLSA 1RHQA 1ZRSA 1PJQA 2C20A 2XKKA 5NULA 2QF7A 5IXSA 4GOXA 4ZT7A 1XZFA 4PVCA 4BXOA 1V11B 4LOKA 2AB0A 1KU0A 1YRWA 2ATXA 4FE7A 4NYJR 4ZCLA 1QJ4A 1QGAA 1XRPA 5ALQA 5JZBA 1OSNA 3NDJA 1USKA 2QD1A 2E4XA 3N87A 3QY0A 4L5JA 1A9YA 4FGSA 4Z2YA 3HWSA 5TIIA 3IQXA 3O8QA 4FYYA 4AP6A 1UDXA 1IHXA 4MV6A 3ZD8A 2H2HA 5DP2A 3S68A 4HXFB 2CXNA 1W9HA 3AR2A 4J94A 1M2FA 1EX6A 1P0QA 4N5NA 4Q3CA 4EX7A 2Q4TA 3I9LA 3TPCA 4G2TA 1QP4A 1SUBA 1YC5A 3LUBA 3SKYA 4KKXB 1T3GA 3MWJA 5EP4A 3NC0C 4MA4A 5FJJA 2I1VB 2P9GA 2G9VA 4DR6B 3MTGA 4LQ4A 1AKMA 4ZO9A 5JCPA 3K9CA 4WFIA 3RTGA 1V45E 2DPYA 2IYTA 5JISA 3CVOA 3EA0A 3IILA 1NATA 3EFOB 1NUHA 2OHOA 1XZGA 5DTIA 1P3JA 2R47A 4MKGA 1EHYA 2J0UB 3G8AA 4YT4A 1AQJA 2OE2A 2O1XA 1U63A 3N2EA 1ZVVA 3C6BA 3HGQA 2R8XA 3WKAA 5JADA 1WTAA 2EW1A 2PIAA 4OXIA 4XLTA 3FROA 4YMWA 4M3NA 4REQA 3TNDA 3ZK9A 3Q3EA 4DLAA 3LDGA 1XQ1A 4H4EA 2Z30A 4PWZA 3MK31 4IEFB 1VI5A 3GO4A 3E9CA 3L7KA 3LI2A 3IODA 1Z6YA 3WIEA 1T5TA 3WNVA 4EHIA 5A9SA 2O8EB 2EFEB 1R0RE 4ZOLB 4DBVO 3DEZA 1QO0D 3MINB 3PKZA 1N7JA 3TTVA 4BB5A 2C5AA 4JH0A 4LCBA 3KUKA 3A4NA 4N5IX 5ISMA 2O8BB 4EUNA 5A9SB 5H1YA 1FL9A 2F7SA 1Y5RA 4XQEA 1GL9B 3PE4A 1CG6A 4DG5A 3PXCX 5DM0A 1P2BA 1RVDA 3IB3A 4JBIA 5D3MB 3RUPA 4BJ6A 4BV8A 4CQMB 5ALVA 2XZOA 1QS0A 1NBHA 2BUAA 4U7TB 2Y1CA 5AM4A 1I4LD 1LBHA 1E59A 4ZOEA 2PBRA 3U62A 4TUYB 2P35A 2QZPA 2Z1NA 3Q11A 2L82A 2C2HA 3FI9A 1FNNA 3GJZA 1DMSA 4GAEA 4H3HB 4Z8YA 1T4CB 1SK8A 3GPLA 2A9RA 5AR1A 5I7RA 5KSPA 1P7ZA 4OGWA 3GYBA 2I6XA 3CLRC 2W5UA 3TVTA 2YWFA 5FLKA 3VAZA 4D9GA 3FFXA 3JU3A 3G2MA 3RVLA 3FWNA 5F52A 1VDZA 3EZ2A 3DBOB 3X2FA 3DO6A 1NTRA 2DT5A 2R6JA 4AQ7A 3RQIA 3F7NA 4YI3A 4DCMA 4GLLA 4BNXA 4N9QA 1RSZA 5AT1A 3QGMA 4J16C 2XNJA 4R69A 1WV0A 1C7IA 2OV4A 2XLBA 2ZATA 3IIEA 4RJ2A 3W6UA 3OAAD 1NONA 2PXXA 1X1RA 4CUJA 4MXDA 4CZ2A 1SPXA 2FETA 2C7QA 1N8NA 1EQAA 2FPGA 3D8BA 3ASYA 1J2TA 2IQ5A 1ISJA 1IRXA 3I62A 5AVTA 5CU7A 3F2VA 4PRKA 3HJFA 4BGEA 2JL1A 4QDOA 1HSOA 1JSLA 2PPVA 4FNGA 1DKMA 4EYSA 5I47A 3GJ5A 3V42A 1MR3F 2I7DA 1GZVA 1OAOA 4ZJUA 1X1DA 1V11A 3FAZA 4K9PA 2PZEA 4CIBA 4PG4A 4QUIA 2Q50A 1AQ6A 1S8AA 4DLUA 5CH3A 2QJTA 2RC6A 1GQQA 4N76A 2PKWA 1JXOA 2DLDA 1RXSA 1FTSA 1QQBA 1L8LA 4WTOA 5GJWC 3PEEA 3D2CA 3MWKA 2I6GA 1FY2A 3FWZA 4HN2A 5ALSA 3V34A 1J0CA 5FI0B 3G1WA 3V3TA 4J0JA 2IODA 2H1RA 1ZH4A 1P4AA 3JASA 3UW1A 1YIDA 1H93A 4TLAA 1NVFA 1T5LA 2A59A 4M83A 5E1MA 2H1WA 5CPBA 4DSNA 2F3PA 2IHJA 1SCJA 2Q8QA 1MENA 2IP4A 2V8OA 3G1UA 4KQ1A 2NVBA 1LA2A 5GJCA 5ICSA 2WYWA 4N39A 5K3FB 4NLLA 1AUQA 3U5TA 1N7IA 2XE8A 4F12A 2YUTA 4MVJG 2B8TA 3H7IA 9GPBA 5E4FA 4KQGA 5SY4A 1F0NA 2IEYA 1YNOA 5AOCA 2P4UA 5ADWA 1G18A 4MHTA 4JROA 3DGEC 1X80B 3MJ4A 2JGDA 2ZBDA 1BO6A 3P9SA 2H2GA 4Z1MD 5HRUA 1F6DA 1MB0A 1POWA 2WHXA 2G07A 1NG1A 2J0UA 3NDRA 2I62A 4P4TA 3AZPA 4UKDA 3K0SA 5EMJA 4XQGA 3OUTA 4UTVA 4RULA 2AHOA 2W6CX 3T7CA 2QVLA 2FCRA 5BMOA 5LQDA 1E94E 3EOZA 3HB7A 3OJOA 3FKSD 2Z6QA 1CNFA 4M9QA 4A6DA 3ICCA 1A9XB 1ZDMA 1FFSA 4IAOA 4AX4A 2O8EA 1JHVA 3STXA 2YR0A 3EPPA 4BGDA 3K70B 4ZOCA 1C9YA 3I01M 4MO9A 5DHFA 5E8JA 4CR7A 4XSHA 3VV2A 2O8BA 4W5WA 3C43A 3TX6A 1CR0A 4KSCA 2NZJA 3ODGA 4RVFA 2Q1SA 5GJVC 1JEEA 4C0AC 4JQYA 4E2ZA 5JAMA 3JWJA 3U4QB 4CQMA 5U9CA 4DR5B 3LLMA 4DEVA 1HDRA 2FZVA 1PQ4A 1Z0KA 4RBNA 1RNLA 1BRMA 3A8TA 3FSRA 3I45A 3OLXA 3U0VA 1MTZA 2RBEA 4A2CA 5KOYA 4TUYA 4DNQA 4RMNA 4MI3A 4WZBB 121PA 1TKRA 3O74A 5IT4A 1HL3A 4AJKA 4NY1A 3QJYA 3CCCA 4G4JA 1VKNA 4B2IA 3GZ4A 4S0XA 5TF4A 4CIYA 1MXFA 2NYAA 2EL7A 3QVGA 5AXAA 5ALUA 4LJ5A 1J8QA 5KQGA 2VHUA 3CWQA 3N0RA 5AVJA 3ZGLA 3IGFA 2VATA 4TV8F 1FLAA 3ZXXA 4CCAA 2IDKA 5GTDA 1U6IA 3DB1A 2B37A 1T4MA 2BTQA 3FYUC 4FNAA 4MUIA 1NAIA 1CR6A 1IK6A 4Y1RB 4KFUA 1EG2A 4P84A 2H1SA 2BBTA 4P93A 3BTVA 4YP1A 2CBZA 2I9PA 2OGSA 1CUJA 2X76A 3ZJYA 1M7HA 1RYYA 1QF6A 2D0OB 3B48A 3HJUA 3WXMA 1M6VA 1SXJC 1E2FA 1E2KA 3DUWA 2P91A 1TO1E 1UT6A 4PCUA 5FF9A 5HNKA 4OHWA 1OH8A 2Y0BA 2YJTD 1T2NA 3KYBA 2H7XA 5CFMA 3ETJA 4LWOA 4BQNA 2GBIA 1QDUA 2DC1A 4BBZA 3TS1A 1O8BA 3CKMA 3B1XA 2YVAA 4XM0A 1V1RA 3E7DA 1OFTA 4IH1A 3CSUA 3L7JA 4GBGA 4G81A 4HH4A 4ZHQB 1L9KA 1YIOA 3HYNA 2TECE 4KPEC 1QMPA 2PT5A 4OSPA 4CKBA 5LOVB 1HG1A 4RFLA 3L9WA 2XUHA 5EKXA 3AJEA 3TW4A 5H9VA 4D43A 2Y0EA 1P62B 2Q62A 3UK7A 3OPYI 1J97A 1OHHA 3RRXA 3GLSA 2V6IA 5CPFA 4TL7A 5AKHA 4X45A 1LV7A 1MXHA 1LNSA 2AFIA 2IPMA 2PZGA 2XIJA 3F97A 5K3FA 1GVNB 1ULSA 2EVWX 4KBYA 2F2TA 5IUJC 1EEHA 4TL6A 5A3RA 2R4QA 1G9XA 1RE1A 1D6NA 1ZVJA 5EZQA 1XC7A 1H6BA 3QFTA 4L07A 3D2BA 3C16C 3IVGA 4Q34A 5TS3A 5L51A 3OEEA 1H6CA 1FVFA 3CZCA 1X80A 4XR9A 1NSYA 2DETA 4IUBS 4X6UA 3JD3A 2AYZA 3VTKA 4E1BA 2AA3A 5T4HA 4DAEA 1F4LA 2ZR0A 1SCUB 1E9FA 5EQTA 2NXWA 2P6MA 3C3WA 1UH5A 1EPUA 4JA2A 1UDAA 4ENTA 5GMOA 3R7FA 4Z51A 1DC6A 3FOFC 2ZT5A 3D6AA 5E1OA 4EM6A 2XE4A 1ODLA 2FZLA 1AS2A 2BMVA 2HMUA 2Q5QA 3P9PA 3F2IA 4GSKA 4QLBA 1K89A 1CZOA 2XUGA 4AJJA 1AQIA 3NR2A 4EB3A 3GLFE 3S1LA 2WAMA 3TW6A 3R3SA 3NKVA 5J1SB 1V41E 4TV9B 4MTCA 1A9XA 4TYYA 5ILQA 4GWLA 2VRCA 2AEMA 4OGKA 3MSXA 3FJ1A 5EQJB 4KLCA 4K28A 3H5NA 4O4HF 4Q19A 2HA0A 4TYMA 5G0TA 4Y2SA 2WJ6A 2Z2KA 6YASA 2ZT8A 4OU4A 4H1UA 3RODA 4ENQA 2XXBA 1MDFA 2CYBA 1TJ3A 4INAA 5FP0A 1G20B 1FYEA 3OETA 3FPBA 4ZV9A 1ECFA 3RYHB 2MSCB 3W04A 5K0FA 4CI0B 2V6BA 3QE9Y 2VLIA 5E3HA 5FBWB 3M1IA 4V24A 3ZK8A 1NRXA 4V0KA 3OJXA 3S2YA 1DU4A 2R1UA 4P3NA 5KQLA 4EABA 5JPDA 1P4JA 1CBUA 2H9YA 2P4QA 3DE1X 4RXTA 4CMGA 5BPFA 2JAXA 4JR2A 4Y1RA 5AM5A 3SBEA 4AKTA 1ISGA 4WIAA 4EJMA 5AK3A 2X4DA 3Q8MA 4LMBA 4CL8A 3C6XA 3L1IA 4LA4A 3NFRA 4BRUA 1IPEA 5REQA 1J7KA 1SURA 1YTLA 3DKPA 4KPYA 4XCVA 4YV7A 1UMKA 2QNRA 2VJAA 4CDGA 5FR2A 3KSDO 1WSAA 3IQGX 3I72A 1X0XA 3OCXA 2YY6A 3EEIA 5IT5A 1HQDA 4L5BA 2PXHA 3LK7A 1QMGA 3IUBA 4ZO4A 4OI0A 1ZMOA 1FYDA 3N39C 4JXKA 4WGFA 1MQ8B 2QLBA 4YIKA 5EHQA 3SYLA 2YC2C 1TF2A 2C2MA 2ADMA 4BZPA 3NTLA 3UENA 3O3OB 4B3FX 4GZMA 1A9OA 4WNAB 4ZHQA 3ZGOA 1YDWA 2R751 3T99A 3JZIA 3G8DA 1ZXLA 3KB8A 4LGMA 4MI6A 3W3AH 1JQAA 4AUNA 1SKAA 3FCSB 5LOVA 4OD0A 4HN9A 3BMCB 5EZSA 1XKXA 4W6ZA 3RB8A 3X1XA 1BS9A 1UMDB 1UBMS 2JGKA 4YWJA 5K8CA 4EO4A 5BURA 2IEBA 3AB3A 2X3YA 1M66A 4MIEA 4Q39A 5KREA 3OCVA 2DU8A 1P0MA 2HC9A 1JDBC 3KKNA 1BU8A 4HBGA 1OYVA 3TJZA 3ZEAA 1W88B 3CS3A 1PS0A 1RWMA 4HMOA 3IH5A 4YCJA 4WQMA 2AD5A 2DWOA 2CNWA 1DDIA 1QB8A 2X9VA 1WZCA 3A1WA 4MV0A 1DEXA 1MLDA 4RMIA 4ZI7B 2O0JA 5EIHA 4HRAA 1ZAKA 1NMYA 2VP0A 5ES3A 1O03A 1ICIA 2FQ1A 1CQIA 2IX9A 2OM2A 3INYA 3K6RA 4GMFA 4W82A 5BSRA 1LCIA 3W8EA 1LPPA 4X71A 1KDYA 3ABZA 4JLPA 1N5KA 1C4WA 1JI0A 5E2AA 1XHFA 3RG8A 3F5FA 4C08A 1ZVMA 2GSWA 4F04A 5EUMA 2FRDC 1ZSVA 3WYFA 4N6OA 4YP0A 5BYJA 1EGVB 3THWB 1N4AA 1C3XA 2DFTA 3QNMA 4LYFA 4QVGA 2OORC 5EA2A 4DYDA 1NJ8A 2BKLA 1DKPA 3Q7IA 2RJ3A 2AYYA 5K0TA 1LNZA 2E6UX 1CFZA 7MHTA 1WU7A 3FGOA 1Q1ZA 1FP4B 3C1UA 2FPUA 2HBQA 4DA9A 5JNLA 5A5VA 3SZLA 3ZDZB 3WGLA 2QGNA 4GI7A 2LR0A 4MA0A 2VXYA 1Z5UA 3I76A 4NBLA 5ICEA 3A9VA 2HJWA 5JLAA 2NMVA 3T5MA 4IRXA 3I0MA 1Z0FA 3E5MA 1GRQA 4P2GA 1B6GA 1Z5ZA 3HJAA 4BMSA 1R0WA 4CCWA 2JEOA 4GGMX 3DOUA 4CWAA 2FKAA 4E11A 4BFLA 1Y6QA 1A2KC 3KYJB 3LVRE 5L3QA 3VV3A 2JD2A 1GLNA 3GFQA 4ITVA 4D9JA 2J87A 3IHLA 4M0UA 4YAWA 3RSOA 3X1ZA 2JLXA 4O2AA 5DI9A 4LFCB 1G20A 1ISSA 1ZOOA 1RWOA 1T5IA 5AVXA 1SCKA 2B7BA 1RKXA 3DP9A 2BONA 3PXBA 4PX3A 4M54A 2ZRNA 3DEFA 5TC4A 5TX7A 4DBLC 4L5IA 2FVXA 3NJ4A 4KB5A 5C5EA 1DCTA 1Z73A 4KSYA 3LO5A 3FH0A 4XI9A 4A10A 5NLLA 1E4EB 3SFZA 4UAGA 3C8HA 5IVHA 3IP6A 4R2JA 2ZR8A 2GHQA 5AKLA 1N6LA 3GJQA 5ICFA 2C83A 5FAKA 1N3IA 1I3MA 1C4XA 2QTVA 4HBZA 3GN1A 1NBOA 4WFJA 5B2ZA 4YN3A 4YRNA 1NP6A 4IIJF 3AI1A 3C3MA 2JBWA 2VAXA 2Z2YA 3K8OE 1O94A 3FNBA 4KAFA 3B38A 5B1HA 3S70A 4DJJA 5JXIA 1DAMA 4MS3A 1UKZA 5LKAA 4PLFA 4LGVA 4NFHA 4Y2HA 4XUGB 1AIPA 2AD1A 3RS3A 3UJDA 4HF7A 1NRIA 1SKBA 2VZ9A 5IBRA 2C61A 5J2UA 1NOKA 1UJ2A 1XZBA 1IZ0A 4LYAA 3UUFA 4XDZA 4Q4JB 1EE1A 3G2JA 5JS2A 1G42A 3LQKA 4HGYA 2HTFA 2XKBA 2GWHA 1A27A 4V3CA 5JYEA 4QDZA 5A4JA 1EVEA 4QOFA 4OFXA 2JVJA 1ZUD1 2J9YB 3OLQA 5LYJB 3J7TA 5IKEA 1RAFA 3C14C 4HNGA 3PL5A 1XJWA 3PIIA 4WVFA 5CDFA 4QASA 3EPRA 3DYVA 3GK3A 4MJLA 1DAEA 1UMDA 2YVQA 3IKVA 3V33A 4TWZA 1I7QB 4IJMA 4O33A 4TQ9A 3L4JA 1QAMA 3QBVA 2CB9A 3KWJA 2IZZA 5BW6B 1E4YA 1TT5A 3N3AC 5CFRA 6ABPA 4RCZA 4JVLA 1H2YA 2J6BA 1E2PA 1T8YA 3WKCA 2ZB3A 4RKWA 2GD6A 2VSOA 1MOPA 5JCZA 3KHKA 2Q29A 3TFWA 4ZI7A 4PTZA 4IGFA 2CL6X 5B3KA 2IC5A 4OKSA 1T3TA 2C9OA 3K05A 4LYJA 3GDFA 1L5FA 2PAFA 4BFXA 3HMKA 3UPTA 3U7GA 2GKGA 3NB0A 1GDTA 3SZGA 3GLRA 1YBAA 4E22A 1N4DA 3V8PA 3JSXA 2QAJA 2ACEA 3B3AA 4RTQA 3P7MA 4ARVA 3KHTA 5A1JA 3DZBA 3ETCA 4N3BA 3RRFA 2RBKA 4MS1A 4F2WA 2AEEA 3IYLW 2D59A 5DHTA 4WV3A 1LV8A 4WMLA 1KFKB 3N9IA 2GBGA 3AONB 3CKLA 3IOMA 1ZITA 2VUIB 3LQ4A 5CVEA 2J33A 3KHUA 1ZC3A 2Q4EA 3BE5A 3H2YA 1FQJA 3RIHA 4ZMBA 5K6AC 1PGOA 3SNHA 4BMVA 1OT5A 1TM1E 4OBBA 3C87A 3QLJA 4JJAA 4GMGA 2F17A 4BAUA 1E2JA 3BERA 1J23A 3F90A 4JOSA 3FPCA 3ZBTA 5AW8A 4M2LA 4EA9A 3BQ9A 5DOZA 2DM6A 4PQGA 5T8KA 2IDJA 1DAFA 4NTZA 1QYCA 2HF2A 2YFQA 4QYSA 1KYVA 2H2DA 1K9SA 3MJSA 4NS1A 5JS7A 4J0HA 1XTZA 3SBDA 1VECA 1XSEA 1ZM7A 1RC8A 4XAQA 4K6OA 2DQYA 5FOTA 4AW9A 4KQFA 4MTLA 2XI4A 2XW6A 2QB5A 3SWWA 1LZKA 4UUNA 1K7YA 4WPGA 4A0RA 2PS0A 4D57A 4MLZA 1W7AA 3EXHC 2IT1A 4MR8B 1NJ5A 2E82A 2LCQA 3WYBA 2BRUC 3HU5A 4BIMA 5BUQA 3O1LA 4DV2B 1N1EA 1SCBA 2Y1FA 4E5YA 3U7FB 2CHFA 4E1AA 4HUJA 2A9QA 1KGSA 4ZD6A 3WO1A 5JEDA 4JNCA 2DFPA 1S02A 1NW3A 2GK4A 3GUUA 1Q0ZA 3R6DA 4NULA 1RAEA 3K6JA 1UINA 2IJGX 2B30A 4RSGA 2C0CA 4ER0A 2VP2A 4TRJA 4NATA 2JGRA 4CBVA 1ZMBA 3ZJ5A 4B2LA 2H92A 4JNKA 2EOAA 3PIDA 5DMXA 1A7JA 2WU8A 4FGKA 1V9CA 1QUEA 2WUDA 3F4LA 3HP1A 4W5QA 3GD7A 2YN0A 3QXGA 4U0KA 4W5OA 1IM2A 4JXJA 1NVUQ 1ZJ6A 3THSA 3R6TA 4XGNA 1T9KA 2QRMA 3QXCA 4RH3A 3DA8A 1NNUA 1YRYE 3DTYA 5AHOA 3ZWXA 1J0EA 1O1YA 3JPYA 4MVJF 5A5EA 3RNOA 3L0DA 3R23A 5FTMA 3VOBA 4J3NA 4JQOA 4GT1A 4AQDA 4BGIA 1XD8A 3N8GA 4Q4JA 5K8JB 3K8YA 1M2KA 3EUWA 1SPBS 3TJMA 3E0QA 1JHUA 4G01B 2YC4C 2CJPA 1KEKA 2DHRA 2NZUG 4DV1B 3PNSA 4PEVA 2UU9B 3GC6A 4AX8A 4LK3A 1JG7A 1W36D 2IPXA 2WB4A 4PO8A 2FR0A 3WLPA 5LYJA 5GZ1A 1WULS 1L7VC 1YOBA 1UFQA 1WEKA 5GOTA 1J39A 4JJGA 5GM1A 4E88A 5EMMA 2P6OA 1BQ3A 1C29B 1H8HA 2ECKA 2NV2B 3HKEA 1EWRA 3R0IA 4OO3A 2ZZNA 3KFVA 1J21A 3BXGA 3MCZA 2D7CA 1GQSA 3B6EA 3WQBA 2I2DA 5EOVA 3WIVA 2QY6A 2YQZA 4QO7A 3TOVA 1Z2NX 2Z57A 2J67A 4G5GA 5E4YA 1FJGB 2ETVA 1C7RA 3IIIA 3W79A 1N2CE 2BP7B 1M33A 1QR2A 5FUYA 4CFZA 1RPJA 4ITUA 1K9VF 3ZQKA 1CUEA 3O94A 3HADA 5IWCA 1BVYF 1L5ZA 4BFZA 1QIDA 4R1MA 3CCFA 3UB3A 3E3LA 1XEWY 4OJQA 1HUQA 1SBTA 5DJ5A 1LSSA 2YICA 2AN4A 2C2XA 2IGBA 1RYNA 3AEUA 3HEMA 4F91B 4N0QA 5IZCC 3RJ5A 2JPDA 1E9BA 3V4PB 2J3JA 3IXQA 2JFNA 2QX8A 1PFGA 4YR7A 2XTNA 4DWVA 3T1YB 3ZQJA 1G3MA 4OJTA 2Y1WA 4L8YA 3LUGA 1CXZA 2ZI7A 1V25A 5IEJA 3KB1A 5T64A 1UOOA 4QTUB 4LS3A 3IR7A 8AT1A 1G5QA 1OFIA 1TIKA 4B17A 4TTIA 3B85A 1VPTA 4DLTA 5SZJA 3X1JA 5EMKA 4N41A 1M2OA 1EHCA 3GLUA 3FTFA 4BMXA 3EGCA 1MHPA 2PUWA 4ILKA 3NUZA 1IMOA 3ZLUA 1VCHA 2W98A 2BEVA 3GJRA 1NMSA 2Z3ZA 1OZAA 2PMDA 4YJ3F 1LDGA 1T6ZA 4YT2A 1IN1A 1EQUA 5CMLA 2C2GA 4PNHA 3HL4A 1JDPA 2GESA 1ZIOA 3BK7A 3LLSA 3GLFB 1UBCA 1N5OX 1VHLA 2GK6A 2FWMX 2YTZA 4MR8A 5IM4F 1ZFNA 1B4DA 1XCGB 3ISJA 3FBWA 3H04A 1Y4SA 1RLOA 3LCRA 1H5NA 1H69A 2FEPA 2HCJB 1DSSG 2QVGA 4BE4A 3AY6A 4X91A 4PQYA 4US1R 1S9DA 1K4YA 3BH7A 5DWQA 1S7GA 2X23A 3QW4B 4GYJA 1FMTA 2MINB 4W8OA 3M6UA 4YCAA 3ZDAA 3E2PA 1T9ZA 3L49A 2VT3A 2HQRA 1TU3A 1Z82A 2AOVA 3DMPA 2ZWAA 3MPUA 4DIOA 1H94A 4FC7A 3VZBA 1EE9A 3DVAA 3M1AA 4JVOA 4D3SA 1TTQB 1PYDA 4YUWA 2C95A 3P96A 4J9VA 4YS6A 5DW0A 4BLTA 2D2XA 3ZCSA 3KU4A 3R5XA 5J9FA 3F4BA 1BKSB 2NYUA 3OZAA 3P2KA 3RS5A 2ZYHA 4LX8A 2C3OA 3LZ6A 3HQ4O 4BQEA 3JAWB 1Z4KA 3NWOA 4LYDA 2R9VA 4ARUA 4WXRA 2VC2B 3DHVA 1P9OA 2O19A 2EX1A 4NU6A 1D5CA 2VK8A 4WJKB 2WWHA 4GC5A 4CLDA 1E8DA 3ELYA 3AMVA 4WY8A 1K68A 5EERA 1RLUA 1DNPA 3IALA 4X1KB 3KOYA 5CLQA 2PAAA 3I1YA 1WBBA 3KUXA 2ODEA 1HT2E 1PZNA 2WFLA 3HJRA 1JFFB 4JR0A 4IX9A 3C85A 4PIVA 1MW9X 3I1JA 4XIGS 5CBPA 2HF8A 3KDPA 8ATCA 3WV4A 1QHEA 2WRZA 2BWJA 2W6QA 4HTFA 1P1RA 4REOA 2JLQA 2OXEA 2ZSFA 1N6KA 4XM2A 1OLSB 4D9EA 4XTCS 1VPWA 1AZSC 2J6HA 4CW7A 4NZNA 1GGNA 4PY2A 3TAXA 3IRVA 2BFAA 3ILXA 5DYYA 3DMRA 3OQIA 3ZDDA 2OV3A 4BU1A 1QTQA 5A3QA 1IXRC 3VU9A 5CB0A 1SHZA 5IXYA 2D2IA 5IABA 2H06A 3GVHA 3PFCA 2XDAA 4IBOA 1ZGGA 4NE2A 1JSRA 1PK8A 2QN3A 3M9WA 4P7JA 3V1YA 3KAKA 6ADHA 1LBSA 4R84A 2I1LA 4B79A 1F8YA 4N54A 1VHJA 4O0MA 1CYEA 3QSYA 5D87A 3AC0A 1XP5A 5A7HA 4PZUA 4QPNA 3H5VA 4Q4HA 4O02B 1WBJB 1IY0A 3RO7A 3S2FA 3WYEA 2REQB 5U1PA 4RTKA 2CEKA 1W5AA 1UOQA 1WCWA 3ORYA 4PPYA 1SOWA 3RHSA 2D62A 4Y2XA 1U7HA 4IMJB 4MW5A 5A03A 3SEZA 1APBA 3G5LA 3L1JA 2BGTA 5ALNA 5FOXA 4KE8A 5M34A 1K7XB 5I5GA 3U2QA 4L95C 1NE7A 3AX6A 5AK5A 1U0GA 4YIHA 3T61A 4U7WA 2HHCA 4U7PB 5A71A 4A6XA 4OAOA 4M1OA 3LO8A 3QE4A 5K09A 2UYCA 4HAOA 4JLOA 2NAFA 5HGXA 1FIUA 5TGZA 1JPNA 3JQQA 4I55B 3R8XA 4QT4A 1J9ZA 3SNKA 3KSZO 3MIZA 4NCXA 4Z0TA 3FPJA 3W5AA 4QEKA 4QO8A 2CKDA 1QHIA 3LX4A 2JHGA 1KIAA 1F51E 1SVKA 4HX2A 4NFSA 4HXEB 4QXQA 3GLFA 2BIFA 2OO5C 4AY3A 4AG6A 2Z83A 3DV2A 4JY7A 1C3VA 2RHCA 2I7VA 2PFSA 4WFKA 2V3WA 4TXHA 5BN4B 1W581 2PNFA 2JIRA 4NCAA 4HNHA 4M0DA 5EGNA 2YY5A 3IUYA 5IC6A 5B7PA 3ZU5A 4LI0A 3VPGA 4PICA 1G6HA 3ZZTA 1ESDA 4LVUA 3VHXB 1ACLA 4KRGA 4EFDA 1HEIA 2GN1A 3RVPA 3JZFA 4ZDJA 5SICE 3IVRA 4BCCA 1NF2A 4MLPA 1ZNYA 2HMSA 1D5WA 2QYSA 4JJIA 2YV3A 1RPAA 4YCBA 4EDFA 3P9CA 2IYQA 4ND4A 4Y6PA 1EXWA 2R1VB 3LFUA 4Y9TA 4BNTA 3IA7A 3OF5A 1D7OA 1O95D 3ZR4B 2F3SA 3E58A 4KVAA 2VA9A 3JAWA 4DMCA 2CFIA 2V7QD 3PDIB 1V4NA 1Q7EA 1YQDA 3IPRA 1OHHD 1NN3A 2RJNA 4J1TC 2J9RA 4EKYA 2QTBA 3H9JA 1N5IA 2GK7A 3KIPA 5KSYA 3EHDA 4KBFA 3QOFA 4OLFA 3GGJA 4LZWA 4C6TB 3DPSA 4O59O 2RH5A 3JR3A 2GTIA 2QQ5A 4KYTA 1XVVA 3M4ZA 3AG5A 3GEIA 4X20A 4YRDA 5JVDB 3WLKX 2VDWB 1VBFA 1Z7GA 2OGWA 2FPIB 5K51A 4QZVA 4AO6A 1FP1D 4IQ4A 4A91A 5KUTA 2YDYA 3WBFA 1CLUA 3M4JA 4RIHA 1XBTA 3DBHA 4FDLA 5DCWA 5JC1A 1R9JA 1DWOA 2WSMA 1VC2A 1YR3A 4O4LF 5AMXA 3K5WA 3RQSA 4QUHA 721PA 1JZQA 1B8OA 3F7OA 1E0KA 3ND5A 1P44A 1P5FA 5I3CA 3D7LA 1IH8A 2IV3A 3AY3A 3BCRA 2SKDA 2E4ZA 4G07A 1IXYA 3UF0A 4KXMA 1GPMA 1P0CA 3GEGA 4A5SA 4YHHB 2YXDA 3A9SA 3MT9A 3M9XA 5C51B 1DRWA 3AR4A 4A36A 2CF6A 3CW8X 1XRJA 3JQCA 2EW8A 4F3YA 2BAGA 4G5XA 3FTQA 4FDTA 4L5AA 2REQA 1L5OA 4DCOA 4UDXX 2FQWA 4K6KA 5IJ9B 2XB4A 3LPLA 2XYVA 1SXGA 4NX2A 4P9NA 2VHTA 1MEOA 2DG2A 4JB2A 4KQJA 1K66A 1IDOA 3TL3A 4GQAA 3SC2B 4EP1A 5LA6B 4AI6A 1O54A 4ZVPA 1S2LA 1UKVY 1QF9A 3GWGA 4G1MB 4JI0B 2GYWA 4R8LA 3O5AA 2LPMA 2PTGA 4YMVA 1M0TA 2LW7A 3Q3CA 4PHHA 4IEIA 4LZPA 3PDJA 4RJKA 1EX1A 1NUSA 1OYOA 3IDOA 1ESEA 2BMFA 3KDSE 4RH1A 5KTKA 4DGSA 1YZ3A 1E96A 1DQPA 1JA1A 1S3FA 3PFWO 4I55A 2EKZA 1E9DA 3JV7A 3R0ZA 1EM6A 4JJ4A 2ZPTX 3RRYA 2CHVA 2O23A 1AU9A 2WU3A 3VH1A 5EIOA 1ZM3A 2ONZA 4W63A 2HFJA 1UCFA 3MBKA 4IXMA 3DP7A 3FUWA 2YXLA 2OLJA 2H7YA 3H3JA 4LJSA 1S2OA 1ZMXA 4RD2A 4G23A 5IN5A 3RBXA 2VT7A 5GADl 3IXLA 3Q3HA 4UEWA 4Q0MA 1GRCA 1ZGAA 2EATA 2YWDA 3HO6A 3GFRA 4K81B 1CDDA 4RKYA 2GASA 3EEFA 2HO4A 3B12A 3DMYA 4NEGA 2W2TA 3IURA 2QLTA 1MT0A 3A3NA 4PU0A 3ROXA 5BN4A 2WUEA 2BL4A 3EGWA 1DXQA 2OC9A 3GVCA 5FTKA 3N6VA 4HC4A 4UBOA 3ROGA 3PR1A 1J2YA 1PG5A 3FAKA 4M1TA 4QTTB 4RZUA 3KT6A 4FYHA 5FPKA 2G0TA 1GCAA 2NUTB 1OWPA 3DWEX 4X61A 3SXJA 3VHXA 1XRSB 1VLLA 1RJDA 2WNSA 3HN7A 5CDHA 4C21A 4X6LA 4V0RA 5A7FA 3ESCA 3OO1A 4NU0A 4GKJB 3NHPA 4Q24A 3QH4A 3L40A 1Q0TA 2XEDA 3ISTA 1D6JA 3BSSA 3E3AA 3HUEA 3UMSA 2P4SA 1PS8A 3FUXA 3ITKA 3PXUA 3IJRA 4DCVA 5FHRA 5ADUS 5KWJA 2Z2IA 3DONA 1XQYA 4IYJA 3ZV5A 4EVSA 4KPUB 1C4KA 3E70C 1P0PA 1K92A 1SVSA 2I0FA 2VH5R 1OXUA 4OEHA 3RF6A 3A6ZA 3SZMA 3DS8A 1Z8HA 1W4AA 2PYZA 4TLCA 4ZQEA 1Z18A 3NVMB 3UCEA 5HDQA 3PC3A 1BX1A 3LUJA 4L0MA 3WLLA 1GPAA 1I3OA 1I7PA 2CNWD 1LPSA 4F4CA 4C6TA 1U2EA 1DCMA 3E03A 5IYZF 3BTSA 4IWXA 1UUFA 2JANA 3EBLA 3FOEC 3D7NA 3A6EA 3R24A 1XCOA 5JXGA 3PENA 2XZPA 3NPAA 1EK6A 1U3CA 2AFHE 1YB6A 3G85A 2VDWA 2ZSBA 5BP7A 2LDBA 2FPIA 2R4UA 4HEHA 4EI2A 5LR6A 3L6OO 1AKNA 4F86A 3PNLA 1JWLA 1EJ2A 1EVZA 2VHEA 2BMDA 4NOJA 5IS2A 1VRVA 3M6MD 2BHLA 3V8MA 3NH9A 1GGEA 5P21A 2ZS9A 3VJKA 3WK8A 3TD2A 3L41A 1R9GA 2ZBGA 4YDHB 5LDHA 1L4EA 1R6UA 2EHJA 2C3PA 5CLIA 3OCWA 2IYXA 4IDDA 2CJWB 3UK6A 5T67A 2R6DA 1KH1A 2WWWA 4BUZA 4CIXA 2BYTA 2JAPA 4DCNA 4BCBA 1MO2A 4MMYB 4ZYTA 1EWQA 1P17A 4L6CA 3DFFA 2AG5A 1P33A 1U1CA 2EJUA 4NH4A 5AW2A 9MHTA 5K7SA 2H18A 4H7KA 4C2UA 1Y9DA 3STVA 3ZHOA 5JZVA 1MJNA 3MMNA 3LA6A 2HJHA 1XMQB 2GXSA 5IJ9A 1H0HA 4JYAB 1JA9A 1UJMA 1SC3A 1C8LA 1ZGHA 1SEVA 4K2AA 1M5RA 2AS0A 2NNWB 1N2CB 1T3LA 1V3QE 4YBRA 5B7GA 4KXLA 5DM1A 1C50A 3SC2A 2BGLA 1PQYA 4L7VA 4MQFB 5LA6A 1R50A 3ZU3A 4PNEA 2JA1A 1SEPA 4OXXA 1X86B 1QRDA 2ZBFA 2ONYA 2XOKA 3B3GA 3MCTA 3TIFA 3UJNA 4J76A 1TW3A 4A0QA 1L3BA 3HXOA 1QRAA 3FRHA 5JXHA 2A9PA 1F8UA 1CIJA 3RIMA 4LDRA 1TZMA 1HQKA 2BDTA 1XRQA 1LBIA 2FK8A 4XWWA 2CBGA 2FE4A 1JQJC 3RVSA 1RHUA 4EVIA 3ZWOA 4NCNA 5TSDA 1IUNA 2QROA 1ZK4A 2J6CA 4HWTA 5F5XA 3SC6A 2BFDB 1J6UA 3WLNA 2A88A 3VHRA 4HXYA 2ZANA 4UNSA 4J0DA 2YQ4A 3D3WB 4LRXA 5G1OA 1YK0A 2CL0X 4X44A 4C76A 1VFNA 3AVQA 1QCZA 4LCJA 4M1KA 5CW1A 4CUZA 4IDPA 2XAAA 3KR9A 3DZ8A 1KEEB 3PHCA 5CAEB 2BDEA 2E2WA 2WNHA 1O6BA 5GINE 2OB2A 1MB4A 3V2UA 4UNQA 1MC8A 2NQ8A 1XJ0A 2NZ2A 2AXPA 5L40A 3NUQA 5BO5A 5KDLA 3LPMA 1S1MA 4CLOB 2JVKA 3IOEA 2O7QA 4DY4A 4FX5A 1KZ7B 3TF5A 1IBLB 5DM2A 4N9WA 2OKCA 2WVGA 1YJ8A 3TLBA 3UV7A 3A6LA 5BSGA 2XUOA 2GJAA 5KS2A 1Y8RB 3H1AA 2J85A 1W5TA 3UQZA 2VL7A 2NSJA 4QYTA 2MCFA 4DTCA 3IPCA 2UVDA 1SBIA 3B3FA 3O75A 4KZKA 3QWAA 2ZRAA 1JXQA 2OMKA 4OHRA 3VU8A 4IRMA 1KDRA 2IYWA 4DIMA 4IWNA 2DLCX 4FQ8A 3O1IC 5J4LA 4E5SA 4HG2A 4G36A 1YZVA 1GUDA 1TYDE 4ILEA 4YJDA 5TPWA 3OZEA 4F9EA 4B3RB 5IUKC 3ACBA 1FUKA 5BWMA 1T4GA 3FFTA 2HRZA 5DLDA 5I8WA 2IEIA 1QHFA 3KFLA 4OQEA 3AH8A 3RFUA 1WXEA 2ATVA 1TI7A 3AETB 1TVKB 3IV6A 3KEFA 1RPNA 5EFOA 4KL8S 4K1XA 3LT1A 3ZW7A 4J4BA 3OU2A 3QKWA 3WGKA 1KKLA 1LTQA 1RLIA 4MJXA 5JW6A 3O8RA 4L7QA 13PKA 3P0JA 3PR3A 2LBPA 4DPMA 2F1OA 2GBLA 2XLCA 3E1GA 4MUBA 4RVOA 3VXKA 3V4ZA 1HGXA 3IKMB 2WW8A 1PUXA 2AG6A 1WSWA 3LT5A 1ZUHA 1KI1A 2FB9A 3PWSA 2BMJA 3TTWA 5IW8A 2CWWA 3D5QA 1U1DA 2FCAA 2ZREA 4B73A 2E7ZA 3A9TA 3ZJ4A 1X19A 1RQ2A 3GH3A 5AHKA 2GZAA 3D1VA 5EFZA 1ZEJA 3VR2D 3VTFA 1DWUA 3SC4A 3FMVA 3GLKA 4NG5A 2MR5A 3QVUA 4TL8A 1JVBA 3BCSA 3WVNA 5FYDA 1N2BA 3ROFA 1G3UA 1V6AA 1X7WB 3BORA 3EDYA 1L1RA 3F5MA 1TUEA 3DV9A 1OKKD 3Q7QA 1D2GA 1XTTA 2OILA 1XWWA 2QTTA 3AQIA 5EPUA 3AUYA 3SEAA 1JSXA 1E1NA 1KO1A 1NP3A 1SUPA 4FM9A 3F7MA 4U2GA 3KJZA 3LC1O 1X9IA 4EHKA 2J46A 4L73A 3ZHSA 1N2CA 5IJ0A 4ZDKA 2PQMA 4I5GA 1FRZA 1NNI1 1KVSA 2ADFA 1OIXA 2E55A 2ZRLA 4MQFA 4X00A 4P80A 3I2GA 1QPBA 4HLUA 5HJEA 2QRJA 4UVGA 4QGSA 5JSQA 1JH8A 1U94A 1TQ8A 3A06A 3Q9NA 4LAFA 4Z9AA 1E1DA 1NLFA 1GU1A 1HFWA 3GD5A 4MULA 5HBGA 5HF5A 3WIDA 4M60A 5LIPA 5HZMA 1SU6A 5KU1A 4BFVA 3O4IA 4CVNA 1MOSA 3CLKA 1AF4A 1C1DB 2GCGA 2ZJ2A 3S5JA 2GDJA 2RG7A 5EXXA 2UXCB 2WKPA 1NC3A 3PQEA 4LOJA 3RC8A 2BTOA 2AIRA 1KAOA 3OECA 5LJIA 2PX6A 3ND8A 5B5SA 4ZYWA 3V7YA 1H4QA 2NU9B 2HB6A 4P36A 2XTMA 4N1AA 1LX6A 5HFNA 3WE7A 3GEDA 4UUQA 3W34A 4C6SA 4QXMA 5TT1A 3AHFA 1U3DA 2ANCA 2W48A 3D3WA 5AUOB 2PUTA 1X7YA 5LXTF 5CLFA 1I2AA 3WWCA 3CC8A 4DIFA 3QMWA 2CEAA 3BL5A 2NP6A 1AKUA 4KPFC 3I05A 3TK1A 4X95A 4EG4A 5FI3A 1EFAA 2YWCA 4GVLA 3GZNB 1ZH0A 1QH1B 2HDNB 2V7PA 4L6IA 3V55A 4DRZA 2P2GA 2DPHA 4F4FA 4B6GA 4J9UE 5T7BA 4IHQA 3O84A 5E7QA 1B74A 1VIMA 3I5MA 3K53A 5JDIA 2PSHA 2HOQA 3OJ0A 1L5SA 4MGKR 3ZCRA 5LMUB 1U2GA 3P2OA 1BDHA 1RS0A 4G4SP 4BB6A 2R2GA 3S2UA 1E64A 3D6VA 3D9QX 3LY7A 1RMQA 2NZYA 1N1MA 1H8HD 2OZPA 1PLJA 4KVZA 4BB0A 4RHYA 1OWOA 1XN1A 2RK6A 2EJVA 2VNHA 4LMRA 1F2TB 1XEWX 3PCXA 3RR2A 4HFJA 2B1QA 2DBYA 5FNZA 1W85B 3DD5A 3KJEA 3KR0A 4IZOA 3O92A 1DG3A 2QM3A 2H7VA 4AZVA 3U13A 3A9UA 2C2YA 4HI0E 3DQPA 1T6YA 2MHCA 2Q7OE 2D0DA 2ARKA 2ERCA 3PYMA 5FL3A 1SMKA 3FFBA 4INZA 1QANA 4PQRA 2Q5CA 3J80A 1YQGA 3EWSA 3AETA 3OE4A 1CDZA 1WPGA 1TVKA 2CDCA 4A8TA 5C8YB 2P3OA 2P0AA 5ALOA 2ZSHA 4PZAA 4ODIA 2VNJA 3B89A 3FZNA 1CB0A 1XK6A 1C9KA 1Y7LA 1Z4MA 2WWFA 3D4LA 3R6WA 4PQFA 4TLBA 2G1UA 5D2CA 1SBQA 4TS1A 16PKA 5J1TB 1WDTA 2X86A 3DMGA 4JB8A 1KEUA 2X2FA 4I5EA 3P0RA 1C3EA 5IFKA 3SAJA 1DS6A 3FNRA 2VSXA 1Y34E 1KYYA 2J30A 5DXJA 4DW8A 2YRXA 2XQKA 1AV7A 1CUBA 5CFNA 2ZDGA 1R10A 1C2TA 2OZVA 2WK1A 1K06A 4P7GA 2GBPA 4UJ5A 4ME6A 3MOGA 2II6A 3RARA 1QNLA 1X7WA 2JJYA 2AJTA 1RP7A 1A82A 2GAOA 4KQCA 1GEGA 5E8RA 3OZIA 2CBXA 2X41A 5K6RA 2C5GA 3KSAC 5TEWA 3TUIC 2QXYA 4JJ8A 4A27A 3OPYB 1R27A 3ZI7A 4WERA 5FFFA 4ZO7A 4UPVA 3WYDA 1IN7A 4AZTA 5K01A 2V6FA 4KLAA 2XRZA 4IIUA 3LW8A 3PEUA 1Y4UA 3GMDA 3V2GA 4BGUA 4H0CA 2DWUA 3V8EA 1Q44A 7REQB 5FXMA 2WNIA 3DDWA 2QV0A 5CA0F 2Q4BA 2H5LA 1X7DA 4KO2S 4QULA 1ZK1A 2BH2A 4CKWB 1V8DA 1WCIB 1WABA 2DF8A 3ZY4A 1Q19A 3T7RA 1C1DA 2JATA 2DJIA 4FINA 2FMFA 1SOMA 2Z4RA 5H80A 5A05A 3INRA 1MABB 4JJZA 1U8CB 5CB4B 5JJLA 3ZWMA 2P7IA 2NU6B 1UPFA 3VH4A 1HT1E 1A1SA 1AK9A 4HZUB 3O6VA 2NU9A 5A0VA 4UBLA 5EKTA 1MO6A 4J0QA 4IM7A 3ZLJA 4HNVA 3JVEA 5AP9A 2PZAA 5ALIA 2QPLA 1PDOA 2Q2WA 4GFDA 2J6IA 3ZE9A 1U7OA 2GTHA 4MOWA 1J70A 2BI4A 1QIKA 1RZUA 2ABWA 3LV8A 4MUNA 4WJZA 1GPKA 3H1BA 1FRQA 3P2EA 3I4CA 1RBQA 3M9LA 1JHDA 2OKGA 4PX5A 3RT9A 4DTIA 2GF0A 1SIUA 2FPOA 3D02A 1RR6A 1D03A 4FILA 4F1WA 4WW0A 3DE7X 1W29A 4RPJA 4JLWA 3AVOA 3AHGA 4B3MB 2O5CA 2P65A 3SLGA 4CKCB 5BQ3A 5H83A 1U8EA 2O3RA 4CM3A 4OX9B 3AZOA 4LBZA 1J4AA 2VPZA 4RH0A 4NCHA 5BWLA 1KKUA 2CUKA 2VJOA 2OHIA 3PLNA 1GZ3A 4Q3KA 1G3QA 1JFLA 1K8ZB 3H99A 1L5NA 3NX4A 3X2EA 3EEOA 1X77A 2EHDA 4Z9YA 1GXSB 2VR1A 2F9LA 3B3JA 3LDFA 4X24A 5FV7A 3LP5A 3PYLA 2XY4A 3H16A 3TR6A 4RACA 2CWDA 2QA5A 1HETA 1XJQA 2FPPA 2XUZA 3BMXA 1Z0DA 4U02A 1SB9A 2DB3A 5ERGB 5EKUA 3RNLA 4D4JA 1XMJA 3QPUA 6GPBA 5B3AA 4D8XA 1FC0A 1OLXB 3NBYC 4F93B 1QHSA 4PAGA 3OKAA 3RTAA 3UK0A 2FFJA 2CLKB 2HCBA 2QTMA 1JG3A 4Z4GA 4IY1A 2OUKA 1C7JA 3W5SA 1RQLA 1LI5A 1KIFA 3K3PA 4MZXA 5CLJA 1ABEA 3V1NA 4HNAB 2HU7A 2PGIA 4E6EA 3QJ5A 2O4UX 1BCRA 1GUZA 4K8RB 5GVSA 1FTNA 3NBZC 2QJOA 3INGA 1ZPDA 3NASA 4UUOA 5GWXA 3TKLA 3ZOKA 2EGHA 2BPOA 2QL7A 5JQGB 1NVTA 2CMFA 2O0LA 4YJHB 1D1SA 1ODCA 2YJ5A 3ROPA 3T9EA 2YXEA 3TZ6A 1W19A 3U61B 3UUEA 4DSZA 2G77B 1YR1A 3B9QA 1XEXB 4ZI2A 4EY8A 4JSTA 4UQLA 3KYCB 2YZ7A 3GN2A 3T3HA 4KITB 4PGHA 1TM2A 2ZDQA 3OPNA 3QHPA 4KI0A 1O0SA 1YULA 1VJ1A 1VYTA 1V35A 3DE2X 2BN4A 4EECA 3O03A 2AUTA 4JOBA 5KHOC 5ABPA 2X8BA 3OPYA 4ER3A 4F6RA 5BSVA 2FH5B 3BSYA 2VN8A 5K0CA 3FWHA 3DT9A 4PZZA 4URFA 3TLMA 1X1TA 2IBMA 3TRFA 2RGNC 3G2LA 1IHPA 2IXAA 4ZVTA 7REQA 3ESDA 2QLLA 1JR2A 1MEEA 2Q1XA 3NTOA 4A2WA 3MFYA 2O7VA 2VHVA 4NJEB 4FDVA 4I4TA 2W6NA 1L5HA 3TIIA 3Q5EA 3V9PA 2H4HA 3LGAA 3DZDA 1WCIA 1VYVA 3UTCA 2JLSA 1ISRA 4Y2RA 5ECGC 1VHWA 2B9VA 4RNDB 4YC7A 4RPKA 2BFOA 2DECA 3HRKA 3HI6A 5DHSA 1EJBA 4TMYA 4JJEA 4RHFA 2RCYA 2O2JA 1G5TA 3DO8A 3IERA 2ILVA 2MSWA 3G23A 2H1IA 3CLHA 3FKQA 4DE5A 2IHNA 2IEGA 4DLRA 2OHVA 4TKUB 4LGYA 3IBGA 3DOIA 1F2UB 5FAXA 3HP4A 1N5RA 5D8DA 4YCMA 5CM8B 2ZRBA 4L51A 4IDGA 3WS7A 2B25A 3V97A 1S8FA 1OFHA 1SVNA 1XHEA 3I9V6 4EJFA 3Q7RA 1KY2A 1OH5A 1BVRA 4ZA2A 1EWYA 1Q6ZA 3BXOA 3ZU2A 4BLOA 3WMRA 1Z4JA 2V9ZA 3U3KA 1W96A 1G19A 3WJAA 1S3SA 3F3MA 3M6FA 1JA0A 4RNCA 4ZCTA 3OQNA 1VG0B 1JDVA 1HRDA 1NSFA 1RAGA 2NQTA 5ELMA 1QIHA 3GDGA 2AL7A 3D7MA 5G41A 3T1OA 3CF4A 4CKCA 3UAOA 4Z4HA 2A86A 3M70A 2J0QA 1G63A 1V8BA 5MFZA 1M5TA 3PR2B 1JQBA 4HRYA 3H6GA 3EVNA 4PLWA 5ESWA 1Y1PA 4DLBA 1UIRA 1GXSA 1PDWA 4Y2YA 3DLBA 4MWBA 4YYEA 1P6UA 2ZTHA 2F4NA 2IZ6A 2R97A 1FPMA 3BCUA 3KR2A 3TLKA 5K3OA 4QARA 3VNBA 2QHXA 1UL1X 3QELA 2F55A 1MJFA 1UWVA 2WJWA 5IVPA 2ZK7A 2XH8A 3C3CA 1MJ5A 3KO8A 3A11A 3RC2A 4HDRB 2Z8XA 2WAXA 1WZIA 4MUKA 1W5BA 3LF1A 4PYLA 5I7SA 2J0VA 3E9YA 4K05A 3M6LA 1OFGA 3I9FA 4Q7MB 4HNAA 2GPSA 2XGOA 3GZJA 3Q7PA 5L45A 1ZWKA 2JBAB 4X3PA 1PGQA 2WSIA 2JGNA 4GDMA 4W8GA 5IKOA 1BSVA 2QX4A 2VPYA 4CLOA 3ETDA 3F0TA 2AFHA 1CQPA 1I5EA 2C7GA 1FE8A 1FYVA 3K2BA 4TRNA 1V43A 2QMOA 4M0FA 1RT9A 4QFDA 5CB6A 2D3TA 1CKEA 4Q7LA 1L7DA 2D1FA 2NUAA 3OCZA 3Q0EA 3S0JA 5DM60 4AJIA 3C41J 1NVMB 3KYCA 4B8ZA 1DUSA 1VTKA 4ACAA 3ENQA 2HHJA 4DBZA 3ZY5A 1GD1O 1IWPB 3HJTA 3UJBA 3WK7A 1IBKB 1Q7CA 3LA8A 2VQDA 4FONA 1MRZA 1P2TA 2BM0A 3DHEA 3OSUA 2IW1A 1YU6A 2QLJA 1LDYA 4G85A 1LWNA 5EP1A 4YRZA 4KXQA 2E89A 3W4JA 3RAPR 5GGXA 3IOBA 1WPXA 1C41A 1TD9A 1XYGA 4JC0A 5J47A 2LWIA 4S12A 4DV7B 3G68A 2EFGA 4J6FA 3SXUA 1GGJA 4BUCA 3JQFC 3QQPA 1BGVA 4YP6A 3KXPA 4W8HA 3W5DA 2PSDA 4HYQA 5BMVB 2GKSA 5H16A 2UYOA 4ETNA 5CXUA 1KOGA 3LUCA 2YFKA 5D1HA 3NS7A 1RU3A 5BSKA 3FDFA 3FGZA 1GFWA 2A5DA 5CD9A 1TZCA 4ND7A 5HDBB 4D3XA 2XMGA 4QRDA 3TMKA 3RJTA 1RJ9B 5L4LA 1OAKA 3F47A 3JAMA 1PK9A 5BWNA 3W2HA 4TKUA 2OD9A 3VRHA 1HLDA 4BHTA 2PLWA 2DSNA 4Q4CA 4BNUA 4M37A 3NC4A 1QVZA 2H8GA 5BT9A 2Y66A 3D6MA 3E61A 3L8ZA 3RIGA 2R0QC 2OAQ1 2XGMA 4D8TA 1U6KA 1F5NA 1M0WA 4QOIA 1A3CA 4N5HX 4EPVA 3NCTA 4Z7OB 4ND1A 2B6HA 1K8RA 1DTEA 4KYUA 3EG5A 4I19A 1HM5A 3OCUA 4F9TA 3SHVA 1JN0A 1L1FA 4XD2A 3TSYA 4WBNB 2EBFX 2V0CA 1UXIA 2J48A 2NN3C 2WFMA 1QAOA 3FPGA 3FWYA 3GFVA 2EEPA 1QB7A 3L77A 3OBBA 4TTVA 3UXEA 5JASA 3CT6A 4IJWA 4TZ0A 3PJEA 1G60A 4PRZA 3UG7A 4B4VA 1SB8A 2YXNA 2IPLA 3FVQA 4AD8A 1KMIY 3KB2A 3LM8A 2IDMA 3TXAA 1JDNA 2RGAA 5GAJA 5F1OA 2CDRA 3EVFA 1PBTA 2RONA 1C1XB 2I6FA 1V8FA 3DKVA 3I58A 2FSVC 1RXUA 1Y1RA 1Z2EA 2FSGA 2ROQA 4QQKA 5CH8A 2B78A 3RGGA 3AUXA 4CR8A 4DLXA 1TMGE 5D00A 1JECA 1O6CA 1OT3A 2Z5GA 4O2BB 4NJMB 1KQ3A 2X0FA 3NQ41 4B35A 2XPCA 3LOUA 4ZQBA 2EEZA 1XTKA 4RO0A 3T5GA 4FOLA 1NRJB 1AS0A 1Z06A 3O8OA 4IDFA 4COOA 3F6SA 4POAA 3LXUX 3GNTA 3Q7EA 1US8B 4H4CA 2Q49A 4HAIA 4TM7A 5I7OA 1UXJA 8ABPA 5JFGA 1YJBA 4U00A 1E1CB 2X4IA 4NKRA 5FR1A 4ZYLA 4UNRA 1DKLA 2NZ8A 1F9EA 3MGCA 1EEXB 4LOAA 4RDHA 4L78A 5F35A 3BDAA 1QNFA 1QGOA 2XRFA 3OKFA 4ZKDA 4XSGA 5CCDA 3WWDA 1KJYA 1E2LA 3DE4X 2QN2A 3SD7A 1V16B 1CETA 1ORVA 2HY7A 2AXNA 4L02A 4DV4B 3QEMB 4Q1DA 3G7UA 3IHWA 4UDNA 2ERYA 3K1YA 1PLKA 2AKEA 2FP4B 3K5IA 1JS1X 4CM9A 5EQDA 4EYGA 2YYZA 3UC5A 1OBHA 1LRKA 4LYGA 2D13A 2XF8A 4ZC8A 1Y8QA 3T0IA 4DAOA 1ZOSA 3E22B 2LIPA 3GLHB 1EIZA 3PNOA 4W5HA 4BJ3A 3RK0A 3KQMA 4HD8A 4JI7B 1HTBA 4RZ2A 2IPOA 2WJHA 1KF0A 2Z2ZA 3GNLA 5E3IA 3O4GA 4YRJA 3S29A 3WB2A 2JLCA 3KQNA 1Z08A 1QYVA 1EAYA 1G6KA 3K9GA 2I2XB 4IZHA 1V4BA 2CF5A 2HNKA 2V4MA 5EEGA 1ILEA 4JJKA 5TRTA 2VDPB 4RLHA 3U1TA 3AKYA 4BFWA 3KJXA 3DGFC 1LDMA 4BMNA 4X7RA 5IH7A 2AMFA 1GZSA 4XOUA 4YEDA 1J8YF 1PJAA 4PFJA 3UCFA 4ZRNA 1E79A 4Z1OA 3FPAA 3ROTA 2ZRCA 4TGLA 2HRBA 3GJ6A 2C4WA 1IFXA 1FFDA 1CZRA 4M1YA 2PYIA 4NONA 3UAWA 2PL9A 1O5TA 1V9LA 1G4UR 2W00A 4GE3A 4YPOA 3RIXA 4BQQA 1I2CA 1F7UA 5A1TA 1AK1A 1MFPA 1OAOC 2XQFA 1GGHA 5JZ9A 3CF2A 4YGXB 3VDXA 2DERA 1NXOA 1Z4PX 1OC2A 1V5EA 3T5DA 4MEBA 3JQ8B 1WXFA 4MKHA 5A3JA 3AIOA 1Z74A 1SXPA 1EX9A 3KQSA 4F45A 4CM7A 4Z4EA 3VR1A 3WYCA 3AJDA 3BXHA 2DHQA 2QRNA 1P1BA 3A9WA 2GCOB 4IO0A 4P86A 3WC4A 2VP5A 2YCBA 4ZOLF 3ZIAA 1J22A 4RGYA 3FPEA 1GAEO 1Y7PA 5DT2A 2PS3A 4DOMA 3B6IA 4NVRA 5DLYA 2IV7A 1F38A 4URYR 3BMOA 3EW7A 5I7EA 3CV3A 3I28A 2FZKA 2FUEA 1GPH1 5JSHA 2Q8PA 3H0KA 3MOSA 3UGQA 3TZHA 2IHKA 1AB6A 2D5AA 5BN1A 4B7CA 4MW1A 1E8MA 1TZBA 1ZN8A 1MH1A 1WCV1 3M2TA 4NMWA 2BBOA 3N8HA 1VE9A 1TK9A 4NK5A 3VYUB 4EYQA 5F9HA 1J56A 1JW9B 1XCMA 3PB3A 2YNMA 4TUYF 1S6YA 1FFWA 3E9QA 1YH3A 4PCVA 1JR6A 4OK6A 1ZU4A 3AM4A 1KZ9A 1T24A 4RF3A 4LKOA 4ZN6A 4Y8VA 1SKYE 3ADCA 3AHDA 5FWYB 4EARA 1KJJA 3PI6A 2MWMA 1WVMA 2VO1A 4C07A 1IC6A 4MIYA 3Q10A 2PLRA 2DBRA 4CMHA 2VYQA 2RAUA 4S1OA 2HMYB 3DZCA 3K0HA 4OK5A 5BYBA 3JYHA 1YRHA 4ALNA 1TEZA 1VJGA 5HK9A 4IIBA 1ZIYA 1JIUA 1QZUA 4NJMA 4TMZA 3D2AA 4G5OA 3ANSA 4QLAA 1XTBA 4XX1A 3MILA 4AJ1A 3LF2A 4D42A 3QVOA 3PT9A 1UT5A 1PF7E 4O4IB 1UFOA 3HWWA 4I46A 1EGHA 2BSAA 5J5VA 5CXXA 1B0ZA 1NXVA 1T6XA 1D2CA 1KJ9A 2AV6A 2JBHA 2P3LA 2QXUA 1RADA 3B7WA 2VZ8A 3LCUA 1WXXA 3OMWA 3T7EA 3LLVA 1I1NA 1MNAA 2AN5A 4ZAGA 5GP1A 5DGCA 5DX0A 1IQUA 4DMLA 2FOLA 5JCOA 3EGXA 4F5DA 4KX3A 1KDVA 1CS4C 4I50A 3PRHA 1V16A 2BHNA 4LTNA 4WNCA 2EZ9A 1X1QA 1FPQA 4K6CA 3ZZ0A 2SBTA 4ZU6X 5G53C 2YWBA 2BGRA 3DTVB 4D0NA 2CDBA 3RS7A 1SC6A 4M7RA 5COQA 4R8VA 2XXAB 4NP6A 1M1NB 1TQ2A 4P98A 5KSOA 2QUJA 3MJVA 3NU1A 1C2YA 4O5OA 4OMCA 1Q6YA 2YMLA 3E22A 4JCCA 3SEQA 4X84A 1H5QA 1UZAA 4OV6B 2RK4A 1E1LA 2Z95A 4HWGA 3ZGVA 1PKXA 2L0XA 3II6X 3IAXA 3K1AA 2HWYA 3Q8WA 1EFRD 2QORA 3BILA 3NO4A 4M7WA 3TRKA 4IUDS 3IQWA 3CUUA 4OTZA 4Z54A 3QU4A 2ECOA 3SIRA 1NBIA 4B45A 1JPJA 4DDWA 2HV8A 2P4EA 1A69A 1JV2B 5C4GB 4CJXA 3EF3A 4PV7A 4H18A 2BEUB 2POCA 1ZIPA 4OQQA 5JMTA 1WZ2A 1MJHA 3BFPA 1JFSA 1VMIA 2EQBA 1AKYA 2QL6A 3M6AA 4MYDA 3GA7A 2C7RA 3TPFA 5ERYA 5AO9A 1HDYA 2V8BA 4UCQA 3PXGA 2G06A 1JHXA 1LPMA 4GNRA 4I1OA 3ZUPA 4ALIA 1MVOA 3SJZA 4WLVA 1JLRA 3EDOA 3UXMA 1PD1A 4UW9A 2DUJA 2Y67A 3CVJA 2FSUA 4FJ2A 4ZPXA 2BVNA 3U5ZB 1WCXA 4PZYA 2PGXA 3KZOA 5H4GA 5JFTA 3ET4A 4ZT2A 1SOAA 4FHEA 1LGYA 1UXGA 4L3WA 2WF7A 1HO3A 3H3XA 4F56A 2CMDA 4EDHA 2Q3BA 3JQ8A 3WK5A 2ZYVX 3IFSA 2H4FA 2HXGA 1BEZA 2Q28A 3KKLA 1PFKA 3KPYA 3C5HA 4JEHA 3AI3A 3RRMA 2X7JA 2I7TA 4CLEA 821PA 3FYUA 4YAFA 2W37A 4YQYA 3EZXA 5I9SA 4RK7A 3WDSA 5TGDA 1PP4A 1V1JA 2ESRA 3EZFA 1L7OA 3PU6A 5EEHA 5CNJA 2Q6OA 3STWA 1V1MB 4UTZA 3L7NA 5EZ5A 2K7FA 1N3YA 1D0VA 3E53A 3QUQA 4KR3A 3OQJA 3UXHA 2XEXA 4IGEA 4YPVA 5DYGA 1L1QA 1U3GA 2GDZA 1X70A 1Z0SA 5JRJA 2HXYA 3VKFA 2AC2A 3O93A 5IVKA 2IYUA 3TAUA 4Y1GA 1EUZA 1F20A 1KS9A 2GFHA 4FNOA 5JAQA 3QSGA 5KJEA 4HDKA 3ROZA 1G0NA 2VRBA 5AD1A 1USUA 1Z5WA 3EEBA 3UGTA 1GPDG 5FWYA 3S8YA 1VPLA 3RUDA 1FNCA 4JOQA 3HE3A 3PJFA 3DTTA 1WHSB 4P82A 1KNXA 5CLHA 6NULA 1M1UA 1NKVA 4L4SA 3K4HA 2A5GA 3VNUA 1JMVA 1TGVA 2C07A 1DPFA 4TV8A 4QG3A 1WSBA 3LOQA 5HQTA 3N2GB 3H9GA 2KMLA 1G4HA 2AR9A 2PH5A 2GH1A 3OU7A 4MARA 5DTEA 5L95A 3K70C 4YRAA 3AW9A 3ZIUA 4YJ2A 1SVUA 2PUCA 1PW5A 3HABA 4K0RA 4LZJA 2HT1A 3DDCA 1GGVA 3CW9A 4MLCA 3N8NA 4RIEA 4B75A 4CEJB 3UWMA 1DGQA 1ZAYA 1HTTA 1BWSA 2OCYC 1HFEL 3ZNQA 4EPRA 2HHAA 5EXSA 3DBLA 1M8FA 4CETA 3R09A 5DEIA 3EH2A 3WL8A 1Z2PX 4IP0A 1B15A 2W8ZA 2NO6A 2VPWA 3DTVA 1E98A 5BSFA 1UOPA 2CLSA 1M1NA 2C4KA 2FEXA 3O4HA 4MR7B 4U3JB 4ZAWA 3UK2A 3V9AA 2VJCA 3OLCX 2OG1A 1T0IA 2BFEA 4P8RA 4B09A 5ALDA 3B2QA 5LOVF 3U37A 4LF9B 4JFRA 3K32A 2CKMA 3CRW1 4MRVA 4FYMA 1H9BA 1WWKA 2BGIA 3ESRA 5FA6A 4CF4A 5K4AA 4MW9A 2VJMA 3IEKA 5JS1A 3RSZA 1L4YA 5CM9C 2ZZMA 3EBOA 3OM8A 5DHQA 2NSDA 1B0PA 1UC5B 1Z6XA 3BHJA 1E1RA 1JKXA 1DTWA 2G76A 3PXDA 3Q3JB 4FZVA 1CFJA 1P3Y1 1X1BA 4GX1A 4GU5A 1DO8A 3EWIA 4WBSA 4ENRA 2B20A 2WJAA 4HPXB 1ZUNA 2AQ8A 4YCCA 2ORVA 4X8HA 2OHJA 1ZGCA 4RE6A 4TVBA 1H3FA 2WEKA 1YBVA 3F71A 2DUMA 5CX1B 4YONB 5HF9A 3C7CB 4V2IA 3H1EA 4H6VA 2R86A 2L69A 4H59A 3KCNA 1N9GA 2SKCA 2P2ZA 1ZI9A 3CRMA 3OPVA 1NXXA 5AM1A 1G21E 1TLFA 4WBXC 1W4ZA 2RGGA 2H48A 2W6IA 3RJMA 3WGJA 3L92A 4IGIA 2CL5A 2YV5A 2X15A 4FN4A 3ZW9A 1T8PA 5LU9A 4UHHA 5I4KA 3B5JA 1Z56C 3EPKA 3HYLA 2ZJ5A 3BJIC 2I6TA 1QIJA 1X2BA 2EBUA 1BFKA 4BJ1A 2GEUA 4JQSA 4EG0A 4FGZA 4J2TA 3VR3A 1CRZA 2HPZA 1FTQA 1UBOS 2IZ1A 2R85A 2RARA 2ZRJA 3K30A 3UAVA 1SUSA 3D0QA 1U80A 1H2BA 3M4XA 2R6HA 3QOXA 5IRCD 3EXEA 5JSKA 1HA3A 4TMFA 4TV9F 3VOTA 3KUDA 1A5AB 3DE0X 2AMJA 4OY3A 2WILA 2WHEA 2JNWA 2PUVA 3OZXA 1BZYA 2BZ0A 2C5HA 5AKGA 2K5UA 3QF4B 2Q1YA 3S4YA 3D6FA 4MUMA 4NNPA 3CURA 2DUNA 3HCFA 1KMNA 2YZKA 5E6UB 1YVRA 2P79A 5GONB 4RFVA 2PXAA 2WF5A 4IH9A 3WB9A 5DOVA 4AL4A 3KOOA 1YT5A 1YVDA 3DLHA 3D64A 3AF1A 1X42A 3P9RA 5HUJA 2FJPA 3QVMA 3GFGA 1DQZA 3RT7A 1K4KA 1UPTA 1PO7A 1XL1A 2EARA 4QDUA 3RBVA 5EY5B 3ZZ1A 1TNDA 4I4NA 4O2AF 1GARA 1JL3A 3EF1A 1ADJA 1OC4A 3H8SA 4IHKA 4JIMA 1XXLA 1XZPA 3UOGA 1BHSA 4F8YA 3U39A 1T9GR 3MT7A 3AF2A 3IO5A 4KVGA 2O2HA 4L76A 4OQNA 3WZLA 4MB0A 1II8A 3W06A 1N1GA 4ISBA 3PNKA 5JD4A 4HY3A 5KDDA 4KSBA 3LQFA 1WHSA 1KP2A 2NZWA 3ELUA 2Y71A 3ESZA 3SP1A 1ZI6A 2RAFA 3QVKA 2DZDA 1QRRA 4R3UC 2NSYA 3KQTA 5F7ZA 1KOLA 1Z9BA 4JJFA 3HLYA 4LZAA 2R7MA 4H3KB 1SG6A 4R0MA 5ALGA 5LVAA 4CQJA 2B36A 3HG7A 1H2XA 3L1HA 4L8LA 5ARCA 1LQ2A 1D9XA 4X93A 3HKDB 1M34E 2R84A 4A4DA 2QI9F 4B5KA 1VBKA 1I2DA 3NHYA 3OUUA 5CNKA 3LC2O 4MIKA 4LISA 1O97C 4D82A 5G0WA 2ODAA 4UBJA 4QU5A 3ZHYA 3ZHZA 4HS4A 4KACA 2GGSA 4JCOA 1K3UB 2NU8A 3R3JA 1RPTA 4F7WA 3DZKA 1KSFX 3O7MA 4BPRA 3HY3A 5KYUB 3L01A 3OLYA 3FYCA 4LVOA 3B2EA 1FUEA 2ZBUA 4KW7A 3MTQA 4MZDA 3ZBUA 4IZIA 3TD6A 3OCCA 3QRWA 1HT3A 3DC7A 4UD2A 5ALEA 3V5NA 3HNRA 3M83A 5DN6A 3UQYS 2XCLA 4U3JA 1L2TA 2NTNA 2C7VA 1M2GA 1RJFA 3KLOA 3NFYA 4HNQA 3K9BA 1GZUA 4MGZR 1ZD3A 3PG5A 4BN0A 4E2FA 1VSTA 4OF4A 4CMKA 5KNBH 3J81A 4ES6A 1WO8A 1WR8A 2XJ4A 4NCKA 2YOHA 2FPMA 2Z9BA 4M38A 3RSGA 4NH0A 4UXHA 1BCSA 5ALFA 3ZGZA 1J8FA 4Z49A 4AC9A 3FJYA 1RWWA 2H1HA 4QDKA 4E5KA 2NPIA 4UULA 2HHHB 5E6RB 4UTOA 4A2PA 4BWYA 1CY7A 1NW5A 2IYEA 1AK2A 2JCSA 2ZRGA 3A32A 4RWZA 4DYVA 1O94C 2ZRQA 1P1HA 1R0KA 2QI9C 4OOEA 2PEZA 3OJLA 4UNPA 5AOAA 4EH1A 4ZI7F 2GF9A 3HCNA 2O54A 2NW6A 2VJLA 2C04A 3HVJA 4O8CA 1V5FA 2P40A 2IW3A 1X1EA 2X6RA 4AY4A 4TVSA 3VVMA 4W5RA 1FW6A 1A71A 3LX8A 3ELBA 5JT1A 1YS9A 2IZ7A 3EAQA 4G1BA 2BZ1A 1YXMA 4BBJA 4B4DA 1CLEA 4J0EA 2P9YA 4JGBA 3C15C 3IOYA 1ULBA 4IIYA 2GF2A 3WSTA 5KYNA 2NTJA 2XA2A 4YFYA 1YDMA 4EB6B 2NTEA 2DY0A 1ELOA 1XLTA 1JIVA 1G98A 3A4LA 2P9QA 2I3BA 4JQCA 4Q66C 2NO7A 2QQ0A 4XDGA 3ZOZA 1SD1A 4EMSA 3AUJB 4LCEA 3SY8A 3ON5A 5JPCA 1NXWA 1DBQA 3RVJA 2GAIA 1FJXA 2P27A 3QU5A 4OFWA 4B3SB 3TLZA 4RELA 1ZESA 1KYWA 4A9AA 3SDZA 3L6CA 1TJ4A 5EE9A 3JTMA 3LPDA 5HM8A 4UTPA 5CVUA 1SUAA 1XYVA 1B8UA 4OLHA 3JW8A 1OUMA 3IAHA 3RREA 2Q21A 2JZNA 3AOGA 1V5WA 4DJDC 5KQPA 5JJIA 3MUFA 2XT6A 3P45A 1A8QA 2UZ1A 2GPWA 4RJTA 1CVRA 3DF9A 5E6UA 4UNIA 1BEEA 1ZR2A 3I6IA 1JDZA 1UKCA 1E3QA 1P3DA 1KYZA 2LCFA 3OQPA 1PL7A 3ABOB 4KQXA 4AJPA 4QLOA 3OJCA 3QHAA 1JKIA 5CFPA 3PGMA 1Q3HA 2GPJA 5KSWB 3OMLA 1WM1A 4GRAA 1W49A 3FDJA 5DHAA 4Q1BA 1C3LA 1B16A 2HR1A 2ZRFA 4RSHA 3COPA 1PE0A 2RKBA 3SVLA 2UXBB 1TRHA 4QM6A 1WKCA 3EQ8A 4KXNA 4MKXA 1EVYA 2G4LA 1KJ8A 4HHEA 4MKFA 5AW1A 3RUCA 3R74A 1COZA 1TAGA 5DASA 3TFOA 2DVMA 2P6PA 3LQ2A 4GI3A 4NBUA 2BI7A 2V98A 4QFCA 2JRLA 3TGLA 3FNQA 4Q47A 2WJPA 2QAGB 3DAHA 1FNBA 2QPAA 4KXYA 5IK2D 4QYMA 1X13A 3VPFA 4KQ9A 2JDID 2VCHA 3R5SA 5TPZD 3HKDA 3EGIA 5DBOA 3T9CA 3KPWA 5G2OA 4AT1A 4IIJA 3QI2A 1ID1A 5IFLA 4EVQA 2XT9A 1ISMA 3UHAA 1HYBA 2QU8A 3CEHA 3DLPX 4GOND 5T8KC 5TT0A 1F3OA 3W4IA 2WZQA 1E1KA 1AKVA 1I24A 3PFNA 4MRAA 2V5UA 5FQOA 3X0DA 1Z34A 4B43A 3A6PC 3IBTA 2CY0A 1XUOA 5T6BA 5AQ1A 4BQFA 4LV6A 7ADHA 4WY2A 2GM9A 3T4EA 4I6GA 1QO9A 1YZYA 2C58A 2ID9A 2YHIB 4M55A 1ZU5A 5GY7A 4AYXA 4FHGA 3ECCA 1OTHA 2PRSA 1OLUB 4FIDA 1TYEB 2HCRA 2DBZA 2ZUEA 1RP1A 3KQUA 1T2DA 5AKKA 2WYOA 5LYJF 3MLBA 1K6JA 3R3ZA 4JKIA 3UHPA 5JC8A 5IEBA 3UOWA 3FMIA 1V95A 4MI9A 2Q9UA 4YQFA 5EJ9A 3PHIA 2VYVA 4RIGA 4CV1A 4FWTA 1Z6AA 1XZKA 4IUYA 5B58T 1JLKA 3MVEA 5FUVA 4EKDA 4F4JA 2AK3A 2IITA 1G6OA 2HQSA 3QQ5A 4HQNA 3QFRA 4AYWA 2ZR7A 3IT1A 1UZLA 4LWZA 1U4OA 4B80A 4BNWA 1SUCA 1BHO1 3VX3A 1A8HA 4NNJA 3DMFA 4WK4B 3VGJA 2R48A 1YRAA 3RLFA 4BZWA 1B23P 2Y6VA 1YSCA 1CUDA 1NQOA 5I8PA 4QRHA 4YAOA 3WA6A 3QEJA 1AHIA 4PLYA 2CMKA 5DGTA 4D6YA 5KWEA 2WIJA 4YV0A 4I4IA 4R1LA 1WXGA 3CEAA 3COSA 3P2IA 4X92A 3VUFA 1M6NA 3WNBA 2UUPA 4EITA 1R8YA 4KIUA 4R98A 4IL5A 4P53A 5E9JA 5D5PA 5DBFA 4LPSA 3RYCB 4BASA 1ZHFA 1YFZA 2G82A 3ZNOA 4BMPB 5IC5A 1NXSA 3G02A 4D3ZA 1Y9ZA 2AI2A 4DRXB 3GLGE 5CJPA 3A4YA 1JLHA 2ODBA 4NYIR 5I6DA 2BFFB 3QU9A 1R0SA 5B2FA 1DXYA 1FDTA 4MX8A 5GV7A 1WAMA 3VNAA 1L4FA 1ZZGA 1XU4A 4RC9A 3AILA 3OM9A 4CKEB 3DVRX 3P4XA 5BPHA 4WD3A 1X8LA 2Y1EA 3MUOA 4RY9A 4W9NA 1U8UA 1RXIA 2CGEA 4UM8B 5DTMA 3KEGA 2EIHA 3KVNA 2DAPA 4IIFA 4CM8A 2J4FA 2VCEA 2ZRMA 4LRSB 4HNTA 1GLVA 3NANA 3L0PA 4TTSA 3U09A 4CL2A 3SPXA 2Q0SA 3W05A 2CHGA 4HR7A 4DMHA 2QLMA 1AC5A 4MQEB 1E69A 4JK3A 4NZMA 2C1EA 2QVBA 4DM3A 5BV8A 3GEMA 3QBEA 3SVZA 2X9GA 4YR9A 4Z0PA 3IE0A 4EL5A 5G3YA 1WOYA 2WG2A 3WLRA 2XRYA 1LSUA 3PC6A 1ANKA 2KBFA 4FEEA 2M6KA 4E32A 2GOYA 4CT5A 2YHSA 4KRYA 3SQNA 3FR7A 1SKMA 3VR5A 1QF7A 1USVA 2V6MA 1NW8A 1DL5A 4B3TB 1V0JA 1ZRMA 2RC5A 4US2R 4MICA 2H08A 3IVXA 2W8BB 3L1KA 3OZRA 1W34A 4MWTA 4M0CA 4Q18A 5LLDA 1LU9A 1H2RS 2QZSA 3H5AA 1NV8A 2OV6A 4HJXA 2OV2A 1TM7E 2ZITA 1VB3A 3SS7X 5IKMA 2IHVA 4DV0B 1QIMA 3DG9A 4LY0A 3UHOA 3LQQA 1ICEA 1DXHA 3LLUA 5FTNA 2EF1A 3CQ9A 1DBPA 3IUPA 3U4CA 3ZZNA 1NTOA 4A8HA 2QENA 1NHGA 2VNAA 5ALLA 1O6FA 2IU0A 4CCYA 5ITZB 3KS9A 1QG6A 1V8PA 1Z5OA 3W90A 1I3CA 1E2IA 5BN5B 4GE0A 2E0IA 1B8VA 4GI1A 1UXHA 4C7VA 4AF6A 1VLVA 1GJRA 2A33A 1CQWA 2XJ9A 4BO4A 3T5PA 4CXMA 1IOLA 1M0SA 1P2VA 3K72B 4E5MA 1STOA 4URUR 2CK3A 1NVGA 1WMAA 2YHIA 3RBZA 4ZU3A 2CXTA 1U9ZA 3HXTA 1OLUA 4GI2A 4U5QA 3S8EA 4D25A 1NW4A 3UH0A 2P9ZA 3PD0A 5K3DA 4P83A 1S0UA 5BSTA 1QUFA 1M1YE 1SUIA 1VFPA