5DYNA

B. fragilis cysteine protease
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
118
structure length
118
Chain Sequence
b'VGSRTVLVYMIAQNSLAPLASADIEEMKEGMRQVDATSGNLLVYIDDYSAPRLIRLGKDKKGKVVEETIENYPEQNSADANVMKKVISTAFNQYKAEKYGMVFWSHGEGWIPSPAKTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative peptidase
publication title Activation of Bacteroides fragilis toxin by a novel bacterial protease contributes to anaerobic sepsis in mice.
pubmed doi rcsb
source organism Bacteroides fragilis
molecule tags Hydrolase
total genus 38
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2015-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dynA01
4YECA 5DYNA 3UWSA
chains in the Genus database with same CATH superfamily
4J8PA 5KQMA 4FX5A 3ZGVA 1CJSA 2D5LA 2GTHA 3OE5A 1Y3BE 4BEBA 3V1KA 3X1KA 3RT7A 3TBKA 4MICA 2XLCA 3IDFA 1U31A 1BKDR 2AR7A 1WXFA 4JDUA 2NYAA 3L7NA 3P0FA 3ZDAA 2QNIA 3S1AB 2QJFA 4UJ3A 5DBHX 4PRLA 1AKUA 4TXJA 3ZNNA 1EINA 2PFGA 2P1DA 3I5UA 5IYZF 1N2IA 4GYJA 4HYEA 4QGGA 5KTOA 3U49A 2OLJA 2QTVA 1QZTA 1U2GA 2OGUA 2HC9A 5DYWA 1N5RA 1PG2A 3OZ7A 3PGA1 4B3MB 1K5DA 5TPZA 3EBLA 4B6GA 4R83A 3K5HA 2V7GA 2WNIA 1DKUA 2G9UA 3CRVA 4X1KA 3SM9A 2GWHA 4NMLA 4ZKEA 1DZIA 2DFNA 2A9QA 2R1UA 3V8MA 4PAWA 3HBNA 3P45A 1NXWA 4CKXA 5C7LO 3LUBA 1E94E 1NW3A 2P11A 3K2IA 4WGFA 3J81A 3L6UA 2GWRA 4XVQA 4DFDA 4ES6A 4RMJA 2BFBB 2FZWA 1SRQA 3GWZA 3M4NA 5FEUA 4S1PA 4ATNA 4D1YA 3EEQA 3JRWA 3REOA 3HU5A 3RIEA 4HBGA 2XQGA 2FSHA 2GI4A 2QK4A 3JZDA 2O5VA 4LGMA 4EUKA 3R8XA 2BHLA 5C9ZA 3MYRA 1PGQA 3U17A 1UJ2A 3G5MA 4NCKA 2PKCA 4BMDA 4D9KA 1KDYA 4BB0A 4L50A 1FX0B 4OB8A 1RYDA 3BMQA 3DV9A 3MWYW 4FCTA 4J2OA 4JI2B 1RC1A 1GPLA 1J1IA 3KQPA 4DM7A 3QXCA 1OZGA 2EZTA 1XEFA 2IUUA 4QG3A 2Z58A 2VA8A 2NO1A 1A5AB 1PJZA 1IG3A 2EGUA 4CKYA 4DABA 1EK2A 1APBA 2OOSA 3WLTA 3UXYA 4IKEA 2C2ZA 3VI4B 3NRCA 3ZCSA 2EC5A 3QLEA 2FRVA 2NWQA 4B83A 4NK5A 2EKQA 1NF2A 2DWOA 4XRRA 1CQXA 3C7KA 3ORHA 3ROFA 1G3IA 3H0CA 3AFMA 2Q2NA 2BC9A 2PWYA 4KNWA 2BLLA 5THQA 1BW9A 3H1PA 4AFNA 2IT1A 3HHPA 4M7RA 1T1RA 2CB9A 3L7AA 4B31A 5JROA 2JARA 1G5HA 2NZ2A 2XUFA 1ZRMA 1CZOA 4HTFA 4S0ZA 4EHNA 2EKLA 2QLJA 2XB6A 3FB4A 3O0TA 4Z4FA 3RK1A 3SP1A 4EG8A 7ABPA 1SIUA 3RKSA 3RIGA 4I14A 2I29A 4IEFB 2CL7X 4GIBA 3HM2A 3O1JC 1FTYA 4KQWA 4GI7A 4TS4A 3WL8A 2A5JA 3I6IA 1R0SA 4DSZA 2FSFA 2PFKA 2WUGA 4MIOA 3JQCA 4MNTA 4PLWA 1RM3A 5GPBA 4KOEC 3U16A 1NJ2A 5DT2A 4LYFA 1H0RA 1ZMBA 2ZPUA 1JR3D 4GE0A 2P9FA 3FUTA 4QGBA 2A8YA 4G56A 2WFAA 4RE6A 5A05A 1KI4A 3WLLA 4ABYA 2ZXUA 4MRPA 3I1IA 1NRIA 1P18A 2OUIA 3BHMA 3GELA 2MYNA 1M34A 4DRZA 1QRTA 1T2CA 3NHWA 1XX6A 4IDAA 5AJUA 5K0BA 3A0UA 3SE7A 1IU9A 2WICA 5IZCA 3LIIA 4DGQA 5BW6B 1CFJA 1VHDA 1JLHA 3O4GA 2HQBA 3BIJA 4LFBB 4F3CA 4AP9A 3RAGA 4OXIA 2C9DA 3P0JA 1GDHA 3KOOA 3OLWA 4EUHA 5KHLB 4FTWA 3COJA 4RZXA 2XMZA 4BEVA 3LY7A 1DKNA 1T43A 2IOFA 4B7XA 3PJEA 3EFHA 4UCXA 1LF0A 1QGAA 3GI1A 1G17A 3EXG2 1QTQA 1IPHA 1SBHA 2C2GA 1VPVA 5DGHA 1OAAA 3OTQA 4AYWA 3A4VA 4W9MC 4ZEWA 2QPAA 1OROA 3D6UA 3S70A 5JH7A 2DHQA 4DLZA 5JPDA 1D3AA 3OU2A 2P68A 4BDTA 4FGKA 2VATA 4OYLA 1KYZA 4N8SA 1OLSB 2R85A 2LIPA 3DAYA 3LUHA 2ZYTX 3PRHA 5L51A 1ZHHA 3G1UA 1EFCA 1PZXA 2EGHA 3QOWA 4ECAA 2AYXA 1E69A 1QH1A 4A5OA 1I7NA 1HRKA 1VPEA 3AFHA 3OLZA 3K9QO 2YUIA 2ASEA 3WJ1A 5FWXB 2W2QA 2J31A 3PQ4A 2RAVA 2B69A 1S2IA 1VIVA 5HKLA 3NTXA 3HRHA 3VJMA 1WB5A 5LM3A 4RA6B 3UG7A 4PXYA 2IH4A 3TW8A 2CXRA 1HC7A 1POWA 1TUIA 3HCFA 3WDLA 1ULTA 4QVKA 1J0EA 2QL7A 4YQYA 3TIXB 3RVLA 3ZWOA 4HLDA 5CJJA 3LPNA 4EHHA 1RLTA 4GH5A 4LHZA 2ORYA 3KV3O 2G6BA 1GQFA 4TKUA 5TGDA 3NDBB 1QK5A 3NWOA 5FV7A 1JG6A 4OQQA 5FLEX 5JJIA 5JFTA 2RD2A 5A03A 2DU8A 2LTAA 2R5WA 5F52A 1X38A 1DRUA 1FFDA 3MELA 3PKJA 4HEA6 4IHQA 3ZV6A 3PEVA 3F2VA 3QU4A 1KVTA 2C78A 4KIWA 3VH3A 3KFVA 4XGQA 3C8ZA 1CR2A 3IUBA 1L5OA 4IAOA 1Y7TA 5NLLA 1E9AA 2J3HA 2D5AA 4HPXB 1UFKA 3D0RA 3RPEA 4B34A 3CW2A 1D04A 2GPAA 4DWVA 3OTOB 2QX9A 3DTVA 3FZNA 5FTLA 1H8ED 3B6MA 2Q2OA 2GFQA 4KIFA 4Q9LA 3LD9A 5E2AA 5E2IA 4IQ0A 3Q6IA 1KJQA 1K0FA 3W06A 3MWJA 1E5XA 5JTUA 1Y4UA 1MDBA 1PQYA 2YZGA 3PD1A 4P08A 4JLWA 3QY9A 4ZCLA 5BN4B 1UJCA 3MTBA 2QXYA 4TTPA 4UAGA 3ZWQA 1RXSA 2JRLA 3S68A 3NWBA 1SB8A 2QD2A 4WI1A 3UXEA 3ADBA 4Z4EA 1WDTA 4XUCA 2NN3C 2Q3EA 4BO4A 1ACJA 4B4WA 4B4KA 1EE9A 4K0KB 5JH7F 4R0MA 1F7VA 1OGIA 4KC0A 1RLUA 3HB0A 4TRNA 5C8DA 4JSTA 5FR2A 2OXTA 2MWMA 1F0KA 1ZGJA 1JA9A 1CRWG 1BXGA 3WSTA 2OYRA 5JRDS 1YQUA 2FHSA 3LZCA 1LFDB 3L7KA 3R23A 4PM4A 3S99A 2BEWA 4QPDA 4NCXA 4PRKA 1CIPA 2R1TB 1O97D 2GQ0A 1E60A 2BE7A 4LJYA 2HIMA 4E03A 3L8MA 3NHMA 3R5JA 4KQCA 4C4RA 4F04A 1MAWA 4DA9A 3THYB 4LZWA 2GFIA 2JVIA 3RO7A 3N5CA 5KYXA 3L4JA 4DIKA 1G4UR 3BH0A 2XXAB 2HOQA 4ZVVA 4FD3A 2O05A 3WGMA 4RCYA 2FRDA 3DAOA 3TVYA 1RYFA 2CBZA 3BXFA 3DQZA 1I33A 5GOTA 5BUSA 4TYNA 4MKGA 2D0PB 1RBZA 4GICA 4YJ2B 2WILA 2VP3A 3AUSA 3OZTA 1AQLA 3DULA 4FDAA 2Y1DA 4OM8A 1L4BA 1HFJA 2W2TA 1DXYA 1AB5A 3G13A 3OBBA 3T1OA 3TBFA 5TMPA 2XZDA 3DDCA 1LBSA 2GYWA 1V0JA 3CO5A 5JE8A 2BHNA 2OENG 4IG9A 3SQXA 4JJAA 4WNCA 1U9CA 5JQGA 3K0FB 3IE2A 2QENA 4QELA 1VXOA 2NACA 4Q9KA 4G9BA 3SYNA 4R98A 1IHYA 1CQPA 2G9VA 3X0DA 1C9JA 1NLZA 1U5AA 3SS9X 4TKMA 1GQRA 5JQGB 3L0DA 5LDHA 2DB3A 2UXCB 4KR0A 3E48A 4LK3A 1KFJB 4UMFA 2MSNA 5D1HA 1VPLA 3EZXA 1IPEA 5CUQA 3LW7A 1T6NA 4Y7CA 2WMOB 2QVYX 2YJ4A 4NS4A 4MV0A 3D4NA 1M7BA 4XTRA 4ER6A 5KTYA 3OQ1A 4R9NA 5D5QA 3JZAA 1LGYA 3BVPA 4E4YA 1YNOA 3CRZA 4JAVC 1U90A 2I2XB 4AYXA 4DWOA 1CQJB 1XKTA 2NU8A 2H1WA 3A6EA 2UVPB 1RXVA 3QLJA 1JHQA 3AERA 1WXQA 1TX4B 1WXIA 3EW9A 1PR4A 2BJVA 3P0IA 1SXPA 4JR2A 5FHRA 3BIOA 5F2KA 3OPVA 4H7DA 3B89A 3NORA 5AUPB 5TPZD 2WJYA 2A9RA 4ZT5A 5BR8B 1DG9A 1JLRA 3CUYA 2VXBA 4EOGA 1P74A 3EY4A 3C6YA 3M5DA 4AJHA 5L3SB 3KSBC 1U8FO 2PL5A 1UC9A 2VDNB 5TT1A 2PRKA 2JCVA 2CCKA 1A8PA 1X13A 4QJBA 3WHLA 3WLPA 5IFLA 5KKCA 4BGIA 1F1BA 4YRSA 4TZTA 2W9XA 1UEIA 2DE0X 3GD7A 1ZD4A 3CZCA 3K0AB 3L6CA 3OKCA 1RS0A 5HOQA 2NZ8A 3Q88A 4MV6A 1CE8A 1C3XA 2XNJA 4N6GA 4OIMA 4BJ3A 2GBCA 1IRIA 4GMKA 4CKWB 1M1NA 1QGUB 1XE3A 1HE8B 4JR1A 1YJ5A 5IJWA 4JX8A 1JXOA 4O4JA 1CU1A 1IQ0A 2LE0A 5KU7A 2ZJOA 4XQ0A 5FI1B 2IVFA 2E1PA 3B3JA 3IIEA 4X7BA 5EGNA 3UJBA 1Y1SA 1YH3A 4BS9A 1JDPA 1DO8A 1P0PA 2FOIA 4DCNA 3CB4A 2Y6VA 1UOQA 4U7FA 4ITUA 3ZHYA 2WDZA 1TZJA 4B09A 1FSFA 3R6WA 4Y9UA 2AFIE 1GZ5A 5JQGF 3U19A 3RU3A 3BUSA 1USVA 1Z0AA 2ZTMA 3UJNA 1A9XA 1ULHA 3OX3A 3KUDA 4YLYA 1GGHA 2ID4A 3VR5A 4JLJA 1SXHA 4HH0A 1BDMA 3EHEA 2YOHA 2YXLA 2QAGA 1S96A 1WJGA 4GXQA 4WUTA 1MXFA 2C7RA 3CLVA 3ZWVA 3VDNB 2G9QA 1IUOA 1WXGA 3LK6A 3O1IC 1B15A 1X1QA 1T5HX 3KPVA 1VZ3A 4P7FA 4C87A 3CLTD 4JYAB 4I1VA 1SBCA 4DIDA 3O92A 3IDAA 3EPPA 3GH1A 4ND8A 1P7PA 4J3JA 3DJYA 3LPDA 5H0IA 1EVKA 5JU6A 4NYIR 1QV6A 2A30A 4U39A 4AD8A 4DXDA 3IBGA 3ZY2A 1X8JA 1U0OC 3AFNA 1ZBQA 2IYPA 1FMTA 4I3HA 2ZJZA 2H5LA 1DBRA 3HJNA 1FRNA 2GVNA 4GUAA 1VHQA 4OU5A 2OEPA 1LLUA 1E98A 2XWSA 4IJ6A 2W6ID 4RIEA 4PEVA 5GZ6A 3R3SA 5LQUA 2I4LA 3N0RA 1LVHA 5PNTA 2QVBA 3DLTA 5CLLA 3CVYA 2X4IA 2PKRA 3I6BA 4LOIA 2OXIA 3L4BC 3HR8A 3HXPA 4GX0A 1FFWA 1ZRSA 4RK7A 4RESA 2VWHA 3I9OA 4BJ5A 1L8OA 2VPZA 3PHHA 4LV6A 5BW8A 4B76A 1S1CA 3UV6A 1WXWA 3VJKA 3CLUD 1JFRA 1NUUA 1QNLA 2I4RA 1JS1X 2VXOA 1V2GA 3BILA 2QZZA 1XL1A 1NN5A 3GLHB 4KYTA 2DFTA 4A8TA 3T1TA 4CG0A 3RNLA 4FSDA 3DOCA 2H18A 2EX4A 2X8AA 4RKEA 2AN5A 4HGPA 5E38A 1GG2A 2EW1A 3H4MA 5AM1A 2HO4A 2X7HA 1ZRHA 3VBCA 1JG2A 1W36C 3K9GA 4CLOA 1O77A 4BO5A 2IEDA 5HWSA 2AN9A 2DPHA 2Z57A 3AETB 1Y0BA 4XLZA 1GFWA 1A2OA 4O4JF 4X20A 3C3KA 2Q5JA 3IVMA 2QTBA 4DIFA 4DLPA 1F8YA 1FNNA 3F3SA 3JD3A 3HR7A 1AS0A 2I4MA 3KELA 1JHOA 3OZUA 5DHTA 4EI7A 1NVKA 1WIWA 1NMSA 2HMSA 1W5SA 2NAPA 4Q47A 3ZCQA 5J58A 3QUQA 3VU9A 2OAQ1 3PTLA 4R31A 3PV0A 2ZRBA 4L4ZA 4EA8A 4E5YA 3Q6NA 3COZA 1XCOA 4BDSA 6CHYA 5CYFA 4IGFA 3PXAA 2QYHA 1PNRA 1T9GS 3D4PA 4PC6A 3RVQA 4HKTA 1NXTA 2JI6A 1XMPA 1TKRA 5EP4A 2X5OA 1RP1A 2AFHA 3L4EA 5HMLA 5DH9A 1WHTA 2GEDA 3ZE1B 3A0RB 3OE1A 5CXUA 2AWOA 4MVYA 2PUDA 1WUKS 8AT1A 5JRJA 3WNVA 2YRXA 3FGOA 1W1IA 4QASA 5C1BA 2WUEA 3ND8A 5KSPA 1TMOA 2X2OA 5COBA 2ZT6A 4BLWA 3M2TA 1O4WA 3KDSE 1AUVA 1CJTC 5D00A 1OYOA 1L4YA 1WP9A 4BNKA 4B82A 1UP4A 2DZDA 1H9BA 2HBYA 4KQMA 3U61B 2H63A 3A2MA 3VU8A 4DC9A 4LYEA 1T1SA 4N0PA 2WHQA 2ZANA 2V1UA 1EFVB 4G1EB 3CPEA 3NUQA 5KNCA 4CCSA 1XBTA 3KR0A 4E6EA 4G8JA 3DE0X 3T7TA 1EWRA 1TRHA 1Z16A 2QU7A 2JFFA 5LZ7A 1R88A 4D0SA 4S04A 5EHNA 3QE3A 1JHVA 2H7VA 5ESWA 4JGBA 5CMLA 3S4YA 3UAGA 4F5EA 3H8SA 3OHPA 5HJ5A 3AEKA 4HN4B 2YWJA 1T5OA 3OIFA 5G0UA 3TRIA 4PSAA 3K70C 3U3XA 1IXRC 1QX3A 4FE7A 4UFOA 5HRCA 1DE0A 2XQKA 1NBWB 2HU5A 5CGQB 1VJ0A 3SEFA 1MVLA 1KF0A 3OZWA 3Q3HA 4AMZA 1EP2B 4FSHA 3W7BA 5F5LA 4QQFA 3KDPA 1I8TA 3KVNA 3AHJA 3KJZA 2OFOA 1CNEA 4UFNA 3WLRA 3JX9A 1YRWA 3LY5A 3PJRA 3GMDA 2G0TA 2DM6A 2QRZA 2VR1A 1NXQA 5E9JA 4Q05A 5GIPE 5AI9A 4DIEA 2H7XA 3AVXA 1EK6A 1L7XA 3H9GA 4X9XA 3SHOA 1V9LA 4JODA 4J0GA 1XAHA 4QDZA 13PKA 1X1CA 1IONA 1N7HA 5EE3A 1XAIA 2E18A 2QLBA 3WMFA 1FC0A 4DMRA 2GM5A 1YDFA 2ZI4A 3LPMA 5FB3A 2OVFA 4GR4A 2G1UA 5DEOA 2FQYA 1ODKA 1N32B 2A5DA 5EWLB 1QHNA 2PX3A 4U6QA 4ASUA 1LJLA 4TYWA 2OM2A 1GAQA 1ETHA 4OB7A 1EAMA 3O8LA 1IVYA 5BN1A 2DP4E 1Y82A 4PYOA 3FIUA 3T7EA 1HE3A 3NHUA 4CW7A 3I28A 4B3HA 4WV3A 4YRZA 5B7GA 4H7KA 5I7AA 1H1TA 1OA1A 5MFZA 1OLXA 5BPFA 2ZWPA 1RLIA 1F06A 3BKWA 3EIWA 3DDZX 4PHFA 4JVNA 3GLFE 4HNSA 5EIEA 2GBLA 1O96A 2GA8A 4PLVA 3MCZA 2BBSA 4EY3A 1UFVA 4DNQA 4MQ6A 4R68A 1ILWA 4MHTA 1K8ZB 3I01A 3MOSA 4KHPB 2V6GA 2JIZA 1LD3A 2H51A 3NRBA 4LQLA 4UM5A 1ZUD1 4H3SA 2QY6A 3AKZA 2QR3A 3DM5A 2ZUWA 4YRDA 4BKQA 3B2QA 3HXKA 3W5HA 4XSGA 3CG4A 9ATCA 2C3MA 3IVRA 3B20A 1TF7A 3L2OB 3S2IA 4CI0B 4FVTA 3AMVA 1GKKA 2UYQA 3DFUA 3L18A 4R41A 1V9SA 4UHHA 1B16A 1DDGA 1FQOA 1O95D 1T26A 1QLHA 1E9CA 2I8AA 3FAZA 1DAIA 1A9RA 3GFPA 4GD3Q 16PKA 4IIXA 4MQLA 2H1VA 4MR7A 4WJLA 3COPA 3EXHB 5CYPA 5DBFA 5GZ3A 3CKKA 2IZ0A 4FXPA 3EC2A 1QC5A 4R7ZA 3EAFA 3UPDA 4FDUA 4BU1A 1R2QA 4DNPA 1XNJA 3PVZA 1UEJA 1HNXB 1WR8A 2Z5FA 1G19A 1DHTA 5EXEA 2ZUEA 4H4DA 2FPPA 2OCXA 3OEYA 4IM7A 4EENA 4M7OA 3R3UA 3W3AH 1W9HA 1GRRA 2CLSA 1JHPA 5EJ6A 3OQNA 3KYDB 2C4VA 2P8JA 1M8FA 1MAVA 4CTKA 2I2CA 1W59A 2O59A 3HUEA 1X1SA 5ARBA 5K6RA 1AGNA 1PVDA 4MMYB 3HJAA 5FWNA 4O1IA 3V33A 1KZ4A 4QTUB 4XGNA 5ETJA 3E5NA 3GXOA 4EVRA 1PLJA 4DLVA 4Q4DA 4XGKA 1MKYA 5EZSA 4HSEA 3TMAA 3YASA 4A4DA 2XHZA 1OW3B 1WMSA 1YXMA 3IP3A 3RC7A 3W4KA 2PGOA 2ET6A 3F6EX 2BTOA 5I5EA 1HE5A 2Q8QA 3GPLA 2B4KA 2NUTB 5LIRA 3DHNA 2BRUC 3DAFA 5ISMA 1XMXA 3HL0A 4YUYA 2ZTVA 1V25A 1XYGA 2CDRA 1HT2E 2XUAA 2BZ1A 2QMOA 4UUMA 3C15C 2DLCX 3OM9A 4WLNA 5DX1A 2XKBA 1N0HA 3NEPX 4ZOLA 4AJ1A 2PUAA 1OXSC 5JAHA 1XN4A 4P6VF 2KBEA 1KQFA 1ZKDA 3F6CA 2PWPA 6Q21A 4FFVA 1KY2A 1SC4A 4R84A 4B73A 2VLIA 1OBVA 3OCCA 5J1TB 4EG6A 5JWOA 3EISA 3E9YA 3L4KA 3G7SA 5L4LA 3S28A 3BE4A 5B1DA 2WUWE 4L95C 2QPOA 1HT0A 2A4MA 1CJCA 2VWGA 1EE1A 4KP7A 2B1QA 3UT6A 3GLRA 1PZNA 2YWRA 4FGUA 4OI2A 2GETA 2BCGY 2X9QA 2ZB7A 2G82A 2LRHA 2TMGA 2RGEA 1S8NA 1AHNA 3Q41A 4AECA 1D2MA 2HQ1A 2I99A 4IJQA 3BTUA 2AFIB 1VI5A 4PQEA 1AVTA 4HZUA 1T9ZA 3MGKA 5ALRA 3IKLA 1LEHA 2FG7C 2WP0A 4KBGA 2QTHA 3EEIA 4IH4A 2LP4Y 3ZK8A 1KP3A 3TRKA 4PCVA 3W9UA 4CI9A 4HDQB 3AB3A 5ADVA 3RSHA 4DLRA 1SD5A 3W6ZA 4CLXA 1NNI1 3ICVA 3F6BX 3C4QA 3VR5D 3L0ZA 1Z63A 5BWNA 3WAJA 3L07A 5FYQA 1SVSA 3FDZB 3TSAA 3WRYA 2OV6A 4F1KA 3ZJUA 4J4TA 1WWKA 1ZM4A 4I50B 1NUAA 4DUGD 4HDSA 4QHSA 3MBKA 1JECA 2Z6VA 1N0WA 1C3LA 5E8RA 4O1HA 1NLFA 5JNVA 1Y33E 5ERYA 1M0WA 1GSIA 4UTZA 2N75A 2VCHA 2V96A 3DUFA 1K92A 3F47A 4K46A 4CUJA 3MWDB 4E11A 3OZXA 2JIPA 5KVSA 1KEEA 2B4YA 2ZS9A 3PHLA 3JALB 4L0QA 4OHWA 1E9FA 3LA6A 1LVGA 4QTTB 4WA8A 3JQ6A 1JDVA 3K0EA 3NBUA 3GGSA 2QWXA 4LWZA 2FH5B 5AR1A 1UBSB 4E1VA 1XFDA 2VHEA 1Q6ZA 2C20A 2UZ1B 3FUVA 3OVMA 1TMGE 4PCUA 1HE1C 3FTPA 3SQMA 3J7TA 1KS2A 2OFPA 4N4AA 1T3LA 3FJYA 5GVSA 4IFTA 3TIFA 3FZQA 3ZVLA 1ISRA 2DCUA 2HU7A 3ZGXA 4D6YA 3EVTA 4UPDA 2BHRA 2Q1WA 3MCAA 3IAXA 4UD6A 2PMKA 4GMXA 4ZOLF 5KWJA 1HH4A 2VHXA 4LZZA 3RRBA 1PWYE 1X7XA 3ZLBA 4N3GA 3M6VA 4LXUA 4Q3KA 5DOZA 4CG3A 3FMVA 1IQRA 4B87A 2C1XA 4JIGA 4D8WA 1Q84A 1XNQB 2JJ2A 2Q41A 4IQGA 3RNOA 1N2OA 4X54A 3U81A 3MK31 2EFDB 3P9QA 2KPOA 1MPTA 1QQ6A 4MW5A 2V59A 3NWJA 4QWMA 3QFFA 1LU9A 5EFZA 2BJWA 2WRZA 5K6TA 3EZNA 3I9JA 4H9GA 2FLVA 5CP8A 3KSZO 1NBAA 3SICE 4P38A 1E2UA 4RXMA 3JWIA 3EWNA 1FNBA 4CWAA 1E2DA 2OBBA 5LSAA 1T36B 2Q9CA 2O7QA 3NCTA 2X2FA 2PL1A 4RK0A 5EXSA 1I7QB 4J2HA 1RC8A 1TIKA 1QCZA 2F3SA 5DHAA 3TCXB 4ETNA 3KLPX 3DVAA 1T9HA 2X4DA 3SEZA 3VDRA 1ZW6A 3QBDA 2GCOA 3QNWA 5JCXA 2QUKA 3CURA 5A0VA 2F3UA 3H9JA 2QQ5A 4EO9A 5AW0A 2PD4A 1EGAA 1W44A 3X1WA 2ECOA 4EECA 5IVPA 3W6OA 2D2VA 1P44A 4H3HB 4FC7A 2B98A 1A7KA 1N3YA 3D3WA 2O3RA 3CH4B 4KQJA 5BSHA 3N6RA 1CUGA 1T6BY 3EGCA 4IIDA 4TXMA 2WBLC 1BXRA 2JIBA 1KJYA 2RHMA 3IUSA 3JQ8A 3ADOA 4QBGB 1YI1A 2XT9A 5KYWA 1YS6A 4B48A 1LRKA 5F7XA 5JAOA 3PFBA 3IRVA 2RE8A 1ZH0A 3OECA 1VFNA 2P78A 3B53X 4M9ZA 3QF7A 4OXKA 3PG5A 4P58A 5BNFA 1SCUB 3VGJA 3HM9A 3BXOA 2AKEA 4KXLA 2VP9A 5KQSA 2WWIA 1B1CA 2C0CA 3PFIA 5KSYA 3GCGA 4HS9A 1A97A 2QYSA 3AOEA 3I04A 4ZALA 4QUEA 2RMKA 5A3QA 2WWTA 2JL1A 1A96A 1CRZA 2R4UA 1U94A 3KEOA 1H0HA 4YV2A 3T3OA 3HYCA 2QEQA 3WR5A 3QKSA 3EAGA 4G25A 1XZ8A 3EQ9A 4QEDA 2EP7A 1KKMA 4RCVA 1MRSA 2CFTA 4IV0A 3AEUA 4X60A 2ODNA 4EB3A 5C34B 5ITWA 4NKRA 4QSHA 5EWJB 1C3OB 3SHTA 1HTWA 4EQZA 4F4HA 2C84A 1QGOA 3BXHA 1HZZA 5TMEA 3L3BA 1R0XA 1MOPA 1SC3A 4HLNA 4I99A 4R1LA 3TPCA 4M6WA 3UT5B 4XKJA 3IPXA 1JGTA 3MAJA 2Y1XA 2ZZKA 1HYBA 4YROA 4AWBA 5M7EA 2R6GA 1JVBA 3BSFA 1AZWA 3T12A 5E9QA 1ORVA 5I9TA 2B20A 2FFRA 2R5FA 3GMIA 3KQMA 1K8YB 4I4TB 3I92A 3OFKA 1MD9A 4RIGA 3W1EA 5L4SA 1H9CA 3V4LA 4B71A 3K1TA 2W2LA 4R6XA 4RJLA 4KE9A 3SHFA 5E6UA 5CNIA 3UAYA 1TUEA 3JRXA 5T67A 3DDWA 4Q02A 3SQOA 4RGVA 5B2FA 4RAQA 4CKZA 3EXG1 4EYEA 1CCWA 1PVVA 3H4IA 4AVYA 2AXNA 3DT9A 3UUGA 2D1SA 2FEWB 1VL1A 3F8TA 5BT8A 3HB4X 4K3VA 4KN5A 2OBYA 4BKRA 4G8CA 5DFAA 1VA5A 4PBTA 4ASUD 3M5PA 3EZGA 3KZXA 1KR2A 4IKPA 3IOCA 3MINB 3VZSA 3UQYS 1PJRA 2X5JO 1GTL1 1IATA 1GPDG 4EW3A 3SLGA 3LBHA 2HM7A 3C6ZA 4FFRA 3CINA 3ESDA 1V6AA 2A94A 3QEOA 4WXYB 4CCYB 2OZEA 3T9AA 2P6OA 2WPNA 3LCUA 1DV1A 1XXLA 2JZOA 3MWFA 4EX7A 2GM4A 2AFVA 2ZE8A 2YVQA 4KTTE 1T1EA 1QZ3A 1U8UA 3AWDA 3W77A 2G80A 3C3CA 3B9BA 5GQSA 3QXSA 2RHJA 2IHJA 1H22A 4HPJB 3QPDA 4K6HA 4Q12A 1B6SA 2ZSAA 2JIZD 3IQWA 5JCOA 4BNZA 1L9XA 4M99A 1QDEA 3T15A 1GXSA 4NECA 2QW8A 1GNTA 4QQNA 2C04A 1NVVR 1QO0A 2JGFA 3AR5A 1EP3B 2SCUA 3IQZA 4DKXA 5IUNC 2C42A 3LJKA 4OXXA 1T6XA 1N6NA 2QGNA 1GU1A 2DTEA 2VK2A 2JK0A 3BA1A 4J6EA 2WJGA 4PO3X 4AMYA 2BFCB 1FLNA 3FN4A 3GNLA 4RZ2A 2WMYA 3T4EA 1UQUA 2X9VA 3BD8A 1JHDA 2XAUA 4D4KA 4JEMA 3AESA 4Z7OB 3QE4A 5LOVA 1EUCB 4XIIA 3VZPA 1YR7A 4Y0AA 5DW0A 5C52B 3TJMA 3U7FB 1GG9A 4C29A 1TEXA 4PX5A 4DHWA 1CP2A 1PWEA 1S02A 4OPMA 1OBOA 1YA8A 3PNPA 4D79A 4YUWA 5IDQA 3HCDA 1EVJA 3O90A 4RPKA 4KR2A 2ZB2A 2WABA 2E4YA 3UA3A 2HF9A 4DNOA 1P6UA 3GT3A 1DWQA 5ERXA 2C5FA 4Y3UA 4LRSB 2PQ2A 3NHSA 4WRRA 4B4VA 3R9XB 1OWOA 2E6UX 3H9CA 1J0BA 3TLCA 2NMVA 1X39A 2BGNA 2Z4RA 1QGDA 2JF0A 2GMWA 1XTPA 3IJEB 4GMHA 1HI9A 3GR6A 1XNRB 3H5WA 4OAPA 1KK0A 1WHSA 5DI3A 1EZZA 1S0UA 3DE4X 4CMAA 3CIFA 4YY3B 3KB1A 4IZHA 3GT0A 4UCQA 1GGEA 1GV0A 1MXHA 2ALJA 3CJTA 4Q3AA 3WIBA 1C3JA 1W6RA 2VHJA 3IV6A 5TJ9A 3Q8WA 3FHLA 4O0LA 3BWVA 3DVRX 3HCEA 3K5WA 4H2DA 1B41A 4G2TA 1KJJA 4GEGA 2VSFA 4HATA 4TLAA 4UBKA 2FQ1A 3NT5A 1RP7A 3KSMA 2WF6A 2VJYA 4DCGA 1IJKA 1KYQA 4QAJA 5E4JA 1MORA 3FBTA 2L19A 4RU1A 1Y8RB 3CLHA 5HE8A 1BDIA 2JGKA 1JU3A 3ANTA 3KZ1E 3EMBA 3AJAA 2H1LA 2WKRA 4LJLA 4FX2A 3CKLA 3PNVA 1PR3A 3H2ZA 5E4TA 2ZRFA 4K1XA 5EERA 4C03A 3U7HB 1K6EA 4GE3A 2PUEA 3C6XA 1HE2A 2PANA 4MO9A 4QXOA 1FJ2A 3BIFA 5IZCC 3U3DA 1ABEA 1M67A 2OYCA 3MJEA 1MB3A 2CYCA 1M0SA 3QWHA 4JBHA 4EPXA 1SBNE 1WE2A 2JKYA 2J0UB 4BCCA 4DBLE 4AJEA 1Y81A 1VL2A 1Z22A 4PC7A 1XD9A 3DP9A 5CK4A 4UZEA 4FYIA 4CLRA 4Q21A 4BFZA 4HXYA 4ISCA 5F7OA 2JIQA 1KFKB 2YC4C 3AZQA 3IQIX 1OCEA 4S12A 2BHSA 2I6FA 1FU4A 1JJVA 1UKCA 2GXUA 1JYFA 4LC0A 2J85A 4XAQA 5I9SA 1TVKB 1U0JA 3QEJA 4DDTA 4DOMA 1NXVA 1ZNYA 4PGGA 1EMDA 3AYZB 3DZDA 1VSBA 3D8RA 3JAWB 1ZG3A 1GLGA 1GPJA 1RWKA 2QTWB 2XODA 4P2GA 5LOVF 4UUPA 2FPKA 1RWNA 3GFTA 2ERCA 2HNKA 4J9UE 1D0IA 1RPAA 1FNDA 4TM7A 1CDEA 3BFVA 4J2TA 2JFBA 1AX9A 4JHXA 3PS9A 4C1NA 4F3NA 1PR2A 1CY7A 4EPTA 1WF3A 2QRHA 1MIOA 1NQVA 2ZJYA 4G24A 4R69A 5AESA 3CU5A 4HNAB 3E05A 1YTUA 2WTNA 4L9WA 3SLRA 5HM8A 4MAMA 3QI2A 1JH9A 5F73A 1Q11A 5I3CA 5EXTA 1H4TA 4B2IA 3B70A 4FZJA 4IVPA 3CBQA 1ZGHA 3TOXA 3ZCPA 1KI7A 2ZE5A 4GGOA 1PEKE 1QONA 3P94A 3JD0A 4MP6A 1FL9A 1UJBA 4TMTA 1QS0B 2R47A 2XSZA 5HIJA 2F1HA 4LBYA 4HUQA 1LPPA 4E5VA 3U4MA 1XEXB 1C1DA 5A71A 2Q5OA 5TS2A 2Y1GA 1T13A 4YUVA 1EIZA 4CQMD 4NNOA 3P0RA 3P2OA 4RXTA 4XWWA 4RK5A 3F3KA 4KV7A 4XWKA 1NONA 2RK6A 3AP1A 3JYPA 3L9XA 3PC6A 1X92A 3E18A 3RSZA 3VZQA 1R74A 4MIYA 3W8RA 4BEJA 2HK8A 4LV5B 4CV3A 1OIWA 3K71B 3DHEA 3P4YA 1R16A 1YD7A 3E8SA 4WD3A 5F7ZA 2P6PA 3X43A 2F8TA 3WNCA 4DCVA 1A9QA 3DKPA 3R0JA 4EB6B 5F21A 5G3ZA 2R751 2QRUA 4C7MA 4YJDA 3GLQA 4D9IA 1A0OA 4EFKA 4POOA 3VHRA 1N4AA 4CLHA 2I9KA 2PKWA 4Q3EA 2AYYA 2FSIA 4L7VA 3C1UA 4HF7A 3PGJA 2IV3A 3MAAC 4CMEC 1XVAA 3OA2A 3R7WA 2CUZA 1CERA 2VWQA 2IZ5A 3GYGA 2DEUA 1JQJC 4HWGA 2BELA 3RS4A 3DC7A 5KWSA 1FE8A 5JMTA 4DDWA 5LA6B 4L07A 2YJZA 2HWKA 4YHHB 1SXJA 3EGOA 4IIGA 1U7UA 5ES3A 3QBTA 2ZSHA 4YAEA 1KHTA 2H9YA 4JJ6A 4L8GA 1DIGA 1R9JA 1HT3A 4CMBA 2WYIA 3EWIA 3HLKA 1KE2A 4M8SA 1KIMA 2CD7A 1WPRA 1ISSA 1SB9A 1U99A 3I39X 1XL0A 3IUJA 1CWUA 4NMMA 1HO3A 3GH3A 2HU2A 4IY1A 2HHCA 3BT7A 4ID3A 3L0SA 4HDKA 4MGZR 3HYRA 3RUIA 4JB3A 3EF1A 2F1IA 3ZC3A 3L7YA 1ZMOA 1VDMA 2XUPA 1FVHA 3CVOA 4UMVA 1IN5A 5D3KA 3TSOA 1T0JB 3I2FA 3NTLA 4Q9DA 2FDCA 3OCWA 3TTTA 1O6FA 4LHXA 5CAEB 1ZN2A 4YONB 1Y7LA 1KAMA 2QRKA 3F46A 1GA4A 3ESXA 1UBCA 2GN4A 4EJ0A 5KUTA 4CM4A 3WLNA 4Q9NA 1VG1A 4M86A 5E6SB 2IYEA 1ATZA 1O94C 2ZYHA 1E7YA 2IGBA 3HVIA 4ITRC 1U7HA 4UU0A 4YCMA 5KBYA 2XCTB 1I6LA 5E6RA 4MYSA 1P7YA 5JSKA 4PR0A 1QF6A 1XTZA 3CPSA 2BFAA 4PZUA 2EP8A 3PGMA 4MKXA 4LYGA 4CKBA 4BCBA 2Q4RA 2D62A 1WAMA 3TZLA 4PLCA 1XQWA 5KWEA 1QHGA 3L0PA 4N82A 1OBHA 1CUDA 1YQDA 4HDRA 4F38A 3O8RA 5HILA 4BKOA 1T24A 1OASA 4CVNA 4UHKA 1CQIB 1GG5A 2I7CA 4JOCA 3USZA 2TS1A 2ZDHA 4S24A 3UK2A 3D3NA 4ZOQI 2OWEA 4WZBE 2ZM6B 2VF5X 3K0CA 3NIWA 1D1PA 2GYVA 2B78A 2Z3ZA 2C2WA 1VSUA 4OHVA 3ZCXA 1FSGA 2D1RA 3FZGA 1NF3A 1FFCA 5D7BA 1QRSA 3FTEA 3NBYC 2WSSA 3V2HA 1PEYA 2VJDA 4IOJA 4FB4A 3QKUA 4BP9A 5JY6A 1ZMRA 1KMQA 1I5RA 2CL0X 2H1HA 2I5PO 1F4PA 4RA9A 2JLUA 2PT5A 4QPJC 3REFA 2DPMA 4L4RA 4ZO6A 4MYHA 4CMIA 1VRCA 5EMLA 3O38A 2NQTA 4M1KA 3DDUA 5K0ZA 4R81A 3T3EA 2VDJA 4RGYA 4UVIA 3RTEA 3OH8A 2OZLB 4Z5XA 1SULA 5LN1A 2FMTA 3ZDBA 3STHA 5JOQA 4D9CA 1Z08A 3DEIA 2BFEA 3ZZMA 3DAGA 2Q7DA 2YWFA 2I80A 4UUBA 1L5ZA 4LC9A 3JARB 1YBFA 4RY0A 3FVTA 1R4NB 4WCDA 1QAMA 4UQLA 2PGIA 1TA4A 5K4GA 2EL9A 4D9EA 4MDEA 4J75A 5I5GA 1DAPA 3NHPA 4A10A 4KN9S 3OIGA 1JP7A 1TKCA 4B3TB 3MNFA 3G9XA 4UARA 2CVHA 1JI0A 3OC6A 3AHGA 4MUHA 4FOPA 2BGWA 4QFBA 4N5IX 3VPDA 5C18A 1N8SA 4GL4A 2BGUA 4RMIA 4OQEA 2F64A 1FX1A 4RPHA 3O4IA 3W2GA 2QG4A 4TWJA 3IEVA 1TC2A 2HNAA 4HEQA 4UEQA 1O54A 3R09A 4UD2A 2CHEA 2QB5A 3BB4A 4GBJA 3RSQA 2RK4A 3P96A 2B36A 3HDTA 4XWYA 5KCZA 4M9RA 4MP8A 4O3FA 1KO1A 2ZCJA 3P2YA 3PLRA 3WZMA 1TCVA 3EVCA 3WI7A 2OHIA 4RVUA 1XO1A 4PX9A 1M2OB 2PMCA 1FMJA 3SX0A 3VKVA 3TLEA 4ETMA 2QDKA 3CVXA 1RLJA 5K3CA 1L4GA 3BL5A 4HDAA 3LGAA 3T3NA 5CXXA 2HIAA 5LQSA 4E13A 1YQGA 2YWXA 4AIRA 5KDDA 2O0MA 4OXNA 5FADA 2CV1A 1KI2A 4NSNA 4AX4A 2G0AA 1GPWB 1GGVA 2IU6A 4WK6A 4F21A 4ZT6A 3DT6A 3C14C 4Z0NA 2VOJA 4YYEA 2P9BA 4ZDKA 4PIVA 1PZMA 4MJLA 5BV1A 2JGAA 1JFVA 1E0SA 1BFUA 1SQFA 4OMUA 5JC1A 5KJ6A 3OZRA 3U9LA 1DJMA 2G28A 3LSYA 4B6SA 1AT1A 3UKDA 4B3SB 3QVWA 4MYRA 1TJ4A 3QVKA 3H97A 4X71A 4EEXA 1FVFA 2QT9A 5DW3A 4MWDA 4BO6A 1ESNA 3R3YA 4BMNA 2NQ8A 4G01B 4R1PA 5CITA 5HMMA 3UYLA 1P7VA 5IJ9B 4OQXA 2QAGC 2QJWA 2CXTA 3DOJA 4LHEA 4RETA 3IESA 2C88A 1R8QA 1H93A 1KK3A 2VHCA 3ELWA 1VE1A 2OQ2A 1C30A 3I9FA 4M1OA 4MS4B 1PT6A 2YCLA 3PQEA 5M34A 4NZ9A 4BATA 5I8PA 1SQGA 3GJSA 2WSYB 4TTJA 3D7LA 5KZMB 4CNBA 4EABA 2W7TA 4M21A 4URFA 1N3IA 1SRRA 2BOVA 2FR0A 2WF5A 1D4AA 3E23A 4GOND 5D85A 3TL2A 5BYBA 3DWIA 1S2LA 4H18A 4LSZA 5DM60 1GL3A 3QEMA 1TLLA 2ZIUB 4ENWA 5CX1A 2WT4A 3TQIA 3WL6A 1WV1A 3JW8A 2GX6A 1XP5A 5AHOA 2JLYA 2BBWA 1V11A 3LRXA 3PIRA 1ESCA 4FZ3A 4IYJA 1NM5A 3KEQA 5AW9A 4RS3A 3RFFA 5I8WA 3GYBA 4WBSA 1AQJA 3MAGA 4OI4A 3ZDEA 4FJ0A 5IK2A 3GLUA 3UJ8A 3VV3A 5GJCA 5BWMA 2CEKA 2C2HA 2WUVA 4KTVE 1JEJA 1W0JA 1CUSA 4V0LA 3GOQA 1XWFA 3WHIA 3FTNA 7GPBA 2XH8A 4JXKA 4BVGA 2NO6A 5J2UA 1SQ5A 4QUBA 4YREA 2A0KA 2AK2A 3HVHA 3OFVA 2X8LA 1ZP6A 1ZU5A 1R6TA 4L4SA 5SYMA 3FNRA 1L7MA 3CUVA 2GLTA 2IP4A 4B85A 4ZOAA 4UBIA 1E63A 3O93A 5F2EA 4IVRA 2GD0A 4U6SA 3AJ8A 3I3SR 4N0MA 3EG9B 4IL5A 4Q1FA 5BSTA 4LN1A 4OKIA 4U7HA 4F97A 2JBAA 2NSHA 3AF4A 3MCTA 1OWMA 5A4FS 1DNPA 2W6NA 4QTZA 3V34A 1BEEA 2QJOA 2NO7A 2UAGA 1X2EA 5D7NA 3JY6A 2XB9A 1T5BA 2JLRA 4N5NA 4Y1EA 2XHEA 2O2EA 4G4JA 4RF5A 3TZHA 3KKPA 3KIPA 1KTVA 3FG9A 1AF4A 5DM2A 4Z3OA 3HXLA 4ZVTA 5HF6A 3ZU2A 3TL6A 2ES4A 3A4IA 4ARCA 4MW1A 5DNWA 2CLLB 3NBKA 2JLZA 5JSFA 3LLVA 4MVWA 3NONA 3IQHX 3TLZA 1U9YA 3T0FA 2V3CC 1JHXA 3Q7IA 2MTBA 2WJ6A 1AKVA 1IY2A 3BYZA 1N2JA 4Y98A 3U26A 3PF8A 1C9NA 2A5LA 4I9HA 1QUEA 4LDQA 4W9RA 2I87A 1M1YA 2PGXA 4L2IA 3UK1A 3AVVA 1G5PA 3D6JA 3ITDA 4TVKA 3UC9A 5NULA 3W05A 1NSYA 2HEIA 4IQ4A 1G291 3EDQA 3V1MA 3ZLVA 4DSNA 5BSMA 3QIAA 2IHUA 5KTMA 3MMPA 5AD1A 1EGMB 4L7QA 3THYA 2G0NA 3ROKA 4EITA 1RAIA 1KEUA 2YNMC 3WISA 4DLWA 2XSZD 3KQTA 4H1UA 1QR2A 2WJHA 3BQNB 3JQFA 1K3UB 4MV4A 3V97A 3QVJA 4TVOA 1SKBA 3DF7A 4B7AA 1XQXA 1KZ6A 4ZK2A 3W34A 2GASA 3I4FA 3IDZA 2I03A 1Q19A 1JXQA 2A59A 1VLQA 4RULA 4GSLA 3CNLA 4GI1A 2YQZA 1OKKA 2PNFA 4P84A 2XUHA 3SF8A 3WZLA 5J2TA 4U9HS 2BM8A 1T5LA 1ZK0A 3CMCO 4NI5A 4V1CI 1J22A 1UMBA 1QQ7A 2VHUA 3D81A 1PJ4A 2AQ8A 1R4ZA 3K7EA 5LBUA 5HIAA 1NQXA 1PN3A 3RYCB 4Z9BA 3TZBA 4P0QB 3LW8A 4W9NA 2G1AA 3ER9A 1LX7A 2BLNA 1QUFA 3KO8A 5DNCA 4WK0B 6ADHA 5J2UF 2ZIGA 1UL1X 3BM5A 1XZDA 1DI0A 3D2CA 4AUEA 4LZOA 1O8BA 5DU2A 5KB3A 1YC2A 2EARA 1KPHA 2UVQA 3NEJA 2HX1A 4XLTA 3UAXA 1Y6GA 4Q4AA 1CRLA 3SNKA 3GZNA 1FNCA 2EU8A 5HDQA 2ZU0C 3LT4A 3GNTA 3T1QA 1ZCFA 1OX6A 2WZQA 2AJTA 3PE3A 3GDHA 3LYUA 1SXJD 4ZVNA 3KT6A 5AKJA 4YAKA 1VJ1A 5IXSA 1HORA 3WLOA 4C4ZA 4INPA 5FFNA 2C97A 4HZGA 2VSQA 1ZNQO 3PFKA 3ME5A 3D2BA 1DELA 4LX0A 3SS7X 1QFZA 4BV3A 1YFZA 4ZTUB 4J0QA 2PT9A 4ND4A 3S29A 1OXKB 1GQQA 3GCWA 3QW2A 1JMKC 4LXTA 3ZKWB 1Z06A 3K6KA 3LDGA 1WTAA 1LFAA 1RKUA 3SC2A 2PJUA 5BMVA 1W36B 1NE2A 4Y2UA 1P29A 2BAGA 4IHAA 1Y80A 1HLGA 5DWVA 3ND5A 2I8CA 2ZPTX 1K27A 3DB2A 4KE8A 2ARKA 2OBXA 4UE3S 1NVXQ 1QM5A 2I3DA 4NH4A 2ZRIA 1MQ8B 4TZ0A 2IPXA 4JJEA 4L0CA 3SIRA 1UMDB 1BCSB 4EYKA 3EUAA 3K9CA 1YZLA 1OF1A 4JQCA 1JZTA 3GHYA 4KQFA 2XYHA 5JIBA 1H2HA 2ZQZA 2V7WA 3HKCA 4WOPA 2IH2A 5EAIA 3U56A 3BRSA 3PCRB 4JVMA 4B40A 4Z4IA 3DHYA 1M6VB 1G3RA 4AF6A 3AL2A 3HSYA 4X85A 1Q16A 2YW2A 1OXMA 5BRJA 3KLBA 1IYZA 4WZBB 2X41A 1I5EA 1HDIA 1T5DX 2X8BA 1JEYB 2XWBF 2I7DA 4RV9A 1Z7YA 3DOHA 1XZQA 4WZAA 3VNRA 2O8BB 1QRAA 1DIOB 1F6WA 1NFFA 4UMEA 3V8VA 1B26A 2HA0A 1P7CA 3Q9UA 5J2TF 4BNDB 2AFRA 4EK9A 5TQ0A 3EDMA 3BZUA 3MIIA 4NONA 3U7EB 3ZHTA 2IHYA 2ZREA 3CYFA 1NF9A 2QTRA 3P9NA 1RZRA 1JFTA 2Q8PA 2CBXA 4Z9FA 5JTTA 2J6BA 2CUTA 3EXIA 3R2JA 5GWXA 2D00A 4JZKA 5HKKA 1ARZA 5ABPA 4PQRA 4P92A 1VTKA 2I6UA 1D1SA 1T9DA 1V7PC 2G5CA 2ZYGA 4P2BA 4AF7A 1TM5E 5KNBH 4B8ZA 4CM8B 1TGVA 2XRYA 3G2HA 5JXJA 1MC1A 2NV6A 1NXSA 1NPDA 1I4OA 3IQDB 4GWGA 4LDPA 4BNHA 1E7QA 4B3IA 3ZZNA 4I55B 3V1UA 1M2GA 2AA3A 2AMVA 2G76A 2P5UA 3K70B 4GZ5A 3AFIA 4LNUB 1NKVA 3MILA 3A31A 1X2BA 4NZZA 3ZW7A 3CKYA 5ILOA 1PP4A 3LM8A 2W48A 1VP9A 2C9ZA 3E81A 1G5QA 1E5VA 2WP8J 5H80A 3MEQA 1WDKA 1FTQA 2Q5CA 4P4UA 3IPYA 4MS3B 4B44A 3WGVA 1LWNA 5BMVF 4JI4B 1L4FA 1L3IA 2VBIA 3NB0A 1KXJA 4PCAA 3ENVA 3OSZA 3X2SA 4A1OA 2C1ZA 4ZYZA 1P39A 4BCDA 2FJPA 4Q19A 4QU8A 4WEOA 1Q20A 2GEUA 1UBUS 4F7DA 5JADA 1A9ZA 1LKZA 4UBNA 2DXIA 2FMKA 3FW1A 2WIGA 4ZV7A 3O8CA 4C5AA 4X92A 1EZ4A 2BMWA 2VHVA 2LV8A 5TVKA 1F9AA 2BFDA 1EBUA 5GONA 1A8IA 1W25A 4OQFA 5C3UA 4ZU6X 5E4FA 3CS3A 3D5EA 2AE1A 4HMOA 1C9MA 3RTDA 3GU3A 3I32A 1KI9A 1HMPA 3BGSA 3FDXA 4OL9A 4PVDA 3NM5A 3O3CA 2BFMA 5HFJA 1ZD2P 3I9MA 2JHGA 3EQ2A 2GH1A 1P1KA 1IB0A 3B6ZA 4OOFA 3RD5A 3M9LA 1F8XA 1N5MA 2J08A 2V5AA 4M1QA 5G02A 3UB2A 4OVKA 4BNVA 4MYCA 4HQOA 4OHUA 2I0FA 1YCGA 3S1AA 5HP4A 5G1PA 4EKGA 1IVNA 1WB6A 3PQ7A 4J0JA 1XD2B 1WDLA 3IP7A 4WECA 4YJHB 3UHJA 5G1NA 4MUNA 1TMKA 3BXEA 4ISBA 4K9RA 4TMWA 3QA3E 3RUFA 4Q03A 1GEEA 3CCFA 2J3DA 2P9YA 3DM9B 2VAMA 4DLBA 2WNSA 4EQ6B 1VQ1A 2XKAA 1YJAA 1U8XX 3PF9A 4MQMA 2OHJA 3VR6H 5A06A 3WBBA 4A36A 3D0OA 5HKAA 4WZZA 2P35A 2GYYA 1IQPA 1U9ZA 2I6XA 3GZJA 3IEXA 2IV7A 1E1QA 2WZBA 5LDGA 3C45A 2P0AA 3H2KA 5TQJA 1XEAA 3N2NA 4A7PA 1E0DA 1OI2A 1B6GA 4BZQA 2XQIA 3ELYA 3G7NA 4OHMA 3TRFA 2XCSB 1Y1LA 2QLNA 4L16A 1Q77A 2BFBA 2WOOA 3N0TA 5FOWA 3RV4A 3OA0A 4BVBA 2PMDA 2FP4B 1PBTA 3NC1C 2LNDA 3UMBA 2FCAA 4ARZB 4DLAA 1UUFA 2RIRA 2IYYA 3VOAA 2IZZA 3SD7A 3H5RA 1JDNA 4NMHA 1TK3A 2GZSA 4BX0A 1N2BA 3K20A 1R8SA 5TY0A 3KAJA 4BPRA 1FX0A 1JQEA 4RX1A 5EIXA 1W0JD 1QP8A 2R3SA 1YULA 4DLSA 2Q6OA 2DQ4A 3ROMA 2JC3A 2P41A 2XJ9A 2ZATA 3LX6A 3ZHXA 5SZHB 1N9KA 2JD1A 5B3JA 1XJ5A 3EQ7A 3IAEA 2ZI9A 2ZIXB 4PGAA 5ENVA 5GONF 3PD7A 4G1FA 3F8WA 2ZKIA 1H3NA 3E5HA 1ZRNA 1FYDA 2B94A 3PC2A 1WEKA 4M0UA 4S1WA 3SFTA 1XTIA 1CUXA 4ZJZA 3OLCX 1YRAA 2W70A 2DR3A 1TCBA 1XTSA 1KZ9A 2XZPA 1SBZA 3N8GA 4P0PB 1V1MB 4DMUB 4LKOA 1FF9A 2CXNA 1DCTA 4LDNA 1G7RA 4JBIA 5EQDA 5BN5B 3WKEA 4RHCA 1DEKA 1V8FA 2IPNA 2V58A 3A2LA 1EB8A 1Z37A 2AH5A 1C3EA 1LC0A 2JHAA 2WAMA 1VJRA 3MWLA 1XDZA 3GMSA 4YYZA 1VIAA 5L8VA 3ZD8A 3OT4A 4DREA 4JJ8A 5I47A 1TTPB 1DIHA 2V1XA 3NZEA 4LXHA 5ALGA 5ALTA 4EO4A 3PL1A 4PTYA 1C0LA 3L84A 4HVAA 3DKVA 3S7ZA 3ZK7A 1EG7A 1HFWA 1RJEA 1P5HA 3FE2A 5I8ZA 4CR7A 4BO9A 1Y1QA 1F9EA 1VE3A 1YS4A 1NUTA 3MW8A 1B6RA 5JZVA 1DJNA 1RWXA 4H1HA 3LCMA 4PQFA 4E21A 2JLCA 3KSUA 3C24A 5BQOA 1Z17A 3KJIA 2P9ZA 2BSAA 2PH5A 3BIXA 5IDVA 4R40A 4AZ3B 2W2VA 5I7WA 1R6VA 4DV1B 1VLZA 4MJ3A 2COKA 3PWSA 4U2FA 3AHHA 1PJBA 2PLRA 4K86A 1KOLA 3T4UA 4OG2A 1OPXA 4HB4A 3OOYA 3W3AA 3ZU4A 1V8PA 1WG8A 3O8OB 3EVGA 3F49S 3IIJA 1KERA 3P9RA 1OKKD 4P1ZA 2ZRKA 5AXDA 3I73A 3IOBA 3E27A 1DVRA 2PGJA 2QN8A 4G0PA 3IOEA 2EHDA 1JH8A 4QLOA 1OR8A 1RDFA 1W1WA 2P1RA 5CB6A 3HYTA 2YBEA 4PQGA 4ZQBA 2K2WA 1SVLA 4NX2A 4X3OA 3WXBA 3AB8A 4F93B 1HZZC 5U4QA 4JJ7A 1VJ5A 4UOZA 2QRQA 1SGWA 2X4LA 4L5JA 4REOA 3BGVA 1PFUA 2JCXA 4N65A 4YDSA 4EGCB 4AJLA 1TYBE 2C5BA 1YC5A 4E2FA 3ORYA 1E7MA 1VYVA 1OLSA 4KSBA 1WXHA 1K7YA 1RRVA 2EFJA 5BSKA 2PMFA 2VQSA 3FSEA 2AN1A 1TL7C 2R60A 2ID8A 2XV1A 4RVSA 4TZ6A 2BVNA 1UKEA 1BDJA 5FWXA 3SY8A 5DE3A 1UWVA 3ZTTA 4QUDA 1E2EA 1Z18A 3F67A 3GK3A 5AJVB 1PGOA 4RD4A 1KRXA 5BV8A 4JFAA 1HM5A 2XUQA 2EW2A 4RA6A 3KDAA 2C7VA 4AI6A 1ZJJA 2HMWA 4AJ9A 1E3MA 1YZUA 3DE7X 1QG0A 2DWCA 4MV7A 1PYGA 1VG8A 1D1TA 3DZBA 3N2ZB 3PZRA 4JL5A 4Q7LA 4DSTA 1TO6A 4K6FA 2RBKA 5F78A 4WPGA 2OSBA 4IDEA 1U9IC 3AEYA 1VG9B 2UV8A 4GLFA 2GEJA 2JK1A 1KZHA 3RARA 3TQCA 1O7JA 2AEEA 3FHTA 3NASA 1O2DA 3DD1A 1NRWA 3F78A 3B1YA 1DXHA 3RS9A 5ALVA 4GRAA 4V03A 4URXR 1O6CA 4BAZA 5TMBA 4UPVA 4QKQA 3D8BA 1BS2A 1MR3F 2XMGA 2IDZA 2I3GA 2VSYA 2OB2A 1QK4A 2WYOA 4LZAA 4F45A 2WAOA 5C37A 3G0HA 1W2WB 2GM3A 3PKIA 4TYPA 2Q07A 4CMKA 1NQWA 3DOUA 3IUPA 1LPNA 2H3EA 4LOKA 3DQQA 4M87A 3SKYA 4CMCA 5K3EA 1KZYC 2CMGA 1CF4A 1ZLXA 5J4VA 2I8LA 2XOKA 3WJ2A 5JBNA 2OKCA 5LZ5A 5CH8A 1THGA 1WU7A 5BN4A 3TD9A 2P2DA 4BOYA 4XUGB 2LKCA 3EIXA 1HMYA 3LKZA 1BWRA 3G89A 4XB1A 1US8B 2NUPB 4DUPA 4CIAA 5K8UA 1GKIA 4UAUA 3TQFA 1B8VA 5HKKD 1ZZGA 3LQQA 2HHHB 1F4LA 5AXBA 2WWYA 3ETCA 1D0SA 4YEDA 4A6XA 4J0FA 4QUIA 3RE1A 3OPMA 4JL6A 3ZS9A 1LW6E 1T29A 1Y5LA 1OI3A 4Q3CA 1CEEA 2REBA 1AUOA 3WSVA 4B7ZA 5C5EA 4DA8A 1LLCA 3JZFA 5DHSA 3NDPA 1T3ZA 4M53A 4C04A 1EAYA 2CL5A 5I7SA 3D6TB 4G0YA 4MPJA 2CD9A 1WULS 4G5OA 3GDOA 2R1TA 4MI9A 2IWHA 3C4VA 4C4TA 1JBQA 2VTBA 2J4FA 2Y2UA 1XRMA 1SUIA 3UMRA 3ZUGA 2DX7A 1UEXC 4P83A 2F43B 4BP1A 3QSYA 1KZ7B 3U3JA 1SCQA 3PUKA 3PXCX 1B8NA 2XNDA 3QQPA 3ZXYA 3A4MA 3PPWA 5FF9A 4E4RA 4OGLA 2GZ2A 1ZX1A 4GECA 3A4YA 2XXAA 1OLUB 5BN3B 3ZR4B 5IH3A 4COOA 1XDUA 1CUCA 2QRVB 3GC6A 5IUKC 3IMFA 5A7GA 4ZGGA 2PT7A 1F0NA 2QL6A 1TT5B 2VWPA 3MTAA 5D5HA 1RFGE 2H54A 2PQ0A 2OO5A 4KQXA 4PYLA 3SG0A 4YJ2A 2VAVA 2WWWA 1IY8A 1L7OA 3FJ1A 3R7LA 2YXDA 3NRJA 5B3KA 3IFSA 1HRDA 3F6SA 1IN7A 3ENZA 3TCKA 4AC9A 2J9ZB 1D1QA 3I0NA 1R0WA 2W6OA 5JDCA 3K0FA 1ZIXA 2E7ZA 1VE7A 1JHMA 3K4HA 4OJYA 2NTYC 4BVJA 2VKQA 3P7MA 3QOXA 4ZOEA 3TSWA 3RHSA 4BQQA 4EG5A 5HF5A 1FYVA 1NMZA 2EKZA 2Q28A 4AJNA 2I65A 3ZQJA 2ZYIA 2Y1WA 1M74A 5C4GB 3SQLA 3F5MA 3OZIA 4RY9A 3ZJVA 1XTVA 4BJ1A 2QMEA 1N57A 1XZEA 2R6R1 4HWOA 3ZCVA 4PFSA 4ALNA 3GFQA 4RHYA 1FK8A 2ZWVA 4O4LB 1RKQA 3B5EA 2O8DB 5ADWA 5AT1A 1TGYA 2A5FA 2XMPA 3C6KA 4BTVA 1E62A 2C1EA 4ZMBA 1KGDA 2D2EA 3ZU5A 3RUCA 3BF8A 1Y4DE 5DYNA 1GPNA 1N2HA 1G4AE 1JV2B 2X40A 4M83A 4HV4A 5JBQA 4JI0B 1ML4A 2NNLD 3BMNB 1CQJA 3E3MA 2UVPA 1E6MA 3I2YX 1XLWA 3N7UA 3UBMA 1E58A 2WZDA 1QQ5A 2GERA 2P6MA 3O4FA 5B55A 4DB4A 1C2YA 1M1UA 2ENWA 1XVUA 4HUJA 4KQKA 3IMEA 5FL3A 1ZMXA 2J5BA 1K2WA 5JEEA 1K6MA 1L4NA 5ALDA 1P1HA 3JQ9A 5ALNA 1UKZA 1SCKA 1VPDA 4G5SA 5K4HA 3MUFA 3LC7O 5DTIA 1IY0A 1G2PA 3BF7A 4IO0A 4P80A 3I2GA 4TYMA 4ROTA 4AN0A 1E1QD 3DMDA 5L3SA 4UUOA 4ODIA 3H5LA 3ZE9A 2FWRA 4H4CA 1UZLA 3D7RA 1MGPA 2K5UA 2QTNA 3I9KA 1XU9A 3S1SA 4ARSA 2CDBA 1UBEA 2C95A 2VYFA 3JQPA 3LTNC 1GNQA 4YPFA 5LQJA 2QAIA 3KQLA 1I51A 3K0AA 5CG1A 1OH8A 3NKVA 4JBGA 4JBYA 2D1FA 4G1VA 2D4AA 2H5EA 2OV1A 4DQVA 10MHA 1PCXA 4AO7A 1PNTA 3DKKA 1K06A 5C1DA 4CKWA 1QGUA 5GM2A 1AMUA 2FN9A 4JENA 4K8OA 1GZVA 4MRNA 4ZT4A 4EF6A 4F4JA 3EDOA 3RTGA 2BFFB 3M34A 5FI5A 3PNLA 4YJ2F 3RUEA 1MX9A 3A26A 4QVIA 4PG7A 2DF8A 2PX4A 1O9HA 1DC5A 2IXAA 2QI9F 4YMSA 3FTFA 3PQFA 2WVAA 3A1EA 3GGGA 4Y2TA 2GCGA 1TM2A 3W6NA 1OT5A 4Y9TA 5IC5A 3G8YA 3NVKI 2F9MA 4IDHA 3L0CA 5KJCA 1EFKA 3TECE 1MBZA 2AD5A 2AGVA 2VL7A 3EN0A 3CLKA 4G0UA 2HA6A 2PZJA 2CKMA 5ALEA 2EP5A 2HUNA 1SZPA 3Q8KA 1V4NA 5AVZA 4PLZA 1BAPA 1GARA 3ND7A 2GSDA 5DHRA 5AOAA 5F77A 4NYMQ 4HWTA 5IAOA 1NDQA 4LMRA 5DHUA 4US2R 1DX6A 2NYUA 4MW6A 4QIHA 3L7MA 1K75A 1YI8A 1ZQ9A 2WF8A 3IAAA 4URZR 4RVDA 3LYLA 3OT1A 1XR3A 4GLOA 4M9UA 1JR6A 2ZJ3A 4G4SP 4NU5A 4YAJA 2OLEA 3BBPA 3EVNA 4ZCRA 3T1NA 5BQXA 3H18A 5EEGA 2WD9A 2OA0A 5EC8A 4TV8B 3D3QA 2IU0A 3KQVA 5KTPA 4JI7B 2QNBA 4MINA 2IIBA 2PKYX 1G20A 2IEAA 4NZNA 4WY2A 4WLVA 4MUIA 4B0OA 3EH2A 4DQDA 4OKSA 4EA9A 3WGIA 5DGDA 1H2BA 3BSYA 3Q7EA 3LCRA 1RXCA 3KOYA 3SN6A 2GCEA 2WEKA 3PI7A 4W6QA 421PA 1PZEA 1Y3HA 2G36A 3BHIA 5I7RA 4LY3A 4FXOA 2CLHB 1CTQA 4JR0A 1K3TA 1Z4LA 1OZAA 5KI6A 2VJLA 1W94A 1X6VA 2G7ZA 3EFEA 4JROA 3K6RA 4QU5A 1UJNA 4Y0VA 4LYAA 3QUAA 1NTOA 4I1IA 3TNYA 5EE1A 5E95A 3GLHA 3OE7A 4YRAA 4ZV9A 2GK6A 3JQBC 1DWPA 1RLMA 1XQVA 2A1TR 1T9AA 1C1XB 3WYGA 1IHPA 4FFDA 3LUJA 2DLDA 3ZHSA 5T57A 2GXSA 3F4BA 1KMHB 5FUMA 3PCXA 3W3AD 3T1YB 4C0HA 1CUEA 1GCGA 3HA3A 1AN9A 1E0KA 2J7KA 5DLPA 3EMDA 2IOQA 3TX6A 1K9VF 2LUOA 5FR1A 2V45A 4TV9B 4F8EA 1E2GA 1WMFA 2FFQA 1VBKA 1A76A 1H85A 3OZVA 4OHOA 2FE4A 4BX2A 2CNKA 3UOAB 1OX4B 1LBIA 3OFNA 2HGZA 4RE5A 1SFRA 3R3XA 4K9SA 1N33B 1CY2A 3ESAA 1GCOA 4K26A 3HKBB 1D2RA 2QN1A 4W8GA 2QJTA 2E1RA 1CY8A 3NPMA 1U1FA 3AONB 1WNTA 4EVQA 1O8CA 3GJTA 4Z4HA 5FOVA 1Z5UA 5KJ1A 1C7EA 1WCV1 3FUWA 2XCRB 1PJLA 2GJAA 3Q9NA 1IXSB 2MSDB 1G6HA 1QTNA 3L8YA 4BYMA 3QBJA 2B6NA 1VZ2A 2NU7B 5DTEA 2C03A 3UMJA 3VTFA 2HJWA 1NVDA 2V7VA 5DRTA 3SEAA 5G2OA 4E31A 2QHXA 4Y2HA 1JAZA 3RVKA 3FM9A 3RVSA 4D0LB 1MIHA 5JAUA 1MN6A 3QPWA 4EGSA 1S6YA 1EFVA 1U2DA 5CLFA 1TCUA 3HB1A 3NLLA 5JAQA 1AKTA 2RJNA 2X76A 2IHNA 3C4JA 2X6TA 3DPUA 4F0JA 3OOHA 3RK0A 5KYKA 5LXTB 2Q0QA 4ZPXA 4GKAA 3LWZA 3ICQB 1JJFA 2IP2A 4MGIR 3G82C 3VTKA 1WMDA 8LDHA 3OLYA 4PU0A 4KV9A 2FJUA 2RSLA 4LRYA 3BB1A 3BFXA 3Q2OA 4WFQA 5IARA 3STXA 5DN9A 3NOVA 1W4BA 1OFTA 1SU7A 2O6HA 3K31A 2G4LA 4RSHA 3I6YA 5KQPA 5ALSA 1YS9A 1PFQA 1O5TA 1QK3A 4ND7A 5IF9A 2HAEA 2JHFA 1N1MA 1T8WA 1VKOA 3C3MA 5EN4A 4ZWNA 3R5KA 2EWMA 4NYJR 4GPBA 1WZCA 3WLJA 2D1YA 3G2LA 1QU2A 2EKBA 1NVAA 3RUHA 1R10A 4Q1CA 4KZKA 4B6EA 4J1TC 1Z6TA 4BRSA 4L5CA 3KETA 2PRJA 1E4EB 3PDUA 4YRJA 1ZSYA 3W79A 3HPRA 4Q9AA 1QMGA 3RSCA 4DJTA 2YYSA 3G49A 1ZEMA 5EMMA 3WG9A 2IELA 3EVZA 4OXQA 1O5OA 5AW1A 4TLDA 2CDCA 3IMKA 1NW7A 4DA6A 3EEOA 5C7IO 1XMQB 3RTBA 1T2VA 1GJRA 1OI4A 3WYDA 4J4HA 2V3WA 4DWJA 2HPVA 2PH3A 4LZNA 3EUWA 3PT9A 2FRXA 4TL6A 5EWLA 1C81A 4M0PA 2SHKA 3EPRA 4JI3B 4L78A 4D2IA 3UPTA 4FLFA 3JYLA 3BPSA 4WCFC 5EE5B 3I4LA 5DK4A 4L02A 2H2HA 3LHFA 5L3QB 1Q0UA 1JA1A 3IBCA 3VTZA 1VRVA 2BR3A 3HRIA 2H8KA 4AQ7A 1V6CA 2J9YB 2AEJA 3LCVB 2QBYB 1XJ0A 2E87A 1H94A 1NMQA 3FRIA 1YQWA 1KGSA 1Z0DA 4LIPD 3GRRA 3L7JA 3CWZA 2CSXA 3AUTA 3RVOA 2H92A 3RBXA 3E7XA 1MW9X 3E3OA 4B8YA 3N2EA 2NZXA 1ZVKA 2XNDD 4X64B 4E88A 2VPQA 3JYOA 5K3FB 3LP5A 1OVMA 1NM5C 1KBZA 3KEGA 4AMBA 4G07A 4N9QA 1FFYA 4KVFA 2JLXA 3ON5A 3NFYA 4EP1A 3ZNOA 1E7WA 3S5JA 4MCJA 3NUGA 1GEGA 2BI4A 1DTEA 2Q4EA 2CT8A 1VYUA 1I5OA 2TRSB 3O8QB 4QGAA 5BNTA 1PBNA 3EXHA 4XQGA 4PHTA 4EHFA 1BG6A 1F20A 3STYA 2KJQA 4WA7A 4BMOB 3AYXB 5ED4A 4UOQA 1RRGA 2J3IA 4LFCB 5JYDA 2QP4A 1MJ5A 2P5TB 1A8SA 1WLYA 4XJVA 4XVRA 5DCWA 3TR5A 3WSWA 1UZUA 1EP9A 3LS2A 5EZQA 1LSSA 2YY5A 1MH1A 2XB4A 1BD3A 4EL5A 3KYDA 4EFDA 5DTMA 1R8JA 1GQOA 4FS8A 3ICPA 3WKDA 1QFMA 1F48A 1TNDA 2A84A 3O9ZA 3JSAA 4AKSA 1XJQA 3QYJA 1AHPA 1ST2A 4YQEA 1UZNA 4YV7A 4C2TA 2Y8EA 5KTNA 3P0EA 4I5FA 2H9IA 1ADBA 2AR0A 1IEVA 3KVOA 3WGJA 1RXEA 1U98A 2FEPA 3O83A 3PFHA 1OVGA 4FMCB 4EDFA 5F23A 2Q2QA 4MX8A 4CFZA 4MR8B 3DVSX 3P19A 4OBXA 1MHPA 3UJ6A 5K8JB 1RNLA 2AN4A 3EVEA 5J23A 1VCMA 4XXHA 2YMMA 3UJPA 1WSBA 3A6KA 2O3JA 2OHXA 2NUTA 3HGMA 4B3FX 3DEFA 3IBSA 1HDYA 2QYTA 4CGYA 2TMKA 4NY1A 3LCJA 3RV3A 1T34A 4ESEA 4TQGA 2XEDA 4EY6A 3RYFB 3ZV3A 3RU9A 1Z8DA 2GEBA 2JNWA 2VNJA 4O1MA 2QZPA 4L8FA 1AO0A 4M46A 2EZ8A 2YOGA 2YWCA 3HCPA 4RADA 1P1JA 1YS1X 2YJ6A 1YQEA 1Z68A 3EGXA 1TW2A 4RLFA 5EE9A 5C5IA 5K8CA 2CF5A 4IZOA 4H7JA 1J42A 3NYQA 3FPCA 3Q3VA 4PGMA 4B6JA 3TGPA 4X95A 1BZYA 4LGCA 1FSPA 1J9GA 1KJ9A 4Z51A 4E07A 2C9MA 3GX1A 3I61A 2BPOA 4ZOBA 1EUYA 2XCOA 1Q1BA 1EEHA 1EVYA 3VNBA 1KJZA 4R9RA 5IM5A 1PUXA 4XTCS 5F1PA 2EF0A 3T5BA 4D25A 1TAUA 2QL5A 4JLKA 1U7DA 1NI5A 1Y9AA 5SICE 1CB7A 1VI6A 3FYUC 3W04A 4V1CB 5ITZB 1DLIA 1TO1E 4RF4A 2CE2X 1F51E 1J2UA 2AFIA 3AF5A 3EEBA 1H0SA 3WMGA 3WICA 4AY3A 1B74A 3C6MA 1ETUA 3MPUA 4YRPA 4RH0A 2GUGA 4O33A 4Q7EA 1P0CA 1Y5IA 2QRNA 2ZB8A 5K0CA 1J09A 4IGAA 5LB4A 3RJ9A 4EW6A 3II6X 2QP3A 2XADA 2X42A 5AICA 4YMLA 1W2HA 2G09A 2QW0X 4MUYA 2F1JA 5JS6A 2BKVA 4J0IA 4L4UA 4RMGA 1N9ZA 1V39A 3H2GA 3F4KA 2HF8A 2R86A 4KOAA 1ZOSA 1PS8A 4JMPA 4MH0R 3EB9A 5DLEA 3FDZA 2PRIA 1NW9B 1FJGB 5CDGA 4A26A 4RK4A 1R9GA 2F9LA 4DW8A 1CZLA 1K6XA 1UZMA 2FETA 3A6FA 2JAUA 3LUGA 3O03A 4JJGA 5TS3A 2OQRA 4UFPA 5BV2P 3R1IA 4NVRA 2G17A 2V98A 3F1KA 4GW3A 1G6KA 3OX1A 5DM0A 2YY6A 1N6KA 5DHPA 1CR0A 3CA8A 3CR3C 2ZAMA 3MWDA 5M2QA 1ECFA 2ZJFA 3MS2A 4DZZA 4JUAA 6ABPA 4KK3A 2O3QA 4C06A 3TR6A 4BLSA 3JALA 3WLKX 1P7ZA 3NP7A 4ZHQB 1I14A 4RMNA 1GIAA 4YUZA 5HJ7A 3TQRA 3VSBA 2QUAA 3I2JA 4ZCMA 3M6MD 4NEQA 1GZ6A 5KSWB 2I4OA 2UZ1A 3PUHA 3QEAZ 2VK1A 1Q3KA 2QZSA 3PR2B 2C2XA 2LXNA 1D6NA 1JJ7A 3EDRA 1BFKA 3KAKA 1U2PA 2A58A 2DKOA 1N0IA 3ITKA 2JZNA 3KCNA 1ORRA 5HFAA 1U6KA 2V4UA 1N92A 3ETEA 2AX4A 4A2QA 4RJKA 1TUBB 4ZO7A 4NC9A 4C0KA 2OHGA 4B6FA 2LW7A 4GM1A 4E09A 3LUAA 4F5YA 1C9KA 4J1QA 4UC0A 3HXOA 1O6BA 2HRDA 4MB0A 4OMFG 3P2IA 1ID1A 3NC4A 1G66A 5D3ZA 5LP6C 1YJ8A 3PUZA 3V2IA 2Y05A 1WZUA 4AZTA 2C4TA 5LMNB 1J9ZA 4MVJI 4EYSA 1L5SA 2D7JA 4NEHB 4NZPA 5ANRB 4BZZA 3A28A 3LF1A 3T06B 4Q3NA 3LQFA 4GOOD 1UBGA 1KDRA 2FEMA 1TE2A 3A9WA 3KZNA 3V4PB 4C0AC 4J16C 1Z56C 5DBIA 5JI3E 2JBHA 2ZGVA 5ALUA 4ZT7A 5KX5B 2FPXA 4C08A 2C2BA 3KVVA 2XUIA 5ADUS 1QVRA 1MNQA 1T36A 3HWX1 3PPIA 1XAJA 4O6VA 3A4LA 3R9XA 3BGWA 5HXAA 1IM8A 3DBRB 1J90A 4G0XA 1Y1PA 4FDVA 2IPMA 3OFND 3U4IA 5T3YA 3CBGA 3NIFB 4I1YA 3KAPA 1KAHA 5EJAA 3PTAA 4IJVA 3P32A 1YRLA 2P0YA 5BUZA 4KGVA 1SELA 2ZKLA 1FZTA 4HNRA 4OIFA 1ZH4A 2PCLA 4ZANA 4BKMA 2XE4A 3IMCA 2B1JA 2GZMA 3CSDA 4HEJA 3L77A 2BWJA 1ZISA 2GFHA 3GJ5A 2B2XA 5MDHA 2OBMA 4JJZA 4KO3S 2AOXA 5JHGB 5AK0A 3T61A 2JI8A 3S2ZA 3TCNA 1XKLA 4Q3DA 1N5KA 2PA3A 3DSRA 4KLCA 3FYDA 2EKDA 2O2YA 4IMJB 4MULA 4B3XA 1YZTA 4CT0A 4GI3A 4LSGA 2QG9A 3SZOA 1W30A 3H6GA 4WASA 5CD1A 1Z2EA 3NIBA 1L4KA 1HDOA 3O1HB 3UW3A 1T5IA 4EVIA 5HVNA 3O7MA 4CG1A 2BH2A 1E6EA 4IG4A 3EYAA 1Y48E 4F6RB 4IJUA 1SCUA 2PD3A 2FF7A 3OQ6A 2VUIB 4GPIB 4C0BA 2ZSJA 4EPWA 4Y8VA 2R5NA 5D1NA 4FINA 3MJHA 1DRKA 2IK8A 4PXAA 1H2FA 1ODCA 1KJWA 1WEHA 3NVMB 4HAVA 2M6KA 2BMEA 2KM1A 1PQPA 3F6RA 3LX4A 2RHDA 1U0HC 5KYNA 4DR1B 3M7IA 2Q5HA 4KXQA 5I51A 1A4UA 3UJHA 2MCFA 1RAFA 1XN1A 4ZZ0A 5IVHA 3KJHA 1JEQA 1JLLB 3HJUA 2ANBA 3COWA 2ZBQA 4HN2A 5EWJA 4UEKA 1PDVA 1C3OA 1QX4A 4F1JA 4FGWA 5HBRA 2B30A 5EIBD 3NOOA 3NANA 3WE7A 4NR0A 4PFQA 2ZWAA 1RMTA 1P17A 2WKQA 1NNUA 1JQDA 2W4IA 1TUGA 1O6GA 2EIXA 3NETA 2LCQA 2PX5A 1SUSA 3G5AA 5D01A 3UT5A 3Q7TA 4QTXA 1BHSA 4YT5A 5AVUA 1Z5GA 4IWYA 5ESRA 1KQGA 4GHWA 1Y1TA 8ADHA 3ZDDA 1TPZA 4C0QC 5A2QA 8GPBA 4BBAA 4BQFA 1LJ8A 3BRQA 4I4TA 2R00C 1EFAA 1XZBA 2BMJA 1F2UB 2O7RA 3B36A 1QMPA 4RTPA 1WLSA 4UQOA 4EH1A 3N87A 3W4JA 1TPYA 1G64A 4BRWA 3LGSA 4I5EA 5IKMA 2BEVB 2BMVA 2D2XA 2JW5A 3GBSA 4UAVA 2XZOA 3GJ3A 4RWEA 3AI1A 3JQAD 4H15A 5BXYA 1VC2A 4B4UA 4NJMB 3MG9A 2DQYA 5JYBA 1PS0A 2IIQA 4GC9A 1PFKA 3RYTC 2BZGA 5J5CA 4EMTA 3I05A 1B73A 1L1QA 2ICAA 2W22A 2EBHX 1Q95A 3QPBA 3MINA 3IPLA 4EGQA 2PUWA 3N05A 4J03A 2Q8NA 3SLKA 4BMZA 1KAGA 3STVA 1RJ9B 3A37A 4FOOA 2VRCA 5DPMA 4RENA 4CCYA 2CJXA 5IT9A 1JEAA 2RI1A 2A9VA 4IUCS 3TXYA 2A5YB 4KI7A 1SPXA 4J0CA 4XX0B 1JHYA 2XUDA 2WOJA 4PO8A 3DEJA 5HDBB 2PYIA 3CNQS 2Q6IA 3H7AA 4FMDB 4QNMA 3FUUA 1I9GA 4QYIB 4Y1RB 4D92A 2V6MA 2YHIB 5K8VA 4DJAA 1X1DA 4IXWA 3S27A 4WAUA 1XJCA 1ISGA 2AI3A 3D31A 1CY0A 2IXFA 5DNDA 3T7RA 4ZYYA 1K97A 3A1TA 3HJBA 4RPIA 1QP0A 4NQRA 2ODTX 1GD1O 4MTLA 4PX2A 2R8ZA 3SXJA 5G0SA 1GOTA 3TD6A 4OX9Y 1RYBA 5EJ7A 3QMMA 2B4TO 4KODA 3Q0TA 2BFCA 1XK6A 3IYLW 3RWOA 2DT8A 1QFYA 2C4MA 2JS7A 2RH5A 2IITA 3EC7A 2EXXA 1WO8A 1O95C 3PEFA 5CX4A 1EUCA 1J5XA 1PQ4A 3CLRC 1OTYA 4HDOB 5FX2A 4JGGA 3QTTA 2ZK7A 1DOAA 1R64A 4J0DA 1ND5A 5KO2A 4ZN6A 3DLCA 3WGUA 3UK7A 5HIIA 1JG3A 2YV4A 3FSJX 3I2HA 1G8JA 5JNTA 4JX9A 4EHLA 4DLUA 4A8JC 3EAQA 4BGEA 1QWSA 2ON6A 4HVTA 1M8GA 1ZD5A 5CT5A 1OH7A 2RGDA 1VP3A 3E15A 4RIFA 3OTHA 4I4TF 2C2YA 3AW9A 3TLJA 2ZUDA 1I1QB 3AP3A 1G5IA 2QQGA 3AZOA 3DYIA 1PSZA 4QYTA 3TTYA 2AOTA 1JG7A 3FFBA 1U6JA 3M5WA 3IEPA 1YKSA 1MRNA 3QU5A 1Q7GA 1BX1A 2XE8A 1PL0A 2ZOSA 3C8HA 3ZX5A 4PYNA 4JLVA 3IEUA 3L04A 4UNRA 3TW0A 2P0EA 2QM7A 3M82A 2QTMA 1K6IA 2FVYA 4N3BA 2WE7A 1PX0A 4DAOA 2XCQA 2AF3C 4ZYXA 1T8SA 4RQAA 4XPIB 2VZ9A 4XIFA 5B37A 3H5VA 3UICA 2VF7A 3D6MA 2IS1A 1Q14A 4N6OA 4YMGA 2A88A 1JQBA 1Y8RA 3SHQA 2CNWA 5IXYA 1FP7A 1KKUA 4DPLA 2DG2A 5TDHA 5EJ5A 4H08A 4IGEA 3U4DA 4AZVA 1GFZA 4LF8B 4I19A 4QG7A 1PU2A 4GAEA 4EJSC 1J0CA 1AA6A 3VDQA 4B46A 2I54A 1QYXA 1U2EA 3CUUA 3HDHA 2UUBB 1XRLA 3QLTA 4OV6B 3ESQA 3VDXA 3RBVA 4EHKA 2J0UA 2PZFA 4PYJA 4DL9A 3OZBA 3F7MA 4Y9DA 3C16C 3P9IA 2QQ0A 5KNBA 3H5OA 4JLPA 3PJGA 4YTEA 3E2PA 5CLJA 4HLCA 3HBLA 1HNNA 1N5DA 3PFNA 2C29D 4QL3A 4LY6A 3RCBA 5JG7A 5EEHA 1C1YA 5EKXA 5ENDA 3VHXB 3VRHA 1TVKA 5AJXA 1DAGA 2P9GA 3MCVA 3ABSB 5D86A 1WMAA 1BE6A 1U3TA 3GRKA 2WKPA 5G4KB 2X23A 3ORRA 2ZYRA 2RONA 2GAFA 2C7GA 3JAWA 3D2AA 2GJKA 3HN6A 1WSWA 3WYNA 2GRUA 5TGZA 3VSEA 3ANLA 3USCS 1SQSA 2J9FB 4DT1A 5A9RA 3GLGE 1UPAA 5AXAA 2IBTA 3ZJTA 4ZAXA 1L5KA 2PO7A 1ZGCA 2BKXA 3ZY5A 2HWUA 2JDIA 3FOCA 4OAOA 1HR0B 1ONBA 4MI3A 2IXTA 4FQ5A 1A5TA 2DBZA 4M3NA 3AUXA 4ZVOA 3M6LA 5B57C 3OM0A 4HNAA 1OXBB 4JOQA 3OPYA 2M1ZA 1WV0A 1FY2A 4V0MA 1Z3IX 4I1UA 3NPAA 4EKYA 3ICCA 3EBPA 3O3NB 2IXBA 2ZBUA 2VC2B 3HEBA 3IQXA 1KC1A 2FI1A 2I71A 2BV3A 2R9VA 5SY9A 6PFKA 2QN6A 5KOIA 5KS2A 5DWDA 5HG0A 3K6JA 2IYUA 1ZOLA 3REQA 5HJEA 3RH0A 1V43A 1QS0A 4LF5B 2C5AA 2X7XA 1DV2A 1RM5A 1YR1A 4HD8A 1W88B 1XEXA 1L7PA 2YQ4A 3TGWA 1ZI8A 4GMGA 3EW7A 1EVEA 3CCBA 5A5GA 3KQNA 2FGJA 3CVUA 5JI2E 1EQUA 3HH8A 1PL8A 7ADHA 2ZYSA 3EOBI 5IEJA 5H4GA 3R9WA 3DAHA 1EK0A 1PG5A 5JNLA 4BVAA 3MVEA 3IHLA 4X24A 1S7CA 5F2NA 1PK7A 1UM9B 3QPUA 4DT1B 1TI7A 4QLBA 1G5RA 1S2GA 1AHHA 1Q17A 2BONA 2DYKA 2Z2KA 3UV3A 1P2DA 1VGQA 4NZMA 4M1ZA 2D2IA 4K05A 1BYIA 2DOKA 2L0XA 3MM4A 4ME6A 2F4VB 3FPHA 1T5SA 2VJAA 4EY5A 2JLAA 3HXMA 2DBYA 2AXEA 1JLSA 2Y1FA 4BMCA 1EK1A 1ENYA 3LBAA 5LA6A 1KEKA 3OM1A 1GVNB 3MLBA 1T2EA 2VZ0A 3BH6A 3UJ3X 4IW3B 4E33A 3BTVA 3O4JA 3WFZA 3G17A 1RBYA 1C1HA 3FAKA 5JMPA 3KJXA 3WWZA 3R5HA 3AHDA 4ID9A 1JDSA 5HR5A 1NUHA 4FLEA 4IIFA 3D3KA 4LW8A 4WKNA 2V8OA 4XM2A 4NU8X 2ZYVX 4X5OA 4KVZA 4DJ5X 5FPKA 2O1SA 1KDPA 1JR3E 4GWKA 2NT4A 3RIMA 5L3VA 4RLQA 5AKHA 1BGWA 4R1SA 4W5TA 1T4CB 3FJOA 2FW0A 3B8HA 1ISIA 3GRFA 3JXEA 2H2WA 3RVDA 4YDHB 3FWZA 2EJCA 4CT5A 1DO2A 5K9ZA 1NYTA 5CEJA 2PS9A 3U1BA 3AHFA 1M66A 4KK4A 1NNSA 4PX3A 5K0LA 5CAEA 3N2LA 1EM8A 4MVXA 1GTRA 5B7NA 1DGQA 3IMGA 5EFOA 2YINC 1UAGA 5E6SA 4RS4A 3K9LA 2VZ8A 2AQHA 2FTKE 5FL7A 1EHIA 2F8SA 4MKHA 1GSOA 4OFWA 3TJRA 3O2NA 2HSWA 2JKZA 3OQBA 3KXDA 1Y1KE 3SSNA 3V7UA