1D04A

Comparisons of wild type and mutant flavodoxins from anacystis nidulans. structural determinants of the redox potentials.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
169
structure length
169
Chain Sequence
b'AKIGLFYGTQTGVTQTIAESIQQEFGGESIVDLNDIANADASDLNAYDYLIIGCPTWNVGELQSDWEGIYDDLDSVNFQGKKVAYFGAGDQVGYSDNFQDAMGILEEKISSLGSQTVGYWPIEGYDFNESKAVRNNQFVGLAIDEDNQPDLTKNRIKTWVSQLKSEFGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Comparisons of wild-type and mutant flavodoxins from Anacystis nidulans. Structural determinants of the redox potentials.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Electron transport
total genus 56
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 1999-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1d04A00
2RG1A 1YCGA 1CZLA 3OVMA 3NFRA 3ESXA 1GG5A 4YQEA 2B3DA 3KEGA 4QODA 3N3BC 5LBUA 1CZRA 1QHEA 1ZX1A 4N82A 4NULA 1BU5A 5NLLA 4CETA 1FLVA 4PTZA 2HPVA 5BUCA 3B6KA 1OFVA 2KQUA 2OHHA 3S2YA 1CZUA 1RTTA 2MT9A 4ZVMA 1DXOA 2HNBA 2XODA 1B1CA 1AKUA 4H2DA 1AKQA 1D4AA 2QX6A 4C0WA 1AKVA 4R81A 3OX3A 3QFCA 2BN4A 3D7NA 2FX2A 3NHRA 3HR4A 3UXEA 4DILA 2Z9CA 5EAIA 3GFSA 5TGZA 3U7RA 1TLLA 3NHYA 4HEQA 3R6WA 2MTBA 2FZ5A 1V4BA 2FVXA 3N39C 2OHJA 1DX9A 1D03A 5F12A 4BMPB 1RLIA 2QR2A 4U7HA 4U7FA 3OJXA 4HS4A 4LTDA 5LMCA 2WC1A 3GAMA 3ES9A 1J9ZA 3TEMA 1FVXA 5LBTA 1T0IA 3NHSA 1DXQA 1J8QA 3P0RA 3NHPA 2MOKA 2QWXA 2D5IA 4LAFA 2ARKA 3EDOA 1AMOA 4M0CA 2QX9A 2QMZA 1FLDA 4Y7CA 3ESYA 3FJOA 4YAOA 2M6SA 3F6SA 1KBOA 3FVWA 1TIKA 3LT5A 3SVLA 3UXHA 2BMVA 1SQSA 2QMYA 3QE2A 1X77A 5ULLA 1C7FA 1I1OA 3KAPA 3O73A 2FLVA 1CZHA 4GR9A 3OX2A 4D02A 2X2OA 4QOFA 4FGKA 5F4BA 4Y9UA 2XOEA 2V5VA 4OXXA 3NLLA 4QOHA 2QX4A 2BPOA 1FTGA 4ZVLA 4XDGA 2BF4A 1AHNA 3OX1A 2FAXA 3JSXA 2MWMA 3EYWA 1QBGA 4QOGA 4Y9RA 5FUQA 2Z9DA 1XT6A 3W77A 1SG0A 1QRDA 4LA4A 4YAFA 1H69A 3ESZA 3B6IA 2FDXA 3GFQA 4ICIA 5LLDA 4U7GA 1F4PA 3HA2A 3O2NA 3W78A 5LJLA 2BZSA 3B6MA 1AKRA 4S24A 2F1OA 1AKWA 1J9GA 4BMOB 2R96A 4DY4A 1RLJA 3QFRA 4QOIA 3NHWA 3K20A 4PTYA 3FW1A 3W79A 4XDHA 1JA0A 2FZVA 1ZWLA 4YAUA 4QOEA 5EA2A 2A5LA 1ZWKA 1YDGA 1YCHA 4N65A 1JA1A 5B3LA 4FX2A 4QOJA 3F2VA 5LVAA 2AMJA 3OWHA 1CZNA 3FX2A 3OJWA 1XYYA 3ZHOA 1YRHA 1E5DA 4ZVKA 3U7IA 2OYSA 4H6PA 1YCFA 4GI5A 3OWXA 4J8PA 3NHLA 1C7EA 3KAQA 1J9EA 4LTNA 2X2PA 4C76A 1QR2A 3NHUA 2M6RA 3NHKA 1FLNA 2QX8A 1XI2A 2W5UA 4FGLA 1YKGA 4NLLA 3GFRA 3F90A 1AZLA 1FUEA 1CZKA 3NHFA 1OBOA 5EMNA 3K1YA 5A4KA 4ESEA 1YOBA 1VMEA 3LCMA 1WSBA 5FX2A 3F6RA 1WSWA 2ZKIA 2GSWA 6NULA 2HNAA 2Q9UA 4CF6A 2FCRA 1FLAA 4YAWA 3TE7A 4YALA 5NULA 3RPEA 3N3AC 4PU0A 4F8YA 1OBVA 1XYVA 2Z9BA 1NNI1 2FOXA 5B3KA 3FNIA 4LTMA 4DIKA 1T5BA 3W7AA 1D04A 2V9CA 3G5MA 2N1MA 4FGJA 3NHJA 1KBQA 1RCFA 4ZVNA 1BVYF 5FA6A 3TZBA 1FX1A 3KLBA 3B6JA 5F51A 2R97A 4GQIA 1CZOA 2KLBA 2Z98A 2Q62A 3L9WA 3HLYA 5JROA 4C0XA 1AG9A 1H66A 4C14A 3L9XA 1AKTA 5LJIA 4N9QA 2V5UA 2OHIA
chains in the Genus database with same CATH superfamily
4MKRA 4DR5B 2FUG6 3PKIA 4V1CA 3KHSA 2FQWA 2P62A 4RAQA 4P7KA 5KJ6A 1BKSB 3C5CA 4IDEA 1FU4A 4LGVA 1LSJA 3A26A 4ZOQI 3ROEA 2I4RA 2CVOA 4DXDA 3UJ6A 1U2QA 2ESRA 3I28A 1SXHA 1WOYA 2R6HA 2YJ4A 2XTAA 3FTNA 5JCPA 1JYSA 1UC8A 2VHXA 4OJKA 5E6SB 1NHWA 2DR3A 3SHOA 2IH5A 1B15A 1UZUA 2FGJA 3HHPA 4GP6A 5FI0B 5BNIA 2XCRB 5HE8A 5LZ9A 1LRKA 4FYIA 3WGZA 3FMGA 1ZK3A 2B5OA 4X20B 2WZDA 2AQHA 1R8QA 4I5DA 2GYYA 2P65A 1NF8A 1WZEA 3K9CA 3SZOA 1CUYA 1JQJC 4X1YA 5K3FB 2AEEA 4IRUB 3S44A 1JZSA 2Y1XA 5KNBD 1ZX1A 2LGJA 4BLSA 4Z4QA 2K2WA 2A0WA 1PN3A 1RKQA 1DTEA 4BMSA 3PFWO 1G3MA 3JZIA 5K45A 4K2AA 3CO5A 4URUR 4JSTA 4WGFA 4M46A 2H06A 4OJNA 5KVSA 2BEUA 4BQFA 3L7LA 2NU9B 3TRIA 2IY7A 2EW8A 3EDYA 5HCNA 4Z1MD 2BM0A 2ET6A 1U3TA 4LRYA 3B6KA 6YASA 2QENA 3GD5A 2ENUA 1N9KA 1U0TA 2EWVA 3ETNA 3GUYA 1E89A 3O2QB 4E12A 3GVIA 4EKIA 3CCBA 4GU5A 3K0EA 4PLFA 1MC5A 3FCYA 4JR2A 4OLAA 1Y8QA 1C0LA 4XIYA 4BLQA 4JC5A 2NQ8A 4OUKX 5JIBA 4QREA 4CRWB 4F6RB 2G1PA 1SCQA 4QOSA 3WZMA 5FJJA 4PONA 4G84A 1LV8A 4BB9A 3AUFA 2G40A 4MWZA 4QHSA 4WSOA 4L28A 3Q5DA 1F2VA 1I0IA 2QE6A 2IQ5A 5AM0A 5K6RA 2H4WA 2YINC 4XSVA 3RC3A 1A4UA 2IF2A 1L2TA 3R44A 2UAGA 2EBHX 3EVNA 2A0YA 2OXTA 2JL1A 1TT5A 3HFRA 3TCXB 4UEJA 4NU6A 3L6CA 4UHBA 2ZSFA 3DVLA 2JLQA 2GBFA 1R0YA 1WLSA 4GPAA 3V8EA 1E9DA 3MCUA 4I81A 5A5VA 3U6KA 3PTAA 1LB1B 3H83A 4P22A 3T7EA 1EFKA 1W0JD 4ZCQA 3TQFA 4GMHA 2HCBA 3JSAA 3U48A 1VSBA 1Z4JA 3KQNA 3LRXA 4ZOBA 3AEQB 4ESOA 2IE8A 3V8BA 2P27A 4RIGA 2R1VA 4TTQA 1TLLA 3DMDA 4Q1DA 2SKEA 4Y9DA 4D98A 1H0KA 3PC8A 1XELA 1BS2A 2G5PA 1OYVA 2E87A 1SOAA 2PQMA 3KZXA 5EZYA 1M2WA 4JXXA 1E98A 2PBLA 5DMXA 2OA0A 2VT7A 5SV2A 3NH9A 2EZUA 2QPOA 3E7PA 4D4GA 3CLVA 4EEXA 3LKVA 1KQGA 2X15A 1BXRB 4QNMA 1V3VA 3MTJA 2WWTA 3QLUA 1TYBE 1LNZA 2PKRA 4U7HA 5FBRB 3M3HA 1WMFA 4DLSA 1O5IA 1YVRA 1U7OA 4OXKA 4UNNA 4BNJA 4CJXA 5EMHA 4GMGA 3V8QA 2Y1FA 3N0WA 3KPJA 1RWWA 1TCUA 3TLAA 1G5TA 5FYDA 5HVNA 3F3MA 1LQ2A 3IALA 5EIBC 5JAPA 3NYIA 4AY5A 3MEQA 1M2GA 2XYVA 5CEFA 4XWAA 1HL7A 1NVXQ 1BG6A 1JDPA 3GRZA 4IXWA 4DMHA 4AQYB 5EE3A 5CA1B 2ZB7A 3ZE0B 3GRPA 1TZBA 2CFIA 3L1KA 3N2IA 3NNDA 4QUKA 4EUSA 4KRFA 4L15A 1GA4A 5BVGA 3OEHD 4GOND 3L0YA 4X8LA 1XB2A 4L9AA 4KU4A 4NXNB 4J0GA 2GCNA 5EYPA 4FS8A 3PJRA 3TE6A 1GAWA 4GPZA 4MUHA 3FR8A 3FNFA 3GRRA 5HHTA 2RI1A 3Q2OA 3ZKWA 5FOQA 3VTZA 2P90A 2W2PA 1I2AA 4QRHA 2AUTA 4UOQA 1QV6A 4FGSA 2WWWA 3KT3A 1U9JA 2AYZA 5JYEA 4NYJR 1HOTA 1RAIA 4FFPA 3N8KA 4TT3A 1EG2A 1HL3A 3IR6A 1HE1C 2Q9CA 4I99A 1E5TA 4ZQFA 3CUKA 1Q0HA 2YV3A 3HKDB 1V0JA 1M1NB 1ARZA 1O89A 2HN9A 2OV8A 3CNQS 3DWIA 3QK7A 1DXYA 4QXQA 1KYXA 5JNLA 5JY1A 1ZK4A 4OP3A 5EESA 3FB1A 1GCOA 3TVTA 3N6RA 5JJCA 4X95A 2B4RO 1XQXA 1P0FA 1I24A 1RBQA 1C8VB 1SXJB 1G5QA 3VGPA 3M1AA 4R2LA 3UOGA 4FR0A 1M10A 1OXKB 1AE1A 4QPCA 1O4VA 2VH2A 2BMVA 1G5RA 3AR9A 2HO4A 1CS4C 2XADA 2MSDB 3W9UA 1N4AA 3AESA 1E2DA 2XA2A 3HEMA 4X45A 5G1NA 5J5CA 1ZBDA 5TMBA 4ZYVA 3FWZA 2BTOA 2OM2A 3LYLA 5EZSA 5FL7A 2V7EA 2VHVA 2BGWA 1AUVA 3VO1A 5DTEA 4Z4GA 5CP8A 1BU8A 2AKYA 4OJQA 1RYYA 2QRZA 3T9AA 1JKIA 2CVZA 2E4XA 2QM8A 1LPSA 3PHCA 4HZIA 5L3VA 3ZXIA 1KF0A 3FPEA 2WY2D 1AF7A 2RHBA 5JD6A 1XD2B 2G7ZA 3HE3A 5C9ZA 2QTHA 2PGXA 1AMUA 4RMJA 1GZHB 1I80A 4L8WB 4YHBA 3VR3A 3IHWA 2C29D 3ZQJA 3U7HB 2WI8A 4KE6A 1Q1EA 1T5OA 2GJ9A 4J1QA 3WRYA 3SNHA 4HAWA 2DR0A 3QU4A 1PF7E 1QTNA 2ZT8A 1OR8A 1X1RA 1DOAA 2PY6A 3H16A 4HGYA 4BNFA 3BT7A 3AVWA 1N3LA 1IM2A 1U3FA 2GO1A 2JANA 3K8QA 2OD9A 4LYEA 2DECA 4F0JA 1O95A 3ZHXA 1PGJA 1XEWY 3DONA 1ZHHA 2MWMA 4GUDA 4W7HA 5CDFE 5HZHA 1UOQA 4FJ0A 4G5QA 3IPRA 2M32A 5KQMA 4E5DA 1VLJA 2CW5A 4KI0A 3H6GA 4QYWA 4B1FA 5CB4F 3CFYA 2HMAA 4BN4A 2QRKA 3B13B 4PZ9A 3KFVA 1JTFA 3OPVA 1XRPA 4O4JA 3TZHA 3TAXA 1ZUD1 4JGBA 3H5IA 3J81k 1ZAKA 3T12A 2IJGX 1VBMA 3GV0A 3WWOA 3GP3A 4TTIA 2D7JA 2EAUA 2A2ZA 1W1UA 4AMVA 3LV8A 1GTSA 3GFVA 4GBED 1HT1E 3KKKA 3ZDFA 3NPMA 4IX9A 4YMTA 4BN0A 2KW5A 3GR6A 3AYZB 3NQ41 4FN4A 2XUPA 4JC0A 5LQMA 4PC2A 4EMBA 5ISMA 3ZS9A 1ZRHA 1X1QA 2DTDA 1AD2A 2LVBA 1Z7GA 4D92A 3L77A 4PLHA 2OV2A 2NPIA 3IPAA 1B73A 1PZHA 1A4RA 3VTAA 2QPTA 4DMLA 1SUFA 4CLOB 3WHIA 5HEKA 5JVDF 3IV9A 5DM1A 4LHWA 2J0SA 1Z0ZA 2C97A 5CH8A 3TIFA 4BV3A 1I4TD 4DT1B 4HV4A 1DU4A 1RFGE 1M74A 1D2HA 2BCEA 2X86A 4LXYA 3VI3B 1NLMA 1VMKA 4D9IA 3U7EB 3VKFA 1O87A 4EM6A 5BV1A 2AZDA 2DPXA 1H65A 2UYGA 4KHZA 4QYTA 1A8UA 2GBLA 2PGJA 5SY4A 3G23A 1KJJA 1G4AE 2OV1A 4EYGA 4B75A 3RRXA 4ZVOA 1CP3A 1RKBA 3SSMA 5IZ4A 3NC4A 1JFTA 2QRNA 2KJQA 2QT0A 5JJBA 1TUGA 3OUUA 2IZ5A 3VYSB 3WL5A 1AIPA 3E35A 4JWTA 4QDUA 2ZRDA 5AK5A 4F1JA 4TKUB 4BNDA 1FNBA 3ANNA 3LKZA 5DGIA 3W79A 5I7EA 1J90A 1KC1A 1PSWA 2OMEA 2I6SA 1Z6TA 2AJBA 5F78A 4BO5A 2Q45A 3N8GA 3BMCB 2YYAA 4KQMA 2MSWA 3BZUA 3T0FA 4Z4HA 2P9BA 4Q3KA 1YJ8A 1KOJA 3OFNA 2NQ2C 2GETA 2XWJI 3MG9A 4WADA 5CNMA 4A73A 2HK9A 3J7AC 1UFKA 4R2WA 1ZU4A 2YV4A 3RSLA 3HXOA 2VHWA 3AR6A 4KDCA 3DEKA 3U7QB 3V6LA 4D6XA 5A5EA 4JI1B 4BZXA 1AB5A 3I3OA 2D1TA 3U26A 2AN9A 2BT4A 2ZZNA 1JEEA 5EJFA 3TD2A 5ERYA 5A7FA 1K3TA 4GM1A 2IT1A 3ME5A 2JGEA 5AJTA 2CT8A 1GQQA 4WTOA 2EJUA 4A1OA 2CV0A 4JVNA 3OQ6A 4RWEA 4GECA 4BZZA 4D45A 2CDCA 3HDGA 2XUHA 4CIXA 4U9UA 2EERA 3FH0A 1F7UA 2I22A 2ONCA 3DCJA 4WOKA 1F2UA 5K4AA 3DQZA 4G8DA 1D1SA 2OOSA 2Y68A 4OL0A 3WLTA 1W94A 4ER0A 4B31A 1FC0A 3AERB 2PGAA 4B4OA 3N7TA 1LQTA 3MWLA 3FTDA 2JFHA 5AO9A 5CDTA 2Q5OA 1TO1E 2DHRA 4UARA 3TM5A 1GHTA 4ZGBA 2O7NA 4Z9FA 2Z6VA 5ESWA 1AGNA 5TSDA 2PXHA 4QQRA 4C7OA 2ORED 5KX5F 1AO3A 1WHTA 5IDXA 5BT8A 2B1GA 4JBGA 1J9EA 3UIEA 3UTCA 4DTIA 9LDTA 3BAZA 1YH3A 2BKEA 3T9CA 1C4OA 2ZREA 1H2HA 1RDFA 3CF4A 3ICPA 4OKNA 2YL2A 1T6NA 5FORA 1YS2X 3AETA 1BOFA 4YRRA 2VSQA 4ER5A 5EIBD 5FOXA 4LC9A 3FBTA 2WF5A 3D5EA 4J16A 1GU7A 1NATA 3L0CA 5C8YB 1JHUA 2WOOA 4B8ZA 2IBTA 3MUNA 2ZB8A 3QXHA 1YR3A 4W4TA 1W25A 1ODLA 2Q6OA 3ZR4B 1XN4A 3ZUGA 1YKGA 2QUZA 4XB6B 5AM4A 4MUMA 2JBWA 1KH2A 1UKZA 2Q1XA 3S6JA 3WK8A 1WX1A 3BGDA 4XGQA 1XNQB 1TA0A 1JAXA 2VCHA 1PZGA 3RCBA 3GQBA 1PK9A 3T3OA 1D3AA 3BDIA 1QVAA 2J3DA 1JBQA 3H9UA 2E85A 1WLYA 2VPPA 3KXDA 5JSYA 2WSIA 2Y0DA 2YZ2A 1TW3A 1Y82A 2YN4A 2WA1A 1WSBA 1DPFA 5K3SA 1KE1A 5EJMA 1L4BA 2EZ9A 4R2KA 1Y3DE 2H4FA 3R2JA 1JG6A 3DJYA 4FKZA 2JAWA 4IV8A 1HT3A 2H85A 3TI7A 3CZAA 4AKIA 4RLHA 3KM0A 4D0RA 2I76A 2VQ6A 4O5AA 3LDGA 3SDZA 1DMRA 4NBRA 2OCDA 3EIUA 4WZBE 4US2R 1LF5A 2R0QC 5K1ZA 4CR8A 4J0HA 3E7XA 1OXVA 4H0FA 2XUJA 1ZHOA 1TYEB 3AHCA 1P9WA 5FA5A 5B4UA 621PA 5C1BA 3AXSA 2WYWA 1C3OA 2FMFA 4BDTA 1PX0A 1I3LA 3A1UA 3KE9A 3MM4A 3QFHA 1PBNA 2MSKA 4YCMA 1XAGA 1PD1A 2H54A 2TMKA 2W90A 4DRXB 1UBGA 1IHYA 1YC2A 2XB6A 3QU5A 4Z4EA 3C6YA 1G55A 3EOBI 2H4XA 3MBKA 2ZS7A 3PGXA 4QBGB 4ZHQF 3MTEA 4W9NA 3CB4A 1ECFA 1NLUA 1YS4A 2QN3A 4FP9A 1NDHA 1ZPDA 2BR4A 4B32A 4DBVO 3R6LA 3T3EA 4NC9A 5I9MA 2FUCA 2BJHA 1P4AA 2QG6A 2N47A 2XJ9A 3AY3A 3N8DA 4ND1A 1TGYA 5CURA 3RUEA 4RD3A 3RUCA 1N6KA 3IUJA 1JZTA 3JQ7A 4I46A 4RORA 2VDNB 2F4NA 4OLHA 1VE7A 4HVLA 2ZIWB 4RNDB 1JEYB 4NRDA 1X8KA 2R7LA 5BW4A 5IVDA 2JIPA 4LQCA 4Q7EA 2HOQA 5D51S 3SZRA 5T4BA 2IGTA 4RE6A 1E18A 4UTZA 3G1UA 3TZBA 2RGBA 3COZA 3LCRA 1J20A 4R0VA 3ZCXA 3T7CA 5L9AA 1EZ1A 3HVHA 1MVLA 4BQOA 4LJRA 4NCBA 1QZZA 3AU9A 4K9QA 4TN5A 3A9CA 3BGOS 4FEAA 2J0EA 4ZVQA 3EF0A 1JWBB 3RRFA 2VUUA 2KLBA 4P58A 2PR7A 2Z98A 4YV1A 1VG1A 2GZHA 1O5TA 3RGGA 4JVMA 5JXJA 3EG5A 1W0CA 5DM2A 4PHGA 4DC1A 2OP0A 2Q0HA 4Q66C 4KNWA 1NXSA 4TV8B 3SF8A 3AUUA 4FFMA 1EHYA 3DE6X 3EVZA 5EP4A 1RAGA 1KR2A 1PUIA 1IN4A 3CVOA 3E5NA 3MAJA 5LWQA 5MFPA 1MJ5A 2QLFA 3KOYA 5AUQA 1KA9H 3SQMA 3CTMA 3VBEA 5BN4A 3N2EA 4GRAA 3O75A 1GWNA 1QLWA 1D2CA 1D0IA 1LVGA 1V48A 1XROA 2A9JA 2R9VA 3E1GA 1FTQA 4NMLA 5CPBA 4LF4B 3NVKI 1BSVA 4X8HA 3F6PA 2X22A 1GRQA 2O2SA 4EX6A 4A8JB 1K68A 1OXUA 2RC6A 3NFRA 4GEGA 1M3SA 3ESXA 4CYMA 4M36A 2GGSA 4IDGA 3TNJA 1L6RA 1CUFA 3FVTA 2IV7A 4QEKA 3T0GA 3H8VA 1H1LB 1M2OA 2FOIA 3F2IA 3FAKA 4CGYA 5AUNB 1GV0A 3LWBA 1LWOA 3DYVA 3QKSA 3ETLA 1JQLB 3AB8A 3EDRA 3OOWA 3G2HA 5EHZA 2Q0SA 3WJ1A 4D4MA 4BMCA 2FMHA 4J0QA 5PGMA 2PANA 2XYPA 5C1DA 3OEYA 3G2LA 4ZI5A 1RMYA 1YFJA 2Q1WA 1E6CA 1XXHE 4BBZA 4XR4A 1Z6YA 3LBYA 4I55B 4KOEC 3SBXA 3AINA 3C7CB 1KQ3A 4RPIA 4GSYA 4QPDA 2IYEA 1MH9A 4GX0A 4CV3A 3AY6A 1MFPA 1Q3HA 3T1TA 2W7TA 3OBBA 3IT3A 1IWPB 4V0OA 2ZAYA 2IUYA 4RFSA 4OHZA 3URKA 3S2FA 3UV6A 3TXAA 2C7VA 4D0GA 5THKA 5CT9A 1STOA 1MVOA 1JSCA 2RB5A 5IVKA 1LLUA 3DCNA 4E5YA 2QUJA 2BFPA 3GCGA 4Y2RA 3OCXA 3KTDA 1GQRA 2K6GA 4W1QA 2C7PA 5J5VA 3IV7A 4IKEA 3T5CA 2C5HA 3JQAA 3UHOA 1U8XX 4Q7LA 5CFOA 1ZGGA 4PV7A 3E5RA 1GJRA 4HCJA 4JBWA 3KR9A 3R5XA 4QPJC 5AVJA 1SD1A 3ZJUA 4ME6A 5CA0A 1OY1A 1BZYA 1HKUA 4FOSA 1SPBS 2A67A 2H1IA 1DUVG 1NNUA 2WHPB 1KAGA 3EBLA 3LY9A 4TLDA 2P7IA 3BDAA 3C85A 1RKXA 2P8SA 2XMGA 4H7KA 2XVMA 4BRSA 4O25A 4JSRA 1E1QA 1G21E 3NYQA 4FILA 4W1SA 3QKRA 3T4PA 3TINA 3SAJA 3BH7A 4JJKA 3LDHA 4QA9A 2AA3A 4LX8A 3RNOA 3OCCA 3ZDAA 2A3NA 3EIXA 1NUUA 2QL7A 1KTVA 4U6SA 2R1TA 1KEKA 4ZJZA 1N2ZA 2YH2A 2ZOSA 3QUSA 4O63O 5HF5A 3RV3A 7REQA 3AF5A 3PC8C 1B3RA 1GZ6A 1WETA 3BWBA 2JJMA 4R1LA 2ZWMA 2YWXA 4MRNA 1RI3A 4AP5A 2W98A 5EY5B 1EUZA 1HDOA 3U39A 4KDEA 4HEQA 1H0SA 3OZWA 3F1KA 2MTBA 2FSIA 4MUAA 4U3JA 5LIRA 1I0ZA 1BAPA 3H9CA 4HDSB 5G4KB 4DE5A 1KFBB 1P3DA 1PRYA 3R8FA 4BNMA 2DWCA 3BJIC 3K8ZA 1HNNA 2XWQA 4TYPA 3P9CA 3WADA 2Q5HA 3DBHA 4JT2A 4LJAA 1LGYA 5F12A 2FUG1 3PG5A 3U44A 2CLMB 2ZULA 5B4VA 4D6PA 1PL8A 4QHYA 1Y3HA 1VG0B 1ZD8A 5TPWB 3THYA 1TXGA 1A98A 5CA1F 2WUDA 5TPZA 1Z56C 3OPYA 4INOA 2CXUA 3U60B 4DRZA 2WC1A 3OIDA 3T5DA 5BV0A 2IXGA 4YRBA 3CKYA 5LQAA 5CNKA 4I5EA 4XFKA 4Z0NA 4EMUA 5JSZB 2GKSA 2Z09A 1PG0A 1KZ9A 1E77A 3N87A 3QV1A 1B76A 1FXUA 3M5PA 1NG9A 3D81A 1X9IA 1JDNA 4MMZB 1YR8A 4Q9HA 1J8QA 1DCTA 3F5SA 3HKEA 1Y3IA 1EFLA 4Y9TA 1E6UA 3EASA 3NHPA 3OMWA 5CU7A 2MOKA 1PS0A 2XBMA 1AX9A 4QUDA 5COBA 1C3VA 5A4MS 1J8YF 4IV0A 5JXHA 4A2QA 3HWWA 1J0DA 4HF7A 4D57A 3RKUA 3H4MA 1YA6A 5IHXA 1E20A 1VL5A 3UXYA 4C05A 2Q5CA 2WKWA 5JALA 2WM8A 4HDKA 1M2HA 4RK4A 4AMUA 5J2UA 3HXQA 1EWTA 3QJ5A 4AJHA 2H4JA 2N0SA 3ZN2A 4IQ8A 1YDMA 4KFRA 3ESDA 4TTTS 1FLDA 1CNFA 1FMTA 3FZGA 3EGDA 2FSVA 2P1ZA 2P79A 3ORYA 3Q8XB 4O3MA 3ESYA 3O4GA 2G83A 5CYPA 4MVCA 3SE0A 1MN6A 4CIDA 1USGA 2CNOA 3GXOA 3ONVA 5C8DA 3WVNA 1GPNA 4ZK2A 1ZSVA 1G17A 2DCMA 1XP5A 9ATCA 3F71A 3KSAC 1KJIA 3EXG1 2X8BA 3FBGA 3H5LA 4LJ6A 4NYMR 1JA9A 3NU1A 3ZZMA 1P62B 2H07A 1OHHA 3ONNA 2CV2A 1GT6A 2QLMA 3ROXA 3PEUA 4CUZA 3H9GA 3K16A 3AGPA 3QF7A 2QMYA 4JN6B 2D0PB 1A2KC 2NZXA 5KBYA 3F6EX 2UXCB 2PUWA 5G0UA 5DOZA 3RIMA 3FOZA 2FG7C 3BZWA 2P2GA 4NJEA 2RIPA 3X2SA 2UYCA 3FN4A 2O7QA 1FRNA 3LQRA 2GARA 3DOEA 1P9LA 3GLFA 4GR9A 4ZT3A 1J5PA 2HBQA 4NMWA 1QOPB 4PSCA 1P74A 4MGYR 1QO0D 1E2JA 3RU3A 2IBMA 1KAMA 4JJ8A 4KVGA 5DP2A 1DAIA 2P4HX 1DWPA 3QF4A 4AZTA 3MD0A 4AKEA 2W2LA 4FGKA 4M8SA 2H51A 3WRYC 3LVBA 3DBLB 1MP0A 1NBMD 5CCBA 4PZUA 3EDQA 2W2OA 3P96A 4C78A 1F6BA 1QRSA 3R6TA 2AE2A 3B1XA 4LXHA 1O95C 2J7PA 3SWWA 2FG6C 3UK1A 4H6XA 5GV8A 4ZI3A 4NZ9A 2EQAA 3QPBA 4X1IB 3RB8A 2EP5A 3GLTA 1K5DA 3A0UA 2XUGA 2BIFA 3GYGA 4GXQA 4P33A 5JNVA 3BRWD 2UU9B 1KI4A 3P9NA 4TSFD 1NQWA 3W4JA 1BQ3A 1N6NA 2IOHA 2WM3A 2EFHB 3PEFA 4Z9YA 3QUAA 4MARA 2YXBA 1MD9A 4OQPA 4BP9A 2Z6AA 3R5KA 4Y9RA 1YTUA 1GADO 1G9SA 1L4FA 1RRGA 3H4IA 4YWHA 1H2RS 4KAJA 4JT4A 3TUIC 3VTFA 1U9ZA 1BJKA 1PCXA 1QIFA 1PZFA 1ZCZA 3CEPB 1CNMA 1TYZA 3L1VA 2FMXA 3RASA 3PFGA 1IUNA 2C5BA 4BP8A 5KYWB 2HW8A 3RVRA 4C1BA 1SCUB 1UDCA 2CFTA 3OY7A 4B3BA 4UXHA 1QYIA 2HA4A 4UXJA 3K0KA 5AW6A 2BFDB 2ZJ3A 1QHYA 3VC3A 1I9GA 4LK2A 3SS9X 3O1HB 3HU1A 3PHBE 2ATVA 2IPXA 1MABB 1VGVA 2QSZA 5EJ6A 3WNDA 3ZW8A 2CXOA 3M6AA 2D5AA 5AVVA 1ZJYA 5I51A 4C6SA 5BSVA 1Y4AE 1JNXX 2O2XA 3NXSA 4QG7A 1HBJA 5EEHA 4NEGA 2YZKA 4MA0A 4HXYA 1LBQA 2C4NA 1H8EA 1J0EA 3MILA 4UFOA 5FNZA 2GBLC 5GM1A 4JAVC 1DI0A 3LY8A 4S24A 3GQVA 4U00A 3TFWA 3P2IA 2HHCA 1I13A 2RARA 2WVAA 3GPDG 4CLDA 4N3BA 3TW8B 2F8SA 2ZZMA 4PIPA 3EMBA 1H3FA 2BSAA 3NHAA 4JFAA 1DIBA 2QTTA 2BGJA 4HQKA 4J29A 4K8RB 4XARA 4NK4A 1VDZA 4UBKA 1L7QA 1JU4A 4BP1A 2JIBA 1C1XB 4IIYA 1II9A 1TVKA 1IN5A 3LPDA 4I8DA 3W5HA 2F1RA 4J4BA 3TDNA 2R5FA 3FYUA 2QZZA 1JLLB 3OOSA 3QOYA 3VYWA 4YRAA 2Z3WA 3D8NA 3B9BA 4JEHA 3BFPA 4N76A 2HPAA 3N58A 1C9KA 4PGAA 3PHJA 3VPCA 4CKEB 1IEVA 1P91A 2A9QA 3OH8A 4HVAA 4Z9BA 4DYHA 3JAMA 1SCAA 2ECKA 2PL1A 4WL0A 2DYKA 1IONA 2QJRA 1XFDA 1LSUA 2DX7A 5TT0A 1QRRA 1TUEA 5DGDA 4B46A 3JARA 1TD9A 3GXBA 2P9EA 4HDNA 4EW2A 3I01M 1BXGA 2H9AA 5TQ0B 4L4ZA 1H6CA 4CL0A 3BL5A 2XZTA 1TRHA 5EWLA 3UN1A 1II8B 1PQUA 3E4CA 1E69A 2G25A 4HGRA 3LRPA 3JASB 3JQ9A 3WGMA 1Y1KE 3SJ7A 5HFJA 4D0NA 4R31A 2GOYA 2GCOB 1EVJA 5LQSA 1PV1A 5BSTA 2DWPA 3NIWA 3W9YA 3HKCA 2HWUA 3I9JA 4TM8A 3EGEA 4XZ3A 1G63A 2ZJ6A 1C3JA 2VK4A 4GZ3A 4MAMA 3AFGA 3DKPA 4C7KA 2RGDA 4HFRA 4DR6B 3FOAA 3OJWA 3EXHA 5JASA 4E08A 1A04A 2FSFA 1JLKA 1UJBA 2LKCA 2YFQA 1NA5A 3KSMA 1NASA 3D8BA 4GH5A 1XQVA 3EAGA 3HACA 5C34B 4D8WA 5KOJA 5IVIA 1PVVA 3S1AB 4QEZA 1WCXA 5JVDA 3TLGA 2V6JA 2A92A 3PHHA 4L3VA 3HXMA 3LNTA 3C14C 2WWIA 4G5SA 4LRXA 1GDTA 4CKZA 2PZBA 1UAAA 2VHCA 4MDHA 3ABOB 3K9QO 1QRUA 3IQWA 1U8UA 3Q0TA 2E4ZA 2XUKA 5DX8A 5HILA 4AL4A 4UTRA 5C8YF 5KINB 3FOWA 3A3YA 7ADHA 3PK0A 4ON9A 5H82A 1U4SA 4H0CA 5GJBA 2I9KA 5AYVA 3BTUA 2Y0EA 2A86A 1SN7A 2Q7XA 4PYKA 1RACA 4PXSA 3ZDXB 3O4FA 5DX0A 3PRKE 1THGA 1R12A 4H3KB 3QVJA 2XUDA 2R7KA 5ALTA 4UCQA 3ET5A 2PS3A 4UKDA 2VXOA 3DMGA 4FGLA 2BR5A 1EWYA 5K51A 4Q1FA 4B82A 2IYOA 5K5EA 4DTCA 2AEJA 2E1PA 4CN8A 5ALOA 4E03A 1H6AA 3RHZA 4KJXA 1AZLA 1SU7A 4KK4A 3D0OA 4M6WB 1O0BA 3PRHA 5B2EA 3QH4A 3RC1A 2DSTA 1VE3A 4IP0A 4DLBA 3L07A 3QWAA 4IDBA 1GCIA 2VDJA 3PTZA 3DTNA 5DO9A 1BC5A 2HRCA 4PLTA 2ERCA 4M1OA 3V1NA 2P75A 4CV1A 1XEWX 3M5WA 4O4IA 3RS0A 1SEVA 1A7AA 5A06A 2A0UA 1B8OA 2RJ3A 5F33A 1I5OA 2XDQB 4PW0A 4X3CA 3NTQA 4LK3A 3C39A 3EIWA 1A71A 5DI3B 4R2MA 3KAJA 2EFDB 1YDWA 3NT5A 3ZDQA 1IBKB 3ZGLA 4KGDA 1PSDA 1TU4A 1CF2O 1XJQA 2FB9A 2LDBA 1B41A 3GAFA 3KWJA 4H0NA 2NW6A 4Y1FA 5AKZA 3UWDA 3IAUA 5GWXA 4XJVA 4BO7A 5GTDA 1D2GA 1OQAA 2XT0A 4RSHA 5FL7D 3Q6NA 4F4UA 3LD9A 4LVNA 4J1SA 3R3WA 1W4ZA 1UWKA 2CL7X 2VAMA 1D7AA 1GPAA 1LX6A 4JA0A 4B5KA 2CJWA 2N3ZA 3EJWA 1V43A 4DQKA 5KX5A 2DEUA 1Q7BA 2XZOA 2AI1A 2H1RA 2TSYB 2QUHA 1KYVA 3V42A 1BDHA 4W9NC 2QP3A 3DYBA 1FP6A 3QNMA 1CVRA 2I29A 3TXYA 2V3VA 4WXEA 5AKEA 4Z8XA 1J24A 2B1JA 5E9JA 3L7OA 1EB8A 4M38A 1QOQB 1T5BA 3U62A 3L7MA 1TUBA 1BOOA 1ZGHA 3F4KA 2J5BA 2QNRA 4X61A 3VJKA 4I4NA 4MW7A 1Z0UA 1SVWA 3AG5A 3I9V6 1L7RA 1MO3A 3UWKA 2QLBA 3BSFA 3OZCA 1VRVA 1W5SA 4FGJA 3EXFB 1O95D 3J81A 3NNSA 5IKPA 4II7A 3PEWA 5HA5A 1L1FA 2PLAA 3JWJA 3QBJA 1XTIA 1Z06A 2PXAA 2G4CA 3OF2A 1PEDA 2G88A 2QN7A 4HPWA 4D3ZA 3WSTA 1IM8A 4LYDA 4EI8A 1HKHA 2Y05A 3TTVA 4DLNA 3THWB 4JI2B 2HQSA 4EAAA 1BKDR 3AEUA 4B3XA 4RYLA 3ACDA 3DZIA 3X1XA 1C2TA 1ZNXA 3TGPA 4NDZA 4JJGA 3B60A 2ZSHA 1P7WA 4MHTA 2F8LA 3DW1X 3O93A 2OBMA 3LVQE 4RDCA 4XJXA 2HB6A 5B37A 1JAZA 3OTHA 4PX2A 4QICA 1J2JA 2YC2C 3BFKA 3HU3A 1O54A 3SMVA 4ZGWA 1OXXK 4XRGA 3VR0A 3PFHA 4P34A 4JC8A 3BH0A 4RF5A 1AQNA 1RQRA 1X1TA 4TV8F 3FUCA 3VXKA 4WNCA 6REQB 2NO5A 3UTDA 4E5VA 1HA3A 4KN8A 3JQ6A 3A6EA 4HWSA 4CMIB 2Z2JA 4WXYB 2HA3A 1JJAA 1ZVQA 1QFSA 2G07A 2ODAA 1CQWA 2EGHA 2AXQA 2W0SA 1NR1A 2RDMA 2FPRA 2HK8A 1G20E 4RF3A 4IDPA 1XK7A 2WAAA 4FHFA 5IAAA 3DFZA 3PQ5A 1SM4A 4W63A 4FSXA 1PR3A 2W93A 1CV2A 3ASUA 3O1IC 2EEPA 4JLKA 4I9UA 3M9LA 3FWHA 4MUIA 4YGXB 5DV9A 2H3HA 3RUFA 1NC1A 4D4HA 1JE1A 2ZYWX 4IO0A 3AHHA 1TOAA 5DLQC 3EX7C 3U09A 5ITZB 4INZA 1NL3A 3BD7A 4P4SB 5J3JA 2RHOA 3DOHA 1HFKA 2OVFA 4Q3LA 4WNAB 1SVNA 2PSFA 2PU7A 3DMHA 3QOWA 1X3LA 4ZHQA 3C3WA 3ZE1B 1FFHA 3NORA 1Y6GA 1EVYA 1VJDA 2E4VA 4I4TB 3EC2A 4B8WA 5BUSA 2JVJA 2OC9A 3ZE2B 1BGVA 3HLKA 1R0XA 2XWBF 1PV4A 1JGTA 1P45A 4N7JA 2ZTMA 4QNRA 2PZAA 4ENPA 1BA3A 1ECBA 1EEHA 3N59A 3C3AA 2BM1A 2EZ4A 3BIOA 4W5WA 4I55F 2QBYB 4PAWA 5EJ2A 4S2EA 3SJZA 5AOAA 3B2QA 1K9VF 3U5ZB 4QODA 1YKSA 3VZSA 2BJVA 4FMBB 1EFVB 1V7CA 4O8ZA 3V4LA 3PQ6A 4E2YA 2PMFA 1CQZA 1DFIA 3EIHA 3MPOA 4PC1A 5C1IA 4MDEA 1FP4B 1NE2A 4Z0PA 2I4IA 1QHEA 2JI9A 4WACA 3LQ1A 3LGAA 2DUMA 1O5OA 1PL0A 2OY0A 3EUEA 1UBHS 1EJ2A 1MA0A 3MJRA 4L0MA 4ML3A 5SYAA 3GG2A 4XX1A 4JITA 4HDRA 1N4DA 2L17A 1JPVA 4MP3A 4WRRA 5K03A 3BB1A 3L5OA 3LBAA 1S6YA 4L9WA 4I1PA 3RTCA 3WB9A 2XMZA 3ZC3A 2B1IA 2BSXA 2EC5A 2VNIA 4CDRA 4ECAA 1Q20A 4I4CA 4IRXA 4P0QB 2JJ2A 3G3EA 1DIAA 3K2QA 3EY4A 1ID8A 3I1YA 3A7DA 1UF9A 3QWIA 4H7EA 4NU0A 3TX2A 1FYFA 3Q7EA 4BNKA 2FRDA 3RG8A 1EQUA 5B12A 2E4WA 4CM4A 5JAMA 3SP1A 5A1TA 1JE0A 1Y5IA 4WOBA 1P0QA 5IXYA 1P61B 3MSXA 3HUTA 1EAYA 2F90A 3QVGB 3RD5A 3S99A 4IDDA 1WMEA 1FDRA 1IBSA 1XXHB 2WILA 1VIVA 4XYMA 5J58A 2HA6A 2JAHA 1E4EB 4TZ0A 4EITA 1NR5A 3L7KA 5D5HA 1N6IA 3FKSA 4Y2YA 5CDHA 3LUPA 4PLYA 3D3EA 1NOIA 2QW1A 1ENZA 3M83A 4QTUB 1GN8A 1Q1QA 1VKHA 2BN4A 2FN4A 3LT0A 5ESDA 5FH9A 1XJCA 4K9OA 4UZSA 3I62A 3QVLA 3DDWA 3F96A 3E9CA 3IEIA 1MOSA 1P80A 1EDZA 4JMLA 4DILA 2EF0A 2EFGA 3V4OA 2PR2A 2R8YA 3JWPA 3WGUA 4ZYTA 2FLWA 4MWBA 3TKYA 5LU9A 3QTBA 2ISSD 3AR4A 5K3FA 3FNQA 3PKZA 3M9WA 4LHXA 5LMNB 2B4YA 2VUTA 3I4CA 4PHHA 3G49A 3HXLA 3RAGA 4NBTA 3L4KA 4M98A 4NOMA 3CVUA 1FTYA 5HIJA 3PE6A 1ZRSA 2XNCA 3P2OA 4S0XA 4H59A 4Q7KA 2NU9A 4QWWA 5JMTA 3A3NA 3O3OB 5KWSA 4MV0A 1W4CA 3FD8A 3K92A 2CHGA 5EGSA 3UB3A 1Z2AA 1G21B 1HZZA 2E49A 4MV6A 4IYRA 2JKVA 5JXIA 2R47A 4RJTA 1FUYB 4EB0A 4EIWA 1L9KA 2BBOA 3MCZA 3UQYS 5M2QA 3C70A 2MINB 3WLJA 3WS7A 3FRJA 4PNHA 4F6RA 1U3UA 3OZGA 3RE1A 3A6LA 5I7HA 1WY5A 3A6ZA 1PO7A 3TEMA 3LLSA 1Q2UA 2HCFA 1FVXA 3GF4A 3TH5A 1R88A 1EG7A 1QAQA 3NCHA 4MKIA 4WFQA 4BRUA 2PZFA 3OF3A 1DC4A 1YRLA 3W9BA 1JPJA 4AKTA 3K9FC 1U02A 2IUTA 2GPWA 1YKFA 3CNLA 3TMYA 4UHFA 1AH2A 2W4QA 3P0RA 1K66A 3OQJA 2C5GA 1V4VA 3BCRA 4CUJA 1ESEA 1M34E 3BTOA 4ZYZA 4CKBB 4CT0A 1L4NA 1KI2A 3EDCA 1IY9A 3PX3A 4LGYA 4KV7A 4C0KA 4F91B 3ZIAA 1W2GA 2VHEA 3AW8A 5JYDA 3WYAA 1QQBA 2Y1DA 3PD0A 5I9BA 2A5DA 4BP3A 4F5WA 1UOOA 2DC1A 2WVHA 4HX5A 1V1MB 2SHKA 1ZN2A 1Z2DA 4GOOD 4Y2QA 2QYTA 4KPYA 2GPNA 3AEQA 2C2HA 4BV2A 2HXSA 5K0SA 1FW6A 2OK8A 4F8JA 4FIDA 2ZU6A 4IPTA 5BQOA 1NE7A 5MN4A 3UKOA 4IO1A 2IOFK 2E7ZA 4ZTUB 4DQXA 2HA2A 1G8FA 1XE3A 4ZIRA 1PFWA 3A3OA 2AX4A 4UU7A 3EPKA 2ZJ2A 4OH7A 4Y6LA 3U61B 4Q39A 1AF4A 5DYYA 2O8CB 1SQGA 4LOKA 1HV8A 1G8MA 3JX9A 2PKQP 3KL2A 2JLXA 1KP2A 2WD8A 3IUBA 2Y76A 3O94A 4KVFA 5BSGA 1BXRA 5ALNA 4X62B 5CT8A 1Z12A 4KAXA 1YR9A 4FQ8A 2GZDA 2ZT5A 1MB9A 3PT9A 3B48A 4IMIB 4QXAA 4DRYA 1M5UA 3SM9A 1SHKA 1V11B 1PLJA 1Q17A 4DA6A 1U11A 1IU9A 2YWHA 3E61A 1XTQA 4X44A 1P5JA 2AR0A 2F1JA 4K2HA 4IWYA 2ZTLA 5DT2A 1P7YA 3PX7A 1FYEA 1C0EA 1C7FA 4BVAA 5FOWA 4HLUA 2XVYA 5I4IA 3NHBA 2F59A 5JRDS 3CKLA 2JKYA 3V9AA 2O8FA 4BWGA 3KT6A 4ZOLB 1ZBQA 1PDVA 1OAAA 1VI2A 4ND4A 4U7TB 1IVNA 3D8UA 1REQB 4DKXA 1PVOA 2FPPB 5CHYA 2W2KB 5F4BA 2BI4A 1FS5A 2PNFA 2A5FA 3BPSA 3NX4A 1PG5A 2QXYA 2PPLA 1O57A 4AJ4A 3EPRA 2J9FB 3BK2A 4H1WA 2XMCA 1NZDA 3Q1LA 3Q41A 2QQ5A 2A35A 4J0IA 3TUZC 4NDAA 1QHSA 3NRBA 4FHCA 4RVCA 4ZZ0A 4HNHA 2IXAA 3D4LA 2GCEA 1P0CA 3FDZB 4QE3A 4WAUA 3HNOA 5CVEA 3LHIA 4BFWA 1KOGA 1TC1A 3IJRA 4ZKEA 4EDFA 1B4DA 1KZ1A 2R5WA 5ALVA 3HKDA 1TAUA 3STXA 5DBGA 2J41A 2BMDA 1EM6A 4RD4A 5FT9A 1LK5A 3PNKA 1AURA 1RMQA 4OQLA 5IJ9B 4KQXA 3V1MA 4GC5A 4MEJA 1AXEA 2UZIR 2OHOA 4FQ7A 1A9RA 2VHQA 4EGFA 3ZBTA 2OBLA 3LX5A 3PA8A 4RH1A 3WGOA 1UDAA 2GYUA 4YO7A 3UAXA 3S27A 2GBGA 4R40A 1U2DA 2QG4A 3ZHUA 5LBIA 4EY4A 3EVEA 5D3MA 1UMDB 5L3QA 5FPKA 2Q0QA 4Y0AA 2R6DA 3ENWA 3HNRA 4US0R 1J39A 1GL9B 4U7GA 4DCSA 1UZAA 4RFVA 1UPAA 1HT0A 1U8ZA 2IW1A 2P68A 4U0KA 3VSBA 4NCNA 4MUNA 5JCOC 2FVYA 3ESCA 3OY2A 3I2JA 2WU4A 4IFEA 2P5YA 1XD2A 2VUIB 1BVRA 3SZLA 3F1LA 1G3UA 5CXSA 5ECWA 4X93A 1T24A 4HDOB 3QLJA 3OOEA 2B8EA 1KRWA 2ID4A 3MMPA 1WO8A 3ZXSA 1JFFA 1NX6A 3O8NA 4XB2A 4BMOB 2B4KA 2NADA 1LXCA 4RLQA 5G41A 1PNRA 3RWOA 2BLNA 3CN7A 2JHPA 2VSOA 1GPH1 3D6FA 4XA8A 4FDAA 3WIVA 4PF1A 2RGXA 4MVJE 1HWYA 2ZATA 3QQPA 1LA2A 1YAJA 3FYUC 5LYJB 3S28A 3JQAD 5J5AA 4JJ6A 4KPEC 3I2YX 1Q12A 3EUFA 1NMXA 1D2EA 3C1OA 4BZPA 1N8TA 1N25A 5B4TA 2Q5EA 4MMYB 2Y4NA 3RTBA 3CSDA 2RH5A 4C4SA 5AVXA 4CIAA 1GQ2A 1GRNA 1LDMA 1ATIA 4J75A 1E1QD 1GGHA 2POQX 2VQFB 3WIBA 2ZUEA 1P5FA 4MWGA 4UASA 1K6EA 4EHAA 3VKVA 1UM8A 3JQ9C 5JE8A 3UAZA 1PS9A 2AHRA 2IY9A 1H05A 4IGKA 2OZLB 5KMGA 2ZSKA 2HY7A 1EXNA 2ETXA 4JI8B 1OZGA 2G80A 2WQ7A 1E7QA 1VMAA 2ZRKA 2WA2A 2PMWB 5AI0A 4RTQA 4WKGA 2RJOA 2ZTHA 2I87A 3WDSA 1E3TA 1EVKA 2YDXA 3WL3A 3EXHC 2BE7A 4L57A 2PYZA 3WKEA 3UY4A 4FFBA 1I1QB 4BFXA 1AGXA 3H99A 3QUBA 5KUTA 1Z5PA 3OQOA 1FNMA 3IKLA 5HKKA 4ATNA 3MYYA 3SPXA 1YZNA 4MPDA 3N1UA 4JKYA 4ZC8A 3DZKA 1GNVA 4MO9A 1I30A 2G9ZA 3COPA 1TJYA 3WDMA 1R1DA 1ZK1A 4P3OA 4LDNA 4DOMA 1DAFA 1MGPA 3I01A 4BEJA 4J8PA 1NVVQ 1PT8A 3FNRA 5A03A 1C7EA 4BBAA 1UKVY 1USUA 2IYSA 4N3GA 3CT4A 2D74A 5JCJA 4AZ3B 5KQSA 4TKUA 1OSNA 4LYHA 4ZU1X 4HGNA 1N2CE 2YJ6A 1MC4A 2P3LA 1V5IA 3AHGA 2GZRA 3KB8A 4XTRA 4DY6A 3KJHA 1TZMA 3DWGA 4US1R 3A10A 1T2NA 3A9VA 1KEEB 4XLZA 4BE4A 5IJWA 4JDUA 4I0WB 1XMVA 4DWWA 3DC2A 4J7AA 2AK3A 2GUWA 4KBGA 4MV1A 3U7QA 1LDEA 1H5UA 4XD2A 1KFCB 2H7XA 1NJ8A 2E4YA 2C03A 2XNSA 2XOXA 3P9XA 4XCQA 2HHJA 3KUUA 5FFNA 4C0JA 1XDUA 4EF4A 3BULA 3FE2A 1N2BA 1FZTA 3FLMA 1O4WA 2Q9BA 5EMNA 3FWPA 3DDNA 3MWYW 2Q27A 2ZRQA 3KO8A 3RTGA 2J08A 1SOVA 2VTDA 2ZRNA 4KREA 1AJEA 1TEHA 2JAOA 1C7JA 5AXDA 2JFWA 4KXMA 2FZLA 2IELA 2V74B 2ZS8A 1CUXA 4JS0A 3Q8KA 4XJSA 1R15A 2JGDB 3ORFA 3TAUA 3KU1A 5JAIA 1XZLA 2M1XA 4J9VA 3BQNB 5BQXA 3CF0A 1Y42X 1Z7BA 4OAOA 5B6IA 2RD2A 1O8CA 1NTRA 5DK6A 2Y8EA 3M6WA 3FUXA 5T67A 3OM9A 3QVMA 2FCRA 4CEIA 3DKKA 1FDSA 4V03A 1OHHD 3PFIA 1GL7A 5GJCA 1PW7A 4HLCA 3H9BA 1JEOA 2O14A 3BHNA 4ED9A 3O0DA 3A4TA 4ZARA 3LLCA 2JLYA 4LXTA 3PQEA 4LHEA 4OREX 4ZQBA 4N12A 2NU6B 4P8RA 2XITA 4CM1A 3DUWA 4JLDA 1JIUA 3V2IA 2GZ2A 3GHHA 3ABSB 1BWRA 1U2EA 4AF6A 5K8VA 1H2AS 1KOLA 5ENVA 5HRAA 2PDAA 1A9QA 2EYQA 1ZW6A 1SCJA 2MSEB 3L92A 4NCJA 4EJSC 5AVKA 5C8YA 1OYWA 4TYYA 3ILSA 3R0XA 4OFZA 1OZ0A 2W2LD 1Z4OA 1USVA 3FCXA 1T5IA 2RC5A 3VOTA 1DJOA 1T36A 1Z0SA 4JB3A 1U1EA 4RY8A 4TM7A 4BB0A 5M34A 3BK1A 5JG7A 2C84A 3VNVA 1YFLA 2BZ0A 3W7AA 4PLWA 3ZHZA 4PE5B 2FR1A 4BNLA 4EHNA 2W6ZA 2Y77A 3HH8A 3ZWMA 2J7PD 1M1YA 4MX8A 3SC2A 3JRNA 3MB8A 1C3LA 1ZICA 4KSCA 3QFFA 3SQXA 1YQTA 5IBCA 3WGJA 3ZQ6A 1KWGA 2CLHB 1R8YA 1YIAA 1CVIA 5D3KA 4M7OA 5GQSA 4ZAYA 1WBBA 1QVRA 1MAWA 2C4TA 4MUXA 1ULAA 5DWVA 1LZLA 2NP6A 2QJOA 1QGDA 3K0CA 4FWBA 4GFDA 3G0DA 1SH7A 3QU7A 4BIIA 2WPDA 4KLZA 4MRVA 4OP1A 4EZIA 4KIWA 3HM9A 4BMVA 2JB9A 4X1KB 5CW2A 1B42A 1QCCA 4D5EA 4E3WA 2JIOA 4D8UA 5G3ZA 2B2XA 1HTWA 3O7MA 3X44A 2EIHA 5D5PA 4A26A 1JFRA 3NBMA 1CWUA 2PWBA 3U9SA 1T5DX 1UJCA 2CLFB 3MT0A 3NWPA 3P4UA 4DL9A 1EQAA 3ND9A 3H7AA 2C54A 1K0UA 4CTNA 4AB1A 4C04A 4MQUA 3R4VA 3CUUA 1DV2A 3AUXA 3LHFA 1KOFA 1HX7A 2NX2A 3LUBA 1CQIB 3TNLA 4E1VA 2QAJA 3K2IA 1Q91A 1GPKA 3VYVA 3AKCA 5CLGA 4GQAA 5K0TA 1PV2A 3CZRA 4DYDA 2OGTA 1JMKC 1SCNE 3N2LA 4FMDB 4K9DA 5AICA 3U3DA 4C0AC 1YFKA 1T4DA 1YS7A 2Z08A 2XB9A 3DE1X 5IJ0B 2DKNA 1PJSA 2R4QA 5MN5A 4Y2TA 1JP7A 4INAA 2I8AA 4DA9A 4I4TF 3DEAA 4QFDA 4G0YA 3WFZA 1XSEA 4XIFA 1L7DA 2B8WA 3EEQA 4Q9KA 1ZR4A 4WMLA 4RKWA 4IHJF 1QIJA 1P2DA 4WI1A 5EJ9A 4WLVA 2BOVA 4P36A 1CZLA 4LYYA 1SUDA 1T4CA 4Q21A 1TE2A 4X91A 1PJQA 4RTSA 1JEYA 2LBPA 1NNEA 1A8PA 1MXFA 4KJZA 4R2HA 5JT1A 4OX9B 3GGCA 4NE7A 4LDPA 3RUPA 2FK8A 4JJ7A 4TMWA 3OIYA 1WZCA 4DAOA 2A4MA 2AB0A 2FOLA 2P2DA 3L8FA 3TR0A 2HFJA 4LYAA 4IMJB 3LF1A 4YQEA 4UDNA 4C3UA 1Q77A 3VVLA 1JFVA 3LPCA 5AQ1A 3WBKA 2IYZA 5DP1A 2HRQA 1N9GA 1KI9A 1XAJA 1CZRA 4C5BA 5J1SB 4RIHA 4IDNA 2DQ4A 3FIJA 1S9HA 3TLCA 3VHXA 2PL9A 4AKHA 2WUVA 4YI3A 3U4QB 2OC4A 4RHXA 1BU5A 4AWAA 4ZOAA 3AL2A 2RE8A 3V4ZA 1OLXB 3HBMA 2A0KA 2CL5A 2Y93A 1OI4A 3LM8A 1SHTX 1X94A 3L06A 3RV4A 4A8HA 3MC1A 2JFNA 2C5AA 3AVPA 4PG7A 2PYIA 5EC8A 4BVHA 5ELXA 3DV2A 4M0KA 4DPKA 3A3KA 2KQUA 1M8GA 3ND5A 5EHQA 1NZJA 3H2GA 4HXGA 1A1VA 2OYCA 2NO6A 4KV9A 2UZ1B 1BXZA 2A9FA 2FN9A 4N5DA 5DI9A 5J4VA 2NXCA 3TLKA 3TW6A 2NACA 4FGUA 4K6KA 4WBNB 2H0AA 4N39A 4L2IB 4WPGA 4D9GA 2Q6VA 3HYTA 3RAEC 5THQA 1A9XA 1SVOA 3GEHA 3BB4A 5EUCA 5DLEA 2MT9A 3B70A 4GBMA 3ADPA 3U4IA 3CX4A 2R6AA 2XODA 2YWJA 4P5PA 2G04A 2PSSA 2ZW9A 4XGRA 2FW9A 1X13A 2VPZA 3AWIA 4A8JA 3SIPA 4C9BA 2ZB2A 1AV6A 4IILA 2JCXA 2ODPA 2Q07A 3FUUA 2CJXA 4G65A 2GPJA 4XLTA 1K5GA 1X7GA 2I7DA 3ZVLA 4DZRA 1RQXA 3E5MA 4R81A 4A92A 3TZLA 5IKXA 1XNHA 5DM60 3GW8A 1H1LA 4IZIA 7YASA 4GI1A 2XBUA 1KRHA 3QWHA 3UMJA 1QLJA 3SFVA 2FI1A 3L7AA 4DCJA 5FEUA 1W7AA 2OGWA 2Q3MA 3ZGZA 3EFHA 1N5RA 1OKKA 5JANA 4DV7B 1EK0A 5KSPA 1XTSA 2QZSA 1T2AA 3O1JC 2Z8ZA 1YB6A 4GWGA 1ZD4A 1J2RA 3GNQA 1T8WA 1V16B 2GBIA 2IOYA 2IEAA 4I55A 2Y67A 3BRCA 3E7DA 1WDTA 2C58A 4LJ8A 4ARAA 4HKTA 2WFAA 4J1NA 3BJEA 3ID6C 5JPIA 2FEPA 2B1RA 3C6MA 5IBRA 3RRYA 5LL6P 2WHXA 1MT0A 3ZY5A 2Q5QA 4CI9A 4HSGA 1JVSA 2HV9A 2QMQA 2WTEA 4QXRA 2W11A 4Q16A 4DUZB 1YE5A 1E1DA 1WJGA 2JGAA 3HGQA 1J1ZA 4LE1A 4ND8B 3CY6A 4KRXA 3WLHA 3GJ3A 3KKMA 4L08A 1NBHA 3LKBA 3AMVA 4KVAA 1E7MA 1Q0RA 4A9AA 5JO0A 4COKA 4QZVA 5JNTA 4GP9A 3BSSA 3OZDA 4DIMA 2PUBA 1XTJA 1ULHA 1XDWA 1JI0A 4I6JA 2A5YB 2YOHA 4B76A 1FFGA 2FK7A 3DZDA 1B0UA 2WHPA 4JJ4A 4D9EA 1M72A 5HBGA 4ZYYA 5KWVA 2I71A 5LWHA 1G9TA 5DW3A 5F5NA 1VL6A 3AB7A 4P80A 3JD0A 4G4IA 2JLVA 3ZVRA 3LC0A 5F9HA 3M1YA 2AZXA 1ZLXA 1AGRA 1XAHA 2ZI4A 1TMKA 3DMYA 1W6UA 2NLOA 1ZM3A 1UKCA 1AOXA 1E5LA 4RK5A 1JEDA 2C0PA 2JIRA 3HVIA 4FSDA 2JG3A 2ZXEA 3LHSA 4R1UA 1CUUA 4NYIR 1ZN8A 5J4HA 4JI4B 1YGPA 2EJWA 1E9BA 3GFOA 3V5NA 3GT0A 3L0ZA 3RSGA 2BGIA 2G08A 3DFUA 1OU0A 3ZD8A 5A3QA 3PXGA 1W36D 1QP8A 3RC7A 4HDSA 1Q16A 2WG0A 4Q05A 5G4KA 3ZY6A 1IRIA 4QQKA 2F62A 4YXFA 3EDMA 1B2LA 1UZMA 2XA1A 4UVDA 3JY6A 3RVPA 5CLJA 5D2CA 5ITWA 2FQXA 1M34B 1NT4A 3ICWA 5JD5A 3NHMA 2NUPA 1FQJA 2J09A 3FPLA 1NF9A 2WSBA 4XWKA 1UEIA 4KXQA 5KZMB 3B38A 4UFNA 1J21A 2O2CA 3JD2A 1U1FA 2BELA 4HLUC 2XA9A 1IULA 3KPYA 5IWAB 3TQTA 3KKNA 3CZ9A 4K9MA 4R9SA 3ZDYB 3S2UA 2AXPA 3U9LA 4DSUA 4KE8A 5CGQB 1NYTA 1DRKA 4R41A 4RA9B 4UEWA 2ZI7A 4HNRA 4P32A 2O50A 3IJEB 2VPYA 3M34A 4RZXA 4IXMA 3K72B 2CHFA 2YIJA 4G67A 1CR1A 1N0UA 4L95C 5CM9C 4AY6A 2HJ9A 3QYFA 4EABA 2CXXA 1ZW1A 5TC4A 2G77B 3DL4A 1OT5A 5L40A 1R50A 1X15A 1KY3A 3E22B 4IUDS 3IMKA 4RHYA 2VRWA 3TO5A 4KHPB 1OI2A 2GN0A 4OHYA 2C00A 3BBPA 4FOPA 1EXMA 3G7SA 4MQMA 1OW3B 3FUWA 5HJ7A 2FH5B 3K9WA 2BF4A 2ZRGA 2II6A 4ND3A 3IOCA 3N86A 3GB9A 5ELLA 2PBRA 4N5IX 1VQ1A 2FAXA 3L6OO 1C9NA 1K98A 3QXGA 2Z56A 3RU7A 4IXDA 2CDAA 4R2XA 5IZCA 1N3YA 3G8BA 3HY4A 1CLUA 4AWBA 5BWCA 5D01A 1CRZA 1BN7A 1L5FA 3O9MA 3A05A 3TVDA 1DJPA 3MMZA 1JMVA 2WZBA 1KS9A 2ID8A 2AUNA 2QTMA 5B1DA 4NV3A 5BURA 2CZCA 5JECA 2GHRA 1SXJC 4H7HA 1PT7A 2OCAA 1LKZA 1OXSC 1YGYA 3KEMA 4G0NA 3SI7A 3V80A 1XKQA 2VBFA 3DPSA 4BZWA 5I3ZA 5GGXA 1TVEA 2VP3A 1T6XA 4OBEA 5JAZA 3GJ4A 4CMBA 3DOIA 3I8OA 3AEKB 3EZNA 1G1MA 2Q29A 3M6XA 1G38A 3IPLA 2ZAMA 1KYYA 1PZEA 2FDXA 1RQNA 4MQLA 5FD8A 1CDEA 1V26A 1GFIA 1SELA 3OT1A 3MWFA 4Q9JA 4W5OA 4QD3A 4R1PA 3DVAB 2FR8A 2XEDA 3ER6A 1ZHFA 2R8EA 1KYIA 3UYLA 5ALHA 3PCTA 1O94C 4MRPA 4DDTA 5ECYA 2IP1A 3TD6A 1M83A 4TKVA 1N78A 1LC0A 2OBFA 3U4MA 1U3VA 1Y0BA 1JJFA 4S2UA 4WVFA 2IEYA 2P2SA 3GP5A 3E18A 1KK3A 1R0WA 2ODQA 2GEFA 3E53A 3W78A 3ZK9A 3IKMB 3KNZA 5ICCA 5B55A 1E3MA 5LJLA 5F7OA 3DAHA 4NBSA 3RVDA 5LYJF 4ZYXA 2IH4A 2VDPB 3I34X 3R3VA 3RVKA 5L7YA 1E59A 4M7RA 3VPSA 3K5HA 1Y8RA 1TJ3A 2JJ2D 4KTTE 3WYDA 3V7NA 5BSWA 3QFRA 1XRSB 3KG2A 3LUFA 3L40A 3MUFA 4H7FA 4MS3A 4TWIA 4X1IA 4AUKA 4E2FA 1JKXA 3JALA 4WLFA 3M33A 2YBEA 1I6MA 1MJGM 3MWKA 4JB8A 3BXXA 5EUBA 1W1IA 4XDHA 1VZ2A 2XNDA 3BF8A 2OAEA 5AVOA 3EISA 1WPGA 4LRTB 4X7RA 1ZWLA 2VP5A 3ZBUA 3IEPA 3L1HA 3G2IA 5EPOA 2GBPA 1G6Q1 4XPIA 3P5SA 1ECGA 1HZJA 5KYWA 1AQ6A 1SCUA 3FKSD 2G9UA 4LF6B 1ZWKA 3GI1A 1Y4ZA 1K8RA 2XKAA 2R85A 3NRCA 1EVLA 1DUSA 4DLVA 3FOFC 1SHUX 3OTGA 1PDOA 3Q98A 2BFDA 4O4HB 2OD7A 1TQ2A 5BQPA 4BQPA 2O8DB 3QYAA 1DAHA 2BCGY 4KZPA 1CC1S 1UK6A 3EQZA 2BEJA 3Q7PA 5CT6A 1OYOA 2HKIA 4QBHA 4E1BA 4Z7OB 5B3LA 4DWJA 5MGNA 2WKQA 2XWSA 3W8FA 4QIHA 4AXBA 1YOVB 4N0PA 2VTKA 1TRKA 3G0HA 4K6OA 2OUIA 3QITA 4AJ2A 1TJ5A 5AKHA 2F3UA 5FEMA 5IG2A 4GLFA 5U4QA 4DQVA 4XYLA 1IPFA 1IZ0A 2QR5A 4DEXA 1YXMA 4L3OA 2C95A 4JJZA 4LBWA 1E2GA 2G63A 1OV4A 3MRTA 4KR9A 2WJ3A 4YX9A 4HDCA 1TQDA 3PXEA 1QRAA 5CLFA 1LJLA 3A2NA 3HFJA 4EARA 1DC7A 3RQIA 4RQUA 3RC8A 3GVCA 1P8JA 1GCUA 3LCVB 1EIZA 2QVXX 3E3OA 4PYNA 4TKMA 1UJ4A 3RVOA 2RAFA 1DQRA 4CMJA 1GL6A 3I5XA 2GVDC 2X4GA 5F1KA 1DS6A 3HJGA 1U9CA 2BD0A 2ECOA 4OHWA 1QR2A 5BSEA 2GK7A 3OPMA 1JIIA 3CLKA 1PTJA 3ZE8A 3GGOA 4C29A 2F3PA 2CY0A 5IHPA 3V8MA 5FV7A 4GZLA 3VNQA 3TLJA 1VOTA 1MX3A 2GJAA 2Q46A 2EJVA 3F6CA 2NUAB 4CKEA 5C1PA 1JKFA 2WM2A 1EPUA 1NXXA 2ZVJA 5FYQA 4IX1A 4R2IA 2VTEA 5HYVA 4URZR 2O0HA 5K0CA 1JPUA 4CFZA 2NZWA 2IZ1A 2IHZA 4YHHB 3ZIAD 4PYRA 3K6RA 3R9IA 4MW5A 3M82A 4LWQA 5I47A 5A6SB 1SC6A 4K9NA 1XZNA 5C5CA 3DL2A 3H86A 4IJ6A 1XHLA 4UHCA 1OBFO 1XVTA 1C80A 3JASA 4N7BA 4UULA 2HLDA 3FXAA 5H1YA 1V5EA 3JVEA 3Q0IA 4QPZA 3T4UA 2GCOA 1JHAA 1L4UA 3PSAA 1KMHB 4JU8A 4QGFA 4RBNA 5KCZA 3D43A 1Q44A 3RBAA 2PO7A 3OD5A 2FDCA 3VNAA 1N2CB 4NBKA 5CBKA 3LCMA 2A9RA 1TTPB 1XTPA 1B8NA 2JHAA 3PF8A 3FGZA 5FX2A 1I4DD 1SHJA 2CDNA 2IDMA 2VSFA 3INRA 2I2DA 5E1OA 3BREA 4UM9B 2OTCA 5D85A 5THXA 1ZN7A 3S1AA 5I7WA 1E58A 2UDPA 3C7AA 4Q4AB 1G2PA 2Q3CA 3DZ8A 3GRVA 5LOVF 2HJGA 1SVKA 1ZRMA 2O5RA 3NOVA 3HB5X 1NFFA 5DTQA 4UNIA 2VYVD 3KJEA 4CCYA 3PD7A 4HDAA 4MWOA 4YQYA 2HGSA 1W49A 2SKDA 1EU1A 2Z2IA 4G5FA 4Y0VA 3H8WA 3Q3GE 3AW9A 4R5HA 1WY7A 4LHYA 1A72A 2O20A 3ZY4A 2CHUA 2IF0A 4HH3C 5BRJA 2QZJA 1RBZA 1H4TA 1YRWA 2K5UA 3GPCA 2HQ1A 4QT0A 4EG5A 3VGJA 4LSWA 1DDGA 1XCPA 4ZV4A 5CG1A 1RQLA 2Z8XA 4ZXFA 4QG3A 5E4JA 2ZVPX 2RK6A 5AQEA 5CBPB 1G98A 5JWOA 1EK2A 5C1OA 1YL5A 4PCLA 5FTNA 1DAOA 1NUSA 2XQVA 2I66A 2H92A 2QD3A 2QYOA 1JHQA 3G5MA 4KGXA 5E6UB 4M6WA 4ERXA 4ZJPA 1E9AA 1WXWA 2ZSUA 1J70A 4P3KA 1QFYA 3DXFA 4Y6RA 3UHPA 1ZFNA 2O3TA 3ZVKA 2C2YA 4PSUA 3UAVA 3U1VA 2C3OA 1DAKA 2JGLA 4WINA 1YB4A 2QD2A 5AT1A 3K5IA 5BYAA 2AFIE 3OE7A 2XDQA 4OMDA 2PWPA 4LMPA 4L5BA 1ZL0A 4HBGA 1SXJD 2QL9A 3LPLA 1LK7A 2Z2XA 2VSYA 3KOMA 4B3TB 1QTRA 3B7PA 5JHHB 1F6WA 3ER8A 1JG4A 1PJBA 1QV7A 2HMWA 4LQDA 4PIVA 4FMDF 3R3ZA 2AVDA 3WGNA 5K6AC 1RRMA 2FZ4A 1F8FA 4ZALA 2YFYA 2QSJA 2J45A 3FPHA 4PZEA 3TMAA 1BMQA 2C9OA 3QUCA 4OK5A 1JHXA 2QXTA 4RAOA 4HMPA 1JHOA 2J8ZA 2WJAA 4HB2A 1BCRB 4YO8A 5A9SB 3BXZA 3CPSA 1O94D 1VBKA 1H66A 2WT9A 3L7DA 1V6SA 4GVLA 4A5SA 3IDFA 5UKDA 1FDUA 5ALJA 1F2DA 3ZI4A 1KERA 5JISA 1ECLA 4KXFB 4MKFA 4HC4A 4RY9A 2HMUA 3IE1A 1XZHA 3TSZA 1WDLA 1YUBA 3E3AA 3E9EA 3GRAA 1E2MA 4HN9A 1VGQA 4UCFA 3IELA 4C01A 4QGBA 4H3VA 1QG0A 4LXUA 2D2EA 2XT9A 1Y3BE 2WABA 4GHWA 3SR0A 5JWRA 3OQNA 4BV9A 5IK2A 3TTUA 2EQBA 2O3RA 4BO6A 2IYPA 1PHPA 4UEOA 1HEUA 1VL0A 1FMLA 2D1RA 3N8HA 1LD3A 4OSEA 2CJFA 4J0JA 4JLSA 4CL3A 5AKIA 1X80A 5DXJA 3KZMA 2BUCA 2WM9B 3ZI0A 1Z13A 3I1IA 3THWA 4ZU3A 4XI9A 4RVGA 1Q19A 1QQ7A 5JY6A 1JHZA 3GFTA 2Q8QA 4BO0A 4X54A 4PG8A 2YYSA 4UAUA 1I7NA 1V8ZA 2P6UA 1U6KA 2XCQA 3R6DA 1MRZA 1SQ0A 3RT7A 5EWJB 4BC1A 3WGVA 4EG4A 1XNRB 2A84A 2O7VA 5EJ7A 1ABFA 4EO9A 2LXNA 4FT4A 4MCJA 1K7FB 1ZXXA 3WYFA 4NK5A 3P9RA 4ENVA 6REQA 3BD8A 2NQTA 1ISIA 4NENA 2AFHA 1VI5A 2WKRA 2HHLA 3PC2A 3SQLA 4CMIA 1G6KA 3PUYA 3GLGA 4HAZA 1EUDA 2GHIA 2WU3A 4GLJA 4QDJA 4CQMA 2E37A 4S04A 4G4GA 4WBNF 1SRQA 2RHJA 3QLEA 4J4TA 3C3EA 3CRRA 3GJ5A 1FPMA 4JT9A 2C4KA 4FOLA 4P08A 4PYOA 4QQFA 2X1MA 4U39A 3U1TA 4C7BA 1XRQA 2GXUA 2YHSA 3EXIB 4LC1A 4QFCA 5DBEX 1FNSA 3VI4B 4WK0B 5EJGA 3LHDA 3EA0A 1I2CA 4H60A 4P0TA 5AIAA 3ZZ1A 1QM5A 4WERA 3G68A 3HCCA 1E2IA 2WD9A 3HU2A 1B7GO 4OGWA 5ILQA 1NIPA 2P9TA 2AXNA 4A8JC 3D7MA 1CY1A 4FXOA 4C1NA 2G5TA 2JH8A 4U2FA 4WY8A 4WNAA 5CUQA 4H3HB 1BHO1 1BRTA 3ZEAA 4DPMA 3WC4A 4E09A 1L7PA 1NQXA 1KS2A 1BRMA 3AF4A 5F3RA 4R1TA 3OP1A 5FRDA 5JCJD 5F98A 1DAGA 4G81A 4LI0A 4JYAB 4KQJA 3ZHVA 5AI9A 3LWZA 4ENRA 2OWEA 4JENA 4FDUA 2ZJBA 3IC5A 1VFPA 4Y6OA 4YDHB 4C4YA 1ZOLA 3HN6A 3B6ZA 1BJRE 2ZYTX 3CUTA 4IHJA 1U2TA 4JYMA 4V02A 4EI7A 5F2NA 2O05A 4EHLA 4QTTB 2QBYA 5IJAA 2L19A 1PS8A 3H2ZA 2R84A 1EFVA 3G5TA 5KYTA 3K3PA 4U2GA 4V0ME 3DVQX 1IN1A 1CJKC 3WMGA 3ZDDA 3AFOA 5IC6A 1AK9A 4TMFA 3ZK8A 5C2JB 3KD3A 4IL5A 3FRIA 3GA0A 1V1RA 3GRUA 3KFXA 1V4BA 3DB1A 3P8ZA 3NEPX 4MYSA 1YBAA 2P9CA 2R8BA 2XZPA 1MOQA 3G79A 1BCSB 4URYR 4MPPA 1W48A 3NPAA 4G0QA 2OFWA 3FZQA 2R1ZA 4RXMA 1I2MA 3RFCA 4QJ5A 3LBFA 1A95A 1HRDA 2QTCA 2XAAA 5BN5B 1ODFA 5F3DA 4Q7QA 2CSXA 3KT8A 2NNLD 3M89A 5E7MA 1EXWA 3F5DA 3NVDA 2ZUDA 2JGNA 2VF7A 3OLQA 3VR5A 4B4VA 4BN5A 5L8VA 2QS9A 3GT4A 4PCVA 1V3UA 2RKBA 1R16A 4HWOA 2GF9A 3BMNB 2D5LA 3BC1A 3CW2A 1NAHA 3CUWA 1R8JA 3I1JA 4XH9B 5DGXA 2PWYA 2OAP1 3QFTA 4NS4A 1HXHA 2G9RA 2BBSA 2O1XA 4LXXA 1DHTA 5AW9A 1L4KA 3GDGA 1GKIA 4HNQA 1KPHA 3H2KA 3NBAA 3QVGA 2GZ3A 1IG0A 4TV9B 1R3DA 4C0SA 2C1XA 1ONSA 2IU3A 2PZGA 4UUBA 4W99A 3IVRA 3RVJA 1MEJA 3VO9A 4D9NA 1WSDA 3A70A 1ZQ9A 1C4XA 2Y92A 4IF6A 2XXAB 2ZPAA 2J3QA 3ET4A 4GD3Q 1R74A 5DHUA 5JAOA 1YK1A 1I3CA 3NETA 4XVRA 1UPCA 1YUMA 1BHQ1 1QHIA 3EZ9A 4WESB 1H0RA 3H19A 3KKQA 4S0ZA 4C4AA 3ZOKA 4XIJA 3DE3X 4U6NA 1IUOA 3L82B 4O02B 1YR6A 1N7IA 2FEOA 2CHQA 2RAPA 4P7BA 5TMDA 1QAOA 4ACAA 2Z8YM 1P0PA 1QVZA 3AHIA 2OZEA 5G0WA 1N0WA 2C5LA 1T9GR 4G9GA 1AQLA 5CH5A 5IARA 2CUNA 2ZT6A 3ORRA 2MYUA 4ACBA 3M4XA 1HYGA 4ND5A 2O54A 3VH2A 1RAHA 3IHLA 1OLSB 1T2EA 2PIAA 5D3ZA 4NBVA 3L6DA 2CEAA 5EXSA 4ZDKA 3DG9A 3TLMA 1J2TA 5DZSA 5GMOA 2M6SA 1VG9B 3BWEA 5ALPA 2QN9A 4ETWA 4HWKA 2PD3A 2BONA 3U37A 3PDCA 1ULZA 4BRZA 2DWQA 2QTVB 5FXMA 4N41A 3DP7A 1FMCA 1QMPA 3SYLA 3D6UA 1JBKA 1RSZA 1Z2EA 2WPDD 4WCFA 4F21A 2Q50A 4IIVA 3UW3A 3W7VA 1LVHA 2WG1A 4Y1RA 1GXSB 1W47A 5CMLA 4YXWA 1OB5A 3AVVA 1PJ3A 3VR6D 5KOIA 3KEFA 1XQWA 3G85A 3NUZA 1SVLA 2A59A 5ULLA 3QXCA 3T0IA 1O9BA 2IXBA 3C5VA 1DPGA 1UC5B 1MZPA 2G0AA 3R76A 3W3ZB 4YJHB 4UOZA 4YY3B 5KS2A 1OC2A 1TLFA 1FF9A 4OQNA 3LMKA 3GMIA 4MULA 4DQUA 2JBHA 1A9PA 2HXGA 4ZV7A 2W4IA 2X2OA 1WUHS 4EG8A 1NVWQ 2MYNA 3LBIA 4N7MA 4BLOA 1D9ZA 1BDBA 4AZWA 2AJTA 4CKBA 3GCXA 3MOSA 3X1KA 3O0TA 1V9CA 3QX3A 3T94A 1S01A 1QIKA 3LQ4A 4CG3A 1ZS9A 3GBVA 3NLLA 3SC3A 2H63A 3L0BA 5DBHX 3AHEA 2QX4A 5C7IO 1VSUA 1FTGA 1X1AA 2Z2KA 3CX7A 2J32A 5IZCC 5FLXA 1XJ5A 4OHBA 5I8WA 1N5IA 3EK2A 3B12A 4G1EB 4JOQA 1GG9A 4PR3A 5CFNA 5E2AA 5FTWA 1EGHA 1ZD9A 1BWQA 2R2AA 5F2KA 1NRIA 1P60A 1YTLA 1TM5E 4TT8A 1JB1A 3ZWBA 2PYDA 3S8MA 2OHFA 3CONA 3F67A 1Y6JA 1N2JA 2NO0A 3ODGA 4AICA 4EATA 2BUBA 3P2KA 1DUIA 1P1FA 4PICA 5DISB 3BSWA 1TM1E 1XT6A 3NR2A 3U19A 3K7EA 2I91A 1SD2A 2B4AA 2XNKA 4KIGA 4MLPA 1KZ7B 2J9XB 3ANTA 4J6EA 2FXVA 1EFAA 9LDBA 2JIZA 3PENA 1IZZA 1U7ZA 1LY1A 1F6DA 2A0FA 4AX4A 4MSUA 2C83A 2J3KA 1C8BA 2FR8C 2I54A 3NBYC 1QVWA 3G8DA 4EA7A 5EWMB 2TRSB 2ROQA 2FP4B 2V6MA 1U8YA 4M0PA 2B7LA 4EGSA 4HXFB 1GRRA 3KZOA 1E96A 5BR1A 2PZMA 2XUAA 4MVJP 1F9AA 5CLIA 4R69A 1TQ6A 1M8KA 4KYUA 2HREA 4JDPA 4ALKA 1YBHA 4B40A 4NBUA 1K97A 4D2IA 2VWGA 1Z0IA 2J3JA 3GCWA 1RXUA 3I30X 4EJ0A 2GFHA 4E88A 1P4RA 1XU4A 1Z4LA 2M98A 2QAIA 1QGOA 3OKPA 4OHVA 5DLYA 4GF5A 1CIJA 1VJCA 1WMBA 3BWXA 4G4JA 5H83A 5EJIA 2J9FA 2M2IA 5BWMA 4J0EA 2P91A 3DHNA 2PUHA 3PDIA 3W5VA 1N77A 4YIHA 1EYZA 1LH0A 4NI5A 4AZSA 1R4ZA 2VJMB 3ZGVA 2XV1A 2GF0A 1T4MA 2VZLA 1Q11A 1RWKA 2ZIFA 3KKZA 4P98A 4YIKA 3RS4A 3FDZA 5DNCA 4QU0A 4EKEA 3TIGA 4DKJA 4BPBA 3UZUA 4MUBA 4AO8A 3ABIA 4PYIA 1W8DA 4C4XA 5JPCA 3HP4A 3LNCA 3VKUA 4GYWA 3RO7A 5C3MA 4MQFB 1SBYA 4E5UA 3NM4A 2B9EA 3WP1B 3KWFA 4DHWA 4EO4A 2H1SA 5ALWA 1FXWF 3UOAB 1Q2XA 4O4HF 4ZN6A 2WJVA 2QX7A 5IJ9A 5BP7A 3UT5B 3QXSA 1Q7CA 1T0UA 5DN6A 5AVZA 3T3GA 4NCXA 1BFKA 1ORRA 1X42A 1GPBA 2A5LA 2V9PA 4MVJF 3TEJA 3T3HA 3VAZA 2H2DA 1MVNA 4G56A 4YRPA 3WK7A 1Z18A 1ZESA 4R8LA 2H7YA 1ITZA 3AIKA 3ICVA 3P7MA 4BU1A 5JW6A 2OORA 1U3WA 4FFLA 1UMDA 1J5EB 1XG5A 4ER7A 4WK4B 4BEWA 1T29A 3GFBA 4MVJI 3DEFA 2J9YB 4IG9A 4RENA 1NQUA 1MJGA 4I3FA 3NC1C 4DA0A 3T9FA 1W5TA 2KBEA 5AW8A 1U31A 3H2YA 3FX2A 1DX6A 3WL4A 1U0FA 1K9SA 1MNAA 1QH1B 2IPMA 5K3CA 3DSRA 4GXNA 3WB0A 1W73A 3ZD9A 1XYYA 5KSOA 1GTMA 2G0TA 2CK3A 4QL3A 2O2IA 3AJ8A 2I6TA 3CZ5A 4OM8A 4IQ4A 4BV8A 2XT6A 1E5DA 3PX2A 5DXAA 1Q21A 4ZVKA 4CV2A 4BNHA 3A4LA 1Z08A 4OCZA 1RTKA 4YFYA 1JSRA 3HXPA 13PKA 3O8QB 1IC6A 3PPIA 4DJ5X 1GQYA 3DHYA 1PTJC 4MVJM 3BD6A 2IX9A 1Z28A 1NN5A 2XMSA 2YZ7A 3BD9A 4TS3A 1YJBA 2LW7A 4UPVA 3DLPX 1LLQA 2PX6A 4PC7A 3B51X 1SU4A 3C7KA 3NHKA 3NXKA 5EMLA 2ZUTA 4EYQA 1JL3A 2OT3B 3Q3VA 4LVOA 3JPYA 4YP1A 4L27A 1TVMA 4G0XA 1CR6A 3MINB 1GQSA 1EVZA 3AHFA 5K01A 4ITRC 4EPYA 1G66A 2CF5A 2PVPA 3HJRA 1Z29A 5HG0A 5JS1A 2QRVB 3LJKA 2GRAA 3F97A 4KPUB 4NLLA 2YJZA 2IZOA 1U7XA 1SU6A 4FFOA 1W1WA 3F90A 4OB8A 4TL6A 2ONJA 3ZDEA 3ORSA 4ZEMA 5IT4A 2B4TO 2LTAA 2OZLA 2OPHA 1GKUB 3P9YA 4FOOA 2Z3VA 1PHRA 1W2HA 3EA5A 3EHEA 4JLPA 3S7TA 2H18A 2IXDA 4GM4A 1R27A 3JZAA 3T8YA 3U0VA 3B1FA 3IA2A 5CHEA 4BMYA 1QVVA 2DHCA 1GL3A 3EEOA 1ELOA 5TQ2B 3WB2A 5CD1A 3AFMA 2PT9A 5LU8A 1PQWA 1Z8HA 2IDKA 2Z04A 4DF3A 1P1KA 1A8SA 4PNZA 2BI8A 5HSGA 3UENA 2YIVX 1XPUA 1ESMA 3TM4A 1UAGA 2F9MA 5CPFA 2BGUA 1ZGJA 4RWZA 3ZHSA 1FJXA 2IPAB 5AJVB 2GCPA 1P1CA 4N5HX 2PM8A 5GVSA 4FFRA 1X39A 2HL6A 1PKXA 2EBFX 3NWBA 2DTXA 1VLQA 3M7IA 2OZVA 4KDFA 4LIPD 3I04M 2FG5A 1KK2A 2H3EA 3C0KA 4AZ3A 2KM1A 4JASB 3FCEA 4I9FA 2H11A 3M3PA 3B53X 4ZVUA 3QX7A 2N75A 2WD7B 4H17A 4Q1VA 2IITA 3AI7A 3LUCA 5BXYA 4KODA 1GAEO 1TZCA 3A1NA 3QKWA 3HCAA 4QJ3A 4KQ6A 1BX0A 2Z9BA 5ESXA 3M9XA 1V2HE 4W5NA 4NHEA 1I10A 4CKXA 4LXIA 2JC3A 3AF0A 2IVFA 1HM5A 1PFQA 3F74A 5B3KA 3LCJA 2J9RA 4CF4A 3JVVA 2G4VA 4MOWA 1S9DA 4D9JA 1U28A 2IHBA 2JVIA 1E4OA 2QGNA 1W85A 2ON6A 3D64A 3R3YA 2X8JA 2AD5A 3H0KA 4JUFA 4RF2A 4Z3KA 2EJBA 4L8YA 3JD1A 2PX8A 3Q85A 2CWWA 2QTRA 2YVQA 3SJCA 1E66A 1BROA 3BS4A 3OEEA 1ZXLA 4LJSA 2W6IA 4V0QA 1CQJB 1U9YA 3TWOA 1MO5A 3E5HA 1IDOA 4Q18A 1HFEL 1K63A 4MWEA 1GZ4A 3EPPA 3DOCA 4IICA 1QHHA 4PAGA 4P54A 1Z62A 2UVPA 3DFMA 3KOWA 2ZIGA 2XMQA 1E2KA 2Y71A 3ZLTA 3H2HA 2VDRB 2OCPA 2YXDA 4L51A 4QTYA 1YI8A 1HE2A 2B3TA 1N7GA 2RHWA 2JGDA 2V7QA 2PHZA 5HZMA 2ES4A 2VHJA 1FFDA 1QIDA 4PPYA 1NMSA 3UPDA 4JV5B 4G89A 1T8UA 4KZKA 3EN0A 2HMYB 4C7JA 4TVKA 2I67A 1LDGA 1M54A 1X0VA 3E9ZA 3UGQA 4NR0A 4BFUA 4CFYA 2ERXA 3UMYA 1EVQA 2IYVA 5LMUB 1SKYE 2APJA 1E8MA 2VHTA 3CWCA 4BVKA 4HLDA 1BQEA 1JHVA 5IUKC 5ENDA 4R7TA 4UOEA 2C07A 5EP1A 3VISA 4IAOA 4QX6A 1M6WA 3RUDA 5JROA 2BCJQ 4IVRA 1EFRA 3C43A 2GRJA 2PJUA 3PGJA 1HK7A 3PQFA 3OE1A 4OQQA 1UBEA 4XM2A 5E95A 4EY3A 3K9NA 2B35A 1T1EA 6GPBA 2J48A 3DLCA 5CH3A 1RFLA 1TF5A 3ITEA 4GYJA 4IS3A 5K0LA 4IH9A 4FJ1A 1G8KA 1J56A 4MVWA 4LDAA 4O1MA 2B9VA 2B7CA 2OCKA 5CAEA 2WV9A 1ZI6A 1MQ8B 2Q4TA 4B6OA 4N8SA 4EAQA