1D04A

Comparisons of wild type and mutant flavodoxins from anacystis nidulans. structural determinants of the redox potentials.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
169
structure length
169
Chain Sequence
AKIGLFYGTQTGVTQTIAESIQQEFGGESIVDLNDIANADASDLNAYDYLIIGCPTWNVGELQSDWEGIYDDLDSVNFQGKKVAYFGAGDQVGYSDNFQDAMGILEEKISSLGSQTVGYWPIEGYDFNESKAVRNNQFVGLAIDEDNQPDLTKNRIKTWVSQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FLAVODOXIN
publication title Comparisons of wild-type and mutant flavodoxins from Anacystis nidulans. Structural determinants of the redox potentials.
pubmed doi rcsb
source organism Synechococcus elongatus
total genus 56
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 1999-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1d04A00
3K1YA 3NHFA 2QWXA 1SQSA 3LCMA 1WSWA 2FZ5A 3TEMA 3O2NA 4XDGA 2Z9BA 3NHLA 1YKGA 3EYWA 2X2OA 1VMEA 4OXXA 1RLJA 2KQUA 1H66A 5TGZA 3FX2A 2MTBA 4YAWA 4C76A 5EA2A 3F6SA 4LTNA 1KBQA 3NHWA 3OWHA 4QOJA 3N3AC 2KLBA 2BMVA 1BVYF 3FJOA 4N65A 5NLLA 3NFRA 3N39C 3SVLA 4ZVLA 3S2YA 4YALA 5BUCA 1OBVA 4Y7CA 2HNAA 1KBOA 3F2VA 4ZVKA 2QX6A 3W78A 2MWMA 1GG5A 1XYYA 5FX2A 2BZSA 4DIKA 1AKVA 4QOHA 4C0XA 1FUEA 3LT5A 2X2PA 3L9WA 1NNI1 1T5BA 2QX9A 3NHRA 5LLDA 3NLLA 2BF4A 1OBOA 1V4BA 4LAFA 3TE7A 1H69A 3W77A 5EAIA 5LVAA 2QX8A 1RTTA 3GAMA 2OHIA 2XODA 2F1OA 3N3BC 4M0CA 3GFRA 3QFRA 2BPOA 1XYVA 5F4BA 4H6PA 2Z98A 1C7EA 3NHJA 3OJXA 4NLLA 4J8PA 3KLBA 3G5MA 3B6IA 4F8YA 3RPEA 2ZKIA 4HEQA 4U7HA 2R97A 1CZOA 3KEGA 3ESYA 3OVMA 3EDOA 4NULA 4PU0A 2FX2A 1FLVA 3FNIA 2QMZA 1FLNA 3NHPA 4DY4A 4C0WA 1BU5A 1I1OA 1XI2A 4FGKA 2V9CA 1JA0A 1YCGA 3NHSA 3NHKA 4S24A 1YDGA 4GI5A 2FOXA 5JROA 4Y9UA 3NHYA 1DXQA 3ES9A 4GR9A 1QR2A 5LMCA 4YAUA 3NHUA 4N9QA 5LJIA 3FW1A 5NULA 1CZRA 3ESZA 4QOEA 4H2DA 1YCFA 5A4KA 5F12A 1CZHA 3OX2A 2OHJA 2Z9CA 1AHNA 2WC1A 4XDHA 5FA6A 1CZNA 6NULA 2FAXA 4ICIA 2Q9UA 2V5UA 4QODA 1E5DA 1AG9A 3ZHOA 1RLIA 4LTMA 1QBGA 1T0IA 2B3DA 4CETA 2FVXA 4DILA 2OHHA 4R81A 3KAQA 5LBTA 4LTDA 2QR2A 4FGLA 3OJWA 2HNBA 1J9ZA 4QOFA 2FZVA 1D04A 2FDXA 4D02A 3P0RA 1ZWKA 1AKQA 3D7NA 1X77A 3UXEA 2N1MA 3K20A 2MT9A 4N82A 1SG0A 1CZKA 2MOKA 3B6KA 4BMOB 4CF6A 2A5LA 5ULLA 3W7AA 3B6MA 1FVXA 4ZVNA 1OFVA 1ZX1A 3F90A 2R96A 4ESEA 4FX2A 1DXOA 1QRDA 1J8QA 1C7FA 1XT6A 3GFQA 1D03A 1J9EA 3W79A 3ESXA 2RG1A 5LJLA 4LA4A 1AMOA 1CZUA 2D5IA 4HS4A 4FGJA 2GSWA 3HR4A 4PTYA 2FLVA 3HA2A 1RCFA 3B6JA 1J9GA 2AMJA 1AKUA 4YAFA 1FTGA 4ZVMA 1AZLA 3L9XA 1QHEA 2BN4A 2FCRA 4YQEA 2W5UA 1B1CA 1DX9A 5EMNA 1F4PA 5LBUA 4PTZA 1CZLA 4QOGA 1TIKA 4C14A 1AKTA 3QE2A 1YCHA 1FLDA 3HLYA 2QMYA 3UXHA 3FVWA 1TLLA 2ARKA 3F6RA 2Z9DA 1YOBA 4YAOA 3OWXA 1JA1A 3OX3A 3R6WA 3U7IA 1AKWA 3QFCA 2M6SA 4U7GA 3O73A 1FX1A 3U7RA 3GFSA 1YRHA 5B3KA 3JSXA 1FLAA 3OX1A 4Y9RA 2M6RA 1D4AA 1ZWLA 4QOIA 4U7FA 2Q62A 4GQIA 1AKRA 2V5VA 3TZBA 5F51A 2QX4A 2HPVA 2OYSA 2XOEA 3KAPA 1WSBA 4BMPB 5FUQA 5B3LA
chains in the Genus database with same CATH superfamily
1BJTA 1FU4A 1NSYA 2Z58A 1WP4A 1TF2A 4INJA 2A1TS 3C3PA 1V7PC 2QM3A 2V7PA 3V8BA 1O94A 3Q12A 3IOMA 4C7KA 4DOMA 5JWRA 1L7PA 3LSYA 3RK4A 1SU8A 4RY8A 1G21A 5LD2B 3D7LA 3JATA 2LWIA 4HC4A 2VHCA 4FB4A 1XXHE 2HA7A 4RF4A 3UMBA 4DQXA 5TIIA 1QLJA 2WTXA 3NONA 4RW0A 2WE7A 5EL0A 1N8SA 3H2ZA 3SF0A 2DVMA 1RRCA 1ZNYA 3QE4A 3FHOA 4R1QA 5FJIA 4Z4EA 4XTRA 3TEMA 2IEYA 4RV5A 1CS0A 1FS6A 1VJDA 3PUVA 1D2CA 3IAS1 1N77A 4QGFA 1EDEA 1D6MA 4L0CA 5KJ1A 5DBIA 5BMVF 5GJCA 1FFGA 3BF7A 3IAXA 4IEFB 4WJKB 2GVNA 2JCGA 2J0UB 3EZGA 1TO2E 1VKJA 1E60A 2JIOA 4B09A 3SU8A 1P5HA 4U7TB 4F6LA 1MQ9A 1JALA 1REQA 1XL1A 2O7QA 2WSLA 3TCNA 5F98A 1KFEB 2RHWA 1DIHA 4ZV7A 3RRXA 3DFFA 9LDBA 2XA1A 3M3DA 2WV7A 5E9QA 1PQPA 2B0JA 2DBYA 1FU8A 4X7RA 2I4OA 3UJ3X 1RU3A 2E4XA 4NBRA 5KC8A 1N5JA 5EA2A 2WKQA 5HZGA 4UUPA 3T15A 1JB9A 5JXIA 5KNDD 5F2EA 4O4IF 4HB3A 2WIGA 2GCEA 5GM1A 1OGJA 3FPCA 1EFAA 2VP2A 2I8CA 4FGWA 3DL7A 3JZMA 1LBTA 2FW6A 3V8EA 4UPEA 3CPHA 2IELA 3QKRB 1QTQA 3H8SA 1G2PA 1T5HX 4ARZB 3LFUA 2C0QA 1ZMTA 5HK9A 4WDQA 3KALA 2YIMA 2O5CA 1NW4A 4M99A 3IVXA 3GHYA 5EEGA 1VFNA 1V9CA 1W85B 2CHFA 3LIIA 5IUJC 1LDNA 1I0ZA 1R0CA 2JFUA 4MS4B 2BHNA 2FF5A 2V58A 1GHTA 1U7ZA 3OG9A 1LBIA 2A9QA 1N6LA 2Q0XA 1E3JA 3BL8A 3N8IA 1M2OA 1DC8A 4TXJA 4G84A 3RFTA 3VYTB 5EJEA 4NZNA 4PG4A 1IM5A 3CONA 3LJKA 4LJSA 4WXMA 1T1JA 4YJ2F 3WLTA 1TUBA 5H70A 1RWXA 4Y1GA 2ZROA 5ED0A 4UE2A 3WIEA 2ODTX 2D5BA 4GECA 3DM9B 1C50A 4EITA 5ICSA 2GLXA 3C6KA 1KOJA 2A78A 2BFCA 3FPSA 4ER6A 5BV8A 5DHFA 3OFSA 5JRZA 1NP6A 3LYHA 3WIVA 1K8QA 2Q6VA 1QIDA 1OLUB 5H1YA 3EEIA 3DGFC 5AHKA 4ZQGA 3SI7A 3WRYA 3U44A 2Z8YM 2H4XA 1OBVA 4JHLA 1GZUA 5J5VA 2PQ2A 4FCWA 3DS8A 3I28A 5EWJA 3I2IA 2HNAA 3C1UA 5DJ5A 1E2UA 4JENA 4RACA 3ETNA 2GBLA 3DE6X 2Q6OA 1XMVA 3GRZA 5FCDA 3UW3A 1GG5A 5BWLA 3TQSA 1YACA 1LA2A 4ESHA 2IZ7A 4JBHA 1G8JA 1Q7BA 1U9IC 2CNKA 1JR4A 3GCXA 4BKUA 4BNKA 5IULC 2HK7A 1I7NA 1XYGA 2D8MA 4YV1A 1KVTA 1QZZA 2RBKA 1CFZA 3FWYA 3KJQA 4NNPA 1OYYA 2DPLA 2IYOA 2QRGA 1YHYA 1XHEA 2YOHA 2JAOA 4ILKA 1NONA 4RXUA 5DISB 2CMHA 2AUNA 1K06A 1NN1A 2VPXA 5HUHA 1QU3A 4M0DA 3L7LA 1EAYA 4MUEA 1X8KA 2OFWA 3COYA 4M1YA 4UKDA 1FRQA 1PNTA 2BJWA 5IN5A 2G77B 3VJLA 3KJEA 3N8GA 2FVYA 2ONCA 1L5KA 5JMTA 2JGDB 5J5AA 4DUZB 1FJXA 3STVA 3B6EA 4ARIA 2VK2A 3LNTA 4Q4JB 2V98A 1KY4A 2ZU0C 5AJYA 1VIMA 3RRZA 4ND7A 3HE3A 2QTHA 1JA9A 3W1WA 5KYGA 1KR2A 2MMCA 5I3CA 4WLNA 2GNPA 2NSHA 4FNGA 2C4HA 2O1XA 3NGMA 4Z4CA 2YYSA 4IHJB 5CFLA 5LVAA 1YVDA 4QEZA 2PA3A 1S3GA 1XP5A 2I4NA 1EGAA 2OHIA 3IEPA 3NDJA 4JZYA 4MRSA 1Z2CA 2JNWA 3CVWA 3SSMA 2XCRB 1G8YA 2HCJB 3ITDA 2IZ5A 2MSDB 2Q5OA 2R6HA 3N3BC 3OE1A 1RLOA 1NW7A 1XLTA 1ZJWA 1E9EA 1C7JA 3G1TA 4BN0A 4MWDA 1QOQB 2EKZA 3HKCA 3GNSA 1CEQA 1UPUA 2IDZA 4GEKA 4ZU1X 5LB2A 3ZBTA 3ZLTA 4NG5A 1I2CA 4EHLA 1EWQA 2BSXA 1PSDA 2IOYA 3DMFA 4GI1A 4Q1AA 2J9ZB 9GPBA 4ND4A 1RZRA 3WRWA 2BFEA 4C89A 1G8GA 4D3YA 2GDZA 5JJKA 1NHWA 3B20A 5CFMA 3MQ2A 2H11A 1TVCA 3OBBA 4NC9A 4WN3A 3PP8A 1DLJA 3KCQA 3PT9A 5KDDA 4UAUA 2W42A 1GPJA 4KIGA 4NBVA 4V1CB 1C30A 3ID6C 1XZBA 4CT4B 2B7CA 3BIOA 1TADA 4B2IA 3G0BA 5AM1A 2FNAA 2FUEA 1K2VN 2EGHA 3Q3IA 1C9NA 2AN1A 2BEWA 1FMLA 1NXPA 2FPIB 2RGYA 4ZODA 3AUYA 5KNCH 2FB9A 4P80A 4LJ9A 2POCA 5IVHA 1Y8CA 3AH8A 3AR3A 4UQOA 5JH7A 1R88A 3CO0S 3AK4A 3ZQ4A 4N39A 1Z0ZA 4RVOA 1X0VA 2O48X 1UM9A 4I81A 3RT1A 4C0WA 4OHYA 1K3TA 1T5TA 4ER3A 4MWTA 1BU5A 4KQ6A 1ZM3A 4POOA 4B17A 4D9FA 2GI4A 4S1OA 1R16A 3VPGA 3H11B 5JJCA 5JPDA 1T2UA 4JR1A 4EYEA 4OREX 4AS2A 4IILA 4JJ7A 3GAFA 4BGVA 4L4ZA 1IUKA 3E7PA 3MB8A 4QPJC 2VKQA 3FY4A 5JZVA 3DMRA 3WIOA 4I1OA 1VL8A 4GZMA 4WLOA 3JZIA 4KMMA 1Z5OA 4Q9IA 1QQBA 3ZJTA 2BM8A 1QV6A 5JHHB 5H68A 4ZMBA 1EWYA 3O3MB 2QLMA 3NVMB 4XCQA 2BJHA 4A0FA 1QU2A 1CNEA 2O23A 1JLHA 3N76A 4RHUA 4PGAA 1O95A 2RC5A 4Z51A 1OAOC 5JT1A 5JS6A 1T1IA 2GJ9A 3BK1A 2P8SA 3ES9A 3MWDA 3BTUA 3QBDA 4HJRA 3IV6A 3JAKB 3U5TA 5E1MA 4RWEA 2JCBA 2PZEA 3PX7A 1XSEA 3K32A 4NZZA 1Y1TA 5DZSA 6Q21A 2CN1A 3RTBA 4YWHA 2NUTB 3FW1A 1VPTA 5EZYA 5JBIA 1X7XA 5GIOE 1L5ZA 1YRQA 3PG5A 3J80A 2WMYA 3QJYA 2IF0A 1ZD1A 1AM4D 4AZ0A 1OFTA 1DAMA 4JLBA 4BO2A 5JV5A 1QDUA 4QRHA 4MEBA 5HGXA 3CVXA 5B3JC 5A4KA 1PJZA 5A9SA 4WOKA 1W29A 1JMKC 4MJLA 4BN4A 4RLSA 4EB0A 1NLMA 2XNSA 1V1RA 1H93A 1P2SA 1SVLA 2R751 3EDMA 4JYBA 5K0TA 1PWYE 4KGZA 3VR6H 2HO4A 2CJXA 4FYVA 2WD9A 4UNIA 1CP2A 3LT1A 3N0TA 4E5SA 2C3YA 3OQBA 4K9LA 1T1EA 1NMEA 1UBMS 3AWIA 2LW7A 2QW0X 3E3OA 1FB5A 5JSYA 3ROXA 4CMEC 4DWVA 1Z36A 4HDQB 1XZKA 3OFJA 4J1SA 3T99A 3UEOA 3SS9X 3IUMA 1VKZA 1EFPA 1N7HA 2BGLA 5K8CA 1D8AA 2B3DA 2WUGA 3LY8A 4O2AB 4C2BA 1D8TA 3ZU4A 1K7CA 4MRVA 2Q3BA 2IDJA 1YUBA 1CQIA 2WI8A 4IIEA 2B8EA 3TIFA 3C39A 1FNSA 2GKGA 4I08A 2RJ3A 4B4DA 4G1EB 4BFZA 1TW3A 2ZS8A 3NC0C 5FADA 3P5BA 5EUBA 1UJ4A 2N1BA 1ZL2A 3OJWA 5K3CA 5IYZB 2DT8A 3C98A 1KF0A 4WDRA 2ZI3A 3M3HA 3MOGA 2XKAA 2H1VA 4G26A 2FZVA 3CRQA 1OU4A 3EDQA 621PA 1W1WA 4A15A 2HDWA 1CIVA 2X1HA 2GEVA 2RGCA 4IHQA 4DLYA 4R3UC 13PKA 3ZNPA 2ZATA 4ZJZA 3SS8A 1ADCA 2Q3EA 3TQRA 1COWA 4IZOA 2FWMX 1EFTA 5FLYA 2NQTA 4UUOA 3D7NA 4FXPA 3PTZA 4D5GA 4H0CA 1RI3A 4E5PA 1F8FA 1Y1RA 4KN9S 5A3VA 4OX9Y 4XD7A 4FYJA 2GTIA 1R6TA 4RV9A 4DIMA 4A36A 3RJZA 3TLAA 1ARZA 2Z04A 3G85A 4EW2A 4UVGA 4ZOCA 5KNDH 1MVNA 1NI5A 1GP2A 1W5FA 3V4LA 3THYA 3BYZA 1JJFA 3F74A 4YJGB 1LV7A 4C3ZA 1MJHA 4HG2A 1T3SA 1YASA 3B2QA 4X60A 3OU6A 4ADSG 4EDFA 5DWQA 3IT2A 3MRVA 4E31A 3M6LA 2QBYB 3AEUA 3AV0B 4Y1FA 1XE3A 2XLBA 3BSYA 4N49A 3RKSA 1SIOA 2CCKA 1AIPA 2D1SA 4AQDA 4B6QA 4L3OA 4ZKDA 3UN1A 1TTTA 1NQWA 1LW7A 1X7YB 3KVYA 4EMBA 4DCMA 1QVAA 4HSGA 3UGQA 4FS3A 2FW1A 4B31A 4F4DA 5F33A 3WV4A 4ZANA 2W0MA 3P94A 2QD5A 4C4PA 5HUJA 1EX6A 3WJAA 4CMKA 3K73O 2G5CA 2CHQA 2RKWA 1I7LA 4JT2A 5CBKA 3SCZA 2B2XA 5FULA 3DTVD 2A9VA 3G7SA 3MMNA 1Q11A 4GBMA 3WOHA 4D9JA 3CLUD 4IDDA 1QMPA 2NLOA 3V8QA 1Z2NX 1OMOA 4NK5A 2WJAA 4GWGA 2PUJA 2D1FA 2X5NA 3MF4A 1FE8A 2W2KA 1UZAA 3M5PA 1G5RA 3QU9A 3DVRX 3IP3A 3LTNC 4C0HA 4C43A 1AV6A 1G8AA 1VP3A 3BTVA 2MCFA 4CCAA 2VP4A 3OCJA 3TUZC 1XU9A 3DW3X 3FZGA 3HP1A 2C5AA 2LV8A 2WM8A 1W1UA 4FFVA 3ZCQA 2A84A 2O0KA 5IWAB 2BWJA 2ZIVB 3GPBA 4PCUA 4TT3D 1N2HA 5BY2A 3K9GA 1D1TA 4IIBA 5DXJA 2O7VA 2NP7A 4G86A 3GDFA 3AL3A 2GDJA 5DE3A 1CYEA 3LO8A 2AJCA 3U49A 3CURA 1R9MA 3NP9A 1X86B 4TTIA 3RRYA 3RFUA 3URMA 1FQWA 4EX6A 3TW8B 1KI4A 3CUUA 4X62B 4R5HA 1MJGM 4TN5A 3ZYZA 3L8CA 1DX6A 2DWCA 2J3KA 2VJDA 4AZWA 4BNMA 1D6JA 1J49A 1NJGA 4QGBA 2D4AA 1AZTA 3WJ7A 1M76A 4LWZA 1IMOA 2B36A 3HCFA 3PVCA 3EAQA 4R7ZA 3D1VA 4BAZA 3MCZA 2ZWIA 1RJWA 1Y1SA 4NQZA 4A5SA 4D0GA 4C7BA 3QV2A 4G4SO 4DZZA 3LO5A 4EO9A 1SXJD 4GKVA 4ZDJA 4QJ5A 4WBNB 1E2NA 2HDHA 3G89A 5KX5B 4RKRA 1WSAA 3RTGA 5KKAA 4C14A 3BAFA 4MO9A 4E51A 5CJJA 1CJKC 3V3KA 3GBPA 4FFBA 5F2NA 1TZ2A 3AP2A 4OFXA 3W5UA 1GTRA 4C07A 3ZTWA 1E0KA 4ZO7A 3ICQB 2C2BA 5LMZA 4E15A 5JADA 4O5OA 4FEEA 1JHMA 5JCJA 3REQB 3HJFA 3OMWA 2I6UA 5ECWA 2PT7A 2HU7A 3AX6A 4R0NA 3FDZB 2GBCA 3TE6A 4YAOA 1RXIA 4YCAA 3GUZA 2FSFA 4ZYTA 1RYBA 2WKWA 3RV3A 5B7PA 1H4VB 5ICCA 1NUPA 1ZNZA 3T3NA 1FSPA 4C4YA 1ZK2A 2FZEA 7ABPA 1F0NA 4OHFA 2H65A 3CCFA 3EVAA 2IQ5A 4DV7B 4A2CA 2CD9A 2DZDA 4OEHA 1L4GA 5J4KA 2YV1A 1KE1A 1S96A 1JDSA 4W7HA 3IUBA 3UMSA 3VX4A 3WWYA 1KYVA 2CBZA 1YU9A 1Z63A 4JBNA 3TINA 2W93A 3E9RA 2R11A 3HDHA 3O73A 1R5BA 3R09A 1N5KA 4O8ZA 4OHKA 1QF6A 3BRQA 2DYKA 2XR1A 4OI2A 1CVLA 1TEZA 3E9MA 3V1NA 1GGMA 1Z2PX 1YE8A 3IAS6 1BX3A 3GT7A 2C9MA 3QOXA 4HPJB 3LA8A 2DGDA 5E9WA 3GDWA 2WF9A 3ERCA 1RP7A 1NVMB 2PYDA 2VF4X 3DFKA 4WI1A 4F3YA 4YP7A 5B6JA 3RYIA 2Q8QA 1LZLA 3TNJA 4BLOA 5EWMA 3EGWA 1JX6A 4I1VA 4HX9A 2O2GA 2FHPA 2W98A 1VOTA 4G8CA 2WB2A 1T8SA 1OZHA 3PK0A 4X64B 4TLAA 3AQ4A 1H3EA 1YBMA 3AF0A 2PO5A 3Q3HA 4KE6A 4Q1EA 3KYCB 1UK7A 3BWDD 4NZYA 2ZBUA 1E9FA 1ZVKA 1R6XA 5CA1F 1TW2A 4S05A 1A2OA 1W0JD 2UYQA 2VP5A 3D5TA 4MPPA 3SM9A 3CZQA 4DSUA 2BGRA 4IQ0A 4DDUA 1Z28A 3MTBA 4CM8A 4WKCA 1HQKA 4DUYB 1AT1A 4QEKA 3U37A 1E4VA 2PGNA 3A2KA 2RGUA 3C5CA 4BGUA 1MVOA 4KNWA 5HE8A 1IZYA 4L4SA 2ZSFA 4A16A 3F1LA 1KEWA 1UDRA 1AQLA 1U9CA 2FI1A 4KPUA 4OUKX 2PZGA 2PRZA 1K89A 2W00A 3HV0A 1YDHA 4PYQA 4Q0MA 1EFVB 2FK8A 5AOCA 2VJMA 2WNSA 3LLMA 1N0VC 2IZOA 3IUNA 4JUCA 4X1IA 4D8VA 3Q3GE 6YASA 3TRDA 4Y2VA 1XRRA 2OGWA 3AJEA 3VKFA 3TQHA 3A1SA 3BE6A 2J4DA 1GA1A 3MCUA 4CTKA 1XXHA 2WILA 2RIRA 4O4IB 4NR0A 5AM0A 3VZBA 1RYZA 1R0ZA 4BJ5A 1E1MA 1OAKA 1XNHA 1SNYA 3KOMA 2EHDA 4BVFA 5IJZA 4WW0A 5K0BA 2ZZMA 2WSSD 4P7GA 3UA3A 4Y8VA 5JJIA 3DR3A 5TV2A 2KQUA 1SUAA 1DWOA 1EVEA 4P5PA 5D85A 5DSTA 3R5HA 1E58A 1H66A 1QGZA 4Y1RB 4B9AA 3O8RA 4DB4A 2WMDA 3F8TA 2CK3D 2CMKA 1W36D 2V3CC 4ZQHA 3SSAA 1PGOA 4CTJA 1X74A 3RSHA 3VNQA 3L7YA 4X41A 3AM1A 3V8RA 1ODIA 2DB3A 3L49A 5J40A 3W5DA 3O92A 3QV1A 4JS0A 2YUIA 1NOIA 5LD2C 4GLLA 3O94A 4IJWA 3O26A 3UWOA 1ZK0A 4IJ5A 3WHIA 1EDBA 4MNTA 3OQPA 1HYHA 4MUXA 5FBHA 3DOUA 1ZN2A 2GZSA 2WFAA 1KYYA 4ROSA 2JGNA 3RROA 5E9AA 4E46A 1Z4PX 4GX5A 5KOJA 5TX7A 2DWOA 1KMQA 3ZU2A 4N1AA 3KL2A 3SEZA 2WG0A 5BUCA 3G68A 3A7EA 3IV9A 3KSRA 4KSBA 3K1TA 3QWFA 2G70A 5KTNA 1T9AA 4G0QA 2PRSA 1GADO 4H16A 2CZQA 1RHUA 2C58A 5HCIA 5ABPA 1C9YA 3AIMA 3H6KA 3EGIA 2HSJA 4QUGA 1WQ1R 1QG2A 1DV1A 5LQSA 2YJZA 4EG0A 5SICE 1I2BA 4N65A 1FVOA 4P0TA 3OF3A 5EWLB 5F3RA 2UUCB 1XDWA 4B7CA 3MOIA 1ZG3A 3SYLA 3B2NA 3JYNA 2EJTA 4HLDA 1USGA 3NQ41 5DTIA 2HCTA 4NI5A 4WECA 4ARCA 4F12A 3KXIA 4MUIA 1TXGA 2WEKA 4RABA 5ALEA 3S40A 2X8WA 4MYCA 2ZP1A 4EA7A 1RXWA 4N7RA 2HM7A 5GY7A 1K8XB 3MTDA 3BF8A 2HRZA 3TTWA 2QL5A 4IJKA 3CMMA 3TPCA 2FN7A 4LC0A 2JKYA 2ZVDA 4CV3A 1ZO8A 1S7CA 4BO5A 1PT8A 1SBIA 1HF3A 2VWQA 4IMRA 4TL6A 3BWEA 2I5PO 4CKWB 4XDZA 5CURA 3LW7A 3KHUA 2BM1A 1Z3IX 2H08A 2PUHA 4LYEA 1C0LA 1A97A 1Q83A 2FR8C 2WPDA 1TYBE 3A05A 3G9ZA 1WZNA 5BWCA 7GPBA 1ZOPA 1C4KA 1L5WA 5C5EA 2HSGA 1FQKA 3GMDA 5IZ4A 3NAZA 1T2AA 2PMBA 1NVXQ 1FDIA 4GYYA 4LXTA 3VXKA 3WJ2A 5ALJA 4MUJA 3SZLA 1CDOA 4BC1A 1O5IA 4WX2B 4DT1A 1E9BA 5LR6A 3ZD6A 1BE8A 2DWQA 3GEEA 3TVTA 1Z0DA 1NVFA 1ZGBA 4BEVA 3JQAA 3VSAA 5DM70 2GETA 1JHZA 4LF5B 1SR8A 2XOKA 2DPXA 4J0GA 4MJ3A 4RGQA 3TQFA 3P8ZA 4AQ7A 3BICA 1LFAA 1UBJS 2BH9A 1UMCB 4GW3A 4KU4A 1E6WA 1TJYA 4MR8A 5HJ2A 4TKVA 8ABPA 1P2GA 2Y9MB 4WCFB 5IRCD 1YA8A 3R20A 5MN4A 3FFBA 3VH3A 2B7LA 3BHJA 2ZVQX 1IOZA 3JQ9A 3MGCA 4M9RA 4XA8A 4IUBS 5IKMA 1S2LA 3GUHA 4QDJA 4TKUA 1UFRA 2B6HA 5BSKA 2A7QA 3I32A 4ACAA 1XTZA 3BC1A 3FOWA 4LV8B 4U1RA 3DLTA 1KP2A 3ECAA 3D7RA 3F7TA 3JARA 4BQEA 4WNAB 4DYDA 2JFBA 1XDUA 3G8CA 5KKNB 3ER9A 1CJTC 1G8HA 4K1XA 1PWHA 3WP0A 2W4QA 1NA5A 5GQSA 3AFNA 1PZMA 2GN4A 1QBKC 1NXVA 4H6PA 4L57A 2WT4A 4OTZA 3PIDA 3LLVA 2PSHA 3IR7A 4QQFA 4XX0B 1I14A 1POXA 2NZWA 3D4PA 3DOHA 3OJXA 1M2HA 4G0ZA 5L45A 1JH8A 2P2CA 3F96A 4EG5A 4EZIA 1NLYA 2AWNA 2DY0A 4LVNA 1HYEA 3PQ3A 3QF4B 1C1XA 1G291 4J2OA 1YAHA 1DUVG 4HDMB 1GKLA 2ERXA 2OZLA 2H5EA 2RHGB 3CX4A 5CLHA 4MCIA 4DTIA 1F2UA 4NK4A 2R97A 4OAOA 1MAAA 2I7XA 1KMHA 4GPTA 4C20A 1DJLA 3CUWA 1TVMA 4OP1A 1P61B 3KKMA 2WYHA 3N0RA 2V0GA 1PQYA 1JXQA 5ER9A 3WWOA 1WPXA 2JB9A 5DGIA 1VKNA 4ZEXA 4UAGA 5JUWA 4UEWA 4IKPA 4IQGA 1GSHA 1HH4A 3PITA 2RI6A 4DEVA 4GQBA 6ADHA 2WJ6A 1GLVA 3DUFB 1NBIA 2GF2A 3SHTA 2JZCA 1Y9ZA 4R2MA 5DNYB 3C3JA 5REQA 3LW8A 1RMQA 2MSNA 1JEOA 3GRVA 4AUKA 3J81A 2GZHA 4IHAA 1EAMA 4JKOA 4NFSA 4V2UA 5AHOA 2C94A 4BC0A 3MJTA 2FWIA 1BQEA 3Q4GA 1MRZA 1NFRA 4CCWA 5BWMA 4DJ5X 2QNRA 3ADCA 3MTGA 4K6MA 4ZAZA 3KTAA 2X8BA 1NAHA 1GZHB 1QIIA 3KPVA 4NMLA 4BLQA 3LV8A 1OH6A 3RAJA 1SZJG 4BCCA 4LJ7A 1VA4A 2GPJA 1NW5A 3N7AA 3ORSA 4R69A 4S2EA 1FIUA 3LK7A 4NMXB 2CLMB 4ETMA 1EM6A 2OV2A 1V16B 2YZMA 2GCIA 3ODPA 4GI5A 5F1KA 4PLPA 4BDSA 3GW8A 2IEDA 3I2HA 3Q8KA 3BMQA 3QA9A 3AGPA 1FCJA 1KVUA 1Z6GA 1OX4B 1KL7A 1Z6YA 3M2TA 1E3LA 3DMPA 3NBAA 3KB6A 1YZLA 4YLGA 3T3IA 3NR2A 3TNLA 4LYDA 1JI0A 1DAFA 3M9LA 4KVGA 4CQLA 3EE6A 4TXMA 3QU4A 4R9SA 1A9TA 1E3WA 1WHSB 5EJ6A 1H9CA 4AU1A 5JQGA 2UZ1A 4B8WA 3BHMA 1BS2A 1N6IA 3GR6A 3ZX4A 3N53A 1E20A 2VQDA 1Q44A 4RHCA 2HFKA 3AR4A 3R77A 4CR8A 4ZYVA 1B2RA 4RZ2A 4ZXFA 3UPTA 4QXPA 1U02A 5EY5B 2C3PA 3SG0A 1JLLA 3RTCA 4EEKA 4JLNA 1U6JA 1H23A 1A8IA 1E1RD 4LFBB 3GGJA 4B44A 1R8QA 2ZE8A 4ZYZA 4GKKB 2JIDA 1LF5A 2FPOA 1D1QA 2Q2NA 2CFCA 2OHJA 3DHWC 1F12A 2II6A 5COAA 1ZI9A 5AJTA 5AQEA 4Z3KA 1CZNA 4ZOEA 4K9KA 1W59A 4PC2A 4OY3A 1ZM9A 1RAIA 4EDHA 2VR1A 2VAVA 4ICIA 3HQ4O 1U4NA 3QMPA 3WGKA 4JXXA 2G9UA 3IKVA 2ATIA 1G4AE 3O8BA 4KDFA 2A1UB 3QIVA 4GZ5A 1T4GA 3B12A 5G2OA 1IB0A 2CC2A 3GFOA 3OIWA 5L3SA 2J5QA 3FM9A 2WBLC 4V0OA 2JHPA 3U16A 2J3HA 2YJ3A 2CKMA 3PQ2A 5DLDA 3VV3A 3AHIA 1UMBB 1S9DA 2XTJA 3L41A 3CGWA 2UZ4A 1QFZA 3OLQA 3GDGA 3K0BA 4IIXA 3GVIA 5DYWA 4UMFA 3SBXA 1C9JA 2B2NA 3V4RA 4PHGA 3C87A 2IXFA 4P3PA 3KU1A 4BLSA 2X8JB 3JQ8B 4FI3C 3UBTA 3ASUA 3N2ZB 4ME6A 3QRWA 3GEDA 1L1RA 2KX7A 4RCYA 1W93A 1TJ3A 2PJRA 3CUTA 2WLTA 5BSVA 2W2MA 1KIAA 3GEIA 3NRBA 2NUAA 4EPXA 4ZAGA 5EUQB 4KOEC 1LEHA 2R6FA 4LRSB 3DBLA 3OIYA 3R44A 4X45A 4M38A 4GOMD 2WZCA 3LC2O 5BVGA 3K20A 1QANA 2GO7A 2O0MA 3TS1A 1PN3A 2Z2KA 5DMHA 2MR5A 4HQ0A 5JBQA 1RQLA 4D2IA 3KE8A 4DGSA 4DBLE 4B3RB 3G2NA 3DEKA 2QY9A 1YL5A 1T0BA 4IINA 2P79A 3VRHA 4TQ9A 3S4YA 2VXCA 1J99A 4OBBA 3UV7A 3WHKA 4TSFD 1QP8A 4AS1A 1BS1A 2X76A 4JUIA 5LP6C 2JK0A 1MFZA 4L85A 2J31A 2QG9A 2NQ8A 1KPIA 2F3UA 1FX0B 3AG6A 3COWA 4LBZA 2ZI4A 1XVLA 4PZZA 5J59A 5JH7F 1VJRA 1QB7A 3GDOA 3S1LA 3OZAA 8GPBA 4H6WA 1FVXA 2W2QA 5THXA 3ZDZB 4EW1A 1FS5A 2NUPB 2OO3A 4HP8A 1KAEA 1CJBA 5LZ5A 4FX2A 1GIAA 2LR0A 1NQAO 1V5FA 2NTEA 3PXXA 4PZLA 2ILTA 1J9EA 4K81B 2VSXA 4CUJA 1DHTA 2HCRA 2VBFA 1H65A 4H7PA 3C5WP 4B3DA 4EHNA 3QEBZ 5JPCA 3VKGA 1PYOA 2O4CA 1C3OA 4JIGA 4BL5A 4CTMA 5A4MS 1U8FO 4XR4A 4G85A 5AWFC 1E5XA 4JBWA 5FUVA 3UH0A 1V0JA 4NDNE 1JT9A 4FGJA 2R8BA 1IOWA 5AI4A 4Y1EA 3IAFA 3LVFO 1LU9A 4B0PA 5AESA 2AQIA 4NQRA 4JQSA 3DUWA 1CR0A 3EY9A 2VBIA 3HEMA 1HE4A 3CN7A 2FGJA 3MPOA 4J76A 2RAPA 2R8EA 3PD7A 1XPJA 3KCNA 4EL5A 1LDYA 4IWNA 1H22A 3HCNA 1BX0A 3PJDA 2G6BA 2WFLB 3DZCA 2R62A 4DQDA 1FTGA 1WMFA 3LHDA 4ZVMA 4NU6A 2HRQA 2H1SA 2R66A 4LJ8A 4FR2A 1Y4UA 4CN8A 1RQ2A 3N5CA 3VZCA 4MPDA 5LFAA 2FCRA 1H3NA 2ACEA 4AP5A 2I4LA 4Q3KA 4YBRA 5DHAA 4DANA 3WA7A 3GQBA 5K3OA 2NPFA 1DUIA 2VF8A 2HYDA 3INNA 4LDPA 4HLUA 4F91B 1AHPA 1S01A 2EHJA 3BWYA 1Z6AA 3FPHA 1ZICA 2NIPA 1MUUA 1RRFA 2BGTA 5AHRA 4CIAA 1YL7A 4WQMA 4MV0A 1C3EA 2YY6A 4JROA 5CIWA 3W9UA 4DLKA 1UWVA 2IIVA 1Z26A 1VMAA 3BFKA 1R9JA 4KB5A 4D92A 1OASA 1Y0BA 1TU0A 1DIOB 2I2XB 1E61A 2IV7A 4BO3A 1KP3A 4Y2PA 1Y8RB 2Y6VA 1HRKA 3BJMA 3FVWA 1RAEA 3HB9A 4I7EA 4R9UC 1UFQA 4AK9A 4RJ2A 5H82A 3F6RA 3CX6A 3JWHA 3ZTYA 2PX2A 5CDHA 1IPFA 1JJ7A 4KC0A 1QE3A 2N0SA 2QMUA 2OBNA 5FPHA 3L7OA 4RGBA 1XJ5A 1RVV1 1UP7A 2DP4E 4DPKA 3NBYC 4OGGA 1P91A 2AC7A 2V55B 3QXHA 2GHQA 3TLCA 1QQAA 1W4ZA 4QG7A 3FUUA 4NZOA 4BNYA 3E58A 1WUTA 4WK6A 4KFRA 3WWPA 1Q12A 4U7GA 2G71A 3HZZA 3NWOA 1VE5A 2ERCA 1OKKA 3W5IA 4C6TB 1E2BA 2ATCA 1E79A 2DTEA 3K0FB 3U7RA 1I3KA 3KVVA 1T2VA 4OQQA 4H7EA 4AMUA 4FBMA 4B43A 1CUSA 2VA9A 1DV2A 4C0BA 4RKYA 1PGPA 5ECDA 4A92A 5M29A 4YDRA 2BP7A 2ZVJA 3QKSB 5CA1B 3UTCA 3NJRA 5E3JA 3T0FA 1N2CB 3IHLA 4IGAA 2OGZA 2YN4A 1JILA 2YXPX 4NCAA 1NUAA 5EJ5A 2O8BA 3L6RA 4TVOA 2WJHA 3LF2A 4P3KA 3QPVA 3ESCA 1M33A 4R0VA 4IOMA 2Q07A 2KYRA 2XNCA 4AZ3A 2IYNA 1ST3A 1L3BA 2VPZA 3FRHA 3O9MA 3ND9A 4HUJA 4JQOA 1I94B 1XLVA 2PQMA 1OFGA 3BTSA 2HA4A 1CR2A 3WMFA 5LQMA 1CG6A 3HL4A 3QUAA 2FDRA 3LPMA 2C31A 3L1UA 5D3MB 2DLNA 2ZRPA 3OX4A 3EHDA 4X8HA 3CEHA 1PUJA 3ITNA 4JC0A 2JC3A 1AUVA 1UBSB 1KO8A 2R9VA 2WUDA 4B6RA 1RJGA 4B74A 3I4LA 4PZ9A 4Z86A 4TV8A 2X5OA 3JRWA 2D2VA 2V6MA 3E22B 2WZBA 1GD1O 2WJWA 4JLDA 4B35A 1P2FA 1QORA 3O8DA 1KDZA 4HEA1 1EXVA 4B8YA 1RPNA 3MBKA 2P40A 2PDAA 2P9FA 4BEWA 5KNCD 1VSUA 3IE0A 3EPHA 3DZBA 4LZJA 1H2YA 2AR0A 3EB9A 1S4MA 3UFBA 4D9NA 1EMDA 2GN9A 2PWBA 2XBMA 1HMPA 3G2HA 2W2NA 4AS3A 3H7IA 1J56A 1FQJA 1JKFA 1YA4A 1UOEA 2CXXA 3FOBA 4LQLA 4X20A 3OECA 4QLOA 4UHKA 4BLRA 3EFOA 1WQ4A 2NADA 3CEJA 1QUEA 4A8JA 3FNQA 4IL5A 3RM3A 1QV9A 2P11A 3T3HA 2PSDA 5C1DA 4NEQA 1KEVA 4DBZA 3D6FA 5L53A 2D1YA 5IABA 4IWYA 5KPDA 3ZDXB 1S1CA 1J2YA 2NUBA 2W58A 1TJ5A 3RI3A 3OE4A 3X1ZA 2Q3FA 4KDRA 2M6LA 3UOWA 4L76A 5D5HA 3MHPA 2PH7A 1EP1B 3KSBC 1Y34E 3E5NA 1U0FA 2PWAA 4UEJA 4MP6A 5FI0B 2V3WA 4Q00A 5EVCA 5FUWA 3R74A 3GPCA 3MSCA 4C76A 1IY9A 3KEOA 3QELA 3W2EA 4NPHA 4IIVA 1AF7A 3FLEA 2FKNA 1Y9EA 2EKDA 4PW0A 5FT9A 4HVCA 2OK7A 2F43B 2HHAA 2OM6A 1UCFA 1OLSA 1M6EX 1ZAYA 2ST1A 1WY7A 1K7SN 2CNWD 2OOKA 3PI7A 3R5SA 4IRMA 2W6CX 3WLFA 4W8OA 4JI3B 4BMSA 3TSAA 2BGJA 4AZTA 4MEJA 4MB2A 1E62A 5TQVA 2A0UA 2B61A 3PGVA 4CQMA 2CB9A 2KLBA 1OA0A 4HNQA 3ILVA 2AFHB 1HKHA 3K2BA 2VK1A 4Y6SA 4L4YA 4L16A 1XMIA 1B8OA 4X9XA 3PTAA 2KB0A 1BVYF 3HDJA 4K9MA 5CIQA 3TW6A 2PR7A 1K0UA 1V1MB 3TD9A 1A77A 1BXKA 1C1HA 3R3SA 5JDCC 3O83A 3A37A 1ECBA 4EI9A 5HXAA 3JQQA 2JH3A 1NBWB 2XHZA 2XMGA 2ZJ6A 2JJ1D 3PFNA 2FE4A 5FV7A 4A26A 1D5CA 3BIFA 3DTYA 4NV1A 3T3OA 1SQFA 1UT5A 1Y3DE 4HVAA 3F5DA 2CHVA 3D2CA 3PA8A 4RORA 1CETA 1OUMA 3CUYA 3GEPA 1WNTA 2JBAB 2VC2B 1P0CA 4HRAA 4RGVA 4UU8A 5CB4F 3BHNA 3O38A 2G5TA 1F8GA 3O9VA 1X9HA 2EL7A 3GFBA 1RKBA 3OIDA 1GKKA 3EGDA 4S0ZA 2OBXA 4RFSB 4W5WA 3UFXB 4ZICA 3NVKI 4I6JA 4OHRA 2C54A 3DL0A 2BD0A 2HREA 4X63A 4K87A 4P4GA 1DZ3A 4KQCA 3K5WA 3B1VA 4AO6A 1AK9A 6REQB 3LHIA 3QIAA 4FC7A 2KBFA 2ZBPA 3M1AA 4IZ6A 4NYJR 5ADVA 5HILA 5JRDS 4UOQA 4BWVA 1M0EA 4TRNA 1NRIA 1G8KA 2VUSA 4ER7A 2Q3DA 3WG9A 1XJ0A 1DOZA 3NANA 4ALMA 2PUVA 3AXSA 5BN5A 5KYKA 1E8NA 1ZCZA 1Q1ZA 5ENVA 3UUFA 3DZ8A 2QX9A 3HU5A 1G21B 3MRXA 3P9SA 3JATB 1MHPA 1UJ5A 2QVGA 3W34A 3NHRA 5A4FS 3HXPA 1AOXA 2ZRFA 3NLLA 3ON5A 2HZ7A 2EP5A 1JJAA 4GPAA 4UASA 2ETXA 1YJBA 2ZSIA 3NI2A 1OBOA 2PL1A 3RJTA 4D80A 1K6XA 2W8BA 4UVEA 1ZZEA 1V4BA 2BI7A 2O3UA 3BBPA 4MH0R 4W8GA 3NHZA 5I7AA 2R6CA 1KMNA 3WB1A 4C3OB 1Z16A 2HZBA 3QVKA 3ETCA 4DE5A 1JKIA 3DHVA 3IALA 5I3ZA 4EHKA 5ALGA 3DBIA 2WJZB 4LDQA 4EYGA 4RD3A 4RETA 3SM3A 2VBCA 2Y4OA 2XWJI 4DJFC 5KWEA 3CEPB 3CRZA 1REQB 3DZFA 3I8OA 4AJKA 5MGNA 5JAQA 2YXDA 4OBXA 3NM5A 5CDYA 4HFJA 3OCXA 4MW9A 1TM4E 4EB6A 1C7EA 4LX8A 5EYPA 5A06A 1KI6A 1Z0FA 1OT5A 2B8TA 2RGXA 1T4DA 2CXQA 3HKEA 4TTJA 5JC1A 2BDEA 4LYAA 2C4NA 4JUBA 4CF3A 3TDMA 1UBKS 1NI3A 2H2WA 1L4FA 3AYXB 4MRRA 1PAUA 1P44A 4GL4A 1ZM7A 3P20A 3UMVA 3PU6A 2JAPA 2ZI9A 3CW8X 3PUIA 3HI6A 4I3GA 4UAVA 4DC1A 4BFCA 1DX4A 2IOHA 1IK4A 1CZOA 2VZEA 3KB8A 2VH5R 4NULA 3DNPA 3M5DA 2XUQA 4WCFC 1DTEA 3B1YA 1HE8B 1HG0A 2PN1A 4LY0A 1G7TA 1DG9A 1M0TA 5AKEA 5EKUA 1NQ5A 5IX8A 1XVUA 4X85A 3W3AA 2WT9A 2OTCA 4Z7QB 1RZUA 2W4IA 1FP6A 4YMTA 1BIFA 1FYFA 3MQ4A 2FQ1A 4MQMA 1LPOA 3VBEA 4FM9A 1J5PA 1Q7CA 4LW8A 1GTSA 3C5VA 2DAPA 2NXWA 1CUGA 1J2TA 2WU8A 3BD6A 1U8EA 2WPNA 3CT4A 2XBUA 4UREA 1BXRA 1IZZA 3S7ZA 2BFCB 4W63A 2VAPA 1A9XA 1O96A 2XCOA 4AC9A 3IAEA 2SCUA 2X19A 4Z7JA 1M8KA 1WOYA 3I4FA 4GC5A 4TV9A 5EHGA 3CF4A 3KJIA 4TYMA 3VZQA 3U44B 5UKDA 5E6UA 2ZU6A 5KJCA 1T2DA 1KFJB 1SC1A 4D7AA 3FYTA 3LBYA 1ZIDA 3AUKA 2EBHX 3DZDA 1SEPA 1WBBA 2IGTA 2WU4A 4L8GA 3QH4A 4RESA 3C70A 3MGGA 1YDGA 2WOOA 3HSKA 4I1IA 1MMFB 1PEAA 4KIUA 4C5BA 3HU1A 4DPLA 1CJMA 5FBQB 4DZTA 2YDYA 3I1JA 1JPNA 4DR3B 3MUFA 2PCJA 5JROA 3U4DA 3VV2A 3Q10A 1S89A 1JQ3A 2YTZA 3H99A 3PJGA 2PRJA 3T9CA 4FD2A 2JFWA 1X8LA 1EWKA 4Q15A 3CWQA 1EX1A 2D2IA 3MMSA 3S5UA 4DTCA 4EB3A 2VJCA 4DUPA 2BTEA 2OCAA 1R64A 2HBQA 3AM4A 4GPZA 4IVPA 5IDXA 4EVRA 1P3DA 3ZY3A 4P1ZA 4JI1B 5NULA 1CUFA 2C7BA 4K6CA 3WRXA 3AR2A 4Y2QA 2ZIWB 4P4SA 1JHQA 3IIKA 4H18A 4TXNA 2P6RA 2X3UA 2GUGA 2H17A 3AFHA 2D8AA 1JSRA 3BULA 1H2XA 5AOBA 4XE5A 1BO6A 4LOIA 4GVXA 4X6UA 4CZ2A 3CW2A 4KRFA 4FQ7A 2JAHA 3NBZC 4ENUA 1NQTA 2QRMA 5BYJA 4F21A 3WLLA 3E3LA 5TB5A 2AI3A 2Z9CA 5DIZA 4UHDA 3EASA 4TXHA 4YQZA 2GD1O 3KQPA 1KYTA 2FAXA 3SJZA 4D43A 5CEFA 1G5IA 4BRWA 2QORA 2CNOA 5AK6A 5ESXA 3GRUA 1XCPA 3LDUA 2H1IA 3NO4A 1ORWA 3G17A 3PGXA 3KQTA 4CIVA 2BTQB 4A8TA 3CB4A 1MIOA 4QUAA 2H54A 4QUDA 2NVBA 3IPLA 3KR0A 2J0EA 3JQRA 1B3RA 3MGAA 1SCDA 4H6VA 4Q3DA 5J4HA 3R9WA 4XIIA 2HLDD 4MTLA 4JI6B 2RHTA 2AC4A 2G5PA 3H9GA 5L51A 3VC3A 3P2IA 4HAOA 3Q0EA 3H5LA 4FGLA 5KYWA 2B30A 1XQ9A 3HJRA 3P97A 3QOYA 4J1TA 3AKCA 1SBTA 5LPNA 2XMQA 4P8RA 3ZZNA 3TI7A 4KE7A 2G07A 5FEUA 3GLIE 3BRCA 5EP3A 2OA0A 2G09A 3RU2A 4D02A 3I9KA 5L7WA 4CF4A 2F67A 4CGZA 1C30B 2FPSA 1OJ7A 2PUBA 3TXXA 5EHQA 5JNUA 2IP4A 3OY2A 5BP7A 4DB2A 4I9NA 1CRPA 4DIUA 5KQPA 3DDWA 2V7VA 4PGHA 4RDHA 2BHSA 2G9NA 2GFIA 2Z57A 2BEWB 2BJVA 2K6GA 2XLCA 1JEAA 1CK4A 2XMDA 3ZS9A 2UYCA 4A6DA 2IH2A 4M1TA 3HJGA 4J4HA 4AZVA 3WLOA 3EQ9A 1Z73A 4R2LA 1FP2A 1ZLYA 2WKPA 3T9DA 1JIVA 1O97D 1UZLA 2FQQA 1NVUQ 2N1MA 3K0AA 4H9GA 4F5EA 5JH7B 4NCBA 3C6BA 5FYDA 4YJKA 5SYNA 1JAYA 4EGJA 1V41E 2B8WA 3MCVA 3KFXA 3W3ZB 1E3SA 1JKXA 2XYHA 2IUSA 4Z0PA 3RJMA 3O91A 1YTLA 5CT5A 2MYPA 5KQRA 2J32A 2CLEB 5T5QA 5B4VA 2C2YA 4DBVO 3EQ6A 3VVMA 3ZY5A 1G20E 2CSUA 4HN9A 2DH5A 2JD1A 5G4KB 4OQPA 1KORA 1ODJA 3O75A 2GK7A 5BMOA 1AQUA 4JLUA 4MHOA 2O2IA 1X1TA 1JFVA 4R1TA 2FWNA 3UBMA 2NXEA 2ZVPX 1GGJA 2R96A 2VXOA 2V45A 5EXEA 3ZDEA 4HATA 4IYJA 3B7WA 2D74A 3FTPA 2W11A 3W8EA 3CYFA 3VR4H 5EIOA 1CU1A 1IEXA 1OPXA 1G6HA 2WIKA 4X84A 3PHCA 1BMFA 1O54A 3ZWNA 3TQCA 3V5NA 3HRIA 2AXQA 4WNCA 4KPEC 5L6LB 1JNYA 3TYXA 2IZ0A 4D9MA 4MAFA 1POWA 1X7XB 1ZH6A 1ZRHA 3S1AA 4F1WA 5K01A 1YTUA 5CD1A 2CKDA 1R3UA 4CFSA 4L1KA 2GSWA 3WQQA 4AZ0B 4H0FA 1EA5A 3R7BA 1MNAA 2GILA 1O6GA 3MLBA 3HBJA 4OYHA 3TUIC 5A9SB 2WNHA 4ZQIA 2QRJA 2YBEA 4L7QA 2G8LA 1J9GA 2CNBA 3PQCA 4A1OA 1LJUA 3L02A 3LK6A 3ZE1B 3OOEA 1RACA 3E53A 1QYXA 5TPWA 3X1YA 1SK9A 3R3ZA 4DNXA 3IEUA 4DM7A 3E4DA 3RKUA 5EINA 1ZR2A 3UWDA 1ODSA 2QJOA 2QV0A 4QOSA 1XIVA 4RF2A 5A05A 1MQAA 1SUIA 1XCLA 4J0DA 3ZXUB 4E4YA 3M5WA 2ZIUB 5H16A 2RHBA 1EFPB 2I2FA 1RQXA 2D54A 4X90A 2G36A 2QLBA 3K0CA 3ENWA 2C5FA 2ZUSA 2R00C 3II6X 5TLSA 4OVKA 1J1IA 1NKVA 1RQPA 2GEUA 2IHTA 2H4FA 4MA4A 2I66A 1VL6A 3LH5A 2QTMA 2RKBA 5CT6A 1F4PA 1ZOOA 1P4JA 5CJ2A 1J20A 3RU9A 2HAEA 3TOXA 1HSOA 1PFKA 4J3FA 3UV3A 3ZHYA 4ZWNA 2B92A 5G0TA 4ZZ3A 2QZ9A 5EG5A 1IZ0A 5CAEA 3IT1A 1DAHA 1UPTA 4MTCA 5IAAA 1ULSA 2C57A 1M54A 4M0PA 1XTQA 1U04A 4HQNA 4JQYA 3VKVA 1AK1A 3EXHA 2GYVA 4HCJA 5CT8A 3LWZA 3HDGA 4WZBE 1KBZA 3HDYA 4IDGA 1EX9A 5F35A 1IHXA 1DMRA 2O2XA 3MN1A 3E5HA 1CQXA 3NPAA 3D3EA 4LS3A 1PNVA 3SK0A 2Z9DA 8ATCA 4BQRA 1GPAA 3G6WA 1JUDA 1E2LA 1PIWA 2ZQYA 5JSQA 3KJGA 5KNBD 4WZZA 4CXMA 4KXQA 1Y42X 3I0NA 5CP8A 4RPLA 4QULA 2A9PA 4HMOA 4AKGA 1MN6A 2YNMC 2XDQA 2XYRA 5JY1A 3N2EA 4PC6A 4YAGA 4BMYA 1QF9A 4FCCA 4TTAA 4FHCA 4P22A 2XNKA 5LZ8A 3U39A 4MRMA 2WHRA 3CZCA 4BO6A 2GPTA 3E35A 1TVEA 1XALA 3THYB 3PUZA 4LYGA 3FNBA 4JV5B 1WNFA 3QG5A 1WOMA 3EA0A 1PHPA 3HCWA 1RMTA 4KYIB 2BL4A 4Z1MD 3U9SA 4US2R 4MKGA 5HWSA 3FF1A 3AERA 3ME5A 1NKTA 2EF1A 1BE6A 5AJUA 3IP1A 1MPXA 3FUXA 2BFBA 1GUFA 1FLAA 2A9KA 2YFQA 2OPBA 3GARA 3GJRA 2NT3A 4FIZA 1GGNA 1HFJA 2CXHA 3LCVB 3NKFA 3AETA 4X1OA 3S7TA 2G72A 3V3TA 2FSPA 1XZAA 2FZLA 4MULA 3TPZA 5LZ2A 2YW9A 1E2EA 2AKYA 1VMKA 2HO5A 2NO0A 4GUAA 8OHMA 2SKDA 4RZIA 1TF7A 4QVKA 4DSZA 3KEMA 1YV9A 1ZMBA 2E55A 5K8VA 5H3HA 3EFEA 5I8ZA 4NZMA 2P30A 4YGXB 1QTIA 2OVBA 4YCCA 1KK1A 2FR0A 2PKQO 3ZWCA 3QFFA 1YWGO 1DWUA 1N3YA 5LDDC 3E6AA 2CE7A 4TZKA 3QEMA 3FJ1A 3IXLA 1LSUA 2GS9A 5K3FA 1O7JA 2DTXA 1XNGA 3NHBA 3R6TA 4MMZB 4D9HA 1JNXX 4TS4A 3H86A 4F5YA 5I6DA 1RXEA 2W7TA 2R8ZA 3PQDA 3KSZO 4Q3NA 5EMHA 3UUGA 5F3WB 2ZBEA 5M7EA 5HUQA 1GPYA 1G7SA 1PG5A 1AO3A 3STYA 1L4NA 3CF2A 3CUKA 3M4ZA 4LBVA 5ER6A 3QHPA 4F8JA 1FW6A 1Q16A 5J5CA 4OK6A 4CE6A 1M2EA 1UWLA 3M4YA 1L7OA 3K0HA 1QX4A 4J43A 3ICWA 1T3TA 3HABA 4URYR 2JBHA 1W5AA 2UV8A 2XCTB 3AR8A 1WRBA 1Z4NA 1P9NA 2GEBA 4BKPA 2PX3A 2VNAA 1PF7E 2RAUA 3PDWA 4GXQA 4KQWA 3RJ5A 4WT7A 1E99A 1YONA 1S5PA 3HBFA 1WJGA 1ESCA 3R7DA 2AXEA 2RB5A 1HQCA 2SHKA 1VE6A 3CCBA 2XKJE 1JKJA 3KR2A 4QYTA 3LS2A 2QMOA 1URPA 1XAHA 2EC5A 2YVAA 3IUSA 4U0KA 1GQQA 1MW8X 3L8GA 2HQRA 4M9XA 1H3FA 4ABTA 4I1RA 1VCNA 4FCTA 4NAVA 1RAAA 3OHMA 4UQPA 4YJHA 2C77A 2CDCA 2VAMA 4UZEA 4LF8B 1ULTA 1L7XA 1NU6A 3MCWA 2G3YA 3PPXA 5JS2A 4B6GA 1T2NA 4C4TA 1V35A 3PX2A 4DR5B 4AXXA 1LVGA 3L4BA 4FSDA 1AS3A 4MQLA 4RE5A 1ZLXA 1K7XB 3C0KA 3RHTA 1S8NA 5JEEA 4Y9DA 5K3BA 4IKEA 2G4VA 4BJHB 1Z7WA 3CZ4A 4R4JA 4KQIA 1B6GA 4DWJA 1QJCA 4U6QA 3SAJA 4NCJA 4OM8A 3W4IA 1ZITA 4X8LA 2X6QA 1X2BA 3TM5A 1ETUA 2YKGA 4X97A 3FFTA 3TWOA 5CB4B 3PQFA 1NY6A 1KRHA 3SF8A 1X1DA 4FHFA 3T5BA 3K9HA 1U5CA 3GD7A 1JEYA 1MCZA 4PLCA 4ZYXA 2OEPA 2OQRA 3W6OA 3RAFC 3E7XA 4BFWA 2QQGA 4Y2HA 4EA6A 1Z0AA 3N39C 3C24A 4X0EA 3VR1A 2QD4A 1O0BA 4G81A 2LNDA 3ZV4A 2EKPA 2JIZA 1MO6A 1S8OA 5JZ9A 1ZN7A 4C0QC 1GKUB 2ASVA 1NVEA 3GXOA 4N5DA 3UMJA 3USCS 3GRRA 1FZTA 1O6BA 2H1CA 4CHTA 3KQSA 3IHKA 1TVKB 3A9SA 1LQUA 2OKCA 3SYMA 4D0SA 3F2VA 3AEKA 3SYTA 3TVYA 5JASA 3F71A 3PJFA 3A11A 1UC4B 3WNDA 5IDWA 4BQNA 1NE2A 3WLNA 3SBEA 2FDCA 1SHTX 1NQVA 5IS2A 3OEWA 2PT9A 1A8SA 1AKVA 2EG5A 1VL2A 2QVLA 1TT5A 3RIHA 1OBHA 3UW1A 4DCVA 5EGSA 1VCMA 3T3PB 4N7MA 5D3QA 1E1QA 4FFPA 5HOQA 2RHDA 4FFRA 1E77A 4CM8B 4N7BA 2OV1A 3PC8C 5LC1A 3NAGA 5DO9A 4DLAA 4IRUB 1T3LA 2LBPA 3UOGA 1M7HA 1OJLA 1F8YA 4CLXA 3U19A 4NWIA 1SIBE 4RAQA 1BRMA 4LZAA 5JDIA 1DC5A 1WP9A 3LZCA 2AG6A 4P6VF 3EUWA 3PUWA 4WBSA 5T64A 3V6MA 3ZWOA 4DFDA 4A91A 4MW7A 4EPRA 1WMEA 4UMVA 2OZVA 3K9NA 4KPUB 2CXUA 3RUCA 2NZVG 1VXOA 5EIBD 1UPBA 2FGKA 3IC5A 4L22A 3RH0A 3TQOA 4F9TA 4P84A 2GCOA 2HU2A 2JFOA 4ZEWA 4B45A 1RCTE 1Z37A 2P91A 2KSQA 2P9TA 3D81A 3PC4A 5KTKA 4RH0A 3VSDA 5H59A 5DULA 1BYUA 1LV8A 4I4CA 4LGCA 3AILA 4LDNA 1L5RA 1T8TA 4TV8F 4YJ3A 2W6NA 1X8JA 1XXHB 2C59A 3SS7X 3W1VA 4BUJA 4PS0A 3AJ9A 4UUBA 5AUOB 3H5RA 2L19A 4XWGA 5EN4A 5CTJA 3U48A 4E7OA 1SN7A 1XZNA 3NP7A 2WQ7A 1CDEA 3PPYA 3UHAA 4MCHA 4HGZA 1BHSA 3K4HA 4YC7A 4U5QA 3IA2A 1ZP6A 1BMTA 4LHZA 3LUFA 1RKUA 8AT1A 2Z2IA 2Z98A 1M67A 2ATEA 4IEIA 2PXHA 1E6UA 4BU1A 1X7GA 2BEVA 1L4HA 2WHPA 5HF6A 4KOAA 1O4WA 1O94C 2BMJA 2VHUA 3JYPA 3QU5A 3EIEA 1ZRSA 2H1LA 2OO5A 2WAYA 3MELA 5JAZA 2AE1A 2CYAA 5FB3A 5J1TB 3VNSA 4OSOA 3OQVA 2GXUA 1DLIA 1KMMA 4KXXA 5HRAA 3PNPA 1B73A 2V7EA 3GEGA 1UBLS 3DV9A 2Y76A 3KJZA 2BMWA 1FYXA 3EIHA 4F92B 4JEMA 1E18A 2G1PA 3BKXA 3AUTA 2QNIA 3LTEA 5KOJB 2DEUA 1TZCA 1ZHHA 1SXJE 4L8VA 3W04A 4NG4A 4AM8A 4QGGA 5AQ1A 2W22A 2ZYAA 3RV4A 3PJEA 2RCYA 4I4TA 5I7OA 3GD5A 2ZSUA 1K5PA 1OC2A 5FPQA 1MC1A 2Q5FA 1UF9A 4PAMA 2CGEA 1S2IA 4Q1VA 1DT5A 3R0JA 5JD3A 3CNBA 4AVYA 5KNCA 3VZDA 1LNSA 1E4EA 1RC0A 2GZ3A 3WAGA 2YC2C 2OXFA 5KQGA 1ZBDA 1XTTA 1SCUA 4ZN6A 3STUA 2YXBA 1HR0B 3ZIAA 4P0PB 1I3OA 1Y48E 3BAZA 3U1VA 3FUTA 1N1DA 4EHJA 3L7MA 2LUOA 3E84A 5C80A 4LI3X 4LY6A 1W7AA 2A94A 5KNBH 2F90A 4HWOA 2JGAA 1GN9A 4UHJA 2CWWA 3DD5A 1DRUA 2EW2A 4MS1B 1KRXA 5AFSA 1NN0A 2AWOA 4RY2A 1YQWA 4G5SA 4CG3A 3DMNA 2AG8A 1D3AA 4UMDA 4R1PA 2BFMA 1TU4A 5GZ3A 2O0LA 5LWQA 3KE9A 4FX5A 1E3DA 2IV3A 1IOLA 2BFDB 3HM2A 1LB1B 4JEIA 3T7CA 3JTEA 3HFJA 5L40A 1X92A 3NV9A 1ENPA 2P9YA 4XCVA 3EXG2 2WD8A 1U7TA 1QHSA 1U99A 2GN8A 1VRCA 1WABA 2WRZA 2C42A 2ZK7A 3L7JA 4HSEA 4L2IA 4M49A 4MZXA 4QXAA 5BNIA 4LFAB 3TFWA 5CYGA 5KU1A 4W9RA 1NVBA 3V7YA 5CTAA 2JVJA 2Q7DA 5K0JA 1XHLA 1D4FA 3JQAB 4FBGA 4BBAA 4D3DA 1JFRA 4OSPA 4PO9A 3OEHA 4TKVB 4OB8A 2QZPA 2R8YA 3WRYC 5HKKA 3ZHQA 1LW6E 1NVGA 5ES4B 4Q3EA 4DV0B 2RHLA 1R8YA 4G56A 3RVDA 2J3JA 2WP0A 4EHDA 3SEFA 1RRVA 1PK7A 3QZUA 4NEGA 4TKUB 1BKDR 4MA0A 2GBLC 3KYIB 4PF1A 4LG1A 1HT1E 1FFEA 1LF0A 3NIWA 4O8CA 1XZQA 2C8JA 2ZYVX 3VR6A 4QLAA 5FXMA 1LI5A 3DO8A 2V7TA 2VNHA 2V59A 3N6XA 2OP0A 5FLEX 2WZDA 1K6EA 3K35A 3CRW1 3A4TA 1AHHA 4CW7A 2NSYA 2XYQA 1G2OA 1R0XA 4M0LA 4CT0A 3ZK9A 4JP2A 1TEXA 3T3MB 1VXRA 3C14C 1K2WA 2NM0A 4G5XA 3NIBA 2HIHA 3B3JA 1NYQA 1DJPA 3AKYA 2JGMA 2OE2A 4UPVA 4QOFA 3IBSA 1BWRA 1FFDA 1GXSA 1NIJA 2Q4TA 2X6TA 3TSOA 5IJWA 1G60A 2GN2A 2OZLB 2YCBA 4W8HA 9MHTA 3LLSA 2JLSA 3BN3A 1YJCA 3D0OA 3NTXA 2V6IA 3C15C 4JVNA 3UB2A 4JWTA 2FPMA 3DLPX 2IIPA 3CU5A 4YN3A 4KR9A 2FPPA 3LG2A 2RD2A 4P35A 4B4OA 4GDFA 1GAWA 4O1IA 1KY5A 3RGWS 2NU7B 1SOVA 4CG0A 1WZCA 4GRDA 3GLIA 4PS1A 3AVPA 3THWA 3K15A 3SEQA 1XCMA 1EINA 3W6PA 5JNTA 1HDYA 2VZLA 3OSZA 4OAQA 4B7AA 4JFAA 4YLEA 3UT0A 1O03A 1E7MA 1NJFA 4BNDB 1XLTC 4OJYA 1KSGA 4RTLA 1BZYA 3BWCA 4TPKA 1TCBA 5JAOA 1HFWA 2HHLA 5LBIA 5AW3A 2XRMA 2POQX 4GR4A 2Z6UA 3E4CA 3L43A 5JFOA 4ZRDA 1ZJYA 5B7GA 2CNNA 4OL9A 4M1EA 4PY2A 3KVRA 5KNDA 3KTAB 1GA4A 1NW9B 3QOWA 2CMFA 2K87A 3DDNA 5FO0A 221PA 5A9RA 5LB4A 2K4MA 1Z0UA 2HJWA 2V03A 3TN7A 2Q1XA 5AH0A 5CNMA 2ETVA 5TXGA 5HHTA 3H9CA 3OU2A 5FNZA 5IBRA 1ZX1A 1P0QA 1K6IA 2PRIA 3BMQB 4F3RA 4ESEA 4IMJB 3MD9A 4R8LA 1G5TA 4AWAA 1OR8A 2P6OA 3FSJX 4GX0A 1G20A 1IPEA 3NXSA 4F93B 3EEOA 4DR2B 5H8WA 1D03A 2PQ6A 3TNDA 5I9NA 4XWWA 1QFXA 3T61A 1QGDA 1L7AA 2C99A 2OBMA 5FUBA 2ZBVA 1P0MA 3AVQA 3EMKA 3ESXA 4QNMA 3M6WA 2HSZA 1E3WB 3BRWD 4MK4A 4KJZA 4TWJA 4LJLA 4PZAA 3ST7A 4XVUA 2UZ1B 3OLZA 5KUTA 4BVHA 1GARA 5HE9A 5GINE 1GYQA 4IWXA 3MWLA 1T35A 4C21A 1UT6A 3ECCA 5KVQA 1VJ0A 1BCRA 2JIBA 2ZXEA 1E2PA 1ENYA 3DVAA 1JLLB 4IDNA 4OH1A 4RVFA 3E1KA 5GONA 1RCFA 3EBLA 4HZUA 1JW9B 4PGMA 5F5LA 3FMIA 3KR1A 3RYFA 1V2HE 4CMAA 1CB0A 1U1DA 4L74A 3SNHA 3CVJA 1IN8A 3X44A 3G2LA 4LIPD 4JDUA 2EARA 4XX1A 1OBCA 1N2OA 4GSYA 4C06A 3JALA 3RADC 4YAFA 3SZMA 1S02A 1VSVA 2YDXA 1OTHA 3WIUA 5B2EA 2DPGA 4Q6WA 3WKBA 5IKEA 1L5GB 1B8UA 2UVQA 2A59A 3MMPA 4DADA 3LWDA 3RIEA 1J7JA 4LZPA 5FPSA 3TPFA 1O95C 4KQ1A 3UAOA 3PNYA 4N5HX 4WFKA 4ZV4A 1CX9B 1ZGGA 2N75A 3K16A 4J7UA 4K1LA 4NBSA 1DX9A 4JUDX 4KZKA 3DF7A 5CH8A 1A9QA 4EG3A 3O7WA 4XASA 1Q22A 1P4RA 2XQJA 1QB8A 3MT8A 5BSWA 1DWPA 4ESVA 1SUFA 2Y1LA 2Y1XA 4C2TA 4XYLA 1FU7A 1BG6A 1PL7A 3C45A 3VHRA 1M1NB 1N25A 4WZ6A 4H6XA 3E1SA 3QE2A 4XOUA 3BZBA 5KCMA 1ONNA 4O2LA 2FJPA 4HI0E 5LCXA 3REFA 1JSZA 4PC3A 3RS5A 1P0PA 1J8VA 3HHPA 1QWOA 3SR0A 1QRRA 1CE8A 1LX7A 2BW0A 4UBNA 4F9FA 4ZDKA 4M36A 2WF6A 3EQ8A 4MV5A 1TLLA 2OECA 1Z2EA 4JI7B 1DRVA 5JFGA 1U8TA 4BO7A 1WXQA 1PYGA 3GJTA 5CVJA 3DBLB 3IB3A 1SZDA 5GJBA 3O9ZA 4GYKA 5D1HA 5BVGB 5AW4A 4WZBA 2H48A 3IHTA 3U7IA 4DMLA 1GFIA 2GNAA 4ZVRA 2EJBA 4JJAA 4FYKA 2V6JA 4KO4S 2IOFK 3SYRA 3PGLA 3OI7A 4LGMA 2C2ZA 3RGGA 4UD2A 1Y6RA 3K8ZA 5HK8A 1D07A 2P9EA 2XQKA 5DBOA 1O8CA 3N9IA 3DMYA 5C2JB 4NRDA 1VDMA 5CGQB 1F17A 2P2SA 4ML3A 3W5HA 3AMVA 2QY6A 4IKOA 3KXDA 4LYHA 4NCXA 2CE2X 1KDVA 1C7QA 1OIVA 1Z7EA 4AWBA 5KYVA 1XMXA 2IZZA 2V9PA 2REOA 4LJ4A 1FXWA 1LD3A 1Z06A 3EDCA 3HJBA 5B3KA 1EZZA 4U2BA 4XI9A 3FR8A 1L8QA 4WUVA 5AI6A 1NMQA 3CRNA 4DNFA 2IYVA 4BVKA 4EELA 4XYGA 1DBPA 2FWBA 1NYRA 2QA5A 1NUHA 3GLVA 1ZWLA 2F3PA 2W2PA 2WSYB 4PYIA 4Q3CA 3AWDA 5AUQA 3AP3A 1LTKA 2H0RA 3GJXC 1PLKA 4FB5A 5I5EA 3UQYS 1P45A 2CLFB 3PIIA 1MB0A 1KEUA 3FSGD 3V46A 2OHOA 3P9NA 1I33A 5T8KA 1KS9A 2PGAA 1U1IA 3DWIA 3BB3A 3I6MA 2NTYC 2QX4A 3E9ZA 2DHRA 3TXAA 1C3OB 2RGGA 4D6PA 1X3SA 3HVRA 3MT7A 5CLQA 4C22A 5H5JA 2XOEA 4PX3A 2PTGA 1X15A 4UBJA 5DTQA 1EUQA 3ADDA 4MB0A 1EQ2A 4BMPB 5FUQA 3H9BA 1Q74A 1SKYE 1RM5A 1HQDA 2XECA 3LKVA 2HF9A 1RWKA 3K1YA 1WPGA 2RK4A 4OKNA 4A7PA 4PYJA 2LCIA 1R5NA 1XELA 3WL3A 4UCWA 3RVRA 3EEYA 3RQIA 3VTFA 3DAFA 3MBOA 1UIMA 1PJTA 3G0HA 3IIMA 4NENA 3L0BA 1KGSA 5TNXA 1EI9A 1MIHA 5ITWA 3MHTA 1KYIA 5ALDA 2VJBA 3GIDA 3NHLA 4RD2A 2ZJFA 3H4MA 1RIFA 4W4TA 2GRJA 5CPFA 4RFLA 1UZNA 1YJ5A 3DXXA 4GMGA 5LM3A 1YC5A 3GQBB 4R9NA 3DB1A 1X38A 3NRJA 1I4TD 2IYFA 1K0FA 3NCTA 2XGSA 3G5TA 4UDNA 4CUZA 5DRYA 4IZIA 1LX6A 5F3DA 2GSDA 2HV9A 1M6VA 3GVHA 1P72A 4TLCA 1H1LB 5CX1A 5TT0A 2NU8A 10MHA 3ZXXA 4UEOA 1CR6A 4F5WA 3N87A 3VHQA 3DBOB 1NJ1A 3JYLA 5A62A 5AK3A 3FB4A 2YV3A 4NE9A 4L51A 2PLWA 3O4RA 4TMVA 4K03A 1Y1KE 3AEQA 5KQMA 4IXWA 3GZNB 1VIAA 1E2HA 2C8KA 4XEHA 1G59A 1PDOA 3JXEA 5BN3B 4JDPA 1Y4DE 3PGA1 3DYVA 4U2FA 4CI9A 2H7YA 4D9GA 1QZ3A 3PLAE 3CN9A 3KTDA 2QQ0A 1GRVA 1YAJA 3IVMA 4IMIB 1RZVA 3COVA 1WHTB 2NXNA 3MWYW 2RBEA 3BE8A 2YQ4A 4LJ6A 3DWGA 3I9MA 1ULHA 2YV5A 2ODNA 4FYYA 4LOHA 2Q3JA 5DHTA 4COOA 4PYLA 5D00A 3IJRA 3KR9A 4MLPA 4P86A 3G2KA 1VBFA 2YFYA 1RQGA 3BD7A 5CDUA 4EPVA 1L7NA 4GQAA 2ZYGA 4BVEA 4Z54A 1ZW1A 3UHOA 3C8MA 4HXGA 1OLXB 3SJ7A 2DCUA 5H3LA 1VFPA 3HA3A 4H35A 1P33A 5FF9A 1BC5A 2BP7B 4OA8A 3W8DA 5HQ3A 5KWJA 2C8LA 1HV8A 2NSJA 3I76A 1I6LA 3UJBA 3OT4A 3G0DA 4QBHA 3MJSA 2O8BB 4BB5A 1CEEA 4M6WA 1C9MA 4UXHA 1N1GA 1UR5A 4ZMSA 1FTYA 4OJMX 3GB9A 4WESA 4QXQA 5K45A 4UU1A 3V7WA 1OXMA 1WEHA 3LPDA 2B3TA 4WIAA 4AICA 3CUEF 4UJ5A 1JTVA 1SU6A 4CLEA 5BUZA 2EF0A 3BFXA 1PZGA 3IP8A 2R7AA 4HAXA 3PFWO 3VJKA 4C4SA 2PY6A 1DAOA 3R9IA 4D3SA 5KSOA 1A5BB 5JJLA 4NBWA 1OLOA 3VM6A 3QVLA 3N74A 2HBZA 4C0XA 5I9LA 2Z3ZA 3FWPA 1ZIOA 2VYVD 1FUEA 3G7NA 1DRWA 2OAGA 2Q5HA 1VI2A 2AE2A 4O4LA 2P9QA 4MKFA 2OUIA 3EIQA 4TV8B 3U3DA 5A2QA 1QVZA 2FMKA 1RIIA 3G5AA 2B21A 1SUDA 4DCCA 5FAKA 5JECA 1R1DA 3CSSA 4JQCA 3CLSD 4ZOLA 3P0IA 4J2HA 2XE4A 5B5SA 1XZMA 2VTBA 2Y77A 3LSTA 3MJEA 3LCJA 2DULA 3HVJA 4E03A 3GBVA 1NP3A 4OG2A 4CV2A 1VCIA 2AMVA 3L79A 4AROA 3LWBA 3QP9A 4BB6A 1G8MA 1E89A 1EFLA 1H69A 3GC6A 1HSZA 1PJAA 4G4IA 4X20B 3I34X 3RS0A 3EFOB 1CUCA 5LN1A 4P9NA 3DR5A 3U1TA 1DBVO 1B0AA 2OV4A 2E5LB 2F8TA 1TCAA 2XUIA 4IIDA 3KJFA 2BISA 3S2EA 3B3AA 1SEVA 5CIYA 4S04A 3OQIA 3CKKA 3R0VA 4S12A 3DTVA 2B8JA 3ROMA 2VQSA 5DHQA 1L7RA 1CLUA 3FYSA 1GCAA 1UDXA 3HH8A 1B8NA 3RG8A 1R3DA 2B94A 1GPKA 2C20A 2XE6A 3DAOA 3MIIA 1LPPA 2XCQA 4MUAA 1LS6A 3QA3E 4P98A 1JTEA 4R8RA 3WO0A 3QELB 5TS3A 1KEZA 3QWAA 2VEDA 1JIJA 4L75A 3O5AA 1CCWA 2RHHA 5AKIA 3C48A 4KLCA 4AIRA 3WGMA 3B6IA 3BTOA 2QVCA 1XZPA 1WF6A 2H2GA 4NBKA 3L05A 3I62A 5EJIA 3T9AA 3NMUF 1T34A 2PZKA 1ZKMA 2ZIAA 1UPFA 3C4JA 4MVJP 4TT3A 4C0KA 3SJAA 1OH8A 2PUGA 4YRPA 3H2IA 3IOCA 3N86A 5BRJA 1KAGA 4CQMB 4QECA 1QQ5A 3TFQA 4I1UA 4EFLA 4W5NA 3AF1A 4KK4A 4LHXA 5I4BA 3HJAA 3I04A 5KYYB 4HMQA 3NTVA 2F3QA 1PBTA 4FSXA 4BFTA 5JLJA 4HNSA 5C8YA 5B58C 3KXKA 1KZHA 3M89A 4MJ7A 5A6SA 4C7VA 1J8YF 1E6LA 4FBLA 2INGX 3GLTA 5CVUA 4CKXA 2DERA 4H59A 4NBLA 4OP3A 1JPVA 2VSYA 1HKUA 1MJNA 1MP0A 5EJMA 3L8HA 5TE9A 2Q2VA 1SXJA 5KDOA 4NOJA 4WE3A 1YB7A 2IIQA 2OXTA 1AKNA 3I23A 2WD7A 2GPWA 4YP5A 4ENRA 4QVGA 4WCVA 4RKQA 4F8EA 2QUKA 5BW5A 1QDEA 2QTZA 1L1QA 3WBBA 4FSHA 2RI1A 1NMZA 3TSCA 5CBPB 4AKSA 4D8XA 2VPTA 5LZ4A 2HPZA 4Z9AA 4CEHA 2ZTHA 4AG3A 1MW9X 1T9KA 3EGDB 2OGTA 5TARA 2OC9A 5J58A 3B82A 5LA6F 821PA 2ZM6B 1P2BA 1USVA 3JYHA 3NKLA 2VOJA 3A70A 1EX7A 3R3JA 2AVNA 3KT6A 4W99A 1GQOA 4MDEA 3H1TA 1PR4A 3LQRA 1U65A 3O3NB 4P92A 4MJXA 4NESA 4OLFA 5K4HA 3IULA 2HH9A 3RNOA 1QE5A 3H13A 2ISCA 4R16A 1VLQA 4YRBA 1P75A 1AS2A 2OYRA 1R18A 3VPBA 3LDGA 5JCPA 4EF4A 3QVSA 5BN5B 3A4IA 4HDSA 4PNPA 3A1UA 1ONSA 4E3WA 2J0UA 5AM3A 2VNJA 2WT8A 1WVMA 1XAJA 3ZR4B 1J22A 1TC1A 3OPYA 1M9NA 3QEAZ 1W88B 2QRUA 1X1AA 1P7CA 1YQEA 3U3KA 5KINB 1NXWA 2QGFA 1XMQB 4XQGA 3D6HA 4KXMA 2ZAGA 4Q4CA 5FA8A 5EVJA 1QQ7A 5BR7A 3FJYA 3CV3A 1EJBA 4B85A 3KWLA 2Z5GA 4E13A 1HDRA 4HYYA 2WHQA 3X2EA 5IT9A 1N2SA 3E9DA 1FEZA 2GEKA 3V2HA 5B6IA 5JNRA 3O8LA 5F1PA 1RYNA 2XDAA 3A4LA 3S28A 4GD3Q 1AN9A 2DM6A 4GKBA 1G4HA 3FGOA 1NE7A 2VRCD 4NCKA 3RIYA 4G9EA 4ZI7A 2EFYA 1AU9A 1RLIA 4UTOA 2QX7A 1K7EB 4K6GA 1M2NA 4X8MA 4TTPA 3ELBA 2J46A 5TY0A 2FVXA 3CNHA 1YZUA 3VGJA 1W85A 3HPQA 1W94A 3KAQA 3U31A 1W0JA 3FIJA 4MS4A 2EQAA 2GT1A 4HKTA 2VWHA 4EB6B 2ONZA 5EYPB 1O9HA 1KI6B 1LLDA 1JIKA 1JG6A 3INGA 4G0NA 4N54A 4DIBA 4YRGA 5JNSA 4OKSA 2QF7A 4YJ3F 3MAAC 3LQYA 4FN5A 1MRSA 2QIOA 4G0WA 1PNRA 1TMKA 1PHRA 1JDPA 1Q15A 2H0QA 2B1GA 2V7UA 1NFQA 1XMPA 2W43A 5IFKA 4RKFA 4CM4A 2PZJA 2W2OA 1N8KA 3V7NA 3KSUA 2F17A 3BH6A 1V7ZA 2ICAA 3P0RA 3GO4A 5EXSA 1F2DA 4J07A 4GL2A 1IL0A 3JQ9C 3N07A 1WDKA 1BH2A 1QG0A 2JJ8A 5EIHA 2CUZA 1V11A 5I01A 4E14A 4B82A 3EMVA 1GSOA 2XZTA 3NTLA 5EHIA 4LXUA 1XMSA 3B7PA 4BJ3A 4AI6A 1F60A 2D7CA 3E15A 4KN5A 2X1LA 3WL4A 4KTTE 2QRQA 2JD0A 4QSHA 3QQPA 1KH2A 1N5RA 1NN3A 3IFSA 4QGHA 2WSSA 1D9XA 4GOJA 3V8PA 1E1CB 3KXPA 4MPTA 5JAHA 4LDRA 2Z6QA 3BXGA 2CK3A 1O96B 4Q9JA 3MG9A 1E0AA 2SCUB 3PR3A 2OESA 2IUUA 3K5PA 1KI7A 3A1EA 2NTJA 5CLIA 1DI0A 3WYDA 3WBKA 5I7VA 1BWSA 4DLBA 4ENQA 4WBXC 4I4TF 1W96A 5GM2A 2AN3A 3RRNA 3WBFA 3DLIA 2WTMA 3SLKA 4I6EA 3B6MA 4HQ6A 4YQYA 3VMFA 2A4KA 3JYOA 1FUYB 5IMSA 5B1YA 2E2WA 2FETA 4GICA 4NPCA 1LWOA 4FC6A 2RC6A 3R5KA 2XB6A 1NBAA 1RXCA 4JBLA 4Q4JA 5CFZA 1M2JA 3LYAA 1RI4A 4IF4A 4MI6A 3U09A 2Z56A 4P2GA 4PCAA 4QUKA 2VLIA 5E4JA 1NXTA 3BD8A 5JXGA 1U90A 4PG8A 3WLJA 1NWHA 1XKTA 2O14A 4WOPA 1TRKA 5PGMA 4EG7A 4IHJA 1V8BA 5IDQA 3WQSB 3IUQA 2QRLA 3VDQA 2ZJZA 2VHEA 4RLFA 2BMEA 2O6LA 3IT3A 5EPOA 4JYZA 1JFSA 5KVSA 5ICMA 1U1CA 2WHXA 1Z56C 3KG2A 4FPXA 4BBPA 2GPSA 1N8TA 1N7GA 2ECQA 4ZVPA 5DPMA 2XXAA 3A1WA 3BEOA 4JJEA 4DMHA 3CZAA 2FWPA 1VLLA 4QPDA 2AKEA 1GITA 1PJBA 4LK3A 4TX1A 4Z8YA 2GXAA 3GNQA 9LDTA 3A1DA 1V25A 4YCJA 5CEEA 1AA6A 2QAJA 2X13A 3GL9A 3I9V1 1H85A 1XRQA 2FRDA 3OCZA 2BUAA 4G0XA 3FD8A 4H3VA 4HXYA 3CEAA 1P9OA 4PEVA 4WY8A 5GPBA 3R5FA 1BE0A 5FYQA 1AZLA 2OHXA 3L6DA 2BUCA 3PS9A 1SA0B 2D0IA 3HR7A 4FMDF 4WPGA 1KVSA 3NTQA 3H1PA 1H1DA 4EJMA 1LTQA 4P33A 1PX2A 1TZKA 4YQEA 3WLHA 1MIOB 2I54A 3VKUA 3BGWA 4BTLA 4N41A 3AL2A 4P31A 3W5SA 1E2KA 3PXCX 1EUCA 5DTEA 4PYNA 3HLTA 1ZH4A 5HVNA 2XCLA 5C31A 4B6JA 1JEJA 3ZJYA 2GM4A 2FPIA 4HVLA 2QUJA 3OM1A 1NWCA 4UDXX 4HH0A 5AHWA 1ST2A 1UBCA 1NDHA 4H17A 2HK6A 1GJRA 3W8RA 3WLMA 5C51B 3M3PA 3L6OO 3GVPA 5CJPA 5KHLB 2CVZA 5TQ0B 5IMBA 3M1YA 1U8UA 2NTNA 3KLMX 5DK4A 4L8YA 1AUOA 1NULA 2FH5B 3UJAA 2C83A 2J07A 3TLYA 3LQFA 3SZRA 3U26A 1TYZA 1I7DA 1F8UA 2BBSA 2CZGA 2F3TA 3ASZA 1MJFA 3QJ5A 2XI4A 2XZPA 4J94A 5ALVA 1CD5A 3ZK8A 4MIEA 3IP5A 4I3HA 5IPFA 2H5IA 3GJQA 2IKSA 5IVKA 2AT1A 4UQLA 1U94A 3VZSA 2AZ4A 3AW8A 1DELA 1VM6A 2FQYA 1CBUA 3F5SA 1I6MA 3K0AB 4GS5A 3FCOA 3D4OA 3GGGA 3KPWA 5BNTA 1DCFA 3Q98A 3FNRA 2OOSA 5JG7A 4KACA 4DSTA 4GYWA 3PVSA 5AJXA 5C7YA 4OQ4A 2P62A 2Y1DA 5CXUA 4ZYUA 3QFCA 4BO8A 3AF6A 4TWZA 5EIAA 5EUCA 1KZ6A 4DCOA 3LPCA 1N2ZA 1DKRA 3ED5A 3JAKA 4GZ6A 1P5FA 3K9FC 3GFSA 2J87A 2Y1OA 2COUA 2FPKA 3NOOA 4QFDA 1FL9A 1HDZA 4KX5A 5JRJA 3SVTA 3A3PA 2GPNA 1IIRA 3ONWA 5EHZA 4RZHA 1VBMA 4TM7A 1CQPA 4JA2A 2M6RA 2VJQA 4U8GA 3VO1A 1NKSA 2B5WA 4UDYX 2VHVA 1M7BA 1MTOA 1UEXC 2QD2A 4MYTA 3V00A 5CDFE 3OP1A 2YZKA 2HB6A 2VWGA 1JJVA 1ZQ1A 1FYVA 3OZEA 1NPTO 1LVUA 4PZ0A 3FCCA 5F4ZA 3TTXA 4RQAA 4R01A 1NVVQ 4HFRA 5BWOA 3KUKA 2W2TA 1QK4A 1X3LA 2WTBA 4RY9A 5E9JA 3K2IA 3B5IA 3LUJA 1UBTS 3ESRA 4B6FA 1U2QA 2OCGA 3K8OE 3KAPA 4L78A 5CYOA 5KWSA 4Q82A 3S1AB 1N0UA 4AJEA 3BPSA 3H4TA 5H9WA 1WW2A 1ZSNA 1I0IA 3K4PA 2MDTA 1PI3A 1NF2A 2YYZA 4UD6A 3V1MA 3LYLA 4ALLA 4BNVA 2I91A 1HYGA 3R40A 2QDXA 3JQCA 2KBEA 3EEFA 1ZVQA 2ZJ8A 3UQZA 3AI7A 1N34B 1WBDA 1AA9A 1NVAA 1RW4A 3USZA 2CEAA 4G41A 1NT4A 1U31A 3MB5A 4G5RA 4K6HA 1BSVA 2IH4A 2XUPA 3LVRE 3LCMA 1BGVA 1MXFA 2GFHA 2JFGA 3TL6A 4CQJA 2KE5A 1W46A 1HA3A 3CX3A 3GJZA 4KAXA 4JCOA 2PV7A 2B9VA 3LUCA