1D04A

Comparisons of wild type and mutant flavodoxins from anacystis nidulans. structural determinants of the redox potentials.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
169
structure length
169
Chain Sequence
AKIGLFYGTQTGVTQTIAESIQQEFGGESIVDLNDIANADASDLNAYDYLIIGCPTWNVGELQSDWEGIYDDLDSVNFQGKKVAYFGAGDQVGYSDNFQDAMGILEEKISSLGSQTVGYWPIEGYDFNESKAVRNNQFVGLAIDEDNQPDLTKNRIKTWVSQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparisons of wild-type and mutant flavodoxins from Anacystis nidulans. Structural determinants of the redox potentials.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Electron transport
molecule keywords FLAVODOXIN
total genus 56
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 1999-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1d04A00
1AKRA 1FX1A 3L9WA 5LJLA 1B1CA 1JA0A 3B6MA 1YCGA 3OJXA 1XI2A 4R81A 2KQUA 2QX8A 3F90A 2RG1A 3NHSA 3NHKA 1XYYA 3EDOA 3HR4A 4YALA 2M6SA 1C7FA 2Z98A 4CETA 5FA6A 3FW1A 1QRDA 4U7GA 5EAIA 4ESEA 3R6WA 4YAUA 1QBGA 3FNIA 2N1MA 4ZVLA 4H2DA 3OX2A 1WSWA 3OX1A 2D5IA 3OWHA 5F12A 1YCHA 1C7EA 2FCRA 3QFRA 1CZHA 3P0RA 2OHJA 1RLIA 3FVWA 4ZVMA 3ZHOA 3F6RA 5ULLA 2V5UA 2MOKA 1J9ZA 1FLNA 2OYSA 3G5MA 4FGKA 3TEMA 4CF6A 2M6RA 3UXHA 2HNBA 1CZUA 2MWMA 2X2PA 1T0IA 2ZKIA 3ESYA 3F6SA 1JA1A 3GAMA 3OWXA 3TE7A 4ZVKA 3ESXA 4H6PA 2FAXA 1BU5A 1FLVA 2BPOA 3O73A 4XDHA 5LBUA 1XT6A 3B6JA 3GFQA 4DY4A 2WC1A 2QMZA 3N3AC 4QODA 4GR9A 2FOXA 1QHEA 1YOBA 5F4BA 1AMOA 4YAWA 2OHIA 3B6KA 4FGLA 2QX9A 4GI5A 1H69A 4ICIA 5NULA 1CZOA 1RLJA 1OFVA 2ARKA 4PU0A 2W5UA 2BMVA 1AKUA 5LLDA 1VMEA 4QOJA 1TLLA 3NHYA 1DX9A 1F4PA 2XODA 1J8QA 3NHUA 5B3KA 2GSWA 4Y9RA 4LA4A 4NULA 4DIKA 1D04A 4XDGA 1YCFA 2HPVA 4QOFA 1J9GA 5LJIA 2Q62A 1YDGA 3SVLA 2BN4A 3ES9A 1CZRA 3JSXA 3F2VA 3KLBA 3L9XA 3LCMA 5B3LA 4N82A 2FDXA 3FJOA 3OJWA 3W79A 2QR2A 5EMNA 5BUCA 1AKQA 5FUQA 3ESZA 5A4KA 5EA2A 3NHJA 2B3DA 3NHPA 3OVMA 2Z9CA 1NNI1 4LTDA 3TZBA 4D02A 1KBOA 2Q9UA 3KEGA 4M0CA 1FVXA 1OBOA 1YKGA 1D03A 1AKWA 1AHNA 1D4AA 2BZSA 2FZVA 3GFRA 4S24A 3RPEA 1WSBA 2AMJA 1KBQA 1YRHA 2QWXA 3B6IA 3FX2A 1H66A 4LAFA 3U7RA 3NHFA 1BVYF 4YAOA 3U7IA 1I1OA 3NHRA 2HNAA 1X77A 4N9QA 5LVAA 4HEQA 2QX6A 2Z9BA 3D7NA 1GG5A 1RTTA 1ZX1A 2FLVA 2X2OA 3GFSA 5F51A 1FTGA 1TIKA 4QOIA 3NHWA 4OXXA 4PTYA 4QOEA 2MT9A 3K20A 4N65A 3W77A 1DXQA 2FX2A 3QFCA 4FGJA 4BMPB 1FLDA 2QX4A 2BF4A 3KAQA 4LTMA 4QOHA 1E5DA 3HA2A 3NLLA 2MTBA 5FX2A 4C76A 3KAPA 1OBVA 2OHHA 3NFRA 1AKTA 1AZLA 4NLLA 1DXOA 2KLBA 4U7FA 3W7AA 1QR2A 2QMYA 1FUEA 1SQSA 3N3BC 4PTZA 4Y9UA 3OX3A 2R97A 4GQIA 1ZWLA 2V9CA 3UXEA 4C0WA 1RCFA 3N39C 2FZ5A 3HLYA 4C0XA 4HS4A 4YAFA 4J8PA 1ZWKA 1AG9A 2XOEA 4QOGA 4ZVNA 2A5LA 5NLLA 5JROA 5LBTA 2F1OA 1SG0A 3O2NA 4Y7CA 4U7HA 2Z9DA 2V5VA 6NULA 3LT5A 2FVXA 1CZNA 2R96A 3K1YA 3NHLA 1AKVA 3S2YA 3QE2A 1J9EA 3EYWA 1T5BA 4C14A 1V4BA 1FLAA 4F8YA 4YQEA 4BMOB 1CZKA 1XYVA 5TGZA 3W78A 4DILA 5LMCA 4LTNA 1CZLA 4FX2A
chains in the Genus database with same CATH superfamily
1Y89A 2MINA 3ELBA 3M6IA 4R9NA 4B4WA 4KAXA 3IUYA 1RR6A 1YB4A 4XAQA 3VU1A 1NFFA 3OZVA 1V45E 5EJIA 4ITVA 2W6QA 4B4OA 2OWDA 4I9NA 4CV0A 2JFXA 3SHTA 3NHSA 2IS2A 3PP8A 3WWYA 1OCEA 3MTGA 5C51B 1Y8QA 2NZUG 4BZQA 5AIAA 4BECA 621PA 1RYHA 2C0QA 4LBYA 1XRMA 3G0BA 4IUCS 3QXJA 3AJEA 4KFSA 5E6RA 4HLQB 2PX6A 1GZDA 5BV2P 2FSGA 2YWJA 3VU0A 1Y8ZA 1N57A 1I5RA 2II6A 3E1SA 3F67A 4R9UC 5ICCA 4WRRA 1ZU5A 3OOWA 3K5WA 4U7DA 5EC8A 1FP4A 1PDVA 1ZA1A 4FS8A 4YH1A 2AN1A 4IVQA 4DQUA 1QIIA 1UKZA 2I6GA 3GVIA 3ONVA 5K0FA 4BNJA 4RF5A 3CPJB 4UHJA 1KO1A 3N3AC 3E84A 4LWOA 2OD2A 1QRTA 1G6HA 1KFEB 1NAHA 4H1VA 3JYNA 4PZCA 1ZIYA 2A0UA 3H4VA 2Q5OA 2QLFA 2HDHA 3C3KA 2XGSA 1FP4B 5FWYA 1GNPA 1L2TA 1SBCA 2WD7A 3CV3A 4NULA 3AKEA 3TECE 3VPBA 4O4IF 2ZYHA 4RKEA 1OXBB 3W8DA 2KE5A 1QCCA 5JHHB 1WUYA 2YJGA 4CUKA 2BFMA 4ES6A 3DLHA 1UF9A 1D1QA 2CJXA 1JP7A 2K87A 3F3MA 4Q3KA 4CBVA 3VYRB 1LPSA 4HUQA 6PFKA 4OHZA 5AM0A 3GLGE 3COZA 3P19A 5G1NA 4IQ0A 3TQHA 1IHUA 4C78A 3AHEA 2GYYA 2FETA 5EQFA 1BCRA 4XVRA 1H66A 1KYWA 5JECA 4K6KA 5LWHA 1XMPA 2PVPA 2BR5A 2WG0A 1OASA 4J0EA 5C4MA 1JWLA 2WFMA 4F3TA 4Q47A 3ICCA 1H1DA 1ORTA 1Z83A 4MWZA 4Y6GB 2CNBA 2QK4A 3R9XB 1X9HA 3GA0A 1C4WA 1WP4A 4L0MA 3W4KA 1INLA 2IP1A 3FYUA 5IM5A 3ZD6A 2FE4A 4FOTA 1HUQA 4N8EA 5ISMA 1R88A 1C9JA 2P9HA 3F7MA 2PUTA 5JISA 3C43A 1KYZA 4NCAA 1B0ZA 2P9EA 4CGZA 2ZS8A 3F3KA 1IYZA 4KQCA 4NLLA 4R1QA 4U7FA 5FNVF 1KP9A 3ZDDA 2KPOA 2QDXA 3HG7A 5CFPA 2J87A 3T3OA 2C78A 2QRPA 2GSDA 4KDCA 1EP2B 5A6VA 4DR5B 3UAYA 5DX8A 3R7WA 1Q7TA 1Q1QA 1Z5ZA 4K9QA 3E18A 3QLUA 1HDYA 4JEMA 3SZOA 1AKNA 5CG1A 2O7QA 4JGIA 3U5TA 3L43A 4O3MA 5JD4A 2WSYB 2O5VA 3PGA1 4ZAGA 4NENA 3ZWCA 4G4JA 3CWZA 5CPFA 2P6RA 2H7VA 1MBZA 4JX9A 3JATB 2YNMC 1RYDA 4BX8A 1CZLA 1JUDA 4RV9A 3P45A 1CF9A 3N6VA 1MA0A 1P31A 5IF9A 3D6TB 3ANMA 3KQVA 2IY9A 4V0LA 4Y2RA 2E85A 1NG9A 1UKBA 1KRHA 1EGVB 3C85A 3TAHA 3KHTA 1K2VN 1G9SA 5L3ZA 2BFEA 2VDJA 4ZJPA 1WPRA 3PHCA 4AF7A 2V7XA 1XAHA 4NRDA 1TPZA 2C5GA 3CGGA 3B8HA 2PV7A 4GEKA 4AMVA 4MUYA 3WGTA 5TARA 3KKNA 5EE1A 3HP1A 4BFSA 3G13A 3RT9A 2Z0MA 2AOWA 1P7WA 5HQ3B 3O95A 2XCUA 4LKRA 4RD6A 3UK0A 5ESDA 2G88A 4ISBA 2XUDA 5H9VA 4C4OA 2PZBA 3R40A 5ENDA 1TT5A 1E2HA 2GBGA 1WHSA 4PGHA 1MNQA 4GDFA 4YXFA 3QSGA 5D3ZA 1QAMA 3LF1A 2Q2QA 4F2DA 1VG9B 2Z8XA 3DAPA 4OAOA 2IZOA 1Z08A 1JFRA 1I2CA 5KYGA 4TTSA 2QM8A 4FGLA 3RGWS 2NXWA 4IDHA 4BJHB 4FHFA 2J59A 3A4IA 3AC0A 4ZVQA 4EHKA 4DPKA 4NX2A 3QP9A 4DY6A 1W5TA 1R16A 2BFCB 2PX0A 2VPZA 2IA5A 3KQKA 3D0RA 1A9SA 3RRYA 3TJRA 3U49A 1AX9A 1IB0A 3SKYA 3ZJ5A 1XG5A 2YWFA 3BMOB 4YRKA 1DV2A 1NSYA 3RJ5A 3VHXB 1DEKA 3FUTA 3A6GA 3WNVA 3QJGA 4EQ6B 5JRDS 1OVGA 2P2ZA 2P67A 2ZJ1A 3MFQA 3OPQA 4TRNA 1FMLA 2QV7A 1I30A 3OPYA 3TRIA 1G5PA 4D02A 1F4VA 3CSDA 2P62A 2VL7A 4AUEA 3D4BA 3O75A 4RH0A 1F0YA 1F6BA 1Y3HA 3CZQA 3U44A 1CP2A 5D7NA 5EMLA 5EJ2A 3JWHA 2QZ9A 4G4IA 1W8DA 1X7GA 2BKEA 2VPIA 2RHTA 2YHBA 3FFTA 3GUHA 4OAQA 3IAM1 3MS7A 4RFVA 2J85A 4BEVA 1QNLA 5CTAA 8MHTA 3BCHA 1DJLA 3DVLA 2YHUA 1II9A 4QOSA 2A9FA 2X0NA 3F71A 2BR3A 3NHWA 4Z3DA 1HLDA 3OBIA 2ZWIA 3TBFA 5IRCD 4MI1A 2QG9A 3AVOA 4C7KA 3LC1O 5CDFA 2P2DA 5JBNA 4MA4A 4MMXB 4AKGA 3ZE0B 2FPUA 1FDWA 3RVJA 3KPVA 5HOEA 5L3QA 2QJOA 1TMYA 4WKBA 5FO1A 3SZLA 1E5TA 2Z2KA 5THQA 4AWXA 4QQRA 4M9CA 4ZVVA 2NZWA 1ZKMA 3SSOA 3IUNA 3G2HA 3ZQKA 2D2IA 3T5DA 2YWEA 2VSNA 4E2FA 1H0HA 5IAEA 4EHNA 3ORQA 3DR5A 3HYSA 4NH0A 4P98A 3NO4A 5A4DA 2G0NA 1FDRA 5EZQA 3M33A 3JD2A 1JKJB 4K6FA 2EQ5A 3G5AA 1ONSA 4DEVA 1A9RA 1Z2PX 3HJUA 4KDFA 5IN4A 3DVQX 2I3BA 4OBWA 4DHWA 3RWOA 1G21A 2BCEA 3FPJA 5ERXA 2W6JD 4LG1A 5BW4A 2YJ4A 1DPGA 4BKQA 1VHTA 2KX7A 4M0UA 2FMHA 1NXXA 3FOCA 1RWWA 1ZMTA 3SJZA 4ENQA 2XZOA 1KOFA 1DZ3A 1N0WA 1J07A 4HUTA 1D4FA 1EP9A 1W52X 3FNFA 4Z3OA 1XMXA 2YRWA 3A9TA 2I87A 2C2ZA 1GU1A 1W4BA 5EZ6B 4J9UE 3QF4B 4HHEA 3ETNA 1Y63A 3D8HA 1CFZA 2A7XA 4B6JA 4TKMA 4WOKA 1I7SB 2CL0X 1FP2A 1Z0DA 1IB6A 3DZKA 2PGNA 4F06A 5AM4A 2ZBQA 4QE3A 4ZDIA 4TS9A 5HOQA 4DA0A 5IT5A 3W2TA 4DR1B 2BFPA 2HSDA 4MI6A 2YASA 1PJSA 3LNTA 4IW3B 4R69A 2JGDA 2R4QA 3VU9A 5ILGA 4DT1A 2J30A 2QTHA 2WF9A 2FXIA 1JAYA 5BN5A 2I54A 1NVMB 2VNAA 1KQPA 4MO9A 4YFYA 4HDQB 4U3JA 3D8UA 4PZYA 2DC1A 2I22A 5A0FA 1DARA 1V39A 2F9LA 3ADPA 1N5DA 4NTZA 3I2IA 3OTGA 2IBMA 4F9FA 1MC8A 3TLCA 1FYWA 2JKVA 2YNMA 3D54D 1U99A 4DQDA 4FMBB 1UBRS 3LY8A 3Q7IA 4G1BA 3GWZA 4C3VA 4QDJA 2DR0A 5I4KA 3ZTTA 2QY6A 2GYWA 4IHJB 4ZAXA 3HCWA 4M0LA 3DTVA 1NZJA 3RC3A 1U7OA 2ARKA 1TU3A 1P17A 4KN9S 1NMXA 3D6FA 4BV9A 1I2AA 2YW9A 3W2EA 1R64A 3OHMA 2GKSA 3UGTA 3KOYA 1J8QA 5GIOE 2FUG1 1FFXB 2GSWA 2ZG6A 3JD3A 2O1XA 4BN4A 3SNHA 3A58B 3JWEA 4QWWA 2OM2A 3K0FB 3O4FA 4QXPA 2C2XA 2D5AA 2GM4A 2Z57A 3ZLTA 2A84A 2Q3EA 3FOEC 1SBHA 1VHDA 2FZGA 4MJ3A 2AV6A 1P9WA 4R84A 1LNQA 1WY7A 4RMHA 3VMMA 3FKSD 4FI3F 1MF7A 3K6SA 2D7JA 2Y1WA 4OQEA 4X60A 3LDUA 1FBTA 3RVSA 4AMBA 4BWVA 4MPJA 1PZMA 4J2HA 4C7OA 2GCIA 1YRHA 3D0QA 1KSHA 4MPPA 5J3JA 1K98A 4JHXA 5TQ0B 3UPUA 4BAGA 2FWIA 1E4YA 1F48A 1YJ8A 2R84A 2XBLA 4RNDB 4RLSA 3WBBA 4QDXA 1E20A 3IVGA 1SCAA 3LYHA 3TNDA 1TYCA 3NDRA 1JMYA 3DOFA 1SD1A 4GFDA 2HK6A 2EU8A 4KLCA 4QU9A 3H1TA 3LS2A 1R18A 4RA9A 3WIUA 5FL7D 4FFVA 1E63A 5JC8A 3REQB 3ZTYA 3BSSA 1A5ZA 5CA0A 3CLVA 4C30A 4WLVA 4C4AA 5BWLA 4FHCA 4Y2PA 1J2TA 2MSWA 4WN9A 5TQ0A 4BNXA 2UUBB 2Q8QA 3SG0A 3QVWA 3V8MA 3ZHBA 2VTBA 1R3UA 2NO0A 2WIJA 4WLNA 1RIFA 2B1JA 3RVKA 1Y42X 3C70A 3IERA 3SQWA 1PSZA 2ODQA 1MOZA 2Q6TA 4HAZA 3LYAA 3LKZA 2Z09A 2PT7A 3IKLA 4QUDA 1SY7A 3D8TA 1G20B 4DCTA 4XGIA 3G2KA 3KD2A 1KI2A 2FFAA 3N8GA 3P5BA 4PHCA 1E79D 4XE5A 5AD1A 3RJMA 1BXKA 2V3CC 3FDIA 1A1SA 2V5VA 3QMVA 1AHIA 3HBAA 2NV2B 2I6SA 3DOHA 1T5OA 1L7PA 1ZD3A 2H2FA 4RD2A 4WK2B 5AICA 1GPNA 4E1VA 1YZYA 5IEJA 3FNBA 3WLPA 4BLQA 1SKAA 5JCJD 1U2GC 1T8TA 4HEHA 1QIJA 3OPNA 3K53A 4OSOA 1WPQA 4L6CA 2O0MA 1S6YA 4ECEA 4YJHB 2A8YA 3MGKA 5BWOA 4EHLA 1AO0A 4TYYA 4CMGA 5A2QA 2M1ZA 1OIVA 4HAUA 4M76B 1KDYA 4C88A 4DQLA 2A1UB 4FS3A 4OEHA 1F6DA 1LS1A 2H1CA 1MJNA 1CQXA 5AXCA 4NZYA 3O84A 1WEHA 1Y8RA 1TU4A 1E94E 4EHFA 3ECSA 1EMDA 3TXAA 2F3UA 1XBTA 1QRDA 2JAQA 1U7HA 4PYIA 2EX0A 1OT3A 4NYJR 3Q88A 4IGIA 1XELA 1F06A 4R3UC 4MP6A 4MAFA 1ZESA 1NGSA 1RCTE 4BIIA 3CPSA 4ZMBA 2XKJE 5B1YA 5DH9A 4QJBA 2X0DA 1JB1A 3FMVA 4LHZA 1ZGBA 4WASA 3S3TA 2QAIA 4MYSA 4O6VA 1C7EA 1J25A 1F5SA 1SXJC 1V95A 2R6R1 3UHOA 1XZMA 2ECPA 3TUZC 1QGZA 4JEIA 2JH3A 1EQUA 3T4XA 5ELLA 4UVEA 2AHRA 1JSXA 4NF2A 2BJHA 1K8YB 2QTRA 3DBLA 1CUGA 4CM4A 7AT1A 2QB5A 2F7SA 1M76A 1UT8A 2DBQA 2QUZA 2ZKLA 4IDCA 4QTUB 2BONA 2JRLA 3BXEA 3HDYA 4R5MA 5E6SA 1SZJG 2LKDA 3M3HA 1VE9A 2VDVE 3EXFA 4Y1EA 1G55A 2FOXA 3CF2A 1KIFA 3RANA 2PZAA 3VBCA 3KE9A 3O1LA 1FYVA 1L5GB 2CSUA 5D6NA 2NAPA 4KQWA 1XMSA 3MMSA 5AIBA 2ES4A 1M6VA 2AN5A 3AY6A 4ZU1X 3SR0A 5F5NA 5BR8B 5LMUB 1T9DA 1AQ6A 4IH1A 1KI8A 4ZT2A 1BJRE 1I2ZA 2WPDD 1VRVA 2X0KA 3T4PA 2HXSA 3ITEA 4DE5A 1HRKA 5AWFC 3W2GA 1OQAA 3VR4A 4F45A 1GKUB 4QU0A 4BZZA 2C2OA 2NSYA 2H1HA 5JSHA 4MCAA 5F4ZA 1VHWA 4BX9A 1XHEA 3KEGA 3P52A 3TW4A 4P5PA 2GTPA 2HCRA 4IICA 1S01A 3QVSA 4WK6A 2VA9A 1L5ZA 121PA 4JJZA 3SCZA 1N5OX 4EABA 3U7RA 1AQIA 1KEPA 4BO4A 3TIFA 1DBVO 5LQUA 3BMXA 2B36A 2QPLA 5E38A 1F12A 1W581 3X1WA 3FHJA 1N5JA 5AHOA 3EZXA 2ZRIA 1JSRA 4JB0A 4LYAA 2OO5A 3AW8A 3MTBA 4JYMA 4LSWA 3J81k 4D1YA 4RPHA 3YASA 4QULA 3WOVA 1GG2A 2VO1A 1CDDA 4X91A 5K3SA 4TRRA 3I1JA 3NPAA 4R8LA 4BO2A 5FOSA 5FULA 1PBTA 1QHIA 4ZVRA 4CTNA 4EX6A 4UNRA 4MV1A 5H4GA 4POOA 1E5DA 3BZUA 5T67A 1VJTA 2X3YA 3OLQA 4IRXA 2MYPA 5E9JA 5T8KC 2P0EA 1G5FA 3GRPA 4AQYB 3OLXA 2GRAA 4EKNB 5BN3B 4E1AA 2NVOA 5DM4A 2VPYA 3LW7A 1B7GO 1I6LA 3N3BC 3AFIA 4Q4JB 3MCUA 3FPBA 4Y9UA 3R8CA 3R3WA 2WJZB 3SN6A 4AW9A 5JQGA 2RB4A 4IDQA 4UULA 3ZBTA 4R8VA 4N0EA 4D7AA 4UFOA 5HS4A 2VEOA 2MSNA 1NVKA 5IJXA 1G8PA 3EGDA 1GZ3A 5I8WA 4AYTA 3RCBA 4YT2A 2EW1A 4D9GA 1AN9A 4D6YA 3F6BX 4F9EA 3BBPA 5K5EA 3UJBA 1IVNA 1NUPA 2OCYC 3FHOA 3FIUA 3IVXA 4KXQA 2YHSA 1U6JA 3CPHA 4COOA 3TLYA 1Y3DE 1XA0A 2VHWA 3GD7A 3RNOA 4B0OA 3I39X 3V3KA 4BFXA 4V1CI 4OTZA 1XYVA 2RAFA 4RX1A 1HDOA 2VHJA 4UBOA 4CPDA 3L84A 4EWLA 3K0SA 4FX2A 4GS5A 3M82A 2GBIA 2R1TA 4EGJA 3F1KA 4RKFA 1JBEA 3VOAA 2ZK7A 4IOJA 3QSYA 4PXAA 2F1IA 2BTQB 2PYIA 1UDAA 5L7TA 1JKXA 2VJNA 3KDSE 4QHYA 1RRMA 1QKJA 5SYAA 3O9ZA 3QI2A 4OB8A 1IU9A 5I9TA 2EZ4A 1BWRA 3QWIA 2IV2X 1DTWB 3NT2A 3VNBA 1XEXB 4OCZA 3IEMA 1WA5A 4A4DA 5F3WB 4D9BA 4PFJA 2GMWA 1HA3A 2XDQB 3B60A 3FPHA 1VG0B 3I1IA 3T5PA 3D6JA 2WDPA 3CLUD 3N2EA 2AWOA 3KOZA 3LLMA 1H2XA 4PLHA 5DB4A 3ZI7A 1CC1S 4DBLE 3HVRA 3C45A 2QJRA 1GQRA 5KJ1A 2R1VB 4G56A 4KOEC 1TC1A 2KJQA 3KIPA 5WRFA 3MCTA 4YI3A 5HIAA 2D5BA 2VTEA 1I4TD 2BPOA 3B3AA 1L8QA 1BGWA 1EA7A 2M2IA 2XDQA 3PFWO 4Y6SA 3RU2A 2OFOA 2WHYA 4RTRA 2XW6A 3K8OE 3VOTA 3PD0A 5LU8A 3KQOA 4OQLA 3DMGA 1YACA 3QKIA 4REQB 4W5JA 4WPGA 4BVHA 4M60A 1VB5A 3PSHA 5ALNA 4ESOA 5LP6B 1QRSA 2TMGA 4HLUA 2NW6A 3H0KA 2VQ6A 1J20A 1DCKA 1Z6XA 2EIHA 3AEKB 3B89A 4WGFA 3MGGA 3UFXB 1NWCA 1YZ3A 1R6AA 8ATCA 1FW6A 1HZZA 4E5VA 5ITWA 4D3FA 3KTAB 1LBTA 3T3EA 3RK4A 3S5JA 2VDUE 2G7MC 2WFLB 4R6XA 4Y9DA 1D7OA 5DSXA 3W7BA 1CETA 3L3BA 4PXSA 4D0GA 4B4VA 1RXEA 1J70A 2I9PA 2XRMA 5T41A 1P2DA 5DN9A 3HB7A 1A72A 1U11A 2HMUA 3BXPA 3L7YA 1YR6A 1ZCBA 1PL0A 1KVRA 2K2QB 2V7PA 4JB3A 4J1NA 3VVLA 1O4VA 1WCYA 5B6PA 1C1DA 3STTA 3SEFA 1QYWA 1KNXA 2HFJA 3C3DA 3EHEA 1WUTA 4QOIA 2HFKA 3L0BA 1OD6A 4G86A 3HCRA 4IH4A 4KQXA 5A3SA 1KR5A 3CZPA 3WQBA 3P4YA 5IXSA 4JMLA 2BF4A 1DFHA 5GADl 2EV9A 3HGQA 2Z6UA 4DSZA 4RJKA 4XM2A 3RUHA 5GINE 4CKCB 1T43A 5H68A 5HF6A 4FEYA 1MC1A 2Q3JA 1LWOA 2C4MA 4GOOD 4UTXA 4KUGA 2CNOA 1JVBA 1YSCA 3R3ZA 1X7XB 3IH5A 4XZ3A 4KH0A 4C0WA 1DKPA 3GJYA 1E9CA 5EOVA 4D99A 2O3RA 2GYUA 3C3EA 3EB9A 3F3YA 1AZSC 1OKKD 2GF9A 1IBSA 1P4RA 4G97A 4MW0A 1JGTA 4HVLA 5A5VA 3RUCA 4XYBA 4EYKA 4Q7EA 3LLVA 3OJLA 1DUVG 3UUWA 4PGGA 3GLUA 1DMSA 4HY3A 4DLRA 3FFXA 2SNIE 2W8BB 4CDGA 2XIQA 2AEMA 1NVEA 3JD0A 2J4DA 2I4NA 3O47A 4RPGA 5BSWA 4MUFA 1R66A 4FBGA 2UVDA 1KQNA 1AM4D 2V7WA 3IEUA 2PUEA 2QP3A 1IG3A 4LRUA 5D3MB 1VL6A 1V8PA 3WFJA 1MT3A 2YY7A 4MCHA 5J4KA 2PSSA 3DFFA 1I9CA 4X8MA 1AC5A 1PHRA 4J4HA 3UV7A 4YHBA 5F7ZA 2BZ0A 4UOEA 1T4MA 4KNYA 4XGNA 4I99A 2QGNA 4MKIA 3DMTC 4WLUA 4NU8X 4FN4A 1RW4A 1Y6QA 5DOVA 4IXNA 1R1DA 1OWNA 1ZYUA 3MWDA 1WTAA 4TQAA 1E0AA 3HKEB 3ZDRA 2PJZA 2OHGA 3VZDA 3WHLA 4AKTA 5AM5A 1VYVA 3ZHZA 3WYFA 1XWIA 4MYTA 1QPBA 3SEAA 2GZSA 3BIJA 5KIAA 2CHFA 3DSRA 3WRYC 3ADOA 4YLEA 4HGQA 3JVDA 5F2NA 5JWHA 4RHUA 4HQKA 3TINA 1A27A 4Q00A 2V58A 2H9IA 3O8QA 3MWDB 3RU3A 4GMKA 4E5KA 8ABPA 3G7UA 3ETEA 3BB4A 4GYYA 4LSMA 2F8LA 4B7CA 5CVEA 2WUGA 4BGUA 4O4JA 2BKVA 3ZKAA 2H0AA 5HG0A 1YE8A 5H16A 1TO2E 3D7RA 5JMPA 5CB8A 3FUWA 3A2LA 3DLCA 3A4VA 1V9SA 3CT6A 3ZWVA 1H69A 3ZE8A 1SN7A 3O8QB 3PF9A 5ALRA 1PW7A 4BCCA 5LZ2A 3FB1A 3B9PA 3D8SA 1L8OA 1T29A 4QHTA 4YONB 1GCGA 2MINB 1IY0A 2YXEA 3M5WA 3WYAA 1QFMA 5IS2A 1JQBA 2NVUA 4L1KA 2DX7A 5JS6A 3ES9A 3KC2A 2I6FA 4L6AA 5DISB 5DKFA 4BNZA 5TMPA 3D0OA 1KERA 2JA2A 5D1HA 3T9CA 2ADFA 3OKCA 1ZH6A 2HDOA 2RCNA 3L77A 1NBMD 4HQFA 4FFRA 1LVHA 3TKLA 1U0BB 1G8KA 4J0IA 1T4CB 1ZXBA 4G5HA 4PLPA 3G2NA 4Q4HA 4WA8A 2FHPA 2ZE7A 4CIYA 4UXJA 4MWSA 3EVBA 5SY4A 4BO0A 3VAAA 1QTNA 3JQRA 3H18A 3QHQA 1WSBA 1JAHA 3WLJA 3WMRA 3C5HA 3ZU6A 4UM5A 3WWOA 3UT6A 4DWOA 4Z7JA 1U4NA 3D7MA 4JWTA 4L8VA 3UMGA 3P26A 5I7OA 5IAAA 3CY6A 4Q1BA 2P2SA 1QV6A 4RZIA 3WK6A 1OE0A 3CKYA 1RFGE 1H8HD 3WSWA 5G0WA 1ZOPA 3MPOA 4W9NA 1NF2A 3AI7A 3IP1A 2AGVA 4H1HA 1G6Q1 1XKXA 3K0EA 4IJUA 2WKRA 3DO8A 4OMCA 4Q05A 5C8YA 5KQPA 1CLUA 1BHQ1 1XTIA 1L7DA 1NOJA 3CLSC 1PR0A 3DNPA 4GWKA 3WK9A 5B64A 4ITRC 1CX9B 4ZYVA 3DV9A 5C8VA 2QQ5A 1C0PA 3QX7A 3PC7A 4FQ8A 1GPH1 3QU5A 1XTBA 2HWXA 4CUZA 3Q0IA 1DNPA 1N3LA 2ACVA 4U7JA 1H65A 3CF0A 1SA0A 2GBCA 1MNAA 3ZZ0A 1VZ2A 4EM6A 1YQ9A 2DHCA 4ZO4A 3UJDA 1APBA 4EMBA 2YIVX 1KO8A 2O48X 2DY1A 2MHCA 2LVBA 2ZB7A 3GJ0A 3KPWA 5DNVA 4ERNA 6NULA 5CFOA 1Y4ZA 1WXIA 4YRBA 5K0TA 1TIPA 3UWSA 4QRDA 2VRCD 1SCUA 4M86A 1KE2A 4EECA 1HYBA 3OJOA 9ABPA 1SGWA 1PZHA 3GPCA 4RWZA 1FLAA 1YI8A 2FMXA 1SA0B 3B53X 2A67A 5B2FA 3AHGA 1LBEA 3M1YA 4OGGA 1EX6A 1Z22A 2ZLBA 4BV3A 2FZCA 5CH8A 4FOPA 1IN6A 3I2KA 1BNCA 1YVDA 5EQJB 4BFTA 4YAIA 1Z39A 1YDWA 2VHTA 1AGXA 1IIBA 2Q9BA 4NCHA 4DSTA 2EZ9A 4P1ZA 1KE1A 3IJ5A 5G53C 2FEWB 4TV9B 4GM1A 2KWIA 4JX8A 5F7JA 1QLHA 3CF6R 1S1CA 4G5YA 5AW4A 1PJZA 2WKSA 2RHOA 3WFZA 2AOTB 3ER8A 4LZLA 4PM4A 2QSZA 3OO1A 3UB3A 4AP5A 4I1SA 4B83A 4AQ7A 2WJ3A 1XCLA 1BMFA 1XCOA 2Y0DA 3AFOA 2WTMA 3AQ4A 1ORRA 1G9XA 2O1EA 3SM3A 3TUJC 3PJDA 2JZCA 2UVPB 1IHOA 1CYEA 1MLDA 4Z3KA 1NUUA 3R3VA 4YP6A 1TCVA 2VPQA 4X85A 3I01A 1Q21A 1YIDA 2IUFA 3JX9A 3QKRB 4TXJA 4MV8A 2FP3A 3CZ9A 4ZVKA 5J1SB 1J1ZA 3T7TA 1ZO8A 2MSLA 3GFBA 1B74A 1O6ZA 2EOAA 2A0FA 1U7XA 4IJVA 3PUIA 2OCKA 2NWQA 3S27A 1TUEA 2J9FA 3BRWA 3VJRA 2DFTA 2WR8A 2UVPA 1JHMA 2GN1A 3NAMA 5FPPA 5L53A 2PVCA 1YUNA 2O19A 3C4QA 3EIEA 4RSHA 4HH1A 4HNGA 2O1WA 1S3SA 3BC1A 4OLJA 4Y6QA 1O4WA 2HNKA 2V59A 3AXTA 3QVKA 4MCJA 4RKQA 4CN8A 3K9QO 5LJIA 2W6IA 2Z2IA 5LXTB 3A2NA 1CUBA 3BAZA 4RGYA 2IH2A 1K75A 1ZQ1A 4RPKA 3DJYA 1XXHB 4OI0A 1UMBA 2W2NA 3NHPA 3R7LA 4D8UA 1ST2A 3LNCA 2QLNA 2QXUA 3NTOA 4W5QA 5J5AA 2LP4Y 2X13A 3EVCA 3CEPB 1C9NA 2C9ZA 2Q5EA 3B1JA 2JL1A 3E7DA 5BV1A 5DN6D 4W8GA 2B1GA 5BQFA 2GUWA 5HQ3A 1EK0A 4JDUA 3PUKA 2HR1A 3Q3IA 4PCAA 4NG4A 4UM9D 3S6JA 1KHTA 1UC9A 2EKDA 1FQKA 1KO4A 4QGBA 4CIAA 1YRAA 4MUHA 3DLTA 4MRSA 1JFLA 4R2HA 5REQB 5E3HA 2OCLA 2GTHA 1MJHA 4IZ6A 2CVHA 4EHJA 4RELA 5BSVA 3C48A 4O2BB 1O6GA 4QX6A 5JQWA 1DXYA 3B6EA 4TL8A 4DV4B 3AVXA 2V7EA 3MS2A 4UOQA 1MRZA 4KI7A 2OXIA 3A04A 1W36C 4E32A 2CL7X 2BE9A 1DOZA 1GGEA 2CB9A 4ZU6X 4IDGA 5C35A 3A3YA 4ND2A 3FTQA 4C2AA 1GLNA 3SSAA 2PS3A 5A1JA 1TOAA 4OIFA 3K1AB 1L5KA 1HGXA 3Q12A 2HTFA 2QTVB 4DCCA 4YPFA 1RCUA 1E0DA 1J49A 1MZPA 1U0NA 3KZVA 5HDQA 1SHKA 3PEVA 1TM2A 3URMA 2OFXA 4P7BA 4TWIA 4EQ6A 3A37A 5FJJA 5HRCA 5AR1A 1MO2A 2QAGB 1XFAA 4NJEA 5LM3A 1XCGB 1Z34A 2D5LA 2E18A 2G80A 2O2IA 1W30A 3S99A 1H9CA 3WLIA 4UOZA 4ZZ1A 1ZJ6A 2MYUA 6YASA 2VR1A 4RYDA 1DX6A 1SXIA 4NU6A 4PFSA 3P0HA 3I23A 4LRYA 5BSUA 4OHFA 1XUOA 4F6RA 5EJ4A 4JXZA 3E8MA 1BMFD 2QUKA 2EW8A 4PINA 3LHIA 4R81A 1D1TA 2SKDA 3M1LA 4YMLA 1WMSA 2CEAA 2ZYWX 2WKWA 4Q7QA 3NNNA 1NN3A 4CETA 2YV3A 4FMCB 1R5JA 2BHRA 1GPAA 2V98A 1IBCA 3F9IA 1ENYA 3FWPA 2Z2YA 3C8MA 3FYSA 3WYDA 5CB0A 2HCTA 4M38A 3WGHA 5IJ0B 2ANCA 3FY4A 4D9HA 1SCNE 4D4HA 1TVKB 2DZDA 4HJRA 1RJ9B 1UR5A 1G4UR 3QV2A 2WOOA 4OLFA 5SICE 3WL3A 5BMVB 4D4GA 1K92A 3I5AA 3K5PA 1T3HA 4JL8A 1CUEA 1SU7A 2CYBA 2WUDA 4CM9A 4PAGA 3QEMB 5I8ZA 2A5JA 2OWEA 5HM6A 3UXHA 1GFZA 2NZ8A 4K7JA 1HYQA 2OG1A 2BEVB 2I7TA 2CMDA 4MUBA 1UJ4A 3HE3A 4KI0A 5DHAA 1XT6A 5GP1A 2EKLA 4MVJH 2ETXA 4QPJC 4U2GA 4RULA 5KHLB 5FF9A 4DDTA 3OUUA 1XB2A 1G21B 1PSWA 1AQLA 1JIQA 2FRXA 3EZFA 3JYQA 3VVMA 2QXTA 3RHFA 1IJFA 3FRHA 3N6RA 3SE7A 4AKSA 1SQ5A 2QUIA 4V1CA 5KNLA 1IQ0A 4G5OA 4QOFA 2NUAA 1WF6A 3OE5A 3ZY4A 4IZHA 1NSTA 4LBZA 3ANSA 4TZ6A 1GR1A 3MWKA 2IVZA 2VP4A 3X1JA 4OU5A 4UCFA 2LCIA 2P6UA 2R65A 4ZJZA 3W1VA 2PUGA 3PQ7A 1BE0A 4KO4S 1I9GA 4J75A 4UDXX 5CLGA 4PFKA 3WRXC 2JK1A 2Y1EA 3JR7A 4XXHA 3IT2A 2J0VA 5LKRA 1C4OA 1CWUA 1D2NA 1LPMA 3L7CA 3NV9A 2IYFA 1DS6A 3IUPA 2AC4A 4X63A 5LZ8A 3TSCA 4ZEMA 1IN4A 4H59A 4JLNA 3SVZA 4LMAA 4C0KA 1K06A 2IYVA 4NOMA 4YUXA 5EN4A 3PGMA 1L7BA 2C5SA 3JVUA 3H6GA 2WYUA 1RLUA 4IZIA 3EF3A 2O5EA 3WDLA 1G6KA 1M2EA 3P2OA 3I0ZA 2VNSA 2W8ZA 3DONA 1HO3A 1TD9A 2X4DA 4LJ7A 1WNFA 3O7WA 2B21A 3D43A 5C1DA 5KWVA 1SKUA 4A2PA 2ISSD 3NIBA 2RKOA 1Z15A 1LV8A 2F17A 3M83A 4ZQFA 2E4ZA 1LJUA 2WJYA 3EVDA 4YCSA 2FSHA 2SBTA 1OWPA 1EJBA 3EOBI 1WKVA 5DBIA 3K1JA 3KKKA 1Y9JA 3LFHA 1IONA 4FCVA 1X9IA 2H29A 4PNPA 1AA9A 1S02A 3FB4A 3ANLA 2NZXA 3AG5A 1UIMA 3DMHA 1DCMA 2SECE 2H16A 3IOCA 3LRPA 3GJZA 2A88A 1Z5VA 1QE0A 2XUJA 3DKKA 1NNEA 5ALDA 5GONB 4L3OA 5JXIA 3GZNA 2WKQA 3IEKA 3IS3A 4A92A 1JLRA 5JBQA 2FEMA 1P1KA 1V6AA 2PIDA 3DAYA 1FL9A 3D31A 4MV3A 1E6WA 4V0QA 4FYWA 2QNRA 2YXLA 3M2TA 5BO5A 2DJ5A 1MX1A 1KOJA 1VRWA 2E0IA 3D1JA 2XT6A 1NP6A 2GCGA 3NANA 4WNAB 5TQJA 3HO6A 4NCNA 1EVYA 2B4QA 2G9VA 3PX2A 3KQSA 1K3UB 5CXQA 5F98A 3CLSD 5I7SA 3UWPA 1OTXA 5PNTA 4P34A 5T3UA 3W2FA 4OI1A 3I2GA 2IDMA 1MT0A 1RXSA 5DT9A 4PG5A 1JLSA 4XCXA 4CR7A 3ZQUA 1B0PA 2G1PA 1XVVA 1XZBA 3UOAB 4CM6A 4TV8B 3M6AA 1SCDA 3PFNA 4B7UA 2YXBA 3IDZA 1U0GA 3GG2A 1TRKA 4DCSA 1JS1X 4AL4A 2X7XA 4GX1A 2PUVA 4OHKA 4TLCA 4C87A 3DE7X 1Y3BE 5BXQC 2OSVA 4RYLA 4CF7A 2XLBA 2HIGA 5CEEA 1TQDA 1VIDA 2KLHA 3LGXA 2GJ9A 1VLVA 3NH6A 1LJ8A 4M0DA 5FUMA 4AICA 1J4AA 4B6PA 1V8BA 1X1BA 1ZJ5A 1J8FA 1XL1A 2VYCA 2WIKA 4ZO9A 4ER0A 4YDQA 1CUWA 1KAHA 3FLAA 3VJKA 4N7MA 2QQ0A 4P38A 2JGFA 5B7GA 2ZAYA 3U9LA 1YFJA 3W5UA 1BFUA 2Y1LA 2HIHA 4MCIA 1NX9A 4RHTA 3PPIA 3WNCA 4BFVA 2QYHA 5CXUA 5AVJA 1P6XA 1O0SA 3I9MA 1VZ3A 3MWYW 2BGUA 2C82A 5D00A 3TLGA 4BWFB 1PT9A 3H8VA 3TTVA 4ZGWA 4JEHA 2AJBA 4RJIA 3RASA 5C1PA 1VCOA 3KUKA 3AYZB 4GKJB 1QVVA 2C2WA 4HFJA 1YWGO 4RK1A 1WAMA 2Y68A 2HXGA 3SPXA 3IHWA 1M1UA 4R2MA 3UA4A 4I9UA 1G5RA 2PTHA 3V1NA 4AJ1A 4ASUA 4J6FA 4LRXA 1O0CA 1WU8A 1RD4A 2IKQA 4R51A 1G4HA 4L9RA 2FZVA 4R1SA 5J9FA 4G8JA 1XD2A 2G9RA 4F3YA 2B5VA 4PEVA 3GLQA 1W4CA 1TEHA 3PU6A 3M4NA 4P0PB 2O3QA 3WV4A 1D1SA 3O90A 1E2JA 2C83A 1F8FA 2XE7A 3EXHA 5F35A 4AVYA 4C5BA 5TSDA 5IJZA 2PRZA 4RTMA 1QFXA 1PGQA 4B1FA 3GGJA 3K70C 2GBPA 4IUYA 4ETWA 2F3PA 1FMJA 4KKVA 3WL7A 1C9EA 3JYHA 3SLGA 3EOAI 3IO5A 2BKUA 2H52A 2LIVA 5IC5A 3ONEA 3T7RA 1ADFA 4JC8A 3OLCX 3H2SA 3HPRA 5G4KA 5EVJA 2W6PA 1N2CE 3V6MA 3NHZA 4PVDA 2PBRA 3PKIA 5FOVA 1E1YA 2B30A 4P4GA 1A9XA 1E1LA 2RONA 1ABFA 3EFOB 4K6OA 5KINB 4QYWA 2UVQA 1VLMA 3N2GB 4YJ3A 2XB8A 2XRZA 4RACA 1TA0A 2XA1A 3CWCA 3GFTA 4KHPB 2DHDA 2CL5A 2XNSA 4TMZA 4AC9A 3NGMA 1ODFA 1XC7A 2R8EA 4Q1VA 4Y6OA 4V3CA 3SR4A 2EF1A 1VL1A 1PCXA 3S68A 2D1RA 3RGGA 1Y1TA 3RBVA 1UK6A 3DKVA 1DQZA 5HIKA 1XEWY 2XYVA 4NEQA 2Q1WA 3FMPB 1QTIA 1P1BA 1WSAA 2FF7A 3HP7A 1PG5A 4GMXA 4DSOA 5LL6P 3MLAA 1FFBA 2PQ0A 4MK4A 3FPAA 3BKWA 3DL4A 2BI7A 4EG6A 1E3IA 4I4TF 3MLBA 1BXRB 4UHHA 4HNHA 3JASA 3OE1A 2ASVA 1Q1BA 3CH7A 3K2QA 4L50A 4DJAA 3K35A 5IH7A 2WG2A 2OYRA 4K40A 1V71A 2A33A 2Q29A 2R6DA 4PCLA 2APJA 4K1XA 1JU9A 1M5UA 4W5HA 1C7FA 2HU5A 4Y18A 3INYA 2PRYA 4IILA 4O8CA 4LCJA 4AZTA 4LZJA 3VDRA 4BLWA 4M89A 3DEZA 5T3YA 2QPOA 1M10A 1TTQB 1JSLA 2QE7A 2XNKA 2OORA 1V3TA 2NIPA 1FRZA 4EDHA 3FOFC 3SMVA 1VSTA 1Y8QB 4EF6A 1RLIA 4JNCA 3SQLA 5ITSA 4EL0A 2XZTA 3O3OB 4RD4A 2JI6A 2ZM6B 2ZKIA 2VPPA 3CMMA 5K8VA 1R0WA 4XDZA 4LF6B 4JS0A 2IS6A 2FAXA 1QHHA 1NF3A 2GLUA 5TF4A 3V8PA 2UXDB 5JFOA 1G8YA 3E03A 3FGPA 5IH3A 1T0HB 2A1TS 3G7SA 4F4CA 4XSHA 1PLKA 1F60A 5CT4A 2IHBA 3IPCA 4L16A 4TLEA 1FSFA 4F97A 3K8ZA 3N0VA 3ZBQA 4HGOA 4YQFA 2VDLB 1F8GA 3A10A 3H1EA 1PUIA 3KR2A 1OHHD 2IYSA 1O8CA 4IEIA 4ZTUB 4TYQA 3T4UA 3DZIA 4MKFA 1S8FA 4TL6A 4Y1RA 5DEIA 3NHJA 1AK2A 1QYCA 1USIA 3OZDA 2OFWA 4UM8B 3VR3A 5HF9A 4DLLA 5KREA 2D0DA 1U1GA 5LU9A 5HIJA 2DTEA 2PMBA 1NULA 1XJCA 5K9ZA 4TYMA 2BMFA 2QTTA 5FEUA 3FX2A 1B0AA 2Q7OE 2IWHA 2B1IA 4WCFB 5TVKA 1I4WA 4FMPA 4URWR 2ZAOA 2AYYA 4K9OA 4ZC8A 1YBVA 3D6VA 3GFSA 1SBQA 4MW4A 2CKDA 4D97A 2HT1A 4WEOA 3KU1A 2IYTA 1JQAA 1KDPA 5AM2A 1T4DA 3WA7A 4BFZA 3AFNA 4HEJA 2ONYA 1GUFA 1T3SA 1X0XA 4D26A 1N2HA 4MW5A 1UZAA 4YRMA 2O59A 1QTQA 4RBNA 1RYEA 1DAOA 1ACJA 1IOZA 3QWFA 2WWYA 5IXYA 4UHFA 5DSTA 1AZLA 1P29A 3FOWA 3I1YA 4G1VA 5BR7A 4NEHB 1QR2A 2GN4A 4NV3A 3G6KA 3THOA 3V00A 3OD5A 3DAGA 3GL9A 2NT4A 3KUDA 1DRWA 5SYMA 5TF0A 2OP0A 1QANA 1TKBA 2I6QA 4P86A 1RRVA 4A8JA 1E7YA 1G3QA 1YQUA 1FTSA 2N47A 3C7KA 4F2WA 1JHVA 3IUEA 4HAYA 4FD3A 3QVUA 8OHMA 3ZWKA 4HFNA 1ZIOA 2HSEA 2AUTA 5KNCD 3FG9A 4IGFA 2NP6A 4NICA 1V3QE 5D5QA 2X6TA 3DMDA 5CNIA 1V4BA 2V55B 1Z7BA 5ENVA 3H2IA 4Z7OB 1DO2A 5FUBA 2D00A 4GYWA 4PPFA 1L5SA 2F00A 3E27A 3PPXA 4KNWA 3VSEA 4A8JB 3ZIAA 5CDFE 4KPYA 5CK4A 3B70A 1KK3A 2I65A 2A9PA 3FMIA 5LJLA 1DIRA 4E5PA 1HFJA 3NHMA 3BORA 2C9CA 1C1DB 5BUQA 1I2BA 4ZO7A 4L0QA 5DYNA 1KZYC 3CUVA 1IRIA 3HU3A 3MMXA 2AI2A 1DX4A 3GYBA 3OPVA 2XZLA 2WRZA 3V7NA 3U62A 3P97A 2CXNA 1I3LA 2AOUB 4QDOA 1G41A 4TTQA 4URUR 3TZ6A 1G5TA 2ZRPA 4AUNA 2FPGB 1RAFA 2HK8A 3A0RB 3NYIA 4KGXA 4BMXA 3THXB 1FP7A 2XWSA 1J5PA 5I7AA 3AF2A 5YASA 5K3EA 3IEXA 1NXTA 3Q6IA 2F1RA 2O2YA 5E4JA 3S1AA 1ESNA 4C3UA 1P5JA 3AU8A 3IALA 4R3NA 1N3YA 4HAVA 4LHXA 3ANYB 4G0XA 3QOYA 4U7PB 1WMEA 4G1UC 4OQ4A 1GOTA 3K09C 2OC9A 1Z73A 1MB2A 1U4OA 1SUDA 4PSAA 5CVCA 4Q4AA 4A5OA 2NTEA 1EVLA 1O95D 1W59A 1ODCA 4D4JA 3EC7A 5JZBA 5BNFA 4E22A 1T1IA 2JI4A 2ZUBA 4XX0A 4M0FA 1TQ6A 2OCAA 2CFIA 1KXJA 1VMEA 2VUTA 2IYRA 3PC2A 4U2BA 4AO7A 2DCUA 3O3NB 3KQLA 5CW1A 4FJ0A 3HR8A 4UMDA 2NLOA 4JQSA 2V1XA 3TZCA 3BMNA 1N5MA 2R6ZA 1T8SA 3JPWA 1PFYA 3A1VA 3R6LA 3B7WA 1CU1A 2HA0A 3SK0A 1SB8A 1N5KA 3BWYA 2H1IA 2JDID 9LDBA 5JWRA 1MG5A 2X77A 1MO3A 1XNHA 1DLIA 4UNIA 1WXWA 3IR7A 4US0R 1UPAA 4IYJA 3BT7A 2HHJA 4G5QA 3F9RA 1Y1RA 2GM9A 2X8LA 3N7UA 4UUBA 2PWZA 5FL7A 3O93A 4RZ2A 5TJ9A 1MQAA 1M33A 1HK7A 2GJ8A 3L5OA 4Z4QA 1XU4A 4H4DA 2QM3A 4I1OA 4GG1A 2IGBA 3QU9A 4O2BF 2IP4A 3EEBA 5DLYA 3ZDZB 3MAAC 3L07A 1XJQA 4DZRA 3V4VB 3TAUA 2OC4A 4NZ9A 3C8ZA 1ZUIA 5TB5A 4DLUA 3UV6A 1X1EA 4DMRA 4HDSB 2O4CA 2W6ID 2G1UA 4HKTA 4JT9A 3UHJA 3SC6A 5DHQA 4PRZA 1WOMA 2A1TR 2DWPA 2WIFA 2Z5GA 3WL8A 2WG1A 1C3EA 2O7VA 4V39A 1TXGA 1HSOA 1MVNA 1RKUA 1A77A 3EEFA 2GLXA 4MEJA 4N6GA 3N8KA 4JYBA 1CUJA 4QJ3A 1Y5LA 1M8FA 2J6IA 2ZTSA 2B7BA 1GNRA 1PDOA 2FX3A 3TD6A 1Z0ZA 2PMWB 3VISA 1A9YA 2BHSA 1C0EA 4UUOA 3IJEB 3OPYB 1U5BA 1QS0A 4GBMA 4GLBA 2PEZA 1HV8A 4FZJA 3TSAA 2DXIA 13PKA 3GBSA 5EP4A 2D59A 2C84A 4TMXA 2EEPA 3AR7A 4OL9A 1THMA 2WAOA 3GELA 4HZUA 4CW7A 2DRIA 3KUXA 1N75A 1QONA 3MMZA 4LTNA 5FOXA 4FWIB 4MVJD 2IV3A 4RVSA 3UT5B 1FX1A 1V5EA 3CH6A 2HDWA 1XKQA 4QGGA 4WKNA 4FR2A 1JA0A 3TIGA 5JCXA 2HU8A 3D3EA 4K26A 4N5NA 1I6MA 2OBMA 3IHTA 1GSHA 3MJFA 1QHFA 1BROA 4M7OA 1X94A 3QX8A 1MHTA 3AEUB 4M36A 4JLMA 2HCFA 2GKGA 2OYCA 3UM9A 2GEBA 2HLNA 2UUCB 2FV8A 5EHZA 3PYMA 2EX4A 2NTNA 2FG7C 3FNQA 2RCYA 1H4VB 1ADBA 1KFCB 2VNJA 3ZDAA 1UK9A 3VU9B 4UAVA 4I4CA 1MV5A 4C29A 4OQQA 3DH0A 1KXZA 1J33A 4TM7A 1SCBA 3CGWA 3RRXA 3GPLA 1M34E 3OE7A 4UVIA 1T9GR 3RO7A 4CNBA 4EYGA 3CN9A 2GN0A 2WD9A 4QPZA 2O8DB 2EFDB 4UVDA 3OQIA 1HOTA 3OFNA 1E1KA 2CCJA 4OHBA 4BMYA 5BWNA 1VLHA 3VKUA 3BGWA 3FDXA 1ONPA 2IYZA 3VV3A 3MT8A 1XDWA 4FNOA 4QNMA 4AKEA 4FWTA 4E3WA 3QLUC 3LWBA 4IIBA 1ZJYA 1BX1A 1W19A 1Z6ZA 1AZTA 2INGX 4AY4A 4Z54A 5B4UA 5IT9A 3ADBA 1PR5A 2WYVA 1PEDA 3R6TA 1SVIA 5GZ6A 4C6TA 1X7DA 2CL6X 3ZWWA 2OO3A 2C9MA 3HJTA 4FWBA 4BBPA 2BFWA 2O2JA 1XTSA 5TPWA 2YMLA 1EZ1A 3ZDCA 1D7AA 3OBBA 4QEKA 1PJRA 4HNAA 3GZTB 3WWZA 4A7PA 2HJGA 4DPMA 1T2FA 5INTA 2AOTA 4RF4A 3IXLA 3DV0B 1JXAA 4DDWA 1YMVA 1QFYA 5T7BA 3BDIA 2BDEA 3OM0A 5EHXA 3CVVA 4CIXA 1I5OA 3MW8A 3OIGA 5AW0A 1TK3A 1U8TA 1E1NA 2A4KA 1HDGO 2IFTA 2YVAA 1TUBB 1QOQB 1RXYA 4HF7A 4LVOA 2M6KA 3BG5A 3RIXA 4W5NA 4HNAB 5KSPA 3AQIA 1Q91A 3ETDA 3FOBA 4R1UA 2HU2A 4RFLA 4ZYYA 4G23A 4YUAA 1IATA 4GI2A 2QT9A 3T9AA 4DNPA 2FW7A 2GPBA 1G4AE 2PWYA 3DCYA 1QHNA 3U2QA 2HY7A 1WW3A 1YZTA 5KJ6A 4PSKA 5GJBA 3DC2A 4YFVA 1KAEA 3DYIA 3L82B 4DKJA 5JS2A 1SQ0A 2J5BA 2J9FB 3AZQA 3KSUA 1KQGA 2R7LA 1N7IA 2WJJA 2ZSEA 2E5FA 3RYFA 4WADA 3W8FA 1SWVA 3C1OA 1BS2A 1TL7C 2I1WA 2Y99A 3OZTA 4WAUA 4ZXFA 2HMSA 2N0SA 1JU4A 4PG4A 4F3RA 4RIIA 3ZH2A 1I94B 1GRRA 3CE9A 3VKVA 4IIHA 2V7TA 2QLJA 4X7MA 3SYNA 3ZW7A 3EVZA 4DCUA 2C03A 5LB4A 2QTLA 3E22B 4V2UA 3AKDA 1EVIA 1UEJA 4X66B 2ZIXB 4G0QA 4BJ6A 3M9XA 3PXUA 1Z47A 1AKEA 2IHVA 3A9UA 1TTPB 3GFFA 1P4JA 5JRJA 2BCGY 2QQFA 3VU3A 1V5FA 2YZMA 3WDKA 1UPCA 2DP4E 2P2CA 1C2YA 2QUJA 2VJYA 3DF9A 3LPLA 3R5JA 3T0FA 2IXBA 3T9EA 1HDRA 3RRFA 4GRDA 1B1CA 1SR8A 2A0KA 4XVUA 1WB5A 3NH9A 3S5UA 4D8VA 4BNKA 1PVOA 3C24A 3HUDA 1EG7A 5FADA 1TM1E 4B75A 1E3EA 2X8JB 4YT4A 4E12A 3R9IA 1GT91 3UG7A 2PMFA 4D3YA 1T8UA 4U6SA 2RGRA 3PEYA 3L2OB 3MXTA 1KDTA 1EE9A 4ZYWA 2AEJA 4PC6A 1PZGA 2CLOB 1YQEA 3H3JA 4RK0A 4HS9A 2FP4B 4EL5A 3GQBA 1VBMA 3N0RA 2F43B 4KR0A 4WNIA 3A27A 1RAHA 1CJCA 3H9UA 4D9CA 2BBWA 5T6MA 2A94A 1CY1A 4B7ZA 2F67A 2QTVA 4GL2A 4YXWD 2FW0A 3QX9A 4ALKA 3LVFO 1JL3A 1X3SA 3LC2O 4TRMA 1IXRC 1YI0A 5B7QA 1MJGM 3OZCA 4P08A 1T35A 3IIKA 3JYLA 3B6JA 4V03A 4AZ3B 4O29A 5EJFA 3GLFB 2QRZA 2FKAA 2C2BA 2PZLA 2Q3MA 2O0KA 1QH0A 2RH4A 3DBLB 1YJBA 3IPYA 4IS3A 1O9BA 4IV5A 4EG4A 1NR7A 4YAUA 5JLJA 2L17A 1AKUA 2QL9A 4GR5A 3HCDA 3JWPA 4X0EA 3TLMA 2DFVA 2XODA 1DO0A 2J1LA 5DM70 4QXQA 1TAQA 1YMQA 3N2KA 3PUZA 2J33A 3ABIA 1FYEA 1GZUA 4XQ0A 2YS7A 3PFGA 2XYHA 1B16A 4AZ3A 3SVLA 2BBSA 2W2PA 1UBEA 1HORA 2HJHA 2J9XB 5JAMA 1XLTC 1U81A 2OHVA 2X15A 1POWA 2R8XA 2WJAA 5FFMA 1UCFA 4BS9A 2I4RA 3RC8A 2A58A 5BPFA 3N9IA 4PQEA 4IR7A 1YJ5A 2OGZA 3ROTA 1OILA 4RSRA 5KWJA 3DTVD 1MC5A 5C4GB 3QEJA 2DBYA 2ZSJA 3H5TA 2F48A 1EJ0A 3BTUA 3E9ZA 3EBPA 3NBXX 5EXPA 2GT1A 4A6DA 4NYIQ 5HKBA 4LFBB 5E6SB 1QDEA 3NBKA 2GDZA 1RWBA 2O3JA 1AS2A 2X7JA 1RPTA 3OLZA 4BVGA 4B8WA 2FI1A 1BX0A 1F6WA 1H4TA 2E2WA 4IINA 4RANA 4JZKA 1DJOA 3RE1A 2EEZA 4KX5A 2DB3A 4NWIA 2ZUWA 4OBBA 1OBVA 2G17A 1R0LA 4BP9A 3UZUA 1ZH2A 3WQHA 3KO8A 5FTMA 3NM6B 5AW3A 4EJSA 1U2PA 1XQXA 1MABA 2VJPA 1WDMA 1ECCA 2AMYA 2QEQA 2BFFA 4C7XA 3EFEA 1Q17A 1IVSA 2POQX 1NRXA 1XVTA 4HS4A 1QGOA 1M0TA 3L8FA 3KVYA 5H82A 2Q7XA 3UKJA 4UPEA 5A1TA 1TC2A 4G0YA 3U1TA 5KMGB 3CVWA 3JTMA 3VPCA 2B92A 4BVEA 3KCNA 4FDMA 3ER9A 1H2AS 1MABB 4NKRA 4ZJUA 1XKTA 1SVWA 5E7IA 5HE9A 3USZA 1FPMA 4BYGA 3SHVA 1OTYA 4HQRA 2V7BA 3HJBA 6GPBA 1C4KA 3PXAA 3A6JA 4MIYA 3D2AA 4QFBA 3Q9UA 3GPBA 3H0CA 1ZOLA 2R0QC 1UC4B 3VDMA 3LCJA 4MTLA 1TW2A 4LY9A 221PA 3LLSA 1JTVA 3FPGA 4REMA 4ZREA 5JANA 3UTCA 4JAVC 3EC1A 3NAQA 2YFKA 4WCFC 3RSHA 2VNKA 1E58A 1ZI8A 5HJ5A 4NBTA 1K68A 2AVNA 2GZDA 2QRKA 2ZYIA 3GN2A 4QGHA 1SG9A 5CNMA 1M0EA 5ES3A 4UBIA 3STYA 3WLMA 1HF3A 1LSSA 2GAFA 3AUXA 1JIIA 1R2QA 1M2OA 1Z28A 1F2UA 1F2DA 1V11B 1R8YA 3PG5A 3S40A 1VB3A 1P4AA 5KYYB 5JZ9A 2Q9AA 3A36A 2PBLA 4XA8A 5AKLA 5AJWA 2VXBA 2AFIB 5CA0F 5LBIA 4OQFA 3RUIA 3NLLA 4RVFA 2JC3A 3CBQA 3Q7EA 4YT8A 2G83A 4RQAA 4CMIA 1V5IA 3SHOA 4Z4EA 2VF2A 4EKEA 5CDUA 3T3IA 2LKCA 3DFKA 4F5ZA 5BRAA 4WY5A 4ARIA 3NUQA 1XSEA 3A32A 1XPRA 1MRSA 2EFYA 2LXNA 4OA8A 4PG7A 2IX3A 3A1EA 5HKLA 4MAMA 3JQ7B 3R44A 1UWCA 4CMAA 3IODA 3EMKA 3L7DA 4UUPA 3VR6A 2PLWA 4DIKA 2RI1A 3HTXA 1ZAKA 4REQA 1EFHA 2WUWE 4YT5A 5BSKA 1CZRA 3OA0A 4NQZA 4U8GA 4OB7A 2FG5A 2PH1A 5KUTA 5ADUS 1TMOA 2HPAA 1YAHA 2G0AA 2JGKA 3FBTA 3MC1A 4NPHA 3CLTD 3M5DA 4LJLA 1SQ6A 4A91A 4WHMA 3TZEA 2ZRKA 1ND6A 1AHNA 1AKWA 1D6NA 1HE2A 1L7RA 3MQ4A 3STUA 1Z4MA 5JRZA 5FFNA 2OORC 5J4YA 2PX2A 1GTSA 2XUGA 4EUKA 3ROZA 2DFDA 4D80A 3W5AA 5IC4A 1BGXT 2C20A 2PZ8A 3RNLA 2JFGA 2X0RA 3KU4A 2WOJA 3DE1X 2H00A 4H7IA 4OX9B 3NP9A 4YCDA 3VPHA 4X44A 3CNNA 1K5GA 3ESBA 3SIWA 2H0QA 1VYUA 3A3OA 1Q2UA 3WGKA 3AXSA 3ZXIA 1E9RA 5HBGA 5IJ9B 1V1MA 1IN1A 1XTZA 4F9GA 2JCBA 1Z4OA 1EP3B 2PD6A 3ZIUA 1BVHA 1Q6YA 1M7HA 5J23A 2E48A 4IHAA 4AMUA 4YRZA 1RACA 1UADA 3U48A 1OWOA 3CEHA 3VDNB 3LVQE 5F1YA 5TC4A 1RFLA 3AB3A 3JQ8B 3DZCA 3KG2A 2A35A 3IILA 4LRTB 3K4HA 4X3CA 1BA3A 1VGQA 3TO5A 2QYTA 5JSUA 4F60A 3PGXA 4PWZA 5HIIA 2YOFA 3HJHA 2CLSA 1KJIA 1LBQA 2GK6A 2GZRA 2ZQ5A 1P5HA 2P9GA 4WY2A 1TKCA 2QL7A 5LDGA 3IJRA 1UKYA 4IQ8A 4M9XA 1J8YF 1YRQA 4NCBA 3N2LA 1THTA 2BEUB 4LDZA 1QP8A 4A8HA 2IOFA 3JQ8A 1ZSVA 2I91A 3VNVA 1GP2A 1GQFA 2VUSA 3BEOA 4H0NA 4RMJA 4O2AB 3U7HB 2HLHA 2JAPA 3BS4A 3DWEX 1G17A 3P2JA 3QMMA 2D2FA 4LJYA 3TGWA 3WL6A 4E2ZA 4ZC1A 4CQLA 4OUDB 5I48A 1NURA 2VRCA 5F7OA 4TLMB 1G3RA 1NVFA 3DAOA 3IL2A 2W2LA 3KEMA 2BGLA 1TT7A 1V37A 5E3JA 1NLYA 3U4GA 5AVXA 1Q7BA 1WX1A 2HCBA 4EG7A 3B51X 4F71A 4A26A 1R0RE 4CLOA 1EFPB 3IQIX 4FB4A 3RSLA 4O2AA 5A0VA 1QAOA 1GEEA 2BGGA 3DLAA 4QYSA 4PGFA 1U0SY 1Z4IA 2PMCA 4IO0A 3Q41A 5TQ2B 3KVNA 2PRKA 4ILKA 2BUAA 5DJ5A 3FMFA 5HHTA 1KI4A 1WV0A 1T2AA 5TLSA 4JC4A 3EFOA 2D2XA 3HDJA 3KLPX 3R8FA 1NBHA 3CX6A 4EQZA 4U0KA 4FJ2A 4AMZA 1G7RA 3I2HA 3ESYA 9ATCA 5ICEA 4L4UA 2W8BA 1Z0AA 1X1DA 1D6MA 5L7WA 1N6HA 1U90A 3O8DA 4J0GA 2C9YA 5KNCH 2DSNA 3HY6A 3MWEB 4MVJI 3VR2D 5FDFA 1CDZA 4N41A 4G36A 4Z4GA 1DT5A 3GVXA 3MFYA 4LXQA 1Y7LA 5CIQA 1UBSB 2IW1A 1YTUA 1VDZA 3OOSA 1WUKS 4ZAYA 3R5SA 4INAA 3EG5A 3M3DA 1ESZA 4I55F 4N48A 4GU5A 1RMTA 1H2HA 3TD2A 3AF4A 1PJTA 4UEWA 1MGPA 4LRWA 1GCUA 3O2SB 3SYLA 2OB1A 2VT3A 1TCBA 1L3BA 2R8YA 2VT6A 3H5AA 4HB0A 5F78A 3F1LA 1X7YB 4IDOA 2QZJA 4C0JA 4WKGA 1AQUA 4E33A 3QUQA 1RAGA 1YZVA 4E31A 3UWDA 4G07A 3QUBA 4EO7A 3Q0TA 1WZEA 2ZUDA 4L5JA 1W6UA 2ALJA 2HJWA 1BVYF 3ABQB 2W90A 2P9JA 4XIYA 1U3CA 5JE8A 4NL4H 3OP4A 5C1IA 5HR5A 3AERB 3GLHB 5IEBA 1AVTA 3AILA 4CMBA 1WXHA 2V74B 3AHDA 3DEAA 4PZAA 4RJLA 3DYVA 1KVUA 1QFZA 4HYQA 1FTGA 2PZGA 4OMUA 4J7CA 4PGAA 5HMMA 4LMPA 3C6XA 2OB2A 3JAMA 3UUFA 2VRBA 1EG2A 3I4LA 4Q24A 3G2PA 1CQPA 2NUPA 5AVKA 5AI6A 1LPNA 2RBKA 1W88B 4LRSB 3I9JA 3BOSA 2LUOA 4OYRA 2ZREA 1YASA 3GOHA 5F21A 3S2FA 2QMYA 3TOCA 5C8YB 2J4FA 1DRJA 2XVAA 3CCCA 3GB9A 3HUUA 3UXEA 5IDXA 3AINA 3QGMA 1K66A 1OBFO 3GC6A 1LJLA 4QTTB 2IBSA 2UYCA 5M2QA 8GPBA 1YFZA 4JJ7A 1H22A 1UXOA 1EGMB 2A5LA 1Z13A 5F1KA 5A7HA 3H8WA 1T4CA 5F3DA 1IBRA 2MR5A 5CU7A 4Q03A 5ADWA 2GHRA 3KSAC 2H1SA 4RADA 3KXKA 3UJ6A 3DPSA 3BIFA 1MENA 4HZIA 4KITB 3WP0A 1KI6A 3IR6A 4Y1FA 1T36A 4P5DA 5LLSA 1OJLA 2J3EA 2AD1A 1V9LA 4XOUA 3HMKA 4HEA6 3RS2A 4DKXA 1UWLA 3I42A 1CJBA 2EXXA 4WCFA 1DRUA 1SCUB 1SWWA 5H81A 3EIUA 3JZMA 1AB6A 2B6HA 2PHZA 3I45A 2R00C 4BQNA 1HQCA 3UMJA 2AXNA 3ZNPA 3B9BA 1T2EA 1QAQA 1GNQA 2VJAA 3EVFA 5EXXA 1GAEO 1WUJS 1G2IA 3PFHA 4J0CA 4JXJA 3PPYA 4NAVA 4OHVA 4UU8A 1UJ5A 1JH8A 3HXLA 4PLCA 2BLLA 1WD7A 4NPAA 4KMOA 4IL5A 2BISA 3ICEA 1JDBC 1EFVA 2Q4RA 4AFNA 2CFRA 4D4MA 1KO5A 2BBOA 5HUHA 2D5IA 2R60A 4X54A 3WGZA 3ZWYA 3JW8A 1BCRB 1M8JA 1Z0JA 2OILA 4YLGA 2WF8A 3ZHTA 3CONA 3ZHSA 1A5BB 3QLTA 2QMOA 1FLNA 4BKPA 4YRJA 4H18A 5KTTA 1D4OA 1H42A 3KYDB 3LUKA 5HEKA 3RVOA 3ZS8A 2HQRA 3G02A 3ZD7A 5LBUA 3B1XA 5TPZA 4J6EA 4DNXA 2J0UA 4JENA 2XUZA 1RKQA 1JG1A 5JVDF 1X2EA 3AI3A 1ZN2A 3VAYA 4G4SO 5LQRA 3B6KA 1QGAA 1TZBA 1USUA 2XUIA 1POXA 1QBKC 3FPFA 1X14A 4OGWA 4I3HA 2ECQA 4FT4A 3UOGA 4XVCA 3NWEA 4YCCA 1F4PA 1UQTA 2KM1A 3OTQA 2AN9A 3R3XA 5CB4F 1I80A 4BTLA 5L40A 2WEKA 4H6XA 3SBEA 3IAM6 5GTDA 3L4JA 1VJ5A 2JFBA 3RS0A 4WA7A 3OTHA 2J0UB 4UPDA 3UXYA 4MDHA 3VQTA 4BMDA 4IJQA 4Y2GA 4Z7NB 4KR3A 1G2PA 2VHXA 4RIGA 4QGSA 1N0IA 2WILA 3AX6A 5AJUA 3KL4A 4IVNA 5JI2E 2O57A 4MMYB 3OTIA 3RSZA 4BUCA 4Q7KA 4LXTA 1RWVA 1U2EA 1TK2A 1RYYA 2HUNA 2MSCB 4G0OA 5I9MA 2CDBA 3AGQA 3V1UA 5HJ2A 1K63A 1R0YA 3T1TA 1SNYA 2H3EA 4MRNA 5IP5A 5JY6A 5DGCA 3CW9A 2HNAA 3UO8B 4Q1DA 4CWAA 1ZA2A 2C98A 1A5SB 5FPTA 1N7HA 4ZVOA 5JAQA 5ALIA 1K89A 2DBRA 4PXYA 5TMDA 4C0QC 3FTPA 5LDDC 1MN6A 1KRWA 2RHRA 1H2EA 1ATIA 2EQBA 1VE5A 2UZ1A 3FPSA 4FI3C 4K9NA 4QBIA 4QXOA 2FLWA 3Q5GA 4BC1A 4EPRA 4JV5B 4FFMA 4BKMA 3ORYA 4ND8A 3M0EA 4FYPA 1OX4B 2VDOB 4HCJA 2OE2A 4NZPA 2PGXA 1P2TA 3CPEA 4GI1A 4XD2A 3TMYA 2QZSA 4J0DA 3PBKA 4PCVA 5DTMA 2FZ5A 1UPXA 1Q0ZA 3OM1A 1NQWA 2FWJA 3G68A 4QOGA 3M7IA 2UZ1B 4CI9A 2GF0A 3VZSA 2G8LA 5JR3A 3RRBA 2ICAA 3PJRA 1DIGA 3VZPA 5E1OA 2V0CA 4JBIA 1QXSA 1EB8A 3VYUB 1HDIA 2ZITA 4ZV9A 1UP6A 5TNXA 2GXAA 4DZZA 3W05A 1P2FA 1X1QA 3LECA 4AYWA 3F4KA 4WDQA 2ZFUA 3K4PA 3T1HB 4EG1A 2EBFX 3IVCA 3CEJA 1ECJA 2VYND 2ZM5A 1BU8A 3GIWA 3KP1A 2WM8A 4DIUA 4E21A 1E0SA 2QA5A 4LJ4A 2IEAA 5A3RA 3O38A 3SXPA 1W6RA 3DWGA 2M6SA 4ZOBA 2DUUA 4UCWA 1ZEJA 3TSWA 4BB6A 4JROA 1ZOIA 4JP2A 4BFCA 5C37A 3AO0B 2Y1OA 3P2EA 3USCS 3K8YA 1VL2A 1TX4B 3HRHA 4OXKA 4WY8A 2COUA 2H4XA 2PX3A 2FMFA 3RHSA 3PT9A 4MUGA 1TUGA 1PQWA 4ESVA 3H4TA 1FPQA 1GTL1 4FW9A 4UHCA 4GXNA 1A0OA 3JWGA 2ZUFA 3FSJX 1IUNA 4NE2A 5AVQA 4QFCA 4EYQA 3C6BA 1X70A 3H87A 1LI7A 2PQMA 1QJCA 3TOZA 3HYRA 5DBHX 2ZI5A 5JDIA 1RJ9A 3QKSA 1V9CA 4XYGA 1KSGA 2B78A 2HLDA 3GLIE 4EAAA 1PNTA 3I53A 3LHDA 3OKFA 2ZBFA 4JLVA 1Z6GA 1ESEA 2AK3A 4RXUA 3V8QA 1LA2A 3LI2A 4B7AA 4H3HB 5AOAA 3WLKX 5L3QB 4CQMA 4B6EA 5EIXA 2H4WA 1IOWA 4FX5A 3HQ4O 2EFGA 4GZLA 2HH9A 4ALLA 5CDYA 1B14A 2K6GA 1G38A 3MIZA 4FGZA 2DG2A 2WIBA 3GIDA 2HA7A 2JNWA 3DQQA 4XOIA 4I4LA 4LOLA 3BA6A 3OM8A 4BP3A 3FNEA 2CSXA 3U7QB 2R6CA 3VV2A 2IYPA 3E3OA 1I3CA 2VFAA 2P3OA 1K5HA 4LN1A 2X9VA 3PCTA 4B80A 1B2LA 3U80A 3VNRA 4ARBA 4AULA 2Q9UA 4PYKA 1WCV1 3AEUA 5I45A 5ITZA 3M3PA 2QSJA 1II8B 3ZDQA 2R3SA 3AEYA 1HG1A 1LSUA 2VDKB 4RD3A 1YV9A 1JG7A 2JANA 5T4BA 1L4KA 3ZJ4A 4KMSA 3U7QA 3ETHA 3KEFA 2Q99A 3QMWA 4OX9Y 2O1SA 2PV0A 3A25A 2H1WA 2JF0A 5TR9A 3VHRA 2JGIA 1LI4A 4QJIA 5K2MA 3CF4G 4QOEA 1CTQA 3JY6A 3ZZMA 3QE0A 4WNYA 1EJ6A 4UBLA 3JZAA 2C7VA 3BTSA 3BXHA 4ZVUA 3QWHA 3RS8A 1G21E 2Y1KA 1MH9A 4KIFA 1Q84A 4G5SA 2P0AA 1N2XA 3EVEA 4EBBA 4BHTA 2ZRHA 1FTYA 3LX5A 4Z9BA 1DOAA 2OGTA 1GGHA 4WJKB 2X2FA 3U26A 2O5RA 1QIHA 4X9XA 5JUWA 4NFHA 3NVKI 1PP4A 1U2SA 4TWBA 3AJRA 4EMSA 4N18A 2PDAA 4JYCA 5A7FA 4EF5A 1B8UA 1Z12A 1YR2A 2F1OA 5DXFA 3Q8KA 2AUMA 5D8DA 5HMLA 2G04A 5K0BA 2JAXA 4HTAA 1EGAA 1Y6JA 3I52A 5DYGA 3DDUA 2ZS7A 1YOVB 3E7PA 5TMBA 1NN0A 1BWPA 1FC0A 3BJEA 3C74A 4K9SA 1EXNA 5TGZA 1N77A 2IC5A 1UWVA 2GZ1A 3SHWA 5DMXA 4CIVA 3OZGA 1T4BA 1J1IA 1U3VA 2O52A 1E1QD 1K3TA 4EA8A 4AY2A 1LQ2A 5FOTA 5GM2A 1YFLA 3EG9B 3BHIA 2JJMA 1MG0A 1J8MF 3QLEA 4CG3A 3G1TA 2QZPA 1B8VA 3FAKA 3TD9A 4TMTA 1ACLA 4WNAA 1PQPA 1PQUA 2OOSA 3NYRA 2PCLA 4DCPA 2R8RA 3ZJYA 3IQEA 3JR3A 5CW2A 4YV1A 4PE5B 1NA5A 2CLEB 2REOA 2B2NA 2P2LA 5BOVA 1F3LA 4GMGA 4IIGA 4JI0B 3QY0A 1KZHA 2B8JA 2O2ZA 3DFZA 1RVDA 4RS3A 1LDEA 3TKYA 1EB9A 3FM9A 4D5GA 3DHWC 4O5AA 3P9IA 5TS3A 3QNWA 1KIMA 1MJ5A 2C5HA 2QN9A 3GPIA 4KN8A 1J00A 5C0OE 1HRDA 4QBKA 3NT4A 3HO1A 3U4CA 1J0CA 3W8NA 4TV8A 1ONBA 1NG1A 3HKDB 2C92A 3LKVA 4WUTA 1FE8A 2XUKA 1F4LA 2FGKA 3SX2A 3ROFA 1ZNXA 2H2HA 1EBBA 1ECBA 2CHEA 2QE7D 3DOUA 1Z0UA 3E8XA 4II2A 1JA1A 1O08A 2GRJA 3LL4A 4WMLA 3OETA 4H6PA 2M6LA 4BLVA 2OQVA 4C04A 2PUJA 2NYRA 4ECAA 3H5IA 4MKZA 3Q3EA 5DRYA 5KSWB 1USVA 2QBYB 2OHIA 2PPVA 3K32A 4WN9B 1SXHA 1R6BX 4HNTA 3R7DA 5JYBA 3H42B 4DAEA 2IZ1A 1FFAA 4BB5A 5ENZA 4LHWA 4H6WA 1R15A 3ZCTA 3KR9A 5FUVA 1ARZA 1BZYA 1KEEA 2X41A 3DZJA 4H1WA 2FUNB 2A3NA 3PENA 2O8BB 1SIBE 4HG2A 3W79A 4X92A 4JLWA 2EZ8A 3GCWA 4ENWA 4BE7B 4MUIA 2O8CB 2BUCA 2LTAA 3HUTA 2GWRA 1H0RA 1HYEA 3UJAA 3OO0A 4PR3A 4Y2TA 1OAOC 3EA4A 5I9BA 2NUTB 1ZRSA 3TH5A 3EXG2 1W25A 4UREA 5CX4A 1GQSA 4NDNE 2EP8A 1BDHA 2JFHA 1PT7A 3GJ5A 4X7BA 1ZGHA 4L15A 4OK3A 4JQYA 3UATA 2XXAB 1ZMOA 5I3ZA 3HO8A 4FYXA 3QVJA 4M1EA 4HWSA 4IDAA 1B8NA 3EXHB 1MORA 3HA2A 1Y8RB 5ALLA 3ZE9A 4N7RA 1SOAA 3PVCA 2ORWA 5KU7A 2DKNA 3RS5A 3LKBA 1S0UA 1PKEA 2GD1O 4L72A 2HMVA 1ZL2A 2JLVA 1IBMB 4MYDA 4G1MB 2KS6A 3PQ2A 1N9ZA 1ZNYA 1WXGA 5HSGA 4TTVA 5IASA 2PG3A 4ZMSA 5HGJA 3DP9A 2Q21A 4U7HA 3OE7D 1Z0IA 4RJ2A 1ISMA 2HSZA 3RJ9A 4OIMA 4PX5A 4CRWB 1KS9A 1OLOA 3HNOA 1RP7A 4PPNA 4F8YA 3QVGB 1DBPA 4LNHA 4X8OA 2YW2A 2FN4A 2YICA 3NWPA 5JNSA 3P32A 2DGDA 4B81A 1JEEA 1ZRHA 5KNBD 4IHJF 3W5IA 3ZQ4A 2N9UA 1EP1B 1QQ7A 3K70B 2QHXA 5J59A 3LCVB 1A95A 4TZKA 1LRLA 3KWLA 4ZFNA 4B2YA 1QZTA 2DFPA 2VVTA 3I6ZA 2FVYA 1G8FA 4CV1A 4JLSA 1Z5UA 1NMZA 1US8B 2GM5A 4Y8VA 1TMGE 2AHOA 1N2CB 3GRRA 3ZY3A 2XCQA 3ZXSA 4UEKA 3W5JA 5BSEA 2FWNA 3TGLA 1G0NA 1LNSA 4BLOA 4RVDA 5JC1A 3EWIA 5F1OA 3UMVA 3MJRA 1LRKA 3P4XA 4A23A 4ADSG 1IPFA 1TAHA 4Q9LA 2Q46A 1MB3A 5EIOA 4XPZA 4YDSA 3W2IA 1N6PA 1GAWA 2PKQO 1IJBA 4H35A 1NW8A 4NDAA 4EIWA 3NASA 1RJGA 2XDAA 4LJSA 1UBKS 1T25A 2FW9A 2WC1A 5JSZA 1JHXA 1XYGA 5I7VA 3UOWA 1ULTA 1CIVA 2WU4A 3HL4A 1MIOB 5B30A 5BURA 1Z35A 1QZUA 1A5TA 1BXGB 1QHHB 2O23A 3NHYA 3U17A 4A27A 3ZDBA 1O94D 3VSAA 2ZUCA 1L8AA 4AAYA 5AW1A 5T64A 4Q4JA 1O95A 1SZCA 3K5HA 4JKIA 3IRVA 1JMVA 2QLTA 1R0CA 2QS9A 3F2VA 5JSZB 1L6IA 3AR2A 4RTNA 1VFNA 5KKAA 4LZNA 4R6WA 4YIKA 2WT8A 5A4KA 3WAGA 4JIMA 1KI1A 4F1JA 2WQ7A 2GPYA 4LV6A 2CCKA 1XZEA 2JD1A 5B1SA 4MIEA 3MTEA 3RAJA 2GPWA 3PITA 4W9NC 3FXAA 4DCJA 4EITA 2JLUA 3WJAA 1ZJJA 1KARA 1AIPA 2JFZA 5A2GA 2WJIA 1KVSA 1P0PA 3TR0A 2DLCX 3W4JA 4P4SA 2RKBA 5B58C 2BHTA 2LV8A 2ZOSA 3RFXA 1TEXA 5F51A 1P4HA 3BWDD 1P75A 3OD1A 4E11A 1Z6AA 3OPXA 4I4TB 4JVSB 4Z1MD 4FLMA 4KVGA 3GGPA 3RC2A 1NFQA 3KWJA 4ZQCB 4CM9D 3WWEA 3KOWA 1JIXA 1SVOA 2ID7A 1GAJA 3SLKA 1P8AA 1DSSG 5MF6A 5JNWA 5FOUA 5M34A 3DDCA 1HURA 2RGAA 4YJ2B 4DBZA 2EKBA 3RYTC 3BL6A 3GHHA 1PEYA 2HMWA 3SJAA 5BR1A 1J8VA 4FIZA 3IKVA 1CNMA 2DUNA 4GKAA 5P21A 3MSXA 1ZWKA 4BCDA 4Y1RB 3T3HA 1IZ7A 5LBTA 4MV6A 3CRVA 5IM4A 2Q4EA 1QH8A 3BE8A 4M9UA 3QXXA 1NWHA 3IAAA 1U2DA 2CJYA 1K7YA 4GO1A 2ZE5A 1ZUWA 1HE8B 3PI7A 4HDNA 4HDRB 3AOEC 4TSFD 2CBZA 1NN1A 5JS1A 2ZYAA 3VRHA 2BAGA 1HEIA 1A4XA 3BMCA 3VSCA 5FR1A 5KHAA 3FF1A 4XR4A 4K9LA 3Q7PA 3BEDA 2AI3A 4KYTA 4RK6A 2M98A 4ROTA 1VE7A 1H5NA 1OV6A 1XLUA 2BZ1A 3H9QA 3A4LA 3RFVA 3FHLA 1AT1A 1IDOA 3GW8A 2QVGA 4CEIA 3SNKA 2Q8PA 1WE2A 2ERYA 1SZDA 2BM8A 2QT0A 4FKMA 4PTLA 3SC3A 4O1HA 4GLFA 4J29A 5FI3A 4B85A 5GOZA 4RKRA 1E2DA 4XTRA 2EJVA 4CN9A 3OC6A 4UBMA 5BV0A 1EFAA 1XA3A 2C3MA 2ZYGA 3E9RA 5TMEA 4BTEA 1JLLA 1GYRA 2XX3A 3NTXA 3RC1A 4RVNA 5CHYA 4EVSA 3IPLA 2AOUA 3UK6A 5KSOA 3W5BA 4F56A 2XUAA 3O92A 2OYSA 3G5MA 4DV6B 3R9XA 1DGQA 3TE7A 4BPBA 4MQLA 3U19A 2ONJA 1TM7E 3OWOA 2GA8A 1ISPA 3G0OA 1DKQA 1K9VF 2GESA 1UT6A 2R25B 3HJCA 3CVOA 3IULA 1YOBA 4P54A 3KZXA 5JDIC 4GI5A 3OQHA 1CUIA 4PYQA 1BHO1 5ILQA 1CKEA 2Q28A 3A3KA 2RH9B 3OEHD 4CKCA 4DC0A 3L4BC 1TLLA 4C20A 4S1OA 4ENTA 3GGSA 2Q2OA 3B78A 4L3WA 5LYYA 4BFWA 5I9LA 4YI5A 1EHCA 4CQLB 1CS4C 3OQOA 2Q62A 4HBZA 2WB4A 4KBFA 2CMFA 1B8PA 1GAXA 2DBZA 1S9HA 1H2BA 1W5FA 5DYYA 3F78A 3IHKA 2PUAA 4AS2A 1LVUA 4UTPA 4IGKA 5KYNA 1ZD5A 3VR4H 1PFUA 1TYZA 4HVTA 1GT6A 2XKAA 1OBOA 1UJ6A 4F04A 1EK6A 1WZUA 3JATA 4PY2A 1DAEA 2V7UA 3QJYA 1HMPA 3Q3HA 5FORA 4OVKA 2DWCA 5CBPB 5HJEA 2BTOA 4B76A 1ANKA 3GRKA 1YJXA 2R6AA 3AIOA 7ADHA 3FDJA 5IBRA 3ROEA 4CDRA 5FBHA 1CY7A 2XQKA 1C3OA 2X2OA 2XJ9A 1N0UA 1V0JA 2HMAA 4GF5A 4DIDA 4C7BA 3GUVA 1TQ8A 3V1TC 2HSGA 1B8OA 1TYAE 2HO5A 1UDWA 5LCXA 5AVUA 1XRPA 1GZSA 4V0KA 2QVZX 1CIPA 1E2QA 1UC5B 2IXEA 2ZJ0A 4UDYX 1NE7A 3W5CA 1RJDA 3GZJA 4N0QA 1EVEA 1H93A 2AG6A 4Q34A 5IYZB 1MGOA 4M3NA 1U7ZA 4LMRA 5E95A 1RRCA 4LNUB 2IHJA 4W9RA 2OZKA 4HV4A 2HUPA 1STOA 2HPZA 3VHLB 2AJCA 4HGYA 2Y2UA 2BWJA 1FS4A 4QKQA 1XRQA 2D4AA 3SF8A 4US2R 3AH8A 2IXFA 4N3GA 4TOIA 2RHMA 3WIDA 1UAAA 2JLRA 3O0TA 1N2ZA 5E7JA 1XDDA 1I14A 2NZ2A 2ON6A 1QR6A 3WYBA 4DLVA 3H5WA 1T3LA 5EIWA 3RM3A 2GLTA 5LA6A 4AXXA 1TA4A 3UH1A 5B2EA 4KIJA 4ZO8A 1XDBA 2YYZA 4PZDA 1HC7A 1JH9A 2WSMA 4GWLA 3A3NA 1WW8A 3BF8A 3VXKA 1UDXA 2XCOA 3KKQA 3SP1A 4GL4A 4MH0R 3AF5A 4G37A 1JTFA 3F5FA 1NUTA 1PHPA 2MYNA 4TMYA 5BWBA 2J3HA 1F20A 4D4LA 2EDCA 1TAUA 2G1AA 5U4QA 3CR7A 3AFHA 2FFHA 4IFTA 5HS6A 3ZNNA 4MXDA