3DYBA

Proteinase k- digalacturonic acid complex
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Proteinase K
publication title High-resolution structure of proteinase K cocrystallized with digalacturonic acid.
pubmed doi rcsb
total genus 104
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3dybA00
3DE0X 4WOCA 4DZTA 3DE3X 1LW6E 1YJCA 3SQOA 1EGQA 3LPAA 3GT3A 1Y4AE 2X8JB 1GTL1 1IAVA 2SNIE 1TO2E 5FAXA 2QTWB 1VSBA 2DP4E 3VV3A 5AVKA 2B6NA 3QFHA 1DUIA 3TI7A 3DE7X 1TM7E 3A3NA 1WVMA 3PRKE 1SBNE 4CFYA 2WV7A 2PRKA 4NMXB 1BE8A 1SBCA 4NE9A 5FFNA 3DDZX 1GNSA 3EIFA 3GT4A 4KB5A 3EDYA 3BGOS 1WSDA 1P7VA 1KDVA 5JXGA 2ID8A 4I0WB 5I9SA 1SIBE 5B1EA 3HJRA 3LPDA 4MZDA 3D43A 3DYBA 5CW1A 3VYVA 5K7SA 4ZOQI 1TK2A 5AMXA 3DW3X 1BE6A 1YU6A 3DVRX 4H6VA 1SCAA 3D9QX 2HPZA 3WQBA 2Z2YA 3LXUX 1GTJ1 1SELA 2IY9A 4LVOA 3Q5GA 1SUBA 4JP8A 1CNMA 2Z2XA 1TM3E 4Z2AA 3DVQX 5B1DA 1TM4E 4WOBA 1Y34E 2IXTA 1SUCA 4CFZA 4ZARA 5SICE 1GCIA 1WMEA 1THMA 1KDYA 3VHQA 1V6CA 3WIVA 1SH7A 1TO1E 3QMPA 1SVNA 2W2NA 2ZWOA 1C9NA 1BH6A 1SUAA 1BFKA 1OYOA 1SCBA 5AVJA 1GA1A 1GA6A 3VV2A 2PYZA 1OT5A 1V5IA 1SBIA 3F7MA 3TECE 2PMWB 2P4EA 2E1PA 3GCWA 1NDQA 1S2NA 2SICE 2Z56A 1JEAA 1AF4A 1CSEE 2PWBA 1AV7A 1Y4DE 3AJ8A 2ID4A 3I37X 2Z30A 4FONA 1XF1A 4AKTA 1GA4A 4HVLA 4H6XA 4NE7A 3A3OA 4OMCA 1YJAA 1PTKA 4H6WA 1C9JA 1R6VA 1SCDA 3ZXYA 1AQNA 1WMFA 1Y3DE 3PTLA 1ZVJA 1Y1KE 1SBTA 2WUWE 4C3UA 4J94A 1SCJA 3L1KA 1TMGE 1DBIA 3Q40A 3BPSA 2TECE 4LVNA 5FBZA 5JMOA 4DJ5X 3VSBA 3CO0S 5JXJA 3ZXXA 1AH2A 4OV6B 1EA7A 1SIUA 1BFUA 2SBTA 1C9MA 1T1EA 2SECE 3DE4X 2PQ2A 3F7OA 4KPGA 5ARBA 1P7WA 1ST2A 1GNVA 3DE5X 2DQKA 1C3LA 1AK9A 2Z2ZA 1Y48E 2XTJA 1T1IA 2PWAA 1OYVA 2Z57A 1R0RE 1GTG1 5JXIA 1S02A 4AKSA 1SUPA 1SPBS 3UNXA 1BJRE 1PFGA 3I34X 4CG0A 4B5LA 3CNQS 3A3PA 4KG7A 3I2YX 2W2MA 3LPCA 3P5BA 1NLUA 1YJBA 1KE2A 4BWGA 4RYDA 1P8JA 1AVTA 1MEEA 2PKCA 5AQEA 1KE1A 1WMDA 1T1GA 1IC6A 1KDZA 4DWWA 1PJ8A 2GKOA 5ARDA 1NDUA 1SUDA 2WWTA 3BX1A 3DE1X 1A2QA 4GI3A 5JXHA 1UBNA 3DE2X 1MPTA 2XRMA 2W2QA 3AJ9A 3T41A 4YN3A 4C3VA 2WUVA 1SCNE 1Y33E 3TI9A 3DW1X 3EE6A 1Y3FE 3H42B 1TECE 2W2PA 2Z58A 1SUEA 4K8RB 1SIOA 3QTLA 3OSZA 2W2OA 4HX2A 1R64A 3AFGA 2X8JA 3I30X 2G4VA 1ZVKA 5ARCA 4OMDA 1Q5PA 3DVSX 3DE6X 3DWEX 1SN7A 3VTAA 1Y9ZA 1GT91 2DUJA 3GCXA 3SICE 4M1ZA 1HT3A 1PEKE 1Y3BE 1TM1E 3F49S 2ZRQA 3WHIA 1AU9A 1ST3A 2ZWPA 2V8BA 1S01A 2HD4A 3WIUA 1TM5E 1SBHA 1Y3CE 2ST1A
chains in the Genus database with same CATH superfamily
1N2EA 2JAUA 3UQZA 2IL1A 3DE3X 2W2XA 3CH7A 8LDHA 1L1EA 3H99A 1G55A 1RHMA 3IDSA 3P2KA 1CQWA 1T0UA 2WK1A 2A86A 2ZSBA 2ZWIA 2UV8A 2OBYA 3FZQA 3HEMA 4IUBS 5K3AA 1CV2A 4OO3A 3HXTA 3SC4A 3RYCA 3A32A 2WQ6A 2C3PA 2X22A 3OMLA 3D6VA 1EGQA 4RV9A 1PV1A 3QKWA 2B8WA 1PCXA 1CEXA 2HRCA 3W77A 1T10A 4E11A 7ADHA 4LSGA 3H0CA 5I7VA 2GZ2A 1R8JA 4ZHQF 4O33A 3NDBB 3TBHA 4GKBA 1KBOA 1Y5LA 1YB6A 4WGGA 3ZD8A 2FPPB 3CLRC 3Q9SA 1BCSB 3M4XA 1YZGA 3A1CA 2VRBA 1YTLA 3C0KA 1XQWA 4C4OA 2ZFUA 3RNOA 1P2VA 2PVSA 3W2FA 1UL1X 2K2QB 4DRXB 1BAPA 5JI2E 2IEBA 4ZGWA 1M66A 5CXQA 4GOXA 2DP4E 1I32A 3U61B 2ZQYA 1XJ0A 2JGDB 1Z6GA 4Z4CA 4C4SA 3KDSE 3DD5A 4JGBA 1XGKA 5HKLA 4CR6A 1JQ3A 1D1SA 4AO8A 2QLJA 3HJGA 2WR8A 4GUDA 3WRXC 2HI0A 3LX4A 3ZYZA 4CCSA 4KUGA 2NIPA 1UKBA 1ZL2A 3ICCA 3MOSA 3SIRA 3PTZA 1K7CA 4EFNA 4XI9A 4YV1A 1TYDE 4KHPB 4FSXA 1ITZA 2N42A 4MP3A 3ZHXA 3B13B 4MJ7A 3PJRA 1EK0A 1QU2A 1OUMA 5EHIA 3E9RA 2OBMA 3CXRA 1H8HA 4GGPA 2EZ8A 2IXEA 5JAQA 4AG3A 2VHVA 3H9CA 1U2GA 1UKVY 2O8VA 4HWGA 4QGGA 3O82A 3NDJA 5AHWA 5ALJA 4JLVA 4NE9A 1I3CA 3OICA 3QQ5A 2HCRA 4FGLA 4HATA 2Q3EA 5IH7A 2P3LA 2P1RA 4CFSA 4Y1EA 2J3JA 4R8RA 1ZVMA 2AG6A 3S2FA 3TTYA 3EDYA 2FUCA 2QLTA 4IGIA 5EWJB 3S8MA 5KB3A 3BGOS 3GRPA 1LV8A 1UFQA 4FEGA 5TQ0A 4B31A 5CT6A 1OV4A 1Y5NA 1VLVA 1PWZA 4D0RA 4BNWA 3QLVA 2I7TA 4L6IA 4WNAB 2NO0A 4BFCA 2G1AA 4MVJD 1V3UA 3NDIA 1AG9A 4NBTA 3WGQA 1C1XB 3U26A 2GNPA 1AGYA 5B1EA 4AC9A 4OX9Y 3FPHA 1NE7A 5SV2A 1C7ZA 3EWSA 4TTIA 3WNBA 4G36A 3RODA 3KPWA 4J3NA 2CFRA 4PTYA 4AKGA 5BSVA 3GAZA 2GXSA 1OA1A 2BSAA 3OZVA 1NVWQ 2NUTA 2O8BB 1JSLA 1E18A 2FSVC 1NJGA 2FP4A 3VZCA 5KAMA 4OCZA 1WZEA 3PHIA 4RK5A 1RHKA 1TK2A 1Z16A 2ZB8A 4YR7A 1ZIXA 4DJFC 1JIUA 3QMVA 2QLBA 2CMKA 2Q4DA 4F3KA 3FFBA 1KAQA 2A0XA 2YYYA 2XMCA 4LJLA 4DYHA 5FH9A 1P0PA 2MOKA 4ZJUA 5DJ5A 1DFGA 4G1CA 2YIVX 4PXYA 3M4NA 4QUKA 5CLGA 3A1EA 4RADA 3KJQA 2BCGY 3GQBA 2GKSA 1RRCA 1VP3A 3T1VA 1T43A 3OX1A 1ZD5A 3CQ9A 5IXJA 3I2GA 5ELMA 1H2XA 1THTA 1U98A 2HDHA 4K3UA 3BXOA 2DQ4A 4BX8A 3OIDA 4ZO7A 3VR5H 5EE3A 2SHKA 2G88A 2PH3A 4L8YA 4PGGA 3UH0A 1QIDA 1ZQ1A 2J48A 1SOWA 3DEJA 3K5IA 4Y0AA 5FUYA 4E14A 3H6HA 1F8GA 4XD7A 1SHZA 2TMYA 4I66A 1SZJG 5JRZA 4EUHA 3IODA 1ULAA 2IS1A 3W1VA 4AZ0A 1JJ7A 2YWEA 3EHEA 4MVCA 1Y6ZA 1FXSA 4NVRA 4I5GA 3TIIA 2CE7A 3E4CA 3GJQA 1NVBA 1NXVA 2Z2XA 4MVXA 3U9LA 4LJ5A 2AUMA 4V0MA 1JE0A 1DIHA 3ASYA 3BVPA 2ZOSA 2P41A 3FYSA 5IBPA 5BN5B 1RXWA 1SXQA 5JSFA 1GR0A 2IXTA 3OPNA 4NH0A 1DAPA 2NADA 1FQKA 3GJXC 4C0AC 1WXWA 1E6EA 2NW6A 4M60A 4CFZA 4ZARA 3OAAA 3RYHA 1CUDA 2Q3MA 4JT9A 2GLTA 5DGDA 3NBUA 3TFOA 4HXYA 1QHXA 3RU9A 821PA 2QRJA 3W8FA 4CI9A 4E5SA 4G23A 5DH9A 4JI6B 3L7JA 4BN4A 3DWGA 3EPLA 2MMCA 4W6QA 2FZ4A 4YRCA 1P80A 4PZZA 5COQA 2IYTA 1T6YA 3Q5EA 4RDIA 3FROA 1DG3A 3PLNA 1GSHA 4IQ4A 5JJBA 3U7QA 1RWMA 4B73A 3JQ7A 1T8TA 1EHYA 2MU1A 2OBLA 3EYWA 4YPOA 5P8WA 4E2ZA 2VFAA 4JUFA 3WNVA 1BH6A 2OT3B 1ZCZA 2VBIA 3M82A 4QU9A 4WY2A 1PU2A 4YB8A 4CKXA 4EFDA 3RFCA 2R751 1DELA 4G37A 2HWWA 3B3AA 2VQ6A 4I9HA 1E2KA 1G3QA 3V8VA 3ZDCA 2VNSA 4OHMA 1S89A 1XL1A 4HZGA 4M2LA 4MX8A 4ASUD 3AIIA 4CHTA 2R1VA 3KSBC 4F60A 2BBOA 4HUJA 3DWIA 5KHLB 1N9KA 1JYFA 3L6CA 1M2KA 4ZA2A 1DEAA 4JHLA 1KVQA 2PUDA 3L8FA 4II3A 2OFWA 1ZOOA 5J23A 2FZKA 4V38A 3WQHA 1VI6A 2IU4A 2O5EA 2CDRA 2Q9BA 4LK3A 1C5KA 4KR0A 1K5GA 5ESWA 4JX9A 1EJ6A 2HHCA 2JA1A 1QU3A 4LJ9A 3C3MA 3H4VA 3PG5A 2EDCA 1PJ3A 3NHYA 4XYGA 5TPWA 5EHXA 1D4AA 4INJA 5M29A 2FUG6 1QKIA 1SD2A 1L3BA 1S8NA 1CY4A 2FV8A 3QOXA 4B3HA 1HRKA 4ARZB 2FEWB 5FBLB 2XQGA 2Q5QA 1SXGA 2FMFA 1RP1A 5IG2A 1UBLS 2V5VA 4RSMA 5CAEA 4Q12A 4I1PA 2GO1A 4FONA 1A95A 2I2WA 4B32A 1DBVO 3H7AA 3OEHA 5C7IO 4V02A 5K3OA 1YMVA 4NESA 2VUIB 3BGWA 3HVUA 1OFTA 2PUBA 1C7EA 4PIMA 4DGQA 2JFHA 4IGKA 3CLHA 2AZMA 1OI4A 2NUPB 3T9FA 3UMSA 3RS7A 2GJSA 4F4DA 3WO1A 2XT9A 3I72A 1TEZA 2ZUSA 2VPXA 1N7HA 2F6RA 5BRJA 1M1YE 1D4OA 4I4IA 1NPYA 3DEHA 4JLOA 5GV8A 3FTNA 3PHLA 4DG9A 4QULA 1YU9A 3ROQA 4ALJA 2QT1A 1DINA 2P1DA 4H6WA 4X1YB 5CVUA 4Z3OA 4Z86A 3TEJA 6ADHA 2DPYA 3ORRA 3UJ6A 2SKEA 3UWKA 2E55A 3EXFA 1BA3A 1EGVB 1M34A 1J0XO 4MDYA 4FDMA 3VAYA 1JHOA 1X86B 1Y3DE 2P0AA 5CG1A 3PQ7A 4KO2S 3D6JA 2V7WA 2XXJA 3FUVA 4R1TA 4KQFA 5AXCA 5HMMA 1IRXA 2O2YA 3T5MA 4RX1A 3ID6C 1CF4A 5LR6A 1FLAA 1UANA 4XDHA 2XMZA 1YVEI 2FPWA 1N6IA 4BXOB 4HWPA 3VOSA 1M2OA 1DBIA 5DGXA 1EESA 2XUFA 1YHNA 1E92A 3OWOA 2VZ8A 1IJKA 1RYHA 1EFUA 1GU1A 5EFOA 1TOAA 1GL7A 2V6FA 2D0OB 3O0DA 1JXAA 2BFBA 4DJ5X 3GEMA 4YACA 3CLUC 4M87A 1IUOA 2WT4A 3PJFA 1R0WA 4IUYA 2WJZB 3H2JA 4RK1A 2D1QA 4KQ2A 5LL6P 1JSXA 3TTUA 4RC9A 2G7ZA 2BR5A 2UUOA 3G2OA 2OEPA 2WYWA 1KJJA 1D2EA 3LXMA 4RH0A 1ISFA 5E1BA 1LBEA 3B1YA 3GQVA 3SYRA 1EA7A 1V5WA 1SMKA 1V26A 3BSFA 4K2AA 4N7RA 4WEQA 3WWPA 1RIFA 3COZA 1US8A 2P5SA 3E1SA 1RVV1 2EZTA 2NZJA 2Z5FA 4D3FA 4UM7A 1YRHA 2H0QA 4BO3A 1RJFA 3MOIA 3EWNA 4RIIA 4B7XA 3UWOA 4FFOA 3GK3A 5CMLA 4TS3A 1CNEA 3LKDA 3DGEC 3ZHZA 3O31A 4FDLA 2NPOA 4ZVLA 3WSWA 3DNMA 3VBEA 3EUWA 3CCCA 2A35A 3Q8WA 3JWIA 3ZE6A 3BH7A 1KIAA 5ISMA 1KWKA 2Y0BA 1DWOA 3DE5X 4JCCA 2I34A 4Y3UA 4KC0A 4MHSA 3ZWAA 2SKDA 2W48A 3DC7A 4N12A 1PT7A 2W6IA 2PFKA 1LPNA 3C6MA 2O23A 2P5TB 3Q8LA 4CM5A 4OQZA 3I5AA 4Z99A 3VZDA 4TS9A 2BGLA 1M7GA 1G59A 2ZJ3A 1AUQA 1XMXA 3IE0A 4Q34A 3HXOA 3ZHSA 4YALA 2HLNA 3KYJB 2J31A 1V4NA 4TXLA 2LNDA 2SCUA 4HWOA 4IOJA 4Q9LA 3FTDA 3NCTA 3ZKWB 4DIBA 5FPHA 3T3DA 2R4TA 1KY2A 3DPSA 2QKYA 4FQ5A 3TEFA 1Q6YA 1VOTA 3L82B 4NBWA 2PR7A 1TYAE 2O8EA 3ETEA 1QRUA 4EKDA 2V7QD 1BX1A 4KG7A 2BEUA 1KIFA 2P6MA 1FP7A 3PRHA 4OQNA 4QOIA 1U6JA 3CBQA 3NAQA 2AOXA 4IIBA 1WB6A 3EXAA 2BTEA 3CR3C 1UH5A 5TR9A 1NC3A 2F3SA 2OK7A 4C7OB 1DC8A 1KFCB 3BZUA 4E5VA 3S68A 1XLUA 2G82A 2YVUA 1NGSA 5ESXA 3DXZA 2EERA 4W7HA 4M0FA 1LU9A 3D8NA 2YV2A 4BZXA 4Z6KA 2I03A 3HJNA 3ERCA 2XZLA 4WN3A 4JLPA 3WK9A 2VT2A 3OLQA 2QAGA 4PX2A 4DPMA 1DSSG 5IPFA 3UIEA 3MAGA 3OTQA 2E3JA 3BMNB 4LKRA 5AHKA 1KDZA 5FV4A 1A5TA 1PJ8A 3MWLA 1G5HA 3S8EA 3NIWA 1T8RA 4EL5A 2QOEA 1TTQB 5FPTA 4Q03A 1H2ZA 1G8PA 4ZT2A 4U0JA 3CUEF 4ZREA 3DZCA 4U1RA 3OFNA 4W8OA 3QEMA 2C1EA 3H5NA 5CFQA 1I33A 1EP1B 3QYJA 1Y1QA 2BFPA 3GAMA 1M33A 4G41A 1XLVA 3V8BA 4CV0A 4F45A 3EIEA 2VJQA 3GLGA 4YJHB 1Z39A 5EUMA 3L3BA 1EFVA 2IV2X 4D0SA 2IH5A 2WUVA 3EIXA 3EVTA 4JS0A 5K4HA 2OSVA 3QA3E 3HDYA 4TLLB 4CMIB 3F4LA 3GJTA 4S1OA 2XYPA 3H5RA 1WCIB 4ANFA 4C6RA 3QLEA 1KZ7B 2YC4C 3QSGA 5G53C 1KVTA 5G1OA 3NBAA 1IL0A 2XOKD 3H42B 2F4VB 3QIVA 3DSRA 2IFTA 5JSHA 1EFDN 4IIJB 1B6GA 5DNYB 4B3JA 3JVDA 1IN5A 1CS0A 4G0YA 1DJOA 2XB9A 2OCLA 3L4EA 4IGAA 1P0IA 1ETHA 1H8HD 4IIGA 1PQYA 2NTYC 1PGJA 1SIOA 4M53A 4BNJA 4E2WA 1XWWA 3KKLA 2YV3A 1JALA 1J2YA 3HFGA 2IF0A 2Y67A 1KSFX 5F78A 3QPUA 5EJFA 1OFIA 3O8QB 3U6BA 1WUHS 3VC2A 1J49A 1JNXX 2XAUA 2QX6A 4MQLA 5CNIA 1B1AA 3EK2A 3HYNA 3I30X 3HG7A 2JGAA 3UWPA 2ZS9A 1DXYA 1RBZA 3E70C 1JFFB 1EX1A 1JWLA 4HDMA 2J9FA 2OG2A 4ND8A 4KXYA 2J0UB 5JZVA 2XE6A 4X20B 4XYEA 1ARZA 2ZREA 3DFFA 3H86A 4X1KA 1X7GA 1WIWA 3GROA 3N70A 2BHNA 3WDMA 2YV5A 3TUIC 2OORC 1XQYA 2EYQA 3IUMA 3KE9A 2BKVA 3C1UA 1UOPA 4OP1A 2R44A 1GT91 4JI0B 4JI2B 1YZLA 2RG1A 4N6NA 4HL6A 4DJAA 3MTAA 1GKKA 4DLWA 1HT3A 4B82A 2IPNA 3CH4B 2F17A 3NFRA 4MUMA 1IVYA 3RVLA 4CE6A 5J47A 3D31A 3X3HA 3N2IA 2W4QA 3ZQ6A 2QGZA 3FPLA 2D0PB 4DWOA 2NTEA 2Z98A 3IA2A 1T2FA 4YUYA 1XNRB 1XRPA 1IY8A 1G5TA 1CC1S 3MLAA 1KY5A 2P65A 1WKVA 3N58A 4LWQA 4U4AA 3WGYA 4V1CA 2HN9A 1QH1B 5FCDA 3RT1A 1ZCAA 2NYAA 4PONA 1SBHA 2GNAA 2ZQZA 1DLIA 3DKVA 1VKJA 3T3EA 3WX0A 1W47A 3A6HA 3LLUA 3OPYB 4WVFA 4BLRA 1HKUA 2VSXA 2V74B 2YWFA 3O83A 2H1LA 3QM1A 4LTDA 4DZTA 3QKRA 1M5RA 4QOHA 1ZGHA 1D2HA 1ZUNA 4XASA 1XZ8A 2BR4A 2VXCA 3BA1A 3PBKA 3QEAZ 3I45A 4C4PA 2MR6A 1J06A 1EAYA 4MTLA 3K70C 3AM1A 4MK4A 3H5TA 1XDDA 1L5QA 2OHGA 3CNNA 2WMOB 1N6NA 4G4GA 3TX2A 5B58C 3KVNA 1RCTE 1YR6A 4M86A 5SY4A 4XD7D 5EHGA 2CD9A 4EA6A 2XYVA 1AGPA 3FCCA 5AK3A 4ZQCB 4DIUA 4JC5A 3AR6A 4M7OA 4YLGA 4HVAA 1Q50A 4DXAA 1UXJA 4MWZA 3W0LB 1DCTA 1AKUA 1T5LA 1X1CA 5JTTA 2Z6UA 4B6GA 3AHEA 3IUPA 2NTNA 1XDZA 3MINB 4GS5A 5IRCD 2WT8A 4QVKA 4OB8A 1ZMRA 3INTA 3QW2A 3Q11A 4OHZA 5BOSA 5JSZB 4PS0A 4QUHA 5JO0A 1MOZA 5AW9A 4LF9B 2FMTA 1IN7A 3T1TA 3OAAD 3WFJA 4TSKA 2OO3A 1B15A 1M8JA 1ZM4A 1C3XA 3G13A 1STOA 2WKPA 1BJKA 1Y4ZA 3CZMA 4KQGA 4PAOA 1KO8A 3NS7A 3V9AA 4URUR 3QBVA 1EKXA 1ISGA 1ZSNA 4GL4A 4LRUA 1SG9A 2CUKA 1AZSC 1Q15A 1Z35A 3JWHA 4GH5A 4X6UA 7AT1A 4YDQA 4ZAWA 1K3FA 4Y6OA 1XCPA 3AGQA 1I7NA 4DANA 3AEXA 4ZZ1A 1GPMA 4DIDA 1RRVA 2W2TA 4ZRNA 2E49A 1ETUA 4FC6A 3WOVA 5LB4A 5IT0A 1EYZA 1QR6A 1DKRA 3B9RA 1KS2A 1CUFA 1QB8A 1YZYA 4QEZA 1VGVA 4KPEC 1LVUA 3OQ1A 1V45E 5C8YA 3R76A 3KXKA 3K5WA 3EIFA 2IC5A 5EAIA 3DCYA 2RHLA 4DG8A 3R3VA 2RB5A 5KOYA 1OQAA 1U1CA 1Q84A 2V9CA 2GHTA 2A8YA 3HE3A 5HCIA 3PGKA 3U44A 2AC2A 3QKTA 2SKCA 4ITVA 4LWZA 5CVCA 2GMWA 3GR6A 3OMXA 4W9NC 4EJ6A 3K6SA 3RT7A 1TXGA 1FMCA 1F7VA 1C9YA 2QJWA 3ZBUA 4MVJG 1H2AS 3A27A 3WNDA 2XQFA 4KTTE 4J1QA 4YJ2F 5ALEA 3QFFA 1FQOA 1ZC3A 2PT7A 2ZVQX 2AMJA 3FDJA 2FFAA 3PVZA 2YQZA 4FOTA 2OBBA 5I9SA 4ZT7A 3ANMA 4U7WA 3EJWA 4GBED 4Z53A 5JDCA 3KTAB 2HWUA 5K0LA 3H3FA 3ZQUA 4PHFA 3HHPA 5AOBA 2V0GA 3IUBA 1SO8A 2YFQA 3TLXA 4CDNA 1SVWA 3C24A 4HEJA 3KKKA 3R3WA 1IIRA 1P0QA 3FR7A 4JJAA 2OHJA 4ZPJA 5K6TA 1RRMA 4O0MA 1B43A 2YBDA 2QSJA 3KUXA 4LS3A 2QUZA 3KELA 5G41A 4QG3A 5KWJA 5A0TA 2FPOA 3EISA 4NU0A 3K8ZA 2XDWA 3GNQA 4XM1A 2NXEA 2VNIA 1JMVA 3IXLA 3R23A 3WFZA 3WS7A 3WL8A 5JD4A 2QU7A 5KPJA 3UMYA 1YB5A 4GOND 4LBWA 1JVNA 1OZHA 2QPAA 4LZJA 2F43A 3D0OA 3FGPA 2CC2A 1XVLA 1GAJA 3BFPA 1O95A 4C03A 1KJZA 1R0BA 5A4JA 4O2BB 3UJBA 4OHOA 2JF0A 4FZ5A 1GTJ1 4KVFA 3S7ZA 3BIWA 1KEWA 1JHPA 4FHEA 2ZUUA 1USGA 3SR3A 4JP2A 4IHJB 1S4MA 3WHPA 2WMNB 1BN7A 1ORVA 2O20A 3SJ7A 1CIPA 1XU4A 1UDCA 2C98A 3M5CA 1NIPA 5MN6A 4A0QA 1R9GA 1RZRA 4EYKA 1NF8A 2DBYA 4NFLA 2NSLA 4N3BA 3HTXA 1ZOIA 3CW8X 2J0QA 1MABA 2QROA 3LXXA 3ZC3A 1BDBA 4EHBA 1OLUA 2MMGA 4HADA 4EZBA 5CDUA 3CGWA 3D8TA 3FPAA 1WDTA 3LY5A 4PZDA 1GL3A 2PYIA 1W0JA 1QRTA 4AZWA 4PHTA 1DX6A 3ILVA 3D4OA 3B2NA 1NVEA 1WMEA 4CKWB 4C1NA 3FGZA 1K7SN 3TLCA 1QYDA 3NBXX 3L9XA 4MAFA 2EX1A 4J8PA 4FS3A 4PGFA 3R7SA 3DH0A 4EB6A 1I2AA 2FDRA 2G1UA 3JU3A 3AQIA 4NCXA 4RHTA 4ZDJA 5EJ6A 3UENA 1KZYC 3OP4A 3ZLVA 3VR4D 1MB3A 1SVNA 5CVJA 4E22A 1FDRA 1HSOA 3E9ZA 1VCHA 3QFRA 1N5KA 4U5QA 4GQIA 2IHUA 3VR3A 2ODWA 2YNMC 3D8UA 4E07A 3EVNA 5B3JC 2ASVA 5DN6A 3LDHA 3QF4A 2J09A 4PC6A 5EXEA 4ZOAA 2J32A 5T6MA 3JASA 4DEVA 2NO7A 1ZXLA 4PCAA 3ZHUA 3SSNA 1G3RA 2QJTA 4FR5A 1JIIA 4HEA6 4Y2UA 1WS6A 5J63A 4A8TA 3PQFA 4Z49A 3PD1A 1DKNA 1IM2A 2NV6A 4BU1A 2GPAA 3V7UA 3TW0A 4LZWA 2WG2A 5ELXA 2HXYA 4R8MA 2XWPA 4MJXA 1QF9A 3AFMA 2RHDA 3JRWA 4I4LA 2BFEA 3WGGA 4A2PA 3IOEA 4NICA 1PLJA 2CHEA 4IV0A 5JD3A 4EO9A 3HYLA 2W6ID 1HUQA 4HNRA 3ZI4A 1C9DB 6REQB 1NDQA 3FUTA 3R5JA 1K08A 4IDNA 4Q7JB 2SICE 3DJYA 1OH7A 1S96A 5J4LA 1K5DA 3NPAA 3J80A 4FCWA 2QR2A 5EP3A 4Q3BA 4LFCB 3SN6A 4ARSA 4LIPD 4B83A 1XZLA 1HY3A 4YRTA 2O8CA 3KZOA 4PC3A 2AZXA 3RJZA 3M7IA 4I2NA 1Z62A 2ID4A 1H65A 4KFRA 2B82A 3NIFB 2DBZA 4B71A 1VKOA 4RPJA 4TYWA 3CX3A 1RQNA 1XJCA 2PQMA 1B41A 5AJYA 3SI7A 5IFKA 3B6KA 1H5UA 3PLRA 2JH8A 3DPUA 3KQPA 4HWKA 4DXHA 1GA4A 2FTKE 1UAYA 4MRPA 1U6IA 5EVCA 4EH1A 2IP2A 2IPLA 2DJIA 4YAOA 3KT3A 3R20A 5KNBA 3D2AA 2DTEA 5JIBA 2Q2QA 3OLVA 2X5KO 4N7JA 2PSSA 4PPNA 1W36B 2IUSA 3TX6A 3THXA 3WB1A 5C5IA 1FEZA 1KK1A 1BX0A 2JCSA 4Q6BA 3IAUA 3SXUB 2AN5A 1QFJA 3BF7A 3DV9A 4GICA 5LYJB 1SUSA 4IXTA 4RZ3A 4TN5A 3DXYA 1R6VA 2FR8A 4I08A 4ZOEA 5BMVF 4JI1B 5FPKA 4EEZA 1NR5A 4I3HA 3IDAA 1PEAA 1F6DA 1RLMA 1UPFA 2FU5C 2X41A 1XPRA 3U4IA 4UJ5A 2FSPA 4BO8A 2IYLD 3NW9A 1A77A 3B48A 2YY6A 1HO3A 3ER6A 3JYNA 2AFHB 1FW8A 1SBTA 5DM4A 1UZNA 1J0BA 1TT5A 1WVGA 2QTGA 2PTGA 2ZYVX 3ED5A 5DBFA 3TQTA 2OV2A 1GQSA 1M2HA 2D54A 4L85A 4H7JA 2PMBA 5DMXA 2IU6A 5L4LA 4LISA 4L78A 3L18A 1SFRA 1ZH8A 1D6JA 3P19A 3UJDA 3R5KA 4PQFA 1C4XA 1A3CA 3A10A 3KWJA 4MS1A 3EGWA 5DU2A 1RQXA 3A6JA 5KWSA 1HNNA 1L5NA 2FVYA 2H1SA 3ENZA 4LJKA 4MVJF 3DLBA 3EAFA 1SA0B 4PYIA 2PY6A 2A4MA 4WZBA 1SRQA 2CHFA 3JZDA 3M34A 4LN1A 1KIMA 3O3CA 3K9HA 1E3EA 3G8BA 5ALTA 1ZFNA 3A37A 4DARA 1DMSA 1JP7A 2DCUA 3D4LA 3CO0S 4OB6A 1AXGA 4I3FA 1FQJA 3VZQA 4Q48A 2HA7A 4YCSA 2EJUA 4RTLA 2XWSA 2E4ZA 3M9LA 2CXRA 3FSEA 3G59A 1AH2A 5CXUA 1YQQA 2GAFA 2E5FA 2PH5A 1TRHA 2KSQA 4MPTA 2W2KA 1T1JA 2BRUA 4TM8A 4N5NA 4BNFA 1ILWA 1A4UA 2ZYHA 4L5BA 1ELOA 4A2WA 3GV0A 3HB7A 5EWLA 3RGGA 2DPMA 2XCSB 3DULA 4MDHA 1XTRA 3H2IA 4PTZA 2PMKA 4P93A 1R6XA 4G63A 5I3CA 3HJAA 4PZ0A 4PZPA 4RS3A 4WNCA 3RS8A 4X45A 2FRXA 2I4IA 1NMQA 4B2IA 1M2FA 1TD9A 3I9V6 3N9IA 2QA5A 1CULC 2UYOA 4HZUB 2MYTA 1A9QA 2B1QA 4FZJA 5CCDA 1NNI1 3BQMB 2FPMA 4TKUA 1O94D 4BMPB 5FDFA 1QF6A 3IKLA 2O2CA 3ABRB 4C7VA 5IABA 1KZ9A 2CV1A 3EPHA 4AQYB 1HDEA 3HUUA 4EDFA 4RMNA 3NKFA 4ZT3A 4D9GA 4M0KA 3FHTA 2JCYA 4EPRA 1OYVA 3VM6A 4HVTA 2A9QA 3K1TA 2Z9BA 3TSOA 2R4QA 4FQ8A 1R37A 2CXXA 4RLQA 4DVJA 1ONOA 3NVAA 3OOHA 2GD0A 1GCOA 2JIRA 2PJDA 3NIGB 1K7XB 1WSWA 3UNXA 3NGXA 3R2JA 1P1CA 1PFGA 1NVGA 3D4IA 3I34X 3N0WA 3VHRA 1U1GA 1XDBA 2IYNA 4Z3DA 3NHZA 4IRMA 4BAZA 2IT1A 4C4ZA 3TUJC 2FPKA 2X15A 1JR3E 4ZCLA 2JCBA 3S44A 2L2QA 2IDJA 2JHGA 1KZ1A 2DCMA 4GMHA 3RK1A 1F2VA 1C7RA 1H94A 2FCAA 1N32B 3ZJTA 1IRIA 2GBFA 1N36B 2H11A 3EQ9A 1L7MA 3HB9A 1KQFA 3ZLBA 2EATA 4MHTA 3VZRA 1KE2A 4AVYA 1I9CA 5ERYA 5FA5A 1QO9A 3OY7A 5EEGA 4HGZA 4BO5A 4CL8A 1FXWA 4CQMA 2F3QA 4GI7A 5IKOA 1SWVA 4C7MA 2PKWA 4FT2A 1M1XB 4R1PA 4A6DA 3AV3A 5JMWA 2IOHA 1U28C 2O06A 2PSJA 4FBMA 1T9BA 3IE1A 2I71A 2FPIA 1XEXA 3L0PA 4IDFA 3UAVA 4OK5A 3Q7TA 3OCVA 3HL4A 4JIMA 4QX6A 2O1XA 5BV8A 1RXCA 1N0UA 1LS1A 2AK3A 1VRVA 4I1OA 4LNAA 4N1AA 4U7FA 1L7QA 4UE6A 4DY4A 4JP5A 3W3ZB 1LVHA 2WTNA 3VX4A 4DNXA 3V7FA 3UB2A 4C22A 1CQXA 4EVSA 4GEGA 3PPWA 4LRQA 4QNMA 3LECA 3GRUA 3RVQA 1T8SA 2YQ5A 3DEZA 4J0FA 3A1SA 3LUAA 2WG1A 4FPXA 4RIGA 2K6GA 4OHRA 2GERA 2X23A 2FSFA 3MSXA 2ZG6A 5GGYA 1IN1A 2HHJA 2X8LA 4FN5A 3I62A 3SVZA 1CDZA 5ABPA 5LZ9A 1H9AA 3DLIA 4Z9XA 2Y77A 1T0IA 4NABA 1WUYA 3D8RA 4DAOA 4M9UA 4GPD1 2Q5CA 3A2MA 4P4LA 2A0KA 5EC8A 4ZYYA 5DNUA 1CK4A 3BWBA 4XKJA 4KRGA 3SC6A 1AGRA 3GD5A 3OIWA 4G5YA 3HN6A 1ABBA 1FLVA 5CA0A 1SC3A 3ROMA 2LXNA 4HCJA 2REQA 4J7AA 4MYDA 4LFBB 4UUBA 4RKRA 3DBHB 3HU2A 3LVQE 4R31A 4LNHA 4OFBA 3RW9A 2I2AA 3I2IA 1NI4A 2V4ZA 1EX6A 3EC7A 3ML1A 5BSTA 1YB4A 2GHQA 2FGJA 2ARKA 1SKQA 2HRQA 1R8YA 1UK8A 2IF2A 4HX2A 4LE1A 3QE9Y 1O9HA 4LMAA 3GPDG 2Z3VA 1X7YA 3EDOA 3OEEA 4RLSA 1NN5A 2ZUCA 2OXEA 1I24A 3GBSA 3KB8A 1CFZA 3OCCA 5E38A 1O97D 4NHEA 3FOAA 4ZEWA 3F2IA 1Z3IX 3NEPX 3JY6A 2HQOA 2VXYA 5J2TB 2LE0A 5E8JA 3QUBA 1RPTA 3KZ1E 3RFVA 3CJRA 4M0DA 1PSDA 2XUOA 4IDOA 3IT0A 4LYGA 3H84A 1WBJB 1YRAA 2DUJA 3L01A 3UGJA 1UP6A 1H9BA 2IQIA 4P7GA 4BNZA 1PR5A 3LQRA 2MDTA 4AJJA 1EBBA 3QPVA 4LHYA 4QWMA 3AFOA 2PAFA 4HB4A 1Y3BE 2P79A 2DBRA 3PFFA 5AW4A 2QZ9A 2FRVA 4D99A 2P62A 1SUIA 2FETA 1MIOA 1TCUA 1XDWA 1HC7A 2PK3A 2PZKA 4WDRA 5K0TA 1IONA 3IAM1 4W5QA 1XP8A 2R8RA 2XVMA 3RTEA 1XC7A 1KMQA 2LV8A 3MIZA 2OCPA 2GYYA 4NBVA 1B8NA 1Q95A 1TCVA 1U8UA 3ES9A 1RLJA 4G0NA 5CB4A 3D54D 4DR5B 2XA1A 4GZMA 5TRTA 2QR3A 3LO5A 4WZBE 3GG2A 5B3AA 3I2KA 3BERA 4F2PA 2DFTA 1O95D 2CVFA 1ZHFA 1HWYA 3O8NA 2CVOA 4KNVA 4R8SA 5GJVC 1QIGA 1FOEB 2FFBA 3AZPA 5FPPA 3H7IA 5BYJA 4E21A 2A1TS 3PF8A 3WL6A 1ZVVA 3PC8C 5KSZA 4NATA 1ULSA 2B5VA 1QSGA 1OTHA 5GVSA 5IDXA 3D6TB 4RK6A 1XPJA 2CMDA 1LW7A 3R6DA 2PRZA 5HQTA 1RZRD 1SZPA 3C5EA 1CRPA 1KEVA 1C9EA 1JB1A 3ZCSA 1N1GA 1AV6A 1C0PA 5JY1A 5FL7A 4M1KA 2HRBA 3VPXA 4OUDB 1M74A 1GZSA 4RNCA 1N2HA 4RL4A 1W0JD 2NX2A 3FNBA 3STUA 4YAGA 5ADVA 2DH6A 3KQHA 2ZUFA 9ATCA 3P9XA 1UEXC 4QAQA 1A8PA 1ZI6A 1ZJ4A 4CPDA 4TLBA 2Y9MB 5JCJA 1QZTA 1KVUA 3GYBA 4HDQB 2ESRA 4H9GA 3T52A 2DUMA 4PPGA 3AOGA 3AKYA 4WESB 4E3WA 1KFJB 1OXMA 4RZQA 4CCWA 3Q7SA 3AT1A 4JDPA 2RI6A 4YMSA 1N6HA 2GWRA 4D0NA 1SWWA 4MVJI 4PLVA 3O74A 2GNOA 3A3NA 1GZ6A 3IP6A 1YE5A 4QVIA 3IVCA 1VYHA 3AY3A 3GUCA 3SC2B 1PR2A 4ZCQA 4F5WA 2YYSA 1EK2A 4RQUA 3SKVA 2PCLA 2H0RA 2OTCA 3P4YA 3D5QA 4TXHA 2CJWB 1TK3A 4D3ZA 4ZAYA 2YTZA 2W4MA 4DG5A 4OQEA 4I4TF 1UKAA 2NUAA 3M5WA 3RI3A 2H3HA 2QB5A 4G84A 3WHLA 2GCPA 5LBIA 4M1EA 1UJ4A 3PC3A 1ADCA 2A7QA 4KAFA 3VPHA 4V3BA 4CHGA 3IUSA 4XR9A 3SYKA 1P0FA 1FBNA 3BSYA 4G0QA 5C9ZA 4HNAA 2CLIB 1QQ5A 1YQTA 3GG9A 3NTLA 3OKPA 1XEWY 4BNXA 2XT0A 2JKZA 2SCUB 4QSHA 1FJ2A 1W6UA 1QLWA 4F4JA 2J5XA 2VF7A 5LCXA 3FN4A 2E48A 1MF7A 1K89A 4FD3A 4M49A 1EZ4A 4P1ZA 1V2HE 1KYTA 2C07A 1H5NA 1SIBE 4AJIA 4C07A 3HLTA 4FP9A 5CEFA 2A6PA 3WWCA 1FMFA 2GWHA 3ENVA 2NZVG 2BMDA 1GV1A 2H7XA 3COJA 3RU3A 4PSCA 1I1QB 4URYR 3KLOA 2VF5X 1WCWA 3QUCA 1IN6A 3E22B 3DLPX 2I87A 4GP9A 1ZR4A 2CDBA 1TLLA 2BTQA 3KAKA 2E5LB 2CLLB 2XMDA 3FGNA 1FDUA 1MJHA 3H9QA 3SKXA 1L7AA 3OOJA 1Y1RA 2DQYA 3FUUA 3VU9B 4EZIA 1H8ED 3IQDB 1YD7A 1NW3A 5FOQA 1NTRA 3QV1A 3VKGA 1G8YA 2Y8EA 1AZLA 1WTCA 4ZJYA 3D7LA 1JHVA 4QGFA 4F4FA 1R0CA 1U4SA 2OCXA 4WWHA 2HPZA 1XQXA 3EIUA 1GZ5A 1FVXA 2ZIXB 4MUIA 4DSTA 3A4LA 5KNBD 3KKZA 3NOXA 1M2EA 3ISTA 1N3YA 3MCAA 5DNWA 5A9TA 2W70A 3CEJA 3K9NA 3IFSA 1V3QE 3JSAA 1S6YA 3NGMA 3TAUA 3UXMA 5DGIA 1EQAA 3WAGA 1KHTA 1OAKA 1PGQA 1FRVA 4R84A 3I6IA 1NQTA 2JLSA 1W4AA 3MCUA 4BLUA 4IVQA 2QD4A 1RLIA 2EC5A 2VP0A 1UBKS 2YWRA 3GZTB 5JWHA 4BP8A 5GZ6A 3TFQA 2NAFA 5GIPE 1Z6YA 1JFTA 2XNCA 2JAQA 3HV2A 2G72A 3EGEA 3Q5GA 3MTBA 4E7PA 2Q3DA 3CGGA 5F9HA 1N5IA 2IIQA 3RG2A 3QLTA 3A6ZA 2WWXA 2ZEJA 2TMGA 3N6XA 3L7IA 2PMDA 3N7TA 4ONEA 4DCCA 3OQOA 4YFVA 3FTPA 4JENA 1KORA 1WETA 2AOTA 4YLEA 4CM9D 1L4GA 1YOBA 4L4RA 2AUNA 3E9QA 4C7KA 1PNVA 2Z3WA 5FPSA 2ZJFA 1R8QA 4PBSA 1DCMA 3CX4A 1M7HA 3VKHA 2XXBA 1QKJA 4YC7A 3FJYA 2XE7A 3ABIA 3C7AA 3PWZA 5K8JB 1X7ZB 2OAEA 2H4YA 4FZRA 4NARA 1MC5A 1JMKC 2AD5A 4XZ3A 3UKOA 4OBEA 4GGOA 3LBYA 4HDKB 4ZO6A 1GPH1 2AW5A 2BKEA 4HDMB 3ZWPA 3ZDRA 2X9QA 1LF0A 1ZUWA 2PU7A 5AUPB 2Y3IA 4NDNE 2N9UA 1NVXQ 2G6BA 2OB1A 2R8OA 3KU4A 2GX6A 4GWKA 4QOGA 4WCFB 1B6TA 3GPCA 3OA0A 4MGYR 3ETNA 2HIAA 1OTYA 4YUXA 4GUAA 4FYPA 2AOUA 4ZYZA 1COZA 4O4LB 3EN0A 1DTWB 1ZX1A 2YW2A 3PUHA 3SJAA 1Z45A 4RANA 3QEBZ 4PRZA 1CCWA 1CUYA 1JA9A 3PXAA 2BFFA 1XNGA 2IELA 4LZLA 3K0KA 4P8RA 2HZBA 5DCYA 4HWTA 4E51A 4OHCA 2REOA 5AVJA 4N41A 3TCKA 5FF9A 5B57C 1EFPB 3AHFA 5BQ5A 1HBJA 2G1KA 1BU8A 2PKEA 1RC0A 3MRTA 4U9IS 2Q0HA 4AROA 1MX1A 2WC1A 2RHTA 3RAGA 4DQDA 3MUEA 5BURA 3ZDDA 2H4XA 2A5FA 1G6Q1 2G04A 2PL3A 4I4NA 2ZTLA 3RFXA 3E9CA 1GZ4A 3K53A 3MWDA 3E3NA 1YULA 4MTCA 4A23A 2WU8A 3QV2A 3FDFA 4PX3A 3RRMA 4V2UA 3THOA 3U9TA 1DX9A 1G66A 1TZCA 2AN3A 2AJCA 5LB2A 2LBPA 1E69A 3PFGA 4KYVA 1JNYA 5B4TA 3OI7A 2PIDA 1K66A 1Y4DE 5FTWA 3NHWA 2ONKA 5I9LA 3K2EA 4FHFA 4JV5B 1Z3CA 2VJNA 2HQ1A 3AVXA 3QXXA 2GCNA 1CRQA 1A97A 1NNUA 3T12A 421PA 1GIAA 2EBWA 3PI6A 4A26A 4DKXA 4DUYB 4CT5A 1DS6A 1Q0SA 4BQIA 1H42A 2JJ1A 2I6TA 3WMEA 4O0LA 4NZOA 2YJ6A 1N6RA 4I55A 5EEHA 5GPBA 1FPQA 1SVUA 2P8SA 1T6BY 2JJ2A 3FFWA 4UCFA 2D4HA 2F3UA 3IAM6 4I6JA 3MJCA 4C21A 1FTSA 3K0BA 4D26A 4DC0A 3F3KA 2CLMB 4MWOA 5HF9A 5A62A 1V1RB 1XCGB 3Q1LA 3QVLA 1U5BB 2H2AA 5HZMA 2UZAA 4RLHA 4AMZA 2MSWA 3AFIA 4KI0A 4RK4A 4BEWA 2ODPA 4CQMD 2D7CA 3E8XA 3UHFA 4F3NA 5LOVB 2ZZMA 3BILA 1G6OA 1VG8A 1TKRA 4CL0A 3S8YA 1WHTB 3UO8B 4Y2GA 4Z4EA 3K9QO 5CDGA 3N8NA 5I5GA 1SCDA 4CUZA 7REQB 2RCYA 3OH8A 1WD5A 4Z8YA 3WBKA 1NSYA 2Z95A 4IVNA 4G1FA 4UM9B 4PLHA 2H9IA 5TEVA 5C7OO 1ECLA 2ZRJA 4G4SO 1R0XA 2GSWA 4DSOA 3ZDAA 2WTMA 3KXDA 4ZOLB 1F4VA 5HE9A 2IWHA 1V2GA 4LZPA 1GQRA 1FP1D 1FFCA 1TK9A 3BXXA 4EDHA 1DT3A 3PDWA 2GBCA 4NCNA 2I3GA 3PYXA 1XZKA 4ZVSA 1KRXA 1SCJA 1Z4NA 2XXAA 3M81A 4HSGA 4C87A 3Q41A 4UCXA 3B3FA 4JODA 4RVNA 3S2UA 1P1BA 1SCUB 1G8AA 3PR1A 2M6KA 4U0KA 1UADA 1BXRA 4X3OA 3RSLA 4PXAA 4HV4A 2R1ZA 4D8YA 4GRDA 1FMJA 3KD2A 1CYDA 5MDHA 3VGJA 3OY2A 5JS8A 1CDEA 4BKPA 1LSUA 3EXHC 1JKIA 2PZAA 3ZNNA 2FSGA 1EVZA 2ZR9A 2R9VA 1P4AA 5BR4A 1ENYA 3AB8A 5C4IA 1R00A 3ZXXA 1N8SA 2Y9PB 4C04A 4UHEA 4CMGA 3BGIA 4P7BA 1O57A 3KQVA 1E2NA 3E3LA 3PEFA 1EWQA 4FI3C 1OX6A 2NP7A 5EKTA 2BSQA 2WPDA 3AY6A 5FLYA 5CFPA 3IP8A 5EXTA 3NFYA 1B42A 3SSMA 5AKHA 1FJGB 4G5XA 3OQVA 1E3TA 1RI5A 1GG9A 4LXGA 4DZRA 3F9CA 1HFWA 1C9MA 3REOA 3WKDA 4GNRA 1E3DA 7YASA 2X5XA 3HWRA 1XD2B 3NKVA 3OEED 3HJFA 2J4CA 1Q7CA 3C2QA 3KOWA 1E2EA 1PDWA 4FFSA 5AW8A 2PKQO 2ZYUX 1WUJS 3I04M 1I7PA 2CNLA 3ZW9A 3PEWA 1DO8A 1JJIA 4G0VA 2O8FB 4U8HA 5CFRA 1XN1A 4BNVA 5BMOA 1FNMA 3HB4X 4RULA 2AMFA 3ZJUA 2R48A 2A5GA 4DQVA 2QYTA 2HZ7A 4MR9A 4YHBA 5HNKA 1WXDA 4BFUA 1FL9A 5AXBA 3U1TA 1V7CA 3DYVA 3LK7A 1L4UA 2WDPA 3CUVA 2C84A 2XUHA 1MH9A 3BIXA 3FPGA 3ADPA 4IDCA 5BYBA 4Q1DA 5FI5A 1E2MA 1F5NA 4MWDA 1PSWA 4M3NA 4EB8A 2VJOA 4EELA 4EI2A 5TV2A 4B4UA 4BX3A 3AIKA 1OU0A 1BN6A 5IMBA 1S7GA 2NXJA 2O2EA 4H4EA 3ZU3A 4BVFA 1D1PA 1X3SA 4PLPA 4Z8XA 4Y6RA 3G79A 2QZZA 1M6VB 4PAWA 5EKXA 4D3XA 5HUHA 1E1MA 3WGLA 1SPBS 3T94A 4JKOA 3G1UA 5JC1A 1ZZGA 3GRFA 2VQ3A 3BGVA 2YMPA 3ESXA 1OAOA 2QUHA 4UUOA 5F77A 5BR7A 5T7BA 2RSLA 3LW8A 5JZOA 2O0LA 4WNYA 3PUYA 3ZEIA 1L7OA 2W6OA 2W8ZA 1RRKA 2ECOA 3HS3A 4K0RA 4M8SA 2H1WA 1I6KA 4RVCA 2ZYGA 4X1OA 4CMJA 5HVNA 2X9VA 3U4QA 2LVBA 5IJAA 3TSYA 5FOTA 4HGPA 2H8KA 3A04A 1YZKA 3IPRA 4Y9TA 1TFUA 5DXJA 5AQEA 3BYZA 1VLZA 4UOQA 4QBHA 1XMPA 2QVXX 3PITA 3AV0B 1SULA 3V8PA 4Q47A 1ESCA 5IC4A 4MUKA 1CP2A 1HDRA 3IP3A 2CUTA 8ABPA 1PO7A 5JISA 3C3JA 1C0IA 3BUSA 2ZRBA 4YIHA 1G19A 1PJZA 1Z4PX 1CHNA 1I4WA 1GITA 3FWHA 1CU1A 3JR7A 4MRMB 1JKJB 4U5XA 1F1BA 5FL7D 3LDAA 4ZODA 2DGDA 1WHSA 3CH6A 1P6UA 2P67A 4OGWA 1BMTA 1CVIA 3CVOA 1BC5A 4N65A 1FMLA 1BRTA 2XIQA 4OTZA 3V8MA 1JIXA 5DNAA 1ZO8A 4QLBA 2PT6A 1LVGA 2PPVA 1U31A 3KPJA 4CTNA 2FGKA 3JASB 1S9DA 2XWBF 3RVSA 4ZO4A 1CUWA 1IDOA 1NXOA 1B2RA 1D1TA 3G6KA 4MI3A 4XB1A 5ES3A 5FKJA 1LNQA 3VC3A 2WKRA 3CH5A 4YRMA 5IVPA 2ZRAA 1C1YA 4JN6B 3RWBA 3ROEA 1X6VA 1FUUA 4R81A 3WGMA 1OLOA 3SXPA 4DA7A 3KPYA 3O2JA 3W5SA 3EAQA 1QGZA 4QASA 5EL0A 4P08A 3HKBA 3WL5A 2EF0A 2PV7A 3PKZA 4F3CA 4F92B 1IIBA 3HJUA 3TLGA 5BNTA 3WP0A 1TJYA 3BGSA 1E2HA 2CLSA 3L1HA 3SF8B 3T3HA 4MQ5A 3RIMA 1UKEA 3WB9A 1PFUA 2AD1A 5ALYA 4A6XA 2N1BA 4BO1A 5H3HA 2YMQA 5FTMA 3O47A 3GEGA 3I2JA 4D02A 1E4EB 5HDBB 2V6IA 2R6R1 1VMDA 4BQRA 5KKCA 2H92A 1M6YA 2AH5A 2QI9F 3MWJA 1YZVA 4GSYA 1Q2UA 2BR3A 2OZLA 4P5PA 3DBLA 1IJEA 4CIDA 1MT3A 2EW1A 1YS1X 3AGPA 1VIDA 3PB3A 3DE6X 3C5WP 4Q4HA 1CVRA 1EX7A 3TNDA 3F97A 4IV8A 2UU9B 2VAWA 1D0SA 3KYBA 3GX1A 3O9MA 5GM2A 1QV6A 1ZNZA 3GVIA 4KFSA 1QHSA 4LDPA 3A05A 5BYKA 4CKEB 1J8YF 1MJGA 1O08A 4M1ZA 4Q4AA 5HK9A 4GZ6A 4Y9SA 2HMTA 3KTOA 5HSGA 1XD8A 3PSAA 2QD5A 2HHLA 4U2EA 4GMKA 4DSUA 3ZIUA 1QFSA 5C2JB 3TIGA 1QHFA 2HMSA 4OIFA 5C81A 2B9VA 3AO0B 3TAXA 1UZLA 5D86A 5JEEA 1QOZA 4KAXA 1JDBC 1Y89A 2C82A 2A3NA 2ZIAA 4WZAB 4QRHA 4ZKDA 5G1PA 3EHDA 3AP2A 3LWNA 3TKYA 3L0OA 1E7RA 4E5YA 4EPYA 2P9ZA 2UZ1B 2X4DA 3C3CA 3L77A 4F06A 1E1KA 4MEAA 3KPUA 3N0RA 4ZXPA 1T4DA 4UM5A 5K6RA 1LPMA 3EG9A 4DR4B 2Y99A 3OOYA 5DW3A 3LPAA 5DO9A 5CA0F 3SZUA 5KVQA 3CT6A 3DDCA 4BLTA 1GGJA 4N0DA 1ZN2A 4OKIA 1INLA 1F6WA 4QQFA 5FX2A 1EFCA 1I5RA 4TZ6A 1C30B 5B2FA 1BQEA 4GYWA 4YRRA 4JWTA 5TMPA 5DTJA 1ZNWA 1TO2E 1B74A 1SU6A 4JQSA 2C88A 2R8YA 2PT5A 1GEEA 2HYDA 2AFIA 2P1ZA 4TMKA 2CUNA 4F38A 2AC4A 2OXRA 3UFXA 4EHDA 3U7HB 3U4GA 4MCAA 3ZE0B 3UPUA 4ECEA 3U3OA 4Y6PA 3NVDA 5EIOA 1VSBA 2I6UA 3K1ZA 1RHJA 4V3CA 1UKYA 4WH0A 3DT9A 1YR9A 3O4HA 4MGEA 4MW0A 4Q7MB 4ZQEA 1E89A 3VV3A 4Z7QB 2WYOA 1QVRA 3M6MD 4C05A 4EX6A 3AF6A 1C81A 1SOMA 2ZRFA 5T8KC 5I9TA 5DWDA 4B6RA 4J0IA 4E5UA 5JV5A 3VZPA 3GFBA 3MBOA 1EK6A 1N0HA 1TVMA 1EBFA 2FW8A 2WIDA 3EA5A 3GLKA 3TI7A 4A6PA 5ICSA 1EUQA 1JHXA 1F0PA 4D96A 3Q88A 4IIEA 1C1DB 1I2DA 4HAIA 2PR2A 3W2HA 1THGA 4IG4A 3NH6A 4Y2VA 1PWXA 1WVMA 4OJNA 3UCFA 2ZLBA 3W7BA 5J1TB 2QQ0A 1DWQA 1SKUA 4EW2A 4Q7QA 5EJ5A 4ZAGA 1JLLB 1EM8A 2GPNA 2P6NA 3K6KA 4IDHA 1BKDR 3TQRA 3BMQB 1II8A 3IT2A 2QE7D 1NI5A 3ZHRA 3AEKB 2AFHE 3NIBA 3IAHA 2VDQB 4YY3B 4DPKA 2PQ6A 1JRLA 3RNLA 1PL7A 4RS4A 3CURA 2E0IA 4P83A 2MIIA 3R8CA 1R74A 1XU9A 5TB5A 1DQNA 2EBFX 3KRTA 3SKYA 4ZDIA 4NYMR 2EG9A 1GG2A 1ZJ5A 1N2OA 3PQCA 3IO3A 4TLCA 4S24A 5IT5A 2EFDB 4OHVA 3NKLA 1KARA 2L0XA 5J4KA 1VP9A 2R66A 3O03A 2QG6A 3KC2A 4HGRA 4ZP1A 4CM4A 4D8XA 5D3MA 1T9GR 3B6IA 4NFYA 5EMKA 2VJAA 4AWBA 1JR6A 4MUGA 2HF2A 2JLAA 4LE2A 4INAA 1L8QA 5DN9A 3TSWA 4IEIA 1QGOA 3R3UA 3V80A 1K6IA 1E7MA 3A6PC 1NASA 4O3MA 3FHOA 2Y05A 1YV9A 3VU3A 4XYBA 3HKCB 2VNHA 3AFHA 2C4KA 2X13A 4NI5A 4GP7A 3TL6A 4F5EA 2QD1A 5HS6A 4C3OB 4URXR 3TSCA 4BFXA 2XW6A 4JYBA 1UMBA 1V39A 4YDRA 1JDVA 5F35A 2ZE8A 4MP8A 5IFLA 1WV0A 1NVDA 3DW3X 3KUUA 3SR0A 4US1R 3N59A 1WP9A 2B25A 2BUAA 3ETDA 2CCGA 3VDMA 4C4RA 2WT9A 1FK8A 2BGNA 2AG0A 3MTQA 4H6VA 1NLZA 2ADOA 2C4WA 4I2VA 5COBA 1I3KA 1KVRA 1J70A 3FH0A 1WB4A 3FSGA 3QHPA 1FYEA 1QH0A 16PKA 3GIDA 5GINE 2ZUVA 1SQ0A 2ZTVA 3O8BA 3ZCRA 4F97A 1I0IA 2PNJA 2PT9A 2CSXA 3KHTA 2ODEA 4ALIA 1E5LA 2NVUB 4L02A 2XWQA 4ER7A 1E7SA 1EDOA 1LPOA 2LPMA 3D8SA 4MKGA 2FKNA 2ZAMA 3L8ZA 4MWGA 4OI4A 5CLIA 5ALZA 1R4MB 3HO6A 4HTFA 1GSIA 3RE1A 2FZGA 1WTAA 4LJYA 4NBKA 3WIEA 3P32A 4FOLA 2ZPUA 5EIHA 5BY2A 4EMSA 1PZXA 2J41A 4JITA 1NLYA 1NYQA 4FJ0A 1A72A 4KO8A 4C4TA 3EUEA 1WLSA 2PN1A 1VFNA 4UNRA 2R6CA 1RYFA 2JBAA 2F1KA 2DVMA 3KT6A 1OWPA 1Q0ZA 1Z8DA 3ODPA 4BX0A 1YVRA 1Y34E 3OE4A 1H3EA 1Z4OA 1CPYA 5K0JA 2PPLA 4NP6A 4WACA 3U3RA 1MN6A 4GI2A 5AKZA 3ZGZA 4B3FX 3HY4A 1LPAB 1A9OA 1OBHA 2FPUA 4LUCA 1B4DA 4IZOA 3QI7A 1U9IC 4H7DA 4QU0A 3QU7A 6NULA 1TPYA 1WW2A 2BMEA 2E4AA 3N76A 3FKSA 3PFIA 4MQ4A 4GPTA 2ATCA 3N28A 4MRNA 1PYGA 2L17A 1RQPA 1TKAA 3GJ0A 2QTTA 3AZQA 3ZDFA 4MLPA 3QFTA 3ULKA 3T1HB 1PBNA 2O8NA 1X1TA 2P2YA 1ZWLA 3RBXA 2ZWOA 4JXXA 2EARA 2UUCB 2EFHB 5HKBA 1TUGA 1AMUA 1T5SA 1B3BA 4UUPA 4U02A 4CODB 1JLHA 1EG2A 3CUUA 4G5GA 1NLMA 1YDWA 1J8FA 2EWWA 2HMYB 3G49A 1AMNA 1N5DA 3HVIA 4C0BA 1JPUA 4DBVO 2C5EA 4RSHA 3D3EA 2Z5GA 2XVZA 3HGQA 3LUPA 4FFDA 4QFDA 5TS3A 4DBZA 1XQ9A 3MIIA 1QZ3A 3LSYA 3E9EA 2A9VA 4B09A 1V48A 1Z82A 2FMUA 3TD6A 2BKUA 3AUFA 3GLVA 3UH1A 4BZPA 4X61A 1UDBA 1VSUA 1IN8A 2R8EA 2IUFA 1I3MA 2HWXA 2Q5HA 4JQOA 2XOXA 3S2ZA 2H6EA 3AW9A 5EP2A 1ZNQO 5JQGA 2I9PA 3UHAA 4PQYA 5LMZA 2C57A 2YWJA 2BOVA 2AG5A 5JECA 3QHQA 2DB3A 2FPSA 4HS9A 3CLSD 3C5VA 3ZLJA 1OXXK 4QHSA 4U6NA 1G17A 2BIFA 1WCXA 4DQUA 4QA9A 3T5AA 4BPRA 5D3QA 4U2FA 4BZZA 1OB5A 3CRRA 4PBRA 3P2IA 3FBGA 5KTYA 3OU7A 1MNQA 5JSUA 4XQEA 2CL0X 5BORA 4LJSA 1EEHA 1VSTA 5DOVA 2WILA 3F3SA 2AFIE 4Q05A 4JELA 2C2GA 4LBZA 1HTWA 2D1TA 4L2IA 3DV0B 2ORED 2ROQA 2WUEA 2XR1A 1YS7A 2Z30A 5C0OE 5JMTA 2DR2A 4IM7A 1IZ7A 5TGTA 3WRXA 3L43A 3HVHA 5C31A 2GRAA 1CZUA 1L7NA 4XRRA 4FW8A 5JSYA 1LFDB 1FSZA 3G9XA 3V48A 3T5GA 1KJ8A 2C4UA 3TZ6A 2FZVA 4F96A 5IYZB 5FO1A 1AQJA 3HR8A 2VUUA 5DTQA 4DCJA 1FYDA 4TQGA 4YPFA 3IUNA 1V0JA 4JEHA 1FNDA 2J4FA 1LB1B 3EXG2 3M6VA 1SK8A 2R6ZA 4PHHA 4TS1A 1XA3A 4MV7A 1UBJS 3KZNA 5I7WA 4Q18A 3TQSA 3RAFC 3IDQA 1W8DA 1XMVA 4YRZA 2PX6A 1IHPA 2ZANA 4OJKA 3JRNA 1O5IA 1XZJA 2R84A 1JSCA 3G3EA 4UHHA 1U0GA 1KFEB 2W6MA 1ODTC 2WHXA 5EZSA 3GDGA 5KTTA 1KYVA 1AQNA 1KGDA 1P1KA 1WZCA 2RGNA 4ER6A 2YQ4A 1ZVJA 4PSKA 2CXNA 3DTVB 4G1EB 1NBME 2G8NA 3H2GA 1IBKB 1DBWA 2POCA 1PEDA 3RS9A 4EENA 5FUVA 2A0WA 3FLAA 2R1UA 3OFSA 2GVDC 4OBWA 4BLVA 1W581 1A69A 3B60A 3TUZC 3L1KA 2WJWA 3ONFA 2V6JA 4YRQA 1VPEA 2XB2A 1B23P 1L5VA 1W75A 2QV7A 4EJSB 1I4DD 3LI2A 4ZXFA 1U7OA 4MEJA 4EGQA 4TVOA 1E3JA 4G5RA 4EG6A 2CXHA 4FYJA 3VSEA 2ZJOA 3KVVA 3ZJ4A 2G8LA 4EGSA 4QU8A 4FFVA 4YRFA 1UKCA 2QNRA 2GM5A 4G25A 4J91A 1L3IA 1TA0A 4D98A 5SZHB 3ZH2A 5I3ZA 3QOWA 5JXJA 1YFLA 2BLNA 4JUBA 1RC8A 1TAUA 1A98A 3IA7A 3N8IA 5JJKA 4B44A 1HT2E 1LSOA 1ZD1A 1ZXBA 3QYAA 1X1RA 2ATEA 4KITB 2FMHA 4V0RA 2RIRA 2I4OA 2I3DA 2PSFA 1E79A 1XVIA 2ZRKA 3LFHA 3EG5A 1DPGA 1YDMA 4QDZA 3JS5A 4TX1A 3GH1A 3DD1A 5ECYA 2CGEA 3NTOA 1OFVA 3AHIA 4DMRA 2JG3A 1CJMA 5CPBA 2H1CA 1Z5WA 5IMSA 1HR0B 3RC7A 4DNPA 3VC1A 4L16A 1BROA 1JEOA 2HA3A 2X1MA 4BLSA 4V1CI 2I4LA 1KI2A 2YCLA 4YEDA 2VPYA 4BFWA 1DKUA 1E20A 4K9OA 4QDJA 1KTVA 2VDLB 2HBZA 4XUEA 1BRMA 1QMGA 5E2IA 1V4BA 2DQKA 5UKDA 3FZNA 5FFMA 3PU6A 1G3UA 1T6ZA 1Z8FA 2YBEA 1U8ZA 2IYOA 3ETJA 3IIKA 4TRNA 1ORIA 2WAMA 2XT6A 4TTQA 3R40A 1MORA 4EHNA 3ZE7A 5L4SA 4H35A 4HD8A 3GT0A 4W1SA 1COWD 2P4SA 2UVQA 2IYXA 5KZMB 2QQEA 3W06A 3GBPA 1PQ4A 4HQFA 1PZNA 3GJ3A 4N18A 4NDZA 5HKAA 3UWDA 1W85A 3E61A 4YYZA 3U0BA 1GTG1 3STYA 3B6MA 2NN3C 1N57A 2PQ0A 4LHSA 4PQRA 2GH1A 3F98A 4AKSA 5J5AA 3SJZA 2NVWA 3V7NA 2QNBA 2I78A 3F6SA 3GGCA 1WV1A 2HEGA 3FMPB 1F1JA 4YCDA 2RGWA 1XQVA 4X63A 4B75A 2XUAA 1ODSA 3C6KA 4J90A 1C8VB 1RMTA 1ZW1A 2XZTA 4L8WB 4GECA 4K6OA 4LCBA 2Q8PA 3LPCA 3EODA 2MINA 3HV0A 1SOVA 2BGUA 4WXPA 2FR0A 3P0HA 5AKIA 1NF3A 3SS9X 5E9JA 2WZDA 4I9UA 3RKRA 4P34A 1M1NB 5KOHA 2YH2A 3M6WA 4HLNA 4ARBA 4HQNA 4CDMA 5E7MA 4K6MA 3HEAA 3X1KA 5DNCA 2QRZA 5T41A 4BC1A 1L4NA 2X58A 3MFQA 4L95C 4P5EA 5K0SA 4JQZA 1U5AA 1L9XA 1WMDA 3KLNA 3PNOA 4GFDA 2QVZX 5AUOB 1GRCA 4R3UC 3EA4A 3H1PA 5CCXA 4NEHB 1Y3IA 2CXSA 2GD6A 3K96A 1SPXA 1NW4A 2B34A 4FHDA 4GPEA 3RVDA 1VZ2A 3U16A 4X7BA 4F3TA 2BJVA 1YHYA 4CVNA 4ZTZB 4OREX 1R6TA 1N2GA 2VG8A 2J5QA 3FOCA 4QYIA 2ZSAA 3P9KA 4KO4S 4QRIA 3V8EA 1N25A 1VCIA 4AMUA 1J09A 4HUTA 4UDOA 1WW8A 1HG0A 2KBFA 5LQNA 1ZM9A 5KNDA 3C3AA 2J0SA 5DRYA 2KX7A 3GLIA 4GI1A 3E5HA 5ITSA 2UDPA 1BYIA 2RK3A 3GGPA 2HDOA 4BYMA 1A7JA 1L5OA 4DIOA 3FFXA 2YYAA 2FMKA 3KR9A 2WLTA 1OI3A 1CZKA 1W52X 3OG9A 5D01A 5AJWA 1TECE 4F6RB 1UBUS 3LOQA 5CM8B 1PFWA 3IPCA 2B8EA 3FIUA 1Y6JA 4P86A 5MGBA 1E62A 1DXQA 1Y3HA 4C06A 3NWPA 2INGX 4GR9A 2FPGA 4M7WA 3A9CA 3LCCA 1NBMD 3VVCA 3S1AA 3ZU5A 2DWCA 4PYJA 4ATNA 1DCKA 5H4GA 1I2CA 2OOKA 4WDQA 1KK3A 1N6PA 1QGUB 4TWBA 5EZYB 1Z37A 3FX2A 1JEQB 4G9GA 4ND1A 5ARCA 2P9TA 4QOJA 4D92A 5AESA 2D8AA 3MZ0A 1RMQA 1AA9A 4UUNA 5AQ1A 2VPWA 3A0UA 3L1JA 1IUNA 5DYWA 5JFOA 1OE0A 3LBHA 3DWEX 5FB3A 3NJ4A 2AXNA 3C3EA 1HLFA 5AJHA 3G0CA 5FJIA 4JIGA 2Z83A 3A8TA 5K3EA 2FMXA 1IBRA 2JIDA 5ALKA 3TTVA 1Q44A 1MU0A 1NAHA 1XRJA 3TRKA 3E15A 2VOJA 4PZCA 4I9FA 1Y8QB 1JDJA 1WXGA 4RCYA 2EFJA 3W5HA 5K8UA 4DDHA 3HXLA 3UHPA 1F51E 2VT7A 3F90A 1KXJA 4I81A 4CL2A 3V4PB 4QAJA 2ZWPA 1DL5A 2ZR0A 3FDIA 4KO1S 2GM4A 4MMXB 2NVOA 4ZJPA 5LZ4A 1HQYE 4MLCA 3A3YA 1HYQA 4W6ZA 4QM7A 2YFYA 2HB6A 4D9BA 4YUWA 2IHNA 3IIJA 1YOVB 2I8CA 1G7RA 4KX3A 3PS9A 1FFXB 3MF4A 1V3TA 3H6KA 1E64A 5TQVA 3TOVA 1GKIA 3FSGD 4A1FA 3UKDA 5HF5A 4BS9A 2PBRA 5EYPB 1HDGO 3ELBA 3O4GA 3UCXA 2O7QA 2XYQA 1GN8A 1A7UA 3UXYA 1E0AA 1Z5VA 3T15A 3E7DA 2HA2A 2XSZA 3H9GA 1ISIA 1L5FA 2IZ5A 3NUGA 4P82A 4XM2A 2PGNA 1VJDA 4YJ3A 3TRJA 4DT1B 3GRVA 4C9BA 3BL6A 3OCXA 3WGIA 1XJWA 3C4VA 1R1DA 2ETVA 2J3MA 3HBNA 5E7IA 3YASA 5M7EA 5JS1A 3EZ9A 5KDOA 3W8DA 5HWSA 2OXIA 3K3PA 4ABYA 1HQKA 4X94A 4HXFB 3ZHBA 1P75A 1X39A 1V95A 3PK0A 4Q37A 4E3ZA 1OVMA 2AZDA 2LZ0A 3GIWA 5HZGA 1K4MA 4DV7B 2OHVA 3GJRA 4X1IB 4D41A 4ZDKA 2QI9C 4R1UA 3PUVA 3JQDA 1XKXA 4JB2A 4PRYA 2OZKA 3Q3EA 4PCUA 3NHFA 5CURA 5CIWA 5DLQC 4WXEA 5TVGA 4A03A 4DEYA 5JJ5A 1WUTA 2QAGC 3ACBA 3ABSB 2WTXA 1RFLA 1G8HA 1CUUA 3B1FA 5WRFA 5GJWC 3Q1KA 1KJIA 4MS3B 4C6HA 3ZY4A 2O59A 3H9JA 1E3WA 1TKBA 1N0WA 1N77A 1RBYA 1F06A 3D64A 4PV7A 3DKPA 1J1UA 2J3DA 3KOYA 2C58A 3GJ4A 1F2TB 3MB8A 1U4OA 1HURA 1J2RA 1LLUA 3S2GA 3UOAB 3IAXA 3UK0A 4CFYA 1Z8NA 1TW2A 2H31A 3ZWOA 1H2HA 4UMVA 1KK2A 5LKAA 2Q9CA 1ZK4A 1KDPA 1OW3B 1P91A 3AHHA 4UHBA 3QGMA 2VWGA 1C0EA 3GLSA 4OLHA 5HTOA 4Q3CA 4S12A 4XVUA 1O8BA 4BMCA 1YUMA 2A30A 2GPWA 4EJ0A 4DOMA 4ESOA 1X7HA 2JCXA 3B7PA 4IIVA 4R2JA 3L1VA 1HDOA 2WFZA 3OF5A 4WKCA 4C76A 1XTQA 5CB4F 2HLHA 1E66A 4K6KA 2QTVA 3UC5A 5HUJA 3IVGA 1YL7A 2D6FA 2YINC 3B6ZA 3O3OB 4YBRA 4LVUA 5FXMA 3CLRD 2VQSA 2D4AA 4TLDA 2A9OA 2DKFA 3HZOA 1P72A 1T2DA 4U3JB 3ZWVA 2L82A 1FDSA 4K6CA 4DVGA 3GT7A 3N8DA 4MYSA 1G0OA 1E2LA 2YN4A 2IBTA 2VT3A 2YRXA 1P19A 2HRZA 3WIOA 4FDAA 3QMWA 2D7DA 4IIJF 4NPHA 4C6TA 1LD3A 4CEJA 1IAQA 2QLMA 3KEOA 2Q99A 4M37A 5T3YA 4B4WA 2ZT8A 3LWDA 2B61A 2C61A 2PLFA 2XCUA 4MUFA 3SM3A 4B6EA 4ZOQI 1V8PA 4RZSA 5F9FA 3ZVLA 1UBRS 2QMOA 1P17A 1NJ5A 2JFQA 2Q2WA 1V9CA 3DOUA 4YIKA 3DC2A 5KWEA 1JIKA 4YASA 1XA0A 2J9ZB 5H3CA 1LPPA 1UJNA 4RD1A 2YCBA 3A4TA 1HE4A 3CPJB 2DPHA 4WRRA 3B70A 4XFJA 3VH4A 4WW0A 1NUTA 3E81A 1O94C 1DXOA 1QZZA 3RSZA 1VYUA 3OT1B 5EJ4A 3NBFA 3GLIE 1H4TA 2ZYDA 3DUFA 4S1VA 1O0BA 2Z2YA 4KH0A 1K6MA 1SBZA 1JV2B 2YXEA 4TSFA 1GSOA 3JPYA 1ZBQA 3VOBA 1WOMA 1AN0A 4MCHA 3WJ2A 2Z1NA 2ZWMA 4CTKA 2H1VA 1Y80A 4HWRA 4MWBA 4J0GA 2XNSA 2EZ9A 4R1NA 4BVHA 1WRBA 2FN3A 3LUBA 3PJGA 4K9QA 1OBFO 4TYNA 1L1QA 3BTUA 3IRVA 4YRBA 1IZYA 1RSZA 2D1YA 2XLCA 1J7JA 3D7KA 4BP3A 3CVXA 1L4EA 2DUNA 3ZDYB 3DEFA 1BQ3A 4FS8A 4LRXA 2ONZA 1X7WB 2J3LA 4A3SA 3TB6A 4GRIA 2Y93A 2VHYA 3VYWA 4RA6A 4RPGA 2YXPX 4X7PA 3KQMA 4WLNA 3FY4A 1P9OA 3BEDA 1BXGB 2X40A 2XQKA 4PNZA 5LZ7A 3C3YA 3K6JA 1XZEA 3DZJA 4NOKA 1EE1A 1SVMA 2Q3BA 4FNOA 3RVMA 4ZEMA 3ZCPA 3C87A 5BSKA 4CCYB 1RJWA 1XRMA 1JKXA 1R3DA 4RFLA 3DF7A 2B4RO 1KPHA 4JROA 3C4JA 1TYBE 3F7NA 1Q92A 2QMYA 1ZIDA 2ZSUA 1RE0A 4XTRA 2PUCA 2UZIR 1NX9A 1G41A 2HMUA 2YUIA 5IT4A 5KTMA 1ISPA 5ICMA 2OZEA 5ALWA 2FSSA 2AMLA 3V8QA 4GSKA 2ZIZA 1E79D 1OLXB 2VUTA 2AW3A 2HBYA 1M6HA 4RL6A 4RY9A 2EDAA 2IXFA 4OFZA 4D9NA 4CKCA 4CNBA 1BS1A 3H11B 3SMQA 3L8GA 2P5YA 4I50A 4D82A 3VO1A 5DWVA 1TF2A 5B36A 4RHUA 4AXXA 4MKFA 3EA0A 3TL3A 1X19A 2XEDA 1EG7A 3EDQA 3K09A 4N40A 4KTVE 1GL6A 3BMCA 3D3WB 4DNQA 3FMIA 1YMQA 3M49A 1QKKA 5BN3B 2JFFA 1RJDA 3MMNA 4D9KA 2GN4A 1L2TA 1KDTA 2JDID 2NU7B 3KAQA 1IOVA 1IDN1 4RZUA 4UATA 1I6MA 4WOPA 4EGFA 3MNFA 1QFZA 2P3SA 2HA5A 5AYVA 3X0DA 2O1EA 3MTGA 1ZY2A 5KYYB 3EAGA 3L8MA 1VB5A 4GLJA 1MVLA 3AF2A 4K03A 1CY6A 1PGNA 4GZ5A 4UBJA 1PUXA 1R0KA 1YUNA 2Q6KA 1A9ZA 1XZQA 4N8EA 4RZXA 1NE2A 3O5AA 4CMAA 1CNFA 1QH8B 2V8OA 3O4VA 1TF7A 4L5JA 5D1HA 4LGVA 1FUKA 2ES4A 1EXNA 1NMEA 2ZRDA 3HADA 2XHEA 1MB9A 2AWOA 4PPYA 1M76A 3ZJYA 1NRIA 2GF9A 1KO4A 1O97C 2G0NA 1WPXA 1XHLA 3SBEA 5KVSA 1FLDA 3QOYA 3TM4A 1LX6A 3SXJA 4P33A 4UM9D 4BB0A 4QLOA 2DPXA 3IUQA 121PA 1PAUA 2COEA 3OLWA 5EIEA 3KFLA 1U8AA 2YRWA 1DKLA 3HB1A 3BICA 3C1AA 3GFSA 4MCIA 2PRIA 3DP9A 3EEYA 4R3WA 1IZ9A 2FSIA 3W90A 5AW2A 3W2EA 4M89A 1P5HA 4ZVUA 4X66B 4XOUA 1WMAA 4UNNA 5K99A 4GBMA 1DEXA 1E2PA 1JJAA 4EYQA 3I9LA 4CKBB 1VHWA 1PNTA 4G4IA 4CLRA 3AU9A 3FWKA 3KSDO 4OA8A 1FS5A 1DUSA 2PUVA 5KYTA 3L6BA 3CKYA 1KI8A 2P91A 2ZRNA 3AR7A 4KQJA 4I1RA 4B6QA 4LYYA 3JQAA 4ZK2A 5GONA 2YXBA 1MV8A 2OC4A 5A0FA 4F3RA 2HO4A 5KJFA 3G9QA 5AVRA 4BVKA 3CWZA 3AF4A 1QDUA 1P39A 2PWZA 3KQLA 3EZ7A 3QVSA 1Q16A 2H7CA 2ZU6A 3I92A 3SVTA 1WXXA 2XDQB 3C98A 3A1NA 2WTEA 1FSGA 3PTLA 5GP1A 4EKIA 4W5NA 1PD0A 2BY4A 4Z0NA 3UOGA 1Z5OA 3G8CA 2B94A 4R8LA 5TLSA 3DAFA 4Q3DA 3ZX4A 4Z3KA 1O95C 4QTZA 3TIXB 1A9XA 4C3UA 2M1XA 1I36A 1CRZA 4Y8VA 5JPCA 5EP1A 3LDFA 5E2AA 4WZAE 3BPSA 1QFMA 1FYFA 2NSDA 1RPJA 3ZN2A 2PEYA 4FJ2A 4OYHA 1QDEA 2XRZA 2ANCA 2C2ZA 1XBTA 4L08A 2VHUA 4OK6A 4TVKA 3HVKA 3TZHA 2YDYA 2XA2A 1R50A 4EATA 1EWKA 3ZV4A 3P5SA 3LCRA 1U7ZA 4PGAA 3NOVA 4HAZA 4E33A 1L5MA 1NJ6A 4NNOA 4AJ9A 4JB8A 4O2BF 3P9NA 1KOFA 2ZB2A 3D1VA 4L5AA 4X62B 1E0DA 2VKTA 3WWDA 4TTTS 2AR9A 5BVHA 4OV6B 4RAQA 4JSRA 5CLJA 2C96A 1BXZA 4R6WA 3H2BA 5DHTA 1JG7A 5L3QA 2A88A 1VDMA 2BFCB 2R1TB 2WIAA 3TNYA 3UQYS 1J8DA 4U2KA 3RUIA 3AHJA 1KYIA 1OY1A 2CN1A 2PO5A 3BRWA 4UCWA 3QNUA 3RHSA 1ZD9A 4I55F 8OHMA 5I47A 4TKVB 4HB2A 1CD5A 2MTBA 3Q10A 4YO7A 1CVLA 3ZUGA 5CCBA 2O8DA 5K6AA 3QVWA 5FFFA 2QTMA 4B3MB 1QFXA 3UHJA 3KAPA 4C4AA 3ZCVA 4NU6A 4ZZIA 5KTRA 2AA3A 3MSCA 2G70A 1D9XA 4BRUA 2HCJB 2MSKA 1JTEA 2QE6A 3KLPX 3VHXA 4BKUA 1KQNA 4Z7OB 5BRAA 1E32A 4D4IA 3T5PA 2NYRA 1DC5A 5FOUA 2H3EA 3FRIA 3RJTA 4FLEA 3QVJA 4ENTA 2Y0DA 1B26A 1HLPA 1SKBA 2J6HA 3B9PA 3PDIB 4E1BA 5CDTA 3RYIA 1PX0A 1IWOA 4U2GA 2P2DA 1Q7EA 1FP6A 3OM0A 4QATA 5BUSA 4QBFA 3WBJA 4NBSA 4CRWB 1L4LA 4HT3B 7GPBA 3A26A 4HAUA 2HCFA 1V1MB 3CE6A 4KBFA 4NEQA 4PSDA 4URWR 2GD1O 4UUAA 3ZU4A 5K51A 2AEEA 4Z2AA 2JKYA 4EKNB 1Z28A 3W5BA 3Q12A 2Q3FA 3KAJA 3NAGA 4KN9S 2QXUA 5AM3A 1OSNA 2WV9A 1XFAA 4GOMD 1LK5A 3A25A 5B7PA 2I1WA 1N1MA 4B5LA 4WJLA 2QRQA 1P1FA 1XCLA 1RQ7A 2JJYA 3JD0A 2HR1A 2CYBA 2J87A 1NR1A 3QP9A 3N8GA 2GESA 3PPXA 5K3FB 1K8ZB 1PLLA 2WSIA 3V42A 2JFPA 4L7VA 2NZ2A 5ADHA 4O4HB 4KQMA 2J08A 2A9PA 4M0LA 4GXTA 2XADA 3ONDA 5FBHA 5B3JA 1BYUA 5D6OA 4QBIA 2WU0A 1ONPA 4I36A 3IQIX 5AI0A 5B5SA 2A0YA 1CUJA 1YJBA 3N07A 1R12A 2FFJA 2XSZD 4MVJP 1O5OA 2QM7A 4XGRA 5DHAA 1E9AA 1VHLA 5AKJA 3ZY3A 3BD9A 5IT9A 1JEYA 2JBWA 3BRQA 2WIGA 1P5JA 3EVAA 3T9BA 3QSYA 1PZEA 4DA8A 2C5SA 1FP4A 1NFRA 2JASA 2WEKA 1HA3A 3CEMA 3I8OA 3M3HA 5A3RA 4HH3C 5MGNA 2D5LA 1T1GA 4JB3A 5BW5A 3NTUA 2EL7A 4KQWA 2QUAA 3V00A 4KIUA 3T61A 3L1UA 4NCAA 3IQXA 1AUXA 1L7DA 2HIHA 2IZZA 1TLFA 4YDHB 3BDIA 5EKDA 2HGSA 1RJEA 2YFHA 1HTTA 1L4MA 3EGOA 2CMHA 4GYYA 4LY3A 4PYKA 1ZLYA 4RESA 2VDVE 3W7VA 4A73A 4DNFA 4UDXX 1W5FA 1FYXA 3H0EA 4RZ2A 4B3SB 5I01A 3I0ZA 3RFUA 1OPXA 1QWSA 1WXFA 2CUZA 4WKPA 2FR8C 4BIIA 3FWYA 3TI9A 1HE8B 4TN1A 4P84A 3EFBA 4WASA 5LDGA 4C4XA 1Z08A 5B1IA 4I19A 4M1SA 2V7BA 3EVEA 4EABA 4HH0A 4PQEA 1NJ2A 2QSYA 4YNBA 1W2GA 3DTYA 4FJ1A 1D8TA 3MC1A 1I94B 2W2PA 2PKRA 2NU6B 1EVJA 2JAWA 3E9NA 3V4FA 4DMKA 3BQNB 3FVTA 2ZR8A 1LNSA 4GAEA 5JAIA 2ZB4A 5ERGB 1O7JA 5DGTA 4JJGA 5YASA 3E18A 1GGNA 1NG1A 1YCHA 4BWVA 1SXJA 2OP0A 4CZ2A 4QUBA 5K03A 1KAHA 3L40A 2ADMA 1AC5A 1EE2A 3EQ8A 3QRWA 5IASA 1E2JA 1R64A 2WI8A 4AUNA 1KO7A 4BWYA 1RTTA 1EFTA 4WKOA 4CG3A 5L7TA 5DLEA 3DLCA 4V39A 5A3QA 1XXHB 1ZVKA 1M2JA 1Z9BA 1R7RA 4GOOD 4LQCA 3VJLA 1P9RA 3QVVA 3C6XA 1HG1A 3BJMA 3ACCA 4GBJA 2J9GA 1U02A 4QBGB 5J2UF 5EESA 3TW8A 1QDLB 2C9DA 3CG4A 3CX6A 1FX1A 4M9XA 1ZJJA 3AJRA 5CRIA 3WQQA 2VBCA 5AI9A 4W5HA 2W9XA 3K0FB 1J24A 4CLHA 4B8YA 4DL9A 3SJCA 2XRYA 4NU8X 1DARA 4P4GA 3VR0A 1YK0A 2NV2B 1T25A 4HDNB 5HILA 2VTVA 3SICE 3O92A 1HOXA 1X8XA 3G8DA 3LVRE 4FYMA 3SJBA 5KO2A 2PYDA 1N2SA 2FFRA 3LD9A 1LK7A 1OOEA 4IEFB 5D84A 1G7SA 4L0QA 4YRNA 4TOIA 3ENQA 2VJMB 4YT8A 2ZRQA 4BVLA 1S5PA 4E2YA 1KOJA 1BS2A 3RWMB 2DU8A 2Q9AA 3UJ8A 4HLCA 1HDXA 1VIMA 1PNRA 3WIUA 1V7QA 2Z4SA 3FFAA 1LXCA 3BFVA 3ROFA 4QDOA 3NHLA 3G8YA 2ZJ6A 3DHVA 3VI3B 2BYTA 5ETJA 4Q7LA 2JCVA 4DIMA 1KI6B 1QOQB 4EVQA 4QNRA 2EL9A 2MYUA 1TQ6A 1U04A 2BEJA 2HSDA 3WSTA 1QHGA 1XXLA 1X7XB 1CY7A 1K68A 1LW6E 3EC1A 3EF1A 3GNLA 4FW9A 2H85A 5B6PA 3AU8A 1X8JA 1A8SA 2YWCA 3GFGA 4WIAA 4DV5B 3LK6A 3HGTA 3RJ9A 1P2SA 4UCQA 3EQ6A 2PGJA 3AM4A 4M1OA 4HMPA 4XLZA 1TT7A 5KVCA 2G9QA 3FB4A 3UTCA 1PW7A 1ACJA 1ZD3A 2VTKA 5FT9A 3WC4A 4CDRA 4NMLA 4GD3Q 3IR6A 4YWHA 1DMRA 2QSUA 3BZBA 1M0WA 1JEDA 5FAXA 3RYFB 1HLGA 1RAEA 4YAEA 1XNQB 4OBBA 3O7WA 3LQYA 3VDRA 4EUSA 4AJHA 5TMBA 3AUUA 4XSGA 2PZJA 2XECA 4J0DA 5DI3A 1QS0A 1IVNA 4ZZ0A 2QUKA 4LOLA 4EFKA 4YJGB 1ESMA 4JUAA 5AVKA 1FVOA 1J2JA 4Z1MD 4PG8A 1UT5A 3E3AA