3DYBA

Proteinase k- digalacturonic acid complex
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title High-resolution structure of proteinase K cocrystallized with digalacturonic acid.
pubmed doi rcsb
molecule tags Hydrolase
total genus 104
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3dybA00
2Z30A 4OMCA 2W2NA 1IC6A 2ST1A 4BWGA 1SUCA 4LVOA 1SBCA 5FFNA 1HT3A 4DZTA 1CSEE 5CW1A 1NDUA 1SCJA 3VYVA 1BFUA 3GT3A 1SBNE 1KDYA 4NMXB 5SICE 2SBTA 1SH7A 3CNQS 4KPGA 1WSDA 4DWWA 1GNVA 1Y3CE 3DE2X 3AJ9A 5JXIA 3VV3A 2P4EA 2HD4A 1LW6E 5JXGA 3L1KA 3I34X 1T1EA 1TM5E 2ID4A 1GTJ1 3VV2A 3WIUA 2PKCA 3D43A 1GA1A 1Y34E 3F49S 4H6VA 5ARBA 1BFKA 1SUPA 2X8JB 1Y9ZA 3P5BA 3DE3X 1GCIA 1SCBA 3DE4X 2HPZA 4M1ZA 4CFYA 1VSBA 1SN7A 2Z58A 4J94A 3EDYA 4KB5A 3LPAA 2W2QA 2PQ2A 4KG7A 1Y3FE 1GTL1 4GI3A 5AQEA 1PTKA 3SICE 2ZRQA 1Y1KE 4ZARA 1GTG1 3DVSX 1OYOA 3UNXA 2XTJA 4H6WA 3ZXXA 1ST2A 1BH6A 1TECE 3QTLA 3DVQX 4RYDA 2PWAA 3PTLA 1P8JA 1S02A 2SECE 3ZXYA 3BX1A 1S01A 1Y4DE 3EIFA 1R64A 3F7MA 4MZDA 2ZWPA 1SIBE 2G4VA 5JXHA 2W2PA 5I9SA 1Y33E 1KE2A 1YJCA 1KDVA 1AH2A 3DE0X 1JEAA 3DE6X 1SBHA 4H6XA 1OT5A 1BE6A 2IXTA 1TM4E 1ZVKA 1SUAA 1SUEA 1T1GA 1SBTA 2IY9A 1SUBA 1UBNA 1AF4A 3GT4A 1Q5PA 1BJRE 4HX2A 3DYBA 1SBIA 3I30X 1SCDA 1PEKE 5B1DA 1TK2A 2Z57A 1AV7A 1Y48E 3LPDA 1SPBS 2W2OA 5ARCA 1PFGA 1Y3DE 4NE7A 4WOBA 4AKSA 2Z56A 3DW3X 1R0RE 4B5LA 2Z2XA 4Z2AA 2XRMA 3TI7A 3SQOA 4C3VA 3WQBA 2B6NA 3AFGA 3I2YX 1DUIA 1A2QA 4FONA 1P7VA 3H42B 3DDZX 2DUJA 2QTWB 1PJ8A 1TO2E 1IAVA 1SIOA 1MEEA 3EE6A 2Z2YA 4C3UA 1MPTA 3QMPA 1ZVJA 4NE9A 4CFZA 3T41A 1WMEA 2SNIE 3VSBA 5ARDA 3BGOS 1AVTA 1ST3A 4YN3A 5FAXA 1GT91 3LXUX 2WWTA 5JXJA 4OV6B 1GA4A 3LPCA 1EA7A 2WUWE 3F7OA 1GNSA 3VTAA 3WIVA 2E1PA 1AU9A 5K7SA 3GCWA 1R6VA 3A3PA 1TM1E 1AK9A 2PYZA 4JP8A 2GKOA 2Z2ZA 2PRKA 1EGQA 1SCNE 1DBIA 2DP4E 3WHIA 4HVLA 1V5IA 1GA6A 3DWEX 1KDZA 1Y3BE 1AQNA 1SIUA 2TECE 4K8RB 5FBZA 1CNMA 1TM7E 2W2MA 2DQKA 1TM3E 4LVNA 1C9JA 1KE1A 3Q40A 3D9QX 5AVJA 3DE7X 4ZOQI 1SELA 2PMWB 1TO1E 3TECE 1TMGE 1SCAA 3A3NA 3I37X 2WV7A 4OMDA 2PWBA 1C3LA 1XF1A 3A3OA 3DW1X 3HJRA 1C9MA 2V8BA 5AVKA 1WVMA 1BE8A 2ID8A 1SVNA 3AJ8A 3PRKE 5B1EA 4DJ5X 3Q5GA 3OSZA 2WUVA 3CO0S 1OYVA 1NLUA 3GCXA 4CG0A 1Y4AE 1S2NA 2X8JA 3QFHA 3DVRX 2ZWOA 1YJAA 3DE5X 3DE1X 1SUDA 4AKTA 3TI9A 1YJBA 1C9NA 1NDQA 4WOCA 1P7WA 1V6CA 2SICE 5AMXA 3VHQA 5JMOA 1T1IA 1YU6A 4I0WB 1WMDA 1THMA 1WMFA 3BPSA
chains in the Genus database with same CATH superfamily
3BDIA 4O33A 3HYRA 3L7OA 2XZTA 4GP6A 3WFIA 4N1AA 3COYA 1EAYA 4U3JB 1FQOA 1WUKS 3N9IA 5ALYA 3T7KA 3QVGA 4JQZA 2XW6A 1XJQA 2Z08A 5CK4A 3KJHA 1JAIA 2VLBA 3KG2A 1GITA 3HSKA 4QQFA 1G66A 1UH5A 2ZAYA 4TLEA 1RVV1 4O02B 3SJCA 3O2JA 3TTTA 4MS3A 1X38A 1KVQA 1YD7A 3ASYA 3LY9A 4CWAA 4GP7A 1NSTA 3ZU3A 1I2AA 1MAWA 3IAFA 4GZLA 2C84A 2VP0A 4G37A 1JDTA 3IQHX 4I50A 1E5VA 1JQAA 3QLUA 3IIKA 3B1XA 4WCFA 5BSRA 3GWGA 1YNSA 2XNDD 5DHUA 1J06A 1U5BA 3SVLA 2ERXA 3VKGA 2F2TA 3C6QA 1GZ4A 3NRJA 1SH7A 1C29B 2DT8A 2W98A 2IF0A 3ZIAA 2EATA 4X45A 5EUCA 1PNVA 5GV8A 2XYQA 3F47A 4UM9B 2ZR0A 2X1MA 3GA7A 3V2UA 3B12A 4TVOA 4CM8B 1KQGA 4PGAA 4S2EA 3AJ9A 3GMDA 1SXHA 5JXIA 3HCCA 1Y4ZA 2IUSA 4WN9B 4FZ3A 3I2IA 4OP2A 4GOXA 4KEAA 1JIVA 1D0IA 2PGJA 3CUEF 4GR5A 3DTVB 3U4IA 3TLAA 3VV2A 2R2AA 1P74A 1X0VA 4MA5A 2EWWA 3GGGA 4MKXA 3R7SA 3BULA 1U9CA 3NU1A 2RC5A 2VDNB 5CP8A 5EVCA 5G40A 4C4ZA 2MYUA 4U7PB 5BQFA 1M6YA 2Q3FA 3IV6A 1QKKA 1S8AA 3DUFB 4O4HF 1W5FA 2UVDA 3OOWA 1RTTA 2FPXA 4KOEC 4BJ6A 1GGJA 6Q21A 4WESB 1II0A 2ZI4A 4C0KA 4KGZA 2C7BA 2H9IA 3HB4X 1CJTC 3FYTA 1NI5A 4C21A 3W5UA 1Y9ZA 1XYYA 4UCQA 2N42A 5D7NA 5LIRA 3B82A 4IGKA 2Y1DA 3LT4A 3PPIA 2QQ0A 4O5AA 1Y0BA 2AQ8A 2IELA 3FYHA 2W2VA 3GIDA 4PU0A 3RF7A 3UAYA 1IXZA 1D3AA 3ND7A 1A0OA 1K5PA 1XCBA 3QP9A 4JASB 1VSBA 4JDPA 4NBRA 3TPZA 4A8TA 2ZPAA 3QFFA 5B36A 1FW6A 1L4FA 2PX2A 3OZIA 4ZN6A 1ZNQO 3QIVA 5CW2A 2QZPA 4BRSA 1QQBA 3G8AA 3GQBB 4RH3A 1DX9A 1DWQA 4KSYA 4F56A 2PKEA 5AKIA 1BMFA 3LUAA 4ZJPA 2JD2A 4JB2A 5IAAA 4M36A 1Y3FE 2G0TA 5GV7A 4E30A 4TX1A 3OQVA 2HMVA 5EZQA 4DIUA 5SY9A 2PE5A 2VYQA 2E89A 3VKVA 2GBLA 3L6DA 3R76A 3SHOA 3AIKA 3LO8A 2RBGA 3CUWA 4OL0A 4RKFA 4ENTA 3FZEA 3GFBA 5DLQC 5A9TA 4EJ0A 1KY2A 1WXDA 1EDBA 1WEKA 1HT0A 5G0SA 2MR5A 3QWFA 5I7RA 3CZAA 3U61B 1GYQA 1A4IA 3DEIA 3N2GB 2I4NA 3C45A 4QDUA 3GFVA 4MHOA 1HFEL 3EVGA 3EYAA 5FP0A 3NEAA 1JBKA 3AR3A 3H5VA 3IR7A 4BLOA 5IVIA 5EEHA 4MDHA 5IJAA 1G2OA 3GT7A 3ANLA 1I24A 1TW2A 1T5DX 3NHJA 2NSHA 4X61A 4F96A 1UMDA 1YZTA 2FEKA 5M04A 2UZ4A 3AUUA 5LOVB 4TVBA 1T91A 2GJAA 2W8BB 3HGMA 3IJEB 1CS0B 5LQDA 4NBUA 1EBUA 1E9SA 2E48A 1F5NA 3DNMA 3MAGA 3VH3A 3OT4A 4M38A 2R60A 3QTBA 2UXDB 2FPGB 1USIA 1BYUA 3O92A 5IJZA 3HK2A 1E32A 1YR6A 3CMCO 2PYIA 4XIGS 2BGGA 4PO9A 2H5LA 3U4DA 1GYPA 1V47A 4R6XA 1LJUA 4P7JA 2W6JA 5IBQA 3CGGA 4OIMA 3U31A 2ECOA 4DZRA 3VVCA 4IDQA 5FLEX 5J40A 4HZUB 1IBSA 4C88A 5BQXA 2C2HA 1NUPA 4YCAA 4IDPA 2PPLA 3I39X 4KPUB 4GBGA 4J1TA 1QP0A 5FL3A 5B1HA 2BKVA 3ZGYA 5L9AA 1FRQA 1AC5A 1CR1A 2AOXA 3LW7A 2M1ZA 4QBFA 4B2LA 9GPBA 5GY7A 5GZ1A 1KIFA 3JQBA 4DQXA 2GILA 3BGIA 5CX1B 1VB3A 2CNOA 2QA5A 3EZ9A 5CVCA 1BWSA 1MO5A 4GH5A 3BF7A 1GGVA 2V03A 3EEYA 4K9PA 4LSZA 4R2HA 3K5PA 4F8JA 3SJ7A 1FTQA 3R7LA 1AGXA 1KE2A 1SVIA 1XU7A 2BUCA 3DEAA 1F0NA 1V5FA 1B8PA 2YY6A 3B7GA 4HDNA 3OEEA 2C1EA 4RZXA 5IC5A 1Z35A 4AW9A 2BGLA 1BXRB 2BJVA 4JH0A 5REQB 1YA6A 4O29A 4K0KB 4YRIA 5K3BA 2BP7A 1Z0UA 2J3EA 3AR2A 3IUEA 2AG1A 4QREA 1X1AA 2C4TA 2YHUA 1IH8A 4M49A 1OTXA 4RDHA 2MMGA 2G76A 3TEJA 4HUQB 1IY9A 1J2UA 4UD2A 4DUGA 2PZ8A 1YDGA 1FXWF 3JWPA 4CN8A 4F38A 1DMSA 4IGEA 4EKEA 2SHKA 4CKEA 2PSFA 2AEMA 4FYHA 1PGJA 5CPBA 1P4SA 2VTDA 3CTMA 3EPPA 4AJ9A 4DV2B 2D13A 1AF4A 3DEKA 4PGFA 5HGJA 1RAIA 2ZUUA 4ZQBA 4AICA 4U6NA 1QNLA 2IHYA 3DOHA 3LVQE 5B1SA 3OHPA 2PG3A 1O6ZA 4YTEA 1MC4A 1CR0A 2XIJA 1H8ED 4M7OA 4XWTA 1BXZA 3BD8A 4Y6OA 2PV0A 1K7EB 1R9GA 1W88A 2VH1A 1NPDA 5GPBA 2Q07A 4Q47A 2JD1A 1BSVA 2O3SA 4OHBA 3VJMA 3LHIA 2JANA 2AYYA 4YDRA 3W5HA 1C3JA 4C0HA 1OH7A 1XU9A 3FPGA 1EE9A 2BSQA 3X1DA 3ND6A 3E7WA 2OXTA 4B75A 5IT4A 1V3TA 1U0HC 3PYXA 2PZMA 1SPBS 1SB8A 5AH0A 3RIMA 3MCAA 1GPBA 5K2MA 5HJ5A 1HE1C 3B6EA 3BQNB 3D0RA 5JAZA 3CYFA 2ZT6A 2AUTA 3H3XA 3JQFC 2DYKA 1CZUA 2ZBFA 2G4CA 5KYXB 1K7FB 4P3YA 2RH5A 3R9XB 1ZVVA 3ZOKA 3QVUA 3PUVA 4DA8A 3JD3A 1OLXB 3TLBA 3NBFA 4RF5A 3CH5A 3TSCA 4EWLA 1NIJA 2QLJA 4IM7A 1VTKA 2HLNA 5GJWC 1Q1QA 2ORYA 3EARA 1YS7A 1OZAA 1IZ7A 2GA9A 1KZ7B 3OX3A 4L85A 1NOKA 4V3CA 1PFUA 4PLCA 4D44A 1K4KA 4ENUA 4I1PA 2FZCA 4B3FX 2OCXA 4C7BA 4DJDC 4FNOA 4NJEA 4Q1VA 1ACLA 1TZKA 1S3IA 2JI8A 3P9IA 4HDSB 4L51A 4NR0A 2REBA 3MB5A 4HBGA 5WRFA 3IPXA 4HNAA 1VBMA 4B81A 2GZDA 1ENOA 1UJNA 1VYTA 3OT1A 1L8AA 1UOPA 1HNXB 2FB9A 2ZIXB 1E2IA 3BB4A 1PJ8A 3LF1A 4HGRA 2C9YA 4O59O 1TO2E 4REQB 4OREX 5CCDA 3O4RA 1EQ2A 2IEDA 2H4JA 4TKUB 3V4OA 4BMSA 5JYCA 3EE6A 2CVHA 3IEKA 4JB0A 4NARA 4IXTA 4MCJA 4NCJA 3C8ZA 4I9GA 5FTJA 4PQYA 4NDZA 3LCJA 3LHDA 4GR9A 1QRSA 4P81A 5K6AC 3JR7A 3OLXA 1II8B 3VO1A 3KQQA 3NBYC 4EZBA 3DDHA 3N0WA 2JZOA 4DUYB 1DQZA 3B70A 3RT7A 4OLBA 1ZQ1A 3A1VA 4ZD6A 3RU3A 2W0SA 3NTQA 5TSDA 1HXHA 3GU3A 2TYSB 4ZRNA 5AW7A 2KE5A 3R9XA 2AMFA 2A84A 1P2VA 2OC4A 1IEVA 2P9JA 4R9NA 1H4VB 3QKWA 4GNKA 1VBKA 2FMIA 4RY8A 1HDYA 1OX4A 3K35A 4CCYA 2IXAA 3H2GA 3HXKA 4EMUA 2XMRA 4QOGA 4E2WA 4ZEMA 3IMCA 4PX9A 1RJ9B 3T7DA 4E6PA 1PK8A 3PQFA 2P1ZA 2D59A 4Z53A 2ILTA 4JC8A 5F51A 1M10A 2EZ9A 1REQB 2XOXA 4XE5A 3V8QA 3GGOA 1JH8A 3P27A 2XI4A 1X13A 2FFHA 1NLYA 2I62A 3OQIB 3GLFA 3WADA 4NABA 5DHAA 1F3OA 1N9GB 1C7QA 3CLTD 2XCTB 4Y3UA 2O0KA 2ZI5A 3OU2A 5HKOA 5ESXA 1E4EA 5U4QA 2D0PB 3NHYA 3PUZA 3KYDB 2YL2A 1GGNA 1NFFA 2DAPA 3K53A 4Q4JB 1PZXA 2V7QD 2PS9A 3RK4A 3WJAA 5A3QA 1ZJZA 1ZQ9A 5ITVA 1O5TA 2DBZA 1PN3A 2PMKA 3K30A 5E0KB 5B3KA 4JFAA 5KUTA 1M2NA 3BE8A 4XR9A 3V9PA 1P18A 3TXAA 3DG9A 4RDXA 1SRQA 2UAGA 2W70A 4TRRA 4Z9AA 4JGIA 1MN6A 4IH9A 1V5IA 3ELDA 3RUFA 1ZM7A 2AXPA 3KHSA 5D5QA 2O5RA 4GPIB 3RJTA 3F5MA 5IKPA 3EIQA 4Q3AA 4AS3A 2Q29A 2XXAA 4QWWA 3WC4A 4HDQB 4LCEA 4OQPA 2F3QA 5A06A 1PL8A 4NPAA 5AHRA 4L6CA 3RGGA 1GP2A 4MSUA 3T7EA 2PJRA 2QI9C 4K8RB 1OXVA 3DBHA 4HQKA 2PK3A 3QVMA 1LBTA 5JD3A 3C3PA 4U7GA 5C52B 3CX4A 1MVNA 4Q15A 2FPGA 3FFWA 4TL8A 3KSDO 2DKNA 1ENYA 3M5DA 1ZXXA 2IGTA 2GF0A 4WASA 5CYOA 2I22A 4PAMA 4L2IB 5AFSA 5SY6A 1LDEA 1KYTA 3ZU6A 4AD8A 1Z29A 4TGLA 2RJ3A 2H63A 4WLUA 3KAQA 5JH7B 2A30A 2CK3A 4DNOA 1NZFA 2FWAA 2BDEA 2EP7A 4FE7A 4LZZA 5CDHA 1GPAA 2QN9A 5AUOB 3ZXSA 3ENKA 2BRUA 3PD1A 1D6MA 4LXIA 3GY0A 3ZTYA 4RESA 4D3FA 4DQLA 5C46F 3Q40A 4WLEA 3DBLB 4G8CA 3LUDA 3ZX4A 4KMRA 3F3YA 3UJAA 4DAOA 8ATCA 3COJA 4ZOQI 1T36A 2AE2A 1L7DA 2BHLA 3MXOA 3KEFA 4EG6A 1GPH1 2ZYWX 2Q4TA 4HTAA 5JALA 2BFFB 4AQYB 3AHJA 1YTLA 4OHMA 4Q3KA 1H3FA 1T35A 4O2BB 5C3UA 2QX6A 3I01M 5ENZA 2JJMA 1JYFA 2JLVA 3RRNA 3SG0A 3TRJA 2BBOA 3AKZA 2JIOA 3DDNA 3GLIA 3GPCA 1Z17A 2FZVA 3DCYA 4MKRA 2ONZA 2R68A 4KGDA 3KXDA 4H0CA 3SNHA 1Z5UA 4O4JA 1J8FA 5DOZA 5GM2A 4EEZA 2V3WA 3HGQA 1RLUA 4K8OA 5FBHA 1RC8A 2ZYDA 3RYCA 1E0DA 3RK1A 5FTKA 2WWYA 1PFWA 4LMRA 2JLQA 3JZFA 3MXTA 1R74A 1BE8A 1TYDE 3AHEA 1SVNA 1WPQA 3D8BA 1W34A 1O57A 1V0JA 2HDWA 5JJBA 1NI4B 1KEKA 4HUTA 4CR6A 1FTWA 1YZYA 4ND7A 5KU1A 2E9SA 3NP7A 4PNZA 1SC6A 2Z8ZA 1NKTA 1XP8A 1CY8A 1HQDA 4KR9A 4KVFA 3H99A 1EB8A 1QGDA 1Q50A 2C5AA 2MU1A 3DBOB 4XPIA 2LXNA 3AJDA 4TV8F 4E3WA 2XUFA 3FDXA 2WSMA 3GCXA 5LNK1 3D3WA 3ZS8A 3JD4A 4Q1FA 2XA1A 2PV7A 1VJDA 1RC0A 5BPFA 2GTIA 3U16A 1BKDR 1WZCA 2V0CA 2FJUA 4TM8A 4UATA 3FFBA 5AK6A 4E32A 1ISSA 1XZLA 2QRKA 2VPZA 2VZLA 1ELOA 1RR6A 3E58A 5DNEA 5LB2A 3NIDB 2F48A 2WSIA 1E5QA 3WIBA 3LGXA 2VT3A 3I0ZA 2J09A 3UHJA 1RQNA 3WZMA 3DOUA 1GQSA 4MV0A 4DARA 4C7OB 2IE0A 1YQ9A 3W2IA 3OPXA 2I3DA 4YI3A 1V7PC 3T3OA 4MQMA 1WXEA 2YQ5A 5A3JA 1PQYA 1N2CE 2XF8A 1BN7A 1O6BA 4PTLA 3C3KA 3KKZA 4YCDA 1DRKA 3B2QA 2IIBA 4WOCA 3VH4A 1DX6A 3T1QA 4KR0A 3A14A 4PTZA 5HIAA 4J0DA 1E9EA 2SICE 2XAAA 2ZYSA 3RFVA 2OTCA 3I72A 1YU6A 4O4IF 1WMDA 3AFNA 2CC2A 3VNVA 1GQRA 4BBJA 1HGXA 4MUKA 3QW2A 4KQ9A 3C3AA 4P58A 2NUTB 3V8VA 2NVUA 2PJDA 3CNHA 1THMA 1I4DD 4TWBA 1GLGA 4E3ZA 4Z9XA 5B1YA 4K40A 1HTBA 2YJ5A 2O3TA 2QU8A 4RULA 5H5JA 1XTZA 2WJGA 4PIPA 1UBCA 2EBWA 5U4XA 1Z06A 1ZM4A 3B52X 4EVIA 13PKA 1VJ5A 3VJRA 3AVXA 1XVVA 2R48A 4M0EA 4DBVO 1E2UA 1QWOA 2BMWA 3F4KA 3SS9X 4N39A 4XCQA 1XPJA 5IZ4A 1YQXA 4JX9A 4IJUA 4XR4A 1KGDA 3BORA 3II6X 5L3ZA 5CLFA 3HBLA 3KPWA 1EH5A 1BKYA 1P9WA 1EP9A 4KUHA 5LWHA 4EA9A 2AZXA 1A5BB 2EG9A 3JZIA 3U49A 4CMEA 4HTFB 4Q48A 5ALZA 3ZHTA 1GU0A 3RBAA 3L7AA 5BWOA 1TTTA 3DDUA 5IG2A 3IPYA 1JB1A 4NZNA 1GGHA 4U2FA 1E3WB 3SM9A 3KXIA 2CCKA 1E7QA 3AR9A 1TKRA 1JEDA 1JDBB 2ZWMA 3MTGA 5LLSA 2FMTA 1IEQA 4ENWA 2AS0A 2N1MA 1KKMA 2UYQA 1JFSA 4TWJA 2HXGA 2Y0CA 2VCHA 4BLTA 3NVMB 2COKA 3VZBA 1RZRD 3G2NA 3AEYA 2ECKA 5BYAA 4Q5IA 2CE2X 3R0IA 3B1FA 3TSZA 2P4EA 2ZBVA 1V3UA 2B1QA 4JBXA 4LQDA 1YBVA 3C6KA 4BQQA 1I0ZA 5THKA 1KKLA 2H17A 2BEUB 2O0HA 2WT8A 1X8KA 3FHLA 4JYAB 2JLXA 3UWPA 1RAAA 3GLQA 4DA7A 2YS7A 4BWFB 4D80A 4QXMA 1MTZA 1AKNA 3ZU2A 1B6SA 5ICSA 4E2ZA 4XWYA 4MDEA 3OQ1A 4KIJA 5IBCA 5LP6A 5EE1A 1N9KA 1I7LA 4L0DA 1XF9A 4Q18A 4LX8A 1XRJA 2IOHA 2XGSA 2L2QA 3DOEA 1DBSA 2WK1A 3OZFA 5I7WA 1YRAA 1T3LA 2RD2A 1E3LA 1Q7CA 2XUDA 3BILA 3RC9A 3GYGA 4CR8A 2F4NA 1NBIA 4Y1RB 4PIMA 4BEBA 3PC7A 4UDOA 1Y1RA 4YJGB 1A4XA 2YV1A 1AKVA 1I2BA 1JU4A 1SVSA 3FDFA 3HYNA 5CFNA 4X1IA 1EFLA 3ZZ0A 4S04A 5AK4A 3EZLA 3BB3A 3TE6A 3CLUC 2D7CA 5BSHA 4G0XA 5DW0A 2O8CB 1ISIA 1JEQA 3EGEA 3OA2A 2Z58A 2PGLA 4RIHA 2W42A 1O7JA 1YIOA 5AI9A 5M29A 1DNPA 1N8NA 4B44A 1UAAA 1N2EA 4LWZA 3FYSA 1Z63A 2JH8A 1FFCA 3LI2A 1Y1PA 4TQAA 5F2KA 2ZUFA 4TZ6A 3VX3A 5PGMA 3UO8B 1N8KA 2DHEA 4HSGA 2GO7A 3AZPA 4KVAA 4R2WA 1KZ1A 3MINA 2PX0A 2XT6A 2VAPA 4E5VA 1V9CA 2ZQYA 5I3ZA 3U19A 1GCAA 4KYVA 1NVKA 4ED9A 5G3ZA 2QJTA 4TT3D 5EIBD 4DCOA 5BOSB 3F46A 3G9TA 5KOHB 3DWGA 4RIGA 1C0KA 3GJRA 5F21A 5A4AA 1E2KA 4IQFA 2H48A 3TFWA 4CEHA 3NYQA 2WWVD 2WMOB 4RFSA 1LS1A 4X1KA 3IVAA 4M22A 4D3ZA 3W05A 3OX1A 1Y4UA 1VJCA 2GZ2A 3SI7A 4QGSA 3H8WA 3RAJA 3V7YA 3L92A 4I9UA 5CYGA 2PX4A 1YHNA 4YDHB 4JQYA 2CN1A 4HQNA 4GRAA 4E2YA 4RF3A 4I1RA 1TEXA 4P80A 2XTJA 4F4IA 3LOQA 3MWJA 5JSKA 4YECA 3KAPA 1BW9A 1TK3A 1OLUB 4H6WA 4TYQA 3W1EA 3ERCA 1PSWA 3CWZA 4PFKA 3D54D 3PNPA 4HDCA 4UEKA 2FYTA 3AQ4A 4YRAA 2CNWD 3OF2A 3OM1A 2NWQA 4GFDA 5A4JA 5GMOA 4EPWA 2EJCA 1AHHA 2GJ4A 2ZP1A 3DVQX 1ML3A 2VPWA 3KHUA 3LZDA 3FPEA 4ITVA 2XR1A 4TTTS 2AMVA 5CLGA 4OA5A 4JC4A 1XQXA 1YDHA 1Y5LA 2P2GA 3DLCA 4BLSA 4E7OA 4QNMA 1P8JA 4QVIA 4FCTA 5BNFA 2DU8A 4XD7D 4IWNA 3ZHQA 3I23A 4BMCA 2O2CA 5J1TB 1QH8A 2CBXA 3DLIA 3L04A 1JR3E 2FR1A 3R5FA 2ZRKA 5LU8A 1D1PA 4TSRA 5T4BA 5HUQA 1UKCA 5ES4B 1W8DA 2HNKA 2SKEA 4WGGA 1XD2B 2BFWA 2OV2A 1SZCA 4FK8A 4R5MA 1H2FA 4NAVA 4EJSC 3OO1A 1ZJJA 1XRQA 1EVQA 3H0EA 1JECA 3BWBA 3T5AA 3DFZA 4Y6GB 2G28A 1W2HA 2IYWA 1AMUA 2QMZA 1A7AA 1C0EA 3M6VA 5C1IA 3CCCA 4CG0A 1OWNA 1SZDA 3M5WA 4G4GA 2VNAA 3IULA 1FRZA 4L22A 4MWSA 4P22A 5I9SA 3ZLTA 3IFSA 2EZTA 2G07A 3GUUA 2OQRA 5FNVB 5AVSA 2CSUA 3TEFA 2REQB 4WD3A 4LF9B 4QVKA 4FNMA 4MGZR 3UBTA 1Z0KA 5K0EA 1Q6YA 4DJTA 4YAKA 5CCBA 2ZM6B 2O48X 3BGWA 1ITZA 2JK1A 2VEOA 3KBOA 1CJMA 1SUEA 4Z8XA 1OC2A 3PBKA 4HYTA 3AC0A 1U2QA 3OOSA 5BPHA 4PQFA 2H65A 1HTWA 4UPDA 3ZHZA 2BBSA 1T4MA 1WMAA 3S1SA 4HPWA 4LF4B 5DHSA 3GJ4A 1T3HA 2QPTA 3QPUA 1UFRA 3PVCA 1D9ZA 1PNOA 1B0UA 2HMSA 3E9YA 2JIRA 5TB5A 4RPLA 2A94A 3L8FA 3VYRB 4WXRA 2QORA 3DV2A 3K73O 2POCA 1M83A 3V00A 4L8FA 4C4AA 3OIYA 1JG7A 3A2NA 3VZCA 5IAKA 1QG2A 5B1DA 3D6FA 1EDZA 3SR3A 5TQJA 1YULA 3AMVA 3FPBA 4GHWA 4NNJA 5L3RA 2NMVA 1YFZA 1FDVA 2B21A 1ZIXA 4PC7A 3VJLA 1O3YA 5EERA 1P7ZA 4HS4A 1SXJD 2X0KA 1TQ4A 4JP1A 1SG6A 4DREA 1M2KA 4FFBA 2AQIA 1VL5A 4GGMX 3LKDA 4E21A 3O8RA 2PVCA 3T1VA 3WGKA 2O9JA 2Y66A 5D3MA 1M1YE 2QM7A 2Y2VA 3C7AA 1PFGA 3F4LA 4CL8A 1JJIA 4OFXA 1R8QA 3DMHA 4AN1A 4AZ3A 3H1GA 4LZPA 2R5WA 4BKPA 2C0PA 3L3BA 4BNDA 3FOEC 1M8JA 2YFHA 1CXZA 4MRAA 2HWUA 1F7UA 5G4KB 2HCJB 1GPKA 1N9ZA 3C6BA 3FTCA 4QLOA 2OCYC 1WXHA 1D1QA 2HMTA 2G83A 2H1VA 3B51X 4ND2A 4L4UA 3SZUA 2XRMA 1JPJA 3ASUA 2HSGA 8GPBA 4HF7A 3CJTA 4I99A 3WZLA 2B6NA 2P8SA 5B58T 4DG8A 5I7OA 2VC2B 1T3TA 3BXXA 3H2IA 4BZZA 3GLSA 5JHGB 3H1PA 2IEYA 3OE7D 3ZD9A 2IXEA 4YV0A 3H4TA 2WYUA 2HU7A 4XSVA 2HBRA 3E1KA 3OD1A 1KMQA 4XIYA 3DDZX 1ISHA 4QOEA 5C5CA 1T9GR 4QGGA 3UQYS 4YV2A 1WXWA 3CCBA 3EGOA 3UHFA 1BCSB 4LYGA 1IAVA 1T5TA 1TUBA 1HDCA 1F20A 3D5EA 3H16A 5DSTA 3AR5A 4Q7QA 4ZGBA 1MABB 3B1YA 3N2IA 2HU2A 4RVHA 4UCWA 3KUUA 4N3GA 1C0PA 1QHIA 1USKA 1QYCA 4OSOA 4XIFA 4INOA 2I3ZA 3FFTA 2OCPA 4UXIA 4PYOA 5BRNA 5KAMA 3SU8A 2BGTA 3O6VA 4J1SA 2YVAA 2GT1A 4K9KA 4TOIA 3NEPX 1RWVA 1OH8A 1JL3A 2ZIWB 4FHFA 4YK7A 2XRZA 3HCRA 2ZJFA 3FI9A 4TLCA 3LO5A 5AKJA 3IAS1 1ABBA 5K01A 3JS5A 2AFHB 3KDSE 4HWTA 2QKYA 2BE7A 1SG0A 2XODA 3I9V1 1U2EA 5ADWA 3BCRA 1EWTA 2NT3A 4QDTA 3USZA 4EB0A 1GNSA 3O8QA 2CXOA 3PDIA 1LFDB 1PU2A 3HWX1 3Q7RA 3QWBA 1NNLA 2X0JA 1WNFA 4FSDA 1HMYA 1KEVA 1N1DA 4Q02A 4Q1EA 3H5OA 2HA5A 3BFXA 3H4MA 3JYLA 5EP4A 1QK4A 3T4PA 9MHTA 1M6VA 1R6TA 3P52A 1YWGO 1B43A 1PDVA 4RTNA 2E4WA 4J9VA 3GLTA 2D00A 3PWZA 1O4WA 2XWQA 4ZHQA 4XVRA 3CKLA 4YJ2F 4BFLA 4RD4A 5JSZA 2HHHB 2IU6A 5DZSA 3K9CA 5HSGA 2QTFA 3JX9A 1TJ4A 1X9GA 3TEMA 5BVGB 5AJYA 3ILSA 5H83A 1LSSA 2D6FA 4JBIA 3DCIA 2YDXA 4MYTA 3LWNA 2XKJE 5C8ZA 3AVYA 1XVLA 3K09C 1VECA 5T3YA 2X4DA 3ZLUA 1WB9A 1XIVA 2DP4E 2RBKA 1HNNA 1T2EA 5HEKA 2VA8A 5A7FA 2WC1A 1NBHA 5LFAA 2JLCA 3GNQA 4II7A 3GDWA 1VGQA 1BHSA 1MKYA 2P7HA 2RSLA 4V1CA 3ICEA 4YV7A 3JATB 4GSYA 4NYIR 4PLYA 4BAGA 4GEKA 1EFPA 3LVFO 3LIIA 3C0KA 3AYXB 2X9LA 2PLWA 2VLIA 3JR3A 2O8DA 1FXSA 1M0SA 1X1BA 4XDGA 3ZV6A 1HKUA 2ZBUA 5EFZA 5FB3A 1G21B 2CF6A 3N59A 3SE7A 1DAGA 2YZNA 3G2MA 1EIZA 2VL7A 3JAWA 4C87A 1Y9JA 2QX4A 5ALOA 4ZICA 4OA8A 2WM9B 2AX4A 3Q3EA 4P83A 5FXMA 1RWWA 2CB0A 2ZSBA 2AI1A 2N46A 3UTCA 4AMVA 1UODA 3L8MA 2C7PA 2Y1FA 4LJLA 5IYZA 4P0TA 4MDYA 2BMFA 3Q11A 5AI8A 5DN6D 1ZZEA 2RGWA 3VNBA 5THQA 5CDTA 3PRHA 2NVOA 2JIBA 1TU0A 5HWSA 1V2GA 3FZNA 4RHFA 3PGA1 3SXUB 1TEZA 1YQGA 3IUJA 2ZRIA 3MMPA 3WP0A 4RVNA 1YIDA 2ROQA 2ISQA 3K1ZA 1SA0B 5EOVA 2V7GA 3ETGA 1TC2A 4A92A 4NDNE 1TO1E 2BEVB 2QLLA 1QG0A 1QORA 2B35A 2CJYA 4FKBA 3GEBA 3PHGA 4NHEA 3QU7A 3U62A 2Y27A 3WKCA 3T4UA 1ZN2A 3UT0A 2AC4A 3V1NA 2UZ3A 2AXQA 4CMAA 3DAFA 2Z6VA 1ZHHA 2LRHA 3BF8A 3OY2A 2O20A 1Y1QA 4WXYB 5F1KA 1RE1A 3E3NA 2CV2A 1GSHA 2H57A 1Z6GA 3C7KA 3ZDCA 3T15A 4Y6LA 3V8MA 1H1DA 1ZCZA 2FSPA 4CF5A 3AOGA 1HSZA 3QWIA 5IBRA 1LF5A 4OHPA 3IELA 4YLEA 2JH9A 2BZGA 5CA0F 1IB0A 1NRJB 3AFIA 4G89A 4KYIB 4S05A 5FO1A 1XQYA 1YE5A 2D4AA 2LZ0A 2OVBA 2WJ3A 1XG5A 1ECFA 3KT0A 4Y6PA 5IEJA 2A5JA 4FCWA 1W87A 1LNSA 2JGMA 4ZC1A 2WB2A 4DR2B 4EIWA 4LTMA 2CKMA 3TR0A 5DYTA 3ZIUA 4Q9AA 1ZGBA 3CUSA 3K7EA 1SPXA 2FHSA 2HWXA 1SXGA 3LBFA 2LTAA 4I4TF 3AUFA 4JUBA 4ZAYA 1QU3A 3EZ6A 4M99A 4PCUA 4Y67A 1JVBA 2QIPA 3BERA 4NBVA 4Q19A 2YNMD 5JBNA 1P1FA 3UUWA 1DARA 3H87A 2R5NA 1K8ZB 4AXXA 1UBKS 2W2KA 3V4RA 5JAIA 4G41A 4RD2A 4C2TA 5EP1A 3AVUA 4NCNA 1T8UA 2GX6A 1KFEB 3F8WA 3HKBA 1M5TA 1C2TA 4NV1A 1NMSA 3ZNPA 1CUAA 2VRCA 3D31A 4ML3A 5ENDA 4M1TA 2G06A 3ORHA 1GN8A 3L4KA 5K3FA 2G4LA 4YPFA 2A88A 3R0XA 1AM4D 4PFJA 2P9BA 1MLDA 3EVDA 3VI4B 4E1VA 5BQ5A 5L6LB 1QF7A 2OO3A 1YBMA 4O4HB 3IBTA 1SO8A 4MEBA 4OBWA 4EFLA 2FSVC 1RCFA 3R3XA 4FYKA 4LYHA 1MHTA 2FN4A 3UT6A 1U7DA 1VKRA 1TVKB 4GIBA 4WOJA 3ZQ6A 4MZXA 1HZJA 1UXHA 4YAIA 4BNZA 2D7DA 4LJAA 3T5PA 2BE9A 3QVOA 3BUSA 4CTJA 1DAMA 3R4CA 3VKHA 2Z09A 1LBHA 3AB3A 3RS8A 3UBMA 3WK8A 5FDFA 3TKLA 1HX7A 2ZJ5A 1WQ4A 3CX6A 3BL6A 2JCSA 2WIJA 3RG8A 5KX5F 1XA0A 4RS4A 1QOQB 4QKQA 1R4NA 3MUOA 4UTXA 3SEAA 4BKOA 5CH3A 3B78A 4BGUA 5K0FA 3AHHA 4AUNA 4EF6A 2OMEA 3O4HA 2VQEB 4MQFB 1N2IA 1QUEA 2IOFK 5LIPA 4OMCA 4C3ZA 1P62B 1YHZA 3H2JA 5DGXA 2W2NA 5IMSA 5HUHA 1UKBA 1HOXA 4JXJA 3AK4A 1LRLA 1IN1A 1Z6XA 1BRTA 3RR2A 3CLVA 3GNLA 4X9XA 2GBLC 1SGWA 1OU0A 1QDLB 4Y18A 5LB4A 2LPMA 1GTSA 3A1NA 3GXOA 2ZRMA 2P1DA 4DV0B 1RD4A 2VTEA 1ZUNA 4MWTA 4B5KA 1X74A 2O2JA 3QKSB 1AY0A 2B8TA 4UPVA 5FI5A 3VDXA 2OFPA 3Q5EA 1SHLA 1I33A 3B85A 3PXEA 4C6SA 4KRFA 1XXHB 4QXPA 4KWCA 4D9IA 1RHQA 3AUXA 1YNOA 2WU3A 3NO4A 5ED4A 1ZD9A 4XKJA 4B33A 5J2TA 1DXQA 4PPQA 2MSEB 4JI1B 3N05A 3QE0A 3ME5A 4KQHA 2OCLA 2P5YA 4POOA 4U7FA 2B1JA 2PANA 2QW1A 4M21A 4CMJA 2PL3A 4KPGA 1MRNA 2FWBA 1R00A 4GM4A 3L1UA 2BJWA 1PLJA 1S1MA 3L8EA 1E92A 3ACCA 4KYUA 1ZKMA 2BTQA 2W6PA 4Y0AA 4DLXA 5IT0A 2H5EA 4J6FA 1GNVA 3ZE8A 5C5EA 1U1EA 5J9FA 3CA8A 3ICVA 2QJOA 2OFWA 3AIOA 3OCWA 3VV3A 4MLDA 1VFPA 3FG9A 4YAFA 1LW6E 3GDOA 2Y9PB 4BZQA 5TE9A 3KQWA 2C5FA 2ZYTX 3VI3B 1GQOA 4QOSA 2QTZA 4FYXA 3BG5A 1L1QA 3DS8A 4TMWA 4EPTA 2IBSA 4EITA 3L18A 2YOHA 3CVVA 5K3SA 4RSRA 4DA4A 3WQRA 1E1RD 1JHAA 2XAUA 5JVDA 1IHDA 1T13A 2GZ1A 4RFVA 5L3QB 1XYGA 2PSJA 4D9NA 1NW8A 1V1MB 3ET5A 3N75A 4H6VA 3FUUA 3FNGA 1QLHA 1WIWA 2GK3A 4EUSA 4TMFA 2C54A 1W1UA 4HXFB 2JAHA 2UDPA 1CCWA 3ZVLA 3NEJA 1R0XA 2HA2A 4HK4A 1N0IA 4KN9S 5GJVC 3WQQA 1NR1A 5BR4A 4K9MA 4TXMA 2EKBA 3CRZA 2WMDA 3PFGA 4YUXA 1CWUA 4HH3C 3OJXA 4OXKA 4FCCA 2AOVA 3TZKA 4C14A 3KD3A 3S2UA 4RVCA 2FPIA 4W82A 3S2SA 3WSVA 1NXXA 1I32A 4CM3A 4EI9A 3H1TA 1A9QA 1L4BA 2HPZA 3OWHA 5BW8A 3EVZA 4CFYA 3HUDA 4JEMA 1AN0A 4ZOLA 4UHKA 4FFMA 2BLLA 1AQ6A 1KVRA 3Q9UA 5EE9A 1O94C 5AESA 4B34A 2A0YA 3KZOA 3SIWA 2B7CA 1H0HA 1L5HB 3L84A 3X3HA 2CHFA 4KB5A 4AMUA 2DWPA 2AK2A 4U2EA 1ZMBA 4X3OA 5DNDA 2F67A 5D8DA 2QUBA 3FUXA 3JVUA 1D4ZA 2PT7A 3ESDA 2AEJA 3EXEB 5EZ6B 3OG9A 4B82A 1YL5A 4PANA 1DMRA 1XC7A 5EXEA 3DNFA 3HXMA 1P3Y1 3REFA 1IEWA 3ANSA 4CDMA 4XWOA 2HV8A 1DIRA 1DKNA 1TRKA 1U7HA 3A1CA 4A0GA 1GRRA 3C4JA 4MROA 3OKFA 2DLDA 2YHAA 1K6XA 3QOXA 1EEXB 1EINA 3IAS6 4ND4A 3PR1A 4DS3A 1HDOA 1A04A 2OZPA 4Z51A 2O8EA 1A76A 3QY9A 3UAZA 2WVJA 5LDDC 3I9V6 2OO5A 4QD3A 5CLHA 3QBJA 3LXXA 4RXTA 3ZC3A 4C5BA 4HWSA 1EZZA 1HOTA 3U5TA 1L8QA 2OBYA 3OHMA 4M9SA 4EJMA 2BI7A 3WYFA 1CV2A 3ZOZA 4MUJA 4Z7JA 5A71A 4H7DA 4XQEA 3WSWA 4UDNA 2VXBA 3DTNA 2POQX 5DWQA 2V3CC 2ALJA 5BR8B 1HYBA 3L0ZA 3TIGA 5DNCA 3EH2A 4OQEA 4QQKA 3HCOA 2F3RA 4KAJA 4KLCA 1VLVA 4YRNA 3QH4A 4HLCA 4OHZA 1UBFA 1JZTA 3V2GA 4BFUA 4H7JA 1EWYA 2HUPA 5JO0A 1TZBA 4YALA 4P34A 3OBIA 5J1SB 1ABEA 4G9EA 4HFMA 4J4TA 4U5QA 4EM6A 1G17A 1P19A 1BN6A 3GRRA 1MA3A 3EMBA 2W5UA 5G02A 5FA5A 5F2NA 1NE7A 4X1YB 3W9BA 5SZKB 2FP4A 5FYQA 2AJDA 3H9GA 4RU1A 4IIJA 3I5AA 5C9ZA 3EXFB 3I1FA 5T8KC 1H66A 2BH2A 4S1PA 4E14A 3T61A 2R8YA 3AL2A 2DECA 4LNHA 2I80A 1NG1A 4JI6B 1XAJA 2W2PA 3KZVA 2O06A 3G3EA 2EV9A 4PCLA 3H2BA 2Q0HA 1TT5A 1W9MA 1AKQA 2ZT8A 3NWPA 2EFDB 4ZVKA 1L1FA 2IHNA 3NBZC 3NFYA 1Q15A 4P5PA 1MTOA 4JEUA 4M0CA 3T1HB 4KTVE 2VJAA 4JT9A 1K86A 1X1CA 1ZGJA 2ATXA 2C8VA 3DE6X 3JVEA 2P2CA 3LRPA 4NP6A 1IG0A 4W5JA 4KX3A 4AF7A 5FD8A 2A92A 2IXTA 1QV6A 4J8PA 4EDHA 1WD7A 1VYVA 2ISSD 2W7TA 4KWHA 3ZCUA 3X2SA 3PX2A 1ECBA 3A8TA 3OKCA 4Q1BA 3ILHA 2D0DA 1A5TA 4U2GA 5B7QA 2XRYA 3O4IA 2C4KA 3MLEA 3NKLA 5KPDA 1PTJC 4BLVA 3JYPA 1CW2B 1XEXB 4ZO6A 4B2YA 1KQOA 5IAOA 1QYRA 4L02A 4I1YA 2WFZA 3PCTA 1DBQA 3GRCA 5A04A 3I30X 4IY1A 2I87A 1TJNA 1MX5A 3HJAA 2ZREA 3R0ZA 5AJVB 2AFRA 3OFND 2ACEA 1T5OA 5DOVA 2Q6KA 5DM0A 4DSZA 4Y9UA 2RG7A 3PQDA 4CTOA 4X97A 3RUAA 1WDWB 1KZ4A 4GI5A 2NV6A 4F9GA 1UMKA 1V8DA 2WYHA 4KXWA 1AV7A 1WCYA 2RMKA 2C99A 2HU8A 2V97A 4FHZA 2J6IA 4IDEA 1NTOA 4JSRA 2RHTA 3TX2A 3WGNA 3CUYA 3U6BA 5EWLB 3EX7C 2ZRPA 5KOJA 5IDVA 2E0IA 2YYYA 3FUVA 3IDAA 1OA0A 2VCEA 3AF4A 5JQGF 1NJSA 2BI8A 1PR1A 4LVCA 4V0MA 2X2EA 3SC6A 2QZSA 7MHTA 1PS8A 2PIAA 5D6OA 5I8PA 2CDBA 1P4GA 3GCGA 3WDMA 4A0QA 4BEVA 5L8VA 2CFIA 1WQ1R 2WQZA 4R8KA 3CRNA 9LDBA 1II9A 2XMDA 3RODA 4LRWA 1D2AA 3W4JA 3T12A 2VHTA 5TMDA 3OTOB 4U5XA 1YFKA 2IYSA 1U0OC 3HQ4O 4OH7A 4FYIA 3WQBA 4C3VA 4RNDB 3Q3GE 2PNFA 1PZHA 3P9PA 4XEUA 3RFUA 4RDIA 3WIDA 2YASA 3WMFA 2JVIA 4DC1A 1O0CA 3E4CA 3VISA 3I62A 3TAXA 2I8AA 3EYWA 2DQZA 5F3WB 3VR4D 1QDEA 3ZBQA 3JQ8B 5HFJA 5BSUA 1HSOA 3KD2A 3VHRA 1J0EA 2HDNB 1FNBA 4QEZA 4XTCS 5FLKA 1AD2A 1Z8DA 2IYUA 1W5EA 3HB1A 2QTWB 2CD9A 4FJ2A 4MO9A 5FI1B 7AT1A 1QTQA 2W6QA 1HFJA 2V9ZA 3H7IA 3BFPA 5IX8A 1OREA 1SIOA 1MEEA 2GWHA 3K32A 3OZUA 4B6EA 3G5MA 4WKGA 3O38A 2XY4A 2RGCA 2VJNA 3IMKA 2O2YA 3QMPA 4NE9A 2ZPTX 1RXCA 1YKSA 2XE4A 1WLSA 3FGOA 4XFKA 4C43A 2ZUWA 1QTIA 5SYNA 1KSFX 1WPXA 3B53X 4BFYA 2B61A 1R37A 5D1NA 4Z49A 4PC6A 1LK5A 3SOPA 4B71A 2RAUA 1ST3A 1ZSVA 2GCGA 1JFTA 1JSZA 2FG7C 2IKQA 4RIEA 4YJHB 2NO6A 3QVVA 5FUMA 3QEAZ 4ENQA 1U8UA 5ALDA 3RS3A 2IHJA 5CGQB 4UNRA 4JAVC 3UC9A 4Q6WA 3AH8A 1NXOA 3PK0A 1X2EA 4FXOA 5JDCC 1PR3A 4WBNF 2F43B 4O8ZA 3QEKA 1XWIA 2WJPA 3R5KA 4GOND 4NHOA 3DZDA 4FJ0A 3NM4A 3IEPA 1SB9A 1X8LA 1K2WA 1R3DA 3FHTA 3FNFA 4F97A 4RGBA 2PKRA 1IJFA 1VJTA 2BISA 1V5WA 2W4MA 3BK1A 4ISBA 2DFVA 3DV0B 4PG8A 2Q5LA 2WU8A 3PUXA 4BP8A 5B57C 4GUDA 1KEEA 4X54A 2LIPA 2GNPA 1M2OA 3DOIA 1FA9A 1H65A 3HFRA 5K7SA 4BP3A 5ITZA 2PN1A 5ICMA 2H1SA 3GJ0A 3SX2A 1B0PA 2B4AA 1DU4A 4IIDA 2HDOA 3L49A 2EF1A 3R23A 5B30A 3WV4A 3MHPA 1NQUA 3LYAA 2JAPA 4MTLA 4WX2B 2DKFA 4OJKA 3I0NA 1DLJA 3AETA 2I1WA 2ZANA 3DLTA 4GQBA 4A8JA 1Z33A 3Q0IA 4I1VA 5TGDA 4MR8A 1XTQA 3C5WP 5FR2A 5BMVA 4LCJA 5JNWA 4DQVA 5ALQA 4BMNA 3FFXA 1A9XB 1EQAA 2CGEA 3V48A 5ALVA 5AUNB 1MB9A 1AB5A 4BVGA 1UMBB 5KO2A 4BFXA 1TEVA 1W6RA 3DWEX 2JW5A 4IIHA 3WI7A 4JHXA 3RU9A 3F6YA 4V0LA 4GDMA 4UW9A 2NUBA 2WJ6A 1SAYA 4BX3A 3GN2A 4R2MA 4B3IA 1KK3A 4HB3A 4P0QB 4KX5A 2FXVA 4OP3A 4DIKA 3KTOA 4RKEA 3FETA 1VSVA 1QZUA 4M3NA 1K6MA 1VFNA 1ZUHA 1GUBA 3QW4B 4D02A 1Z62A 4TZKA 1CNMA 4RV4A 3QLTA 3ABIA 1GUYA 1OX6A 1JDSA 4RMHA 1DCTA 1UM9A 2GD2A 4OAOA 2G5CA 3RC1A 2FZWA 3PIIA 1WA5A 4YFYA 4R2XA 2FG6C 3IQZA 4OBXA 1EFRD 1TE2A 2IU3A 1FVFA 2Q5QA 4MI1A 5DRYA 3LMKA 4ASUA 3O8CA 2R85A 1H85A 1RAHA 4LGMA 4ZT6A 4Z0TA 3ITEA 5ENVA 4YRGA 2PUAA 1WY5A 3M3DA 4ZCTA 2PDAA 4WE3A 4WTOA 1W73A 1ANKA 1HLPA 1IFXA 1V8ZA 4X1YA 5L3SB 4DY6A 4CQMD 2YIDA 2QRVB 1QS0A 3GVPA 4MRSA 3IQDB 1EP2B 3K0HA 2AMJA 4LE0A 2I6TA 4NV0A 5ANRB 3NATA 5FJJA 1BDHA 5JCXA 2Q6IA 3ZKWB 1PIWA 4YUAA 4TTJA 2A3RA 2I3GA 4RHEA 1Z0AA 2XYHA 1QVVA 2H4XA 3JTEA 4P4SA 4UNPA 1GOTA 5TPZA 5TS3A 3B3QA 3P97A 3ORRA 5CHEA 3ZBUA 1M2JA 4DCGA 2JVKA 2JFZA 3FOWA 3K94A 4G1BA 1XZFA 3DXFA 2IEAA 4HUJA 4X24A 4OMDA 1XZIA 4N9WA 1M0WA 1ESEA 3BCUA 2PWZA 4POAA 5DFAA 3T34A 4F2HA 1PK9A 4KO2S 3IXLA 2DR2A 2RI1A 3T5CA 3LY5A 3ZZTA 2BL4A 1XQ1A 3FMGA 1CIPA 3ZE6A 4BECA 3LCCA 2VYNA 4G1CA 4TXNA 2J9FB 4OATA 5TQ0A 4CMEC 2LV8A 2DR0A 2ZK7A 3DM5A 4OLFA 4TT8A 1GZ7A 3HJHA 4LQLA 1WHSB 4OD0A 4PZDA 3R7NA 3L06A 1Q2UA 1H6BA 3IXQA 4GZ3A 4FD2A 4DBZA 5CXXA 4MS1A 2C5SA 2ZRDA 4KNWA 2OZLB 2GYVA 3EDRA 4WEOA 3WGZA 4D82A 3H75A 5DX1A 4EO9A 4FFRA 1FYVA 3GLKA 4DLLA 4YX9A 4RL4A 4HGYA 5IDQA 1RPNA 3DMDA 4Q3BA 3GFFA 1HO3A 1KJJA 2QQEA 3TZHA 3E35A 4LFCB 2CXSA 2Z9BA 4CKBA 5I4KA 5I8WA 2YYSA 3S6JA 2NX2A 4DCMA 1H6CA 4ZVLA 1HLDA 2Y1XA 2GCOA 3G5TA 3M6AA 4FBLA 4RLHA 5C34B 3TUJC 5J4HA 1RQLA 3EEOA 1S4MA 1CEYA 2X8JA 1SVMA 1IONA 3UM9A 2AXEA 4QULA 1XD8A 1RJFA 3PKIA 3QFHA 3R2JA 3MWDB 2FWMX 1MA0A 3RTDA 3S2ZA 3EG9B 4UFPA 3THXA 3DE1X 4MHSA 5T3UA 3QEMA 1CTQA 3VSEA 4QUDA 3PHLA 3OIVA 2JIZD 3A4MA 2X8BA 4P53A 4B6JA 1KERA 3SS7X 1A9RA 2AHRA 3QVKA 2OILA 4EB6A 5LMCA 2W37A 3ICQB 4YT8A 4N0MA 4BQPA 4O1HA 2R6AA 3AF0A 4PZYA 4XB6B 2VK1A 1QG4A 3ROGA 1AUVA 2DKOA 2F9MA 3KJNA 4BUZA 1S2OA 2ATEA 1F60A 3OCZA 3W3AA 1ZH0A 1VCMA 1POXA 1YL6A 3U7EB 3VHQA 2BOVA 3DJFA 4H59A 4MV3A 2RCNA 3ND9A 4MUXA 4Q4DA 4DYHA 3TN7A 3OIUA 1L5KA 4TL7A 1S7GA 3V1UA 4UE2A 1BH2A 1WMFA 5BR1A 4CIAA 2XB4A 1IIRA 1FLDA 3VOSA 4RE6A 5IM5A 3UKJA 3BMOA 3HU3A 2EGHA 5TY0A 2H2IA 3HBJA 2VF7A 1XTIA 4PM4A 4YRLA 1PX2A 2R5FA 4A5SA 4FVTA 4BMZA 1JZSA 3IDZA 1VRWA 1M7BA 1N2ZA 1CY1A 3U39A 5LZ9A 3ZUPA 4OLAA 4PYKA 2LDXA 3BD6A 3GFRA 5A62A 3ZW9A 2ARKA 3BTVA 3G7SA 1T3SA 4LX0A 4DNPA 4RJKA 2ZBGA 4LJ7A 4KSBA 4X7BA 1JVNA 1C3VA 2QTLA 3DZHA 4YIKA 4C7KA 4J4BA 4EZEA 2UYOA 2GYWA 1VE6A 3IRVA 2NP7A 3WLHA 4ETIA 3OJCA 2GLXA 3L02A 4Z8YA 4BKUA 3EF3A 2C92A 3QIAA 3AEUA 2YUTA 3GP3A 5CEJA 5JNRA 1K4MA 5I7VA 3ABQB 3NGLA 3QRWA 2KPOA 1Y3AA 4L74A 3NGXA 1RQPA 3TIVA 5AW1A 2X4IA 1GDDA 1VPDA 2VK8A 4GWLA 1FSPA 2PGAA 2Z4SA 4CT4B 1XUOA 3HCEA 1UINA 4DWWA 8LDHA 1RRGA 4G1EB 4MVYA 2QBYB 3VTFA 3STXA 1HDXA 2HD4A 1CY4A 4R68A 5JCOA 3VOTA 3Q1LA 5FOWA 3T5TA 4COOA 2O23A 1ODTC 3I34X 3LCMA 3FPHA 1ZIOA 2FPPA 3GX1A 4WXMA 1I9CA 5K51A 3VPBA 2MSKA 2P77A 4X71A 1UKEA 3OCUA 3PGMA 1QLJA 3BEOA 3L0DA 1X1DA 3OFVA 2HLPA 3CZMA 2WYOA 3ENNA 1HA3A 4X0EA 4ENRA 3DF9A 1B6RA 4Z5XA 4BPBA 3FCAA 4HAWA 2ACKA 2Y67A 3OCCA 3S2YA 1GLNA 2NU6B 2VDKB 3IEIA 3JQAD 4JYPA 3SZGA 4TKLA 3U4GA 4ZV4A 1PZMA 4AY4A 5L40A 4D7AA 6ADHA 1PNTA 2DPGA 3V34A 5T57A 5DH9A 1K6IA 1B8OA 3B1WA 3QJYA 1IMJA 1X9HA 4BLUA 1VSUA 3H04A 1JEJA 4BE7B 4BCBA 1D2RA 1C4KA 2Q4RA 3R3VA 3O82A 3LBIA 3JRNA 2IE8A 4Y2PA 3RVKA 4JLDA 4Q4CA 3WB9A 5DCWA 2XA2A 2XB2A 1IZZA 2O2GA 3QYAA 2P9YA 5ECYA 1PJBA 3CNLA 2WIKA 4G9BA 5GWXA 3LDFA 3QFRA 4YRZA 1SHJA 4F4DA 2WQ7A 4RLQA 2GN9A 4IFTA 3ELYA 3FZQA 4MVXA 3RYHA 2WEKA 1RLIA 1E79D 2IXGA 2NZVG 1XZCA 4KQKA 4MW1A 2B30A 2EGUA 2WE7A 4XDYA 7MDHA 2KWIA 4LS3A 3ZBTA 4D5GA 3ZHBA 3OZWA 1YCHA 5FQNA 2VT6A 1IUOA 3H6GA 3HS3A 2H0RA 1KOLA 3SC2A 2NXCA 4PO3X 3KKOA 3UF0A 1HDGO 1CUIA 3IYLW 1FMJA 3GK3A 3H65A 4KQCA 1ZGGA 4OXQA 3O2NA 4D8WA 4B7AA 1BEUB 3H9CA 2C00A 5TVKA 2GM4A 1W5SA 2RKBA 4ICIA 2UVQA 1KZ9A 1GM5A 1BMDA 4TVSA 1NJ8A 3W5IA 3WWEA 4CM4A 3FBGA 2X86A 3ZD6A 1A9TA 1MRSA 2V55B 1J25A 1H22A 1EVZA 2ERYA 2JFXA 2JHPA 1G8PA 1X1RA 5JNUA 1X7DA 1Z5VA 3QG1A 5HILA 1AGYA 3H8SA 3TM4A 4DCTA 1P1HA 2JCYA 3ZH2A 2KB0A 2ZJZA 3E0QA 2VQDA 1USGA 1R6DA 4DLRA 1QGUB 4DCUA 1NC3A 4P5DA 1LBIA 4W7SA 5MF6A 1TVCA 3JYHA 4KRXA 1JMYA 3LKZA 4U9IS 2EFJA 3KR2A 4ZCLA 2W6ID 4UTRA 2DHDA 2GLUA 1SCKA 3A9RA 1G5FA 2R66A 3QYJA 1S8OA 5DLEA 1BOFA 2H11A 2YX1A 2WIBA 2BKAA 4ITRC 3T3DA 2YBDA 1Z4NA 2OENG 1KAGA 2O7NA 2YHIB 3G9XA 3GNSA 4HFNA 4W1QA 5K2OA 1A9OA 3TQFA 4HQLA 1G3UA 1VLLA 1UF9A 4J90A 1Y8RA 1MR3F 4BNIA 4HNUA 2XB8A 3GRPA 4K05A 4P08A 3BX1A 4CLOB 4FLEA 1E59A 2WKSA 4PAOA 2YXBA 1X0XA 4BRZA 2QJFA 3KLPX 1RMQA 1GZ3A 4EG1A 2PRIA 4C7VA 1UDXA 2P3SA 4XX0A 1QRAA 2AFHE 2J48A 5FWAA 4JA0A 4PXAA 3IV7A 1GNTA 4HB2A 2WAAA 3C3XA 4UM7A 3EWSA 3ZHVA 4CEIA 1W4RA 1JJVA 3C5HA 5ETJA 1HORA 5F78A 1US8B 2HA3A 2J4FA 4KDRA 5DLYA 4GM1A 1IHXA 4ECAA 1OVMA 4I9NA 1CG6A 5E2BA 1SXJB 3W6NA 3THYB 4R1OA 1M73E 3KUDA 2VWPA 4TTQA 5IANA 5HRUA 2QI9F 2HRDA 2I4LA 2X2PA 2JJQA 5AW9A 1BWQA 1EBBA 4FQ8A 3IKTA 4JLOA 4XPZA 2QYSA 2AZDA 3DHEA 2QQ5A 2V98A 3EAFA 3GNTA 4R98A 3F78A 2IYNA 1NVDA 4CUJA 4TUYB 1PBTA 4D4IA 3KR1A 1FDIA 2CLCX 3UV3A 1GLVA 3KXKA 2EDAA 2O0JA 3O83A 4HRAA 4IS2A 4R83A 5FCDA 4HY3A 3WLAA 4EUKA 4GPD1 5AD1A 6PFKA 1CR6A 1OT5A 1Z18A 3QEJA 5EMLA 3L1IA 3KOUA 1HUQA 3ASZA 3FWNA 3K1AB 2O6LA 4UBLA 4P4TA 3UHAA 1M0TA 1U7ZA 2EBFX 1RRVA 1U98A 1Z0ZA 2IY9A 2PCJA 4J91A 3OP1A 2BM8A 1Q5PA 2FAXA 2SCUA 3QU4A 1W2WB 4IXWA 3K1YA 3O1IC 1IQRA 1LLUA 1UZLA 4PRYA 5TMEA 3G0HA 1SBIA 1QFSA 1DP4A 5LUBA 3AUTA 2CB9A 4HI0E 3MC1A 4K1LA 1OFVA 2R1ZA 3O95A 2VP9A 1I0LA 3EGXB 2QMQA 3LUHA 2ZBQA 2HV9A 3B9RA 3FZYA 3AHFA 1YGYA 3D4LA 2I54A 4FMDB 4FMPA 1SKYB 4WLNA 1G21E 2PGDA 3EZGA 4P2BA 5DF1A 4BVJA 1T1SA 3QUTA 2AN4A 3EDCA 3KCNA 1SHZA 1G8MA 2C2ZA 1NWHA 1MC1A 2H8GA 2MIIA 2ORIA 1GUZA 1OGJA 2ORED 2WTAA 2QV0A 2YN0A 4N65A 1RXSA 2CLHB 2IYAA 3DOFA 4D0NA 4DMRA 5JQGB 3KTAA 2Q9CA 3NR2A 2J3JA 1NNUA 1XKLA 2E4XA 3N0VA 2NADA 3O84A 5KIAA 2HT6A 2OSVA 3QUBA 5L7YA 5KTOA 1Z6AA 1VPLA 1HE4A 3ESRA 3P2OA 4QEDA 2Z6AA 1DS6A 1ZOSA 3QFCA 1TDJA 3A6EA 4DRXA 5KCZA 2VDWA 1U2DC 1UKZA 4MOWA 5E6UA 3P2IA 3G02A 5EGNA 5CBPA 3B6KA 4IQGA 4TYPA 2G5GX 2JJ8A 2R8BA 1XSEA 1BVYF 2ZT5A 1RQ7A 4Z99A 3O2QB 4F4UA 4EY5A 3PFKA 5A4KA 2JC3A 2AZMA 2OHJA 2CKDA 3PYLA 4HB4A 4HDKA 5ALEA 5BVHB 5AKYA 3FTPA 3S1AB 1RADA 3SKVA 3IP1A 5DBFA 1Q74A 4OI4A 4BV9A 1LI4A 2X9NA 3EOBI 1GTMA 3L0CA 3S8YA 4WNIA 4ZTZB 4BFZA 4V38A 1C0IA 4R0MA 4QTUB 4YDSA 4Q01A 2WA1A 2B1RA 2PRSA 2ERCA 1ZO8A 3THOA 3HKDB 4RVDA 2FUCA 1HETA 2QX8A 1E1CB 5JMWA 5LVAA 5P21A 2ES4A 4LG1A 3L7CA 1Q0ZA 4KIUA 3EY9A 2XX3A 2BR4A 2FF5A 2G9UA 4QJIA 2JDIA 2P69A 4R6WA 3VDMA 2FWJA 1LSJA 4EUHA 1V5EA 1TUGA 1SU6A 1M33A 1NJ2A 721PA 3PHBE 1AVTA 2NAPA 4IJVA 2E5WA 4C0WA 1OGIA 5C80A 1RDFA 1R50A 3AKDA 3BMQA 4IX9A 1ZH2A 4I3FA 2BFPA 4JJGA 4YN3A 3B5EA 1UAYA 1ZCJA 2F9FA 1R66A 1UC9A 5EXPA 2WJJA 4ZK6A 2LCQA 2E4UA 2ZRJA 3HYCA 1T6XA 1IVNA 1L7EA 2HCTA 4MJXA 5F5NA 1EHIA 2VTBB 1H9CA 4KO8A 4EENA 1DT3A 1EGMB 3OJLA 4ESOA 5CG1A 3TRKA 3JQDA 2FQQA 4LOLA 1ECCA 1X3LA 3DQZA 3INRA 2F9LA 4G2TA 4ZGWA 5AK5A 4DLZA 1QCYA 1U9IC 2HA4A 2I4RA 2OOKA 1PYOA 2QSYA 3GEPA 3JVIA 4MUFA 5CH5A 3RVMA 3R74A 3TBHA 3NBXX 4M1YA 3AEKA 3R40A 3VR4H 1XO1A 4XD7A 3X43A 5CA0B 1EKXA 2WTBA 4RKYA 1VHJA 5CB4A 1Z15A 5A6VA 4OJYA 4PSKA 3O74A 3W2FA 1PQUA 2QT9A 1KI6A 1JDJA 3BFVA 2VBCA 3H5LA 1PL7A 4JLVA 3SLRA 4ZZ3A 1ADYA 1UJ2A 3R5XA 4P7FA 3WK9A 1M3SA 2JGRA 4M4SA 2QXYA 4HHEA 4LHEA 3UUEA 3WR5A 3X0DA 4DG5A 2JK0A 3I5YA 3A0UA 4GRDA 2P2NA 1FFHA 3URMA 3SBXA 1KYVA 2ZJ2A 3S99A 3OE4A 1DDGA 2XUZA 2BW0A 3CEHA 5KTYA 1KI4A 3ZV3A 5HIKA 1P9RA 3DULA 1NT4A 3UTDA 2V5AA 2QRPA 3VTZA 5IAEA 2ZUEA 1W85B 4NECA 1P2UA 2ZVPX 2LWIA 3VUEA 1QBKC 3I01A 3TJMA 3OPVA 4LSMA 4AUKA 2QSZA 1AK2A 1WU8A 2BBTA 5KYYB 3O3CA 4KIWA 3KR0A 3CVYA 3IT3A 1Y63A 4PNEA 4ZOAA 4OL9A 3PVSA 3U9TA 1X7ZB 2H1RA 3LPNA 4I6GA 2OV3A 2OMKA 2P0YA 2J30A 2PSEA 4LRXA 1H9BA 2GHQA 1FY2A 5AM3A 4NESA 2ZIZA 3QKTA 4BO5A 2G1JA 1VKNA 4L9SA 1NFQA 2DQKA 1P5ZB 1IOWA 1ZVQA 2H31A 3FE2A 1RYMA 2G9NA 3B3AA 2WG0A 2Z95A 4JEHA 4KREA 1EJ6A 4NYMR 3D7MA 1XXHE 1ODKA 1D1SA 1VHDA 1XFAA 4FN4A 4UQOA 2FVXA 3TGLA 5CX4A 3BXZA 1WETA 3RKRA 1OJLA 1QOZA 2QMOA 1WO8A 4OMFG 2P1RA 4RYLA 5BN4A 2B4RO 2ODWA 5E1MA 5A05A 2P75A 4I4NA 3QUQA 1Z2CA 4A2WA 5ITWA 3HBFA 3ZD7A 3HKEB 3S55A 3DE7X 3GMIA 4P38A 3GVHA 4MVJD 1F9AA 2WKRA 3V6LA 1OJ7A 5AXBA 2A9QA 1E77A 3QVWA 1AQYA 3NWBA 4GLJA 4KAXA 4MVJP 4RY9A 5EIWA 4WUVA 4DXHA 4JWTA 1IBRA 2OZEA 4GICA 3RRBA 2BIFA 4X20A 1R5BA 5AHKA 1I4OA 3R6LA 5BWMA 3C7CB 3E9EA 1O5OA 2XQKA 1THGA 3WO0A 1OGYA 1Q6ZA 2Y2UA 3UICA 5BSFA 1N3BA 1UMCA 3NAMA 3BXHA 3IMFA 5JARA 4ARAA 1ZHFA 4C0AC 1WW8A 1LV8A 1CUJA 3DW1X 2RDMA 5IS2A 1BQ4A 1W52X 3A04A 2IPMA 4DVGA 4D42A 3QWHA 3DEZA 2HM7A 5TEVA 4UOQA 1T25A 3FVQA 1QRDA 2P4QA 3PFBA 1O0BA 2OGSA 2B5VA 4QWMA 3HKCB 3IAUA 5B2ZA 1BHO1 4YR9A 1OH6A 4BYGA 1A4RA 4AY5A 2AYZA 2BONA 3GR6A 1JLKA 1NVFA 2Y1GA 2I33A 4B8YA 1O77A 1J2TA 1IM8A 1BGXT 1VSTA 2BZSA 3IUNA 4YAEA 3Q8MA 4KHPB 5DYYA 1X8XA 3JTMA 5EXTA 1EXDA 2RK6A 1BWPA 1IXSB 3WNCA 2ZIVB 1BS2A 2A1UB 2EP8A 2GYUA 3R3SA 4YRSA 1QYDA 2X5NA 2FPOA 1UJ5A 1BC5A 1RYZA 1QQ6A 4JHLA 5L95A 3C39A 3H2YA 4IDNA 4DDVA 1X7HA 3QYFA 1X15A 1B2RA 5DP2A 3LX8A 4MUGA 3OF5A 4UCFA 3IX7A 4B3HA 5JDIC 1SVKA 3MSCA 4B9EA 1T9DA 4EKDA 2C8LA 2ZTSA 1E0SA 1JWAB 1L5RA 3DLPX 3M6MD 5IN4A 1YI1A 2BFBB 4GZ5A 1J09A 5H81A 1R18A 2VPXA 4R9RA 5C8YA 5B6JA 5KVVA 1M66A 1XI2A 1YL7A 4OVKA 4AX4A 1UIMA 1RBQA 1CETA 1FP6A 1NVVQ 3S44A 4Z4IA 4RAQA 3O31A 3LF2A 1MB4A 4EHJA 4A9AA 2X23A 2FSFA 4TN5A 1AKTA 5B4UA 1ZKDA 3L8HA 2F1OA 4HSEA 4LUCA 1W29A 1LBEA 1VIVA 2IU4A 2ZU6A 1T5LA 3PPXA 5EJIA 2BHNA 4WNCA 2GD0A 4B4DA 1J9ZA 2DSNA 2I2BA 2D1QA 3MF4A 3MPUA 5D86A 1M5RA 1H8HD 1WZIA 1IHUA 1FU7A 2QGZA 3DDSA 4RK1A 1IL0A 1UC5B 1I1OA 3VC2A 4C06A 1G0OA 3A4LA 2TS1A 1PJ2A 4BNTA 5F52A 2DH5A 1AS0A 4LDQA 5BW5A 2IHBA 2BM0A 2EJTA 4P1ZA 3W06A 4DHEA 5KSWB 1KVSA 3TRDA 1HURA 1SXPA 4RJLA 2DBVO 3WL5A 1RKUA 1HZZA 4ZI7A 2HMAA 1IK6A 1UWVA 2C5HA 2F17A 2VT7A 3HYSA 3EZ2A 4GE3A 5LYJB 2QG4A 2BEWB 4HJXA 2NQTA 4C4OA 5T5QA 4UASA 5KMGB 3KE8A 5CFRA 1DC6A 2H2WA 4L5IA 4ZANA 3DLHA 4UM8B 3S5UA 2BPOA 1NDUA 1UOOA 5TQ2A 5K8IA 3T9FA 4Z9BA 3VYVA 5FFMA 2CUKA 1OWOA 2H5JA 3ZNOA 2IVZA 2ORWA 2LNDA 2YYAA 2CSXA 4CYMA 2AX3A 3ADDA 5YASA 1X87A 4CF3A 3ZY6A 1KEUA 1OQAA 1FP7A 2W6NA 3TK1A 3WWCA 4DT1A 2P9ZA 1W36D 3C3EA 5CUQA 3HR7A 2I8LA 4NMXB 4QYSA 1PJ3A 5B37A 1IXRC 1RAFA 3IHWA 4NENB 1BCRB 2NU8B 1VKZA 3O2SB 5H68A 4DVJA 5C7IO 1HDEA 3LXMA 4E1AA 2OHOA 2QTRA 2IH4A 2AI2A 5JAOA 2FJ0A 4C03A 2ZB4A 3REGA 4EW3A 3UFXB 4Z4CA 3FSGA 4O5OA 1NW5A 2HMWA 1RRCA 3L0BA 4KBYA 1XMXA 2VNIA 1EDDA 1A88A 1PL6A 2XUPA 2IKSA 1J8QA 5LJLA 4CL3A 4I1IA 4JR0A 1XTUA 1U3WA 1B6GA 3P2YA 1FLNA 3CXUA 4HN4B 3OPMA 2MJLA 3MA0A 4JP5A 3T5BA 4IHJF 3TZCA 1M6EX 1PV2A 1PNQA 4LDNA 2J07A 2YWXA 4EATA 1H2YA 4C05A 1UT6A 1C30B 3PC2A 1HQYE 3R3ZA 4K87A 2Q3HA 4KKXB 4EW6A 1XZ8A 5J4YA 1OFTA 1G7CA 4KR3A 3FX2A 2MR6A 2XXJA 1G19A 3DFUA 3P2JA 5E1DA 5EHIA 5I47A 1YO6A 3KOMA 1DAIA 2FSUA 4JBLA 5J23A 4X1OA 1GCIA 1C7ZA 1U0BB 2R8OA 2Y77A 1B16A 2QVXX 4QBHA 5J4VA 4GLOA 4KWIA 5EHZA 4LKRA 4XUCA 4LF7B 1X7GA 3DLAA 2GKGA 4DYVA 1JEOA 1JI3A 1NLFA 2G36A 3LQ1A 3V4PB 4FFVA 4Z7NB 4HNSA 3HADA 5I9BA 4A1FA 3JASA 4H4DA 1GV0A 3ZHCA 1ZXLA 1ZOPA 3TG2A 2JJ1D 3NOOA 2YWRA 4EZIA 4TSFA 1ZJWA 2FMHA 3K9HA 4JLKA 1A3CA 3A2KA 3A1WA 2HL6A 4GNRA 3IODA 4FFDA 4L1KA 4EGCB 1DWOA 5CURA 1Q57A 1GTL1 4HFJA 5JJ5A 2ORVA 2BFEA 1OXXK 2Q8QA 1G3MA 3KTFA 1JDNA 5AKEA 4LC9A 1LTQA 5LLTA 3DH0A 1X80A 2NVWA 1U7OA 3BGDA 3TJRA 1FP1D 2ZS7A 1Q95A 2XDQB 4GYJA 3SEQA 4TPKA 2ZWIA 1ZSNA 5HOQA 4RIFA 4C2AA 4LZLA 4FHGA 4F2PA 3RNLA 1R2QA 5ECGC 3PDHA 1NN5A 4CTKA 2LE0A 2OT3B 2XBMA 4QZVA 2I34A 2IPAB 1L1EA 3FWHA 1XT6A 1XN1A 4CMKA 4FIDA 2I2FA 3HYLA 3LTEA 1QH1B 4L72A 5B7NA 1KY3A 2C9MA 2IUEA 2J41A 4R84A 2H51A 1W5AA 2FLVA 2AWOA 4KQ1A 1TAUA 2D5IA 4I4CA 1NHGA 1U7TA 2W4QA 3GZNB 1JILA 5LZ7A 3FD8A 3C6YA 2F00A 2FN3A 2DJIA 2J3LA 4QT4A 1KNQA 3SBDA 2B2NA 4PPFA 4YC7A 3LT5A 1S1CA 3V3TA 3VYUB 4AJEA 1H3EA 1DJLA 5ICGA 3C7TA 1XRSB 4X8HA 1L5FA 4R7GA 3ZJTA 1J1ZA 2HCBA 3CX7A 5DULA 4B73A 1EGAA 1SR8A 1H0RA 3L7YA 2GEDA 4D8TA 4LSGA 4P54A 2EQ5A 4B3TB 2VYVD 3AUSA 3D2AA 2Q2NA 3VR5A 1S02A 4M8NE 2WU1A 5HF8A 1EIWA 3HPRA 3WKAA 4RPIA 1N2JA 2GERA 1ZONA 2X8AA 2XNCA 4F5ZA 2DERA 3DOOA 2JGKA 1POWA 4OOFA 1Z0FA 4G5QA 5FBWB 3L5OA 4GZMA 3OFSA 4X63A 4DMCA 1Q17A 2GFIA 4A23A 3G79A 4BFSA 1GAQA 3SJUA 4FDLA 3V55A 4ALLA 4C4SA 1XNJA 2J3QA 2GNOA 3L79A 4AURA 2IOQA 1I30A 4DXDA 4W5QA 3BWYA 1ZN7A 3ENZA 5EP2A 1B73A 1JKJA 2BFOA 4CMIA 1N0UA 3NHKA 5HZHA 1EBFA 3MMNA 2C42A 1U8YA 3ZJ4A 4BN4A 5LPNA 1F2UB 3W7VA 5JXHA 2PT5A 1F17A 2GBFA 2HIHA 3DHWC 1RZ3A 3GUYA 3K5WA 4RA9A 4GW3A 1JG2A 1JSLA 1F2VA 4UEQA 3ER9A 1WZUA 2BELA 4UARA 2C3OA 2HJRA 3RS9A 1EA5A 3VC1A 1KYIA 2P3OA 1RWNA 2W8ZA 2XB6A 3KWLA 4JJ6A 5JD4A 1JEAA 4W1RA 5DKFA 3QI7A 1NPTO 2QS9A 4DNXA 1AURA 2RI6A 2R4QA 5TLSA 3H8JA 3CRQA 3AG6A 2QDKA 4JXZA 2D5LA 1J2RA 4KN8A 3NH9A 3U9LA 3QEBZ 2C88A 2NZ2A 4YT4A 2DHCA 2QTMA 4RMNA 1FFYA 2AOTB 2CVFA 1I5OA 4Q3EA 2WE8A 3LLCA 3GN1A 4PFSA 1N5MA 3CC8A 4F7DA 5JXWA 5M2QA 2Q1YA 3T35A 1F2TB 4C76A 2AKYA 4RVOA 2Q3DA 3KZCA 4YYEA 2WJWA 4CEJB 3NCTA 4XGKA 3GELA 2VQFB 1MH1A 3EXIA 3FSEA 4JA2A 4ZOCA 5FLYA 1MQ9A 4KDCA 3TD6A 4MRMB 3AFMA 3FFAA 3BSSA 1QK5A 1V16A 2XDAA 1XCGB 5BN1A 4DMHA 3NHRA 2WU0A 1DPFA 2C3PA 2OHXA 4YAWA 4AVYA 4KITB 5K05A 3JW8A 2QE6A 4KCGA 2RGNC 2H2DA 3TBKA 2FE1A 3OE1A 3MGGA 4OHWA 4DA9A 4H7IA 3QXGA 2DTEA 2YXNA 3NZEA 1YAHA 1MF7A 4CCYB 3LPDA 1SHUX 1QCCA 2EBHX 1VJRA 4IDGA 2C1XA 1Q7EA 1T0UA 3KSAC 2O2EA 1U3CA 2Y0EA 3AVPA 1UWKA 3DKKA 5CTJA 1IWPB 4EL0A 2WHQA 1A77A 4AKSA 3SQDA 2NTVA 1ZISA 3IUBA 3DOJA 1U65A 1ULSA 1XK7A 3ESQA 2PSDA 4MYSA 2XTZA 4LECA 2Z2XA 3WRWA 1D2GA 1P1IA 1SKBA 3NC0C 1F8FA 4Z54A 3K0BA 5CD9A 1GTRA 2R84A 3FNQA 4NBLA 2E5FA 4UJ5A 4BB9A 3VNSA 1FJXA 1PS9A 2E6KA 3ZV7A 3GLGB 1QK3A 1Y8QA 4Q00A 1QCDA 3I2YX 3VSAA 2IHKA 1EI9A 5BRJA 1Q0TA 2QE7A 1KQPA 1CYDA 4PIVA 1XNRB 2O7SA 3LQKA 2ZSDA 3QVTA 1RM0A 1T8RA 4FONA 1BMFD 2VUIB 4XJVA 4OAPA 4HPJB 2B20A 1K9SA 2DUJA 3C3CA 3EQ2A 4YT5A 3ZNQA 1J2EA 1JALA 3QUCA 1DIHA 1JR4A 2QM8A 1IBCA 4JZKA 4K86A 2XKKA 1BE1A 3D7NA 1S2IA 3VPHA 4UHBA 1F6BA 1AXRA 3QEOA 1FYEA 1VLHA 4ZT3A 1ESZA 3FLBA 1CZRA 5BMOA 4V0KA 2GZRA 1L4UA 1CR2A 2AXNA 1RLMA 2R0QC 4QBGB 1P75A 1U0EA 4TSKA 2Y99A 2GJKA 3DFKA 3LLUA 2XCLA 3AI2A 1JMVA 3BGOS 4N3NA 3OBBA 1HEIA 4WBNB 3MTDA 3GEMA 1X8JA 1Z7EA 3K0AB 4FU0A 4EQ6A 1KH2A 4NFSA 3U7HB 5CAEA 4A91A 3FCEA 4QPZA 2WZDA 3ZDBA 5J2UB 2QMHA 2QWXA 3N74A 4LRQA 1RBMA 2WICA 4JIGA 3VQTA 4EI8A 2R6DA 1NASA 2AYXA 3JZAA 3T94A 1V2HE 3FNEA 4ZCRA 3H0CA 1H0KA 2ZTUA 5KWSA 3K16A 2OAQ1 4J0EA 5IKEA 3HV2A 2Q1TA 3UCFA 2XWJI 3VU9B 1D9XA 5H1YA 3H9JA 1CC1S 3P7MA 4F9TA 3U2QA 3PFNA 2NIPA 2A5GA 1UXJA 4JNCA 5K1ZA 3EGDA 2PUCA 1HT2E 4WY8A 2W6JD 5FBVB 1YFJA 2VHEA 3AW9A 1JX6A 2QLTA 4H0FA 4OHXA 4ZYTA 4DR4B 1Z8FA 5IT5A 1I14A 4K26A 3CEJA 5AQ1A 3AKEA 1XWWA 4CQMB 4DB4A 3JQPA 4S35A 4ZFNA 3K6SB 3TQTA 2Y9MB 2FY8A 1JEYB 1SCNE 5F1OA 1DBIA 4EG4A 5A9SB 1L8XA 4DLUA 4NJMA 1G6Q1 1ILWA 3VYSB 1GQQA 2QZJA 4NPCA 3GEHA 1SEPA 1X7YB 1ESCA 3W5AA 1GGEA 3CF2A 1JR6A 5EJ8A 3DEJA 2CBZA 4UUNA 4MR9B 4D4HA 5DT2A 3A58B 1WP4A 2Q2VA 3W6OA 4NCIA 1OFGA 4DNFA 5JWOA 3C3YA 4I81A 4YB8A 2IW3A 1B0AA 4FMBB 3V2IA 4BFTA 5KQPA 2WAYA 3GD7A 3L7DA 2L18A 4OYRA 4EGFA 4Z7OB 3OEED 3RTEA 2F4VB 1RWPA 4LIPD 2CHVA 2P11A 3TTVA 4U4AA 3W6UA 1KEWA 3LNCA 1QZZA 2PT6A 3AUJB 3NIWA 2DG2A 4IYJA 3WQSB 5T7BA 4Y1GA 1S96A 3FAKA 3HN2A 2QPAA 4DUGD 1Q11A 1OXBB 3MUFA 4OM8A 2VDRB 3W1WA 1HM5A 3C48A 1E69A 4KZKA 2BCEA 4ZEWA 1UT8A 2X2OA 3PTAA 4QRDA 1YCGA 5JS7A 4YRJA 3U80A 3GZJA 4YCMA 5HKKA 2ZJ1A 3RWBA 3LQRA 3A6FA 4OBBA 4DW8A 3OWOA 3O8OA 4M0MA 1AXEA 1QM5A 3EC2A 2CLFB 4O25A 5AKGA 3UW3A 4XWAA 3QE4A 2O2SA 3CLTC 4XFJA 2L82A 2XITA 1SELA 4R8SA 2JPDA 5JBIA 3UWMA 5JAUA 3QWAA 1DIGA 1P44A 2IUYA 3TTXA 1FYFA 1B1CA 1JHXA 3TECE 3L7MA 5DMXA 5DISB 2OHHA 1TT7A 4AI6A 3WK4A 4DJJA 4RM2A 2ODAA 1RMTA 3WYCA 4DUPA 4MB2A 4Q37A 4DDUA 5EJ6A 5IHXA 2CY0A 1XAIA 3IOBA 1YUMA 4FYJA 2IZ7A 3RI3A 4QUJA 1KSGA 4YMSA 4PO8A 3TQQA 5CXQA 1U2GC 2O8BB 3GJ5A 4BTLA 1QIKA 2HF8A 1XCPA 2DHQA 2IHUA 5MN4A 2VJMB 2IYLD 1BEEA 3MT8A 4PZZA 4GC9A 5KVQA 1WVMA 2A0XA 4O2AB 3IT2A 2B25A 1L4EA 2LW7A 5KTKA 5HP4A 2PZFA 3OZCA 2E5LB 1LI5A 1UPBA 3DDOA 1SC9A 1ZC4A 1ZJYA 2V7UA 3ID6C 4QBKA 2OBNA 3D64A 5IAJA 2J87A 1XDSA 2WZCA 4YUYA 1N5LA 4EHDA 4U7DA 4TN1A 1YJXA 3HLTA 1EM6A 5ALIA 4M8SA 4BV8A 2X5XA 3H0KA 3CO0S 2XPCA 3TPFA 2X3YA 3K8QA 4DMUB 1Z13A 3DKIA 1X42A 3HN6A 4OIFA 4LF8B 4MVJH 3RS2A 1HI9A 3TS1A 2FDXA 3X1MA 5BNWA 4OEHA 3AHIA 4RJTA 1J21A 1HE8B 2JGNA 5I7SA 4G8BA 1H4QA 2QYTA 1MG5A 1R0WA 3TL3A 4C08A 1GTVA 1BXKA 3E23A 2O6HA 3C6XA 3D4BA 3IALA 5GZ6A 3LBAA 3I58A 5K8UA 1H69A 3EEFA 1GGFA 3KTDA 4P2GA 1V25A 3MK31 4H08A 1Y6RA 4LGYA 3TI9A 4ZT7A 2GRAA 1MOSA 3I2FA 3WMGA 3ASVA 1P2FA 1O97D 3HP4A 1YJBA 1LDMA 1O95A 4DA6A 2GZAA 1UAGA 4KQXA 2ZB3A 4UU0A 1S7CA 1NVUQ 4B2IA 2LKDA 5DPMA 4N40A 4KXQA 3F1LA 3FJYA 1V6CA 3T7JA 1TLFA 3CVWA 3FYUB 5LA6B 1WLYA 4QEKA 1KS9A 1P3JA 1OKKD 1P2DA 1KPIA 2FWNA 4H60A 2WLSA 4HEA1 5GJBA 3ZCTA 1H23A 5KSZA 5FOQA 1FRVA 1W5BA 2XMQA 5CLIA 1QE3A 4GC5A 5AHOA 3BFJA 5FT9A 2C5BA 1DBPA 5E8RA 3KVYA 4QQNA 4WY2A 1N2OA 3PXAA 4F3KA 2VUTA 4Y30A 4JI3B 3EIOA 3SVZA 3DYIA 1SD2A 1H3NA 4MW5A 3FOFC 3GUVA 3WJ1A 3OKAA 2GCEA 4WKCA 4IRMA 4XB2A 3LQ4A 1ONNA 4X84A 3E03A 1SUCA 2XV1A 4NCHA 1KH3A 4MTCA 3A70A 4CE6A 3MB8A 3QITA 1MW9X 5LZ4A 4AYWA 2CFOA 4WBXC 3THWA 2V65A 3VR3D 121PA 2ZAMA 5FFNA 5AXAA 2C29D 3JQAB 3JQGA 4ZCPA 3TNYA 1KQFA 2E4VA 3L9WA 4CL0A 4L15A 1J2JA 1ES9A 1LLQA 2QN7A 2V7WA 1H1LB 5FTNA 3FRJA