5ECDA

Structure of the shigella flexneri vapc mutant d98n crystal form 1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
132
structure length
132
Chain Sequence
b'HLKFMLDTNICIFTIKNKPASVRERFNLNQGKMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHTGQIRAELARQGRPVGPFNQMIAGHARSRGLIIVTNNTREFERVGGLRTEDWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA(fMet)-specific endonuclease VapC
publication title Structural analysis of the active site architecture of the VapC toxin from Shigella flexneri.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Hydrolase
total genus 52
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01850 PIN PIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 5ecdA00
3ZDCA 5H4HA 2WP8J 5HNKA 2QIPA 2IHNA 3ZD9A 2H1CA 5ECYA 3ZDEA 2DOKA 1EXNA 5ECWA 1TFRA 3TNDA 1V96A 5L6MB 4XGQA 3QEBZ 1O4WA 1TAUA 1Y82A 1W8IA 3I8OA 1YE5A 4XGRA 5HMMA 3ZDAA 4WA8A 1BGXT 5SV2A 1A77A 1XO1A 1RXWA 4MJ7A 1UL1X 3H8JA 3QE9Y 1A76A 2HWYA 2MDTA 1UT5A 1V8OA 3ZDBA 3ZDDA 5FV7A 3H87A 3H7IA 2BSQA 5HMLA 3ORYA 4CHGA 3Q8LA 2H1OA 1V8PA 1MC8A 3H8WA 5ED0A 2HWXA 3Q8MA 2IZOA 1UT8A 3ZD8A 3H8SA 1B43A 2HWWA 2FE1A 5K8JB 1RXVA 5L6LB 2LCQA 1TAQA 3QEAZ 3Q8KA 5HP4A 3ZVKA 5ECDA 5H4GA 3IX7A 3DBOB
chains in the Genus database with same CATH superfamily
4RETA 5IT0A 1P9NA 1OAOA 4QWWA 1EFRA 3VR4D 1GNQA 1M1XB 2DULA 2Q3HA 1OBCA 2DQ4A 3USCS 3WO1A 4AU1A 2QBYB 2BM8A 2IKSA 4O33A 1YR6A 3N2EA 4RAOA 3PICA 1XROA 1DC3A 1Q1BA 4WOBA 5AIAA 5FFFA 3FB1A 4G5SA 5WRFA 3WLIA 1Z06A 2BJVA 1VP9A 1MMFB 3L1JA 2XE7A 1EVQA 4R1LA 5B57C 3KTAA 4I6EA 2OV8A 4HFJA 3NV7A 1RKUA 1S8AA 1ECBA 3QOWA 2PPLA 2C5EA 2GPAA 1NIPA 2XOXA 2XTJA 2BFCB 3IEXA 4ID9A 4E2ZA 5J3JA 4NCJA 3ICPA 1JTFA 4OLBA 2ZJ3A 4I4CA 5B7PA 3NC0C 3ERCA 3AVYA 2IZ0A 2X5XA 2X0FA 4AO7A 3QXGA 1PT7A 1N2EA 1V1MA 4QHSA 5AP9A 1L5KA 5C8ZA 3M1LA 1PR9A 2FV8A 1OH8A 4LXGA 3ENNA 2YZGA 3DOHA 3THSA 3X1KA 1SUEA 1AGYA 3HE3A 1TB4A 1IEQA 1UBSB 1OLUB 2PRYA 1CE8A 1U0JA 3HDTA 1IN4A 2Q8PA 3GLHB 4J0KA 4Z86A 2JHPA 2RGWA 4NZMA 3TBKA 1BN6A 4HG2A 4LVOA 4N0EA 3UXEA 1X9IA 2J67A 4W7HA 4BEWA 1K8RA 1PZXA 1ZAYA 3QKSB 2J4DA 1N4DA 1Z2NX 3L7NA 5F73A 3WBKA 1FMTA 3K72B 3D4LA 3C39A 4MVJH 1R0XA 5KYGA 3GFQA 1KR2A 1S2DA 2XCLA 1LQ2A 2YC2C 4JA0A 1QIEA 3RSOA 3QF4B 1JIVA 3L6OO 1E1YA 1TUBA 2R87A 4ACAA 5BN4A 2JLUA 1CVLA 2JLXA 1XP8A 1YBAA 3W8EA 3FYTA 4PTLA 1KKLA 2MSNA 1KTVA 3WZ2A 4CEJB 3H1AA 2QAGC 4LE1A 1QLHA 1I2ZA 4GOMD 4WUVA 4NFYA 4NPAA 4JYBA 1O6ZA 2QPOA 1CG6A 3B1JA 1C9YA 3H8VA 3MYYA 3KJNA 4AWXA 3O8BA 3KYCA 1A8QA 2TYSB 4X41A 4EJSA 3RVBA 4EG0A 2XQKA 3V1LA 4W5TA 4CG2A 4G2NA 2GLUA 4A8JC 2PJRA 3NBAA 3AFMA 5AVZA 2OB2A 4KVGA 1XNQB 4ZQFA 4BL5A 5FR2A 3AQIA 4TWIA 2J3IA 1UXGA 2J0UB 2MSDB 5EWMA 1CR6A 3TQFA 2WM3A 3BK7A 5ENZA 1TCCA 3V3TA 4ETNA 5KNBH 4CXMA 5H9VA 1EFAA 2F64A 2DT8A 4EW2A 1LLDA 3PLRA 4ROSA 3DV2A 3IEVA 4ILEA 3THWB 2OV2A 2RH4A 3C45A 4NQZA 5FUWA 3VOBA 2FE1A 5CIQA 1RXVA 5C0OE 4YDHB 5A4FS 1HY3A 4QBFA 5I7VA 1DMSA 1MEOA 2BFDA 5EE9A 1QE5A 5C5IA 1I30A 4DIDA 3PFHA 3HCCA 2CB9A 5CTJA 5JY6A 3DVLA 5CURA 3GT0A 3UB3A 3PDJA 2WB2A 2GXQA 2X5OA 3DDNA 4WLOA 4R2IA 1NXWA 3TLYA 2PGJA 4FCVA 1V4NA 3JD1A 3ND9A 3GMDA 1O94A 2VHYA 2ZCUA 3T54A 4IZIA 4JD5A 5FWXB 1D6MA 1MX9A 1PTKA 2OY0A 3QE2A 2JAPA 3I1JA 1JDNA 2EW1A 4BMSA 1QZTA 1SUIA 3B3QA 3AJ8A 2OP0A 3L6UA 3HV0A 2JJ2D 4HX9A 3D0RA 1KE2A 3OMLA 4PE5B 2ALJA 4KYVA 2BISA 2XRZA 2E5LB 2WUEA 2X0NA 4X8LA 3ZD7A 1SCUB 2MSKA 4OG2A 3TZQA 4ARIA 2FUKA 1XEFA 4DV5B 3QHQA 4N5NA 1HDEA 2JIBA 4PC3A 3MINA 3QIAA 5CVVA 2H8GA 4ZCLA 2O7VA 3EEFA 5DHSA 4BWVA 3KO8A 3P9CA 3ZU3A 1N2OA 3HUEA 1V1RB 3R5FA 2X3YA 3AJDA 2O0HA 4B6SA 2RAVA 5BNWA 1WVGA 3G1UA 3PNKA 1UOOA 3QXHA 5JQGF 4HN4B 4CI0B 2ACKA 3L1IA 4FBGA 2GLTA 3QQ5A 2OCKA 5CM2Z 2RSLA 2D5IA 3WLNA 1IN7A 5FUVA 2O48X 1GRQA 3EGOA 3U3MA 5GJBA 5K0CA 1HLDA 5L51A 1RBZA 2QXUA 4I1UA 3RSGA 3ZBPA 2LUOA 4A73A 1I1QB 5IH7A 2RGAA 3FWNA 2NZWA 1Y82A 2HIMA 3ELYA 2Y3IA 2XUHA 5BQ3A 1JU9A 3TW0A 1QG0A 1DADA 2GJ9A 4RNDB 2VK2A 4LDNA 3EPHA 4YP1A 1MJNA 3GY0A 4WY2A 1LBEA 1UC8A 4J3FA 1T0BA 2Y92A 3D8TA 4IO0A 1BJRE 4RM2A 5LXTF 1BE1A 1LF5A 3AXTA 3TOCA 8GPBA 3FOEC 3EXEA 3IUJA 2YIDA 1RI2A 1QK5A 4K46A 1PL0A 2W2NA 4GMFA 3MBOA 2LR0A 3DBHB 3K9GA 2Q6KA 2I3BA 3PE4A 2REOA 2OXTA 3U62A 1UBEA 2X4LA 2VDLB 3LV8A 1IEWA 4MCJA 3KLNA 2GS9A 4K9LA 5EPUA 4M2LA 3IDSA 1P73A 2F1RA 1KI3A 3PJFA 4H7KA 5IPFA 4DV7B 1N0WA 2IT1A 3DNFA 4LTDA 5AW9A 3S5JA 1W6RA 1G5PA 3EEBA 1JIJA 3VKVA 5H83A 3RC1A 1IY2A 3X43A 5FHRA 4WN9B 4HH1A 4MYDA 2QD2A 2WIGA 4Y2RA 1WXXA 3BB1A 2GHQA 3OMXA 1KFJB 1GL3A 3IKMB 5U9CA 3VPCA 2EZUA 2UXBB 4TRNA 2OV6A 3OBIA 2H1FA 3ILVA 4I8DA 4LCBA 1S2OA 1OC4A 4Q03A 4EKYA 1XZ8A 3W5JA 5L9AA 3MTQA 1LU9A 1Z16A 2P35A 4AWBA 1O0BA 3JAWB 2JGAA 2V6GA 5T57A 5J5AA 4DDTA 1A8UA 5IASA 1PVOA 1YQ9A 4KWHA 1GDDA 1ZD1A 3H9QA 1S2NA 3RK4A 3WTCA 2B0CA 3G8YA 4P34A 2D74A 5G2OA 3OAAD 1C3OB 4BATA 1J1IA 2GEFA 3F67A 5FWYA 3MM4A 1RI5A 1ZD9A 3VSEA 3E1KA 3C1AA 2XITA 4EI9A 1HF3A 4XLLA 2PX2A 3SSNA 3T7TA 4MEAA 3VPSA 4OK6A 3TRIA 5G3ZA 1JV2B 2ZSFA 1W93A 1Z12A 4L9WA 3A4YA 3U7QA 3HVJA 5AVTA 1MIHA 2F4NA 3CGGA 3KC2A 3D8SA 4OEHA 3ZEAA 1QTQA 3UA4A 4ZTUB 4HAIA 5KYUA 2AW5A 4R6XA 5AXDA 4WDRA 2JGFA 1RVDA 1X1CA 2YMMA 1OPRA 3RT1A 2BBSA 3NWEA 4J6EA 4ZEOA 3R7FA 2XT0A 5BO5A 2HCTA 2IK8A 3F3YA 3HACA 1CQIA 4RLFA 2Q6TA 4EGAA 3UJCA 5A5FA 4KNWA 1NF9A 1UEIA 1EWYA 1OVMA 4D42A 3PFWO 3DBIA 4MA4A 3UBTA 4Q9KA 4JBGA 2A92A 1Y3FE 3OCVA 1T9GS 4BN0A 1O08A 4QZVA 1FSSA 2GYUA 2WHPA 2X8BA 1XVVA 3MOIA 4KXLA 3FCYA 1UCFA 1QF7A 1Z45A 4GX0A 1CEEA 3B38A 4CKEA 3DH0A 1XA4A 5BUZA 2E4VA 4U8GA 3BC1A 1Y3HA 2YHIA 3LUJA 1BD4A 2HO5A 2J9GA 2X19A 3DYBA 3SMVA 3UWOA 2YMQA 3Q41A 2GM9A 3CU5A 4LNUB 2K87A 4IIUA 5CLLA 3SJBA 2F90A 5FOQA 1O97D 4KDFA 3OEHD 3LC7O 2O2DA 4LHEA 4MGIR 1AQYA 3DFZA 1DS6A 3CXRA 2QVYX 5KVVA 1FRFS 1S4QA 2LXNA 3OU2A 4AKTA 1QO9A 2NMVA 5JCPA 3B20A 3K6KA 2NU8B 3SVLA 5IHPA 2VYCA 3DBRB 3FX2A 4P0TA 4V02A 4G25A 3DMYA 4DMUB 3OX2A 4PC6A 1QQBA 1OVGA 5L45A 2ODQA 3U44B 2ET6A 2BCEA 2OHJA 2VDJA 1GA1A 1NQTA 1UBUS 1Z6QA 2V1XA 2I9KA 4H3VA 4CDRA 3OIGA 3FD8A 5HWSA 3JTEA 1IG0A 2OGWA 3RQSA 2V7QD 4JMLA 2YBEA 4MKGA 1WCXA 1ZNWA 2FFHA 3ZHZA 1HFJA 5J58A 1U0OC 4JR0A 4M54A 1IE3A 4IGIA 2YN4A 1SXIA 1L7AA 3AFGA 4ZT3A 4YUAA 2ZP1A 4JC5A 5ES3A 2AI1A 4HDNA 1ZJJA 3FB4A 5KREA 2FN8A 3LY5A 3OO0A 5JDIC 1YB5A 4MDHA 2A5GA 1M8KA 5ED0A 3K4PA 5KTOA 2FA9A 3DOJA 3G5LA 3TLJA 1JWBB 4BFTA 5TB5A 4PG7A 2OO3A 1DE0A 4XAQA 4YB8A 3K0SA 1G291 1SVUA 4D9JA 4XD7D 4UU1A 1KPGA 1XQ9A 3OJLA 3PBKA 3GK3A 2VXBA 4B84A 3L5KA 3IKTA 1T34A 1XLTA 2JGMA 1SURA 1ISHA 6YASA 5CBPA 3INTA 1CFZA 2OKGA 3G23A 2X6QA 2NPOA 4MV3A 1FMFA 1U2ZA 2R6CA 1TE2A 1CULC 3EFOB 4JXKA 4Q3NA 5CW1A 1YC5A 1P3JA 2D06A 2WA1A 2DPMA 3PL5A 3QV2A 2E9SA 4QUKA 1XRNA 1AS3A 4QDJA 4OJTA 3VTFA 5HTOA 4GOXA 2ZRNA 2EC5A 2J8ZA 1X15A 2KHZA 2NZ2A 3PGMA 2OHHA 4KUEA 4WLNA 5EJ8A 3PXBA 1NVAA 5JC1A 2V8BA 1G6HA 3G6WA 2XF8A 1M1ZA 4OA8A 2VR1A 5LP6F 3DVAA 5B7GA 3GJQA 3UA3A 4DC9A 5CPBA 2GK7A 3N2GB 1CC1S 2X6RA 1Z6ZA 1I13A 3RYIB 4QO8A 1INLA 1XQ1A 2A0UA 4CDNA 2ZB7A 4G0UA 1CX9B 4PSKA 1DJLA 5K3FB 3Q7EA 3ANSA 3IO3A 1B74A 3H4IA 4M7WA 3LWNA 1NN1A 2QTMA 4UZSA 4NU0A 4TL8A 1J24A 1NBOA 3KOOA 3KS9A 4MQBA 4X8MA 3UJ7A 4B3XA 4E11A 1OYWA 1KQNA 4Y6LA 1M34E 1NMZA 4EGCB 2QJWA 1JDVA 5ULLA 1J33A 2BFBA 1FJ2A 1JDBB 4RBNA 4Y67A 1NMSA 3VR0A 5T4FA 4MO2A 3FDZA 2VPTA 2WG2A 3CLHA 1E2KA 2BKXA 4UM8B 1KVSA 1DWQA 1KZYC 1V6CA 2ZI6A 4JUFA 4MS4A 3UB2A 3VX4A 1K3FA 1ZGBA 3EAGA 4GE3A 2YS7A 3VHLB 4A03A 2C4NA 2SKCA 1IULA 3KOZA 4GNRA 4M21A 5BYKA 4RYDA 3G2IA 1C7QA 1WXEA 7MHTA 4LBYA 3MCZA 4I1PA 4KN8A 4K86A 1SUWA 4HZUA 3AEZA 3COWA 3I8OA 4J49A 4HPXB 4V0OA 3OO1A 3IKJA 3HYTA 5BYBA 1BMQA 3MZ0A 2ECFA 3OPYA 3R0VA 3RI3A 1H3EA 1KR5A 1CPYA 2FPGA 5DHPA 3UEOA 5DULA 1C8KA 4TS4A 3NKVA 3Q7PA 4JWTA 2E55A 4Z99A 2KBFA 5GONB 1RWVA 1F17A 1VZ2A 4ZIRA 3DS8A 4LMRA 3S2IA 3S7ZA 1T8PA 1LGYA 1GOTA 3QBDA 1NDHA 2IF2A 1R0BA 4HN9A 3WB0A 3WHKA 2O59A 4F2HA 5FJJA 2XVYA 4GPTA 4YIKA 1FQKA 1UJMA 3M4YA 3TLXA 3TZKA 1A3CA 4RO0A 5FI0B 2ZXUA 2J5KA 2Y0EA 1T43A 1BYUA 4JJAA 2ZQYA 4IWNA 3ZPXA 1T2FA 2YV3A 2YIVX 2ID9A 4ZI7B 2BFEA 1WHTB 3LDFA 2OBNA 4FDVA 1EVIA 5LL6P 1BS1A 4EY8A 1QH1B 1S9DA 5AKYA 1DDIA 3W9YA 4BLSA 2JKVA 1K75A 3DHWC 3NC4A 1WEKA 1AX9A 4OQYA 3GPBA 4MVCA 4PZEA 4CHGA 2JHFA 3O38A 4BQPA 5JBIA 2WKQA 1FUEA 1MA3A 1QKKA 3QV1A 3WJ7A 3ZGNA 4D99A 4DSZA 4PY2A 1I94B 1DTEA 3DVSX 2AN4A 3MWFA 3OPMA 1CTQA 1DOHA 4HNRA 2HRBA 2XODA 2FPIB 1Z7BA 4R6WA 1IXRC 3A2LA 3NHJA 5CNJA 4BGUA 4U7FA 1CDZA 1JUDA 2P2NA 3AF1A 5D3KA 4XJSA 3K1TA 3RS9A 3D7LA 3OF5A 3I9FA 3IALA 3O8OB 4DLSA 2RGBA 2GARA 4NOKA 2H2WA 5BSVA 4PIVA 5DNCA 2GCGA 5JPCA 1N1GA 3LDGA 1B3BA 5BSRA 5TEWA 3SJUA 2CV0A 2IPAB 4GHWA 5DIFA 1ZU4A 5MFPA 2LVBA 4KMOA 4L8LA 2QZ4A 3BRSA 1SHZA 1YFKA 3DT6A 1KDRA 1XBTA 1BROA 2H4XA 2OCXA 3EVDA 3KLPX 3OJEA 3H13A 3QLUA 1GV0A 1JWAB 1ODKA 4KBGA 4LJ9A 1GTMA 2LCIA 4P80A 5E6RA 5A4AA 3G2NA 3I2IA 2VPZA 3IBTA 1JSLA 3SYTA 3LVBA 2G3YA 5JYBA 4PANA 4UUAA 1HOTA 4FCWA 1A4UA 3SKVA 1K4YA 1HDYA 5JS8A 3F46A 1WDMA 2P2DA 5CGZA 1FX1A 3QXSA 3PE6A 1RYDA 2RH8A 1SBHA 1SIUA 3BTUA 3FHCB 4MS3A 2IEIA 3DEZA 1N92A 3HHPA 3KT8A 1X42A 3EPRA 2H65A 1JGTA 4GQAA 4PYJA 1I32A 4OHVA 1R88A 2PUWA 3IRVA 3BHIA 1AK9A 1PRYA 2UUOA 2Z6AA 3THXB 3RABA 1KI6B 5GP1A 1L4EA 3U3KA 1MABA 2RFLA 3QLVC 1QFSA 4HAYA 4HFNA 4S0ZA 4PN3A 4WT7A 1XZIA 3R5HA 3JR3A 4HQNA 3TG8A 3TSZA 5KDLA 4YCJA 2O6LA 1QIFA 3ZY6A 3PU6A 2ZITA 3IQWA 3FYSA 1R6AA 1G6OA 1T6BY 2O2CA 2OV4A 4DMKA 5B6IA 5MDHA 4Z4IA 4HX2A 1HE8B 5C8VA 3MCTA 5AHKA 4AUNA 5EZYA 1BOFA 2GWRA 1JF8A 1KVUA 3N86A 2W0MA 2OAGA 2WKPA 3CVUA 3D8RA 5I8ZA 4QDTA 2B37A 2DHQA 1A8HA 3T7SA 3SG0A 1T4BA 3ANMA 3P96A 3P0IA 4Q3KA 3R7SA 1OXXK 4OKIA 1EXDA 4P7GA 3GP5A 2HU7A 1ZD2P 1YE5A 2C95A 3RS3A 1SFRA 4J1QA 4L02A 1UBMS 2AD5A 3TAXA 1SB8A 1SQ0A 3TECE 1UMDA 3PD0A 1M34B 2XDQA 3ZNOA 4XCXA 4EQ6B 4X6LA 3DKPA 3AI3A 3EAQA 5IW8A 1QHGA 4RFVA 2ONJA 5SYNA 4YN3A 4B43A 3CY6A 1L7NA 4IMJB 3WGYA 1WLYA 4G4IA 4HDSA 1QB8A 2FSUA 2R4QA 3ZZTA 5SZIA 4I5IA 3CO0S 2X3FA 2MU1A 3ZKWB 4GQIA 2BONA 3UBMA 3BXHA 3Q5DA 3CEPB 1JG2A 2J0SA 4AJ4A 1I0LA 2IL1A 3HU5A 1M33A 1TDJA 4N9WA 5BNZA 4KIUA 4F72A 1LUAA 1IVYA 2AT1A 3ENVA 1JHZA 1F2UA 4Y2UA 1AUOA 2VLIA 4OFZA 5FWDA 1V4BA 4IBOA 4P35A 1AHHA 4QYXA 3WNZA 3JWPA 5T6MA 2DSNA 2Q62A 1EAMA 1M2WA 2H4WA 2ZULA 4TT8A 1QHHA 3IP8A 4DLNA 1GHTA 2OVFA 1TJ3A 3RFTA 1K5PA 3STYA 4HS9A 3AL0C 5GIOE 2E1RA 4RQBA 4L5IA 1D4FA 3K94A 5EE3A 1KI4A 3IGFA 5ALXA 1QBKC 4D0NA 5JD6A 3M49A 3ROPA 3N2YA 3VOAA 2ZRCA 1GQOA 3ABZA 2YN2A 2PKEA 5K45A 2NPFA 1BEUB 1DG3A 1VMAA 2BM0A 3PNPA 1O6BA 3RBXA 3SS9X 4G9GA 4LOAA 3AR6A 1BH6A 4EVSA 5FBVB 1JJ7A 2ZS9A 2HTEA 6GPBA 4AJJA 2OM6A 1S0UA 4DGSA 1XZMA 4JH0A 4U0JA 2FX2A 2PX0A 1JBKA 1CSEE 1K89A 2BMWA 5AW0A 3B6JA 4ABTA 3N6VA 3OSUA 5C3MA 1Z73A 3MB5A 4WOCA 1U81A 3U7JA 1DGQA 1NFRA 3QEJA 4P3PA 1VE1A 4X00A 4Q02A 3KKQA 2AUTA 5HNKA 2HU5A 1KMCA 5T67A 4TOIA 3D6MA 3EWIA 1TO6A 3ESYA 3OJWA 3R2JA 3CBQA 4P31A 1TD1A 1DP4A 1XZBA 3QEKA 4JYCA 3UB4A 2JBAB 3I92A 3UC9A 1PFWA 1QAOA 4DLYA 3K6SB 1UT6A 2YCBA 2BEKA 3LP8A 3R6TA 3FPBA 3VX3A 4F96A 2Q3EA 2ZYWX 3EVZA 2OPBA 3JY6A 2PKXA 1J8VA 1GD1O 2EQAA 1SVKA 3KB1A 2ZSDA 3EOAI 2F1KA 4IHQA 1E9VA 1F4VA 2JFVA 2WFAA 1DIRA 1GXSA 1Q16A 2N9UA 3CJTA 3KKPA 4GL4A 3TMAA 4R71A 4DV1B 3U0BA 2A4KA 2YV4A 1GA4A 1PFGA 1TLFA 2FWRA 3C3BA 4P93A 3GIDA 4CI9A 4FDMA 3U31A 4TTAA 4G0MA 1W5EA 4RPIA 3N2LA 4X24A 4UEKA 2N1MA 2ZS7A 3D2LA 4ZHSA 2AOVA 4BLVA 1DBIA 5HBGA 4GI2A 1WULS 1RYBA 3GLSA 1QO7A 3QU9A 4M7OA 1V35A 2DF8A 3NHSA 4OHWA 3QWBA 3PEWA 5G4KB 1WCV1 7MDHA 4TLDA 1RR6A 3O74A 2PU7A 4AECA 2GOYA 4BO1A 4LY6A 5DFAA 1AB6A 4B09A 3MHTA 1G21A 1DZ3A 1M0EA 2VHXA 3E9NA 2HNKA 4WKGA 2BZ1A 4DT1A 1J1ZA 4LW8A 1NTRA 5JTUA 4ZO7A 2EWMA 3UMMA 1XMXA 3E5MA 5H7XA 1MB0A 4KQ2A 4GI7A 1E9RA 3DDSA 2H8KA 2XUDA 4ENVA 4OHKA 5JXJA 4JNKA 3R09A 4NESA 3C14C 1EUZA 2QU7A 2O54A 3OSZA 3LQ4A 3CNOA 4O2AF 1FLNA 2CN1A 4GLFA 1T29A 3RHSA 3OTOB 2HF7A 4NMLA 4RIEA 2YXDA 1GZ6A 1XPJA 3OT5A 1GYRA 2RGDA 4TV9F 1WJGA 3WKBA 3MMSA 4E5UA 4ENTA 4RHCA 2V6JA 1XCPA 1BOOA 4N7JA 5CHEA 4NATA 1VCMA 3QKUA 1YS4A 2AMJA 4NR0A 5IYZF 2RKBA 4BO7A 4JYZA 1G8AA 3FKSD 3UICA 4ACBA 5HE9A 5T64A 4U7JA 3WHPA 1ZM4A 2XCIA 4YCDA 4NAHA 1P1RA 1QZUA 2YVQA 4YACA 3BMQA 2CKDA 2Y05A 2R25B 3HJFA 1K88A 1NQUA 4GL2A 3U4CA 4GKAA 2VPPA 4UE2A 2FU5C 3HKBA 3MWLA 4RH3A 1PYGA 5M29A 1E1CB 3ICWA 1VJRA 3U7HB 3MS2A 1ULUA 3WKDA 4U3JB 1L4LA 4HAOA 4YV0A 5FX2A 3EG5A 5T4EA 2G25A 2XB4A 3Q9UA 1ESEA 4ONEA 4FI3C 1VGVA 1GKYA 1WAMA 4PX9A 1DBPA 1HEIA 4W1SA 4BP3A 5I3ZA 5HR5A 4PXSA 3CXUA 3B1WA 5DO9A 4D45A 1R0SA 4MGYR 4QYSA 3PC4A 1A7AA 5KYXA 3W9UA 2NO0A 4UU8A 2BBOA 2P79A 4WGFA 1DQYA 2O19A 2DPGA 4MUBA 1EX6A 1C14A 2I2AA 2J41A 1C1HA 3BH7A 4QVKA 3TXYA 5JNLA 4YFVA 1NJFA 5FPKA 5JYCA 3RS2A 3CV3A 1CNMA 1STOA 3JX9A 4KQFA 5GM2A 2A14A 5H80A 3L0SA 3BL8A 3MCAA 3OTHA 5CT9A 3TQTA 1WZEA 1U04A 4HAXA 2G1UA 4L27A 4X0EA 1JPVA 4LZJA 1XRRA 5AVJA 4QOEA 1OXUA 1E6LA 3BFXA 4RGBA 3SJCA 2PR7A 4P38A 1DAEA 5DI9A 3MLAA 5TXGA 4Z6KA 2YZMA 5CRIA 1YHYA 1J2TA 1N9KA 4Q3OA 5K0SA 1E2IA 1YDHA 1QPBA 2ZIGA 5LZ4A 1EVYA 1LY1A 3PWSA 2IQ5A 3V2GA 1KFCB 4ER0A 3JQCA 1Y98A 5HJ2A 3BCUA 1R9NA 1YRBA 5DTQA 4AQDA 4C6TB 4B6OA 5AM0A 5ITWA 4IZOA 1YFJA 3EVBA 1NHGA 3KJXA 4ZD6A 4Q6WA 1A4RA 2VAMA 2HIAA 4CLOB 4DWWA 4Y2XA 4GEGA 3UOGA 3X1DA 2ZIWB 4EY4A 4TZ6A 3LHDA 3L7MA 4TZTA 4U7PB 4XPZA 4MDEA 2GRUA 2CFCA 1S2LA 2HCBA 5HRCA 3OEEA 1GN8A 1KTIA 2OAQ1 1RHKA 3NIDB 4MRMA 2Z5GA 3GNTA 4B0PA 2PCJA 3CZAA 1XAHA 2I8LA 3C6KA 3EISA 3LJKA 2YXBA 3JPYA 2CJWA 1X94A 4D92A 3ADPA 2WVJA 1MIOB 2JJ1A 3QOFA 1SN7A 5DHQA 3RAGA 2CWWA 4ES6A 4HDCA 2BEJA 1NY6A 1OCEA 2PGDA 1V4VA 2I1VB 2V9ZA 3BGSA 3H2YA 3Q3VA 5EHNA 4D9CA 5CDTA 1UFKA 4FHDA 2HA5A 1GTL1 4WK4B 3LVFO 1UZLA 1LRKA 3IIKA 1COWA 2PS1A 3IKLA 3N8KA 4Q3AA 4S0XA 2YR0A 5CNMA 1EPUA 4PTZA 5DCLA 4A92A 4C78A 3O0DA 5BT9A 2V9CA 3BERA 2Z5FA 3H5OA 3TRJA 1VMIA 1ID1A 2EL9A 3ED5A 2Q2VA 4C4RA 5I6DA 1XEWY 1XPUA 1XWFA 5KNDA 4OYLA 5FNVF 1WB9A 1PL8A 4J0HA 1AE1A 1PJAA 2VT7A 4JC0A 4YJGB 1EDZA 5I47A 5ENDA 4F11A 1EFKA 3NUZA 4PG4A 1P7PA 2HDHA 3MILA 5AW1A 3UHJA 3G0OA 5AT1A 3V4LA 4CDGA 3B78A 2G04A 2YVLA 3WDKA 1DT3A 2IW1A 4PLWA 1NVTA 2DY0A 1G1MA 3ZUPA 2IZ5A 5E6SB 5J4KA 1DMRA 3WIBA 3M1YA 1PR6A 3PSAA 4UTXA 2B20A 4GX1A 5GIPE 3ADOA 3N5KA 3KVRA 3SEZA 1DU4A 2GTPA 3BD6A 4GMXA 1RW4A 3M82A 7AT1A 2V55B 5FHQA 1SCAA 3LNCA 3RJ9A 3DQZA 5BRJA 4D0GA 5CB4F 4IGAA 4WEOA 5BN5B 3ISJA 1MAUA 4JJ7A 4RTOA 1R6UA 5EXTA 3NANA 5TX7A 2R7NA 3DA8A 3E4DA 3TO5A 2HXGA 2GZ1A 3KB8A 2WZBA 1GADO 2R7AA 3KQTA 1ZD5A 4U39A 2VQFB 1OIXA 1T1JA 2V98A 1W88B 4CUJA 3C3WA 4E5KA 4MP8A 2IYVA 1X14A 2H7CA 2UYCA 1WPQA 4INOA 2G0TA 2YJ3A 4NAUA 4HPWA 5G0TA 4FC7A 3HKEB 3ZE8A 3FG9A 2P7HA 3UJ9A 4XUGB 2QZPA 4BVKA 2XBUA 4OD0A 1U3DA 5MFZA 4NH4A 4H1TA 4K8OA 3N7TA 4RHTA 1USIA 3SHOA 2UZ3A 4LWQA 5JLAA 3EGWA 4EUNA 1KPIA 4OUDA 3ZJ5A 5DISB 4XXHA 2P3LA 3MWGA 3AP3A 4A6PA 1NVGA 5EGSA 1QS0A 1P5RA 1W30A 3L6RA 4JP8A 4XVCA 1JFLA 1QYIA 5GJWC 4JUAA 2DKFA 2ZYGA 4AF7A 1M6VA 1VL1A 2H85A 5TC4A 3V2UA 4Z4HA 4WY5A 1G42A 2RHJA 4GSYA 4Q7LA 3WE7A 3ZZ0A 3EEQA 5CX1B 4S1VA 4WMLA 2GEJA 4L76A 1CR4A 3W7AA 4CM8B 2IELA 3IBYA 5DX0A 1SBIA 4L78A 2E4YA 4HBGA 4PYNA 2EBFX 2QTHA 5FI1B 4FWBA 1CUZA 1SBQA 1SUSA 2O8CA 1CQJB 3UJ3X 4A16A 2WZDA 3QVMA 3IESA 3JZAA 1F2DA 4B7UA 5BQ5A 1NJ5A 1AU9A 3VJKA 3OQNA 3IOCA 2GUGA 4KMSA 3HADA 1RAEA 4BQEA 3E05A 4MV7A 2XUOA 2ZSJA 4IF4A 1H5QA 2IQIA 2BY4A 4MV4A 4R01A 4BNFA 2AC2A 3MMZA 3O7MA 4OSOA 5EZQA 4A2QA 1KSFX 2X0KA 3GYGA 4NBLA 3NOQA 1MCZA 4BV3A 4CDMA 1SVWA 1HRKA 5U4QA 2PUJA 4D46A 1LPMA 2D7JA 1E1RA 4IDAA 2EWVA 3SC2A 4ZYTA 1WCWA 2AN5A 4L95C 1MA0A 1Y9AA 5C35A 3MMPA 3NDRA 4D2IA 1KZHA 3ROTA 1EA5A 3TRDA 2VHCA 1F8GA 2EP8A 2OO5A 3HLYA 1VYHA 1OXVA 4YI5A 3SYLA 4ML3A 4JSTA 1LK7A 1NG1A 1A5ZA 1I9CA 4MHOA 4R3UC 4XQ0A 2V45A 2Q0QA 2CUZA 5KYWA 4NICA 2ASEA 1DQNA 1FFHA 4GZ3A 3L8DA 2NVWA 1W96A 2PT9A 1M54A 3RGGA 1OT3A 3RJMA 1P1CA 3PCRB 1U90A 3BOSA 2W6JD 4BMXA 1OREA 3ZQ6A 1AKTA 4MULA 4MWEA 1QANA 3H2SA 1NUSA 2FP4B 4R2HA 2H9IA 1YS9A 1RI1A 3GZJA 1KK0A 3HY3A 4MMYB 3V34A 3D6HA 4ENUA 2RH5A 1CY7A 1HTBA 3EG9A 1N2GA 3VMFA 3AW9A 4FHEA 4MA0A 2BAGA 1GVNB 3C7DB 5ALPA 2I6GA 1P0IA 3KUKA 4WOJA 4Z1MA 2B0JA 1Y1LA 1L7QA 5TQ0B 1A8SA 2ZYIA 4M38A 5I7EA 3HO8A 3WAJA 3H1TA 2OCLA 2CUNA 5JECA 4AD8A 1QIHA 4IV8A 4QYIA 2FZLA 3L5OA 1WNTA 5HFNA 1UMCB 4PPGA 2Q46A 5YASA 3SIWA 1T8YA 4OXKA 5EPOA 3LUHA 2AOXA 1SKYE 2CE2X 1F1JA 2RHMA 3IOEA 5TT0A 4D3YA 4MJLA 2C8VA 1NDQA 1Z0UA 4JP3A 4FP9A 1X92A 3OZFA 1YKGA 2RHRA 4FS8A 2EFCB 1P6QA 1SXJA 4WJZA 3E35A 5LWHA 1RQPA 2AJ8A 2WM2A 3MUFA 4X7BA 1DV1A 1YULA 2YXPX 3KXLA 2Q4TA 2HK7A 2ZS8A 2G70A 2WMDA 1RP7A 2OXFA 4XEHA 2JZCA 2QM8A 5D84A 3H9JA 3GLQA 1S5PA 1KA9H 1O4VA 2NX2A 2Y4NA 1RXEA 3LIPA 3QVSA 1M6HA 4RC9A 4RV5A 9ABPA 1K66A 4RGQA 2JGDA 2PS3A 3IAS1 3AKDA 3NBQA 3O2SB 1NBHA 3FRIA 1QHFA 1Y6JA 3S4YA 1OH7A 4ZGWA 3R7WA 3M9WA 3HK2A 2EX1A 2WJJA 4MUYA 4UKDA 5KQRA 5L3SB 3P9NA 5FEMA 4ZZ0A 5MHTA 3H75A 4RY8A 1PTJA 5JE8A 4HGZA 4J75A 2MINA 4W4TA 1X0VA 3LLMA 3TIIA 3VDNB 4B4VA 4C0LA 3D3WA 2Q4RA 4YY3B 1RM3A 4PGAA 5JQGB 1ZC3A 1P2DA 1UBFA 5DMHA 2UKDA 1T9BA 4A0QA 3EXIB 2PRSA 5LMNB 1JEYA 3T1HB 1TZMA 2C4WA 2FPWA 2LW7A 2FB9A 5AUNB 4JYAB 1U3WA 2ZWAA 4H7IA 4X54A 4XDGA 1UAAA 4NU8X 3W3AA 4MO9A 4BASA 5IMBA 4GZMA 4L50A 1BGXT 3QFRA 1IONA 2NACA 1E2EA 1JHDA 2NO6A 1NT2A 4LY3A 5I51A 5JDCC 1GUBA 2P9YA 2Z8YA 1EVJA 3GMTA 1OD6A 2C1EA 3QNWA 1FBNA 2ZIXA 2ZJOA 2ZTSA 4DIUA 4DLZA 2IHUA 3C6QA 3P19A 3W4IA 3FSJX 4UHDA 4B32A 2ENWA 3RYCB 1K98A 2W2MA 3V4VB 1JR3D 3AH8A 4JBHA 1YOVB 4NYJQ 1GPKA 3H9CA 2J3MA 1I6WA 1BWRA 4R69A 3RK0A 2R0QC 1XU9A 2EKLA 2WT8A 4M9CA 1VKNA 4GMDA 1MJFA 4PZDA 3RTBA 3T15A 1SC6A 1YRLA 2IYAA 2XTNA 4C7KA 4URXR 4QG3A 1LF0A 4B81A 5FUXA 4IJ6A 1OI4A 4LBWA 5BV8A 1RM0A 3ABSB 1AZSC 4BQQA 1PR2A 2BPOA 4TXLA 3JRXA 4BO4A 4E12A 5FLKA 2VHEA 3GQBB 3QX9A 5JPDA 1PLKA 4QSMA 3H8WA 5BYJA 3VKWA 5AQ1A 4S04A 1HSOA 2W43A 1E61A 2VF2A 1XIVA 4L4UA 4WZBB 3WI7A 4ABYA 4BFVA 1YS2X 3HFSA 4UBOA 5KNCA 3PDIB 2P6MA 1W8DA 2EGUA 1E77A 3DAYA 1U0TA 1ZG3A 2HGSA 4QTYA 4A36A 4GPZA 4W9NC 2AFVA 3TJZA 5TMEA 3IAUA 4YMVA 4OJQA 3I3OA 2KPOA 3K5IA 5LQKA 3ONVA 1U3VA 2RIRA 3D7KA 3HZRA 3C5HA 4ZCIA 4QUEA 4GDFA 2R47A 4LJ4A 1SNYA 1W87A 2Y1WA 3JV7A 3LTNC 3ESDA 4HXGA 3DDWA 1UZMA 4C2BA 3ROEA 4MVWA 4UULA 4YS6A 2IDZA 4NLLA 4GX5A 2PUHA 4CF3A 1V8BA 4HDKA 1MOSA 2QT0A 1NJ8A 1P1HA 2G5CA 1RHJA 1IOZA 1E0DA 3DE5X 2VHWA 4JLBA 4BDSA 5HSGA 1J22A 4G01B 3CUUA 1G1AA 3LUCA 3OCZA 3PHIA 1WB6A 2P2SA 2V58A 4RK7A 5JSZA 4XX1A 2Q5JA 1ZMBA 4BLOA 3LPMA 3HA2A 1KP3A 3Q3HA 3LWBA 3PX2A 1U28C 2J3EA 2RK3A 5DBGA 4BAGA 3DNPA 1E8DA 4I14A 2A58A 3P4XA 5IWCA 2IHNA 1G2IA 1M8FA 1QC5B 5AKIA 5NULA 1JJVA 3BSYA 3E7DA 2NM0A 3FBWA 3Q9NA 5CLIA 3FR7A 3UWKA 4QOSA 3FCOA 3ZXYA 3OLXA 2NO1A 2NAPA 1VL5A 3HCPA 1AQLA 1NRXA 4PHFA 3FDFA 3UMCA 1FDTA 1ZMXA 2Q5FA 4WD3A 1KOLA 3W5IA 5JZOA 3KQHA 1PYDA 4NXNB 2ZUSA 1KO4A 5HKLA 4CQNA 1V9LA 1VE9A 3AIMA 3UG7A 1XZEA 3B3AA 3U3OA 5L3QB 4RVUA 3AP1A 4GYYA 1NXPA 1NXOA 2FUCA 2HF2A 2VSFA 1KDPA 2X2OA 3BYZA 1G66A 1GGKA 1RLMA 3U4DA 4MPJA 1SKAA 3LGAA 2TRSB 3AR4A 4CM3A 4MRPA 3OPVA 4WKCA 5HPYB 4F4JA 5HRUA 4U00A 1XTBA 3DV9A 1GCUA 4G1VA 3WWZA 1SEPA 3ZE9A 1VHWA 1ZONA 1V6SA 5F76A 1ISFA 3IDQA 1DAOA 4GPEA 1YL5A 1DJOA 4H1UA 1SG9A 4FE3A 3SZUA 2RGEA 2ZBVA 3GA5A 3I72A 1NBMD 3KLBA 3QKIA 4P84A 4AY3A 2NN3C 3AJEA 2HK8A 1SBYA 2PGLA 3IULA 1J90A 3PVZA 2PQ2A 4A27A 2N0SA 4UFOA 2RI0A 2VDQB 2V3VA 3A9WA 1ZSVA 3B70A 3VNRA 3L79A 4RL6A 4C21A 3U61B 1JFRA 1KXJA 1QKJA 2VYNA 2DM6A 3DMDA 3FI0A 1WHSB 2Z8ZA 1DBVO 1PP4A 1WVIA 2AD1A 3A58B 3L4SO 3MNFA 4KJZA 4OU5A 4XEUA 1D6SA 3L7DA 5CHYA 3SSOA 1I5EA 1VPEA 4BN5A 1R0WA 1Y5NA 3C4VA 4TTSA 1RACA 2OLKA 4L4ZA 1J9ZA 4L4YA 4H17A 4JC4A 4UAJA 3NTRA 3LWDA 1YIOA 3Q5GA 1SKMA 4K28A 2Q21A 4PGGA 4B2LA 1V26A 3HKDB 5ISMA 1KOGA 1G41A 3BM5A 4CG3A 1TKCA 1I8TA 3ETGA 3DKVA 1AMOA 1J4AA 4NMXB 3OE4A 1WUYA 2PBRA 2GD1O 4FFVA 2FGJA 3G5TA 4PS0A 3FVTA 2Y9MB 2YJGA 4N3AA 2CUTA 1Y1RA 4WOKA 2D3TA 1NWCA 4TUYF 2CHFA 1R0KA 2ZE6A 2UVPA 5DNVA 3TCXB 5A7FA 3SKYA 5F64A 1OQAA 1IJEA 2CDCA 4DCTA 4XDZA 1JKJB 1OF1A 2OV3A 5CDFE 3AHHA 3JASA 4H0FA 4O4JF 3VR6D 5CVDA 3PPWA 2Q45A 1N57A 3HBMA 4WGGA 3BIWA 3K5PA 2FW9A 4ZYWA 1HM5A 2BEWB 3A37A 4N5HX 2ZKLA 1F2VA 3AM1A 3F5SA 4OBWA 4B3BA 4BN4A 5C2JB 3EQ6A 1UM9A 3O1HB 4ZCTA 1UPAA 5CM9C 2VDUE 2VKQA 1KY3A 4P5EA 4BX2A 3DZGA 2Z2IA 5HIKA 3EQZA 1R00A 1EINA 4IPTA 1DX9A 2FY8A 4QXMA 3EZ9A 5CH5A 2F3QA 3P4UA 5PNTA 4DV0B 3LOQA 1QGUB 1XK7A 2P75A 4HC4A 4F12A 4YMGA 1YI0A 3O8CA 3W8DA 4GPIB 3OQOA 4LKRA 5C7LO 2PL3A 1SHLA 1M66A 2HUPA 3W05A 1AV7A 1HT2E 3I64A 3I9KA 4REQA 2QQ0A 4GRIA 5SICE 3UJAA 3CZCA 3TBHA 4XSHA 5CXQA 1E99A 5E3JA 2X3UA 1DEHA 2ZBEA 4KH0A 4KE9A 5BN4B 1KJ9A 3CO5A 3WLFA 5A5EA 1AQIA 1QFXA 5LP6B 2YUIA 1XHFA 4MQEA 1ADYA 4YRTA 2HT1A 3BTOA 2P2YA 4MGHA 4WZZA 3I4FA 4CMIB 2PX3A 3FWKA 4H6PA 4HFMA 1YRHA 4ENRA 3QMMA 3LG2A 1G64A 1WMBA 2ZI3A 4FFRA 2VWHA 4HWSA 1IRIA 4EYOA 2PS9A 4G5FA 1KEKA 1PO7A 3COZA 3KX2A 1OI3A 5JAZA 2NZVG 2R7LA 4CUZA 3A1NA 1JG3A 1T13A 1RJ9A 3LOUA 2WJIA 5HF9A 5LLDA 2CVFA 2WD7A 4JB3A 1PJZA 3OHMA 4KG7A 2ZJ4A 5JWHA 1RJWA 4AJIA 2FF5A 4X1YA 2PKWA 5EZYF 4EI7A 1TUIA 1DBQA 1HE2A 1FRNA 2V7PA 2ZB2A 3G02A 4JC8A 4XGRA 4NS1A 5BORA 4YV7A 4BVGA 4MCIA 4V3CA 4EW1A 2R66A 3N5CA 1CT9A 1KETA 4YRIA 1T8RA 2CLLB 4DA7A 5TPZA 4B8WA 4M1SA 4RM3A 4UDXX 4EB6B 2OCIA 1P29A 3CW8X 1CRZA 2PL5A 2LDBA 4D81A 5BSTA 1WQ3A 1AHNA 1FTNA 1KC1A 4O2BA 1N0UA 2FFQA 2QTVA 2HCJB 3E1GA 3JAKA 3GLIA 1EFDN 1DEAA 1R0YA 3DO8A 1RWPA 5A4JA 3VVMA 1O5IA 4QPZA 1KNXA 5CH3A 4IFTA 5DW3A 5C5DA 1B6SA 1NM5A 1VB3A 2I99A 2YWDA 2GN6A 4DJDC 2MSEB 2PKQP 2CKMA 3PUIA 4H31A 2D4AA 3AR5A 4QXPA 5KAPA 3SZMA 3ZU6A 4YCLA 3MELA 2Y6UA 5ICGA 2ZSIA 3F97A 5ITZA 3IE1A 1ZD4A 4QLOA 2GLXA 4E33A 2Y93A 4K3VA 3AKEA 5JMPA 1MN6A 3F73A 4QNNA 4KQCA 4YJFA 3HDJA 1XL0A 3EASA 4WNCA 5JMTA 3TQRA 3EBOA 5JSQA 4OHCA 3B13B 2O8FA 2FMXA 4C05A 4B0OA 1H05A 2I8CA 4TV8A 2AQKA 3ZWMA 3WK8A 1S9HA 4HXEB 2O5EA 1R10A 4U2FA 1TECE 3H0CA 4NDAA 4ZAGA 5HP4A 3AETB 1ESMA 1PHRA 2AR9A 1XDBA 4RKRA 4BGVA 3DHYA 1Y9ZA 3KLMX 2PUAA 2GKSA 1T9HA 5CYPA 1MB3A 3L8GA 4X1IA 4ZYUA 3DW3X 3CRQA 2DUWA 3U1TA 4C5AA 3ZX4A 1BQEA 2PKYX 2OTCA 4W5WA 4WW0A 2O8DA 1ISPA 2IYLD 3UZUA 2GO1A 3A25A 2ILVA 3HN6A 1IZ8A 3KYBA 3PR2B 1HL7A 3B2EA 5EUMA 2QIPA 1PWXA 3AHFA 1EE1A 4FEEA 3UC5A 5B2FA 2ABWA 4QT0A 8OHMA 2BR4A 2DERA 1ADJA 1ADFA 2IX3A 1A72A 4C4AA 5I7FA 5LKAA 2QAJA 2R8EA 4HB2A 1E9EA 3X1JA 5BPFA 2WAYA 2DFTA 3I23A 4LRSB 4TGLA 3ZZMA 1FP4B 1SHKA 2AOWA 2VDRB 3CONA 1KI7A 1KJQA 3OEYA 4JL8A 2XGMA 4OPMA 2VJLA 3UJPA 1H4VB 4CQJA 2XQVA 4Z7NB 2GILA 1JS1X 1J21A 2AS0A 2KWIA 4MGKR 2ZW9A 4K05A 4DMLA 4HNAB 2WJPA 2PV7A 3DDUA 4WA7A 3ZBUA 3S2ZA 1WXHA 2Z2YA 3JQDA 4PYIA 5L6MB 2CJYA 1UKYA 3A36A 4L5BA 5I4IA 4OMUA 1NULA 1MG0A 3HSSA 1MTZA 3IIIA 4BFLA 5G40A 4E15A 1UJ4A 4LISA 2PSSA 3F78A 4D0LB 3IBSA 1JN0A 2QPAA 3IUQA 4RD2A 3VJLA 4LF4B 2MHCA 3QIVA 1GRNA 1GPWB 4O1MA 1BRTA 1E4EA 1TJPB 3NHPA 4O3FA 1T1SA 3CNNA 2BGLA 2BH9A 1ESZA 3GCWA 3AERA 3O4GA 1ZGHA 4GIBA 3ILHA 2VRCA 2DMRA 3P2IA 2FSHA 1B16A 1X2BA 3B9PA 4LQDA 4MKXA 4RE5A 4RZSA 1FSFA 1SUCA 5KQPA 1YZVA 2O0JA 1GNLA 3MOSA 1C1DA 2JRLA 3T7IA 2DFVA 1QLWA 1VIVA 5JU6A 3JCZA 1BIFA 2YV2A 3X3HA 1L7BA 3F7OA 3Q9LA 2VXCA 2RAFA 2WKRA 4OU4A 3HP1A 2PWBA 4GKVA 5BVGA 1BJTA 4RD4A 5EIOA 5KC8A 2G7ZA 1DB3A 4LQCA 4E14A 2NUTA 4Z9XA 2Q1WA 1UXJA 1WNFA 3CH4B 1E5TA 1T10A 5GZ6A 5P21A 3VR2D 2HYIC 5DGXA 2JD0A 1IBCA 3CNLA 1XRLA 3OOYA 4JMPA 2ONKA 4KLZA 5TARA 4DLKA 4DVGA 1RKBA 1ZK2A 2NTNA 3DLTA 5F2OA 2A2ZA 4R54A 3CUEF 3Q87B 1RAAA 5BWBA 4EELA 1EEXB 4F7WA 2WJ3A 3V8BA 2P9JA 4IQ4A 1KORA 3AP2A 3R0JA 4JR2A 2BUAA 1DRKA 3GRCA 2HKIA 3JALB 4ILKA 4PZZA 1LVUA 3CX6A 1Y7LA 4UM9B 3A9SA 5IJWA 4NYIR 4WLFA 2J46A 1HT0A 4J7CA 2FSPA 3L82B 3HJGA 1OGIA 4YWHA 1DL5A 1X1QA 3WGTA 2PEYA 5J47A 2XB8A 1SCBA 4IJMA 1CERA 1F2TA 3PXCX 3NH6A 3H6GA 2AOUA 2GCOB 3G2QA 1JFVA 1BW9B 4Q7MB 3SJZA 1TD9A 4RGYA 1IZ0A 2G82A 2I34A 2JFUA 5DGDA 4QUGA 4YR7A 1TQ2A 4M0DA 5TLSA 1RZRA 1DXQA 4JL6A 4ZK6A 3FLAA 2ROQA 3WMFA 5A1TA 1FFWA 1GTZA 2ZE7A 1R0ZA 2QJTA 4RD6A 2MYPA 2VNAA 4ZRMA 5IC5A 1E66A 1ORRA 2QV7A 3FBGA 4URUR 4RENA 3ST7A 1XZAA 3HFJA 3OURA 1NU6A 4G0OA 1GILA 1RNLA 4EW3A 2OCYC 1DFHA 1O1YA 2WMYA 1OXTA 4DUZB 4LZOA 4KZPA 4TM8A 3PC3A 3MTJA 3ZWQA 1VFNA 1ZN9A 4DIKA 3LE8A 1R8SA 4K9PA 5M2QA 3TDKA 4Z53A 4AAYA 4R2KA 4WN3A 2WUWE 3KOXA 4FZVA 5CIYA 5LN1A 2XMCA 5KX5A 2FMTA 3FETA 1Y81A 1NXQA 2WILA 1JW9B 3IQHX 1SUAA 3DO6A 4I19A 3ZX5A 2V4MA 1SOMA 1VE7A 4N9QA 2QR5A 2P62A 3U16A 2B8WA 3QJ5A 1QU2A 1ZM2A 4XYMA 3ILYA 5LUBA 5IULC 4DB4A 1KFEB 5ARBA 4MVJA 4FHGA 5F4BA 1S3IA 2V8OA 2H92A 1CIPA 4FCTA 4Q39A 5DCWA 3AK4A 2F55A 3U4QB 4WTOA 5NLLA 4ZI3A 1ONPA 5FTLA 4CE6A 3C7CB 1J00A 3PZRA 3SDBA 1LS1A 2ZJBA 3IODA 2YWHA 5CVCA 3KXDA 2V1UA 2ZRQA 3OZEA 2JHAA 4E2FA 1UAYA 3I58A 5CVEA 3VKUA 3SGLA 1CUJA 2PMFA 1ECCA 2PIAA 3B9BA 3W5BA 4RIFA 1RMQA 2XCSB 4LWZA 3UAWA 3OCWA 2HEGA 1OWMA 2ODTX 2J5QA 3RIHA 1AF4A 3GEBA 1UMBB 3DMHA 1BMTA 1PT8A 3H86A 4MKZA 4R1UA 3SJAA 4CLEA 5IM4A 2CEAA 4WAUA 4HZIA 3ZVLA 3DULA 5JRZA 4FINA 5IXSA 1CR0A 1N0IA 2AMFA 5CEJA 4RXTA 3KYDB 3MAJA 2DHEA 2XAUA 4TMWA 4J1NA 4K26A 5BN1A 1I51A 2LPMA 5IKOA 1MGPA 1J25A 5BR7A 2JFWA 1VZ3A 2W93A 1PJCA 1HDRA 2YJNA 5D1NA 2IVZA 3W3AD 2FFRA 4C6RA 2H31A 2ANCA 2OXCA 4OXXA 1BU8A 2J3HA 1C4OA 2CLMB 3ETDA 1F48A 1XLWA 2YRFA 3I5AA 1K8XB 3LAWA 2YYYA 2AFHE 4GOND 2PLRA 3C6BA 3ZH9B 3BAFA 4AZ3B 4WJLA 3KZOA 4IW3B 3U3DA 5A04A 4QTZA 4XFKA 2OCGA 2D59A 1GVHA 1FTWA 4B8YA 2VNHA 4XYBA 5KOJA 2XB6A 1RZVA 2HCFA 3DEHA 1Y5IA 5H59A 5KMGA 5KYTA 3E9YA 1T5OA 2P2ZA 4UHEA 4BV8A 2AHOA 3RRMA 1E92A 2DR3A 3AEQA 2YJTD 3K32A 4MW0A 2KYRA 4CCWA 1N77A 3IVGA 3FPLA 3H83A 1E79D 4O2AB 1VHTA 4B71A 3LD9A 4O25A 2PRZA 3HG7A 5IANA 2XECA 1ND6A 5CLQA 4IEFB 3N0RA 2WSIA 3N8DA 5DBHX 2UVQA 4R2XA 4L7VA 3RJ5A 4TV9B 421PA 4N7RA 3U9TA 3CLSD 5CB0A 1TI7A 2LCQA 2GBFA 2Y0CA 1GCGA 1U8XX 1ONNA 1UAGA 4LOHA 3MVEA 1QB7A 5DNYB 4BVLA 2H1VA 1E1QA 3DR3A 3MC1A 3VVLA 1URPA 1DAGA 2WU0A 1KVTA 3L05A 1II8A 2Z2ZA 3MLEA 3K0KA 1ND5A 4LS3A 1NJSA 4WCDA 2XXJA 3NM6B 4Q00A 3RTGA 4F45A 5JJBA 4JI2B 5A5VA 1RPAA 4Y7DA 1LJ8A 3RV3A 5KNCD 3K9BA 3TPFA 1K5HA 1E4VA 1RQLA 2OYRA 1LBSA 1KU6A 5EXEA 1ECLA 3QW2A 4X20B 2XSZD 2NO7A 1Y8QA 4ZEWA 3ND5A 4R1QA 3F90A 4FKZA 4RK4A 3JVEA 3V8EA 3AM4A 3S1AB 3VPHA 2AXQA 2EP7A 4LC0A 3TLKA 1ABFA 4BUCA 1UC4B 3QYJA 3ABOB 4NSNA 5CFNA 1R5JA 3QVGA 2ZBGA 4I5DA 1IJBA 4BQRA 4QGHA 2W8BB 3PXUA 1UBRS 3OKFA 5LDDC 4TL7A 1TC2A 1I2BA 1Z6YA 3JVVA 4HGYA 4PQEA 3LXUX 4WADA 1KJIA 1OXSC 2JJMA 4P5PA 3CPJB 4CTJA 3HSKA 1T35A 5CA1A 4L8GA 3N07A 5I8PA 1Q92A 3CWZA 4RHXA 2PWZA 1WUTA 5T41A 4ZHQA 4DEVA 3E3NA 5EMMA 3E7FA 3P9RA 4CF7A 2EJBA 2GYYA 2VTVA 1ESCA 2XE8A 2UZAA 2YJ6A 5DT2A 3TS1A 1ZA2A 1IY0A 5DHAA 1TZJA 2QIOA 1CZHA 2JFBA 4A8TA 2BGNA 1NR5A 2P41A 3QPVA 4BEBA 1QO0D 4Y9DA 1E1MA 1L7RA 3RSFA 1E2FA 3DEYX 3KTAB 3NT4A 2PG3A 1MPXA 5C5CA 2VHJA 2XMSA 4P86A 2VA9A 3FOCA 4KPGA 1RXWA 1CF2O 2PAFA 3FKJA 1GGEA 3WQQA 1V1MB 2OMKA 3RBAA 4UTRA 1T5IA 4N8DA 1KIAA 3OEWA 2NO4A 4WCFA 3GJ4A 3KOMA 1U0BB 2VIIA 3BGOS 1KQGA 4HTFB 2JLCA 2OCDA 4LOIA 4PIPA 4F1WA 1CE8B 4XKJA 3W4JA 1O6CA 1A96A 1KGDA 2HREA 5DIZA 1PJ2A 3RSLA 3WOVA 1W49A 4Q93A 3T7AA 1G2PA 1JSXA 1PS9A 2X5JO 2ZWIA 2ZXEA 3UK2A 1R16A 2ZRIA 1YUNA 2RHTA 3SE0A 5IABA 1SUFA 1FQWA 1ETUA 4IDFA 1Z6PA 4DA4A 2WZQA 3QKRA 3W5VA 3K0AA 3UW3A 5MN4A 2RKOA 5JZMA 3FRJA 2A7XA 5EJ9A 4D8VA 4M9SA 3O5AA 1A8PA 1TUBB 1VP3A 3OZVA 3PIDA 3TVYA 3CZ5A 1RCFA 4XIYA 5DTMA 5A9TA 1PX2A 4PC7A 4NBUA 1XXHA 1YIDA 3ESQA 1VE5A 3F49S 1FTGA 4OGWA 4F3NA 1Z74A 1GZHB 3K92A 4ZOQI 1T3TA 2BHSA 2XXBA 2GB4A 1DKLA 4TVBA 1GITA 1T4MA 2HV8A 2QP3A 3AM5A 3I0ZA 1CRLA 2GN2A 3H5AA 4P2GA 4QTTB 4DJTA 2C9ZA 3CR7A 1PR4A 3H65A 4S05A 4JR1A 2O2YA 2WV7A 3IJRA 3KYCB 3LZCA 5FWNA 4EJSB 4UAUA 1QF6A 5F5LA 3VBEA 4NG5A 4RZIA 3CLTC 4PRLA 4Q1AA 3DAGA 5EOVA 1ZOOA 1U6JA 4ZXPA 4NMWA 1JHYA 1QYDA 1GQYA 1S3FA 2LKCA 3VU0A 4D4IA 5FH9A 1SIBE 4AO6A 3I9OA 4D4KA 4OTZA 4OM8A 3G0HA 3OZCA 4WLEA 4O3MA 5EWMB 3W1WA 2XZOA 1LC0A 4FGKA 4R0NA 3HYCA 4HXYA 3W1VA 1MGOA 4HVTA 1KWKA 1Z6AA 2BTEA 1P4HA 4QDKA 3AVXA 2J5XA 2FVXA 3N7UA 5DLPA 1DO0A 3L84A 4NY1A 4LVUA 4O8CA 1L7DA 4EPRA 4MITA 3NYQA 3OUTA 4N1AA 4N3NA 3DQQA 1OFHA 2BFDB 3KCQA 4W6ZA 2JFOA 2ZJYA 5CPFA 4E21A 1X19A 1EXWA 1OC2A 2AZTA 4GP9A 2P30A 5AJWA 3MN1A 2ZIVB 3ZIDA 1TEVA 5CT5A 4KR9A 3B9RA 1O0CA 3EMKA 2CNBA 2QZ9A 1CWUA 3LC1O 3FCUB 4Y8VA 1LB1B 1GM5A 4EABA 4JI0B 3O3OB 5AK3A 2X1HA 3A8TA 3GPLA 3NM4A 3M89A 1KI8A 2X41A 1QP7A 4KQWA 1YZTA 2BFPA 1VECA 5TR9A 4PLGA 1F8XA 3LSTA 1DC6A 5FTMA 1YS1X 3ASVA 2Q7OE 3WYBA 2SCUA 3DFUA 1EI9A 3DL0A 1UWKA 1JIQA 1HKHA 2QTAA 1A8IA 4IH4A 4EVIA 4N0DA 1XCMA 2RGCA 3BDVA 3H2IA 4TKUA 3MINB 4D5EA 1I4OA 4KGDA 4A2WA 1JHRA 4RXMA 5LBUA 1FVFA 4RSGA 4H08A 2XTZA 1NWHA 5ECGC 3WSVA 1NF8A 3NBYC 4TPKA 3LOPA 1Z8FA 2B35A 3DM9B 4UJ3A 4V2IA 1SULA 1XO1A 4ECAA 1YR3A 1Y8CA 4EJ0A 5EE5B 2HMSA 4IXMA 1JLRA 3X44A 2PWPA 5EJAA 3DB1A 3T3GA 2BDEA 4CZ2A 4MB2A 4HAWA 1SPXA 1QFMA 1R74A 1Z39A 2R48A 3J7AC 4RTSA 1OI2A 3QE9Y 4DMGA 1EKXA 5DWDA 2A1TR 2JAQA 4MQ5A 4NZPA 2P90A 5K3OA 3E3OA 1JXQA 4KXWA 4QUHA 3SX2A 1BWSA 3RROA 3V00A 4KFSA 1PDVA 3GZTB 2QVCA 4XARA 1B42A 5LP6C 1XDZA 1DLJA 4UVDA 4UMVA 4AG6A 1Y9JA 2QN2A 5JCOA 4BFCA 1YFLA 2B83A 2VP9A 3L41A 4QPCA 1TPZA 4M1KA 1GPYA 2H06A 4FR5A 4TXMA 5DHTA 4LBZA 5E2BA 1RRKA 1GR0A 1YRYE 4UARA 3MLBA 3EXEB 3FE2A 3HJBA 3ZHRA 5HS4A 4PV7A 9LDTA 4G1FA 6REQA 1SXPA 3ZCPA 1IQPA 1GUYA 3HMKA 3EVCA 1L6RA 1U6IA 4HRXA 5IU6A 2JD2A 1Q21A 4EA7A 3KHSA 4BBJA 4TT3D 4TTVA 2IYUA 2HJRA 4DQUA 3ZD8A 3B2QA 1A69A 1OHHA 1P33A 5K1ZA 3KUUA 4ZO4A 8ADHA 1D03A 1IHDA 1L7EA 2R4UA 1JG1A 2V7EA 4M1WA 4DA9A 3T7RA 3WMGA 1RWKA 4R3NA 4YNBA 4KAXA 5KQGA 3ZHCA 1JB9A 2DH6A 4AZTA 1JJAA 2C61A 3HWWA 2OXRA 1L5ZA 2RKWA 4UE3S 1FDVA 1JRLA 1QHYA 2JVJA 2GPWA 2P5UA 4PLZA 4AF8A 4BP9A 4LSWA 3OG9A 2QG4A 2WY2D 5JV5A 3O3CA 3COSA 3UV3A 4Z51A 4AL4A 1WKVA 1TRHA 1WV1A 1H6DA 1IZYA 5B1SA 5ADUS 3AU9A 3BZBA 2PDAA 1KRXA 4I2NA 3S40A 4EP1A 2XEDA 1XQVA 4AI6A 2C5LA 3C3EA 1C7ZA 1ZW6A 1CR2A 2VO1A 2DJIA 3GEEA 3DT8A 2UUPA 3DQPA 4K9NA 1L4YA 1PT9A 3WQRA 1X7WA 4AURA 4ZZ1A 2WJ6A 5JCZA 1HG1A 1E18A 3BH0A 2YV1A 3BJZA 3DZKA 2FCAA 4OFBA 1YMUA 1IIRA 1ULZA 1DQPA 1TK3A 2HLDA 4Q9HA 5DK4A 3FM9A 4RCZA 4ER6A 1H8HD 4MSUA 4YMHA 3DEAA 3OLYA 3D3NA 1I01A 3GHYA 4OQZA 4Y2VA 4I50F 3U7QB 2XB2A 2ISCA 3EXG2 3M5WA 3S99A 4L1KA 2GUWA 4PX5A 1S1MA 3RAPR 1SCIA 2EHJA 4OXQA 1ORHA 3OZUA 4KQMA 5KYUB 1VG9B 1BNCA 3AR8A 3S68A 4JV5B 3PR3A 2CVOA 4B47A 2ZAYA 2VJNA 3E27A 4QL3A 4PG8A 2V7WA 4N6NA 1BZYA 3UXYA 4FFOA 1I7QB 2IS2A 4ZVRA 1BAPA 1CQIB 3FYHA 3LF2A 2Z3ZA 4N0PA 3ETEA 4JQYA 4R05A 1KAQA 3OUUA 3N8NA 4KLCA 3BJMA 2JJYA 4Q4LA 2DPXA 2NO9A 3D5EA 3DJFA 1IXSB 1DQSA 2VJDA 3KOWA 1XDUA 2QM0A 4PYMA 3SR4A 2IS1A 5DE3A 3B1YA 3S27A 1ZHOA 3MJDA 1A2KC 1PJLA 2WHPB 2WU1A 2ZRJA 4UC0A 5CYOA 4OK3A 4OX9B 2A4MA 1OTXA 1RKXA 1NPTO 4CKEB 3ZCRA 2P8SA 1X8LA 3ZZ1A 5DKFA 5KWEA 1Y1QA 1SXHA 3TE6A 2YHIB 3WV4A 4BE4A 1HTWA 4KW7A 1GIAA 2IPOA 4PZYA 1EFPA 4DLUA 4GOKA 2FKAA 4KK4A 3ETLA 3FUVA 2A84A 4QG7A 4J7UA 5AJHA 3IURA 2ZE8A 3GLTA 1WB5A 4I55A 4BKRA 5THKA 3V33A 4CCAA 1AXRA 3C3AA 4GPBA 1MDFA 3EMVA 2R11A 2VZLA 2QNBA 6CHYA 1VI6A 1U0LA 2R86A 4TMFA 5EG5A 2ICAA 3DAPA 4YP9A 2O50A 3ZV7A 4LSZA 4AYTA 5EFOA 2V5AA 3U3ZA 1KKMA 2C3PA 4AN4A 4RTPA 4MKFA 1ONBA 2IXFA 1QLJA 3AVPA 4N01A 1B4DA 3GA7A 3WOHA 2SICE 4MEBA 4EFKA 2H0AA 1ARZA 1SB9A 4HWGA 3A6ZA 3L7BA 5IVIA 1PGOA 2C42A 4LJYA 3Q8MA 4Y6PA 2A78A 3ENKA 2QEQA 3DT9A 1IY9A 4JVSB 2AK2A 2JHGA 4URZR 3K20A 3ZWNA 1M2KA 3LSYA 3VNVA 2X22A 5ALMA 1YWGO 5K0LA 2WUVA 3CVVA 2GVNA 2C0QA 3K96A 5F78A 4HS4A 5K8TA 4UHFA 1D6NA 4GP6A 4RZQA 1F38A 4LZAA 5CLGA 4EWLA 3KQLA 1ZIPA 1UR5A 3I6MA 1N5LA 3ZDFA 2J0EA 4HDNB 3RLFA 4QPDA 4R8MA 1C8VB 3URKA 3ORFA 5I7RA 1MQSA 5EUCA 2B82A 4UD6A 1WPGA 3VPDA 5KJFA 3PQ8A 1SUBA 4IIJA 4YRBA 3WY9A 4JQOA 2DP4E 3LDAA 1GEGA 3QFHA 1USKA 3DP7A 2JH9A 3MQFA 3I1FA 3Q11A 4IQGA 1BXRA 4QC2A 4C06A 1A97A 3K1YA 5H81A 4P4UA 1HQDA 2JATA 4AMYA 4EVRA 2QYHA 2WUDA 3L4BA 4B3HA 4OQEA 5L4NA 4ALNA 4DANA 4DDWA 4BWGA 4Q7QA 2QJFA 2ZK7A 3EF3A 3LLCA 3LL4A 3UWSA 1PJQA 1UBGA 3C74A 3EC2A 2CL0X 1R27A 4PYKA 1YVUA 3Q5EA 2D00A 3ZHTA 5CBPB 3VPAA 5CH8A 4BC1A 1F5SA 2OT3B 4ZRDA 2IH5A 2PWAA 3BBPA 1RZRD 4LZPA 4K88A 2O4CA 2CYCA 1HZJA 3T35A 4Q82A 2G4VA 3AQ4A 1BKDR 3EXHA 5M7EA 1J70A 2OORC 3EUFA 4XUDA 3ID6C 3LUGA 4I9HA 3PQFA 3TTXA 3UXHA 3CQ9A 5A7HA 4C0XA 1Q7GA 5A06A 1TFRA 4HEA1 4R5HA 4QU0A 2J4CA 3OZXA 1P5HA 4LYDA 1NQOA 4U7DA 5AUOB 3DVAB 2HSGA 1NMQA 1L6IA 4OHBA 2DWOA 1LD3A 4OSPA 2Q7XA 1CF9A 1AA9A 2CDAA 4G5QA 2UXDB 1KVRA 1JR3E 3NHMA 3AMVA 3QA3E 2IJGX 3VJMA 1O95A 1UBHS 4MW7A 3JAMA 1JI0A 1ODSA 3GAMA 3ADBA 5A2QA 2Z2KA 4PYLA 4V03A 3AVTA 2OYCA 3OM9A 4QFMA 4JJEA 4V3BA 4ZC8A 4XI9A 2AG6A 2HFJA 1J5XA 2BFBB 2IP2A 4FBLA 3IT2A 4MVJD 3SX0A 3OZWA 1T0UA 2PLNA 3H5LA 3V9PA 2IOQA 1SVLA 3FDZB 2XQJA 3W04A 1PHPA 4JLKA 3SIXA 3ZV5A 1CHDA 4MS4B 3KPUA 2JGJA 4KVZA 3UN1A 5HKKA 4J76A 1G7RA 1H1DA 4F38A 3CJRA 2PJZA 1IZ7A 4BLTA 3CX7A 3FGOA 3T95A 1S3GA 5J4LA 4K9OA 1SKQA 4D9NA 5HYVA 2EHDA 2RGXA 4MR8A 2G36A 2PFGA 3HUDA 2JGIA 4HZUB 1QUFA 3JYHA 2G83A 4K9KA 3JQ8A 4QRHA 1E62A 1P1IA 3QWFA 1MXFA 3OPYB 4G3XA 4PR3A 1BHSA 2FPGB 3EZFA 4OYYA 4XYEA 3OE1A 4FVTA 2ADOA 3F2IA 1T4CA 3KHKA 3HYSA 4QEDA 3TZCA 2QX4A 5CVUA 1Z47A 2Q9BA 5G0WA 2DWPA 3GH3A 4YBRA 4NBNA 3TAHA 4ZIRB 2ID8A 4AKSA 4TYPA 1C0EA 3HCRA 3QITA 2CL5A 4WFIA 3TSAA 3E3LA 5G1NA 2AXNA 1PFKA 3RIGA 2ZQ5A 2BH2A 4RAQA 5KHOC 4JHLA 4D56A 1U8UA 3ED1A 4G1EB 2IXTA 3NNDA 1X7XA 1W46A 1EP3B 5KNBD 2QD3A 3LDUA 5EP1A 4ZGBA 4UUQA 4PGHA 4K2AA 4HQRA 5DTJA 5B3JA 2CYAA 4GAEA 3LNTA 3OQVA 1OWOA 2EEZA 3FUTA 2BFEB 3VBCA 4Z4CA 3DMTA 3USES 4LECA 1T3SA 2JF0A 1LVHA 4M1QA 1KOFA 1TQDA 1ULHA 4MW9A 1KBOA 4LF5B 4K2HA 4J9UE 1MV5A 3ER9A 2ATEA 1NYRA 3ENQA 5E2AA 2C04A 3IPLA 3RKSA 1F3LA 3M3PA 1AHIA 2O52A 4G9BA 1NV9A 5AHRA 3TLAA 4K0KB 5K8LA 3NVAA 3E8XA 1ELOA 1K7EB 1I4DD 5LJLA 4TV8F 1YF3A 4OLJA 3GJZA 3H4TA 4RZ3A 4NOJA 3INRA 2BGTA 1GZ5A 4EEXA 2VWPA 3VTAA 2CNDA 5GJVC 1SKUA 4XM2A 2I2BA 4HGOA 1WR8A 1M74A 1NYQA 1PE0A 1TYEB 2DHCA 2PL9A 3NHAA 1LSOA 4HAZA 3BJRA 3HU3A 3NW9A 1B6GA 1O9GA 2E4WA 2QSJA 5J40A 3SYRA 2WVHA 3B89A 3KXKA 4BNHA 3CPHA 4H2DA 1L3BA 1GGMA 3QVUA 2XX3A 3GP8A 4PYOA 1JBEA 3AUJB 2HA0A 3WGIA 5E6RB 1WETA 4AQYB 3CX8A 1WXFA 4TMZA 1NJ1A 3ZDQA 3H1PA 4O0LA 4J90A 1YGYA 2V7XA 2VNJA 3CUSA 3QXJA 3VR5H 4YRPA 1NBME 1RHQA 3AHJA 3P5BA 2YFKA 2G09A 2FETA 4JWKA 4N0MA 3O75A 1WUKS 2H29A 3PCTA 2VSOA 3D2AA 3NCHA 4ZMRA 3BX1A 3I5XA 2WOOA 3LIIA 4IEEA 4JK3A 1OX4A 2ZU0C 3WGQA 4YAKA 4FT2A 5AM2A 2WWTA 1M67A 1RIFA 1JQLB 1C0KA 2JGNA 3CUTA 4OJMX 1HE3A 4EB3A 1VPVA 2ZTVA 1MABB 4PCUA 1Z28A 4A2CA 5ESDA 1FNMA 1NVEA 3LY9A 4KWIA 1SXQA 3MTDA 2I4RA 4FYIA 1QXSA 3TI7A 3H5WA 1CRWG 3KEFA 4ASUA 4Q19A 4DADA 1P7WA 4RD0A 1VJCA 4JNCA 1UJBA 1G21E 5AIBA 3B6KA 2OXEA 3ZLUA 2NYVA 1T3HA 3FTNA 3KPVA 3P97A 1WEHA 5EZYB 2FOXA 4C89A 2PZ8A 2D2FA 3GHHA 3JQBA 1BD3A 2GKGA 4WK2B 5EMHA 4CG0A 1CLEA 3RRZA 2RAUA 1HBJA 1RI4A 2GCPA 3RT7A 2OHXA 1UBKS 2W0SA 2F43A 4JUBA 1CJBA 3I9V1 4EM6A 1OA1A 1OFGA 3TIGA 5E9QA 1E7SA 2ZVJA 1NBIA 4EOGA 1KI9A 1UMDB 2LP4Y 1P7ZA 2XDQB 1OAOC 3ZG6A 1QHSA 3WB9A 5IKXA 3TTYA 1FUYB 1N2JA 3I9JA 2FSVA 5F12A 2V54A 1Z0JA 2OZPA 2H16A 4HN2A 2OOSA 3BWMA 3LYUA 4FQ7A 4HDSB 2GZHA 2IXBA 4L9SA 1C0LA 4AJPA 5BSWA 3EVTA 3G1TA 3V42A 4UUPA 3T9AA 2EJVA 3EWSA 3L6DA 3WGMA 3JVUA 1ZOPA 3Q7IA 2YXEA 1YZKA 4QHTA 4EGJA 1S8OA 1QM5A 2WWRA 4QUDA 4RHEA 5BWCA 3L0ZA 1F2UB 4HL6A 1JKIA 1ZK4A 1KEZA 1M76A 4RDHA 2HHLA 5DGCA 5FPSA 4NG4A 5IAKA 5ALLA 4CUKA 4RFLA 1M10A 2UUCB 3HBJA 5H16A 4XB6B 2H1IA 4GWKA 1QHHB 2NNLD 1JDSA 2Y6VA 2ZEJA 5DM70 4MVJP 4FEGA 1X7HA 2W8ZA 3D7SA 2OHGA 5CXSA 4D41A 3ADCA 3A4LA 2JCBA 3NONA 3T9DA 1WXDA 4PZCA 4AYXA 1SCKA 2B7BA 5C8DA 3C3DA 1W9MA 4FXPA 3WLPA 3E4CA 4ZYLA 3CLUD 3UPUA 3Q12A 1MR3F 5EP4A 3U4HA 3ZDCA 3RIEA 2VHQA 3KKEA 5P8WA 2VF8A 7YASA 1LBHA 1K27A 1UOEA 3HN2A 5CLFA 3FNFA 3IYLW 4LRWA 1LNSA 2B1IA 4IWXA 4NJMA 4WERA 5FORA 4EKGA 1CEYA 4BWFB 2ZR0A 4KC0A 3STXA 5HFJA 1ULAA 1N2HA 4L16A 2C59A 2HN9A 3IHKA 3DCYA 2O2JA 1Z75A 1ZICA 1PVVA 3F4LA 2IU0A 5DTRA 3HVUA 2H1HA 2IOHA 4OATA 3ZK7A 4JIGA 5C1IA 2ZIZA 3T0IA 4XASA 3BXFA 4YRKA 2WE8A 2ZUCA 3G7UA 2C2GA 2QS9A 4QGBA 4W8OA 3T5CA 1S96A 2I2DA 4TTTS 5LIPA 1PUJA 3PC6A 5KX5F 1N6RA 2JZOA 4M83A 3F1KA 5CT6A 2NSDA 2WJ4A 1QMGA 4MPDA 2IEYA 1R0CA 3SDZA 3ZGLA 2MT9A 3DM5A 1JHMA 2HU2A 4AXXA 4JL5A 2RBKA 3K0CA 3WMRA 1X3SA 2GDJA 2JIZA 3FAKA 4MW1A 2Q5HA 1AMNA 1LSSA 4LPKA 4L0QA 4DYVA 3PTAA 4HB3A 1M2NA 4MVJF 2VT6A 4W1PA 1XF1A 1J0XO 5KC9A 3FHTA 4G0ZA 3ZWAA 1KSGA 3I6QA 1AOXA 4TS9A 3IB3A 4BVAA 1XZKA 3THRA 3TK1A 1T5HX 5K3EA 2IUFA 2R3SA 5HUHA 3I61A 1VPLA 1PZNA 4EPYA 2JI8A 3VGPA 3F7TA 4MPRA 1EXMA 1XJ5A 1W1UA 5EXDA 5CT8A 1GXSB 3ZGXA 3ESCA 2J9RA 4HEA6 2Q0SA 2O20A 4I8IA 4US0R 1J56A 2FQQA 3CUYA 3LFTA 3BSSA 4CM9D 1IL0A 2IV2X 2EXXA 1EH5A 1N1DA 4OOEA 4XWWA 3JSXA 2G1AA 3GNQA 2QTZA 5B58C 5IM4F 4OHZA 4DABA 1UODA 4RTMA 1YTLA 3KUXA 1DHRA 1PGNA 4U9HS 4FJ0A 1ECGA 3FY4A 4G0WA 2O07A 3NWJA 1TVKA 4IDGA 1O94C 3P8ZA 5AUQA 1YTUA 1FU7A 2OEPA 2QA5A 4YAFA 5FTNA 4UHJA 3G6KA 1LI5A 2R6FA 3A7DA 4IG4A 3L1UA 4CTKA 5IAEA 3LCUA 2MYUA 4CM7A 4YUWA 4F60A 4OYHA 1G21B 5DM4A 3BD7A 4IIHA 3R3HA 3B6EA 4WFQA 2I91A 2EKQA 1J8DA 3B7GA 2G07A 4DT1B 2GZRA 2O3JA 3OFND 1J1UA 1FFEA 3ROMA 1B0ZA 3KQKA 2J30A 1SA0A 3ZI4A 3VC3A 1B0PA 2OVBA 3HCAA 4OCZA 3WYGA 1K06A 1HYHA 4BZPA 4C76A 2HL6A 2P0EA 4AWAA 2Q27A 2ZUDA 4HUTA 4UBMA 4AKHA 5DX1A 5KOIA 2YWGA 3PQ2A 1CJCA 4EH1A 3K0FA 1N8KA 1Y9EA 2EJCA 5L4SA 4ZDIA 4CLRA 3SFVA 5KKNB 5KB3A 4X7RA 1NP7A 3D31A 4FX2A 4AJLA 3QVKA 4GOJA 2CMFA 1C7FA 1TZ2A 2I6FA 3AHCA 4KE7A 1GG8A 3IOBA 4ITUA 4IQFA 2F00A 2REQA 4QRIA 5FKJA 5HCUA 1A9ZA 1RJEA 2EBUA 3EGEA 3SAJA 4Z7JA 3SICE 4RV4A 5A2GA 3QLEA 2Q29A 4IS3A 3NWOA 3ZY5A 1H2AS 4UASA 3SZ3A 4E07A 1DBSA 3O8QA 2P8JA 4EJ6A 3AHIA 4FLMA 2I2CA 5HUJA 1BKYA 5A4IS 3HKBB 4PZPA 3OU7A 1Q1ZA 3DZDA 4EY5A 4Q6BA 3TUIC 5KNLA 1TGVA 1JE1A 2WKWA 3AIOA 3F6EX 5FCDA 4Z0TA 1L5OA 3V97A 3WBJA 3RU3A 3UTCA 3FTEA 1HXHA 4Q4AA 3A4IA 3PB3A 4UMFA 3DE1X 5T4HA 2B78A 3ZCUA 4EPWA 3ELDA 2R44A 3DMGA 2ZBFA 4B73A 1G6Q1 4RANA 5A4KA 1XJQA 3QQPA 3ZXIA 4AXBA 3I62A 1QKIA 1JQKA 4KAAA 2NXNA 1GNSA 3I34X 3GDFA 2H17A 1IC6A 2SNIE 5CA1F 4CKCA 4Q4HA 3RYTC 4BO5A 2OPHA 1VLHA 3HNRA 4LZLA 3LBNA 2CFRA 3IEPA 2VWQA 4I6GA 5KYXB 7REQA 1U0NA 1I7LA 3IJ5A 2PJUA 3AY3A 3G0BA 3LGXA 4RHFA 3TW6A 4O4HA 5EXSA 4O5OA 1QG2A 1GU1A 1YR2A 1U2GA 3MF4A 2YJ5A 3DG9A 5HHTA 1V9CA 1ADCA 1MC5A 5K3DA 3DLCA 5DM60 2LIVA 3UHOA 5F1KA 1X1TA 2EATA 5J4HA 3IR7A 3R3YA 1XU7A 2B6NA 2JEYA 3NVMB 3D54D 4CQLA 3LYHA 3K73O 3F4KA 3VTKA 5HJEA 3GFOA 2GK3A 3OZAA 521PA 3L02A 4URHA 5IUNC 4DBZA 1H1LA 5DYNA 1YJ8A 4OIMA 4W7IA 1M72A 3NLLA 2NO5A 3HHEA 1VSQA 2OFFA 3ROQA 3RVRA 4B74A 5IZCA 4IOLA 3A9CA 2YVKA 3G2JA 2ZIAA 3D6VA 2XIJA 5EIBC 3UOAB 1MW9X 4DLVA 3CLVA 1WMAA 4B3TB 4D80A 3GARA 3QMPA 1CIJA 2WAXA 2WYOA 3BFPA 3DZHA 4WXEA 2Z6UA 4HMPA 4GXRA 1QHEA 2YZ2A 4TN1A 3WICA 2KJQA 1NUUA 1V5GA 4OBBA 3ZDYB 5JYDA 1EAYA 4RZ2A 4W1QA 3K70B 3WGGA 3O8NA 2DB3A 3WRXA 2PLFA 4MRMB 5DTEA 4DCOA 4IVQA 2AXPA 3W6UA 5ICFA 1DKQA 1GPBA 3E7WA 2E1PA 2CJWB 2ZAIA 3GW8A 3A1FA 1ZMTA 2I76A 4LJAA 4DCNA 1UIMA 3D2CA 3AUUA 4K6HA 4UTVA 4HNGA 2BKVA 4N8EA 3HLKA 3AKZA 1OXBB 1X1AA 1ZN2A 1UP4A 5EA2A 5HUQA 1DBWA 3EW9A 3MTIA 3V2HA 2X5KO 3IH5A 4EMSA 1LBTA 2FEXA 4FIDA 4EJ2A 4D9IA 4ZP1A 2O23A 3UH0A 4RXUA 3JQAD 1MRNA 821PA 4DR4B 3GG2A 3MTEA 3EY9A 2Z98A 3OFJA 3OD5A 4U5XA 3HN7A 3VHXB 2B4YA 1YB2A 2IYPA 3IA7A 4TS3A 4AJEA 3IEMA 1DIHA 2PZFA 3HU1A 4PPFA 5CDSA 4RJTA 2OA0A 3QE0A 1FRQA 2IY8A 2CMHA 3EOZA 1P1KA 1B0AA 4GVPA 3ROKA 5IT5A 3C6MA 2FN4A 2QDXA 3CT6A 1U94A 1R9JA 1HPLA 1YC2A 1NVKA 3M6LA 2LBPA 1AHPA 1F1BA 1QP8A 4OHFA 4NBVA 2R1ZA 4JB8A 2D2XA 2DTXA 3RU7A 3RWBA 4ETWA 1W5SA 8ATCA 2M1XA 4ARCA 1PBTA 1XTVA 3HBFA 3T4XA 2VOJA 2QAGA 5JBQA 4M1YA 4RMGA 3CTMA 3FZNA 3R77A 4PAMA 2UU9B 2WNIA 4GPAA 3EOBI 5IVKA 2BKUA 2GXUA 2COUA 1TM5E 2G71A 2PYZA 2VBGA 3MJCA 3TOVA 4CG1A 2H2IA 1V96A 3HRKA 3KWLA 3FNRA 2HD4A 1F0PA 1U7PA 4A8JA 3NHBA 4JS0A 4ZU6X 3Q3JB 4F0JA 1AKVA 5EUQB 4UZEA 3LW8A 1L1QA 1NXTA 5DHRA 2GK4A 3AFIA 4XCVA 1UM8A 2JGKA 5JSFA 3WDMA 2H4JA 2A1UA 3ZJYA 3I52A 3KD2A 3QBEA 3TR6A 1PV4A 1WSBA 2NTVA 2O5RA 4QO7A 1CZUA 2JAUA 5J2TF 2JASA 2WFZA 3AESA 4KQEA 4YRSA 4G81A 5CCBA 1O96A 4YAWA 3GU3A 4OUDB 1MU0A 4K9DA 5HZMA 4MROA 3K9FC 3IIEA 3NZEA 3Q98A 3QPDA 2X1LA 1WWKA 2H5JA 4KE6A 4TQAA 1BO6A 1ZH2A 1Q15A 4D4LA 1QS0B 1QBGA 2OZVA 3R3UA 1JG7A 1RHUA 3OFKA 3QH4A 4L28A 4R9VA 1C4KA 3E84A 4JGGA 1GTJ1 2P91A 1XCOA 2XI4A 5CVJA 1M6VB 1NUPA 1U0EA 2OE2A 4LKOA 3NM5A 1OFUA 2VJQA 2XQIA 5KWJA 2ID4A 5C34B 4G1BA 1T6YA 4GGOA 2XYVA 1OLSA 3HCOA 2OHFA 1PNOA 3HA5A 3VR6H 2XYGA 3F74A 3L0CA 2VF5X 4LOJA 3CLRD 4RKYA 2HDOA 4D44A 4M88A 4JSYA 5HK9A 4L4SA 2RHOA 5THQA 3X1WA 4ECEA 2WYHA 1DI0A 1Q44A 1V48A 3DP9A 5B1YA 2O8CB 1P4GA 1OROA 2H6EA 1TA4A 1WW2A 5CITA 5EESA 2B21A 3OPQA 5F9MA 2E5WA 4H1WA 1JFFA 2C5FA 1L5VA 2VUTA 4LC9A 5C52B 1Y6RA 3EZYA 3DWIA 2VH1A 3P9SA 4B83A 4EGQA 3BE6A 5KEIA 3DLAA 3K9LA 2ZJFA 4ZK2A 5L7TA 1MXHA 4QT4A 2ZYVX 4ZVMA 4F3KA 1A71A 1JKFA 2VEOA 3KKNA 3N2NA 1M9NA 1B6TA 1Y63A 2GZDA 1KMHA 3SC2B 4DCSA 1PT6A 1P2GA 4YQFA 5KS2A 2QRZA 2OD2A 3OWXA 1RXYA 3L43A 2CJPA 1UZNA 3PWTA 4L8WB 1YNSA 2AF4C 4J0FA 4WXHA 4KTVE 4YHBA 3GFRA 2H54A 3RF7A 4RKWA 3ZGYA 4BFSA 2EX0A 3SDSA 4DA6A 5AVQA 2GX6A 5BW5A 3E2MA 2Z6QA 3R5KA 2G76A 5KYWB 5B4VA 2E49A 4OO3A