1ENOA

Brassica napus enoyl acp reductase/nad binary complex at ph 8.0 and room temperature
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
297
structure length
297
Chain Sequence
LPIDLRGKRAFIAGIADDNGYGWAVAKSLAAAGAEILVGTWVPALNIFETSLRRGKFDQSRVLPDGSLMEIKKVYPLDAVFDNPEDVPEDVKANKRYAGSSNWTVQEAAECVRQDFGSIDILVHSLANGPEVSKPLLETSRKGYLAAISASSYSFVSLLSHFLPIMNPGGASISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKQNIRVNTISAGPLGSRAAKAIGFIDTMIEYSYNNAPIQKTLTADEVGNAAAFLVSPLASAITGATIYVDNGLNSMGVALDSPVFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENOYL ACYL CARRIER PROTEIN REDUCTASE
publication title Common themes in redox chemistry emerge from the X-ray structure of oilseed rape (Brassica napus) enoyl acyl carrier protein reductase.
pubmed doi rcsb
source organism Brassica napus
molecule tags Oxidoreductase
total genus 101
structure length 297
sequence length 297
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1995-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1enoA00
3ZU4A 3WNQA 3NDJA 4YQYA 3OICA 3SJ7A 2UDPA 4R41A 2PKRA 2V65A 4CQLB 4XGNA 1KVUA 2UAGA 3ASVA 3DC2A 4Z0HO 3ZNQA 1B8PA 2NU6A 1W8DA 3R1IA 3U5TA 1V9LA 2C7GA 1DAOA 3AK4A 3CH6A 5KCZA 1GD1O 3PEFA 4YT8A 4BNIA 4ZICA 5ICSA 4CMHA 2O3UA 2NADA 1XIVA 5L51A 5JC8A 2GERA 2NWQA 1GYRA 1YB5A 3W8EA 4GSLA 2WYUA 3TOZA 4CLOB 1NHWA 3K92A 5CHEA 3VZRA 3GHHA 1NQAO 3RU9A 3ZHXA 4ND1A 2C0CA 1LSJA 2CFCA 1PJLA 3C7DB 3P7MA 2D59A 1YONA 2B4RO 3CMCO 2HMSA 3M1LA 1NQOA 4GWGA 3BZUA 1EFLA 1UZNA 5GMOA 4P4GA 3B1KA 2P9CA 1DRVA 3U4CA 3I83A 2EHDA 3JQBC 3Q9NA 3QRWA 4DMLA 1U2GA 4K26A 2X0NA 3AJRA 2I65A 4LVCA 3B6ZA 2J6IA 3O26A 1HDYA 4B8WA 5JAIA 1EQUA 4FGWA 1HDRA 2EG9A 5CFZA 5JMPA 1WDLA 3BTUA 2Q4BA 1ID1A 4RJTA 2PTGA 1VKOA 4J6FA 1K6XA 5A9SB 1FMCA 3AY3A 2FRDA 2P9EA 3CE6A 3ZU2A 4FJ2A 1G0NA 4CM3A 3FI9A 3U49A 4R5HA 3WFJA 5JNLA 2HK8A 1V6AA 2VTEA 3L6DA 3RBZA 5A02A 4HXYA 1A7AA 3AUTA 3H9UA 5AXCA 2GGSA 2VUUA 1F8GA 2FHSA 4KMSA 4UUNA 5CAEA 4JBIA 4M87A 2UVDA 4XA8A 5I7SA 3ZCXA 4UEOA 4JX8A 1GEGA 1YJ8A 4J0FA 2I3AA 1DHTA 4EITA 1QYVA 3BHJA 4KDEA 2VZ0A 4MIEA 4PLFA 1SOWA 3V1UA 4CUKA 2P2SA 4GMFA 5L7TA 1ZSVA 1C1DB 3EY4A 4AJLA 3IJPA 1PJSA 3DMTA 3IKVA 5EPOA 2XOXA 1DC6A 3OQ6A 3WLEA 1H6AA 1NP3A 3AU9A 5KOIA 1J49A 9LDBA 1WMAA 2VNSA 3F47A 3IP1A 3RQSA 5HTOA 1ZJYA 3ONEA 5EL0A 2FP4A 1LI4A 3B1FA 4QX6A 2O23A 5G0VA 5THKA 3MTJA 4CMEA 4ZRMA 4R1TA 3L77A 3M2PA 4GKVA 4MP6A 4DUPA 1DOHA 1KS9A 2CD9A 4L8VA 3GVCA 2DM6A 4RVUA 2C2YA 4M86A 3RUEA 1TEHA 1A7KA 2C82A 1JLLA 4NBVA 1ENPA 4FCCA 2X23A 3MJCA 5FI3A 3WGZA 2O3RA 1YBVA 3WDSA 1Z75A 2PH3A 4GH5A 2X0RA 4BB6A 1ONOA 3UVEA 4QUKA 1H94A 4M55A 3GGPA 4LCEA 4YJFB 1R4MB 5FI5A 3RD5A 2ZTMA 2GNAA 4YT4A 3TZ6A 1LQTA 1LA2A 3LF1A 5MDHA 3ULKA 4CM7A 3ITDA 2QG4A 3MOGA 1LC0A 4OKNA 3JQAA 1PTJA 4Z0PA 5DCYA 4MIYA 3UF0A 3VPXA 2BI8A 4BGUA 3A4VA 1ORRA 4FC7A 3OBBA 1HE5A 1Y8RB 3OEYA 4OXNA 3HB5X 3ITKA 4XYEA 2DBVO 1TT7A 1L7DA 3VZQA 3EYWA 1UXKA 1NYTA 4C4OA 4PRKA 1LU9A 4XYLA 4K6CA 4DBVO 4YRAA 3LT0A 3ONFA 3QQPA 2EP7A 1JWAB 3WYCA 2Q50A 4EJMA 1GR0A 2DQ4A 3LVFO 5H83A 3D64A 5IDQA 4R9RA 2IDZA 4NBRA 5C3MA 3MJEA 3X2FA 1H9AA 3GY0A 3RUAA 3V8BA 3WGGA 3ZU3A 3EVNA 3D3EA 1FDVA 4WGGA 1T2CA 1HSZA 3RC9A 2HSDA 1VL6A 4OQZA 2FSVA 1QLHA 4RDIA 4RGBA 4FDAA 4BNFA 1P33A 2BF7A 3DEYX 4WNIA 2HQ1A 4LGVA 3TZCA 2DBRA 3IIEA 2EKPA 5CEEA 3OJOA 4ZGWA 3T4EA 4YYZA 1RKXA 1ZK0A 2XF8A 2BMAA 4DIBA 5I7EA 2VZ8A 3E18A 2G17A 2YJZA 3QJ5A 3WGYA 4YCAA 2O3TA 4B4WA 3DTTA 2OL4A 4I9HA 4AJKA 4E5MA 4O0LA 4EEXA 4PN3A 2PV7A 4RORA 4GX1A 2X0IA 2WSBA 2X1HA 3BMCA 1BW9A 1IY8A 3DAPA 5FYDA 5BSEA 4NFHA 3K30A 4TVBA 1MA0A 2ET6A 4GBJA 5JFOA 4LSWA 1YBMA 3KYCB 3NJ4A 1RM5A 1N9GB 3TPCA 4WJZA 3GA0A 1NWCA 4FN4A 5DBIA 1WAMA 3BMQA 1N7HA 3HZZA 4HFRA 2I5PO 5JY1A 1VE9A 4BO1A 2EGHA 1X7HA 1RPNA 3QSGA 4MP8A 4WCFB 2IRWA 5DN9A 3TSCA 4ILKA 3PJGA 3BHMA 2OOSA 1Q0HA 1QRRA 3O4RA 3I4CA 3NAQA 1BSVA 1P1IA 1FF9A 1EBUA 3JQ6A 3PQEA 1Q2XA 2CY0A 2EJVA 1P74A 2FY8A 3PVZA 3G49A 3Q2IA 4QSMA 4AJEA 1E6UA 4BHTA 2DFVA 3QWFA 3IJRA 3ADOA 1UDBA 1HRDA 4CL8A 4OYRA 1LNQA 3OP4A 1PQPA 3R6DA 4IDAA 4MJLA 4PLYA 4WLVA 5I7FA 1Q0LA 3OQ1A 1P0FA 4EGFA 2O2SA 3FNHA 1VJ0A 1U9JA 1XHLA 2BKAA 3MEQA 3E8XA 4FFMA 1XKQA 4AG3A 3F9IA 3UW3A 3JQ7A 2YW9A 3CUKA 3ENNA 2QQ5A 5F5NA 1KEPA 4WEQA 1S7CA 4NI5A 4L0QA 5KVSA 4RQTA 2HUNA 1KEUA 2HAEA 3C1OA 4NQZA 1IYZA 3C85A 1LSSA 1DC4A 4A5OA 3GRKA 4OOFA 3VTFA 1VSVA 2VOEA 4DA9A 4CV1A 3HB4X 2A92A 5COQA 3JD3A 3RUIA 1MLDA 3PPIA 3U62A 4WCFC 5DP1A 3UAGA 5BNTA 5B12A 4Z3DA 1XYGA 3KETA 1S6YA 5CG1A 4M89A 3DO5A 4F6CA 4D0RA 3VVBA 4E4YA 1BDBA 5DOZA 4KP7A 4N5MA 2OORA 1EVJA 1LDYA 2D4AA 4IQGA 2V6MA 1OMOA 1Z82A 1IZ0A 1OC2A 4IIVA 2J5QA 1M67A 4XRRA 3K73O 2H6EA 4J3FA 1RYDA 1ZMOA 3H2ZA 4MVJH 1I3NA 4MDHA 4TRRA 1PQWA 1U28A 5A06A 1I36A 1P44A 2WMDA 4BGIA 1OI7A 1TB4A 2GN6A 2WEKA 3VH4A 4BNXA 3DOJA 1NR7A 2IYOA 1PEDA 1Y81A 4NK4A 4M8SA 1ZNQO 1ADGA 2DT5A 5I8ZA 2X9GA 1FDSA 3AUSA 2PZKA 4DQVA 3EK2A 2X4GA 3L9WA 4XD2A 2DVMA 1NM5A 1DEHA 1PS8A 3B70A 4CMBA 4IMRA 5JBIA 1UUFA 1EK6A 3G79A 3GNQA 1ULSA 1UXIA 4D44A 2PGDA 1KVSA 3WYBA 4QFCA 2VRCD 4N18A 4CM6A 4Q3CA 4NFYA 4YJDA 3UCFA 4CMKA 3WX0A 5G0UA 3RJ5A 3GLQA 4HP8A 1HXHA 1ENZA 4UUOA 4FOOA 4P4LA 1I0ZA 1F17A 4NJMB 3JV7A 4UULA 4YAKA 4ID9A 4GX2A 3BMOB 4NFSA 1PJ2A 3ZHYA 2WJPA 1KIFA 1PJTA 3I9NA 3P19A 3DBLA 1Y7TA 1B15A 4NJOA 1GQ2A 4EBFA 4PLCA 3O38A 3MJTA 4JCOA 4CQMB 3K6JA 4XYGA 3ETEA 1PL8A 3F6YA 4QQRA 4CR8A 3GG2A 4IPTA 1I8TA 2DKNA 5COBA 3JCZA 1DIBA 1NWHA 1FDTA 4NZ9A 3SC6A 2Q2QA 2PH5A 1V3TA 1ZK4A 3ZV6A 9LDTA 1UP4A 3FPLA 2HRZA 4KWHA 3NT5A 2AEJA 4C7JA 3CPSA 3PZBA 4CM9A 3HDJA 1AHHA 2JD2A 4IDCA 5A04A 4PLHA 2AG8A 3FHLA 1MFZA 3L07A 1CIVA 2B0JA 4YAGA 1V0JA 3JQCA 3AI2A 1WLYA 5DBGA 4Y6SA 2VWGA 3ZWBA 2Q99A 1ADCA 3AM4A 2Q4EA 4MVJG 4NU6A 3PWSA 5EQDA 1GEEA 2YDYA 4AJ1A 1VSUA 1KYQA 3VDRA 3BMNB 3HDQA 4Y6RA 2R00C 1ML3A 2WD7B 3R3JA 1NXQA 1U4SA 4WLFA 2VUSA 2C07A 5C7OO 4BNYA 2QX7A 1R4MA 4ROSA 2I9PA 4DGSA 1K6JA 2BLLA 3ZDFA 2DAPA 3PTZA 5MGBA 3W8DA 3OJEA 1XELA 1XR3A 5T6BA 2WYWA 1DFIA 1O5IA 2DUWA 4PLTA 1AXGA 1EVIA 3PRJA 3F5QA 3DBRB 2EERA 4JNKA 4BVAA 5IZ4A 1FJHA 1KEWA 2QW8A 2R6JA 4FSHA 3RKUA 4CR7A 5ADHA 3GH3A 2VT3A 2O3JA 1WZEA 3C1AA 2P9GA 4RLSA 4CQMD 1A71A 1YXMA 2IXAA 3UCXA 1BVRA 3I5MA 4DC1A 3WGIA 1C1XA 1R4NA 2Y67A 4JQCA 3R3SA 4BIIA 4IGEA 2HJRA 1BXKA 1I2ZA 4GGPA 4JBHA 4YB8A 4DBZA 4MVJD 4P4NA 2Y66A 5IAAA 2NVBA 1DIRA 4GI2A 3H6KA 4ZHSA 4IDFA 2W8ZA 4U7WA 4UEKA 1FDUA 3NT4A 3G3EA 4J49A 1A9YA 5TJHA 2PR2A 4BNHA 4WK6A 2FWMX 1HZJA 1HEUA 4JJFA 1HE3A 3D4PA 5TLSA 3C3XA 5IFLA 3IKTA 4BO2A 1C0IA 1RJWA 2YV2A 3ZNPA 4TRMA 4N5NA 1PGJA 2GN4A 4TRNA 3ST7A 3P2YA 3GAZA 4W99A 4BO5A 4J0EA 3DHNA 2GCGA 2X5JO 3DBHB 4ZQEA 1MX3A 3ASUA 1HF3A 4CM4A 5TX7A 3JQ9C 3G1TA 5JMWA 4LK3A 1VRWA 2HMWA 1SMKA 3TL3A 1E3LA 1MUUA 4Y67A 1P3DA 1ZEMA 4BGEA 1PS0A 3JQGB 4PFJA 3RC2A 1E3WB 1U2DA 3FR8A 5JE8A 3S55A 3H5NA 3JYQA 3WJ7A 3FN4A 4R1NA 4YJHB 2G1UA 3MZ0A 1KETA 1JTVA 4IINA 3IUPA 1BMDA 1Y8QB 3ZWXA 2OP1A 1ZMTA 1A4IA 2O3QA 3GUYA 3I9OA 3PGXA 2E4AA 2JAPA 3ICCA 4PG4A 4U0KA 4WCFA 4E5PA 3WWYA 5F21A 4ALNA 2CDBA 1YOVB 3PDUA 1PGQA 1B0AA 1PZHA 1P1KA 1JWBB 2VYND 4DWVA 4W4TA 1QYWA 3BA1A 3B1JA 4BKPA 1E1NA 2X5KO 3AUUA 5HS4A 4QO8A 2VCYA 3KO8A 5JDCC 4IDEA 4CMCA 4CLRA 1T25A 3E9MA 4BKUA 1T4DA 3TRIA 4BV9A 1IPEA 3WMWA 3PXXA 2GLXA 3CTMA 2VHZA 4YT5A 4J16A 5BSGA 4R3NA 2X58A 5TSDA 5TRTA 1C0LA 2BRUA 3FSRA 4RLHA 1SB8A 1NAIA 1HL3A 4JN6B 3GVXA 1LLQA 1CDOA 1Y6JA 4F45A 4E33A 1CJCA 3PFWO 2EWMA 1HDZA 1NX6A 4R5MA 1JW9B 1SAYA 3DZGA 4W6ZA 4TROA 1HWYA 4QTZA 5HA5A 1YVEI 1L7EA 3RU7A 2HMUA 1B26A 3IAHA 1E5LA 4OAQA 1LRLA 1GCOA 3C7CB 3G0OA 4R9SA 4KDFA 3L4BA 4E2ZA 5G4KA 4ZJUA 3PLRA 3KYDB 1I2CA 1QMGA 1UAGA 3E5MA 2EJWA 3AU8A 1F06A 5IN5A 4KZPA 4D41A 3NGLA 2OHXA 2CSUA 3W6UA 4FFPA 2YQ5A 1JAYA 3E6AA 4ZQBA 5H81A 1D7OA 4IZHA 3ABIA 4DLLA 1N2SA 4R01A 3BTOA 4J1SA 3GC6A 3SLKA 3ZN2A 4R68A 5JY6A 2EGGA 4FJ1A 1NFQA 2E82A 3PLNA 2GZ3A 5ENVA 5L4SA 8ADHA 5F3RA 3GFBA 1F14A 3KVOA 2HCTA 1B16A 3BTVA 4FFLA 5LDHA 2QRLA 2WWRA 1I24A 3V5NA 1GYPA 2VNAA 1IHXA 2HKIA 4FD3A 3OF2A 1HYGA 2J5RA 4IMPA 5TF4A 5A5FA 4BV8A 5IN4A 3TZHA 3INGA 4B4UA 3VH2A 1ONNA 1LDMA 1ZSYA 2VWPA 4BB5A 3D4OA 4D42A 2B69A 4A2CA 2PLAA 3LF2A 5ER6A 2BHLA 2FR8A 2IZ0A 4IIUA 4CUZA 4QXMA 5B4UA 2VWHA 2O4UX 3MWEB 3GUCA 4ND4A 4RPLA 2BFMA 1LSOA 3CMMA 3HNPA 4Y98A 1T24A 4Z9XA 5FF9A 1WVGA 3ANLA 1I01A 2ZK7A 1GUFA 3K5PA 4M49A 3W4JA 1P1FA 1SC6A 4QFDA 5A3JA 3LC7O 4BO3A 2CZCA 1UR5A 1QYDA 5JO0A 4XIJA 1BWSA 2Y99A 3ZHBA 4ZU3A 3GZNA 3OA2A 3U9LA 3H5RA 1A4UA 1PR9A 5BNIA 2BFPA 2GR9A 3H65A 3ZWWA 3RFXA 1NASA 3TFOA 4MVJF 3KSUA 3K8ZA 1TA4A 4W9NC 1E6WA 3O8QA 3AOGA 4ZRNA 4EI2A 1X1EA 3QP9A 3TDKA 2QZZA 4R4JA 4DYVA 1EQ2A 4CMIB 3KUXA 3V2UA 3NT2A 3FNGA 2DFDA 5IDYA 4YR9A 1MXFA 2ZYGA 2JAHA 2D8AA 3BMNA 1JDJA 3CEAA 4IJKA 4ZVVA 2PWZA 5KJEA 5KVVA 3CKYA 3GVPA 4RPJA 5CDYA 1B8UA 4BL5A 1QSGA 3TNLA 1N8KA 4RCVA 1QR6A 3ORFA 3PHJA 2G82A 1MXHA 1U5AA 1X15A 4CM8A 3FTNA 4Y6PA 1ZSNA 1K89A 3QVSA 1H9BA 2ZQYA 5CG2A 1PX0A 3NEPX 4F6LA 3Q0EA 5G0TA 1UDAA 3JQ9A 3PYLA 2X9VA 4HV4A 1B7GO 3GR6A 3TL2A 2QHXA 2NNLD 3PHHA 4IDBA 3BYZA 4DMMA 4AL4A 5TT0A 1R6DA 1GCUA 1TI7A 4Y9DA 4G2NA 1LTHR 5ICMA 3DONA 3SBOA 4A10A 3BIOA 4DQUA 3QE3A 1ZXBA 2OZPA 1XU7A 2AQ8A 3GPIA 1VL0A 3KEOA 2NQTA 4LCJA 1T2FA 4FQ8A 2YHIA 3PP8A 4J90A 4YXFA 1MP0A 4AFNA 2PGLA 4JGBA 4II3A 1J6UA 3K9QO 2X22A 4WECA 1JKJA 1LLCA 4G5HA 1O0SA 3RUCA 4IDGA 4WPGA 3IUSA 5JYEA 2DU8A 3KB6A 1H6CA 4IDDA 3CIFA 4I5EA 1MB4A 3FBGA 4HX5A 5DCUA 5AXAA 3W8FA 1TT5A 1PJ3A 3FNEA 5JDCA 2EKLA 3PHIA 1GQYA 2AQKA 3EMKA 4D3FA 3QA9A 5L9AA 3GVIA 1UDCA 4EDFA 3ZI0A 1U7HA 1E1MA 1NPTO 3PJFA 1Y5MA 3OA0A 2IZ1A 4TVOA 2CNBA 1E7MA 3IOYA 4II2A 2JD0A 3L6OO 1PL7A 1PGNA 4J4HA 1OBFO 5EESA 4J91A 4LMRA 3NGXA 2Q3EA 3P2OA 4IXTA 1Q7BA 3PI7A 4MKZA 5DULA 1AXEA 5L40A 2O50A 3JD0A 2Q46A 2W2LD 3VAZA 4WLOA 2Y0EA 3Q1LA 2HO5A 3I1JA 2H9IA 5HRUA 5CPFA 4AJHA 1PJQA 4CMAA 5JCJD 5B4TA 5JW6A 1UJMA 2X7HA 3D7LA 4TQGA 2F1KA 3NTQA 2AQIA 4UVIA 4TSKA 4PCVA 1E0DA 4WEOA 1WMBA 3HQ4O 3PWKA 3C24A 2NACA 5IDWA 1ZFNA 1CQIA 4TZTA 4XWYA 3I9KA 1VJTA 3GN2A 4PIVA 1JAXA 3S2FA 1EVYA 4ALLA 2GZ1A 4EUHA 5EN4A 2A9FA 1XEAA 2WD8A 4JP2A 3RI3A 2VTDA 3VVCA 3MJVA 4UREA 3JQEA 1IUKA 2P5YA 3PK0A 4WASA 5C7LO 3RROA 1T2EA 2CUKA 1V3UA 4MPDA 1BTOA 4GVXA 2YV1A 3VTZA 2WE7A 3UICA 4X54A 4HKTA 4GVLA 2B5WA 2CVOA 1NQ5A 4NK5A 1JQBA 3RVDA 2LDXA 1NPDA 1ZK2A 4E2YA 2EEZA 1Z73A 2QZ9A 4J1TA 3WQSB 1U3UA 3EVTA 2EF1A 1K3TA 2ZATA 2H63A 3W4IA 4ND2A 3GK3A 3LDHA 3T4XA 1ULUA 3UFXA 4EZBA 1GPJA 1ZBQA 2Q1SA 4CLXA 1SB9A 1YJQA 3DQPA 3CZRA 4IJWA 2PKQO 4BO6A 3ZWCA 1CEQA 4FR5A 5HM8A 2VHYA 1EFKA 4PZEA 4L4RA 3GPDG 1D1SA 4Z9YA 3HSKA 3PDJA 1YB4A 4G65A 1SNYA 3ON5A 4HNGA 3I4FA 1DBVO 1SEVA 4GLLA 2JCXA 2FOIA 2CVZA 4YJGB 4CV2A 5K6AC 5F1OA 4PGFA 4UAGA 2CF6A 2C59A 2GZ2A 3DXFA 1I5RA 4HFMA 3WSWA 4GSKA 4XKJA 3ZV4A 3QVOA 3E9QA 5CPBA 5JCXA 4BNGA 3R0IA 4J9VA 5TQVA 1DFGA 5IG2A 4UUMA 3N58A 2UV8A 2OBNA 1DDOA 5L53A 3VPHA 4AJOA 1GADO 3H9EO 4B79A 1HE2A 1AHIA 2QRKA 3JQBA 4W9NA 4E32A 4J43A 4Q3EA 1ISGA 4LVUA 3G1UA 3RASA 4I1IA 3TFQA 3WLFA 1E7WA 4AJIA 4XJTA 3QV1A 1YKFA 3EC7A 1LDGA 4L76A 1NTOA 4J9UE 2X6TA 4QO7A 1BRMA 2C7VA 3ZW8A 3DAFA 4B8ZA 2J8ZA 3DZBA 4YTEA 4FW8A 4CQLA 3LZ6A 4OOEA 4DXHA 3WTCA 1BXGB 1BGVA 3S1LA 4O59O 5CEJA 3W6ZA 4A03A 3DFUA 3OETA 3QLJA 1E92A 4YPOA 1CF2O 1H2HA 4WLEA 5KJ6A 2Q1TA 3K2BA 1D1TA 3JQFC 1Q7GA 3QWAA 4NBUA 4D3DA 5JPIA 4P22A 4HBGA 4Z6KA 1CETA 4J4BA 2DPHA 2C2XA 3HUDA 4IQ0A 3QVTA 1E5QA 3WTBA 4CLOA 2Y1DA 4H3VA 3O03A 2RIRA 3ROPA 1U3WA 4OO3A 4L9RA 3QVWA 2AEMA 2W2KB 3VZSA 1UXHA 1GYQA 3L9XA 5JXWA 2Z95A 3H9QA 5KWEA 3BAZA 3SXPA 1U1IA 3H8VA 5AYVA 4CM1A 3SLGA 2VHVA 2P68A 4JBGA 3KLMX 3OIGA 1YL7A 4CMIA 2CF5A 3F1LA 3C7AA 4RF2A 1HDOA 4LRTB 4ZA2A 2X0JA 1GAEO 2FPIA 3U4DA 1QKIA 5FFFA 4B7XA 1PJ4A 3V2GA 2C20A 5A9SA 1JVBA 1SBYA 3VPSA 1E7YA 3DR3A 1ZH8A 1VJ1A 4OSOA 2SCUA 4XR4A 3WGTA 4NH4A 4IM7A 1GV1A 3ADPA 2ZCVA 2EV9A 4E12A 1AN9A 3H9GA 4EUFA 5T57A 2GO1A 4FS3A 1ISJA 4OKIA 3F1KA 5H82A 3RBVA 3TWOA 4RPKA 3Q9UA 2B4QA 1W6UA 2OXIA 2GSDA 3TQHA 1JA9A 1PR3A 2NVWA 2D2IA 4YBZA 1MG5A 4FOSA 4Q9NA 3LT1A 4K28A 1C1DA 1V8BA 2HK9A 3PQDA 1YL6A 4GAEA 4XGKA 3SVTA 4WLNA 3E48A 5U9CA 4FFOA 5JO9A 4E2WA 3OMLA 4D46A 1Z7EA 1R0LA 4JIGA 3Q11A 3GT0A 1DJQA 1RM4A 1HSOA 1SO8A 3OFSA 2DPGA 3V1YA 2BGMA 4JXKA 4I08A 4AJPA 4BS9A 1HKUA 1JN0A 3OIDA 3WQQA 5KKAA 2UUPA 2NQ8A 4RVFA 3ZH2A 4GWKA 1B2LA 4A73A 4PRLA 3NV9A 2P4QA 3HFGA 2GN8A 1DFHA 4MKXA 1D4FA 1C0KA 3A28A 4ALJA 3PHLA 5KJ1A 1SPXA 4BNMA 1GTMA 2ZTLA 4U6SA 1HT0A 2GYYA 3NX4A 1ZW1A 4MP3A 5GZ3A 3VOSA 1P1RA 3GZ4A 4MOWA 3AFNA 5T8KC 4U0JA 3D1LA 3HN7A 2VYVD 3NJ8A 3GDFA 1XA0A 1LBEA 2BGLA 3JD1A 4YJFA 4BQRA 3CZMA 4WOKA 3UOGA 3KTDA 3UH1A 3S2GA 4GL4A 3RKRA 4A27A 5C37A 1O9BA 3FTPA 1I33A 2PGJA 1QORA 1Q0QA 3A1NA 2G5CA 5BSHA 1LX6A 4TRJA 1KC3A 1QP8A 2WYVA 3RFTA 2AHRA 3RSHA 1ENYA 5EMHA 1Y8RA 3H3JA 3H2SA 3QY9A 3RUHA 3DZIA 1EDOA 2WDZA 5BNFA 1F0YA 2YFHA 4ALIA 3K2EA 5DT9A 4YAEA 1E7QA 1QYXA 4OHUA 5AOVA 1PJCA 3LQFA 2PZMA 1A27A 4YAJA 3L6EA 3ZWMA 2ZCUA 2LDBA 4DYDA 4XGIA 2JFFA 3AI1A 3UN1A 2OMEA 1X13A 2BELA 3DZFA 1BHSA 5K6AA 3WWZA 5JLAA 4XB2A 1AE1A 2XPCA 2JFGA 4CL3A 3IP3A 2IE0A 2A94A 5L4NA 5HWSA 4GMGA 3HADA 2DTXA 1HDGO 2JFHA 4Q3NA 1LC3A 4C7KA 3GEDA 2AE2A 4L73A 1P0CA 4BNNA 4ND3A 2FR0A 4A26A 5AQ1A 1CYDA 3LSYA 4BO7A 2PA3A 1X7GA 3ZWVA 3A9WA 3VC7A 2IODA 1ZK1A 1K0UA 3QIVA 1IULA 4CPDA 3I52A 2ZJ0A 1E6EA 2JHFA 5TJ9A 3NDIA 2YHUA 3WGHA 3HJAA 1HLDA 3WG9A 4P8RA 4IQ8A 1R0SA 3ETDA 4J7CA 3KYCA 4DREA 1MC4A 1XDWA 4EW6A 3NUGA 1N9GA 1WWKA 1D8AA 4NBWA 1YDWA 5TNXA 5K9ZA 1DLIA 1PIWA 3VDQA 1X0VA 2WM3A 1YH3A 4ALMA 3ICPA 3JQFA 2EW2A 3V2HA 1ADFA 3WBBA 4DLAA 4RVHA 2NM0A 4JROA 4TKLA 4HFJA 3S2EA 2RH8A 4WUVA 2RAFA 1Y1PA 3JQAB 3LT4A 1H2BA 3OQBA 1ZK3A 2GD1O 2HLPA 3MJ4A 4AJNA 1F8FA 1O95A 3CXRA 3E82A 4XQGA 2B35A 2PZLA 1PZGA 2HJSA 4UUPA 4PLPA 3FF4A 4I9NA 2V6BA 4NPCA 5A05A 4BQPA 1HYEA 2D5AA 4ZQGA 3GMDA 4DPKA 1GQQA 1E3EA 2HMVA 1E77A 5A9RA 2FPPA 6LDHA 1DRUA 4HNHA 3OIFA 5KIAA 3WFIA 4F3YA 2A35A 1Y9EA 2PZJA 2VRCA 3N7UA 1WZIA 4JP3A 4QEDA 1P31A 4DPLA 3D3WB 3DL2A 2YV3A 5IXYA 1ZO8A 4R54A 5JC1A 2O7QA 3AY7A 1ZCJA 4WCDA 2Y05A 1YE3A 4IS2A 4BNWA 1OAAA 4XZ3A 4OH1A 2FPGA 3HG7A 3AOEC 4DL9A 1GDHA 1X14A 3U0BA 1YGYA 3ZV3A 4N7RA 1EUCA 4U5QA 4CUJA 3O9ZA 1UP7A 3GHYA 4RDHA 2BI7A 1UZLA 2TMGA 3UUWA 4TMFA 3DB2A 2W2KA 3GVHA 1QV6A 3BMCB 1DC5A 1X1TA 1XSEA 1BW9B 2ZYDA 4RF4A 3S8MA 1UZMA 3AM3A 3ZWNA 1GPDG 2Z1NA 1IZ9A 2O3SA 2YY7A 1VI2A 4N5LA 3DOCA 3JQAD 3IQDB 5K0ZA 5EINA 2RHRA 2DC1A 3INRA 4OQYA 3DHEA 3LU1A 3LLSA 2PD6A 3BMQB 5FWNA 4Q3DA 3BXXA 1A5ZA 2OP0A 4GKBA 1V3VA 2I66A 4KUEA 4PLZA 4W7IA 2ZB4A 4I5GA 3UCEA 2Y1EA 3MJSA 3ZNOA 1PS9A 1UP6A 5BT9A 1NAHA 4OM8A 4AJ4A 2X5OA 3MTGA 3EZYA 3G17A 4KQWA 4PLGA 4DVJA 3WNVA 3D5QA 1TVEA 1DIAA 3ZWAA 5U4QA 1IB6A 3KSDO 3KV3O 5ILGA 4AJ2A 4NIMA 3ANMA 1VKNA 3H7AA 3DZJA 4NJMA 5I8WA 2R00A 1CERA 3M1AA 4I5DA 5L95A 3BMOA 3PWZA 1I2BA 1QYCA 1XQ1A 4W82A 3ZHZA 2IYPA 5C5IA 3IS3A 1ISMA 5T8KA 2Y0DA 4HFNA 4FGSA 4CQMA 5A9TA 5EERA 1ZEJA 2DLDA 1ISFA 1T4BA 3NDRA 3IL2A 1WNTA 2GF2A 5EQFA 5I7VA 3JQ7B 1GZ6A 3ZZNA 4E2XA 2JD1A 3JYPA 1KVTA 4NHEA 1W73A 3ROMA 3EDMA 4MVJA 4B7CA 4MVJM 3D4NA 1NBOA 1QLJA 4J1NA 1Q1NA 3JYLA 2OFPA 1FDWA 2GN9A 2C5AA 4AICA 1UXGA 2QYTA 4BUCA 1LLUA 4PVDA 2YYYA 5B1YA 4UVDA 4YACA 2ZYAA 4BNKA 2VUTA 3I9LA 3JQDA 5AXDA 4KTTE 1SEPA 1QV7A 4NMHA 5DF1A 5HBRA 3OECA 1BXZA 2Q2WA 3LT2A 3ZWOA 1RYEA 2FMUA 2JHGA 2WD7A 2VZ9A 3PJEA 3EAGA 3LC2O 1DLJA 4PG7A 5T67A 5DP2A 3W1VA 4CM5A 1V35A 5T5QA 4RVDA 1U7TA 2HMTA 4YWJA 3QW2A 4E13A 1GV0A 2AW5A 2G76A 5KTKA 5DOVA 1R12A 3QVXA 5DCWA 5CDGA 1DC3A 2HU2A 1FXSA 4OSPA 3KYBA 3DHYA 5L3ZA 1EBFA 3DBRA 4H15A 3OHSX 2ZTUA 2DUUA 3INTA 2CDAA 3WJAA 3SX2A 4DIOA 4D7AA 1DRWA 3SJUA 3UHAA 1LDBA 1XGKA 8LDHA 4BGVA 4PG5A 1K6IA 4OJNA 1KC1A 1RWBA 1M6HA 3EUWA 3NTOA 4J2HA 1I32A 3DZKA 3PQFA 1G1AA 4XDYA 3STHA 6ADHA 2J3IA 2NU8A 5TIIA 3DBLB 3Q3CA 5G0SA 1IL0A 1QXSA 2Q1WA 3UKOA 2VYNA 4OXYA 1SOVA 1PU2A 1O6ZA 1GL3A 3I6QA 3KHUA 4KOAA 1EDZA 2C29D 1Y5RA 1HE4A 3GNTA 4DPMA 4YRDA 2E6UX 2XXJA 4JLWA 2P91A 3GFGA 4XDZA 2IZZA 1P45A 1P9LA 1OZAA 4RV9A 2NSDA 1DJNA 4TKMA 4UEJA 3A14A 5IXSA 1M75A 1O8CA 1NFFA 4CMGA 4E0BA 1B14A 1P1JA 2IXBA 1N92A 4O6VA 1EMDA 2GDZA 1KVRA 3DBHA 5JSFA 1Z7BA 4XQEA 4FB5A 1VLLA 2QRJA 1RM0A 3QWBA 1T26A 4J2OA 1NPYA 3FBTA 3RWBA 4KUHA 4L75A 1T2AA 4BNTA 1GFSA 3RJ9A 4PLWA 2EXXA 3JQGA 4XQCA 3P5SA 1E3WA 5IJZA 3WIDA 4PG8A 4YJHA 4RPGA 1HYHA 2V6GA 1R15A 1TLTA 4B4VA 1LLDA 5CDSA 1Y8QA 4D3SA 4E30A 1BDMA 1YQGA 2O7SA 3AY6A 3TZKA 3ANNA 3AOEA 4XCVA 2BH9A 4GQAA 4BMNA 4NBTA 4F46A 4WOJA 2A4KA 1YOVA 4D79A 5JDIC 1KERA 4OMUA 2B4TO 1XG5A 4A0SA 5GY7A 1JKFA 2FSSA 3H3FA 4PZDA 1KEVA 3BTSA 3NYWA 1WDMA 3OJ0A 4CV3A 1ZUD1 5ER9A 1E1LA 2BD0A 1C1XB 1R4NB 4R69A 2PK3A 3Q2KA 1VM6A 3I23A 2HDHA 4EUEA 3JTMA 3TZQA 3WR5A 4MVJP 1XWFA 1HDXA 4BKQA 5FEUA 1M6WA 4L4SA 5T64A 3U4IA 4KUGA 5ENDA 2EIHA 2VRBA 1U5CA 1GZ3A 4NNJA 4XB1A 3JYNA 5BR7A 4CM9D 3D3WA 5A3VA 1FK8A 1H6BA 1W0CA 2WTBA 3WB9A 4GX0A 2Y1GA 5CDUA 2I3GA 4I8XA 1JU9A 3MOIA 1A9ZA 1KVQA 3DFZA 3I9MA 4MVJI 4XR9A 5F1PA 1ADBA 4S3MA 4LSMA 5JAQA 4A7PA 4NDNE 2D0IA 2Z1MA 4XQ9A 1UAYA 1O89A 3WGOA 2AQHA 2J3JA 4BNJA 1R66A 3COSA 1ISIA 3WICA 5ITWA 4CV0A 3WIEA 3WGQA 1L1FA 2QYSA 2G0TA 2NV6A 4JJGA 4FFNA 4NU5A 2E49A 2O48X 5DNAA 2H5LA 1MC5A 2PY6A 4QT0A 3VHRA 1NR1A 4D0SA 3KYDA 4BMSA 4CM4B 4MKRA 3DAGA 3HHPA 2CVQA 2Y93A 2ZB3A 2FZWA 1WPQA 1HTBA 5BSFA 1QG6A 2Q49A 3PGJA 5A4DA 3PYXA 1EE9A 3KBOA 2AEFA 4O63O 2ZB7A 3OM9A 3OSUA 1PQUA 4FBGA 4J7UA 1PZEA 4URFA 4ZQHA 1EVZA 1CRWG 3LK7A 4MO2A 1ISHA 3FNFA 3PIDA 2AG5A 3S2IA 2NU7A 3ZNNA 4CR6A 3I6IA 2ILTA 1EE2A 2E37A 2DBQA 4RF5A 1X0XA 4RVGA 3AM5A 2BFAA 3N74A 3RC1A 2UYYA 3IDSA 1N1GA 3A06A 4Z0TA 2RH4A 2DTDA 4W7HA 2B5VA 4EYEA 1GU7A 1H6DA 1H5QA 4ESOA 4GPD1 1E1KA 2R2GA 3PHGA 1B3RA 5I9LA 2YFQA 1C0PA 4L74A 2JCYA 1DIHA 3QHAA 1D3AA 4M1QA 1NVMB 3EW7A 1LXCA 1ZJZA 3MCVA 3ETGA 1EUZA 5THQA 1N5DA 3ZU5A 4CLRB 4Z3KA 5JAMA 2NVUB 2CDCA 2YDXA 2BGKA 1C14A 2EP5A 2EW8A 2FN7A 4XYMA 3U09A 1W4ZA 5GZ1A 4R1UA 4HUJA 4NG5A 5IZCC 1E7RA 5KNLA 3DBVO 2AMFA 2BFOA 4CLHA 2AXQA 4E5KA 1KY5A 3CSDA 4CLEA 1Z45A 2GPTA 5LCXA 5CDTA 4BKOA 3ROQA 5JS6A 4Q3BA 2Y1CA 1LRKA 1PWZA 3PJDA 5EJ2A 4INAA 4XEHA 3ZV5A 1B3BA 1DIGA 4RZHA 2X9NA 5TC4A 4WLUA 5C7IO 1K2WA 1PZFA 4TWRA 1P77A 4O1MA 4PZCA 4TZKA 1I10A 2Z5LA 1AUPA 4H16A 3WSVA 3VH3A 1ENOA 5L7YA 5A1TA 1YWGO 1ZZEA 3PIIA 4EEZA 3JQ8B 4UVEA 1T1RA 3FCOA 3OJFA 1OC4A 1Q7CA 4RF3A 2XAAA 4BKRA 1SCUA 3JD4A 1Z74A 3GN1A 1I3MA 5G4KB 1PSDA 4FJ0A 3LC1O 2W98A 3BHIA 1WXDA 4E21A 1LEHA 3RUFA 3HE3A 4RO0A 3TF5A 4K6FA 1MGOA 2OGUA 3HWRA 2I6TA 2Y0CA 4XYBA 1HETA 5EIOA 5AXBA 4CODB 1VL8A 1U8FO 4CLDA 1UXJA 4D45A 3NTRA 3EGOA 4J7XA 4UVHA 1YBAA 1PGOA 1MV8A 1J5PA 1Y9AA 1A72A 4G81A 1I3KA 1YB1A 3GDOA 4E5NA 5AVOA 5TS3A 3WS7A 2VHWA 4DC0A 3L0DA 1XU9A 3AUAA 1WDKA 1ZIDA 2J3KA 2UUOA 2YZ7A 2O2YA 2OUIA 1ARZA 3FRJA 1CWUA 3U4HA 4ALKA 5LDGA 4WNCA 1LRJA 1GZ4A 2IEBA 3C1TA 4L4XA 1F12A 1OFGA 3F4LA 1DHRA 3K31A 3PYMA 4RL6A 4B3HA 4PLVA 1NQTA 2JKVA 2W2LA 7ADHA 4IJVA 1PWXA 4RPHA 5JAZA 4Q39A 2HK7A 2Q1UA 1YL5A 3GEGA 1AGNA 2OO5A 4IUYA 5JCJA 3WBFA 4IXWA 1ZKMA 1E3IA 5HS6A 1NVTA 3RIHA 2O4CA 3L4BC 4U6QA 5KVQA 3ZW9A 5ITVA 3GGGA 1R37A 1CQJA 1U4OA 5KJFA 2EKQA 4P38A 3VPFA 2P4HX 4BNUA 3T7CA 2PD4A 1WW8A 1EUDA 1YQXA 3DTYA 5JDIA 1GUZA 3WMXA 5KVCA 3AW9A 3KRTA 1H93A 2NU9A 3F5SA 3ONDA 1YS4A 1HDCA 3GZNB 4MINA 5G2OA 3DDNA 4OGWA 1DPGA 2YQ4A 4Q3AA 4I9UA 4GX5A 2NTNA 2VQ3A 2Q45A 2GUGA 2C5EA 4K1LA 2AE1A 4E3ZA 3QWHA 2Q2VA 3O8QB 3RUDA 2ZIZA 1B8VA 4PG6A 2F00A 3WYEA 1LQUA 2J5KA 1TXGA 4OXKA 4DTIA 2RHCA 1RM3A 3WOHA 3E03A 1MG0A 2JL1A 5JYDA 3B20A 2J3HA 1R16A 1H0KA 4ZQFA 3VH1A 3KZVA 2GASA 5KKCA 1JKIA 1J0XO 2TMDA 3TN7A 3EZLA 4B4OA 5CEFA 3AI3A 4FIZA 3E9NA 3JD2A 4N54A 5I9MA 4IJUA 4AVYA 1KOLA 3ZGYA 1R0KA 2X86A 1E7SA 1SZJG 3KSZO 3SEFA 3VZPA 3JSAA 4CM8B 2DBZA 1IHYA 4FFRA 5IDXA 4MVJE 1IPFA 1G0OA 1DXYA 4MIOA 1XQ6A 2NTJA 3OH8A 3GGOA 3KOUA 4R16A 4BO0A 5J23A 2QIOA 5F5LA 3RC7A 1XCBA 3VPGA 1U3TA 1U3VA 3K96A 4BMVA 2DTEA 3D5TA 4YRBA 4LMPA 4GLOA 5CP8A 4LN1A 4IS3A 4BNVA 3H5AA 4Z9FA 4XX0A 2CMDA 1KBZA 2RCYA 5COAA 5L7WA 1DO8A 2W4QA 1PL6A 3AWDA 3NRCA 4BNLA 2ZKLA 2I99A 2NTVA 1M66A 4K9DA 3TJRA 3ROKA 3E5RA 2JJYA 3GRPA 1I30A 3H9JA 3RFVA 4HY3A 5G0WA 1BVUA 2OBYA 1HLPA 3RBXA 2PNFA 2Y1OA 5DBFA 2YUTA 5ES3A 1N1EA 3FWNA 4CJXA 4YT2A 3F3SA 4ZD6A 1LDNA 2D5CA 3RAJA 4J1QA 2YHIB 3NKLA 1NVGA 3UGKA 3L4SO 3W4KA 3KXDA 4D43A 4U8GA 5TT1A 2ZQZA 1ZXLA 3D0OA 2VOJA 1EK5A 3PFFA 1GUYA 2H1SA 2I76A 1ONPA 2VT2A 2Y1FA 2P5UA 4XIYA 4RZIA 3TOXA 4DRYA 1DB3A 4QECA 4DQXA 2I67A 1TT5B 3F4BA 1J4AA 3OEWA 3DMYA 1DAPA 1UH5A 2IEDA 4BNZA 1DSSG 4ONEA 1O94A 4CMJA 4PVCA 3ENKA 1EZ4A 3I3OA 4EJ6A 5IZCA 2XXBA 1P1HA 4IBOA 4OIMA 2WE8A 4YJGA 3QWIA 4YVFA 3HDYA 5U1PA 3LLVA 4LISA 3DMTC 3GNSA 2B36A 1MFPA 3DOOA 4E6PA 3KLPX 3DWFA 2PFGA 1LUAA 3HFSA 4O5OA 2D1YA 3ZWPA 4WE3A 3WXBA 3KEQA 5TGDA 4XJSA 2B83A 1M76A 4XRGA 4RVSA 4CMEC 1VPDA 5I9NA 4LRSB 4DLBA 4IGFA 2ZJ1A 3DZHA 2AA3A 3UXYA 2E48A 4KTVE 1XLTA 5ILOA 3FWZA 3VKVA 1HZZA 1JVSA 3SC4A 4YQZA 3GMSA 1K5HA 1NHGA 1LJ8A 4YEDA 4I5FA 3E1KA 3X2EA 4LW8A 3H4VA 3JYOA 3EHEA 4E31A 1BXGA 2FZEA 5L4LA 2PD3A 2NVUA 3M6IA 2POQX 4B3JA 3FD8A 1N7GA 1YDEA 3PZRA 3Q6IA 4Y8VA 1VC2A 4HWKA 4H7PA 1Z6ZA 3HDHA 2Y68A 5GZ6A 7MDHA 5IF3A 2W90A 4YA6A 4BO8A 3IC5A 3MWDB 4HADA 3GDGA 4R1SA 3ZWYA 3T7EA 1I3LA 2RBEA 4J4TA 2PKQP 1WP4A 4B3IA 1T1SA 4JK3A 3GG9A 3M2TA 5KJCA 1KY4A 3LYLA 5LC1A 3FR7A 3F46A 1E3SA 1PGPA 3GQVA 4EJ0A 4YAIA 4R3WA 5A03A 2VN8A 4KQXA 5DDIP 1NNUA 2GRAA 3GF4A 2C54A 4RQUA 1GY8A 3KM0A 3FPCA 1NFRA 3OJLA 4BOYA 3CINA 2NLOA 4AJJA 5B37A 2ZTVA 1IOLA 2ZB8A 3RCBA 4B7UA 3JQ8A 4E5YA 1T2DA 3HN2A 2NUAA 4KWIA 5L45A 2D3TA 4IY1A 1YRLA 3GOHA 4BO9A 3I9JA 3U3XA 4UVGA 3V1TC 4ZN6A 5A5EA 2FR1A 4S1VA 3WQRA 2HRBA 4WKGA 1X7DA 4BO4A 1M2WA 4NR0A 1ZVMA 4ND5A 4JJIA 4M54A 4IZIA 4DIFA 2JCVA 1YO6A 3VKUA 1YQDA 1U8XX 1PJBA 3IMFA 3GEMA 5F1KA 4GGOA 1LDEA 2V7PA 1OOEA 2VYVA 5G4LA 1EEHA 1C3VA 1E3JA 4FC6A 5BQFA 2VWQA 1LSUA 3GAFA 3AFMA 4ITUA 1IE3A 1G6KA 2V6FA 5DZSA 4FPXA 2X8LA 5B4VA 1BG6A 4OL9A 4YDRA 3C8MA 4R51A 2B37A 2VHXA
chains in the Genus database with same CATH superfamily
1OFHA 3TUIC 5HK9A 10MHA 3WKBA 2QRHA 1OBHA 4L8WB 3MOSA 4MS3B 3QEBZ 1YVPA 2IPXA 3OICA 1N3LA 2CNKA 2AK2A 3Q0TA 5E7QA 3CWCA 4O4HB 4CQLB 3LZCA 4MWSA 2UAGA 4B82A 1HNZB 1Q19A 2DQSA 3LX5A 1VYVA 4Y9SA 5FNVB 4RDXA 5KTYA 1JNYA 1V9LA 1BVHA 3HZHA 3T3IA 2I6SA 1I6LA 1MGPA 1XRSB 3I04A 4EVSA 5KCZA 2PXXA 5DXFA 3PEFA 3ZK9A 1CS0B 4EO4A 3PEYA 5JSYA 3RC3A 4WHMA 2O3UA 2P4UA 4N7JA 4ZYYA 3HJHA 1WG8A 2GERA 1GYRA 1GGKA 2GAIA 1DG9A 5FTMA 5F4ZA 1N3BA 3IDAA 4FEEA 2JLWA 1XRQA 1NW9B 2H2DA 2QMQA 2IIPA 2YWJA 4BLRA 1AZSC 1GGVA 1NV9A 2ALJA 4R98A 1XZAA 4B6SA 3C7DB 2NTYC 4MW5A 1E5VA 2XMZA 4UAVA 3C3EA 4DRXB 5J59A 2B4RO 2NXJA 3CMCO 4XJVA 3ROZA 4GWGA 5K3OA 3AF4A 4G86A 3ZJ5A 2NOAA 3MXTA 2PRZA 4Z51A 1B0PA 2FFHA 1JFTA 1NKSA 5D1HA 3VOBA 3U4CA 3I83A 4LOLA 4XAQA 1T10A 5AVJA 4DMLA 2CBXA 1I4TD 3KQKA 1U2GA 4K26A 4LRXA 4I4TB 3AJRA 4MVCA 4LVCA 2ZVQX 2W8BA 3B6ZA 5C1BA 2Y1LA 1W47A 2VL7A 3W9YA 1AHPA 1G8KA 2QL6A 2NT4A 4H7IA 2GF9A 3NHMA 2WWWA 3HGMA 4GMKA 3HXPA 5CFZA 1WY5A 2H7VA 2Q8QA 3IIKA 3DLAA 2PMBA 4RJTA 5JH7F 1VKOA 1JQAA 4C4PA 1JEQA 5DPMA 1WLSA 3COVA 2PBFA 4TXJA 3OY7A 2A33A 3HYTA 3EFBA 2OLJA 5AKIA 3SAJA 1N25A 2NXEA 5JNLA 4FCTA 1UFKA 4BWVA 1E2LA 3AXTA 1EG2A 1D2NA 3DGFC 1PRYA 3UB4A 4LHSA 3P9RA 2GGSA 5H3LA 1F8GA 1FRQA 2FHSA 4IRUB 3BXGA 4Q16A 4PNZA 4UUNA 4M87A 2UVDA 4LHXA 3VR3A 1TGYA 4JX8A 4UEOA 2XUKA 3BD6A 3M6UA 4J0FA 3BXHA 4I9FA 5EKUA 4ZZIA 1Y5LA 2QAGB 3AXSA 2LGJA 2P0AA 5CK5A 1QYVA 4EITA 4Z3OA 4HDAA 4PLFA 4QPDA 4WW0A 5JVDA 2P2SA 2O8VA 2IPLA 3LBHA 1PF7E 2OORC 5B3JA 4D3YA 1ZSVA 2F55A 2QM7A 3DMTA 1PK9A 4QPJC 4G1EB 3RVJA 1DC6A 4EHAA 1H2XA 3QF7A 3WLEA 4FUQA 1C8LA 1H6AA 2JK0A 2LP4Y 4OUDB 1NP3A 1A5BB 1NQXA 4F6RB 9LDBA 1YRYE 1MOQA 1IXZA 4O3MA 2VNSA 2QV7A 3IP1A 2PEYA 1QTRA 3FFXA 4Y0AA 4HJRA 2FWNA 2FP4A 2WW8A 2G6BA 3M4NA 4JP8A 5EL0A 4AROA 1KO1A 6REQA 2IYNA 1S4QA 1Y3DE 3FPFA 1RZRA 4PHCA 2BFEB 4R1TA 3ZDDA 4NC9A 3M2PA 4U2GA 1QIMA 1WVIA 1L7QA 1OT3A 2CD7A 3PQ6A 2UZ1A 3CHYA 1J90A 3E1SA 5B3KA 3P2EA 2IZ6A 4HDRA 5FB3A 3C8HA 3TINA 3N8GA 3HHEA 4M86A 2O5VA 3TW8B 3VC2A 1JQ5A 3I4LA 2OCKA 4RVOA 4TS9A 5LB2A 3S4YA 2VUIB 1YBHA 4CFYA 2EARA 4Y7DA 4G4SO 4FCCA 1A9QA 2X23A 3MJCA 3ANXA 2RAPA 3OIVA 4KXXA 4CCSA 5ITZB 5E6UB 3UPUA 2BHTA 2O3RA 4ZVKA 4GH5A 2FI1A 2J9FB 3VPBA 3K9LA 4P33A 5FBKA 1RRMA 4QUKA 3GFRA 4D96A 2QAGC 2VJLA 3IBTA 3HNRA 2I1LA 2NO5A 4YJFB 2GNAA 1Q6YA 4IUBS 4YT4A 1FFGA 4MI6A 4PR0A 1G291 1LQTA 1LA2A 4HGYA 5EJMA 3M3DA 2H4FA 2YMQA 4LJ7A 4O4JB 2QD2A 2QG4A 4NP6A 4OKNA 3I32A 5AIAA 3HKDA 1NXXA 1AQNA 4NCBA 1NJSA 2GNOA 4UFPA 2JHPA 4Z0PA 3IELA 4Z4HA 2QX4A 1TPYA 3BILA 2BI8A 2NUPA 3UF0A 1ORRA 3EGIA 1JH8A 5C53B 1N8NA 5JT1A 1HE5A 1UQUA 3GUZA 4AY5A 4B3SB 1OXSC 4JA0A 2DBVO 3MT9A 1KI2A 2BFCB 1L7DA 3OAAD 5I7OA 2V59A 2DQKA 2ZJ8A 3SSAA 1RI3A 1CG6A 3AR3A 3L7OA 3ADKA 1L5GB 3FPGA 5CR9A 1LU9A 4C4OA 4KXYA 2AN9A 1J2UA 4V2IA 3VJLA 4JJ4A 4DBVO 5BQOA 3QQPA 2A5FA 2EP7A 1R00A 2RKWA 2Q50A 4EJMA 1GR0A 2DQ4A 3KIPA 5H83A 1JV2B 3D64A 2C31A 3FJ1A 3I2HA 2JVKA 1H4VB 5C3MA 1GQOA 3R4CA 4B34A 5JQGF 2BE9A 3GPBA 2O8FB 1JIQA 3GY0A 1POXA 3ETHA 3EIQA 3HMQA 1M8JA 1TF7A 3IHTA 1JDUA 2V7TA 4WGGA 3RVDA 1T2CA 2ZREA 4OHZA 4GICA 2VRWA 3AFHA 4K2HA 3VR4D 4H4DA 4GECA 1CHNA 1VL6A 4MWTA 3NAGA 4OQZA 3R44A 1A8UA 1T43A 2I62A 4OK3A 4QTTB 5KWSA 1FSSA 3RRBA 3ED1A 1RWMA 2Z4TA 5IM5A 1YA6A 2I4MA 4DSOA 3TGLA 5CEEA 4HWOA 3SR4A 3T4EA 4YYZA 1NURA 2R1ZA 3V4ZA 1DKLA 3IBFA 4IKEA 5LZ9A 4B75A 2YHSA 4RZSA 4D8TA 2X5NA 1BX0A 3A31A 1SG0A 3E18A 3I2KA 4Q48A 2G17A 4DIBA 2OZVA 2PZBA 1PV2A 1RZ3A 3GUUA 4YCAA 1OYVA 5LU8A 1XJWA 1OFUA 2Q7XA 1WUIS 4EY7A 2A1TR 2KM1A 2H5JA 4AJKA 4EEXA 5CMLA 5LYJF 4V1CB 1XP8A 2X1HA 3BMCA 3DEZA 1IY8A 3DAPA 4MA5A 2WIAA 5FYDA 5LUBA 3KHTA 3GMIA 4NFHA 1L8AA 3HCBA 4TVBA 4RQBA 1MA0A 4EFDA 2ET6A 5ALHA 5JJ5A 4IH9A 1GKYA 4LSWA 3OWHA 3ACCA 3BXEA 1RM5A 2IELA 1RLOA 4C4SA 2A1IA 1BHQ1 1J8QA 2J0UA 3TPCA 3GA0A 5LQMA 3D6AA 3WBKA 3FDZB 1C5KA 4HFRA 2JLSA 1VE9A 1X8JA 1TU4A 2XOKA 1SKAA 2EGHA 3KQVA 4UOZA 1FRZA 1ZUNA 3CX6A 5FWYB 4AZ0B 5DN9A 2W70A 1E99A 3TSCA 4ZYVA 4D6XA 2FDRA 5HUQA 3BHMA 3ZEIA 4V0QA 4M60A 2C9DA 5EJ5A 3BF8A 3OUZA 1QC5B 3I4CA 3NAQA 2MR6A 4A6EA 5SZHB 3ZWKA 5HKOA 1X7XB 3V7FA 4LV5B 4MAFA 1UFRA 3FTDA 5FL7A 2CY0A 2FY8A 2EJVA 2GM9A 3D54D 3Q2IA 4AJEA 3DP7A 2DFVA 4P1ZA 1D2MA 3LHSA 2QRPA 1UPAA 1L4FA 1M8PA 2HMAA 2FA9A 3UWPA 3B48A 4G37A 1PQPA 1RWXA 3UA3A 3V8EA 5A4KA 1S9HA 5C4MA 1Q0LA 2AJLI 3VNRA 1P0FA 4YRCA 5FA5A 2WD9A 3NWPA 3M8KA 1LPMA 1DAHA 2GZDA 4CWAA 3MEQA 1GLGA 4FFMA 2HZ7A 1XKQA 1TTTA 3QK7A 4I36A 4EIWA 1JHZA 1HH4A 4WKPA 3E0QA 3JAKA 3REOA 3JQ7A 4MS3A 4DS3A 2WIFA 3M82A 4IV8A 1V16B 3GLVA 3GAAA 3IDOA 3WDLA 5K8VA 1DVRA 1XTBA 2YIDA 1W4RA 5FH9A 1Z8NA 1WF3A 5HQTA 2IY9A 4DV2B 5B1HA 5DSZA 5LFAA 1PWYE 3C1OA 1IYZA 2R6DA 2WPNA 3C85A 4CFZA 2X3UA 1WV0A 4DGQA 3VYRB 1VSVA 4FYIA 3F8SA 1E4EB 1XVLA 4ZAZA 1J9GA 3MF4A 3RUIA 4DNOA 1X70A 4G8JA 1XCLA 2MTBA 2PZAA 2AUTA 5B12A 3W5DA 4Z3DA 3B2QA 2FLWA 1S6YA 2ZJFA 3AVWA 4ZT4A 2QTZA 5D1NA 4AF6A 3PEVA 2A9QA 3MN1A 3VVBA 3BH0A 4R0NA 1CY0A 5M34A 1VRCA 1AO0A 3ZJTA 1XLVA 2XB2A 1YJXA 1C9JA 3K72B 1H2RS 2OFWA 2OORA 3HA5A 3BPSA 4N1AA 5HCNA 3UOWA 1Z82A 2WTEA 2J5QA 1M67A 3M70A 2VBGA 5ES4B 4J3FA 4TWBA 4X94A 1RYDA 1ZMOA 5K0JA 3TMKA 4QARA 1ZITA 2H1IA 2Z3VA 1AZLA 1R5BA 4NRDA 1J1UA 1UJNA 2WMDA 2A9VA 1OI7A 4BGIA 1FMLA 2WEKA 1JU4A 4I4TA 2AWNA 2IYOA 1PEDA 4BVHA 1ZNQO 1CCWA 2XQKA 1QX4A 4HN4B 1F8UA 1ADGA 5AVTA 2QTRA 5JATA 2DT5A 3SDZA 1X80A 1NSFA 2PZKA 3AUSA 2XCSB 2WQ6A 4XD2A 4G63A 4IHJA 5CB6A 4JC4A 1DEHA 1ZCZA 2B8JA 2Y9MB 3TLGA 4CMBA 3B53X 3G23A 1K4YA 1UUFA 2OZLB 5DNWA 3OZXA 3RANA 3GNQA 3P9NA 4WFQA 3W3AH 2I2AA 3W0LB 5FA8A 2D54A 5DISB 4IYJA 2Z83A 3KAPA 3UCFA 4ENTA 2H1OA 1FTWA 2H11A 4P35A 5G0UA 4Q37A 3WX0A 3RJ5A 1CQXA 2BONA 3IV7A 4HP8A 3GLHE 1BU8A 4FOOA 4NICA 1I0ZA 4WFIA 4ID9A 3QXHA 1W5BA 1A2QA 3GMTA 3STYA 4AZSA 2WJPA 2IYAA 4I4CA 3DBLA 1Y8ZA 2HGSA 4DWOA 5CB4B 2GA8A 3DF7A 1J7JA 1SC3A 2RDMA 3WFZA 2Y71A 3O38A 5HG0A 5AKYA 1P2GA 3P27A 3AC0A 1R6AA 3ETEA 2CXHA 1RQNA 1C1YA 2Q4OA 3MS7A 3O2JA 3B13B 4QQRA 1Y6RA 4BLQA 3FCXA 2QRZA 1DKMA 3JCZA 5BRNA 1DIBA 4G0ZA 3W2TA 4NZ9A 5LM3A 5EIEA 3M6AA 1G5IA 2PQ6A 4DB2A 6Q21A 3PSAA 4ZVQA 5L3VA 5AI8A 1T5TA 2VH2A 1H85A 5K0TA 5LLDA 3QVJA 1UP4A 2FYTA 5I9BA 4KWHA 1ZC4A 1ZN8A 2OESA 4C0QC 4MR8A 3L0BA 4ENRA 3TLXA 2QGFA 2P6RA 4Q01A 3PZBA 1P0MA 1QR2A 3HDJA 4GQBA 3OOJA 2OV8A 5F7JA 4F56A 2C96A 4UATA 4X7RA 4B8YA 5C4IA 4TT3D 3C6ZA 3LW8A 3SM3A 1GU0A 3T61A 1V0JA 3LL4A 4Y6SA 2Z4RA 4QOIA 5L3SA 1ADCA 2QMEA 3AM4A 1P3JA 2ZDGA 3NC4A 2W0SA 4M8KA 2RGXA 4TXNA 1IU9A 2CLSA 2XKBA 2YDYA 1WXQA 1ZRNA 4OIFA 3CUUA 5DLPA 3BMNB 3N5KA 1K8ZB 1O58A 2DWQA 2WD7B 3OHMA 1GPWB 3R3JA 1V3QE 3SSMA 1PKEA 1KOFA 3QBVA 3TXXA 3WK5A 1U4SA 4UQOA 3VU8A 4WLFA 2FR8C 2VUSA 5IJXA 1W4LA 1KFEB 2Q4TA 3TRDA 5C7OO 2CB9A 1AGXA 5TMEA 3CA8A 3ND8A 1U94A 3QVGB 4RDCA 2ILVA 1IQ0A 1NLUA 4U1RA 2BLLA 4PO9A 3OJEA 3SFZA 5T6BA 2WYWA 4BBJA 1O5IA 3IGFA 2V1UA 3UY4A 1EVIA 2HUPA 1I7DA 2QW8A 1VLMA 2R6JA 4FSHA 1BYUA 4CR7A 4X63A 2ZI7A 3GW8A 3VX4A 3AI7A 3BQNB 2YW2A 2E55A 3SHTA 4PRZA 4CQMD 2P0EA 3UCXA 3MVEA 3P0IA 3I5MA 5DHUA 2D1RA 3ESRA 3U4QA 5P21A 1C1XA 2HIMA 1GNLA 3H6GA 3R3SA 4JQCA 1FFSA 5F7ZA 5GGYA 2AD1A 4H31A 5DTJA 5LMUB 3OLWA 1BXKA 1I2ZA 4JBHA 1Q1BA 4P32A 4X45A 5B2ZA 4MVJD 2WF5A 2H1LA 4C0JA 1MPXA 2D0OB 2Y66A 2NVBA 5KTRA 3KVNA 4JOSA 2QTCA 4GI2A 3KK0A 5B57C 3H6KA 1XTPA 4UTPA 4ZHSA 1NXWA 2JGJA 4J0JA 2OCBA 1JE1A 1C9KA 3BB1A 3G3EA 1A9YA 4GC5A 4J49A 8MHTA 4Y6GB 2FWMX 1KO8A 4JJFA 1HE3A 4YFYA 1THGA 5IFLA 2RGEA 3LUPA 4LAFA 3BX1A 5KTTA 1C0IA 4QRHA 5CX4A 3EX7C 1XWWA 1XYVA 4XGQA 1PGJA 4XVRA 1JAHA 3PA6A 5EJ9A 3ST7A 4AI6A 1ML4A 1IQRA 3P2YA 1XRNA 4DQ0A 2J30A 3HDTA 1LV7A 4WJLA 1R3DA 1QO7A 3TI9A 4BO5A 1FNCA 1WKCA 1X1QA 2CMGA 3DHNA 3AV0B 3DBHB 4HAWA 4RTPA 1JI0A 2ENWA 3I01M 4WXEA 4PQYA 2VC2B 3D3QA 2IYEA 2Z56A 2ZWAA 4UKDA 1VBKA 5TX7A 2A9RA 5K3CA 2X40A 5ALRA 2OSVA 2G9VA 5JMWA 4WOBA 4RD0A 1VRWA 3N6XA 3I2GA 3NRBA 3N0TA 4ASUA 2HMWA 2I78A 1XVAA 1W93A 1YVUA 5K3AA 4HT3B 4RAQA 5J47A 1DP4A 3K0HA 1N0WA 3KOWA 5BVGA 4B5LA 1P3DA 4MLPA 5LPNA 1YU9A 3T0GA 4BGEA 1PS0A 4UQLA 2PUBA 1JLMA 1EFDN 1ZGAA 3FR8A 4F4FA 3WJ7A 1VDZA 4R1NA 4ER3A 6NULA 2DUJA 2RHOA 2G1UA 3NP7A 2OYCA 3WNZA 3MZ0A 1KETA 5KYXA 2ZVJA 5D3QA 4LI0A 2HEIA 2NZUG 4OLBA 2I3BA 4EHHA 1JB1A 3IUPA 1XCJA 4H59A 3MSCA 4DHEA 3LOQA 4EEKA 2O3QA 2JPDA 3GUYA 3I9OA 1U2EA 2E4AA 2BMEA 3PGXA 3CVVA 1KR2A 2EFDB 4MB2A 3J80A 5M2QA 3NONA 1YOVB 3PDUA 3IQXA 3T1NA 4OB6A 3SJAA 3IEMA 3KQUA 1JWBB 4F11A 2ZU6A 1IONA 1NN1A 4W4TA 3BIFA 2HJ9A 3C70A 3ZZ1A 1BXRB 4DXDA 4LZJA 2X0EA 4BB0A 1U0GA 1IRIA 2FWBA 4KXFB 2WUGA 2BH2A 1SZDA 5I9TA 5G1NA 5BYAA 2E5FA 1NW4A 1ONBA 1XEFA 4OU5A 1OLXB 4GYJA 4K9MA 5JDCC 3MBIA 1T25A 1RADA 3R7LA 2V3WA 3E9CA 4WERA 4XWTA 1T4DA 2GK3A 3T9EA 3TRIA 5EZSA 3DDHA 4DV6B 1Q1ZA 2ZJOA 2FGJA 3G2HA 4BFZA 1Z22A 5BSGA 4R3NA 2QTBA 1JYFA 1J2YA 5ALYA 1D0IA 1UBNA 4EMBA 3DFIA 2PUVA 3S1AB 3UWMA 4RLHA 1TAGA 1NSYA 3DE7X 3OPYI 4AC9A 2I8AA 2QUIA 4KXNA 2Q1XA 1IK4A 5CXSA 1BROA 2Z8XA 4BIMA 3EWNA 2JRLA 4NBLA 2XMCA 4E33A 1TCUA 2G9UA 1Z35A 2A5YB 4CL0A 2ZAIA 4DJEC 1JW9B 3L1JA 3ET5A 4W6ZA 1OX4A 5CTAA 1TUGA 4TROA 4X41A 2JAQA 1OXVA 3LDUA 5EJFA 3TKAA 3W7AA 1QPZA 5F9MA 4ZO9A 1YVEI 1WPXA 3VOTA 2FPSA 2HMUA 3TKLA 3LVRE 3PD0A 2HV8A 3RRFA 5IVDA 5L3QB 3MW8A 1E79A 1E5LA 3P8ZA 1EINA 1R88A 5KSPA 5C8YB 4EKNB 4KDFA 2BSQA 3KYDB 1I2CA 1XZPA 3E5MA 4CU2A 3KOYA 3KLNA 5C81A 4MB0A 5DHFA 1BVYF 4V3BA 4ZAFA 1F06A 4OB7A 3LUGA 4KZPA 4LOJA 2K7ZA 3FWHA 2XJ9A 3NGLA 4RXUA 4Y7CA 2TMKA 3FB1A 3ZZ0A 1XA4A 4BRSA 4CHGA 2VP9A 4CT0A 4D9GA 3QTTA 5F9FA 3NXKA 1EJ0A 1F4LA 4O0MA 3U3OA 3CNHA 4YX9A 4E09A 1CX9B 2HI0A 2HO4A 3LBFA 1IK6A 1N2SA 5IULC 4G5QA 3LBAA 2ZUDA 3GC6A 3IIIA 1T3HA 2G1KA 1G18A 1IZYA 2VAWA 2WHPB 3O4JA 4FE7A 4IXNA 4K0KB 1KP9A 2C98A 3BJRA 4R2HA 2HCTA 1TCAA 1THMA 2QTVB 4FFLA 4PRYA 3MINA 1KA9H 4QNRA 1NBMD 1FUUA 4LA4A 2M98A 1PT8A 3EQ8A 3H1TA 3ZKAA 5E1DA 2OCGA 3ORHA 2OZLA 3PHBE 4FD3A 4IMPA 4L6IA 5A5FA 4MQ4A 1JEEA 1V11B 2J3QA 3LXXA 5IN4A 2B2CA 4BX9A 1LDMA 1G98A 2JATA 5JWRA 3A1CA 4JLUA 1HV8A 2CCKA 4FQ7A 4ARVA 3G7UA 3PRKE 3D4OA 2YXPX 3IT1A 5EXDA 4D42A 4JVSB 4A2CA 2PLAA 2ZIXA 1DDGA 3H2HA 5GOZA 1MAWA 4MV4A 2FR8A 2IZ0A 2NNWB 3EODA 3N8NA 4KVGA 3V8MA 1NW3A 3ZGOA 1CP3A 2VWHA 4RM3A 5J4YA 2J59A 2AW3A 2CV1A 1U04A 3HNPA 5EYPA 1IDOA 5DIZA 4Z9XA 4I66A 1WVGA 3ANLA 3RFUA 4AURA 5BVHA 2ZK7A 2BR4A 3QLTA 2FG7C 5A3JA 1SC6A 4QFDA 2RE8A 3AVPA 1M1YB 5K3FB 3LC7O 4IIJB 4TL9A 3ECSA 3GJ0A 5HRCA 5JADA 2CZCA 5JO0A 4XIJA 1BWSA 4CF7A 2DYKA 2DQYA 2G9QA 4JENA 5GIPE 3OA2A 1YJ5A 1L8OA 3G2MA 1A4UA 4AY4A 3T3HA 2WG2A 2BFPA 5KNCA 4DFDA 3H65A 5I4BA 3QPBA 3ZWWA 2KYRA 3KKMA 4UTVA 3RFXA 2CJFA 4D80A 1NASA 2UYHA 2JJ2A 3GJ4A 2HNKA 1RHUA 4RL4A 1HORA 1YCHA 2XDYA 4I1OA 4FX2A 2ZIGA 4B3TB 1C80A 3I5YA 4GYYA 4RKQA 3O8QA 1CVRA 2H54A 3AOGA 4W9NC 2C3OA 4EI2A 3QP9A 2REBA 3E70C 4QJ5A 4R4JA 5JZBA 1EQ2A 5AW3A 1X7WA 2BUBA 3RVOA 1SU8A 1NXPA 3V2UA 1N32B 3FNGA 2DFDA 2E4ZA 5E2IA 2ZWPA 1BYIA 3AHGA 4ZT7A 4OU4A 2GD6A 3DEIA 3SK0A 1MXFA 1E5XA 2AKYA 3RH0A 2VP2A 2D8AA 3BMNA 1JDJA 4UU0A 5KDDA 2GXSA 2JZCA 5KTSA 1RPZA 3CKYA 1UEXC 4TLDA 4U3JA 3U60B 1Z68A 3AFIA 1T1JA 4XSGA 4H0NA 1X8KA 1F2UA 1J8VA 2A9JA 2B25A 4LHWA 1DKOA 5DHAA 3VYTB 3TNLA 1N8KA 4DCUA 3ORFA 2AGVA 3MMXA 3IX7A 1WXEA 2D1TA 5ARBA 1N36B 4IDPA 3BG5A 4EJSB 4ZIRA 3FTNA 1L5OA 2QSUA 3EIUA 3QH4A 1E9VA 2YZKA 1FJXA 2QU7A 1A4RA 1C7QA 1Y4AE 2XNDD 4WWHA 5CG2A 3N6RA 3NEPX 2HADA 2HLNA 3FOEC 3EVZA 4Z1MA 3RYTC 1H1LB 3PYLA 4QDTA 3O5AA 3MT8A 1E66A 5F5XA 1H05A 3KP1A 1P75A 1XAHA 4ZEMA 3FNRA 5D3KA 3BYZA 3D5EA 4H7FA 5TT0A 4MYDA 4NY1A 3CUVA 4BTEA 4FB4A 4Y9DA 2OWEA 2BTEA 4KXQA 5JARA 1LTHR 1YV9A 5K20A 3OZFA 1B00A 3HCNA 2MSCB 1U2RA 1DL5A 1ISPA 2AYYA 2NX2A 3QG1A 4MULA 3IVGA 1E4VA 1QQ7A 3P2MA 4EFKA 3V7WA 1Q17A 1G5HA 1KY2A 1O4VA 3JASA 3S7ZA 1XTQA 2PSEA 3N39C 1VA4A 2ZB2A 1AKMA 1CZNA 4Y2TA 3E05A 3B6KA 4ISBA 1G7TA 3UAVA 4XD7A 4NOMA 1YJAA 3ZYZA 1A5SB 1CQJB 2NQTA 1CC1S 3PP8A 2BHRA 1XPOA 1KGSA 2FV8A 3T3PB 3Q88A 1W85B 1WU8A 4YXFA 2OXEA 3U7JA 3SCZA 4BYGA 2IH4A 3T38A 1YRWA 4JGBA 2IXEA 3AB7A 3IA7A 1J6UA 1XB2A 3LXRA 4WECA 4P93A 4IDGA 3IUSA 2HBYA 3KB6A 1KYYA 2QAIA 4IDDA 4I5EA 5DCUA 1MB4A 5CCEA 4YMSA 3W8FA 2X3FA 5EJ4A 3T1HB 4Z4FA 3FNEA 3EASA 3IJ5A 2SKDA 5JDCA 2EKLA 3PHIA 2AQKA 4PHGA 2LV8A 5IT5A 1LVUA 4GM0A 1TJ4A 5L9AA 3GVIA 2YQZA 1ZUHA 3BSSA 3QMPA 1U0NA 4HLUC 3JARB 3ZI0A 4F4CA 1U7HA 3QU4A 1SBZA 1KU0A 4YMWA 1H8ED 1U7OA 2CXPA 3IQHX 3OOHA 4M1KA 2IZ1A 1RE1A 4Q4HB 4TVOA 3KQLA 3LXMA 3OQVA 3OJWA 3IOYA 3QM1A 1R64A 2JD0A 3PUXA 1PL7A 1PGNA 2EKZA 4J4HA 4C01A 1GA1A 4NNPA 1OBFO 1T6NA 3MB5A 5EESA 1P5FA 4G56A 1KJ9A 4LMRA 3T06B 3P2OA 4I6GA 3CH4B 4ZOLB 4BBAA 1T5SA 2D4HA 3PI7A 4MKZA 1EHCA 1NNSA 3O2QB 4WFJA 3RS3A 5L40A 4P58A 4MUEA 1PO7A 1WIWA 1BEUB 2R79A 3DT6A 4I99A 4AKIA 2FLKA 3GCXA 3I1JA 3RHSA 4B3MB 5CPFA 1PJQA 4CMAA 3LUCA 1J09A 3GAMA 3PXCX 1G66A 1UJMA 1KS2A 4FMDF 2BSAA 4W7SA 5AHRA 4AKGA 5BN3B 4UHBA 2AQIA 3EGCA 5CM8B 2G1PA 3FSGD 4UD6A 3UJPA 4AN0A 1PNRA 4Y18A 2ZWMA 4QYMA 2AS0A 1GRQA 4XPZA 3HQ4O 2CWDA 3C24A 4KK4A 2EX1A 1BXRA 3FPSA 1JX6A 4X1YA 5KOHA 5FBVB 3AGQA 4ZDKA 1ZD2P 4II7A 3GN2A 3KAJA 5ELLA 1C7IA 2Y2UA 3HUTA 3OSZA 2WG0A 2A9FA 5EN4A 2WD8A 3RI3A 3VVCA 4Y3UA 3E2PA 4C4YA 4EI7A 4ZWNA 3U7FB 2ZUVA 1VYHA 3W79A 1IUKA 2B94A 1K7FB 3GEHA 1TLFA 3BFVA 4JXJA 4WASA 1YMQA 1CRQA 3AB3A 1T2EA 3WHLA 2ZU0C 4BLOA 4GVXA 3W2HA 3OM0A 3VJKA 2IBMA 5GP1A 3VTZA 1CJVC 1NZDA 2EKBA 2O0MA 1R4ZA 2WJJA 1DG1G 1G63A 3E84A 3PR1A 3AKYA 3R7BA 3V34A 1JXQA 2B5WA 2O5RA 3E22A 5KYWA 5MN6A 1NQ5A 3A4NA 1IXKA 2GYVA 3LBNA 2Z1DA 4M0FA 1ZK2A 2I4NA 4NK5A 4WBSA 3DTVA 5CGZA 4YRFA 1Q3TA 1SVWA 1NRIA 2C61A 1FLVA 2CJYA 1JEJA 4HAVA 4RCZA 2EF1A 1K3TA 2OCXA 2ZATA 4E5DA 3KAKA 2FSGA 3PDHA 1Z4NA 3UFBA 2I2DA 5HF5A 1ZR2A 4LHYA 1LW7A 2OV6A 1ZBQA 4YK7A 4H1WA 2NO7A 3AR8A 1FCJA 1SB9A 3EZXA 3CZRA 3WLRA 2ZZNA 4NZYA 4EAQA 4I3GA 4BO6A 3Q7EA 1NJ1A 3ZWCA 4DR4B 2B3DA 4J2TA 3K70C 1M2HA 3GPDG 1M73E 3W2FA 4AQDA 5KI6A 5FA6A 2WKRA 3HSKA 2GCPA 3PRHA 1SNYA 3DOFA 1D6JA 1YJCA 2XB8A 1JHOA 1KZGB 3DPIA 1VB3A 1EWKA 3D8UA 2H2HA 4NVRA 1XXHA 4MPJA 4UAGA 2QVYX 2C59A 5KX5B 1U4NA 1BRTA 1CZLA 4GSKA 1YMVA 2MMCA 3BBLA 2OYRA 4P5PA 3ENZA 3ZV4A 1U80A 2UYCA 1E61A 3E9QA 5JCXA 2R6CA 4V38A 2ANCA 4J9VA 5ARCA 7MHTA 4Q7KA 5TQVA 5CU7A 1W5SA 4DSTA 1DFGA 1N7IA 3DA8A 4ER7A 2WWYA 1OB2A 4HLDA 2UV8A 1ZL2A 4G9GA 1IHDA 4X00A 3VPHA 1SQ5A 3M6XA 4MKIA 3HWX1 1RKUA 1P2SA 2QZ4A 1GUDA 1HE2A 3JQBA 2BCJQ 4GZ5A 4W9NA 4E32A 4J43A 2PLFA 3NMUF 4LRUA 3VR0A 1IWPB 4O02B 3OX1A 4FEGA 3TFQA 3WLFA 5SYMA 4LKOA 1QU2A 2MWMA 3MA0A 5C0OE 3TEFA 1EK1A 2Q4DA 2PHZA 2BFBA 3N7AA 4UXHA 2WWGA 1PT5A 2C7VA 2XMSA 1PI3A 1SD2A 1T2NA 3DAFA 4ICIA 4OREX 5E2AA 2J8ZA 2CJWB 4Y6QA 1R8JA 4BAGA 4DEXA 1WB5A 1KEZA 2VBIA 4YMHA 4DXHA 1DJPA 4M1ZA 1BXGB 2XTAA 1BGVA 1OH5A 1D0SA 5EZYA 4PYJA 5LXTB 2IYTA 2ATIA 5BV8A 4YPOA 1E2UA 1E92A 1X1RA 4WLEA 1H2HA 5C1DA 1OY1A 1Q7GA 2N47A 3OEED 4G41A 4UTZA 4B85A 5IW8A 4P22A 4HBGA 3GBVA 4LY3A 4MA4A 2DPHA 4ZEWA 2ZIFA 4L1KA 3SZUA 1S8FA 1L4YA 2FPUA 4YQEA 2Q2NA 4H3VA 4FDVA 4ZHQB 5HOEA 5AM3A 4LV8B 4NDZA 3ZCTA 4NOJA 3C7TA 1JHMA 2G9RA 2QF7A 2ZWIA 2W2KB 3A58B 3HABA 4X3CA 1GYQA 3BRWD 1J97A 1K08A 2CLFB 2P7HA 3VZSA 5JXWA 1K7EB 1KRXA 1E8DA 5K09A 3U3KA 1Z4MA 3OX2A 1W48A 2KE5A 2PT7A 5AYVA 5EMJA 2XV1A 1QIEA 1HYQA 1Q0SA 3O9MA 3DDUA 4KPUB 4UUBA 2Q7DA 4AIRA 1EB9A 1YUBA 1PD0A 2P68A 2V7UA 2YV4A 4JVLA 1U2SA 1WR8A 5K8IA 2RGYA 2JJMA 4GOJA 4S2EA 1Z4KA 3M6WA 1Z13A 4D4MA 1JIVA 1HDOA 2QOEA 1JAIA 3IDZA 2QRUA 3NO4A 4YRMA 3SJBA 4C43A 1QKIA 2X8WA 5HX7A 2E6KA 1F0KA 4KE7A 2YR0A 2DPYA 3TSAA 4ZZ3A 2YJ3A 2AXNA 2C20A 5ERGB 3QHQA 1ABEA 1SBYA 1ETHA 1NDQA 1SWVA 1E7YA 2PR7A 2ZJ4A 4P83A 2BW0A 4UJ3A 3M3PA 2OAP1 4OSOA 2ZEJA 1NVXQ 2CGEA 5AK0A 3WGTA 1OPXA 3CLSD 4MQMA 4NH4A 3ZQJA 5AI4A 7ABPA 3SVLA 5LD2B 2EV9A 4EHLA 3I61A 3R5HA 4Q9HA 4JI8B 2GD2A 1ELOA 5EXTA 4MUAA 2IIVA 4LYGA 2Z6AA 1ISJA 2B30A 2IP2A 2QQGA 1DOZA 1ZONA 4RPKA 4FYPA 4MQEB 1Y8CA 4BJ3A 1TO6A 5EI5A 5HZMA 4YLEA 2GSDA 4HLUA 3TQHA 1JA9A 3K6SB 1SHJA 5AKXA 3VKHA 4UPEA 1MG5A 3LHFA 5A0TA 1EQAA 3WLNA 3WLAA 2F8LA 2JFZA 2CYCA 5G41A 2CNLA 1C1DA 4LF6B 2QENA 4GAEA 3SVTA 4M1SA 2H7CA 4MCHA 2XCQA 4WLNA 3PRYA 1N2OA 3FGPA 1P9OA 3EZFA 2MSDB 3HYSA 4FFOA 4ZV9A 3UMRA 3VU9B 3VV2A 1UKAA 3AJAA 5JO9A 4D46A 5JNWA 5JISA 3FDJA 2H2GA 1FVXA 4K3VA 1U8EA 2QN9A 1CD5A 4GOKA 3MTAA 1DGQA 2DB3A 1DJQA 2WB4A 3GRUA 1JHPA 1Y63A 2JC3A 2HL6A 1PVVA 4I08A 4MWBA 5TMPA 1QHHA 3GLUA 4HEA6 1QRDA 4OM7A 5KKAA 1G9XA 2PTHA 1XMXA 3ZH2A 2IX3A 3FZEA 1B2LA 4GWKA 4NAUA 4A73A 4P7GA 1VIDA 5EHIA 3BF7A 1J22A 2P4QA 2Z3ZA 3NV9A 4MUGA 4X20B 4EG6A 1DFHA 3QVMA 4O2LA 5CW2A 1PR1A 3GCWA 4DA6A 3TD6A 5LD2C 1MF7A 4M76B 3ZQ4A 1DKQA 1KI3A 3EISA 1RWVA 1GG2A 1HT0A 2GYYA 3HI6A 3I1FA 1RPTA 4MP3A 1PUIA 1SVNA 3ESCA 3KJHA 3QPWA 1UPTA 1BX1A 5WRFA 4D82A 1QGAA 4MOWA 4OI0A 2YYAA 2FQYA 4QGGA 3JWPA 2J4CA 4G2TA 4PO3X 4U0JA 4ZO4A 2QVZX 4ER6A 1K92A 3JD1A 1LBEA 2OMKA 2QQFA 3C3JA 4LQDA 3CZMA 4XOUA 5C31A 3PXDA 3UOGA 4A0FA 4R40A 4F4DA 1RYMA 1TW3A 3QKSA 4JKOA 2Y77A 1O6GA 3L7YA 3IRUA 4QDXA 2BFWA 2YJ6A 2GZSA 3NPMA 3RKRA 3UC9A 3G82C 3FTPA 3GPCA 1USUA 2I71A 2PGJA 1Q0QA 2W4IA 4AU1A 1VFPA 4WXHA 5I45A 4ZTZB 4TRJA 2W6NA 1SOMA 1QP8A 1F2TA 1A77A 4MYTA 1M7HA 1N2BA 1SVMA 3I05A 3KUUA 5FJIA 4W9RA 1IRXA 4IP0A 4YIKA 3EVAA 1MJGA 1Z5OA 2DHCA 5IYZA 3T1TA 3RUHA 1SR8A 4M0CA 1W87A 2WDZA 1F0YA 5KHOC 1T9ZA 2ONZA 1SUSA 5CBPA 1S0UA 1L4MA 2B1QA 2C77A 2W2MA 2FOXA 1IHPA 4E7OA 3SYKA 3B38A 4J0DA 4OHUA 5D84A 3LQFA 4EKYA 1A27A 3SQMA 4F2WA 2WAOA 2CXTA 1J2EA 4XE5A 2G67A 5D01A 5ALIA 4EYKA 2B2XA 3JQPA 4E22A 4KW7A 3BGWA 3ZC3A 1C3EA 3A3NA 1S3GA 3IPCA 4QQNA 5HDQA 2HJWA 2B99A 2G8LA 1H2EA 4XGIA 2LNDA 5E95A 4ZOEA 4HQNA 2FQ1A 1X13A 3KPYA 3UV7A 1BHSA 3I0NA 2XXAA 1JECA 2O6LA 2BEUA 2ZR9A 3WWZA 1E9SA 3G0GA 5JLAA 4F1JA 3N86A 2HRQA 1YGPA 4KFUA 4MEBA 4BZQA 1AE1A 2RH5A 4QXAA 3C41J 4CL3A 2XUJA 4ENVA 4OD0A 1J0AA 2C8VA 2IE0A 4WVLA 3GLTA 5IBRA 1CZUA 4PTLA 2XCUA 3QVKA 2FGKA 3U4AA 3WRXC 1R27A 1NMXA 3GEDA 2AE2A 5AUOB 4MNTA 1F0NA 1P0CA 3HM2A 1U2PA 4A26A 5M29A 1CYDA 4BO7A 3ZWVA 1JAZA 2W6CX 1CRPA 3PPVA 4YDHB 4PZUA 3A9WA 3KXPA 3H11A 3G1WA 1OKKA 3W34A 1FP1D 4KAAA 2CHUA 3VNUA 2C8LA 3ESDA 1G3UA 2DMRA 5TJ9A 1FEZA 1R5NA 2OENG 4EFNA 1QOQB 1JLLB 3I1YA 2HHAA 2QX6A 3R5FA 2OLEA 3HJAA 3IQGX 4IQ8A 2IYZA 1NVDA 3M4JA 4GD3Q 2V58A 4XEUA 3ZWQA 2AUNA 3NG1A 4G0VA 3UMFA 1ESCA 1PKXA 3A4TA 1MC4A 4DJ5X 3NUGA 1N9GA 4HWRA 4I55A 1SQFA 1JKMA 2YZNA 1H1TA 5K9ZA 4NYIQ 1AUOA 1PIWA 2PN1A 2HV9A 5AW1A 1GZDA 1EJ2A 3ICPA 3LY5A 2IHJA 4H7HA 3WBBA 4CTOA 9GPBA 5D51S 1RWWA 4UBKA 1UOPA 4TKLA 4HFJA 3OWXA 3QPUA 5EJAA 5JAHA 3VR3D 2RAFA 2IS2A 3EDRA 2R7KA 2CW5A 3JQAB 3LT4A 3RGWS 2EZ9A 4IDNA 3MJ4A 4R1OA 1GGFA 3B5EA 1D03A 3ZTYA 3E82A 2ZJ7A 3FPEA 1EVKA 1W5TA 2QT9A 1SBIA 3LO5A 4PLPA 3FF4A 1IBMB 4NPCA 3KKNA 4PGHA 3F97A 1I0IA 2HCFA 2P65A 1P1CA 4HXEB 3DVSX 3GMDA 2CLKB 3A6PC 1AKQA 2B9EA 1JVNA 4PC1A 4PSCA 2HMVA 4R6WA 1KAQA 2VSYA 2JFUA 5CVCA 4CE6A 3FY4A 1HTTA 3IAUA 3RVSA 4ARIA 1DRUA 3AM1A 4LQCA 4ZCMA 2Y4NA 1E1CA 2PA0A 3OIFA 4I8IA 5KIAA 2HJHA 4KXMA 4FXPA 4F91B 4RGVA 4JYZA 4AWAA 2DR0A 2VRCA 3N7UA 2DHEA 3NCTA 2A0WA 2Z9CA 3AJDA 1P31A 1Q1QA 2VF5X 3D3WB 3OPVA 4JY7A 3T5MA 4DPLA 2FX2A 2AK3A 3TIVA 1OH7A 2ZWOA 5EE9A 1RZRD 2BC9A 3RT7A 3SZLA 4CCWA 1GILA 2G4LA 4X84A 1DCMA 2ZXUA 1ZO8A 4N5HX 1ZINA 2QPTA 4KQHA 5M04A 1ECPA 1SCJA 3D8RA 3UZUA 5LXTA 1ZCJA 1B42A 2ZAYA 1XC7A 3BICA 3NDPA 3PR2B 4OEHA 5KBYA 4M0UA 1V25A 3NFRA 4ZRDA 2D1FA 4EMUA 3MS4A 1US8A 5FOQA 3W77A 4ZCQA 1L7VC 4S1TA 1UBHS