1ENOA

Brassica napus enoyl acp reductase/nad binary complex at ph 8.0 and room temperature
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
297
structure length
297
Chain Sequence
b'LPIDLRGKRAFIAGIADDNGYGWAVAKSLAAAGAEILVGTWVPALNIFETSLRRGKFDQSRVLPDGSLMEIKKVYPLDAVFDNPEDVPEDVKANKRYAGSSNWTVQEAAECVRQDFGSIDILVHSLANGPEVSKPLLETSRKGYLAAISASSYSFVSLLSHFLPIMNPGGASISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKQNIRVNTISAGPLGSRAAKAIGFIDTMIEYSYNNAPIQKTLTADEVGNAAAFLVSPLASAITGATIYVDNGLNSMGVALDSPVFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENOYL ACYL CARRIER PROTEIN REDUCTASE
molecule tags Oxidoreductase
source organism Brassica napus
publication title Common themes in redox chemistry emerge from the X-ray structure of oilseed rape (Brassica napus) enoyl acyl carrier protein reductase.
pubmed doi rcsb
total genus 101
structure length 297
sequence length 297
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1995-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1enoA00
1IL0A 4RZHA 1I01A 3RJ9A 4KMSA 3PIDA 1C1DB 3O9ZA 3OH8A 4R1NA 2VHVA 1P1FA 3JD1A 4XJSA 2G1UA 3X2EA 4R9SA 2CFCA 4DBVO 3DZBA 3D3EA 5ES3A 1L7EA 3NGXA 3DMTA 3PDUA 1NHGA 1ENYA 5L7WA 5AXAA 4GKBA 5DP2A 2EKPA 1KC3A 5A05A 3AFNA 3RU7A 4B8ZA 4K28A 4IZHA 4CLXA 4IDAA 1TVEA 4TSKA 2Y1EA 4MVJH 3SJ7A 3UCEA 4Y6RA 3W8DA 1LLUA 4EJMA 3ZHZA 4B3HA 3DTTA 2X0NA 1WDMA 4P22A 1EUDA 3KYCA 3NJ4A 1XELA 3SBOA 1IZ9A 2DTDA 3I6IA 4O5OA 1KEUA 1ZBQA 3GUCA 4GLOA 1UXHA 4NBWA 4UAGA 3KVOA 4UVDA 4CODB 2G0TA 3ASVA 3NUGA 1BHSA 4CUZA 1YXMA 3DZGA 4PZCA 3PDJA 4DYDA 2W2KB 4WOJA 2F1KA 4GH5A 1RM0A 1ML3A 2FR8A 4D7AA 1UZNA 4FD3A 3A1NA 4N5NA 3G3EA 3K2BA 7ADHA 5EPOA 4ND4A 2VTEA 2W2KA 1EK5A 1HWYA 1PEDA 4CM4A 4L75A 3ZI0A 2NADA 2V6BA 1JWAB 3DDNA 4W9NA 1LLCA 1YJQA 1U4SA 3ZWNA 2EF1A 3H2ZA 3LF2A 5DP1A 5JSFA 3VOSA 1HYHA 4ITUA 3WXBA 2EIHA 5JCJD 4INAA 4Z0TA 4BKOA 2VWQA 3OP4A 4JP2A 2BI7A 3MJ4A 1RM3A 4ALNA 1LQUA 4XDZA 2WSBA 1R4NA 3MOIA 5IXYA 1E6EA 4CM4B 3ST7A 3CZMA 3Q2IA 1YQXA 4XKJA 1UDAA 1D8AA 1V35A 2I67A 1Y7TA 4I5GA 3WOHA 1O0SA 4U6QA 1X14A 5KKCA 2VRBA 3FNEA 1SB8A 4EZBA 1LSUA 3VC7A 4AJ4A 4IIUA 2JAPA 3FHLA 8ADHA 3DBRB 4J4BA 2UUPA 3BMNA 4MVJD 2JL1A 3MTJA 3RI3A 1Q7GA 2OZPA 2GR9A 1LU9A 4E2YA 1DFIA 1H6AA 3H9GA 2AE1A 5JAMA 4FJ2A 3K30A 4PLFA 1E7YA 2X9NA 4PLWA 4BS9A 1I36A 2ZCUA 5CDSA 5K6AC 1Q0LA 3FWNA 4FS3A 3UOGA 3OIGA 4LW8A 4FBGA 3GRKA 4E31A 1GZ4A 3K8ZA 5C37A 4XB1A 1GEGA 2C2YA 3B6ZA 5EINA 1ZCJA 1U8XX 3E03A 2RCYA 4CM9D 3ZU3A 4CUJA 1GD1O 3DBLA 5GZ1A 3QVTA 1KOLA 5A9RA 3H5NA 3GH3A 1YWGO 3COSA 1IB6A 4NG5A 1GZ3A 3ETEA 4TRJA 1A9YA 2D0IA 4ROSA 3WQSB 2JHFA 2Q1SA 3B70A 4B7XA 3NEPX 1P74A 3EC7A 4N5MA 3V1UA 1T2EA 3IP1A 4FPXA 1GY8A 3IC5A 2HJSA 1QV7A 1G0OA 3MJCA 2OO5A 4BUCA 3JD4A 2IRWA 1ISIA 4J91A 1WXDA 4PG5A 4J3FA 4BB6A 1JKFA 4CUKA 4J2OA 5TT0A 1VE9A 1A7AA 4PRLA 5L95A 1DC6A 4GVXA 3P5SA 3IMFA 4TRNA 4UUMA 5JYEA 5ER9A 3WQRA 2X0JA 3KYBA 1BTOA 3CPSA 4XGNA 1I3KA 4MJLA 5JDCA 3TL3A 2I5PO 2P2SA 5A3JA 4ND3A 2NVWA 2HK9A 3IOYA 4AJ2A 3L07A 3UICA 1IPEA 2NU7A 5CDTA 5L4SA 3WLEA 3DBHA 3BMCB 4DQVA 5C7IO 2X0RA 4MVJF 3N74A 4J6FA 4E5KA 3PGJA 4R1UA 4XA8A 4KUEA 3FBGA 3TZ6A 1VJ1A 3AOGA 1I24A 3IUSA 4RPKA 4MO2A 4PFJA 4DPLA 1BGVA 2POQX 3K92A 1KC1A 1NFQA 1QYVA 3H5RA 3WTCA 3GG9A 3I9JA 2HKIA 5G0WA 1A4IA 4TVBA 3RUFA 1ADFA 4DMMA 2B69A 3VTZA 4MIYA 5CEFA 1XLTA 4GWGA 3FI9A 2A92A 3OETA 5L4LA 4LMRA 3ZWWA 1P45A 5A9SA 2FY8A 4BNKA 4HFMA 3GVXA 3LVFO 3I23A 2RBEA 3GGPA 5JNLA 2P9GA 1UR5A 4I08A 1U5CA 4EDFA 1KY5A 1E3IA 2Q45A 3M1LA 3JD0A 2Z1MA 3I5MA 1ZNQO 3FR7A 2AA3A 1YOVA 3L6OO 2HSDA 4R69A 4FFNA 4XGKA 2YHUA 2VTDA 1PJSA 3IDSA 4GGOA 2G82A 3ZWXA 4CMAA 2AG5A 3HFGA 2GPTA 3TNLA 2D8AA 3INTA 4AJHA 5EERA 5CFZA 2GZ2A 3ROQA 2Q2WA 5ILOA 1N2SA 1ZUD1 3GAZA 3PP8A 3MTGA 1X13A 2GERA 3PHHA 5T8KA 4JGBA 4NU5A 4ALMA 1EE2A 4W99A 2NV6A 4J9VA 4WK6A 3WX0A 4P8RA 2YHIA 3QQPA 3DZHA 1ONNA 1WDLA 4J7XA 3BMOA 4BIIA 4YAEA 1GCOA 1EBFA 3IJRA 2HAEA 4HX5A 2W98A 3K9QO 3DAFA 1IE3A 1P44A 4IJWA 3S8MA 3NKLA 1E1LA 3DR3A 4CLRA 5FI3A 5T64A 2DVMA 1IUKA 5KJ1A 4RGBA 2NUAA 4M55A 3WGOA 2E4AA 4CMKA 1T26A 5JY6A 4GBJA 3NDRA 4GPD1 3VAZA 3SJUA 5IJZA 1FF9A 5KCZA 1WMAA 4IUYA 3ZV4A 2VHXA 3AJRA 1CQIA 1Y6JA 3HB4X 1PJ4A 1AUPA 3VZRA 4EUFA 1GZ6A 2CDAA 2X9GA 5G2OA 1GL3A 3AUTA 3T7EA 4ZJUA 4R4JA 3ADPA 4AJKA 3FTNA 2B35A 3F9IA 4WLUA 4MIOA 2V6FA 1PSDA 1GQYA 4L4SA 4XYMA 4XZ3A 3IKVA 1GR0A 4BKUA 4DPMA 2VN8A 1DC4A 4M8SA 3U3XA 4U5QA 1SZJG 4RVSA 3GHHA 3GNTA 1GUYA 1EVIA 4WLEA 4ALJA 2ZYDA 3ANNA 1UDBA 3AU9A 4OXKA 3VKVA 1TXGA 1YBMA 5BT9A 3QIVA 2X5JO 5C5IA 4XX0A 2PGDA 3DOJA 5JYDA 3GR6A 4UUOA 1PGNA 4XGIA 2EW2A 3ENKA 2ZK7A 1W6UA 3DMYA 3P7MA 2AQKA 1C14A 4DWVA 4E21A 5KIAA 2VUSA 1MG5A 1ONOA 5C7OO 1B7GO 5K9ZA 3DBVO 2HMSA 1JW9B 3G79A 4RVGA 4ZU3A 5HRUA 2GN6A 4AJ1A 2ZB7A 1SO8A 3JQFC 1KIFA 1YGYA 4YQYA 5TX7A 3NDIA 3RQSA 1Z73A 3PHLA 4YRDA 1JU9A 1WVGA 1OI7A 1W0CA 1NAIA 4YEDA 2X4GA 2CF6A 2ZATA 4A03A 3OFSA 2OP0A 1LDMA 5MDHA 3ZWAA 1F8GA 2J5KA 2FRDA 1FDSA 4YACA 1LDBA 3G0OA 1I0ZA 1PR3A 5BNIA 3RBVA 1YQDA 3W6ZA 1OMOA 1PIWA 1TEHA 3LK7A 4GLLA 3WLFA 5KJ6A 1RM5A 2CY0A 1LC3A 5DBGA 5FI5A 2I76A 4GQAA 2BFOA 3TZHA 4J2HA 1ISGA 3WQQA 1K6IA 3CEAA 3L77A 3DZIA 4BGUA 3ORFA 4LSMA 5IXSA 5JC1A 3OJ0A 4AL4A 2RIRA 3WSVA 4CQLB 1KVQA 2VUUA 1LLDA 2BELA 2X5OA 1C0IA 3GF4A 3O26A 5DOZA 2JD0A 2VT3A 4MPDA 3E18A 1V8BA 4YTEA 3I9NA 1WZIA 3W8EA 4PLCA 1J0XO 1ZK1A 2OOSA 1GFSA 1HEUA 2YUTA 3BZUA 1EFLA 1F06A 4CM5A 3VTFA 3LLSA 5B37A 2EW8A 3WGIA 3PHIA 3V2UA 3VPFA 4I5EA 1LLQA 2TMDA 3BMOB 3SX2A 3OSUA 4KWHA 2E6UX 1E1KA 3ZU2A 1K2WA 3VH3A 4KDFA 3W4IA 4J7CA 1Y8QB 4OMUA 3Q2KA 1YBVA 3W1VA 3JQ7B 2PLAA 1I33A 4CMEC 2PD6A 1JAXA 1GPJA 5CEEA 3KEOA 5HA5A 4D46A 2OBNA 1WZEA 4YR9A 4GI2A 4R01A 1VKOA 3P19A 3AUSA 1BW9A 3TPCA 2BMAA 2PZKA 3P2OA 3SXPA 3RC1A 2J6IA 1XA0A 4XCVA 3HUDA 3ON5A 4Z9YA 5I8WA 3E5MA 1KETA 4J1NA 5THKA 5L3ZA 4O1MA 3RSHA 1PGOA 4PG4A 1HE5A 3HZZA 4AVYA 5KKAA 4AFNA 3ITKA 2GZ3A 1T4DA 2PH5A 5A5FA 2GLXA 4JNKA 2YV2A 2UAGA 2VNAA 1L1FA 1U28A 4BOYA 1N9GA 4ND5A 3CINA 2B83A 2B0JA 1H6DA 3PZBA 4CR8A 2AEJA 1MFZA 3Q9NA 3GLQA 3GOHA 3VZPA 3WGGA 1ARZA 3E6AA 3R0IA 2FPGA 1MA0A 5I7FA 4NDNE 2P9EA 3R1IA 1LRJA 1HE2A 2C7VA 3DWFA 4I1IA 4JQCA 3LYLA 4KZPA 1HDRA 1WLYA 1SBYA 3DMTC 3HN2A 1V0JA 4TROA 4MINA 4CM6A 3KV3O 2WJPA 2P4HX 4NFSA 1UUFA 4WECA 4Y6PA 1K6XA 4YA6A 3CUKA 4KTVE 2GD1O 5G4LA 1I2CA 4IINA 4OJNA 4UVIA 3C7CB 2YFQA 2Y0DA 3GVHA 1YO6A 4PCVA 2CF5A 1DIRA 3ZNNA 5BSHA 2Y05A 4BKRA 1VRWA 1PQUA 1RJWA 4WPGA 3GN2A 3IKTA 3JYNA 1DFHA 3AM5A 4MP8A 1YB5A 1H9AA 4RV9A 4JBHA 5JDIA 4DYVA 4F6CA 5I7SA 3VVCA 3NRCA 1C0LA 1ZEJA 3WGHA 4NU6A 2AQIA 1GYQA 2BFMA 2VWHA 5A4DA 1B8UA 1UP7A 3OQBA 1ZKMA 4BO9A 1C1DA 2H6EA 3OQ6A 4QEDA 2ZTVA 1KEWA 1YRLA 3MWEB 4QFCA 1M6HA 1DEHA 2Z95A 4I9HA 3C1TA 5B12A 1Z7BA 1U2DA 4KWIA 1DB3A 2E37A 5CG2A 4J43A 2Y1FA 1E77A 3FWZA 1M66A 1Q1NA 4LCEA 3B20A 1YBAA 3N58A 4ONEA 3U4HA 5GZ3A 3JYQA 4NIMA 5K6AA 1GQ2A 1N1GA 5AXBA 3HB5X 2QW8A 3CSDA 5MGBA 3KLMX 1X7GA 4NBVA 1B3RA 3NTOA 4HWKA 1XU9A 1CQJA 4X54A 1DLIA 1X7HA 1E3SA 3JQAD 4NPCA 3G1UA 5HBRA 2J3IA 2VQ3A 2Y66A 2O2SA 1EE9A 4TZKA 5COQA 3WICA 5KVSA 1S7CA 3OF2A 4WCDA 4UUNA 1ZJYA 2ZB4A 3JQEA 1LQTA 1H93A 5G4KA 4DQUA 3LC1O 2ZYGA 3AUAA 3GQVA 2IZZA 4C7JA 4EEXA 1ULUA 4YYZA 4J0FA 2O3SA 3O4RA 4JN6B 2DPHA 4XQCA 3ZNPA 3G17A 1AHIA 2DFVA 4FFLA 4BKPA 5A03A 2NVUA 4R3WA 3QWHA 4R16A 3TDKA 2DBZA 3ZW9A 2AXQA 2VHWA 1GYPA 4YT5A 3IAHA 1N9GB 2BKAA 4GVLA 2BF7A 3OECA 4IGFA 4M54A 4YDRA 4Z9FA 5DN9A 1T4BA 4BMVA 1MXFA 4RLHA 3WGTA 1T2FA 1YH3A 4E4YA 2DLDA 3ULKA 4WEOA 4DL9A 3QE3A 4NR0A 1F8FA 3PFWO 3ENNA 4Q3CA 1B2LA 3M1AA 2DTXA 4YAIA 3QVOA 2Z1NA 4UVHA 4FOOA 4KP7A 5A04A 2C2XA 5KJCA 3DBLB 1BRMA 1PU2A 4EI2A 4NZ9A 3PXXA 2EJWA 7MDHA 4J90A 3GEDA 1ZK4A 4G2NA 2IDZA 1F17A 2V65A 1HZJA 1Y81A 3CIFA 4IJKA 4DREA 1PS8A 5BNTA 2Y1OA 3EAGA 3JD3A 1O89A 4D3SA 3ZHBA 1U7TA 1M76A 1U9JA 3FNFA 2H63A 2ZTLA 4YJFA 3L9XA 4WLFA 3ZNQA 4C7KA 1DIBA 4CMHA 1ZXLA 4JP3A 4MP3A 1SEVA 4W4TA 1UP6A 4GSKA 3S1LA 1EZ4A 3GVCA 1QMGA 2D5AA 3V2GA 4O63O 3FNGA 4E5PA 2HMVA 2D59A 4L0QA 5THQA 4GX0A 1A4UA 3OICA 3CZRA 1LJ8A 3PJDA 3PJFA 4E32A 3KETA 1DHTA 4RL6A 1ZMOA 1U3WA 1PX0A 1T1RA 3GMSA 1UZMA 2D1YA 3UCFA 1B14A 2AEMA 4H15A 3RC9A 3FBTA 1PL6A 3KSUA 4J16A 3I1JA 4BNXA 2NU9A 1OZAA 2CUKA 2QHXA 3AI2A 2QRKA 4Y6SA 4I9UA 4TVOA 4ZA2A 2G17A 3WGQA 1IPFA 2HQ1A 2PKQP 4XIJA 5GMOA 2ZJ1A 3L4SO 3QJ5A 2GRAA 4OKNA 5JLAA 1MLDA 2AE2A 4YT8A 4DC0A 3LT0A 3BTUA 3KYDA 3JQAA 1ZSNA 4FJ0A 3DZFA 3LT4A 5ILGA 1OC2A 3I52A 4AJNA 1Q7CA 1UH5A 2X8LA 4D42A 5KNLA 1NPTO 4G81A 1GYRA 4IPTA 3O8QB 3PJGA 3TOZA 1U5AA 2PGJA 3F5SA 3E82A 4GMGA 4B4WA 2FOIA 2J8ZA 4YBZA 5BSGA 4U0JA 2PFGA 3S55A 4ALIA 3KLPX 4J7UA 4P4GA 4OAQA 6ADHA 3A9WA 2C82A 3WSWA 3GPDG 3KTDA 3P2YA 4KDEA 2PD3A 4QT0A 5GY7A 4U7WA 3NT5A 3H9EO 1U3TA 2WYVA 4YAGA 3L4BA 4CM9A 3JQGB 2WD7B 2G5CA 3LU1A 3UVEA 2VOJA 3JQCA 4A7PA 5CDUA 2O3UA 3Q1LA 4RQUA 4B4UA 1LSSA 3D4NA 3D5TA 4DUPA 1MGOA 1VL0A 1YE3A 5A9TA 4DQXA 1LSJA 1UDCA 1V6AA 1YVEI 3K31A 4JLWA 5JAQA 3RBXA 2NVBA 3DOCA 4UULA 1RPNA 3RUAA 4D3FA 2BGMA 1QG6A 1HETA 3RUEA 2P68A 4PG7A 4AICA 4Z3KA 3E48A 4MVJM 1EK6A 3HJAA 4YQZA 2OP1A 2VYND 1D4FA 4W6ZA 1HSOA 1VL8A 3UN1A 3WR5A 2D2IA 3GNSA 4U6SA 3ONDA 1CRWG 3C7DB 4PLGA 1P1KA 5I7EA 4H7PA 4PLPA 1PZHA 2R00A 5JS6A 5JBIA 3I4FA 4DLBA 1ZSYA 1DC3A 2DQ4A 4RO0A 1F14A 1LSOA 4JXKA 3H3FA 1DIAA 2CDBA 1DAOA 1BVRA 3H9JA 1MV8A 3HSKA 4RLSA 1NASA 4CLRB 1TA4A 4IY1A 3FF4A 3W8FA 1DIHA 2C59A 2BLLA 1EVZA 2O50A 3ITDA 4CR6A 1VPDA 1PQWA 8LDHA 4Z0PA 1EDZA 3WWYA 4KUGA 4BNHA 2RH4A 4H3VA 5JE8A 4L73A 1QYDA 1M2WA 1PL8A 4RVUA 5G4KB 3C7AA 3KUXA 1FMCA 3NTQA 2A35A 1YB4A 2E49A 2NACA 4OSPA 4GX1A 1ZK0A 2O23A 4WCFC 2HMTA 1GCUA 2CD9A 1R16A 2DTEA 4ZRNA 5EQDA 1KEVA 2HMUA 4CMCA 4L76A 4GMFA 4NJOA 3ZWYA 4M49A 2XXJA 2J3JA 4FN4A 4A27A 2EKLA 1BSVA 4BNZA 1UAGA 3EZLA 3HG7A 1R0SA 2B4QA 3VKUA 1DHRA 1NPYA 3BYZA 3DZJA 3GN1A 1CWUA 3UW3A 5G0SA 5FYDA 1YDEA 1H2HA 1NHWA 1VSVA 4CJXA 3K2EA 2PGLA 1HXHA 3L9WA 1BWSA 1B15A 3RFXA 1PZGA 1R12A 4K6CA 5G0UA 4CQMB 2PD4A 4KOAA 1YONA 5TF4A 3ROPA 3HDQA 1C1XA 1K89A 3AK4A 4EEZA 5JC8A 4OGWA 1E7QA 4WNIA 1QYWA 2Q4BA 4XYEA 2ZCVA 4J0EA 1HYEA 2P91A 3IS3A 5L7YA 4EGFA 9LDTA 3A14A 1X0VA 2SCUA 4FFMA 3ZN2A 4YRBA 4NK4A 2Y68A 1H9BA 4O6VA 1Q7BA 2HRBA 3EVNA 2W2LD 3NDJA 1YJ8A 2Y67A 3CXRA 4N18A 3L0DA 4DXHA 2Q46A 2QIOA 3HFSA 4Y8VA 2HRZA 3QV1A 2X22A 3AWDA 2NM0A 4NJMB 3IUPA 4HFJA 2CSUA 2BD0A 2Q50A 3QA9A 4W82A 1W4ZA 3TZQA 1PS9A 3U4CA 5T67A 5L51A 1P1JA 3I9KA 1T2DA 3K73O 5CHEA 1AN9A 3GZNA 4FSHA 2ZIZA 1A9ZA 4O59O 4CV2A 5IN5A 3OA0A 3PLNA 3TWOA 3VDRA 3WNQA 1QSGA 1UXKA 1BG6A 4OM8A 2X6TA 3KB6A 4OO3A 4Q3AA 1F0YA 4R51A 4S3MA 4CMIA 5TIIA 4E12A 5J23A 5BSFA 2UVDA 1DAPA 2I99A 2PWZA 4D79A 4CM1A 5ICMA 3FNHA 2HK7A 4B7CA 3FPCA 3H3JA 3HDHA 1O94A 5F3RA 4GAEA 3DOOA 4F3YA 1T1SA 3PPIA 3Q6IA 4I5DA 4NH4A 1SOVA 3ICCA 4IBOA 2VYVA 1QKIA 2V6GA 3RWBA 1A5ZA 1LDNA 3S2IA 4OXNA 3QWIA 1P31A 1H6CA 1RYDA 3VDQA 5I9NA 3VPXA 4E13A 4R1TA 4QFDA 3QW2A 4ZQBA 4CM8A 3IIEA 2XOXA 1NYTA 4E6PA 3INRA 2EG9A 1EUZA 2JHGA 5CPBA 4DRYA 3BXXA 4PIVA 4E5NA 1RM4A 3TZKA 2FWMX 4AG3A 1VJTA 2GCGA 4FJ1A 1B8PA 3V8BA 4EBFA 1HKUA 2A4KA 1M6WA 1XKQA 3L6EA 2C54A 4YCAA 4E2XA 1DOHA 1HE4A 4J49A 2NTJA 1NBOA 2FMUA 1I3MA 2PZJA 1TI7A 2CVOA 1RWBA 1NFFA 3I83A 5AXDA 4Y67A 5IFLA 3B1KA 1LRLA 3F3SA 4FCCA 4J4TA 4DLLA 4WOKA 2RHCA 2HCTA 3ZV3A 3CMCO 3H8VA 5TNXA 1X1EA 5B1YA 4OQZA 2OUIA 4QUKA 1PJCA 2C29D 2AHRA 2PA3A 4N5LA 3BIOA 2PR2A 2O3QA 3RU9A 3RC7A 5TGDA 2YYYA 1EDOA 4J1QA 4YWJA 4BNTA 4TQGA 2AQ8A 5JXWA 3GT0A 5AOVA 3ZWVA 4AJEA 2BH9A 1DIGA 5B4VA 3RUCA 4H16A 3KSZO 1NP3A 4Q3DA 1A27A 2AQHA 1E3EA 5JY1A 1I8TA 1QV6A 4P4NA 1N92A 2JJYA 3WGYA 4NK5A 4S1VA 1ORRA 1D3AA 4FIZA 2ZB8A 4JBGA 4O0LA 4QQRA 3D3WA 2GN8A 4L8VA 4YJHA 3F4BA 2A9FA 1I32A 2DM6A 1NFRA 4OYRA 4BQRA 1DPGA 2C5EA 1ZVMA 2EEZA 4BNJA 4CV0A 4DLAA 1ZFNA 4LSWA 3H4VA 2VZ9A 3QY9A 2FPIA 3UH1A 4TRMA 5G0TA 1BW9B 3UUWA 3ZWPA 3JQ6A 1KVSA 2GZ1A 1PWXA 4F45A 3GFBA 2HU2A 1NVTA 1NX6A 1V3TA 1VC2A 4E3ZA 1B16A 2IEBA 3ANLA 3Q3CA 2O7SA 3GGGA 4HY3A 3E9NA 2QQ5A 1Z7EA 2Q49A 4WJZA 2Y0CA 1FJHA 2PY6A 3LT2A 4FC6A 3LLVA 2B4RO 1HDOA 3FPLA 1ZW1A 1QLHA 1NXQA 4RDIA 5CG1A 4NFYA 3CH6A 4OOEA 1QYCA 9LDBA 1GTMA 3JQBC 1J6UA 1DRVA 2JCXA 3S2GA 2PZLA 4KUHA 4IQGA 1MX3A 1XR3A 2Q99A 1SCUA 5F1OA 3WJAA 1C0PA 4CLEA 5A5EA 2VHYA 3ABIA 2YDYA 1B0AA 4M1QA 5JDCC 1PJ3A 5B4TA 2I9PA 1LI4A 3GY0A 1PJQA 2J5RA 1XG5A 3HNPA 4IIVA 5F21A 4BMNA 4DA9A 3PZRA 4L4XA 4IDFA 1MXHA 3KM0A 1LTHR 1UZLA 4MVJE 4BNVA 2I3AA 1OAAA 3G1TA 1WMBA 4W7HA 3OM9A 1DBVO 4BO4A 4I8XA 2DUWA 3DBHB 3D7LA 4BO2A 1C3VA 5EL0A 4BVAA 4PLHA 4PZDA 2C0CA 2WD8A 2O3TA 4QTZA 4EJ6A 4IDDA 2XXBA 1N7HA 2W4QA 1JVBA 3LT1A 4IS3A 3ZWOA 2Y0EA 1ADBA 5KJEA 5JAIA 2DPGA 3RBZA 1EBUA 4NMHA 5HWSA 1SEPA 4IJVA 4FQ8A 3VPSA 2W8ZA 2P4QA 3STHA 1DSSG 5JW6A 2DUUA 5TLSA 4YJHB 2C07A 1VL6A 4RF5A 4DBZA 3EK2A 4FFRA 4L74A 3WWZA 4KQWA 4Q3NA 4CMIB 5F1KA 3H6KA 3PLRA 3NGLA 5G0VA 5B4UA 3OBBA 4CM7A 1ZIDA 4D41A 6LDHA 1ISFA 1RKXA 1NWCA 3ROMA 4J1TA 1MC4A 4F6LA 3ETDA 3X2FA 3GEMA 3HQ4O 1AGNA 4RF2A 5TSDA 1QLJA 1R4NB 1PS0A 2YY7A 2Z5LA 1P0FA 4MKRA 1WDKA 2VZ0A 5ITWA 1QP8A 1ENOA 1JKIA 1EQ2A 3B1FA 1YOVB 3LSYA 4WUVA 3C8MA 4E0BA 4HADA 4OSOA 1FDVA 4RPJA 1EUCA 4UVEA 3OJOA 3INGA 1T2CA 4EUEA 3JCZA 4BO0A 4RVHA 1R0KA 4G65A 5H82A 5DZSA 3QVXA 3VVBA 4QECA 3ZWMA 1JA9A 3BHIA 3HE3A 3EYWA 2A94A 1U4OA 1IHYA 1ZSVA 3N7UA 4LN1A 4MDHA 2YV1A 3VPHA 5CDGA 1E0DA 4FOSA 1GQQA 4YXFA 4J1SA 1Y9EA 2YJZA 1QRRA 5H83A 2NLOA 3AI3A 4JX8A 1HSZA 4CQMA 5L40A 2Q4EA 1JWBB 1J5PA 3VZSA 3E1KA 4BNYA 1DLJA 2BGLA 1MFPA 1OFGA 1FXSA 2X0IA 3KYCB 3PIIA 1R4MB 4MIEA 1LDYA 4LRTB 2H1SA 4OQYA 1VLLA 2O3RA 4QSMA 1JVSA 1CETA 3D4PA 1P1IA 3DHEA 4UEOA 3OJLA 4LVCA 2PV7A 4IDGA 4ZHSA 2P9CA 1R4MA 2H5LA 3JQ8A 5BR7A 1SOWA 3DFUA 3H9QA 1KS9A 4M89A 1E7RA 5JAZA 1EFKA 1W8DA 1R66A 1J4AA 4FFPA 5DCYA 5T6BA 4ZRMA 4EJ0A 4JK3A 1BXGA 1AHHA 4XWYA 3TSCA 4Y98A 2ZYAA 1E92A 3O03A 4LMPA 4N54A 3JQAB 1PR9A 4MKXA 4CLHA 4HFNA 3PQEA 4EW6A 5ITVA 4RZIA 3MWDB 4L9RA 2DKNA 4FR5A 4DMLA 2O3JA 2B5VA 1XYGA 3EVTA 4TMFA 5KVCA 2H9IA 2X23A 2W90A 4CLDA 1MG0A 4IMPA 4BV9A 1SC6A 4YT4A 2BFPA 2NNLD 1KEPA 2X1HA 2YFHA 4HKTA 3E8XA 1DC5A 1ZMTA 2Q1TA 2FR1A 3WIDA 2I66A 1JAYA 4CMJA 4Z0HO 2GF2A 1X1TA 3F1LA 4YJDA 1GADO 2VRCD 1N8KA 3GEGA 4CQLA 2QRLA 3NYWA 1ID1A 1WWKA 2EKQA 5F1PA 3PI7A 1ULSA 2BHLA 5JMWA 1PJTA 2AMFA 3KO8A 3GVIA 3GVPA 4IS2A 1E7SA 4HNHA 2WM3A 3OA2A 1QR6A 3K6JA 4IJUA 1OOEA 2V7PA 1LX6A 1H0KA 4WEQA 3BHJA 4E2ZA 2X9VA 2NVUB 5JCXA 2TMGA 1NTOA 1PGPA 1ZEMA 3ASUA 3QVSA 4ZQGA 3WMXA 4JROA 4R68A 2Y1DA 2FPPA 4AJLA 1JTVA 2EWMA 1Z82A 2RHRA 5JPIA 1T2AA 1HDYA 2GASA 1HDXA 5I8ZA 1A7KA 4YRAA 2WYUA 2DBRA 3C1OA 1YL5A 4XRGA 3W4JA 3RFTA 5KVQA 3FN4A 4PG6A 1WPQA 3E9QA 5DT9A 3U9LA 5CP8A 4MOWA 1S6YA 2I65A 3K5PA 3KHUA 4PLVA 1DXYA 3ZV5A 3ZHXA 4IZIA 5CEJA 1KVRA 5A3VA 3LF1A 2VUTA 4BKQA 2GYYA 1JN0A 1ISHA 3PYMA 4OHUA 2Q2VA 5JO9A 3JQ9A 2X7HA 3G49A 2OL4A 3QLJA 3UF0A 3W4KA 3L4BC 1P9LA 2IZ1A 1NVGA 4XDYA 4PLZA 1X0XA 2CNBA 3BTOA 3CE6A 1A72A 1LEHA 4IDBA 4RORA 4TWRA 4FDAA 2ZQYA 1K5HA 3W6UA 2HUNA 1LC0A 3JQDA 1I3LA 5C3MA 4EUHA 3PWKA 1XIVA 5L7TA 1G6KA 2UDPA 1CIVA 5A02A 2QX7A 3U62A 4EYEA 4AJOA 3ADOA 3BMCA 1R37A 3AM3A 1NR1A 3H65A 1HDZA 2FR0A 3R6DA 2O7QA 4U8GA 2QYTA 4GSLA 3TL2A 3TRIA 2JCVA 2PZMA 4A5OA 4DC1A 1ZH8A 1Q0HA 4GX5A 1R0LA 2FSSA 1I10A 3BTVA 3JQGA 4B3JA 3JYOA 4F46A 2JCYA 3OMLA 4Q3BA 3UFXA 3PWZA 3EDMA 4PLYA 2FSVA 3I9LA 3TJRA 4ZQHA 4E30A 2Q1WA 3JQ9C 1NPDA 2O2YA 1WW8A 4CV3A 2DT5A 4RF4A 5DBIA 4ZGWA 4BNGA 5I9LA 3PQDA 3ZU4A 2GN4A 2VYNA 1NQOA 1YL7A 3DAPA 4ZICA 1P1HA 5EQFA 3E9MA 1E6WA 1LNQA 3DONA 1BXZA 4MVJI 4ILKA 1YDWA 4YAKA 2QRJA 4DPKA 2C7GA 4A10A 5U9CA 4WCFA 3F1KA 1RYEA 3TQHA 4ZQFA 2RH8A 3RCBA 3RROA 5U4QA 3ZHYA 4IMRA 4BNFA 1PTJA 5AVOA 1FK8A 1SNYA 2EERA 1EVJA 4FGWA 2NTVA 3JSAA 4WCFB 2VNSA 3I3OA 2O48X 1HTBA 2YQ5A 3UAGA 5T5QA 3F46A 3OEWA 3VH2A 1HT0A 3D64A 4GGPA 1P33A 5F5NA 3ZGYA 5KWEA 3S2EA 4R41A 2PNFA 4P4LA 4GKVA 1VI2A 3V2HA 3TFOA 1XU7A 3CMMA 3L6DA 4XEHA 2J3KA 4MVJG 1HZZA 4WLOA 4DIOA 2WD7A 4OH1A 3SC4A 5JMPA 3AFMA 3GGOA 1CF2O 1LA2A 3QP9A 5IDXA 1ONPA 4MKZA 3ZU5A 3KYDB 1IHXA 3TF5A 1BXKA 1DFGA 3ONFA 4NHEA 1F12A 4U0KA 4YJFB 5AQ1A 1DRWA 1EQUA 2GO1A 4NI5A 4YPOA 4JCOA 3GRPA 3O8QA 2IEDA 4I5FA 4HV4A 4WLVA 5GZ6A 4Q39A 2UYYA 3EZYA 4EITA 3RUDA 3AW9A 3V5NA 4IXTA 4PG8A 1FDWA 5IDYA 4BNWA 3ZW8A 4BV8A 1X7DA 3PYLA 1E1NA 5FF9A 5AYVA 3KZVA 4QO7A 4PLTA 2VCYA 1U7HA 3RFVA 1E7MA 5I9MA 3D3WB 1E5LA 5DNAA 2LDXA 2ZKLA 1Z74A 1SAYA 5EJ2A 1GEEA 2W2LA 4WASA 1BDMA 2EV9A 3TOXA 2X58A 4LRSB 3RC2A 3PRJA 2GDZA 3ZWCA 1MC5A 1A71A 1CYDA 4JIGA 1YQGA 2XAAA 5IN4A 2WEKA 3PHJA 1NQ5A 1XQ6A 3U4IA 4ZD6A 1U3UA 4IQ0A 4WE3A 4OIMA 1V3UA 3WB9A 1E1MA 4XD2A 1E3JA 1WAMA 4BHTA 4BGIA 3NTRA 3AY7A 1MP0A 4R5HA 3UGKA 4CLOA 3OJEA 2B4TO 1LXCA 4GWKA 2ZTUA 1N1EA 3GHYA 4MVJA 3GDFA 1KBZA 2AW5A 2Y93A 4II2A 2NU8A 1Y8QA 3A4VA 5TQVA 4ZVVA 4OXYA 2DAPA 3MZ0A 2OFPA 2Q3EA 2P5YA 3F6YA 1IY8A 5KVVA 3GAFA 5IF3A 1OC4A 4JJGA 3BMNB 3OHSX 4AJJA 3TN7A 2VYVD 4LCJA 1LDEA 1L7DA 1O9BA 1DRUA 3QWFA 2EGHA 3KXDA 1NQAO 1C1XB 5IDQA 2JFHA 3JQFA 5LDGA 2YDXA 2PTGA 4YVFA 3RJ5A 5JDIC 2GNAA 1LUAA 4YJGA 1W73A 5TJHA 4R1SA 5DDIP 3AY3A 4K9DA 4C4OA 4URFA 1IULA 3C85A 3RKRA 3WIEA 1NNUA 3KSDO 1KYQA 5KJFA 2JKVA 4OL9A 4CL8A 1P77A 3MJSA 2LDBA 3LZ6A 2BFAA 4XR4A 2HLPA 1NR7A 4YAJA 5TS3A 4RJTA 2YV3A 1PJLA 3GNQA 4OOFA 3DL2A 3LC2O 4D44A 3AUUA 4E5MA 4WLNA 1V9LA 4HUJA 5H81A 1E6UA 3DO5A 2NSDA 1Q2XA 5EN4A 5C7LO 1K6JA 2FP4A 4XIYA 2Q2QA 3TFQA 3CKYA 3JQBA 3T7CA 3QWBA 1XEAA 1O8CA 3GDGA 1FDUA 2CZCA 4RPGA 4XYLA 3GG2A 3BMQB 1X15A 3LDHA 4RDHA 1HRDA 1WNTA 3UHAA 1E3WA 3JTMA 1T25A 5TRTA 5ENVA 5L45A 1P1RA 5ENDA 1TT5B 3JV7A 4UVGA 2HDHA 3JYPA 2IXAA 3PVZA 4PVCA 3HADA 2FHSA 3R3JA 1IYZA 3EUWA 2GUGA 2DFDA 5IZCC 5CPFA 1E3WB 1Y8RB 2QYSA 3ETGA 3WBFA 1Q0QA 4BO3A 3BMQA 5IAAA 4NJMA 3GMDA 4ESOA 3ZCXA 3ANMA 1LRKA 3O38A 3VPGA 4IQ8A 1Z6ZA 3V1YA 3M2TA 3NX4A 3SC6A 4CMEA 1G1AA 4FFOA 3H9UA 3DAGA 4ZN6A 1ISMA 1PL7A 1GV0A 2VOEA 1XWFA 1ZJZA 3ROKA 1I2ZA 1M67A 5HS6A 1VSUA 1N5DA 4G5HA 3U4DA 1Y1PA 3C1AA 2NU6A 1KVTA 4ND1A 4RPLA 4W7IA 1LBEA 1NWHA 3IP3A 1PJBA 4PRKA 4YB8A 2HJRA 1KVUA 4GX2A 2WMDA 1XGKA 3K96A 2O4UX 2EGGA 3MOGA 2WE7A 4R54A 3ICPA 4UREA 4CMGA 3DHYA 3TZCA 1C0KA 1BMDA 4CL3A 5EESA 2PK3A 1HDCA 4E5YA 2NQ8A 2IE0A 4YJGB 4Z9XA 3ZDFA 4BQPA 3H5AA 5JFOA 1K3TA 4NBRA 4BGEA 3WTBA 4XQEA 5HM8A 3U0BA 4NBUA 4HBGA 1B26A 4E2WA 1PGQA 1SB9A 2B37A 4UEJA 4RVFA 4IGEA 3DBRA 4TKLA 3VH1A 3LC7O 3H7AA 5KOIA 2AEFA 3S2FA 5IZCA 3OQ1A 1B3BA 3HHPA 1Y5RA 3RASA 1SPXA 1T24A 3PJEA 1NAHA 2GN9A 4XYBA 3U49A 4JBIA 3ZZNA 2GSDA 5LDHA 5DULA 4XJTA 4CLOB 4JJIA 1D1TA 5FFFA 5COBA 2I6TA 1ADCA 5IZ4A 3ZWBA 1JQBA 3VH4A 4RQTA 1GU7A 3A28A 3OIFA 3RIHA 4CMBA 3R3SA 3M6IA 1XHLA 4HP8A 5L9AA 4ALLA 1XCBA 2CVZA 4TRRA 3NV9A 4IDCA 4R5MA 3BAZA 1VKNA 3SLKA 2JFGA 1E5QA 1I2BA 1O95A 3AU8A 4Q9NA 2EHDA 2ZB3A 4P38A 1HE3A 3DZKA 3OIDA 2ZTMA 4R9RA 1ENPA 1ZXBA 2ILTA 1TB4A 3EY4A 3RKUA 1Z75A 3Q0EA 1DJNA 2D4AA 5TT1A 3Q11A 1BXGB 5K0ZA 3I9OA 3OJFA 5BSEA 2OXIA 4BO8A 5I7VA 4FB5A 3PK0A 1TT5A 3WGZA 3U5TA 4XRRA 3HDJA 4J9UE 3PQFA 3QRWA 2YQ4A 4A26A 3AY6A 1ADGA 3VHRA 4I9NA 2Q1UA 4DIFA 3QHAA 1N7GA 1PZEA 4PVDA 4CM8B 4Z6KA 2HMWA 4A73A 4D3DA 3VZQA 3PTZA 1M75A 2DBQA 4CR7A 3DB2A 3NAQA 1CERA 3JQ7A 2GGSA 4E33A 2PH3A 3UCXA 1U1IA 2EJVA 4B4VA 1WP4A 4DIBA 2C5AA 3GA0A 5FEUA 4NNJA 1P3DA 1PGJA 1HLDA 3AM4A 3RUIA 1ISJA 4B79A 3PEFA 4PGFA 1Z45A 4CM3A 1MB4A 3WFJA 5JO0A 3QSGA 3M2PA 5CAEA 5HTOA 1YKFA 3HWRA 3IJPA 3UXYA 1QXSA 3JYLA 2DU8A 2P5UA 3WJ7A 2F00A 4IM7A 1UP4A 2JD1A 4J4HA 3ZH2A 3RUHA 3PWSA 5HS4A 1JLLA 2AG8A 1XQ1A 3PYXA 4AJPA 4PN3A 1FDTA 4BO6A 5FWNA 3D5QA 2J5QA 3KEQA 5LC1A 3F5QA 3FR8A 4CQMD 4B8WA 3D1LA 3Q9UA 2QZZA 3E5RA 4BMSA 1NM5A 2IXBA 3WBBA 4DVJA 3WFIA 4QXMA 4UEKA 3FSRA 1H6BA 2OMEA 2VT2A 2BI8A 4BO7A 5F5LA 2IYOA 4XQ9A 2JD2A 3WDSA 4BO1A 5KTKA 1DO8A 5ICSA 4Z3DA 2EXXA 4K6FA 3JD2A 4B7UA 3WNVA 3DFZA 2EP7A 3MJTA 2FZWA 4K26A 2E48A 5A1TA 1CDOA 4D0RA 2OORA 1GUFA 1MUUA 2BGKA 2X86A 1PWZA 5TC4A 4CV1A 2D5CA 3I4CA 2Y1CA 1ZK2A 2R2GA 4ID9A 4MP6A 4WGGA 2EP5A 4ALKA 5A9SB 2DC1A 5BQFA 4N7RA 4HNGA 3DHNA 3FTPA 4RCVA 4NBTA 1HF3A 3V1TC 1B8VA 3F47A 5AXCA 4BGVA 4W9NC 5DOVA 1UJMA 3I6QA 3T4EA 3WMWA 1Y9AA 2NWQA 4WNCA 2E82A 5LCXA 1O6ZA 2OHXA 2VWGA 4M86A 3GFGA 2VHZA 4XYGA 4UUPA 1HLPA 1GPDG 1D7OA 1G0NA 3AI1A 4IXWA 3T4XA 4CPDA 1GV1A 4LK3A 3EGOA 4RF3A 3BTSA 1OBFO 2QZ9A 3CTMA 3UKOA 1HDGO 4K1LA 5EIOA 4B4OA 2I3GA 3C3XA 3HN7A 5L4NA 1JDJA 1UXJA 2Y1GA 1UAYA 2VRCA 3KBOA 4DTIA 1ENZA 3H2SA 3KRTA 3NT2A 5U1PA 4BNUA 3IL2A 1AXEA 2WWRA 1GUZA 2WE8A 3EMKA 4L4RA 3EW7A 4IDEA 1KY4A 1D1SA 1J49A 3MCVA 2DBVO 2CMDA 3DXFA 1U3VA 2IYPA 1YB1A 1V3VA 2WDZA 2R00C 3BHMA 1HL3A 3A06A 1GDHA 2D3TA 1IOLA 3FCOA 5L53A 4D45A 1EEHA 1P0CA 4TKMA 3WYBA 4XQGA 3EHEA 4RPHA 4PZEA 1QORA 1Y8RA 3I9MA 3DC2A 4OKIA 4NQZA 3GZNB 1E3LA 1E7WA 1EVYA 3MEQA 4FGSA 2FZEA 1R6DA 4B3IA 4XR9A 3WYEA 1AXGA 3QVWA 4YT2A 3WG9A 1U2GA 1NVMB 1KERA 3GZ4A 4WKGA 2B36A 2YHIB 4D43A 3ZNOA 1HYGA 1VM6A 1ZZEA 5DBFA 1LDGA 3B1JA 1NQTA 1ZO8A 5EMHA 2HK8A 3RAJA 3LQFA 2CDCA 2QG4A 2ET6A 2V6MA 4QO8A 1BDBA 4MVJP 1H5QA 2FN7A 1YS4A 1SMKA 4QX6A 1I5RA 3SLGA 5DCUA 1XSEA 3WS7A 4LGVA 1XDWA 2JFFA 4A2CA 4XB2A 5DCWA 1DDOA 3GDOA 1CJCA 1H2BA 1YL6A 4BL5A 3OEYA 1BVUA 3SEFA 2X5KO 5TJ9A 2UUOA 4D0SA 1O5IA 4Q3EA 2PKRA 4KTTE 2XF8A 4GL4A 4BNIA 3MJEA 3ZV6A 3AOEC 4NFHA 4BB5A 5JCJA 3C24A 5T57A 1IZ0A 5T8KC 1PZFA 3HDYA 2OGUA 3FRJA 3GPIA 3SVTA 2CVQA 5DF1A 5ADHA 5BNFA 4HXYA 1CEQA 3GUYA 5IDWA 3RD5A 2HO5A 2IZ0A 3ONEA 2WTBA 4M87A 3FD8A 2O4CA 2IODA 3U09A 1JKJA 4BNLA 2YW9A 1K0UA 1ZK3A 2OBYA 1PQPA 4R3NA 3D0OA 2NTNA 2ZQZA 3PHGA 2UV8A 3PFFA 3QWAA 3NJ8A 3PGXA 3AOEA 2VWPA 3KOUA 1TT7A 1H94A 2VZ8A 1UXGA 2Y99A 4II3A 4A0SA 3F4LA 1TLTA 5COAA 4FC7A 4ZQEA 1DJQA 2NQTA 3GC6A 4AJIA 5ER6A 2J3HA 3RVDA 1R15A 3DTYA 1VJ0A 4DGSA 2WYWA 3BA1A 1U8FO 2R6JA 5CDYA 3IQDB 2B5WA 3JQ8B 1Y5MA 4BNNA 2XPCA 2ZJ0A 2C20A 4LVUA 4Y9DA 3WYCA 1I30A 3DQPA 4BNMA 3MJVA 4TZTA 5A06A 2PKQO 2G76A 4KQXA 4LISA 1PJ2A 1EMDA 4JJFA 4RVDA 1GAEO 2BRUA 5IG2A 1UXIA 4BO5A 3GK3A 3DEYX 4FW8A 1AE1A 3D4OA 3NT4A 4ND2A 2RAFA 2JAHA 2YZ7A 1QYXA 1I3NA 4HFRA
chains in the Genus database with same CATH superfamily
1WXHA 4RZHA 3RJ9A 1MEOA 2DT8A 1C1DB 4OF4A 2P8JA 5AVWA 1W2WB 5I47A 3H8WA 1YK0A 3JD1A 4EW3A 2R1UA 4XJSA 3UXMA 3T5MA 1DT5A 3L7MA 3QXGA 4R9SA 2O1SA 3U0VA 2ZZKA 5EHXA 1L8QA 2B5OA 3R76A 4DBVO 5ES3A 1H1DA 3FUUA 2GXAA 3DMTA 3H5TA 3I92A 4WKNA 4K0KB 3OTHA 5FR2A 5BW5A 4KU4A 5L7WA 5LQRA 5A5DA 3FZNA 2H2DA 1B74A 1KC3A 2EKPA 3BWVA 4KQ1A 4XAQA 4AYXA 3RU7A 2H9YA 2QB5A 4B8ZA 1XRSB 3A9UA 1NUHA 3TIGA 2OBBA 4E51A 5A6VA 3F6SA 4IDAA 1RI2A 1ESCA 1TVEA 1Y42X 1NUAA 4TSKA 4BMPB 1EG7A 2VJDA 3H86A 1ULHA 3SJ7A 3UJNA 2WZCA 3L7YA 4CF7A 1NMXA 3ZHZA 2GOYA 2HF2A 2QTRA 3WGLA 2WF9A 5LMUB 1U0FA 2RGNA 3VU9B 1CDDA 4BEBA 3SU8A 1IEVA 4FU0A 2FEKA 3GT7A 4Q6WA 2WSMA 2D7CA 3SCZA 3SEQA 2RC6A 3RC8A 1IZ9A 2J31A 4BEVA 4O5OA 1W34A 2E89A 3GUCA 4NBWA 4NQRA 4UVDA 3QY0A 2G06A 3QTTA 2G0TA 3ASVA 2C61A 3EFBA 2C0PA 4MUJA 4RGQA 3OKPA 4M9SA 2C1ZA 1YXMA 2QSYA 3B6EA 2AJ8A 2IOHA 4DYDA 2W2KB 3TIFA 2F1KA 3KQQA 4GH5A 4GOOD 1RM0A 2FR8A 2WF5A 3HM2A 4EHLA 3O2JA 2EFCB 2H07A 2B1IA 4ML3A 2XYQA 3BDIA 3RHSA 5AUPB 1XCPA 4X3OA 4YQFA 1MJNA 1O54A 1T5BA 2PYIA 2W2KA 1PEDA 4E5SA 2PO5A 4Q9HA 3EIXA 4TL6A 4YV1A 5INTA 2I4NA 2NADA 3OZ7A 5DYIA 3ZWNA 2A78A 3KDSE 2AG1A 3VOSA 1L5OA 1QUEA 2HXGA 4NHOA 4ETIA 2VWQA 3IQFA 3PWTA 4JP2A 4ALNA 3BBPA 1CQIB 4HL6A 4QDOA 5FWXA 1F7VA 4AG6A 4XDZA 1GLVA 1R4NA 5IXYA 1CUFA 2FXVA 4CM4B 3DGFC 1FYFA 1YQXA 3IAXA 4XKJA 1Y7TA 4GQBA 5T4BA 3GRUA 3KOOA 3HACA 5CJPA 4Z4QA 3HRIA 1GU1A 4I8IA 4MSUA 4FFVA 3R5FA 1FMTA 2V97A 3DDSA 1TTHA 1ZH0A 2ZJYA 3JU3A 4FGZA 3HR7A 4BJHB 4IIUA 5LBTA 3FHLA 3K1AA 2VNIA 3QJGA 1AMNA 3LPLA 3UJPA 2OEPA 3B8HA 1TYCA 1XC7A 3DBRB 3DHVA 3IQEA 3KEGA 3KT0A 3ONNA 5CXXA 4YPFA 4P86A 1XMJA 1YZYA 2EFJA 4KVZA 1MO2A 2BWJA 1E2UA 2WJVA 1LU9A 1DFIA 2PVPA 3H9GA 4F4CA 1WF6A 4DNQA 2QTFA 4DEXA 4LI0A 1AY0A 1BWPA 1WDWB 4OPMA 3R7WA 3KPUA 2X9NA 3X1JA 4A6DA 5CBPB 2ZCUA 1Q0LA 1M6EX 4H18A 4RTSA 3UOGA 1LW6E 4BWYA 5JU6A 3IQIX 3DJYA 2VJKA 1WRBA 3R74A 1C7RA 1M2OA 5CLQA 2W6NA 1I9CA 1OHHA 3CBGA 1EXWA 3C1UA 3GJSA 4FGLA 4HGRA 4MQLA 2W8BA 5C37A 3G1WA 5F2NA 3O8CA 2RCYA 4CM9D 1X1CA 2W6QA 1NE7A 5A2QA 1GD1O 2H2GA 1KOLA 3ER9A 4CKCA 5A9RA 3BXGA 5HKOA 1V7ZA 4UUBA 4F4UA 1IB6A 2DBYA 2G72A 3AHJA 3ETEA 3IMKA 3F49S 4GOLD 1E5VA 4C43A 5ELMA 5F7XA 4IH1A 5AD1A 2O8DB 4RGYA 3J81k 4FIDA 4BVLA 2C2WA 1D2MA 3EIOA 3EF1A 4YASA 4ZZ1A 4GPTA 3AJDA 4FPXA 3DMPA 5BSWA 2V9ZA 2HJSA 1TGYA 2OO5A 2IRWA 1P62B 5FP0A 1JKFA 1FVFA 3L8HA 2PYDA 1KO7A 4X1KB 4TRNA 1T1IA 5JYEA 3WQRA 4PZUA 3KYBA 1PZMA 4BQSA 2PT7A 3CPSA 1YS1X 2J0UA 3FNBA 4IF4A 4RIFA 3NHAA 4MJLA 4BCBA 1Q21A 1EX7A 1OB2A 3DLTA 4QIHA 2P2SA 1P7PA 4YECA 2A58A 4S1NA 1JG7A 4YAOA 4NLLA 3CH7A 2IOFA 2NVWA 4AJ2A 5CDTA 2WUWE 2RHHA 3M6WA 3UICA 1AH2A 2OXRA 1XZCA 3WLEA 3P20A 2FZ5A 1RJEA 3HN6A 3K0FA 4RUKA 3SDZA 4HAYA 4IV0A 4J0JA 3L46A 3R7FA 3T1HB 3THXB 3DE3X 2DLNA 4XA8A 3R7BA 2VPZA 5JJKA 2D3WA 3FBGA 4KUEA 4XVRA 1Z4IA 3WVNA 3HSYA 4MGZR 4DPLA 3EPKA 1V9CA 1C7FA 1IMOA 3IA7A 2XHEA 1AOXA 3I4LA 2AN9A 3GB9A 1HKHA 2PSSA 2HKIA 2QN8A 3I9JA 2QAJA 3TX2A 3LXMA 5E6SA 2B69A 3IT1A 4L50A 4MIYA 3VTZA 4BP1A 2E85A 4QEZA 2A92A 3PQ2A 3R24A 2BGRA 3OETA 5L4LA 2LVBA 2XYVA 1IG3A 1P45A 2ZRQA 4BMZA 2RBKA 3T5BA 1NJGA 4MYUA 2IPNA 1XP5A 2OYSA 2WM8A 5LZ9A 3SC3A 3O8NA 4A5SA 4C87A 1UK9A 3F5MA 3CPHA 3QITA 4XCXA 3UYKA 3D6VA 2J32A 4P35A 1Q0ZA 3RS9A 2VDJA 1ZNXA 4CF3A 1RQLA 1TIBA 1DO2A 5F76A 4EDFA 1F3OA 3HJUA 1E3IA 4MV5A 4QDUA 2C00A 4D4HA 3EGWA 3TLXA 5JFTA 3SR4A 5IF9A 2ORED 1BWQA 2Q6OA 4HZIA 4BZZA 3S2SA 2R6AA 2AA3A 5A71A 4XGKA 2LCIA 2X5NA 2ZITA 3HYNA 4GGOA 5ALXA 1L5GB 4EOGA 3HFGA 3EOBI 2D8AA 2P4EA 2XMSA 4OFWA 4Y6OA 3RAPR 4UNSA 4AJHA 1XU4A 3QE2A 4QXQA 3M4ZA 5JSHA 3HFJA 2P1RA 1N2SA 2YC2C 5HE9A 5KSWB 2YY6A 3GAZA 1NBMD 3MTGA 1X13A 2EGUA 4MUYA 1MPXA 3KJQA 4FBMA 5T8KA 3SICE 1L5RA 1RABA 1ZIYA 2ZS7A 3UK6A 4N9WA 4XIFA 2Z5FA 1UWKA 4WK6A 1FFAA 4PQYA 1YDHA 2XJ9A 4PIPA 1QU2A 1ZUWA 1DJMA 1PHRA 3DZHA 1ZM2A 1GXSA 1ONNA 4DWOA 1WDLA 2J59A 1V7QA 4BIIA 3LO8A 2P2ZA 4OGFA 2O05A 4O3MA 2B1QA 1EBFA 1R7RA 1XZIA 4JEMA 2YNMC 1R00A 3DAFA 3K9QO 4UUAA 4IJWA 3UJDA 1QX3A 2WUGA 1L5HA 1F2UA 3O3NB 5FI3A 3SF8A 1TC2A 2FSPA 4Y3UA 4ACAA 4BFSA 1ZI9A 3A9SA 4RGBA 4M55A 2BIFA 2PEYA 2ZZMA 1N5JA 3ADCA 3VAZA 1VP9A 2JGLA 3E22B 4LA4A 3SJUA 3LL4A 5L6MB 4BV3A 4R1QA 4TM8A 5F9HA 1KJ9A 1RE0A 2IHBA 1C2TA 1EP1B 2B82A 1PJ4A 2Z08A 3A6EA 3HB4X 3T7EA 3ZW7A 5IYZB 3WP0A 1GL3A 4PF1A 1VSTA 2OXTA 2JS7A 1D6NA 1Z13A 4Y2QA 1WUHS 3HB1A 2YIJA 2B35A 4K8OA 4AQYB 1H3EA 1MPTA 2G9VA 3HDGA 4X6LA 4CG1A 5A62A 4RVNA 3OTQA 2QY6A 3OKFA 4L4SA 4TQ9A 4XYMA 4WH0A 4TV8B 1XWWA 3Q10A 3P4XA 1O77A 4JJZA 3GLHB 3ZXSA 2W2MA 4CEIA 4HG2A 4D9BA 3IB6A 1ZOLA 2PUJA 3EAFA 3GHHA 3GNTA 2P40A 5JQWA 1C7QA 1O5OA 2ZYDA 3ANNA 4X62B 1UDBA 1BE8A 1ESEA 1ES9A 1YHZA 1YBMA 3AU9A 4OXKA 5SYAA 3TPFA 5KU1A 1AS0A 2X5JO 4I1PA 2NPIA 5G3YA 2PGDA 1ZD3A 4Q16A 2PU7A 5CJJA 4EMBA 3GR6A 2HLDD 1PGNA 4MW9A 2EW2A 2FKNA 4I50B 4YDQA 1W6UA 3DMYA 3P7MA 2AQKA 1LZKA 1Z8HA 2VUSA 5BMOA 1ONOA 2L18A 2XQJA 3KWJA 1B7GO 2D5LA 3C3BA 3DBVO 5K9ZA 3G79A 4OLBA 5HRUA 4ZU3A 2WA2A 3G2HA 4JS0A 4N01A 2B3DA 1L4KA 1DKUA 1G5HA 1KIFA 3JQFC 5TX7A 3EODA 3WHLA 1UJ2A 2WYHA 4RK0A 1GSOA 3NDIA 5DHFA 3RQSA 3RV4A 3PHLA 4MR7B 3VR1A 1WVGA 3N8KA 1OI7A 4O4JF 3T1YB 1W0CA 4IO1A 4O33A 4CKBA 1EWKA 3GXBA 4ESHA 4MS4A 2BFBA 4X00A 3T35A 3S8YA 3JASB 2C88A 3W0LB 5CX1B 1VA5A 2ODAA 2J5KA 2VHEA 2PL1A 4YUAA 1YU9A 5K6RA 4MI9A 3W7BA 4Q1FA 3BB3A 5JXGA 3U4MA 1J1UA 3L5KA 2YR0A 1FUUA 1KO5A 1QGUB 1T4MA 3UA3A 5EWJA 4YHHB 3RSOA 3UWOA 1GVHA 1YQDA 3G0HA 5LKRA 4JHLA 2OXFA 1G1MA 1TEHA 1TAQA 3LK7A 3VSAA 4CIDA 4CIWA 4DBLC 5KQLA 1LJUA 5TQ2B 2WUFA 2CY0A 3EBPA 1LC3A 3ANYB 4KMOA 5DBGA 3TZHA 3WRYC 1BGWA 3IMCA 4JJ6A 4J2HA 4Y9RA 3RRXA 1ISGA 1ZCFA 3LSTA 5REQB 1K6IA 1K98A 2ZG6A 3ZIDA 2E0IA 3LUCA 3HGQA 2QAGC 3ANXA 1YZNA 4LHVA 1YRHA 3GRYA 2RIRA 3IQWA 3EGDA 3KOZA 4ITVA 1U0LA 4S12A 5F2EA 3ZDEA 3EW9A 3EUAA 3PC2A 2QXUA 1M8FA 1UFKA 4LQLA 4C5BA 2VT3A 2XMPA 4MPDA 3E18A 2YXLA 3L7IA 1W88B 4U7TB 3WJ2A 3ZC3A 1CS4C 1RRPA 2WABA 3PUWA 3LDUA 1GFSA 1HEUA 1WZNA 3BZUA 4M0DA 5KZMB 3M9XA 4TTTS 3W5DA 4HZUB 1BEUB 1VLVA 3LLSA 4R3UC 4BLSA 2G04A 4F92B 2JG3A 4FMDF 2VBCA 1V47A 3K8OE 5DHRA 4I5EA 3V6LA 4N5HX 3MJRA 1QK4A 3RTDA 3ILHA 2GJSA 1XZPA 5EUBA 1H42A 3RRZA 5BP7A 5A7FA 1GZ5A 4KWHA 5TPWA 2E6UX 1VLMA 1R9MA 2BISA 2JFWA 1CCWA 2VBGA 1K2WA 3ZU2A 4UNQA 5MN4A 3RLIA 4OLFA 1U9CA 3QLEA 3ZY5A 3DMHA 4NYMR 1JF8A 1HNNA 4MUBA 4TQUS 2Q5LA 3WKEA 2WU0A 4FMPA 5FAXA 1I33A 1KK0A 2BMEA 1W59A 5HKLA 5JHGB 4Q21A 4AWAA 4OUDB 3SSNA 3VKFA 1KRWA 3AEKB 1L5QA 1J8DA 3BDAA 5HA5A 1CUUA 3FPHA 3ZJ4A 4MR7A 2H7CA 2PX4A 4R01A 4PFSA 2XMGA 1N3YA 3LP5A 3AUSA 1BW9A 1M6NA 2PZKA 3VR5H 3W05A 1XZHA 4PANA 1PJZA 3RC1A 4AO6A 4XSGA 3RT7A 3QF7A 4LNHA 2RDMA 1RZRD 3TMAA 1NUSA 2OSVA 5FYQA 3CYFA 5CCDA 4IW3B 5L3ZA 4O1MA 3KQYA 2C95A 2VP3A 3MVEA 1FFDA 4QJIA 2ZAOA 2IEZA 3HEBA 4PG4A 1VHQA 1BQ4A 1JJAA 1HE5A 1OX4A 2D2XA 3HZZA 1KJIA 4IAOA 1FS4A 2GZ3A 1G8JA 3SEAA 2PH5A 1YMVA 4A6EA 2GLXA 4WBNF 4JNKA 2VNAA 2NUTA 4K9MA 4ZZIA 3QBVA 1Y1RA 4BOYA 1OSNA 3RLFA 5AM1A 3HCFA 3TLBA 3REFA 4CR8A 1H6DA 1LWNA 2AEJA 4FWBA 1MFZA 4GIBA 4MS1A 1BVYF 3RRMA 5HIJA 2XYRA 3ZHVA 5CXUA 4CKCB 1PFKA 3VZPA 3Q98A 3ZLUA 4TV9A 5DCLA 3JVUA 1IAQA 2IHTA 5BSVA 2FPGA 1MA0A 2A3NA 4W8OA 3PNSA 5I7FA 4DA4A 1LRJA 1HE2A 2NYRA 4CG3A 4I1IA 4KZPA 4MCJA 4C29A 1WLYA 3H11A 1SBYA 5HXAA 3U6BA 1RWVA 4BMYA 2P4HX 2X19A 1UUFA 1C4KA 1LX7A 3A04A 4MQUA 4QELA 1R64A 2IYUA 2P9TA 4ZOLB 3EEBA 2BFCA 4L9SA 3O75A 4MUKA 1OI3A 1K6XA 3OD1A 3QBJA 4YA6A 4K87A 4FONA 5FTJA 1Y7LA 2TS1A 3C98A 1AS3A 1MKYA 5G4LA 1I2CA 4IINA 2Q8NA 2P6UA 3C7CB 2YFQA 2Y0DA 3DDWA 3PD7A 5JALA 3OZDA 1T1JA 2CF5A 2LKDA 1WVMA 2CBZA 2OO5C 3JRWA 4E22A 4RTQA 3TR6A 2D1SA 3AUJB 3I8OA 4BKRA 2YXNA 4BBAA 1OJLA 3COZA 1JR2A 2YUIA 2EJBA 4UUQA 4LC9A 4UE2A 4WPGA 2IYXA 5DJ5A 1DAHA 3AM5A 3G9QA 3K6KA 3MS2A 4E15A 1J99A 5LU9A 1H9AA 4Q48A 4G63A 3NRCA 4F8YA 2PFKA 1E8MA 1C0LA 3WGHA 4ZYZA 1R0CA 5H70A 2BFMA 1GYQA 2VWHA 3GLHA 4IZ6A 4ZGGA 1E1RD 1X2EA 3Q15C 3QVUA 2H6EA 4QEDA 2EJTA 1JBKA 1NMEA 2F8MA 1QIIA 1UZAA 1SBQA 3KZ1E 3OE5A 1FVHA 4QFCA 4CF6A 1Z8DA 1ZN8A 1U2DA 1DB3A 1G8PA 1U9YA 2FLWA 2BMDA 2XY4A 1L4GA 3A58B 1RC1A 5IYZF 5SZHB 4DLWA 1E77A 2EDAA 4TMXA 1M66A 3V1LA 3CO0S 2DKFA 4GI1A 5DE3A 1GWNA 2UZ1A 3GLKA 3C4VA 4ONEA 4IIYA 5DMXA 1WETA 2GHTA 4J0CA 3FMPB 1OH7A 3BWCA 3NIDB 1ZR2A 3NG1A 2XEDA 3G59A 1HE1C 3UG6A 2FW1A 4EF5A 3CSDA 4NE7A 2Q3MA 3KLMX 1SM4A 5F1YA 3BD9A 3T7TA 3PDCA 4RFSA 4NBVA 3W90A 1EP9A 1GPUA 3AONB 4J3NA 4YBRA 2WHYA 3JQAD 1NT2A 4G2TA 2IITA 2IHUA 4HGYA 2OQVA 3MGBA 3I5YA 4NXMB 2V9CA 3HMQA 1WSWA 2VQ3A 4O8CA 2O2SA 3TSWA 4B48A 4DLYA 4MS3B 4I55A 1H9CA 3BE4A 4HH4A 2HA2A 5EWLB 4J0DA 4NPAA 9ATCA 3OF2A 2BBSA 2W0MA 1QRTA 3BT7A 2FGKA 1A7UA 4CIYA 3BG5A 4RD4A 3WRVA 1QFZA 1Q91A 1H2FA 1H93A 5G4KA 4DQUA 3LC1O 2CSXA 1NN5A 2ZYGA 3PR3A 4GI5A 5HTKA 2IZZA 1T91A 4YYZA 1D8TA 2BHRA 2ZSJA 2G4LA 1JQ5A 3LBIA 4JN6B 3ZNPA 4JOBA 3EG5A 3H1PA 4J0QA 1YS2X 5AK6A 3W5BA 1XPUA 2AJCA 2DFVA 2QRVB 4BKPA 2TYSB 4EB0A 4GMDA 2BTOA 1W30A 5T4FA 2I22A 2GVZC 4V0LA 5BUSA 2VYFA 2O20A 3N1UA 4K3VA 1JH8A 2DBZA 5DNCA 3ITNA 1BKYA 3H7IA 1R0ZA 4KZKA 5H9VA 4YT5A 2BMWA 5DNUA 4A6XA 1N9GB 3I62A 1V5EA 4GVLA 2WWXA 4QDXA 4MLPA 2FWRA 5ALLA 4Z9FA 1V1MA 3EIHA 1T4CA 3FSGD 1J1ZA 1MXFA 3DD5A 2XE7A 3QNMA 2JFXA 1YH3A 1ZGHA 2ZSKA 4YJ3A 2DLDA 2X7XA 4GGMX 1VLZA 2WVJA 1M7HA 2C3PA 3QU5A 5H5JA 1G291 4E14A 2VH1A 1ZH4A 4TLAA 1DMRA 4C6SA 2X14A 3DQQA 1DNPA 4V03A 4TZ6A 2GESA 3ENNA 1IK4A 2AC2A 3GRRA 3L02A 3X1WA 4FOOA 4KP7A 2LIPA 1JEQA 1U65A 4R2XA 5KDLA 1EGQA 1T6NA 3RRJA 5LQCA 1TAUA 4IIJA 1MJ5A 1IOWA 3WK7A 1G8KA 4WFJA 5DYNA 1XTVA 1PU2A 3QMVA 2XKBA 1EWTA 5F9MA 3GEDA 2I87A 1ZK4A 2XGGA 4G2NA 3IFSA 4AROA 4EY7A 2IY8A 1WKVA 3A6PC 2Y1OA 1SUPA 3B60A 3EAGA 2JEYA 2OZLB 3JD3A 5KYUA 5DSZA 4P58A 3SHWA 3VHLB 2ACEA 1GPBA 2WJ6A 3QVGA 4QNNA 3QFRA 4B3TB 3FNFA 4IXMA 1TQ2A 3B82A 2H63A 1P4GA 4RWEA 2ZTLA 4BN4A 3R6TA 4DQDA 1OBVA 1MT0A 5BUQA 2A9OA 3I3SR 5EP2A 1E79D 5F3DA 4WLFA 4J3JA 1HMPA 1EE1A 1M6VB 1TO6A 2BBTA 2JCSA 4JU9A 4WDQA 4XW2A 3ENQA 4R9VA 2IWHA 4HD8A 4FZJA 4Z0NA 4URVR 1LPAB 1K63A 2ODBA 3NZEA 5JMTA 1LVGA 1SEVA 3SSOA 4ZC1A 4GSKA 4EHKA 1O6BA 4MVCA 2AL7A 3V2GA 4E4TA 2YZKA 2PZ8A 2HMVA 1EKXA 2D59A 2IYRA 4OI2A 3UAWA 1TCUA 1SA0A 5JNWA 5DBOA 2Y3IA 3CZRA 3OICA 3BFXA 3JZAA 5JXJA 4JC8A 4WVFA 4DV3B 1KEEB 2EBUA 3TI7A 4L4YA 2PH1A 1MO4A 2YWHA 1WO8A 4OL0A 1KAHA 2D4HA 2P75A 1I3OA 1SBHA 1FUYB 2OCYC 3HCEA 2J09A 2F3TA 4GYYA 2OLJA 4V02A 2NU9A 1IXYA 5AT1A 4Y6SA 5E3HA 4Q01A 4TVOA 4ZA2A 4DVGA 1Z07A 4RK5A 5JRDS 2II6A 1FLNA 1JAZA 1MAAA 4R2IA 2PKQP 4XIJA 4H3HB 5GMOA 2VP5A 3WJ1A 3TI9A 4C78A 2GRAA 2DSNA 1MJGM 2W2XA 1MLDA 4OKNA 5JLAA 3FTCA 4RKRA 3ZUPA 2O6LA 5C1DA 2D62A 2GXQA 5PNTA 3WISA 1BN6A 2ZSEA 4KXFB 2JI7A 4FI3C 4FJ0A 5G1OA 3LT4A 1C81A 5ILGA 3OWHA 13PKA 3NHUA 1ETUA 1IB0A 3WAKA 1B23P 1UH5A 4XASA 1MX1A 2RGBA 4UC0A 2VP9A 4QOFA 4TTRA 3NO4A 4IPTA 3CCCA 1IHPA 1OWPA 1XNHA 2C03A 3TOZA 3N07A 1QR2A 2PGJA 4GMGA 4V0NA 2FOIA 1SIWA 1AIPA 1OX6A 3B51X 2IP4A 4I81A 3A3PA 2PMWB 3B13B 5AI6A 1K5PA 4BLVA 4W5JA 4MYCA 2XNSA 3BB4A 3LUKA 3S55A 1AA9A 4CQJA 4IFTA 4J7UA 3Q5GA 4OAQA 5CGQB 4K9PA 3WSWA 2BHSA 3P2YA 1UBRS 2NSLA 2PD3A 4D74A 4ZYUA 4U7WA 3NT5A 5ETJA 1U3TA 4YAGA 3L4BA 1GPAA 4CM9A 2WD7B 4CT4B 4ZT7A 1E9AA 1R9GA 1VLJA 2O3UA 2X76A 4KH1A 1LSSA 1YHYA 4RQUA 4ZPJA 4B4UA 8MHTA 2VDVE 4KLCA 3QXCA 4L22A 1I4DD 4DOMA 2DWQA 2GX6A 1QONA 1K68A 1UDCA 1V6AA 4JLWA 3DAOA 4IG9A 2H0AA 5TPZA 4Q7KA 3SJZA 4D8UA 1PVOA 2ZB2A 5HEKA 4HPXB 2QTWB 4L4ZA 3IO3A 7GPBA 1JDSA 1QG6A 1K92A 4QGBA 1W94A 3NP7A 3RF6A 4F1KA 4MVJM 1QAOA 1ESZA 3CZPA 1IU9A 4E7PA 4Y6GB 2OP1A 1NY6A 4KBGA 4W6ZA 1HSOA 3Q7PA 4U6NA 3UN1A 2BTEA 1O96A 2D2IA 4ZOQI 3IE1A 1H4QA 4EHAA 3NALA 1T9GR 1X1RA 3ONDA 1BFUA 4UU7A 4ATNA 2BFDB 3OE1A 1KQNA 4AMZA 1P1KA 3C45A 3MMPA 5I7EA 2W6IA 1PZHA 3NHYA 4NEGA 4P4SB 3V48A 3IEUA 1ULAA 1CEXA 2DQ4A 4HATA 4EA7A 3K9BA 2CL6X 1GG5A 4HDSB 4IVPA 3PQ4A 3I28A 1BVRA 3VGPA 1NASA 1TA4A 2JJ1D 1L7BA 3FNQA 3FF4A 2JAXA 4IRXA 3N39C 1NYRA 2PZAA 1NV9A 2GJAA 1Z0FA 1BCSA 5L3QB 3R3WA 3FHCB 2GBCA 2O50A 2QD2A 2B3TA 1EDZA 2EJUA 3DFKA 4A8JC 3D7NA 3JWEA 2RH4A 3K16A 3LJKA 4H3VA 4QPJC 4L73A 1QYDA 1P7WA 1PL8A 4TWBA 5G4KB 4MWCA 5KYYA 2ZUVA 1OFVA 4RABA 3OQIB 5D3ZA 3PCXA 2P6NA 2GCIA 1C9KA 1HUQA 2QSZA 4FYKA 2A35A 4G1BA 2IYQA 4LBWA 5D6NA 2E49A 4OSPA 2V7GA 3DV0B 4GX1A 4M9CA 1XHEA 2HMTA 1GCUA 2DTEA 1R16A 1PWYE 1VHWA 2HA6A 1EFDN 3JZMA 2MMGA 4ZRNA 4P1ZA 5IK2D 4IV5A 3GYGA 4EB3A 1Q15A 1ABEA 4JA2A 2XXJA 4KE7A 3ZKAA 2PJRA 1RD4A 1K7FB 1Y0BA 2BOVA 2PXXA 4LI3X 2C9OA 4BNZA 2EKLA 4F06A 4J6EA 4DDKA 2ADFA 1BS1A 1U8AA 2BFBB 2X4IA 2GM4A 1IZ8A 3U3MA 1R0SA 1HLFA 1GN9A 3DZJA 4ZEWA 2YYSA 2BDTA 3V7YA 4ZMSA 4BX2A 3IOBA 4RSRA 4BRWA 1M2NA 2LNDA 3K2EA 4CTJA 3VKHA 3FYUA 4JBYA 2FP3A 1K6MA 3RFXA 1PZGA 5AQEA 3T3PB 4KI7A 1CUAA 4RY2A 3WIUA 1SQ5A 4K6CA 4JIMA 1N0VC 1KXJA 4MQ4A 1L5ZA 4CQMB 4KOAA 5TF4A 1E1QA 1C1XA 1SCUB 3AK4A 3Q7QA 4EEZA 1I7QB 2DLCX 1WSBA 4EATA 4C7VA 1QYWA 2Q4BA 1Q6ZA 1NBMA 4KHPB 1J07A 2HU5A 2D06A 2AOXA 3QMWA 4I9FA 1RAEA 4J0EA 4ZAVA 5KTMA 3AZOA 4MUEA 3WMFA 2FN4A 4M60A 1DE0A 9LDTA 3A14A 4IVNA 3EC2A 1Y34E 1USWA 3QTLA 3GWZA 4TMTA 5JQGA 5EAIA 5JWRA 1PRYA 4JQSA 1PW7A 3D81A 1KU6A 1H9BA 2G5PA 2G9NA 1OH8A 4YP9A 3AEYA 2H4JA 1FUKA 1ACJA 1VMKA 1XN1A 1YKGA 2X1VA 1ECBA 3JW8A 3HFSA 3L0DA 3MELA 4GBED 1L3BA 2QJOA 2HRZA 2WF7A 3FWYA 4LV8B 4LYJA 3WB0A 2C4KA 3NV7A 3OZSA 1QKKA 2NO6A 3G13A 2V54A 3IUPA 1XTTA 4OJMX 3QKRA 2GZDA 4W82A 2X8JB 1FOEB 2O8CA 4XDHA 2FEOA 1ECPA 3U4CA 3V4LA 4PNEA 3ZYCA 3AB7A 3MBOA 4ZU1X 1JJIA 5ECGC 2OD2A 1M2KA 4ZT5A 1P9OA 1A9ZA 3LMKA 4OAPA 3VDRA 3OA0A 3PLNA 4HAIA 4DR1B 2JAWA 2RKWA 3EF0A 3ELWA 4LVNA 2EG5A 1QSGA 4AG5A 2HGZA 2YVLA 4OO3A 4Q3AA 4Z8XA 1U3FA 1FYWA 2IPOA 3JQQA 5ED4A 1R6AA 1I7PA 4OLHA 2IBTA 5ICMA 2AC4A 1GG2A 2GNOA 2GCPA 2O52A 4B7CA 2OTCA 2HMYB 4BY9E 2K4MA 3H3JA 1IONA 1O94A 3KKLA 4MS1B 3U9SA 4W5OA 1YZVA 1NW9B 1YZHA 1UBSB 3AVPA 1J0BA 1JLHA 3HI4A 2Z2XA 3Q6IA 5KI6A 4GHWA 1GL9B 1LK5A 3U7JA 2W6ID 4BJ5A 4N49A 1CY6A 4YJ3F 5JPDA 2FZKA 2OC4A 4G0PA 2OUKA 3AF4A 1H6CA 4HS9A 4OHWA 5SZIA 1XRRA 5BN5B 4E13A 1JHYA 3P9SA 4URHA 4B9AA 3MOSA 3SMVA 1XLUA 2HPHA 1BEEA 1JA0A 1NSYA 1Z5WA 1E94E 2ZIXB 1JSXA 4CM8A 5C1IA 3TIIA 3TVDA 5C46F 1UBEA 3L0CA 4HPWA 1HY3A 2O6HA 4M0CA 5ALWA 5ARDA 1EUZA 3W3AH 4AZVA 5HP4A 3L7DA 4ESEA 2B8NA 3WP1B 3B6MA 2F62A 1IN5A 3ANTA 1KMMA 3CNEA 2I2XB 2FWMX 3GJ5A 4FNAA 4Y2GA 4EYOA 4RTOA 3HKCB 2O2GA 2GCGA 3FLAA 4NJEA 1NIJA 4JHXA 5AICA 1HKUA 1DVRA 1P7CA 2CVPA 2IW3A 3S3TA 2JB9A 2FFJA 5KSZA 1NQUA 4NYMQ 2CFRA 4OMCA 1BHJA 1OYOA 2GD6A 1K1EA 1S8OA 2KBEA 1DOHA 4YCAA 3W7VA 1GPWB 1A95A 2Z2IA 4TMVA 5TE9A 2NTJA 2IV2X 1F7UA 3AVWA 4PTYA 1I3MA 3O94A 2IT1A 3LUAA 2CVOA 2W6JD 3KQWA 3SNHA 5MFZA 3QSYA 4FN5A 3QE9Y 3KJEA 5AXDA 3TTWA 2R1VA 2EOAA 2FPLA 2Y1LA 2YQZA 4NE9A 3I09A 2ODTX 4BVFA 5IFLA 5HK9A 3GMIA 1KMHA 4P0PB 1IY1A 1NI4A 3H87A 1GA6A 3KHTA 4QYTA 1QK3A 4FCCA 4DLLA 1RWWA 2Y2UA 5BV0A 4K7JA 4FYXA 2I6FA 1UOOA 5LIPA 3B9BA 3I8XA 3ZV3A 2ONZA 3H8VA 3V4SA 5TNXA 4QPZA 4OQZA 1PD0A 2R62A 2ZPUA 3FLBA 4W8HA 3SZMA 3UIEA 2PR2A 2C83A 2IYAA 5CA0B 1E20A 4N0QA 3BMXA 1GZHB 4BP8A 2GDJA 4UHEA 4PWZA 3AVOA 4R2KA 5TS2A 2O2ZA 1UJ4A 3OIUA 2SKDA 3LQKA 3ZD6A 1DTWB 2NO5A 4Y30A 4EHJA 1SVIA 5JXWA 3GT0A 2RBGA 2P9FA 5C1PA 2H57A 3RUCA 2BVNA 2JKZA 3BKWA 3KSZO 1NP3A 2GCOB 5IVPA 5K5EA 4HH1A 5TQ0A 4F9TA 5AHWA 4EEKA 1N92A 2JJYA 1YS9A 3QUCA 3Q8KA 1NI5A 1ORRA 1D3AA 1P5FA 2J46A 3HJGA 4LF7B 1N0HA 1XO1A 4QQRA 3ZHOA 1TZJA 2WG1A 4YJHA 3QX3A 2WLSA 3FFTA 4KQ6A 2OG1A 1ZOSA 5K0TA 1KJJA 2C5EA 4C3OB 2IH4A 1JHUA 1GCIA 4G0YA 3GGDA 2C9ZA 4PQEA 3NPMA 3UM9A 5CVUA 1T2UA 1ZFNA 3M6VA 5BW8A 4LSWA 5K20A 5ELXA 4LFCB 5B7QA 2VZ9A 2DWOA 2C58A 3STWA 1Z2PX 2HH9A 1BW9B 1WTAA 3UUWA 1KVSA 1BJRE 3P0FA 3QHQA 3TXXA 2ONKA 2QTLA 2GZ1A 4BYMA 4QVIA 3I53A 1MR3F 1NVTA 1BJTA 1SUFA 3WLNA 1U11A 1GR1A 1MVLA 4EF4A 1ZCAA 2DKOA 3TCKA 4E3ZA 1B16A 3BCHA 3MTQA 2DEUA 3KFVA 1NC3A 2RGAA 1IIBA 3AUXA 2AI2A 2NAFA 3GGGA 3IQHX 3OUTA 2XLBA 4RU1A 4ZRDA 4LSGA 3SFZA 3PA8A 2Q49A 2BEUB 3TR0A 5LOVF 2I1QA 2ZW9A 4WJZA 1W2HA 4WXHA 5EI5A 3TW8A 4CG0A 4WMLA 4HQFA 2X42A 3MD0A 5KPJA 4B71A 5EJ5A 1PV2A 4LXXA 3V8QA 5JEDA 3S70A 1HYQA 1HEYA 1QLHA 1NXQA 2V74B 2I62A 2ZVJA 1G2QA 3CNBA 3OO0A 4QUGA 4TMYA 4D3YA 4DYHA 2O5VA 5LPNA 1WCV1 2AK2A 9LDBA 4JYZA 3TAUA 5H68A 1Z25A 1KQPA 2F64A 2PZLA 4IQGA 4JL5A 4KO8A 4MGIR 5CLGA 2Q99A 1QH0A 4G89A 2Y1XA 4QJ4A 4UTNA 2C5LA 2JIDA 3IGFA 3O8OA 2YDYA 3PVSA 1B0AA 4TMZA 4V1CA 3A70A 2B9EA 2I9PA 2HNKA 1GZ7A 1LI4A 4U7DA 1TO1E 2IYWA 3WNZA 1XG5A 5F21A 4IH9A 1AO0A 3ZKWB 1MW8X 1ZJ4A 1WXEA 1K08A 3EZFA 2O2XA 2G7ZA 1DUSA 4ABYA 1P6XA 3F0TA 4FEYA 5G40A 1UZLA 4GT1A 3VFDA 1J22A 2K2WA 3LUBA 1WMBA 1WHSB 3M5WA 2ZYWX 1NN0A 3KL4A 3NDPA 4BFWA 5CA1F 3A11A 2QW1A 3O73A 4ZYYA 5GIPE 4I8XA 2GEJA 1KDOA 5L8VA 3VU3A 4IQFA 4KXQA 1HBJA 2N47A 3L8MA 2OZEA 1YCDA 4O2BA 2C0CA 4PLHA 4TS9A 2R8XA 1P4HA 4LE2A 3SF8B 4QTZA 4EJ6A 3BCRA 4CTMA 2HA3A 4IMJB 2AFRA 1V6CA 2G6BA 1VG9B 2R5WA 2Y0EA 1ADBA 1OXKB 3OFNA 2DPGA 1PFUA 2XE4A 1EBUA 3RBZA 3RYIA 4B32A 1CRPA 3N2GB 4OQXA 4QOHA 5GJBA 1TD9A 2QZPA 5AUQA 4NC9A 5AVUA 2UZ4A 1GPNA 4RY0A 1DSSG 2JFBA 4AMVA 1AVTA 2DUUA 2ZRPA 4YJHB 3FTEA 1VL6A 2FK8A 4P0TA 3F7OA 3WWZA 4EHHA 4KQWA 5KOHA 5ALDA 4UQLA 5EA2A 4RXMA 3AF5A 1X8XA 3NIFB 4WBXC 5JAPA 3N6XA 4OJTA 1ZIDA 2OKCA 4DM3A 6LDHA 5J43A 3LCVB 1Q5PA 3MT7A 2ZSAA 3QEMA 3Q7TA 3ROMA 3X1KA 1M8GA 5JZVA 3C14C 4JV5B 4WESA 4MMXB 1E89A 3A9CA 1Z5PA 2D54A 3HQ4O 5K2MA 3TNDA 5DM60 4YRRA 1RP7A 5TSDA 1QLJA 2CJYA 2P62A 3EJWA 3FPGA 4OH7A 3D8TA 1PS0A 4I4CA 3JR7A 2QPOA 1UJCA 4INJA 2ZUFA 3ETHA 1Q74A 3ICQB 4IKEA 4D4LA 3VO9A 2JEOA 5B58C 3WLKX 3A6DA 3OTWA 4DKXA 1EJ0A 4UVEA 1QVRA 2ZAMA 4RTPA 1KL7A 2P1ZA 1H23A 1KYIA 2FEMA 3JCZA 1H5NA 4BO0A 3D4IA 3TE7A 3PPWA 3F6EX 3TBHA 1RQ2A 3D6NB 4G65A 3VVBA 2B6HA 5DZSA 4REMA 5C2JB 3E8MA 3BHIA 4CGZA 3DDZX 4C7BA 1HYBA 1IHYA 1ZD8A 2Q5FA 3N7UA 4EPVA 1NQXA 5CDGA 1R6TA 1E0DA 4UU1A 1NXSA 2YJZA 3I01A 3EGIA 4JUAA 4G0QA 4N82A 4UHCA 3AI3A 4JX8A 3P2KA 4WQMA 4CQMA 5TMDA 4GG1A 2QDKA 3E8SA 1U0OC 2RGUA 1EFVA 3E1KA 3E2MA 4UJ5A 1W76A 1MFPA 3GRCA 3PIIA 3PJRA 1SQGA 1T9BA 4MIEA 1LDYA 4LRTB 4QLOA 4IUBS 4OV6B 2VJAA 1SHLA 4ZGBA 4UEWA 3A4NA 3LA8A 1JVSA 2XVXA 4M88A 1P1IA 3MT0A 3DHEA 3BXFA 1K8RA 4BN5A 4HT3B 4PHGA 3QPVA 2PV7A 2ENUA 4IDGA 1N2XA 3MRSA 1U3DA 2P9CA 3H5LA 4ETMA 4ETNA 4GOND 1US8A 4RC9A 5IAOA 5JTTA 2JFQA 3PC8C 3DFUA 2JIPA 3M8KA 3F2IA 3N7TA 4KQFA 3W3AD 2HTFA 5FL7A 3CJQA 5JAZA 4FDLA 2UZAA 5BRNA 1J4AA 2R1ZA 4ZRMA 1E0KA 1XX6A 3NANA 4O0MA 3TSCA 5K99A 3WLIA 4Y9TA 4M76B 4N6OA 5HRAA 4ZO4A 4LMPA 1TK9A 5CVDA 1VG0B 3VGJA 3JQAB 2JNWA 2CDNA 2EWWA 4CLHA 5E1BA 1HDEA 3PQEA 2JGDB 4AD8A 3MWDB 2HQRA 5LNK6 2JVKA 4FSXA 3NM5A 5C4GB 5LJLA 1UMCA 2YIVX 3EVTA 5TB5A 3UXEA 1SUWA 2TMKA 3ND9A 3VHQA 4AY6A 2W90A 3WYNA 1GLGA 2H1VA 4K6GA 4A6PA 1MG0A 4IMPA 5K0SA 5ESDA 1M34E 2B8EA 4YT4A 2HX1A 1S1CA 1T8UA 1TJ4A 2BFPA 3MC1A 5HFNA 3U3JA 4G5QA 1NUUA 5DBEX 1QKJA 1ZC4A 4BB9A 5GVSA 4HKTA 1KO8A 1M2EA 5BQ3A 2Q1TA 4KGVA 1Y1KE 2DP4E 3HCBA 1MF7A 2I66A 1KSJA 3BIXA 5DGCA 1Y3AA 5DM2A 1X1TA 4Z0HO 4CMJA 1EDEA 4M2LA 1J8QA 1R0XA 3RSSA 2JLRA 2V5UA 1XZGA 4NOJA 4OHFA 1ZRSA 1ID1A 3HVJA 4QGFA 4DE5A 3TO5A 2FK7A 5AJTA 1ULSA 4JYBA 1XTSA 3FUXA 5K3CA 3GVPA 2OO7A 2BGJA 3K94A 4IS2A 1P9RA 3OA2A 1QR6A 1U8CB 3AIOA 3C3MA 4JZYA 3IE0A 2VJMA 3NBKA 3I58A 5J5VA 4E2ZA 4XGQA 3RRFA 3KK0A 5JCXA 1SKUA 5A4KA 4IX9A 4PAOA 1BEZA 3SZGA 1PZXA 3ZXIA 1TJYA 4PFQA 3DLCA 4JROA 4LC0A 2PMEA 3VNBA 3IMEA 2FPPA 5FBKA 4AJLA 2RHRA 2CCKA 3I1YA 3BCSA