1ENOA

Brassica napus enoyl acp reductase/nad binary complex at ph 8.0 and room temperature
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
297
structure length
297
Chain Sequence
LPIDLRGKRAFIAGIADDNGYGWAVAKSLAAAGAEILVGTWVPALNIFETSLRRGKFDQSRVLPDGSLMEIKKVYPLDAVFDNPEDVPEDVKANKRYAGSSNWTVQEAAECVRQDFGSIDILVHSLANGPEVSKPLLETSRKGYLAAISASSYSFVSLLSHFLPIMNPGGASISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKQNIRVNTISAGPLGSRAAKAIGFIDTMIEYSYNNAPIQKTLTADEVGNAAAFLVSPLASAITGATIYVDNGLNSMGVALDSPVFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ENOYL ACYL CARRIER PROTEIN REDUCTASE
publication title Common themes in redox chemistry emerge from the X-ray structure of oilseed rape (Brassica napus) enoyl acyl carrier protein reductase.
pubmed doi rcsb
source organism Brassica napus
total genus 101
structure length 297
sequence length 297
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1995-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1enoA00
1VLLA 4M49A 3LT4A 4KUGA 1SCUA 1D3AA 4PLCA 4XQGA 3O8QA 1HEUA 1KVSA 1R0SA 3G1TA 3H5AA 1PR3A 1UH5A 2AEJA 2I5PO 2ZB7A 2J5QA 3FNFA 2X23A 1XQ1A 3KYDB 3L4SO 3GEGA 1JW9B 3BTUA 2CVZA 3C24A 3E9QA 3RKUA 2EIHA 1YBMA 5EN4A 7MDHA 1IE3A 5CEEA 1ZK4A 1T4DA 4IXWA 2DM6A 1IZ9A 1E6WA 1MA0A 2PLAA 2PZLA 4J7XA 2R6JA 4IJWA 5AQ1A 2GZ1A 3OH8A 1ISMA 2W2LD 1UXJA 3I6IA 3L77A 4CMHA 3INRA 2C5AA 1RJWA 2DKNA 3EK2A 9LDBA 1O8CA 1QSGA 3PQDA 1KEVA 4OJNA 2BGKA 5AXDA 1QLHA 3WIEA 3WNVA 3RSHA 4GH5A 2X86A 2Q45A 1RWBA 4UAGA 3WLFA 5THKA 2RHCA 3K2EA 4FJ2A 4OIMA 1DIRA 4I1IA 4B8WA 4ZQEA 5JMWA 3H5RA 1E3WA 1Q1NA 3WGHA 2EP7A 2ZTUA 4F3YA 5IG2A 3H8VA 4G2NA 4WEQA 4CV2A 1DFIA 4BNNA 4CV0A 1YJQA 2GO1A 4PRKA 1H6CA 2YDYA 1LDNA 1U28A 1UUFA 4J6FA 3L4BC 1NR7A 1VJTA 1EK6A 3RIHA 2VOEA 3BIOA 4PRLA 2DTDA 2C2XA 2UDPA 1QRRA 1R6DA 4FFOA 5BSEA 1MFZA 1VJ1A 4AJ4A 4CM4A 4BMNA 3DEYX 3GGPA 3ASUA 1TA4A 5JXWA 2E49A 2CMDA 4R3NA 3T4XA 1LRLA 4A10A 2W2LA 5G0VA 4Z0TA 2PD4A 3JQFA 5BNTA 5CP8A 5DNAA 5ITVA 2VUSA 3KBOA 4FFNA 4PN3A 4CM6A 2BMAA 3S2FA 1GEEA 2O2YA 3CINA 3NAQA 2NUAA 4Y8VA 5BQFA 4CMIB 4GVLA 3STHA 1OOEA 3GG9A 1YE3A 3R3SA 4PG7A 3P5SA 3RQSA 3QVWA 4ALLA 5ICMA 1UDAA 5BSFA 1X1EA 4E2XA 3TOZA 3NDIA 4NFSA 1VM6A 4PG8A 1NP3A 2DFVA 2HLPA 2VUTA 4NQZA 5CPBA 1KYQA 1KOLA 1BW9B 2NU7A 3ZGYA 1LI4A 3PWZA 4RVUA 1ZSVA 1YQGA 4JCOA 2X9GA 4HFRA 5TS3A 4L9RA 1O95A 4ITUA 4CLHA 5DCUA 1GYPA 5T57A 1DC3A 4TROA 3C1OA 2GGSA 4OH1A 4PIVA 3GMSA 2PA3A 4NFYA 2YHIB 1WP4A 2RIRA 4QXMA 4YACA 1DHRA 1ZFNA 2VRCA 4E13A 4DQVA 1Y8RA 3FNGA 4PGFA 4WCFA 4CMCA 1PEDA 2YZ7A 1CQJA 2A4KA 5A5FA 2V65A 1UXGA 4YJHA 3W8FA 3H2ZA 4MKXA 3VTZA 3O9ZA 3PIIA 2OFPA 4XJTA 2YJZA 4MJLA 4E12A 1XGKA 4HX5A 4BO6A 1TT5B 3K5PA 1NPTO 1CYDA 1H6BA 2OGUA 4PVCA 4B7XA 3ST7A 1C0LA 1FK8A 3OJ0A 4CMJA 3DBLB 4BGUA 3DHYA 1YONA 1P1FA 2PFGA 5A06A 4J0EA 3DFUA 1N2SA 1E3JA 4NG5A 1PQPA 4FSHA 4WLFA 1HZJA 3ZHBA 3FBGA 3CXRA 1T24A 1ZXLA 2UUPA 3DC2A 1MX3A 4GLLA 4R41A 3HWRA 1IY8A 1K89A 2EERA 1GV0A 1UJMA 2C07A 3ZWWA 1HETA 1BXKA 4IDAA 4KOAA 3ZU4A 3JQBA 1Q7GA 4URFA 5I8ZA 1YRLA 3BTSA 2PKQO 1PGNA 4BQPA 5COBA 1HXHA 4NH4A 1NWHA 3BTOA 2CZCA 2BGLA 3V5NA 2Y1FA 4GX2A 1PZGA 1K5HA 1T2EA 4NJMB 5IFLA 1Q0LA 4W4TA 2W2KA 3GDFA 3PQFA 4TKMA 4TRRA 4CQLB 3UW3A 1E6EA 3JQ7A 4ROSA 4FB5A 2CVQA 2WE7A 1SZJG 3D5TA 3EUWA 1B3BA 4BMSA 4HUJA 4GMGA 1OFGA 2X6TA 4J49A 4NHEA 3U4HA 1YGYA 4BNZA 1EUDA 1T2FA 4JBHA 3DR3A 2VHYA 2E82A 1BMDA 3I9LA 4GVXA 3TL2A 4JBIA 5ICSA 4MOWA 1CWUA 2J3JA 1PJ4A 4YJGA 1KC3A 2CDAA 3HDYA 4MDHA 3OP4A 4E2YA 2TMGA 3RU7A 3HSKA 4Q3AA 5IZ4A 2AEFA 1E1LA 3VH2A 2AQIA 3SC4A 2TMDA 2OZPA 3GN2A 1GV1A 3BHJA 1YS4A 1B0AA 1CIVA 5A5EA 3JSAA 1X14A 1QMGA 5K6AC 3O4RA 2ZQZA 1E3IA 2B5VA 1ENYA 4GGPA 3V2UA 2VNSA 2D4AA 4EYEA 2DTXA 3DAPA 4XR4A 5EL0A 3LF1A 3GPIA 1MXFA 1XQ6A 3K2BA 3BMQB 1LRJA 3E6AA 1T2CA 2A94A 3HZZA 1E7WA 4K1LA 4UULA 4UUPA 4JK3A 2ZB4A 1BDBA 5EQFA 4IS2A 5KJEA 2GERA 1V6AA 1P31A 5DP2A 3RASA 3KB6A 2C7VA 2J3KA 5G0UA 3EVTA 3WLEA 4Z0HO 1VI2A 1TB4A 4CMEA 3WX0A 1YB5A 1PL8A 3M1LA 3I9MA 1VPDA 3PGXA 4AJNA 3QVOA 1I0ZA 4BO3A 2VZ9A 1P74A 3PJGA 2UYYA 1GTMA 2JCXA 4JJFA 3WQRA 4L0QA 4R1NA 1F06A 2Y1EA 5DCWA 4TZKA 4F6CA 1ZUD1 4YAGA 3BTVA 1PJBA 1LTHR 2OP1A 1NFQA 1DHTA 5KVSA 3AY3A 3QWIA 4I5GA 1CDOA 3K8ZA 1YB1A 1E7RA 1YQDA 3OSUA 4NK4A 4Q3CA 5DULA 4BNYA 1T2AA 4QECA 3TL3A 3WDSA 4D3FA 1NAIA 1OC4A 5COQA 3CZRA 4BB5A 4CLDA 5EQDA 3V1UA 3MWDB 4CMAA 1PL6A 3P19A 1N1GA 1UZMA 3RUHA 1P45A 3I9OA 2EXXA 3WICA 5TNXA 4D3DA 5JAQA 4J1NA 1FJHA 3CZMA 1EVIA 3GVHA 1T1RA 2C59A 3VTFA 3WOHA 1E6UA 4DYDA 1W73A 2GN6A 3ENNA 2BFMA 1C1DA 5I7FA 5JFOA 3HN2A 2FR8A 1JWAB 1ZO8A 4IDBA 2O3RA 2QHXA 3L6EA 1R37A 3GDGA 4R1SA 3JD4A 3IMFA 3OMLA 4MVJG 5TX7A 2FZEA 4F46A 3L6DA 3ZWYA 3L6OO 3GPDG 3RAJA 3SXPA 2C5EA 3EGOA 4BKRA 1DBVO 1MUUA 1VC2A 5L4LA 2YDXA 1D4FA 4AJHA 2ZJ0A 4Y6SA 3L4BA 1MC4A 1ENPA 2NU8A 3WJAA 2I65A 3HE3A 3D64A 3SBOA 2HMTA 3C7AA 4CMBA 1OZAA 2RHRA 3JQ8A 2Q3EA 4EJ0A 5CDSA 1WXDA 1XG5A 2GRAA 1AUPA 3W8EA 1X7HA 2PD3A 5JYEA 5BNFA 3PJFA 1J5PA 3H6KA 3R3JA 5IZCC 4RVSA 1YBVA 4AVYA 1WAMA 1H9AA 1I2ZA 3PYXA 2Y67A 1OBFO 2DBVO 3D4OA 3ITDA 1WWKA 4O1MA 2HRBA 4FW8A 4NR0A 5IN4A 5I7SA 4IQ0A 5DOVA 1L1FA 4FIZA 4HWKA 4CJXA 3WYBA 2X5KO 1HRDA 1GUYA 1A9ZA 1NM5A 2O2SA 1NASA 1SAYA 1OC2A 3LDHA 1DIHA 4AL4A 1VL8A 4IIUA 3G3EA 4UUOA 2A35A 4RJTA 4FC7A 4E2ZA 1PQUA 4PCVA 1JDJA 2D5CA 2E37A 1GADO 4AJIA 2ZB8A 1P44A 4S1VA 3EAGA 3TNLA 3UXYA 1RYDA 2EG9A 3BMCA 1HYGA 1A4UA 1ZMOA 1DC6A 4FQ8A 4K6CA 3L9XA 2I66A 3Q1LA 3KYCA 1U4OA 4EDFA 4TWRA 4DIOA 3MOGA 4ZICA 3CH6A 2FSSA 4WLUA 3W6UA 1B8PA 3ZWOA 1UDBA 3GNQA 4R1TA 5TC4A 1TT7A 2X9NA 2CD9A 1LLQA 1LEHA 2D8AA 3NT4A 4BB6A 2J3HA 3GUYA 1GYRA 3PJDA 1RM0A 3ANMA 5TSDA 5T8KA 4GX5A 4P22A 5ITWA 3U9LA 4KWIA 1VRWA 4PG6A 4IQGA 3BMNB 3BMOB 3E48A 4ZQGA 4U6QA 1P0FA 5JC1A 4UVDA 4XQCA 4YTEA 4TVBA 1PWZA 2B5WA 2VYVD 1PJLA 2NU6A 2GF2A 2HAEA 5CDYA 1R12A 2Y05A 1CRWG 1X0VA 2B0JA 4I9NA 4IS3A 4B4WA 1CEQA 3N74A 3HHPA 1EQ2A 5AOVA 5TT0A 1YWGO 3TRIA 4BO2A 3H9QA 1ZK2A 1ONNA 2NM0A 2HU2A 4S3MA 1DSSG 2G5CA 3EYWA 3FD8A 3I1JA 3KSUA 3WSWA 2AE1A 2FPPA 3JQ9A 4L75A 5F5NA 4OM8A 1LXCA 2C2YA 4WPGA 5L7YA 1QYXA 4NK5A 4M54A 3TJRA 4BNKA 2NWQA 4BKQA 3NGLA 1U2DA 5JMPA 2C7GA 4BO4A 4J1TA 2CSUA 5F1KA 4FFMA 4YWJA 3GAZA 2Q1UA 3F4BA 3IKTA 3E9NA 3P2OA 4FDAA 4U5QA 1PGJA 1YOVB 5KVQA 2GASA 2BFAA 4P4GA 1SO8A 4QFCA 1GQYA 3OA2A 2VYVA 1IULA 3IUSA 1GZ3A 1RM3A 4ZHSA 5U4QA 3TZ6A 2OO5A 5EERA 1ISHA 2EW8A 4OL9A 4GMFA 1GL3A 3ZWAA 2Y93A 5T5QA 1D1SA 3T7CA 1Z82A 4PLGA 3GAFA 1C0IA 4XYGA 4WGGA 4DC1A 1IB6A 3UCEA 5I7VA 1WNTA 4RVDA 2C82A 1QLJA 1DEHA 1Y1PA 3IP3A 4E21A 3EZLA 1MGOA 1N5DA 1WZIA 2Q2VA 4OXKA 5K6AA 1ADCA 4J90A 4FFLA 3OQ6A 4JX8A 3AUAA 4MKRA 5DZSA 3E8XA 3WGQA 5THQA 3KXDA 1NVMB 4UUMA 1PU2A 1HE4A 4WEOA 1R4MB 1DC4A 1B2LA 4FCCA 3MJ4A 2FN7A 3JQEA 2FP4A 1ZVMA 4HNGA 1M67A 4J2HA 1PGPA 3H4VA 4A73A 1I2CA 1T4BA 4ND2A 2EWMA 3SJ7A 5JPIA 4CM9D 3WGIA 2AQ8A 1KVTA 3PQEA 2PNFA 5EJ2A 4OYRA 2NVUA 4JIGA 3RBZA 1Y9AA 2VUUA 1ADBA 3AY7A 1RM5A 4WOJA 2AA3A 3M2PA 4ALNA 4BKPA 3QVXA 1NYTA 1SB9A 4LRSB 5H83A 1QYVA 2JCYA 5A02A 5JO0A 3A14A 5TQVA 3JQBC 2EKPA 2OUIA 3FTPA 3AJRA 2PGDA 4W99A 3D3WA 3MTJA 3RI3A 3JV7A 4IUYA 3M6IA 4LISA 4XDZA 4YDRA 4BKOA 3LT0A 1R0KA 2HK9A 3NT2A 3ZW9A 2NQTA 3I5MA 4R01A 2PY6A 3F1LA 3R0IA 4XA8A 2BFPA 5H81A 3AM3A 4TZTA 2B83A 3MOIA 3TF5A 4CM9A 2Z95A 5L53A 4CM5A 2C29D 3I9KA 5K9ZA 5G0WA 1GQQA 4ND1A 2I67A 3FR7A 2IDZA 2Y1DA 3AI1A 1VL0A 4J2OA 4MINA 3NGXA 1ZJYA 4XGNA 3H9EO 2D2IA 1EK5A 3LC2O 3V8BA 5IAAA 1HSOA 2P9EA 2P91A 4DMLA 1H6DA 4PLVA 3KSDO 4RVHA 4RF5A 3OA0A 1C0KA 3ULKA 2WMDA 4FC6A 3C3XA 4JLWA 3IS3A 4NI5A 2YW9A 5B4UA 1MXHA 3W6ZA 3GFGA 3IJPA 2OMEA 1PL7A 1Z73A 3LK7A 5EMHA 3ROQA 2Y1CA 2Q49A 4R51A 4B7CA 4ZQBA 3MJTA 1B26A 2OHXA 5IZCA 1XCBA 2JAPA 3B1JA 4OOFA 3TZKA 2FY8A 1ZSYA 4XCVA 3JQAB 1KS9A 4OO3A 2Q4BA 5A9SB 1B14A 3ADPA 1Q0HA 4I5EA 1PR9A 1QYCA 2C54A 3KVOA 4KDFA 1SC6A 4CODB 5JW6A 4NPCA 2A92A 3JD0A 4K26A 3MCVA 3IUPA 4DTIA 3O26A 1UR5A 5TJHA 3AK4A 3HFSA 4CQMA 1P1KA 3VVCA 4EJ6A 1F0YA 3OBBA 1P77A 1JU9A 4RPHA 3AUTA 3LSYA 3VH4A 4MP8A 1KY4A 4IMPA 1C1XB 3ZWVA 4BO5A 2B69A 2CF6A 1GCUA 2ILTA 5AXCA 3RUCA 4BNXA 5KWEA 3DAGA 1WMBA 1VL6A 3PIDA 3Q0EA 4LCJA 3JYNA 5B1YA 4XX0A 4BO0A 3RWBA 1I24A 1J0XO 1NVGA 3WB9A 4BNFA 1FDTA 2YQ5A 3CMMA 3MTGA 1FMCA 3ZU2A 4DMMA 3OETA 5L7WA 2O3SA 2XOXA 4RPGA 4J4TA 1JKFA 2VT2A 4CM1A 4RVFA 1U5AA 5JLAA 1T25A 2X22A 3DBRA 1HL3A 1LDBA 3KHUA 2O3JA 4HFNA 1YDWA 3VH1A 1E3WB 3FTNA 3LZ6A 4CUKA 5JBIA 4MVJA 2EF1A 2H6EA 4XGIA 1LQUA 4CM7A 2UVDA 5CEJA 3VPSA 3I4CA 4GKBA 4QO7A 4MVJE 3B70A 3FNEA 4CR8A 3ROMA 5MDHA 4HFJA 4BUCA 2DBZA 1ONPA 4XZ3A 3DAFA 3BXXA 2JAHA 3L07A 4P4LA 4TRMA 1P0CA 2Z1NA 3DBHA 5B4VA 4RO0A 2WSBA 3AI2A 3E9MA 4R68A 1Y6JA 4FS3A 4OSPA 4IBOA 4R9SA 1JAYA 4N5MA 3H2SA 4IINA 1CJCA 1E7MA 1S6YA 3D3EA 2JCVA 3JD3A 4YJFA 2YV3A 3K9QO 3TWOA 3W1VA 4YT8A 3QWBA 5GZ6A 4IZIA 2PGLA 1WW8A 2V6FA 4II2A 4U0JA 3OJOA 2YHUA 5DP1A 2X58A 3INTA 2NACA 3ETGA 1ARZA 3GGOA 3CSDA 4HXYA 4UVGA 1XEAA 3ZU5A 1U3WA 1PX0A 4M87A 4W9NC 3ZNOA 2HJRA 4JJIA 4NBRA 4BNTA 3KLPX 4EUHA 3GF4A 1Y8QA 1YXMA 3SLGA 4D0RA 3BHMA 4NBWA 1EBFA 4UVEA 2HKIA 4R3WA 1P9LA 1A7KA 5B37A 1QG6A 2NNLD 3TZCA 1AHIA 4ESOA 2W8ZA 3DZJA 3OHSX 3W4IA 2DBQA 1V3UA 1XSEA 1HDXA 5ES3A 4O0LA 5KCZA 3KSZO 1A9YA 2QX7A 3RFVA 2YQ4A 3GNTA 4PLFA 3C8MA 1Y8RB 4WCFB 1Z7BA 3VKUA 5TRTA 4BNGA 4RGBA 4YJHB 4KQWA 3Q11A 2J5KA 4XWYA 1JN0A 3VKVA 2WM3A 3DTTA 4FOSA 4E3ZA 2W90A 4RZHA 5T64A 1HLPA 1K3TA 1LSOA 2ZYAA 1D8AA 4ZD6A 4ZRMA 1FDUA 2CF5A 1LDMA 1I10A 4NFHA 2BKAA 2UV8A 4CR7A 4CR6A 2QQ5A 3C7CB 2PZJA 3NT5A 1I01A 5KJ6A 2HO5A 3QLJA 1W8DA 1YKFA 1DJNA 3DOCA 3TFQA 4J1QA 5AXAA 4ZU3A 5T8KC 3FHLA 2PR2A 1ZCJA 4YRBA 4WJZA 2I6TA 1LUAA 2DAPA 3UCFA 5IDQA 5HM8A 4Z9XA 4WNIA 4OMUA 1FDSA 1SOVA 3UUWA 3WGTA 1BW9A 4CL3A 2PTGA 4ND3A 1KVQA 1QV6A 3VPXA 3WWZA 3JYOA 2R00C 2WWRA 4PZCA 4XKJA 1LBEA 1GR0A 2W2KB 3IIEA 2I76A 3UGKA 3JQ7B 3D7LA 3DBVO 3JD1A 3GVIA 3QVTA 4J4HA 4KDEA 5TF4A 3JQ9C 1A5ZA 4OXYA 3GEMA 3PFWO 4EUFA 1Y5MA 3DZGA 5HS4A 1K2WA 4D43A 4YJGB 3PK0A 1EDZA 1LLUA 5U9CA 1CF2O 2G82A 1UP7A 1KIFA 3PZRA 4ONEA 4YAEA 4FBGA 2VTEA 3UICA 4FOOA 1T2DA 4GGOA 4W7HA 4BNIA 3ZHZA 3GUCA 2YV2A 3K30A 4X54A 3IJRA 3A28A 2FRDA 1OAAA 3ZNNA 1U3VA 2JJYA 3U5TA 4LK3A 3CUKA 4GL4A 4J91A 3GGGA 3LT2A 3Q3CA 1J4AA 3GZ4A 3Q2IA 4OSOA 4G81A 2O7QA 4MVJM 3DOOA 4C7JA 3M1AA 1P33A 4PLHA 4GAEA 4CLRA 3HJAA 3PYMA 2DC1A 4O6VA 4ID9A 4IDDA 4IGEA 5F1PA 3NRCA 1B16A 3MJVA 3K92A 3FSRA 2CVOA 4PVDA 2FR1A 4BV8A 5C3MA 1HDGO 2NVBA 4AJ2A 2GN8A 3Q6IA 3KEQA 4WKGA 3DZHA 4RV9A 4DIBA 3HNPA 1PGQA 4DLAA 5JAMA 4UVIA 4MVJF 4UUNA 1LSSA 5A3JA 2PZMA 3AU8A 1E7QA 4YB8A 5CPFA 4YRDA 3S2IA 3I9NA 3P7MA 1T1SA 1N92A 4XB1A 3FWNA 3U4DA 3ZWNA 1ENZA 2QZZA 1X15A 1NNUA 1P1IA 2AXQA 1CETA 3K31A 2WDZA 4BNMA 2VT3A 1P1JA 3ZH2A 3RUAA 1DIGA 3ZI0A 3NUGA 1SMKA 3EC7A 2AQHA 3OJLA 3OEYA 2HK8A 1PJTA 4FD3A 4BS9A 4I5DA 4EW6A 3GHHA 2GNAA 2XXBA 3KO8A 1K6JA 3FNHA 3LC7O 1X7GA 4MPDA 4EBFA 4IXTA 2XPCA 5CDTA 4MIOA 4A26A 3EHEA 3QIVA 1XU9A 1C1DB 3HG7A 4QFDA 5TGDA 2X0RA 3HDHA 1GZ4A 1YB4A 4YQZA 1EVJA 4ALJA 3F5QA 1DLIA 4W82A 1WDMA 2QYTA 3VPGA 5IDYA 1DFGA 5A1TA 4Z0PA 1O9BA 3BMQA 4YT4A 2VWGA 3UVEA 1KEWA 5ILGA 4BNWA 3DTYA 4D79A 3TPCA 4IDFA 1O94A 4AJPA 1JTVA 2CFCA 1PZEA 4BGIA 2FOIA 5BR7A 5G4LA 3G49A 3TZHA 1GY8A 1L7EA 3R6DA 2PH5A 1DB3A 1PSDA 4U0KA 4XQEA 2AQKA 3DHEA 3JQ8B 5GMOA 4Z9FA 3JYQA 4E33A 4Y98A 6LDHA 3BHIA 3OIDA 4OXNA 3ZHXA 3VZRA 3IAHA 3NYWA 4L74A 3ZWPA 4C4OA 1NPDA 4TRJA 1ID1A 1GU7A 4WK6A 4WNCA 4J43A 2Q99A 5TJ9A 4GLOA 3U4CA 1ONOA 1DRUA 4FGWA 1I3LA 2VN8A 4Q3BA 4BVAA 1C14A 3TN7A 3TDKA 3G0OA 3JD2A 5JY6A 3HFGA 2VWPA 2VZ8A 1BRMA 4JP3A 5I9LA 3FF4A 3W4KA 2I9PA 4W9NA 4ZN6A 3H65A 4PLTA 5HBRA 1E3LA 1NVTA 2YYYA 2RBEA 4I9UA 2D3TA 1X7DA 3UAGA 4K9DA 2DBRA 4YPOA 1XA0A 3IKVA 3KYCB 5L45A 3WTBA 3H3FA 3VAZA 3ASVA 2E4AA 5CG1A 1KVUA 3AM5A 1GEGA 3RJ5A 4LVCA 1BVRA 3COSA 5FF9A 1I2BA 4DQUA 3JQGB 2O4UX 3WBBA 4E32A 1YJ8A 3VVBA 1IPFA 1I36A 2O48X 1W6UA 4GPD1 4JBGA 1A7AA 4UEOA 4WASA 3TFOA 2ZTVA 1EZ4A 2EGHA 2PD6A 3HDQA 1I8TA 1IHXA 5CEFA 2VOJA 1MC5A 1H93A 4IIVA 4YCAA 1R15A 3KUXA 4TMFA 4YA6A 1NQAO 1K6IA 4E30A 3B20A 4N18A 4M1QA 1B8UA 1O0SA 4YVFA 1SB8A 4XGKA 4DRYA 2VHXA 5ER9A 1I30A 1LLCA 3HN7A 5JE8A 5G2OA 2Q2WA 1E77A 2CDCA 2YV1A 1DIAA 2ZYGA 4L73A 3WSVA 4F6LA 3AUSA 1GPDG 3WYCA 2B4RO 1O89A 3TZQA 3RBVA 5G0SA 3A1NA 4GQAA 5I8WA 3GH3A 2DU8A 4LSMA 2GCGA 2J8ZA 3D0OA 3NDRA 3FI9A 3UCXA 2VWHA 4XIYA 1E3SA 4D3SA 1G0NA 1EUCA 2R00A 3W4JA 4O63O 5CAEA 2AW5A 4DYVA 1V9LA 1ZEJA 3Q9UA 3PWKA 3RCBA 2Y99A 5JO9A 4F45A 2PH3A 1DPGA 2O4CA 1ZSNA 1AE1A 1EE9A 1HDYA 3QWFA 1K6XA 3PJEA 1G1AA 2V6MA 1A4IA 3ZDFA 5DT9A 3C1TA 3DWFA 5EPOA 1IUKA 3ZN2A 5KIAA 1U8XX 3KZVA 2PK3A 3D4NA 2G17A 3F1KA 3KYBA 1M76A 3ENKA 4L4XA 4Z3KA 1NQOA 3I4FA 1F12A 3N7UA 2J5RA 3AI3A 5L4SA 2PKQP 3PHHA 1R4NB 4ALMA 4KTVE 2Q1WA 4XYLA 3ANLA 1U7TA 3KOUA 4J1SA 5ILOA 1Z74A 2IEDA 1EVZA 3G1UA 4CPDA 3PDUA 1Z45A 3EDMA 4PLWA 3ZV5A 4BO1A 1UXKA 3SJUA 2Y68A 1XDWA 4EJMA 5H82A 2QRJA 3AW9A 4G5HA 1YBAA 3PPIA 5IJZA 5KTKA 1NWCA 1U2GA 1BVUA 1BXGA 2H63A 3B6ZA 3SVTA 4AG3A 3ZCXA 2QIOA 1BWSA 1DRVA 3R1IA 3D4PA 3GC6A 3H7AA 4Q3EA 2XXJA 2FMUA 4QT0A 3AY6A 1XIVA 2JL1A 3FBTA 2NVUB 3WNQA 4J16A 2WD7A 1R66A 4WE3A 1YH3A 2V6GA 2P68A 3S2GA 3GRKA 4Q3NA 3SLKA 1F17A 3NTRA 4KUEA 3LF2A 1TI7A 4HY3A 3WIDA 5CG2A 1E3EA 1B15A 1Y81A 2BF7A 2WE8A 2JFFA 4K6FA 3WGYA 2Y1OA 1ISFA 1PJSA 4UREA 3NV9A 4NJOA 1N7HA 5JNLA 3LLSA 2X5OA 5HRUA 2OORA 2QZ9A 3D3WB 2Q50A 4YQYA 3RVDA 1VSUA 2ZK7A 5FFFA 3GFBA 3RFXA 3SC6A 2CY0A 5KJCA 1WPQA 3ADOA 4R69A 4K28A 5FI5A 3OF2A 2EKQA 2BGMA 3NX4A 3WQSB 4P4NA 3S1LA 3I9JA 2VNAA 3DZBA 1SNYA 1LC0A 1LDGA 2O7SA 1F8GA 4WECA 3VDQA 2POQX 1Z75A 2EGGA 3I52A 4XIJA 5CDGA 3CMCO 4RF3A 4YYZA 2NVWA 4C7KA 1E7SA 3QP9A 5T6BA 3PTZA 1PWXA 2FR0A 4IJVA 5LDGA 1HDCA 3GT0A 3PXXA 1BGVA 2JD2A 3IC5A 2OBYA 3E5RA 8LDHA 3KEOA 4E2WA 2I3AA 2VYND 4LSWA 1D7OA 2B4QA 4XB2A 5BSHA 4PLZA 2NQ8A 2B36A 4XEHA 4YT2A 4RDIA 4BO9A 1TXGA 4HADA 5KJFA 2WYUA 4NU6A 5JDIA 2QG4A 1WZEA 3V2HA 2PGJA 3INGA 2GYYA 4JP2A 4DBZA 1ISIA 2I3GA 3PDJA 1DRWA 1Y7TA 1ZW1A 2GD1O 1NR1A 2DVMA 4KQXA 2FPIA 2OBNA 3E18A 4XYMA 4GI2A 5FYDA 9LDTA 3QA9A 4EI2A 1LX6A 3WBFA 5COAA 3P2YA 4W6ZA 3A9WA 1QR6A 4B3JA 4LW8A 5L9AA 1MG5A 3MWEB 2IXBA 2OOSA 1E1MA 2SCUA 4ALKA 1N9GA 5HS6A 4DVJA 4CQMB 3ZV4A 2J3IA 1I32A 3RBXA 4Z3DA 3WXBA 3ON5A 4ZQHA 3QRWA 3VPHA 1NHGA 2VYNA 4OQZA 3JQAD 1AN9A 2D5AA 4G65A 1MP0A 1PJ2A 1EEHA 1LNQA 3EVNA 3GZNA 3VDRA 4H3VA 3O8QB 1UP4A 4Q3DA 1VKOA 4A27A 1DLJA 1EFKA 3WTCA 4GWGA 4ZVVA 2RCYA 1GFSA 4BQRA 4EITA 3EW7A 2GDZA 4KP7A 2WYVA 3L0DA 3F6YA 3PHLA 1U3UA 4IY1A 3DBRB 3U0BA 1M75A 1H9BA 4H16A 4BNLA 3F4LA 3FRJA 3RC7A 2WTBA 4TKLA 3HUDA 3BZUA 1FDWA 1YL5A 1VJ0A 1YL6A 5KVVA 3C7DB 3RC1A 4A03A 4CLOA 2XAAA 3RD5A 5G4KA 5IDWA 5GZ1A 3JYPA 1E0DA 1MG0A 2AG5A 3PYLA 2YY7A 4YT5A 3GN1A 4DBVO 3G17A 4AFNA 4RF2A 4I9HA 5F3RA 3IL2A 1PJCA 4A7PA 4II3A 3LU1A 5A9SA 4YR9A 4QSMA 3VC7A 3JYLA 4DLLA 5CFZA 4ND4A 2O3QA 3ZW8A 2AMFA 3FWZA 5EESA 3GQVA 4KTTE 4KWHA 3WGZA 1IL0A 1PZHA 4R5HA 3AFNA 4E5KA 1N7GA 1PS9A 4HP8A 2RAFA 4EZBA 4YJFB 3DQPA 4Q9NA 1B3RA 4FFPA 1AXGA 4CM8A 3A4VA 4Z6KA 3ONFA 4RPJA 4WOKA 4CM4B 4ZRNA 1NPYA 3B1FA 4O59O 3V2GA 4B4OA 3OFSA 1C1XA 3ONEA 4D41A 1BG6A 4XRRA 5I7EA 4OOEA 5AVOA 4CUJA 3WGOA 1QXSA 3X2FA 1HSZA 1VE9A 5BNIA 2HK7A 3AM4A 5C7LO 3ITKA 4DGSA 5TIIA 3MJCA 3KYDA 4DUPA 3U3XA 1GYQA 2Q1TA 1Y8QB 1F14A 1WVGA 1HE3A 2Q4EA 1VSVA 1LSUA 1A72A 2EKLA 3UH1A 2P9CA 3V1TC 1LA2A 3VZSA 3QQPA 4DPMA 4Y6RA 1DOHA 2FWMX 4FPXA 4R5MA 1LRKA 1QYDA 3GLQA 4UEKA 4BOYA 5C5IA 1M2WA 3DONA 3WQQA 3N58A 1IHYA 4H7PA 3HQ4O 1IOLA 3OIGA 4XQ9A 4UVHA 4J9VA 3KLMX 1JQBA 4IQ8A 4MVJP 3S8MA 1G0OA 3WGGA 4DWVA 5L40A 5MGBA 2IE0A 1X13A 4YJDA 4WLOA 1NAHA 3QJ5A 4DPLA 4YAIA 2Z5LA 1M66A 4RORA 3PHGA 1PJQA 4P8RA 3DMTA 3RU9A 4L4RA 3ZNQA 3UOGA 1JVSA 4HFMA 5HWSA 1V3TA 4CLXA 3NEPX 3F46A 3WFJA 2VRCD 1DXYA 2R2GA 1B7GO 1FDVA 1IYZA 2A9FA 4BNUA 3MZ0A 4W7IA 4CV3A 2JHGA 4XYBA 4XR9A 4JN6B 3GOHA 2LDBA 4P38A 4Z9YA 1HT0A 3CKYA 3S55A 4CL8A 4OKIA 1A71A 4IDEA 5L95A 4LN1A 2NTNA 2Y0CA 4KMSA 1HYHA 1LQTA 2VZ0A 5JAIA 5A9RA 1RM4A 4R9RA 3ORFA 1IPEA 4CMIA 2P4QA 2VHZA 4CLEA 1Z7EA 4GX0A 2WEKA 3RC2A 1DFHA 4N7RA 4MP3A 4BV9A 2BLLA 1DAOA 4MIYA 1ORRA 1U9JA 3NJ8A 3ICPA 4DL9A 3LQFA 2BI7A 2Q46A 1YQXA 4RDHA 4JJGA 3GK3A 2FHSA 1Q7CA 1UP6A 3E1KA 3JCZA 4DQXA 2G1UA 4CV1A 1UXIA 2YFQA 4BHTA 3KETA 2XF8A 4I08A 3HADA 2I99A 3PVZA 4MKZA 4PLPA 5AYVA 2ZATA 8ADHA 4AJEA 2F1KA 2YHIA 1ZH8A 2HUNA 2FPGA 3H5NA 3MJSA 3PLNA 4BNVA 5LDHA 3RKRA 4MP6A 2J6IA 3AFMA 2ZCVA 2DTEA 2CDBA 4NNJA 4BGVA 2NTJA 2VCYA 4RQTA 4DLBA 3WJ7A 4ZA2A 1JKIA 2JHFA 4RPLA 1EUZA 4ILKA 1Y5RA 2X5JO 1Z6ZA 2E48A 1WLYA 4D44A 4EGFA 2DFDA 3H9UA 4HKTA 4AICA 1CERA 1TT5A 2VQ3A 2EJWA 4IPTA 1EMDA 4CM3A 1TVEA 2EHDA 2HMWA 3OQBA 3DBLA 4JXKA 2IRWA 3K6JA 4CLRB 1XWFA 2D1YA 2HMVA 4B8ZA 3BYZA 1I3KA 1ML3A 1WDLA 5B12A 3ZWBA 1I33A 3U4IA 4ND5A 1U3TA 4LMPA 4WUVA 2GR9A 1NHWA 1LDEA 4FGSA 2YUTA 2Q2QA 1H94A 1ULSA 4RL6A 4NU5A 5JC8A 3NJ4A 4GWKA 3BA1A 3ZV6A 3NTQA 1YO6A 4D46A 2H1SA 1U5CA 4DXHA 5A3VA 2OXIA 1A27A 1EVYA 1S7CA 2IYOA 1MV8A 2QRLA 1KBZA 4GSLA 4B4UA 1ENOA 1GZ6A 1H6AA 3JTMA 3OJEA 4M55A 3W8DA 1U1IA 3GY0A 1HLDA 1R0LA 1TEHA 2IZZA 1TLTA 1HYEA 2FZWA 4NJMA 2F00A 1UZLA 2UUOA 4PZDA 4CQLA 1SEVA 1V8BA 2JKVA 3CTMA 4MIEA 4YBZA 2H5LA 3IDSA 2X8LA 2BI8A 2BH9A 3IQDB 4EEXA 3K96A 2O3UA 2BRUA 4TRNA 3HB5X 3WMXA 3X2EA 1ZMTA 3QV1A 1ISGA 4CUZA 3AOGA 3AOEA 5LCXA 1ZK0A 2BHLA 4A2CA 2GZ2A 2G76A 4FN4A 3LVFO 2Z1MA 1Y9EA 3DZIA 4OAQA 3ABIA 4FR5A 2GPTA 4J7UA 4N54A 3RFTA 3K73O 3PHJA 1QKIA 4Q39A 4WLNA 3AWDA 2JD1A 2O3TA 3RROA 3TOXA 4M89A 3HB4X 1V35A 1U7HA 2ZCUA 3UKOA 2OL4A 4YEDA 3ANNA 5JDCA 1E92A 2VHVA 1MB4A 1KERA 4BO7A 3UFXA 3C85A 4WCDA 2IZ0A 4QTZA 3DXFA 3OJFA 1AHHA 3ZWMA 4BO8A 3EMKA 3KRTA 1D1TA 2HCTA 3H9GA 5TLSA 1DAPA 3FPLA 3U62A 2ZJ1A 1HE5A 5A9TA 4YAKA 2PKRA 3BAZA 3ETEA 5LC1A 2HDHA 5EINA 4DPKA 2D59A 4NDNE 1GAEO 4NMHA 3VOSA 5AXBA 1HZZA 3FCOA 1BDMA 1GD1O 4Y9DA 4AJLA 2JFGA 4OQYA 1ZJZA 2BD0A 3ROPA 1E5LA 2ZTLA 5FWNA 3NTOA 3RJ9A 4NBTA 3LC1O 3VHRA 5JDIC 2X7HA 3E03A 1KC1A 1HKUA 1DDOA 4EEZA 1YVEI 5I9NA 3JQDA 3DDNA 1WDKA 5G0TA 3RUFA 5DBFA 4JNKA 2WJPA 1C3VA 1I3NA 1E5QA 1JWBB 2BFOA 4HV4A 4XYEA 4TSKA 4E5NA 1GCOA 2DLDA 2QRKA 3SEFA 1GQ2A 2ZB3A 4AJKA 5DCYA 3QE3A 1P3DA 1LLDA 2HSDA 3F5SA 4J0FA 3AU9A 4BKUA 4H15A 4D45A 1O5IA 3LLVA 1E1NA 1HDOA 2NADA 2DPGA 3WS7A 3D5QA 1L7DA 4OHUA 4BMVA 1XKQA 1EDOA 4RQUA 5L51A 4QX6A 5IF3A 3CEAA 5TT1A 2CNBA 4E5PA 5JCXA 3VZPA 1MFPA 3BMCB 3U09A 2CUKA 1I3MA 2EJVA 3PWSA 5KJ1A 1H5QA 1HWYA 4DA9A 2V6BA 2NTVA 2ZIZA 4RF4A 3PFFA 5IXYA 3DZKA 1XHLA 4E5YA 3D1LA 3DB2A 3VPFA 5DBGA 5C7IO 2Y1GA 3M2TA 4NZ9A 3RUIA 3WWYA 4FFRA 1JKJA 2NSDA 4U6SA 4GKVA 4PZEA 3LYLA 3OEWA 4R4JA 2Q1SA 5BSGA 4N5LA 1E1KA 5B4TA 4PFJA 3ZNPA 5HTOA 1BSVA 2GN4A 1JAXA 1K0UA 3RUDA 4GX1A 1LDYA 1ZIDA 4IMRA 3V1YA 1ZKMA 1OMOA 1ZNQO 2HMSA 4XJSA 3NKLA 1NFRA 2FSVA 4RPKA 1HE2A 3OM9A 3ZWCA 1AXEA 5ENVA 4EUEA 1ADFA 2P2SA 1NX6A 3O03A 1CQIA 3CPSA 3I6QA 1NBOA 1RKXA 3GVCA 4L4SA 1AGNA 3GR6A 4LRTB 5L7TA 5KKAA 3QWAA 4LVUA 1OI7A 3G79A 3ZWXA 2VRBA 3OIFA 3I3OA 5KVCA 3PP8A 1BHSA 1SBYA 5CDUA 3C1AA 2O23A 1UAGA 3H9JA 4KZPA 5C37A 4HNHA 3NDJA 3CE6A 1GPJA 1ZK1A 3JQGA 3OECA 3QHAA 3UF0A 3AUUA 4IDCA 1WMAA 4JGBA 5DF1A 3DHNA 3VH3A 4DREA 3E5MA 1HDZA 4GSKA 4OGWA 4AJ1A 3KM0A 1RPNA 4J7CA 3KV3O 4LGVA 3GA0A 3PLRA 1V3VA 3PGJA 4IGFA 3GRPA 4IM7A 4E6PA 3E82A 3IOYA 4CMGA 2C20A 1JLLA 3ROKA 1DO8A 2P5UA 4BL5A 1PS8A 5ER6A 4IJKA 2O50A 1F8FA 1ZXBA 3WR5A 3T4EA 4NBVA 3OICA 1PGOA 2YFHA 2P5YA 1QYWA 2EP5A 2X1HA 5JSFA 5JS6A 1ADGA 1EBUA 1KEUA 5L4NA 4PG4A 3I83A 3DFZA 3JQCA 3F3SA 3VZQA 2PZKA 5A03A 5J23A 2E6UX 4R16A 3PI7A 2IODA 3QSGA 1ZEMA 4AJJA 2Y0DA 1LJ8A 1GUZA 3BMNA 2VTDA 2IXAA 3BMOA 3LT1A 1EFLA 2IYPA 4U7WA 1U4SA 2GUGA 1BXGB 4IZHA 4E31A 2EEZA 2B35A 5ADHA 5JAZA 1Q0QA 2ZTMA 2ZYDA 4XD2A 5IN5A 3DMTC 1Q2XA 5FEUA 5KOIA 3JQFC 1X0XA 4E5MA 5U1PA 4DC0A 1PJ3A 2WD7B 3ONDA 4IDGA 2GZ3A 2DT5A 4B4VA 1H2BA 4BGEA 1EQUA 4JQCA 4RVGA 1C0PA 2PWZA 1O6ZA 1RYEA 4M86A 2DUUA 2DUWA 2NLOA 4YRAA 3PHIA 1DIBA 4IJUA 3GMDA 4OKNA 1M6HA 1E7YA 1I5RA 2OP0A 4RLSA 4D7AA 1YL7A 5IXSA 1LSJA 3DMYA 4RCVA 4U8GA 1UAYA 1W4ZA 6ADHA 4YAJA 4PG5A 2IZ1A 3MEQA 1BTOA 2DPHA 1KVRA 1YOVA 1T26A 2AE2A 3FPCA 3FN4A 2NU9A 1NFFA 1DJQA 1VKNA 5F5LA 3QW2A 1NTOA 5C7OO 1R4NA 5I9MA 2EW2A 3S2EA 4HBGA 1UXHA 1EE2A 1HF3A 3DO5A 4MVJH 1H2HA 2WYWA 1PQWA 3ZZNA 1XYGA 1X1TA 4QUKA 3GDOA 5DOZA 2D0IA 4KUHA 5GY7A 3SX2A 4CMKA 2P9GA 4WCFC 3WFIA 1W0CA 5F21A 3TQHA 1SEPA 2W4QA 3U49A 4GBJA 3JQ6A 3UHAA 3MJEA 3GVXA 1NQ5A 4J3FA 4J4BA 2PV7A 2AHRA 2X4GA 2X0NA 2H9IA 2B4TO 4JROA 4UEJA 1QV7A 4WLEA 4DIFA 2ZQYA 2RH4A 1N1EA 2BELA 4FJ1A 3OQ1A 1NQTA 1PS0A 4O5OA 2QW8A 3B1KA 3DOJA 3ZV3A 1H0KA 5A4DA 1J49A 5DDIP 1GDHA 4J9UE 3PEFA 1QORA 4LMRA 1M6WA 1ZBQA 5A04A 1R16A 3L9WA 1HDRA 1MLDA 4M8SA 5ENDA 4AJOA 1Q7BA 3QWHA 3RUEA 3A06A 1R4MA 3DL2A 3WYEA 1U8FO 2IEBA 4NIMA 3ZU3A 4ZJUA 4R54A 1V0JA 1LC3A 5L3ZA 1XELA 2GSDA 4D42A 3ETDA 5JCJD 1XR3A 3ZHYA 3H3JA 3EZYA 4RZIA 1IZ0A 2HMUA 2X9VA 3KTDA 3T7EA 2ET6A 1N9GB 4D0SA 4B7UA 3QVSA 4BIIA 1BXZA 3GG2A 2V7PA 4MO2A 2QYSA 3TSCA 4B3IA 1N8KA 1PZFA 1HTBA 2HRZA 5HA5A 4BNJA 1B8VA 2ZKLA 1UDCA 3Q2KA 5KKCA 2Y66A 4A0SA 1ZK3A 3GNSA 3IP1A 4WLVA 5IDXA 5BT9A 5EIOA 1QP8A 3GZNB 5DBIA 3EY4A 2GN9A 1JVBA 3WMWA 3F47A 3I23A 4B3HA 3HDJA 3ICCA 5JYDA 5F1OA 1G6KA 1DC5A 1PIWA 2AG8A 3PZBA 5CHEA 4CQMD 3DZFA 2VWQA 3FR8A 2Y0EA 1FF9A 4Y6PA 2HQ1A 3GHYA 5T67A 1JA9A 4I8XA 4QEDA 5JCJA 2LDXA 2RH8A 4R1UA 1P1RA 3CIFA 2DQ4A 1KY5A 5DN9A 1FXSA 4INAA 1SPXA 1J6UA 1SOWA 2JFHA 4CLOB 1XLTA 3GEDA 4LCEA 4QO8A 5GZ3A 5G4KB 2HJSA 4TVOA 2B37A 2JD0A 5JY1A 1NXQA 2VHWA 2C0CA 1LU9A 4TQGA 4QQRA 2WD8A 3AOEC 1ISJA 3GVPA 4E4YA 2G0TA 4YXFA 5KNLA 4I5FA 5FI3A 1PTJA 2AEMA 1KEPA 4XRGA 7ADHA 4L76A 3F9IA 4PLYA 1ULUA 4E0BA 4ALIA 4XDYA 4N5NA 4MVJD 4FJ0A 2NV6A 1P1HA 3O38A 3Q9NA 3RC9A 3PRJA 2W98A 2P4HX 2X0JA 4CMEC 5JDCC 4NBUA 5K0ZA 2X0IA 3WG9A 3QY9A 4MVJI 1ZZEA 1UZNA 1KETA 4ZQFA 1YDEA 4RLHA 4CM8B 2EV9A 4A5OA 1XU7A 1GUFA 4Y67A 3UN1A 4ZGWA 2UAGA 2GLXA 3JQAA 5A05A 4B79A 4BNHA 3DBHB 4L8VA
chains in the Genus database with same CATH superfamily
4RY0A 2EJUA 4P7KA 3DLCA 2C5LA 1YZTA 3UHFA 3FAKA 4PLCA 2AFIE 3RRXA 3KUUA 5C52B 2WIDA 3O8QA 1HEUA 2J3EA 3G1TA 3H5AA 1PEKE 1FCJA 4ZMBA 2VUIB 2AEJA 4TTVA 1WU8A 2WV7A 2J5QA 2ZB7A 3B9BA 1KYWA 1XQ1A 2DFTA 5BPFA 1G59A 2OAEA 1JW9B 1S02A 4XGRA 3RKUA 3LBYA 3UANA 1F4VA 4B0PA 5CT9A 3BCHA 3SPXA 1PFVA 2BEVA 2W4IA 4KO1S 3OC6A 3UK0A 4C76A 5CEEA 1T4DA 1V4BA 2R8XA 2WA1A 3EMDA 1Z2OX 3HCDA 1G2OA 2BHRA 1MA0A 4HAYA 4NJEB 4QU5A 1H1LB 5AQ1A 1P91A 2EDCA 2I1LA 1OLXA 3OH8A 2OZVA 2UYOA 2W2LD 4JB3A 2IIVA 1CDDA 4PYMA 1P3JA 4QASA 4FNGA 1X1CA 4N40A 3K0EA 3INRA 2Z8XA 3HL4A 3T9CA 3EJ6A 1H3FA 1V1MB 2BGKA 3WNVA 2P9JA 4B3RB 1XMJA 2O8CA 2VJQA 1GL9B 1JWLA 1V11B 2Q45A 3DVSX 1RWBA 3IVMA 3WL3A 3HYLA 4LJ6A 1CUYA 4JDPA 1R5JA 3U80A 3QTLA 5THKA 4JD5A 4FJ2A 2WUDA 4AUKA 4ZVSA 3H5RA 4TMZA 2IYRA 5JHHB 2ZTUA 3NWBA 4J0CA 4XPIB 2I62A 4ECAA 5JCOC 5FA8A 2VA9A 1TAHA 1DFIA 2A1TR 2H9YA 2JANA 1MJFA 1T4CB 2VDRB 4HMOA 4UBLA 3PQ8A 4UNIA 4ZOCA 2JLVA 1Z15A 2FWRA 2OXRA 3H86A 1KHTA 1U5BB 4ND8B 5SICE 3LKDA 3ZR4B 1ZD3A 4CT5A 3HCFA 3IT0A 4YFYA 1UUFA 3N70A 4P2BA 1QIGA 2CK3A 1NQUA 1W2WB 2JH3A 4LZLA 2IU6A 4ZO6A 4YRPA 3RIHA 1XNGA 2ECOA 1DZ3A 2WJYA 5BSEA 4FFOA 2J31A 3LY5A 4FCVA 2XGSA 3BEOA 3CF4G 3HJUA 3N0TA 4FE7A 3F73A 1MABB 4S12A 1VGVA 2JLBA 4R8KA 2NZYA 1OPXA 2CHVA 1SKUA 1FC0A 3SQDA 4UU1A 1EM8A 1GRQA 5BP7A 1LRLA 1OGJA 1VLHA 1ORWA 1Z5NA 2W2LA 3JQFA 2R4TA 5KYYA 4AWXA 3F96A 4HVLA 3KBOA 5ITVA 4BATA 2HA3A 5IJAA 3S2FA 1GEEA 3I62A 4ITVA 5D8DA 2UZ0A 4Y8VA 1AURA 4KWEA 5BQFA 3IHWA 3ZI7A 1RVV1 2B0CA 4F86A 3NHUA 1SELA 4RPIA 3GT7A 1XMSA 4GM0A 1W6RA 3GG9A 4EMTA 4QLAA 1UKEA 3OCJA 1WQ3A 4LC1A 1W25A 3R3SA 3ZHQA 3P5SA 1OLUB 1Y8AA 2F43B 4CL2A 3D2AA 1NN5A 2QGFA 5BSFA 3KFLA 3NDIA 2CV2A 4RANA 1QH1A 4F97A 3PA8A 3T41A 1A5SB 1SXJB 2DFVA 2Q2NA 3AP3A 3KTOA 1GQSA 1BIFA 1YZYA 1KYQA 4NQZA 2BR5A 1BW9B 3FMFA 4QELA 3T94A 3PCXA 1LI4A 5ERXA 2G6BA 1YGPA 2REQA 2WNIA 3PBKA 4JCOA 2X9GA 4HFRA 2Q4OA 4BVBA 3ROFA 5A4AA 4KYIB 4ITUA 4TTTS 1UZAA 3THSA 1GYPA 1WTCA 3RTEA 5JZOA 1DC3A 4PQFA 3RYFA 1EVQA 2BZ0A 2H1OA 2H1HA 3GMSA 1X9GA 2AVNA 4TLLB 3ZOKA 1HA3A 4YACA 5LMZA 3OQMA 3DKVA 4UCXA 5C53B 1ODSA 4HB3A 4RXUA 1T35A 4DT1A 3FNGA 3ILYA 1XOIA 4CMCA 2CLHB 1C30B 1G5IA 3P9QA 3TW0A 1QYIA 4EMSA 3W8FA 3H2ZA 1Z68A 3VTZA 1ZJ4A 3PIIA 1OYOA 2OFPA 2GFHA 2O1EA 2QTFA 4GR5A 4XJTA 2CWWA 4H4CA 4DBLE 1EAYA 3TCNA 1RWWA 5F9MA 3OSZA 3VR5H 3WA6A 3M6MD 4HX5A 3N8DA 4B3MB 1PR2A 1TT5B 1CUVA 3PSHA 4G2TA 4DWWA 4EB8A 4CF6A 2QX9A 2C2HA 5HKLA 3PD0A 2J0VA 3VC1A 3Q98A 1OH8A 3DUWA 3OJ0A 3USZA 4CMJA 1TC2A 3L05A 3U7IA 2WA2A 1YONA 1P1FA 4B2IA 5A06A 8OHMA 5DM70 3ETCA 1UJ4A 4JL6A 1XMPA 1E3JA 1AY0A 1PQPA 4BRWA 3BFPA 4MWDA 3U7HB 1CR6A 1Y4AE 5BR4A 3KB8A 4Q9KA 2FZCA 2ZSAA 1KAMA 4YFVA 1ZOOA 3UENA 1CY4A 4GLLA 4IKEA 5IUJC 3KAJA 2WFLA 4F7DA 1K89A 2VSOA 2EERA 3C8UA 3RW9A 3PX7A 3OM1A 5SZJA 4JLPA 2C07A 4KOAA 4FI3F 3GQBA 1TTHA 1Q7GA 3KQKA 2QT1A 3I6YA 1YRLA 5T4BA 4YRZA 1RFLA 2PKQO 4KV7A 4WL0A 2CCGA 4PRYA 4TLDA 4BQPA 3HB9A 1HXHA 2X40A 3AV3A 5EE3A 3ZBTA 2I2CA 1KOGA 1E9CA 2P41A 1OX5A 4H0CA 1GTSA 3BTOA 1LD3A 1TQ2A 3L92A 2UZ1A 4LEIA 3M89A 2SKCA 2BGLA 1V8PA 1XJ5A 3HXOA 1P7CA 2IF0A 2J6HA 1DKMA 3GEHA 4X97A 1N34B 1Q0LA 1R5OA 3HKDA 1XPOA 2C42A 2F1HA 2F59A 2VJOA 3CCFA 2ZRLA 3GDFA 3LY8A 4TKMA 2XCTB 2TS1A 3UW3A 4BEVA 1WHTB 3G0BA 3JQ7A 5AVWA 3BWBA 4IUDS 3CCBA 4K9SA 4MI3A 2WE7A 3LUGA 2NPIA 2C0PA 4RK1A 1TU0A 1B3BA 1CB0A 2B94A 5B30A 4J49A 2X6TA 3KB1A 3SDSA 3B89A 3I37X 2CMKA 1ISRA 4PIMA 1EUDA 4NEQA 3K1YA 2HA5A 3S2SA 1CYEA 3HJGA 4Q4JA 2ZIAA 3F4KA 3I9LA 2NT4A 4MW2A 3BWMA 1D6JA 3IAUA 4MOWA 3TL6A 2CE2X 4C22A 4YJGA 3ID6C 1KC3A 1FYWA 3HDYA 4F38A 2QOEA 2ZAIA 4ZKDA 4IF4A 2VAXA 2ORVA 2BV3A 2FN8A 2Q07A 3RU7A 3LQYA 3EC1A 1RJFA 5J3JA 1WV1A 5DJ5A 2IXGA 3B1ZA 1CJMA 2XZOA 1AG9A 1IB0A 1S3IA 4IVQA 4K9KA 4ND6A 2A33A 4LC9A 4BUZA 1A9SA 1DQSA 3JSAA 4FYVA 1QMGA 1B76A 3P96A 3UFXB 5JHGB 2ZQZA 1S9DA 3PUKA 3G9ZA 3V7NA 3KUCA 1JIJA 3ZHOA 4XX1A 1NI3A 2PA0A 3DAPA 4LOAA 4NYJQ 4QRIA 2EBWA 3H75A 2B34A 1MXFA 1L5RA 1XQ6A 3IRVA 3LF1A 5K0EA 1LRJA 5BV7A 3WBFA 1E7WA 1XNHA 3EIHA 4IS2A 3BIFA 3H19A 1V6AA 4IHKA 5DP2A 2HQRA 1ONSA 3RASA 1K7YA 5CYOA 2C7VA 1GDDA 1AUQA 1L7VC 4FLMA 2WUVA 1TB4A 1P9WA 4CMEA 1TRKA 3I2FA 1PR4A 1AZLA 1M2VB 2FFBA 1A0OA 1PL8A 2PX3A 3C48A 3E3MA 3IA7A 3M1LA 5JBNA 2VP0A 4RADA 5BORA 3KCNA 3UB3A 1BX1A 5JZBA 1PQYA 1P74A 1KYXA 2ESRA 2B6HA 1GTMA 1M1YB 1QAQA 5KAPA 2JCXA 3W9SA 3WQRA 2C3PA 3I28A 2ECPA 3FOAA 4MVWA 3PGKA 2GESA 1OJ7A 3M4XA 4TWJA 3LLMA 2Q8PA 2Y1EA 1DEAA 3K1ZA 4ZARA 3THOA 5KQPA 3ABZA 1PV1A 2GZSA 1ZD1A 4O02B 2Z4RA 2OP1A 3EUFA 3W7BA 1NONA 4QIHA 3HO1A 4X60A 2OCDA 3MW8A 2W6QA 4ACBA 2CJFA 2PKXA 3MGCA 1E7RA 4KVGA 5DB4A 2VDQB 3OSUA 4NK4A 4Q3CA 4LECA 5I7UA 1T2AA 4H1UA 4QECA 1VJ5A 3QUSA 3QX8A 2HU5A 3IJ5A 4KRXA 1BDIA 1K7EB 1SKQA 3OZSA 3BWDD 4EKNB 3MWDB 4F3RA 5NULA 3VHLB 5HKBA 1M0TA 1SA0A 3QVUA 1FNCA 4L6IA 2ZI7A 1P45A 1NC3A 4TMKA 4TV8B 3CLKA 1SKBA 3DYVA 2QE7A 3GVHA 4MWBA 3NHBA 2O8EA 3MIZA 3ENNA 2IV3A 3OKFA 1C1DA 1YRAA 3WDLA 2VH2A 1TL7C 3HN2A 4YMSA 3SGLA 1KI8A 4P92A 4R1OA 3STTA 2V9PA 4EJFA 4ZMRA 1QO9A 4IDBA 4YJ3A 5B2EA 2O3RA 3O4FA 4Q4AA 3VVLA 3HCAA 1W88B 4S0XA 4XVCA 2IHBA 3OMLA 1Z28A 4F46A 3S4YA 1KA9H 3L6OO 2JCBA 3RABA 1LWOA 3WC4A 2RAUA 2CXHA 3RAJA 1LB1B 2C5EA 4K2HA 3VGPA 1YQ9A 2O8FB 2BW0A 2YDXA 2ZJ0A 2CL0X 4JI8B 3I45A 1JIQA 3NGMA 3MS7A 3BXFA 1MC4A 2V6JA 4DNOA 1TZJA 4ISBA 2J4CA 4RD4A 3RFCA 3PD1A 4I50F 4DVGA 4CIYA 3H1TA 4BN4A 2XRZA 2WF5A 2H06A 4EJ0A 2HJ9A 2R84A 1EWRA 3AINA 1PJAA 4TWBA 5I5EA 3V9AA 4URUR 5J2TB 3ANSA 4FYIA 3W2EA 4KXYA 3W8EA 4TUYF 4QSHA 3PJFA 1J5PA 4WMLA 5BNFA 4BQFA 1P7YA 2Q3LA 2QTHA 2R1VA 1VP3A 5FXMA 3TD6A 3B9QA 4IDHA 4AVYA 1I2ZA 3DD1A 4G5RA 4EJSB 2QX8A 1VCIA 2Y67A 1KDOA 1K5DA 4KLRA 5DNYB 4LJRA 2NPOA 1YB2A 5IKMA 1Z39A 3HEAA 2GM3A 2Q6IA 2HLHA 3GLHA 3QLVC 4KN5A 4ZO4A 1E4YA 5I9SA 4DWOA 2P67A 4ARVA 5IN4A 2DG2A 2GHRA 3DGEC 3AHGA 4FIZA 3USES 3GLHE 1SVKA 4KQFA 1EWKA 1GUYA 2IHZA 2PU5A 1CSEE 1XQ9A 3AFGA 4KW7A 4RDCA 3HLTA 2YIDA 4ZOQI 1SAYA 1Q0TA 1DIHA 4AL4A 1Z6AA 3TK1A 4QHYA 5IKXA 2A35A 1FUEA 2ZYTX 2P2CA 4PO8A 1OWMA 2XUIA 2RH5A 2PS1A 3D2LA 1BDJA 4AJIA 2ZB8A 3O3MB 4Q7QA 4S1VA 2G4CA 3TNLA 4DAOA 1RRKA 4EH1A 1D1PA 1A4UA 1ZMOA 4LYEA 4H31A 4YGXB 1QQ6A 5E3IA 2O07A 5J58A 2O0HA 4LHXA 1P0PA 3L9XA 3PNVA 4XAQA 3B1WA 4ESEA 4DLKA 5JALA 5KSZA 2WJ3A 1Z12A 1TE2A 4DIOA 2FKAA 3CH6A 4ABTA 4Q1CA 5A7HA 1N2EA 1JLLB 3CF6R 3QUTA 2W11A 4NCJA 5ADVA 1U7WA 4OA8A 4ADSG 1NN0A 5M2QA 2V74B 3W6UA 5JD5A 3DLHA 1B8PA 4L4UA 3GNQA 3NTVA 4R1TA 5DIFA 2OV1A 2X9NA 3KSMA 5TC4A 6REQB 3HYSA 4R8MA 4IUBS 2VRWA 3BJIC 3TIFA 1FQOA 3F98A 3G89A 1LW7A 1FQKA 3GUYA 4FQ7A 4L5YA 2C92A 2JJMA 2N1BA 3T7SA 1GYRA 1E58A 5FWAA 5EZYA 1RM0A 1WSWA 1TKRA 4MGZR 3NU1A 1EX9A 3ANMA 4TOIA 2GZAA 4MR9A 4P22A 3ICOA 4I1SA 1G5TA 4MEJA 5J9FA 2A0FA 4TSFA 4DA7A 5LYJA 3INYA 4HN9A 4C0LA 1JIVA 4ZQGA 1S0UA 5GOTA 1ZGGA 4MKIA 2CLIB 5JC1A 3OJCA 4RW0A 4UVDA 5EZ6B 4LBZA 4W5JA 5EJMA 2B5WA 4GPAA 3DKKA 5D3ZA 4AX8A 2NU6A 4Z86A 2ZIVB 2HNBA 2YH2A 3CF4A 5CDYA 4F60A 3VKHA 4PAGA 4B4WA 1K06A 5KTPA 1CEQA 1AB6A 2BCJQ 3C3JA 4A16A 5JBQA 2Q5EA 4RIGA 1WU7A 3ZGLA 4M98A 3QYPA 1A9QA 1N6LA 4L5BA 1E1RD 4IV0A 4ZALA 1ZK2A 3KSAC 1GSIA 2NM0A 4S3MA 4BFSA 1DSSG 2VP2A 2Q7XA 2YQZA 1E60A 2LE0A 4HX2A 2ZSHA 1Z0KA 2ECQA 2FZVA 1USGA 2HEGA 2W6PA 2NSLA 2ZRDA 2ZBEA 3I1JA 3LC0A 4ZGBA 2WZQA 5IKEA 1GTG1 3KTAB 3U3JA 1LXCA 1X2BA 3F9RA 4WPGA 1XPJA 2QX6A 2PT9A 1JIIA 4M54A 3TJRA 4RD3A 5JMOA 1XDUA 1UBSB 3OFJA 4HH1A 3NGLA 4KPGA 1U2DA 4KSBA 3K35A 4OHFA 3ZDEA 4BO4A 1U1DA 2WC1A 5L3SB 2H54A 1BU8A 1Y6FA 3HR8A 4NOMA 5CR9A 3GAZA 3IKTA 3DQZA 4R8RA 4FFWA 3S5JA 1NXWA 2YOGA 5HGJA 1PGJA 4CT4B 4XUDA 1WUYA 3V7UA 1ECFA 4X1KA 3I6MA 3P0HA 1C7FA 2BFAA 1H4TA 1UFOA 1AK9A 3DDUA 2ZUDA 1IULA 4KPFC 1REQB 1HLGA 2V59A 4CG1A 1DKLA 3FNBA 1JZTA 3TZ6A 3LQRA 2W2PA 4JC5A 4AW9A 5ICEA 4ZYTA 4JI2B 3MD0A 4DRZA 5EERA 3NORA 4FGLA 2ZSFA 1ISHA 5B1SA 4DLPA 1GIAA 3TTSA 1I94B 2QQEA 1ZWLA 3EEFA 1NW9B 3UH0A 2PSDA 4UHJA 3OQOA 1LV8A 1FLAA 2CEKA 1JQEA 1FS4A 1Z6PA 3H8SA 4K6GA 4XYGA 4XIIA 5TMEA 4WGGA 4MLCA 1JJ7A 1QOZA 1A8PA 1EFCA 2JRCA 5HBGA 3UCEA 4RVDA 2XA1A 4WUTA 3B6EA 2JGIA 3P9YA 1C4WA 1QLJA 1DEHA 4E21A 1QPBA 5K3EA 1SIBE 1MGOA 1WZIA 2DQSA 3L40A 3PKIA 4OXKA 3S28A 4BWGA 3O8NA 4J90A 2ZYVX 3FPFA 2G1JA 1O54A 4JX8A 3D3JA 4MKRA 3E8XA 1KBQA 1DQRA 2WWIA 3KXDA 3I0NA 2J45A 4ZPJA 3QVLA 1SC9A 5THQA 3KOXA 4RKYA 1PU2A 3TUJC 3W6PA 3WLAA 3SX4A 2LCIA 2MR5A 4DJTA 1ZCBA 2EFDB 5ALTA 5E6SA 4MGIR 4NMXB 3TB4A 5IKPA 2EQ5A 1B2LA 2X0FA 3MJ4A 1ZITA 2HWXA 3JQEA 4Q02A 3S2ZA 4TWIA 2HL6A 5LZ7A 1M67A 1U8AA 1PGPA 2C3OA 1X1BA 2QPLA 3H4VA 3PI6A 4JBWA 3GJTA 4A73A 4HDSA 5JPIA 3WGIA 1GPUA 4XWTA 2FFQA 3GZTB 1X86B 2PNFA 2QXYA 1USWA 5ALRA 4PC2A 1E9SA 1G2PA 2GD6A 4JIGA 4PXSA 5JYCA 2XHEA 5KYNA 1GVHA 2PZ8A 3VV2A 1CS0A 1ZJJA 2NYUA 2ZJZA 4JSTA 3STYA 4UCQA 2SHKA 4DMKA 1Y33E 5GV7A 1UPUA 2CBZA 4MYCA 3BXHA 4QQKA 4P5DA 2XODA 2OYSA 5H83A 1QYVA 2JCYA 2OAP1 1EFHA 5EEGA 1MORA 1RAFA 4XVRA 4P3YA 4OB6A 3PB3A 2RGGA 3A14A 3DKPA 1YRYE 2EKPA 4EM6A 4M3NA 3GFTA 1GKLA 1T3LA 4W99A 2PGDA 3E9DA 6GPBA 4BXOA 3RI3A 3H42B 4L6AA 1W9MA 3JV7A 4YRLA 5LQUA 3AUKA 3WNZA 4MQEB 3GCXA 3DTNA 2JLXA 4R3UC 1QVZA 5B7NA 2Z2IA 5EJ5A 4YDRA 3H97A 4NQRA 3PXGA 4FYKA 2IV2X 2WY2D 3GWGA 4PQEA 1XPUA 5IJWA 1R0KA 3PVSA 2NQTA 2QTNA 3FTQA 4M6WA 4B2LA 5CXUA 3F1LA 3R0IA 4WV3A 4U39A 5H81A 3WY9A 5KWVA 3R5FA 1KMCA 2YCLA 3OM0A 2B83A 3TQIA 3EAFA 3TF5A 2Z95A 4ZAZA 1VE6A 2WFAA 3HSSA 4JLKA 3I9KA 4QVGA 5DE3A 5JNTA 5G0WA 3DD5A 4BQQA 2UZAA 5FPSA 1GQQA 4ND1A 5F1YA 5LVAA 1C7JA 1II8A 1HQCA 2W93A 2WIKA 3FR7A 1U2PA 2IDZA 2Y1DA 5DHQA 2J7KA 2ZYWX 4RM2A 2WJGA 3PNLA 2VVTA 3P9IA 1ZJYA 4MINA 1CUXA 1YTLA 2ZSEA 3EGVA 4PINA 2FK8A 4Y2TA 3V8BA 1NATA 3WXMA 2IOFK 3UO8B 2FRDC 4QJ5A 3ICEA 3W2TA 5FDFA 3IBSA 3GFFA 5KX5B 4HJRA 2ZRAA 3OTWA 1UQRA 3KSDO 2OYCA 1KAOA 1C0KA 2JGEA 3N2KB 3N2LA 1E1CB 2WMDA 1QONA 4TYYA 4WA8A 4KGVA 5H3LA 3SKXA 3C3XA 3EGXA 3IS3A 1LK5A 2YW9A 3QX7A 3W9YA 1BS2A 1BHQ1 3IO5A 3IJPA 5MN4A 2GUWA 1O6BA 3LK7A 2E1PA 3QE2A 5EMHA 3NZEA 3HB0A 1OFTA 4FUQA 4RJIA 5K51A 5JARA 2FLVA 2GXUA 2PLNA 5IZCA 1JQDA 1K4KA 3B12A 5FULA 3KD2A 2FY8A 2Q4BA 3ZBUA 4NE9A 3P32A 5LZ9A 3V55A 5UKDA 3HXMA 2DULA 4I5EA 2XZTA 1PR9A 3JVIA 2IHVA 2O2EA 3KVOA 4YAUA 3NEAA 1SC6A 2G5GX 5KOHB 4FX2A 3R0ZA 2A92A 2NZVG 3JD0A 1GPAA 5ABPA 2NUTB 4I4LA 3IUPA 4PO1A 2FN4A 4QWWA 3ODPA 2FMTA 3DVAA 4FCWA 4K5QA 1RYNA 4GG1A 5JNSA 1RW4A 4A8JA 5GV8A 2XVMA 4OLAA 1XDGA 5DNVA 1KYVA 4GO1A 1EX7A 1SBCA 5FTWA 4V02A 5JEDA 5KDLA 2KE5A 4MP8A 2B30A 2RDMA 1IY0A 5EMKA 1KY4A 3CUEF 1C41A 4KHZA 3DJYA 3GFOA 4PSUA 5M3BA 2Q8QA 3TNDA 3ZWVA 4EHJA 2CF6A 1GCUA 4UTRA 3TMAA 4A36A 4F12A 1NBEA 5HKOA 1VL6A 2W2TA 3DE1X 3L8EA 1EX6A 4DIEA 2Q5JA 4R7ZA 4LCJA 1W94A 1AD2A 3K1AA 3JYNA 3Q41A 5BWCA 1KMHB 4BO0A 3BZBA 3SOPA 2X8WA 5HJEA 4BNFA 2YQ5A 3ZU2A 5JAHA 3BWCA 2AMJA 1QGDA 1Q1GA 2VCEA 3AXTA 3FKSD 4CQJA 2O3SA 2V6IA 2JFYA 3GFSA 3JVEA 3ECAA 4J4TA 1YCFA 4RPGA 5KMGB 1L5MA 4RVFA 4P4SA 1U5AA 5K3SA 1T25A 1IPHA 2HV9A 4V0NA 2L42A 3DBRA 1HL3A 1T9HA 1MNQA 1CFJA 4W8GA 3SZ3A 3P0RA 1P2DA 5KNBD 1OREA 2QTZA 4EF6A 4EO9A 3LZ6A 4CUKA 3O1HB 3QBVA 3F3KA 1XTVA 3H2GA 3FMGA 4YP1A 2H6EA 2AVDA 4GNKA 3GT3A 5FL7D 4IHJA 3VNSA 5CEJA 3EVAA 1QTQA 3VPSA 1YR1A 4QO7A 2CXXA 2GT1A 5L6MB 3QE9Y 3E81A 1KQPA 2PM8A 2YXLA 4OXXA 3ROMA 2REXB 4M83A 3IAS6 2GETA 4AZ0B 1WSBA 1CZLA 2FSIA 4XZ3A 3DYBA 3SF8A 1B42A 3DAFA 3L07A 5I4KA 4P4LA 1BGWA 1KPGA 2OLEA 2WSBA 1P2FA 2VSQA 1RZRA 4OSPA 4D4KA 1QC5A 3KT6A 4BEWA 5LOVF 1DUVG 2RBGA 3H11B 2BDEA 2P9ZA 3UHPA 4BLSA 2YBDA 3H2SA 4IIFA 1S6YA 1OAKA 3D3EA 4WFIA 1DXQA 2JCVA 2VDWB 4JB2A 2NUAB 1CE8B 2Y27A 2YV3A 1LZLA 3LVQE 4UCWA 3QWBA 4IDQA 3HJCA 4YJFA 4ZU1X 3QTBA 5GZ6A 4OHYA 5THXA 2H2FA 3AEQA 1HDIA 3ORQA 4EPVA 1GN8A 2B1JA 2C9MA 3PFGA 3PL5A 4U0JA 1WBDA 1TK2A 4R7TA 2QP9X 3GJZA 2XE8A 3ETGA 1ARZA 1J9GA 5EXDA 3QXXA 5K3AA 2DUNA 4PRZA 5LR6A 3RAPR 2ZAGA 1SUBA 4M87A 2FZLA 2GSWA 3ZNOA 1HV8A 1L6IA 221PA 1DGQA 3PNYA 1VFNA 3KVRA 3AUJB 4D3YA 3BQMB 3KLPX 1QIJA 3KQLA 1GG5A 4BFYA 3GF4A 4D0RA 3MS4A 4O4HB 2GEFA 3AILA 3A9UA 5CD9A 1AMUA 4OJKA 1AV6A 3DEKA 3HFJA 5BVHA 3TZCA 3WMEA 3MBKA 3OHSX 5H1YA 4G0NA 3W4IA 4FE4A 2XOEA 5JH7B 2XGGA 1V3UA 1R6BX 4WCVA 5ES3A 5KCZA 4JI4B 2QX7A 4KRYA 4YRJA 3AR2A 4BP1A 2C4WA 1RLOA 3A32A 4Q82A 5FORA 4TUYB 3ZOZA 3H16A 1Z7BA 2G9ZA 1NTRA 3C5EA 5TRTA 3TOCA 3VKUA 1ND6A 2WHXA 4KQWA 4XWYA 1H66A 4EUSA 3TRDA 4YLYA 4FOSA 1MHPA 4J76A 4E3ZA 4MIKA 2XE7A 2G4VA 2XUHA 4RZHA 1BJKA 3FZGA 2QLTA 3CNQS 1D9XA 1HLPA 3EQ7A 4RNDB 3T7JA 4ZI7B 5F9HA 3QEKA 4ZRMA 5IT9A 4E4RA 1QIMA 3T3MB 1GUAA 3IQXA 4RQBA 3IAAA 1XNQB 5LM3A 5GZ3A 3D0KA 2QQ5A 3C7CB 3G6KA 4PX5A 1AKNA 3LX5A 4QJBA 2HI0A 1BJTA 1YKFA 3HA2A 1H85A 2JGKA 2NYRA 2XSZD 3R3HA 4BQEA 4ER7A 3IR5A 4EYQA 1XRSB 1CUDA 1Z17A 2GF0A 4YO7A 3EDCA 1I6MA 1EZZA 3FHLA 3H13A 4D80A 4W63A 4AP9A 3G2QA 1RC8A 5JADA 1UBHS 3NLLA 1LUAA 4BX9A 5D84A 1JQJC 1OQAA 2CBGA 3QPWA 4X20A 5D6NA 1JTFA 2ACWA 3UJPA 3LBAA 2JAQA 3DM9B 1NXTA 2GHIA 5HM8A 1OUMA 3H1FA 2OHVA 4CNQA 2A0WA 1ZR4A 1I1HA 4HGOA 3C3YA 4EPWA 3SP1A 4V39A 3G2HA 6AT1A 1KVQA 5DLDA 3VPXA 1UMCA 2I4TA 1IHOA 3ZEAA 3JYOA 2O8NA 3KZOA 2B3DA 4K9QA 4MTLA 1ODJA 5CW1A 4EARA 1K08A 1G19A 1UBEA 2W2KB 3M5WA 4C3ZA 3BWYA 2YMLA 5JT1A 3DE0X 2QVCA 1F51E 4C14A 3B52X 4LY6A 4DTCA 1Y3AA 5HX7A 5A0VA 4F4JA 5TF4A 1CF9A 3AEKB 4A6DA 1C3JA 1HEYA 4HRYA 1AZSC 3OEED 4V0SA 2PGIA 3G8AA 4KXFB 2XDWA 3PFWO 4HDMA 2XSZA 5CFOA 1U2DC 5DNEA 2NZ2A 5HS4A 1IFXA 2FFHA 2H5IA 4D43A 2R6GA 4PR0A 4N1AA 4OFXA 1XZEA 2RAPA 1K88A 1MB0A 2TSYB 3HA3A 3B7GA 4Y1GA 1X1RA 4LI0A 4MQ4A 5LA6F 5IXJA 5J1SB 3JWHA 4TQAA 1CF2O 2O0LA 2X4IA 4WK2B 3FRIA 1X7XB 4ONEA 1WBBA 3K0AA 4IO1A 4RA9B 3RODA 3TGWA 1KFEB 4UQOA 3UICA 2O8DA 2HCBA 1R9NA 1FPMA 2PO5A 3G2OA 2PZGA 4ZVLA 2HIAA 1WL8A 3P8ZA 4RIHA 1UXOA 4BNIA 3DYIA 4ENSA 4ZI2A 1FU7A 3DULA 4M1WA 3AZPA 2C3YA 4MLDA 2GD0A 2I80A 4IIJA 4QNMA 1DQPA 3ZVNA 3U5TA 3P4UA 4LK3A 4FOLA 2DPYA 1R9JA 4GL4A 2G67A 2CNOA 4J91A 4KRGA 3GGGA 2NPFA 3FOWA 3A25A 2I6SA 3GZ4A 3Q3CA 4OSOA 3V7YA 4P3PA 4R40A 3DOOA 3M1AA 1PG5A 1XCPA 1F2TA 1XTUA 2K87A 1E63A 3PYMA 4QFMA 1SHJA 3OEEA 5F1PA 4IGEA 3N8KA 3IILA 3T5BA 5K8JB 4QOEA 1B16A 1E61A 2OCKA 3LA8A 3LNCA 3CRRA 5FBKA 5C0OE 3A1FA 3FSRA 4PVDA 1MH9A 3WWCA 1HDGO 2GN8A 2ERCA 4U02A 4DJDC 4DIBA 2QWXA 1KFJB 3HNPA 1QIHA 1R8QA 3FPSA 5AWFC 3COZA 4DLAA 2DQZA 4YMLA 1FIUA 4QDKA 4DAEA 4CEIA 1CBUA 3G8BA 1XF9A 5HE8A 4N41A 3SNHA 4YB8A 5AJTA 4N6NA 5CPFA 3S2IA 3I9NA 1PL0A 2APJA 3KT8A 1T1SA 1XTTA 3P7MA 4XB1A 2DFLA 1L4MA 4RKRA 3DLAA 4D56A 4QPJC 2AKEA 1KZ4A 1JV2B 1I14A 4IMIB 3TKLA 2FE4A 3U4DA 3EPKA 1P1IA 1GTZA 2RHOA 1TQ6A 2Q4RA 5KYGA 5LWHA 4WZ6A 1DIGA 3H2YA 4CETA 3EC7A 1ZD9A 2OORC 2ZWOA 3OJLA 3OPQA 4LBWA 4HN4B 1Y48E 1MAWA 1BYUA 1N5LA 1PJTA 3NVAA 3T6KA 3IDAA 2GNAA 4ZKEA 3F90A 3DE3X 2HBYA 2WJZB 3PQ6A 2C7BA 1XAHA 2EYQA 4JIMA 1Q84A 3E4DA 4D9HA 1W76A 5HZMA 2GN2A 1DAKA 4WKOA 1SZCA 1S4MA 4NPHA 4C3VA 1EK0A 1SIUA 4KH0A 3QIVA 2FPMA 2NUPB 2PAFA 4RMHA 5I4BA 5KAMA 2PL5A 2ILVA 3SFTA 1FY2A 2OKCA 4N39A 1Z4OA 2QTAA 2X0RA 1F3LA 2FWJA 3U16A 2FEXA 2ZRBA 3KWMA 1EVJA 2B20A 3KEFA 3MJRA 3Q3EA 4I8IA 3UMBA 5HIAA 1GKYA 3VPGA 5A1TA 4TQ9A 2YS7A 3MINA 5E4FA 1G6HA 1O9BA 4RHXA 3WWOA 4YT4A 4I46A 1VB5A 2OG2A 4D9CA 5B6IA 3VDMA 3H18A 3LKBA 1W5TA 3DTYA 3FWPA 1FYXA 1R0YA 4YRRA 5J43A 4DR5B 1SUCA 2W8BB 5CTJA 3VDXA 1U6KA 4BGIA 4BLUA 1ACMA 1U9ZA 4BQOA 1L7EA 3R6DA 3NIWA 5FLEX 2OXEA 1VG9B 2WWGA 1BE8A 1G8FA 2OCGA 1FEZA 3ACCA 2O52A 2JFVA 4Z9FA 4JMPA 4Y98A 4YP0A 3GRUA 3LCRA 6LDHA 4NBKA 5HOEA 1XVLA 2LPMA 3BHIA 3OIDA 1D5CA 1ZD4A 2QLFA 3ADDA 1W5FA 2GPWA 2KMLA 3T5GA 5K3BA 3ZHXA 1VQ1A 1IM2A 3JZFA 3ZE8A 3RHSA 2BEJA 2IFTA 1NPDA 3TIXB 3CHYA 3MGBA 2IEGA 4D9JA 1GU7A 3KVNA 3OY2A 5JAOA 1WSAA 3MBOA 1N77A 2XE6A 3EE6A 2QVGA 2WJAA 4FGWA 3RS3A 4LYFA 3WLNA 1M5TA 4WXRA 3GPLA 1MX1A 1R6TA 1I3LA 4GPZA 2A3RA 4P35A 1R2QA 2ZBDA 3O31A 4XUEA 4BMXA 2W6OA 1C4XA 1KO4A 2ZW9A 3DWIA 3PDIB 4D8WA 2VNHA 5K03A 1M54A 2C4VA 4MS3B 2IUEA 2VDMB 2HB6A 2CC2A 2ES4A 3KHTA 4X8LA 4D74A 3CRQA 1KZ9A 3V33A 2I9PA 1IVYA 4ZN6A 3H65A 4MPJA 4PYLA 3LFTA 5FUVA 4AKHA 3GGCA 1TW2A 2PXXA 2UVPB 2QVYX 3ABQB 5BR8B 3IQHX 3BB3A 2MINA 1H8ED 2RBEA 3MYRA 3WRXC 4I9UA 1WQ4A 1USUA 2IBMA 2Z9DA 5DH9A 5AW6A 2UYHA 4DDKA 3IXLA 3KS9A 4K9DA 3Q9LA 3X1XA 3J81k 4O2AF 4U63A 10MHA 2ZUSA 4JLDA 5L45A 4JJ7A 3H3FA 2FPRA 2IS2A 4YV2A 2WM2A 2D1TA 3LDUA 2Y2VA 3UHJA 1L4FA 3AM5A 4QBTA 4UMDA 4UMEA 1OA0A 5AOAA 3RJ5A 3SJBA 2H4YA 3ND7A 1QQ5A 2IL1A 2IHTA 5DXFA 2OQVA 3STUA 3ISJA 5IX8A 1GRNA 2FG5A 4EEKA 5IVDA 3NBXX 3JQGB 2O4UX 4JVNA 4HMPA 3SCZA 2GRUA 5E1MA 1U11A 1YJ8A 5FOUA 3WZMA 2GCNA 3VVBA 3SQWA 3COYA 5JATA 3UMMA 4GPD1 2J32A 4FIDA 4TS3A 4A0RA 1A7AA 2QQFA 3K6SA 3JASA 3M6XA 2ZTVA 3H5WA 3QU2A 4KZKA 4M76B 1EZ4A 2EGHA 2I3ZA 2VPIA 3FDJA 3FUTA 1IHXA 2QZ4A 1TZCA 4QNNA 4YI3A 1OR8A 3WLSA 2ATIA 5CT5A 4JHXA 3R7WB 2G1AA 3I76A 2J09A 4LDPA 5AKEA 1G60A 4A8PA 1MC5A 4RENA 4IIVA 4ENUA 2O5CA 2CHGA 3NCHA 3SE0A 1D2GA 3KUXA 3H0EA 1K6IA 3Q7IA 4P83A 3C14C 2W5UA 4ARUA 1QK5A 2HWUA 3B20A 1IEVA 3RM3A 2R1TA 3N28A 1RMYA 1TVKA 2GAFA 3L1UA 4M1QA 1QIFA 4LDJA 5F7ZA 1SB8A 5A7GA 1H8EA 4KU4A 4C03A 4DRYA 2VHXA 1Z6QA 1IQ0A 5IVKA 2QTWB 1Z5OA 5DM4A 3WJ2A 1D2AA 2DQYA 3ZCRA 4CTMA 1N75A 1JG7A 2C8VA 3EN0A 4I4CA 1DIAA 4L7VA 4FYHA 3WSVA 4F6LA 3AUSA 1EP3B 3U3MA 3HGQA 3NNNA 2B4RO 3TZQA 3WYCA 4CT0A 1P4GA 1PVDA 2VA8A 4OHCA 1ZESA 2GEDA 3C8ZA 2VNKA 1JI0A 3O83A 4GQAA 3RBVA 4FGJA 1NY6A 2DU8A 1M34A 3L7KA 2J48A 4NULA 2DWPA 4A9AA 3FTEA 2J8ZA 4B74A 1QX4A 3D0OA 3FPKA 3K9CA 1IOWA 4BEJA 3GARA 4JWKA 4LWQA 4Y1EA 1M34E 2FWBA 5AJYA 1FDIA 5IJ0B 2D6FA 4BLQA 2R00A 3E15A 1JLHA 2O0JA 3WV5A 1R27A 4BJHB 5CT8A 3EX7C 4LWPA 1O2DA 1V9LA 1ZEJA 3LUHA 4FBLA 5JO9A 4XWWA 1JH8A 3H04A 4AQDA 1ZSNA 2H1WA 1HDYA 3IESA 3QWFA 4FWIB 4MUFA 1A4IA 2F9LA 3K4QA 1S3GA 1M6YA 2CUNA 1EBBA 4OYHA 5CCXA 1S9HA 5A0TA 1TIKA 3LRTA 2GEVA 2ERYA 2VHJA 1DPFA 1C80A 1AKVA 1KRXA 3V8RA 1I80A 2HJGA 3K4PA 7YASA 5LOVB 2PPVA 1L7OA 4HO1X 4Q1FA 3F1KA 2QDKA 3KYBA 1RPTA 2HHLA 3ENKA 4L4XA 4JI6B 1J0EA 5AHRA 3T38A 3IQIX 2QMHA 3N7UA 5BV1A 5KOYA 2NU9B 4BMYA 2VJYA 2PKQP 1JL3A 4Z7OB 1YFZA 1WY7A 3TAUA 3HYTA 2P3SA 2JZOA 3KZMA 4ABYA 4B83A 1DRKA 5EP1A 4J1SA 2R4QA 1E98A 1X39A 1HYBA 4UBIA 1VYHA 4TTQA 4FYJA 1Z74A 3R5KA 4ZRDA 1GNQA 1L7BA 1NW6A 2Y4NA 4CPDA 4ETWA 4W9MC 4BFZA 1Z45A 3E9CA 4I9FA 1SU6A 3ASZA 1UXKA 4PLWA 4TXLA 3SJUA 1XDWA 2VP9A 4EJMA 1BCSA 4GEGA 4HRAA 4R05A 5A3QA 2I2DA 4PF1A 4OCZA 3THWB 5LQKA 4PO9A 4G5HA 1YBAA 3ZQ4A 5IJZA 3OPNA 1HNXB 3ELDA 1U2GA 3RVOA 1BVUA 4NENB 3RIGA 3SVTA 4JUCA 1DRVA 3H7AA 2PIAA 3NWEA 5K3OA 1XIVA 4G5SA 2OFOA 1KJ9A 4MUNA 2J33A 4K1XA 3U4AA 4EECA 4F5YA 4J16A 4YRNA 1WB4A 1IN4A 1KJIA 2V7QD 3UXHA 1YH3A 1HC7A 1T5HX 2P68A 2YFKA 2MYPA 1YDGA 2YMMA 1G20A 1G41A 3D81A 1O4WA 3ZHSA 4AX4A 3LIIA 1GU1A 2WE8A 3ANTA 3C4QA 4IAOA 3JALB 4YBRA 3RHFA 3U7QA 3WGYA 4ACAA 2DT8A 3TPFA 1G20E 1JEYA 2GM4A 3PXDA 1PJSA 1XUOA 5K0JA 1QK3A 1XA4A 1NN1A 3R5TA 4UREA 3V4VB 2G25A 2XB6A 1IJBA 2O05A 1IY1A 4NTZA 2H11A 3KU1A 4KXMA 4HLNA 3ESCA 4ARZA 1VSUA 3L8CA 1HT3A 4RSMA 2GPAA 3RFXA 1PFUA 2CY0A 3USCS 2GJ9A 1J09A 1ZKDA 3BBLA 1YD7A 2IZ5A 1TPYA 1ZRSA 3WL8A 3OVMA 1Y6ZA 2W6CX 3Q7QA 1C7QA 4UPDA 3SSOA 4CQNA 4TTJA 4K28A 3S0JA 4E1AA 1F3OA 2GI4A 3OF2A 1WCV1 2EKQA 3GJ6A 2BGMA 1JG2A 4ZVPA 3WQSB 3M6LA 3R8XA 1UEXC 4QYMA 1SNYA 1LDGA 1Z13A 1D2RA 1F8GA 2JI6A 3OOSA 3PV0A 2F17A 4WECA 4L9WA 2EGGA 621PA 4CCSA 3CMCO 5KYUA 2V7QA 1CJTC 5EMJA 1UEJA 4MI6A 3FYCA 4C7KA 2B78A 3A9SA 1VBKA 3KJZA 4QYWA 3LPCA 4FT4A 3KQMA 1IVNA 1PWXA 1DTSA 1HDCA