1ENOA

Brassica napus enoyl acp reductase/nad binary complex at ph 8.0 and room temperature
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
297
structure length
297
Chain Sequence
LPIDLRGKRAFIAGIADDNGYGWAVAKSLAAAGAEILVGTWVPALNIFETSLRRGKFDQSRVLPDGSLMEIKKVYPLDAVFDNPEDVPEDVKANKRYAGSSNWTVQEAAECVRQDFGSIDILVHSLANGPEVSKPLLETSRKGYLAAISASSYSFVSLLSHFLPIMNPGGASISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKQNIRVNTISAGPLGSRAAKAIGFIDTMIEYSYNNAPIQKTLTADEVGNAAAFLVSPLASAITGATIYVDNGLNSMGVALDSPVFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Common themes in redox chemistry emerge from the X-ray structure of oilseed rape (Brassica napus) enoyl acyl carrier protein reductase.
pubmed doi rcsb
source organism Brassica napus
molecule tags Oxidoreductase
molecule keywords ENOYL ACYL CARRIER PROTEIN REDUCTASE
total genus 101
structure length 297
sequence length 297
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1995-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1enoA00
1FDVA 5IZCA 3JQAD 3VPSA 2XOXA 2D59A 3I9KA 3LLVA 1HE5A 4KTTE 5B4TA 3ICCA 5JAMA 1H9BA 4J1SA 4XWYA 3HNPA 2JAHA 4YJFA 4RPHA 4RPLA 1R0SA 4P22A 5ES3A 3Q2KA 1HE2A 1MC4A 4D41A 1PGQA 2P9CA 4WPGA 4ZQHA 1KIFA 1R16A 1QG6A 1TVEA 3WYEA 1TT7A 4J3FA 3ZWPA 4CLRB 4GWGA 2B69A 3I4CA 3AI3A 3KB6A 1LTHR 1Y8QA 5CPFA 4GKVA 1DHTA 4BNTA 3GVIA 2IZ0A 3CKYA 1HSZA 4L4RA 2I9PA 5DT9A 4PLWA 4PZCA 1HETA 5THQA 1I01A 1PQUA 2H5LA 2D4AA 1ZNQO 4YA6A 3C1OA 1P74A 4PZEA 1DHRA 4RORA 3WICA 1T25A 3QE3A 2ET6A 3JTMA 3DZJA 1RM4A 2I3AA 3EUWA 4CMEA 1UXKA 1X7HA 1E3LA 4YVFA 5EMHA 5ILOA 1VL8A 1BWSA 1MA0A 2FR1A 2JAPA 1Y9AA 3RC9A 2CVOA 2HCTA 5LDGA 5JE8A 1UXJA 4OKNA 3ZWAA 1HL3A 1ZCJA 3UCEA 3X2EA 3MTGA 4MKXA 1H9AA 5A03A 2IYOA 3ETDA 1NQAO 4H3VA 1NQOA 5G0TA 4IQGA 1DIGA 1SZJG 3TFQA 1N9GB 1H6AA 4QTZA 4J4HA 2QHXA 3RUAA 2WYWA 3MWDB 2PNFA 3BTUA 4FR5A 4AICA 2XXBA 3WOHA 5BR7A 4DIBA 4CMIB 4FDAA 4BKQA 4M1QA 3W8DA 2V65A 3HN2A 2NTJA 2X5OA 1JA9A 3WG9A 4ZA2A 4MDHA 1E7QA 4E30A 1OFGA 4R5HA 4J49A 4R51A 2AEMA 3WGTA 5L53A 2ZB4A 4BGUA 3JQ8B 4QO8A 4A2CA 3CPSA 2JD1A 1MX3A 3C1AA 3BTOA 1SNYA 4FS3A 4W99A 4YT4A 4XR9A 3BHIA 5TX7A 3H3FA 4R01A 4OHUA 5EINA 2WE8A 1BVUA 3QQPA 3W8FA 2ILTA 1BW9A 3NX4A 4KP7A 4YJHA 1W73A 4K9DA 2O3JA 3M1AA 1VKNA 2CDBA 2VWQA 1DRUA 1FDTA 4CR6A 2OBYA 3ANLA 1DFGA 4RQTA 2OGUA 3F9IA 3BTVA 3LSYA 2GLXA 2J5RA 3GDFA 4JNKA 5TGDA 1YGYA 5JAIA 3AM4A 4Q3BA 2PKRA 4B7UA 3DR3A 2G76A 1KY5A 4ZN6A 4IDCA 5A4DA 4LRSB 4QXMA 1GUZA 3S2EA 2E48A 3RBVA 5T6BA 3OA2A 4E2XA 2F1KA 1UDAA 1AXGA 3I9OA 3KOUA 3PVZA 1QYVA 3PFFA 3HDQA 3JD0A 3ZGYA 5GMOA 2DVMA 3S1LA 4Q3AA 1P9LA 4AJPA 2HDHA 3K9QO 4H7PA 2PKQP 4A5OA 4NPCA 4BNGA 5HTOA 2XF8A 3PDUA 4EZBA 2OOSA 1B15A 1TT5B 3WX0A 2O3UA 1DFIA 4URFA 2HAEA 2C5AA 2HK9A 3E18A 3EVTA 1NPYA 4YXFA 4JBGA 3DOJA 1DIBA 3TL3A 4R41A 1ZW1A 3KO8A 2OUIA 5COAA 2C5EA 1PWZA 1UZMA 1PS8A 4PRKA 1IUKA 5DCYA 3LYLA 1EVJA 4UULA 4J7UA 2GRAA 3GPDG 1N9GA 1JVBA 1ZJYA 1ZXLA 3DZGA 3GR6A 4UVHA 4J1NA 3IJPA 4Y98A 3DTYA 4YYZA 1C0LA 3F4LA 3P2YA 3TZ6A 4AG3A 4D0RA 2E49A 3GAFA 4IXWA 4WLEA 1C0KA 4UUMA 1XYGA 3DXFA 3SC6A 1PZHA 1PQWA 1VI2A 1LRJA 1NASA 1X7DA 3MJVA 3S55A 5JAZA 1XIVA 4EEZA 2GZ3A 1DLIA 3E82A 4OXYA 4RZIA 2WD8A 3QWFA 2ZJ1A 1Z74A 4J16A 2NU6A 5DOVA 2DT5A 1SOVA 2C59A 1R15A 2G17A 1PU2A 4Q3DA 3E6AA 5CEFA 4PG6A 1H0KA 1QLHA 3DMTA 1XG5A 1H5QA 3LDHA 1GYQA 2X23A 1JKJA 1KY4A 1PJQA 2R00C 1PJBA 3PQFA 3ITDA 3QIVA 3EMKA 4KUHA 3WFJA 3TFOA 1RM5A 5I9NA 3ZWOA 5IDQA 4IS3A 2Q2QA 2EHDA 2Y0CA 1O0SA 1LSOA 1HYHA 1O95A 2ZB7A 3QVWA 1BSVA 2VNAA 2DUUA 1UDCA 2DFVA 4FW8A 3AJRA 4MPDA 4WEOA 2B5VA 3KZVA 1YRLA 4NBVA 1ZSYA 3RUDA 4OXNA 4EUHA 3F1KA 1RPNA 1N8KA 3LF2A 1UDBA 1QYCA 4UEOA 4HFRA 3Q2IA 1QMGA 9LDBA 3LZ6A 2Q45A 3SJ7A 1OOEA 2CNBA 1AHHA 4D45A 2VUUA 4LN1A 1DOHA 2A9FA 5HBRA 4F6LA 3GNTA 4XGIA 3D64A 4Z6KA 1YDWA 4FBGA 3FN4A 3IJRA 4GWKA 1KOLA 2ZTUA 3FR8A 1QORA 3VHRA 1PJ2A 2R6JA 2NVBA 1ZEJA 5IN5A 3NDIA 1VE9A 2B4TO 3OM9A 4XJTA 3DOCA 2Y1GA 2ZKLA 4CR7A 3ADPA 3K31A 3S2FA 2VNSA 3IP1A 5KVCA 1E3SA 1GEGA 3LLSA 1Q2XA 3GAZA 2HRBA 4PGFA 4LSWA 3NGXA 1NNUA 4IGEA 4BUCA 4WCDA 3GFGA 4MVJF 2V6MA 4IXTA 5JDCC 4ZQBA 3VC7A 5JDIA 3KETA 4ALJA 5B4VA 3VPHA 5T64A 2OHXA 3DZBA 1K3TA 4WOJA 5JYDA 2YFHA 4BV9A 2WE7A 2Q46A 3W4KA 4E12A 5HS4A 1JAXA 2UVDA 4WLFA 5IXYA 4CM9D 4R69A 5CDSA 2D0IA 3RI3A 4XEHA 3FTPA 4O1MA 2WWRA 1I32A 2GN9A 3MJEA 3OIGA 4R1TA 3C24A 3SC4A 4BS9A 4W7IA 2EKQA 4TKMA 4Q9NA 1RYDA 3DBHB 2BGKA 2ZTMA 3LVFO 2Q2VA 4PLZA 3WLEA 3UN1A 3DC2A 4ALLA 3TWOA 5ENDA 1E7SA 3U4CA 5DBGA 2PZKA 3F47A 2VUTA 5LDHA 2HMTA 3WGHA 1Y81A 1T4BA 4W82A 4DLBA 3H6KA 1D3AA 2FZEA 4N5MA 5H83A 1HXHA 3DAFA 2CUKA 4JQCA 1LA2A 1PR9A 1VLLA 2JJYA 2NLOA 4BNIA 1GADO 1Y8RA 3KLMX 3OHSX 1UP4A 5FWNA 1DFHA 3EY4A 3LC1O 4KTVE 4IBOA 3GVXA 4IQ0A 3INRA 1B14A 5F1KA 4QSMA 5AXBA 1KVSA 1KYQA 4BGIA 1G0NA 4CM9A 1P1FA 3JQBC 3AUTA 4A0SA 3OIFA 3OIDA 1KEPA 2OO5A 5CPBA 5TNXA 3WGIA 3BMQB 3PP8A 1WDMA 1YH3A 5T57A 1WMAA 6LDHA 1EQ2A 3PQDA 3HSKA 2WJPA 4Z0TA 1EFKA 3D5QA 4IUYA 1AHIA 2QRJA 3HB5X 3VDQA 5TLSA 4AJNA 1QLJA 3QVOA 4XGKA 5F5LA 4AJJA 2QIOA 1YWGO 4TZTA 4UUNA 4EI2A 1ADCA 2P91A 3QY9A 4IMRA 3STHA 4CLXA 1F8GA 3GVHA 4AJIA 2QZ9A 5L40A 2B37A 3H5RA 3L6EA 3ZWBA 3JYNA 1MXHA 3ZNPA 1PJ4A 3AU8A 1C3VA 3JYLA 1I3LA 3INTA 2AA3A 4L0QA 4ZICA 1L7DA 1V0JA 5JC8A 3D1LA 3VTFA 4NFSA 1BDMA 4OM8A 4J2HA 2Y0EA 2FPIA 3GG9A 1RKXA 4MKZA 4RVDA 3ZI0A 2YW9A 2DU8A 2IEDA 3ROKA 1DEHA 5TJ9A 1OAAA 1YOVA 4JXKA 4OYRA 1BVRA 1F17A 3B1FA 4YDRA 3WYCA 3IIEA 4J0FA 5A5EA 5BQFA 1UAGA 1QYWA 3TZKA 3OEYA 4DA9A 5TIIA 4OO3A 1PJ3A 4NHEA 3AM5A 1GD1O 1I2ZA 3V2UA 4W6ZA 1YONA 4FJ1A 1X1TA 5JNLA 1NQ5A 5IG2A 4PLYA 3ENKA 3Q1LA 4MVJA 2A94A 5KCZA 1GCOA 1G0OA 4BQPA 3FNGA 3VH2A 1KVUA 2O3SA 1J49A 3KUXA 1DDOA 2ZIZA 2D5CA 3FR7A 1JW9B 3ROPA 2FPPA 2HLPA 2VT3A 2CY0A 1BGVA 5C7LO 2BI8A 3QWBA 2WD7B 4EYEA 1MG0A 4EUEA 4BO5A 3H9UA 2QQ5A 1VM6A 4CODB 2FR0A 4LW8A 1U8FO 3FNHA 3OJFA 2X9VA 3V1UA 3OQBA 4XIJA 3PZBA 4EJ0A 2CF5A 2AG8A 4JN6B 3T4XA 2Y66A 2PKQO 2BRUA 3WQQA 5BSEA 1E3WB 5C3MA 4BNHA 3JQFC 2DKNA 4LMRA 4MP8A 4PRLA 4FQ8A 2FHSA 3HADA 1OI7A 1U7HA 3DBRB 5G0UA 3GQVA 5KNLA 3PRJA 3ZNQA 2HMSA 1U2GA 3F46A 4BO3A 3DONA 3EZLA 1KBZA 1KEUA 3N7UA 2Y1EA 3NTQA 1ZH8A 3G17A 3NGLA 4FIZA 4IZIA 4QEDA 2WYVA 3SEFA 2FPGA 4EGFA 3WFIA 4GAEA 1CERA 2VYNA 1WMBA 1YDEA 5IF3A 2H9IA 3OFSA 1D8AA 1RJWA 4F3YA 5CEJA 5K6AC 4BNYA 5CDYA 4UVEA 2FSVA 2D2IA 3TDKA 4YAIA 2HJRA 4PLPA 4PLTA 1RWBA 4MOWA 4Y67A 4XRGA 2J3KA 1U2DA 2EW2A 4CQLA 4DPLA 1E7MA 2W90A 1QYXA 1NFQA 4F46A 2YDYA 5DF1A 1D4FA 2X22A 4LCEA 4WLOA 2GPTA 4GX5A 5KJFA 4R68A 4CQLB 5A3JA 4BNXA 2Y68A 4P4LA 5JW6A 2ZK7A 5L4LA 4OMUA 3UICA 1F06A 3VTZA 2PTGA 5B12A 2BFPA 1ISMA 5L45A 3CZMA 4MVJH 4AFNA 1QKIA 5IDXA 3FD8A 4MVJE 2W2KA 4ND1A 1SBYA 4BO7A 4DMLA 5ICSA 2JKVA 2OORA 2HSDA 2C29D 4G81A 4XQ9A 1BXZA 2C7GA 3V1YA 4TRJA 3QWHA 4E31A 5B1YA 1XA0A 3DZIA 4Q3NA 3RWBA 5CHEA 2GDZA 1UJMA 4NR0A 3KVOA 2Q4BA 4GL4A 4G65A 4BO2A 3WMWA 3IP3A 4LSMA 3WJAA 1B3RA 3GUCA 1EVZA 4FC6A 1XKQA 3ITKA 3VDRA 2YY7A 2HJSA 2QW8A 2CSUA 3P7MA 4WJZA 2PY6A 3PJGA 4XYEA 3TZQA 2VHXA 3QWIA 4CMKA 4M55A 5L95A 4M8SA 3AUSA 3WB9A 2YFQA 4HFNA 1I0ZA 1T26A 4ZD6A 3ZWMA 5L51A 3CE6A 4RLHA 4DBVO 2P2SA 1K6IA 5DDIP 4M89A 3CMMA 1M76A 2UDPA 4F45A 4RVGA 4RQUA 1CQIA 4CR8A 1T1SA 4OQYA 3WGQA 3R1IA 2I99A 1PTJA 4TROA 1N2SA 2Z5LA 1J0XO 1LJ8A 3AWDA 3IUPA 1HWYA 1XQ6A 2PK3A 3O9ZA 4DQVA 5A5FA 3EW7A 2VRCA 3JQ7B 4AVYA 4BL5A 4AJ2A 3JYQA 5JO0A 3I23A 3ZWXA 3G1UA 3JQCA 3KYCA 1LBEA 5C7OO 4KUEA 1LDEA 4B7CA 3LT2A 4GLOA 4PG7A 5A06A 3CH6A 3IDSA 4HP8A 1JWAB 4YRBA 2Q1TA 1LLUA 3P19A 3GGOA 3GFBA 1R37A 2BELA 2I66A 2PZMA 3TOXA 3PFWO 4M86A 1ZKMA 1E6WA 3EK2A 3M6IA 1ZMOA 1H2HA 3O26A 4BNMA 1E7RA 1YB4A 3AOGA 3PWSA 1MXFA 1HE3A 2VYVD 4D0SA 2HKIA 4IJKA 8LDHA 3B6ZA 4LRTB 3Q11A 1BXGB 4OSOA 4CMBA 3BMNB 3GZNB 4NBTA 2HU2A 4J1QA 3KXDA 2ZCVA 3PI7A 4BO0A 4NBWA 4CUKA 1CF2O 5CAEA 5U1PA 1NWCA 2EGGA 2ZATA 4EW6A 1IE3A 3ONDA 1BXGA 1K89A 3EYWA 4M87A 5I7VA 2W2KB 2X5KO 3RC7A 1ZZEA 2B83A 1PS9A 3B20A 4IINA 4NK4A 1O9BA 3OICA 1XSEA 3PHGA 1XR3A 4XYBA 5L3ZA 1JWBB 3HE3A 3ICPA 5JO9A 4UVGA 2O7SA 5AXAA 1HRDA 4PFJA 1N5DA 2OP1A 3QHAA 4XB2A 2P5UA 3L9WA 3BHJA 2FSSA 4EJ6A 5EERA 3V1TC 3K30A 4B3JA 5G4LA 4BMVA 4BO8A 3L4BA 5KJCA 4GX2A 4WUVA 3MOGA 5ER9A 1P1IA 2GGSA 3T4EA 1A7AA 4B4WA 5BNIA 4CM5A 3MJ4A 1KERA 5KJ6A 4DVJA 1I2BA 3FNFA 4HY3A 4MVJP 1H93A 4XRRA 4CLRA 5A02A 3KYDB 4RLSA 2FWMX 1Y8QB 2OP0A 3HQ4O 1NX6A 2W8ZA 3K96A 3UF0A 4BOYA 4LVUA 5TRTA 1RYEA 1NPDA 3GA0A 4DC1A 4HNGA 4FFMA 3WGYA 3M2TA 3WIEA 3KSZO 3ZU3A 3GF4A 4N18A 4PVDA 3OECA 4IPTA 3V2GA 3BMOA 3QRWA 4KWHA 4BO6A 2A35A 3GNSA 1JLLA 3GRPA 2BFAA 4NDNE 3HDHA 1O6ZA 2PH5A 4JROA 2PGDA 4K28A 4U6SA 3C7CB 2WEKA 3AUAA 1NVGA 4HFJA 3VPFA 4GSLA 4NBUA 3PQEA 5J23A 2XAAA 4ALMA 2FMUA 3GVCA 3JD4A 5DBIA 2VWHA 3OMLA 4RVHA 1Z45A 1B7GO 4RF5A 3ZH2A 1VJ1A 1VL6A 3IUSA 3MOIA 4P38A 4PG8A 4KOAA 3RUHA 4AJOA 2E6UX 3S2IA 3GZNA 3PHJA 1I36A 1ULSA 4BNNA 5A04A 2ZYAA 4HX5A 1SEPA 4GVLA 2X0JA 4PG4A 3WIDA 2PWZA 4GMGA 3HDJA 4WCFC 4ZGWA 5HWSA 4XQCA 2D5AA 1ZMTA 2I5PO 3HB4X 3K73O 1DBVO 4IDFA 4Y6PA 3V8BA 2AEFA 5IZ4A 1QYDA 4E21A 1P1RA 3ZWCA 1PS0A 2GN6A 2B35A 1IL0A 1HDOA 4J7CA 3Q0EA 1FMCA 1ZEMA 3BMNA 4Y6SA 4CLHA 3W4IA 2R00A 3JQ7A 3IQDB 2YUTA 2BMAA 1KEWA 5ILGA 3PLNA 2NU9A 5B4UA 5JCXA 2NTNA 2O3TA 4XDYA 3ANMA 2Q1UA 3EZYA 4J4BA 2P4QA 3GT0A 3I6IA 4QQRA 5COBA 5AYVA 4NQZA 4D7AA 5JXWA 3FHLA 4YTEA 1WW8A 4DQUA 2A92A 3NJ8A 2YQ4A 1P44A 1EVIA 3DL2A 4EITA 5GZ6A 2EEZA 5IXSA 1EVYA 1EE2A 1GAEO 3JQGB 5TT1A 4FFNA 2JD2A 3C1TA 1NP3A 2YHUA 1U3WA 2O4UX 1I8TA 2Y1DA 2NQTA 3JQGA 5F1OA 3PDJA 2EW8A 4BIIA 3GPIA 5I9LA 4DIOA 4GQAA 1CEQA 1LI4A 4CM4A 3UCFA 1PGOA 2AQIA 2QG4A 2HUNA 3GEMA 2AQ8A 3GK3A 3FTNA 3DZFA 4NU5A 2BKAA 1IHYA 4ROSA 4U8GA 2HQ1A 3KEOA 3LF1A 4B8WA 5FF9A 4GKBA 1B0AA 1EE9A 2E82A 2AMFA 2X8LA 1E77A 2EP5A 3WBBA 3NV9A 1VPDA 4FFOA 4K26A 1A9ZA 4WCFB 2C54A 3RCBA 1HYEA 4EBFA 3OP4A 1IB6A 4M54A 2NSDA 4J9VA 3AUUA 4IDAA 3ZHZA 3RFXA 4ND2A 4U0JA 3GHHA 4R54A 4NG5A 1R4MB 3NDRA 4KZPA 3BMOB 3CSDA 3I83A 3QW2A 4BB5A 4BKOA 3D3WA 5B37A 5C37A 2EKLA 1P77A 5DP2A 3DAGA 1XCBA 2HMVA 2NNLD 4FJ0A 3B70A 4GH5A 4MVJG 2BFMA 5JDIC 4R1SA 4W9NC 4YAJA 3AU9A 3IL2A 4CMJA 3H9JA 1GQQA 4XB1A 1HDCA 3ORFA 5KJ1A 5MDHA 4XR4A 5F3RA 2GN4A 2AQHA 3B1KA 3W4JA 1PIWA 4J4TA 4AJ1A 1R4NA 1KVRA 2ZTVA 4CMIA 4MVJI 3F5QA 3GMDA 4KDFA 3HDYA 3L77A 4P4GA 1DO8A 2W4QA 3A9WA 2RCYA 3PTZA 4CM6A 1U4SA 5EQFA 3DBLA 5DULA 1O89A 3UXYA 2UUPA 3U3XA 4TRRA 4U7WA 3HUDA 1H6BA 4DMMA 4MKRA 4WASA 1LC0A 3JQ9C 3KYBA 1DJQA 2H63A 4R1UA 4E5PA 4IQ8A 1U7TA 1JKFA 2VOJA 4RF2A 1YQXA 1K5HA 2IDZA 3G1TA 4I9UA 4J6FA 3DBRA 4FCCA 3IOYA 1E1MA 2ZCUA 4BGVA 2NQ8A 1F12A 3DO5A 4BVAA 1PGPA 3TJRA 3LU1A 3WNVA 3GDOA 2NVUA 1LRLA 4Z0HO 3ULKA 1JU9A 5FEUA 2V6BA 4OGWA 2AEJA 1J5PA 2J3HA 1PGJA 1A27A 4J2OA 4LGVA 3U9LA 1P45A 4GVXA 3DDNA 5I7EA 1NFRA 1SOWA 2RIRA 1DAPA 1D7OA 3VH1A 1PGNA 2QX7A 4RPKA 4RVFA 5JS6A 1VJTA 1A9YA 3HN7A 4JJIA 1ENZA 4Y8VA 1C0PA 1R0KA 1PL8A 1XU9A 1Z73A 1GPJA 4WKGA 4RCVA 3TZHA 1O5IA 2YYYA 4G2NA 2GSDA 1PWXA 2PH3A 1SAYA 3Q9UA 1BHSA 3WLFA 5U9CA 1X1EA 3HHPA 1EUZA 3H4VA 3Q6IA 2XXJA 4QX6A 1TEHA 4ONEA 2GZ2A 4RF3A 4FOSA 3RBXA 2J8ZA 3GMSA 4NNJA 4CLOA 4FGSA 3H9GA 3AY3A 4Z9FA 4QO7A 1NR1A 1TXGA 4CQMB 4DBZA 4RVSA 1LSUA 1LC3A 3DHEA 3FSRA 1W6UA 7ADHA 3R3JA 5KVSA 4J90A 4LK3A 4D44A 1I33A 3LQFA 3ZWWA 3W8EA 4EUFA 3KSDO 3FBTA 3GGGA 4Q3EA 3OETA 4IDGA 2QRLA 2Y99A 4JGBA 4JX8A 2CMDA 2AE1A 2HMWA 1Z6ZA 1JN0A 2X9NA 5EESA 3G49A 5A9RA 1GZ6A 4FFRA 1Z75A 1ULUA 2CVQA 1HKUA 3DBVO 4I9NA 4GGPA 1NTOA 2P9GA 2B4RO 2PLAA 3D3WB 3R6DA 5A05A 2X4GA 3R3SA 1CWUA 1E3WA 1VSVA 1W8DA 3FCOA 3O4RA 2X7HA 3ONEA 1YVEI 4PLGA 1VJ0A 5F5NA 4I5EA 4CLEA 2DFDA 3UAGA 2EJWA 2F00A 3JV7A 3VPXA 1XU7A 4JBIA 4ESOA 1V3VA 3NTRA 2PR2A 2POQX 3C7DB 1E7WA 1TB4A 1YQGA 3GZ4A 2NVUB 4AJEA 3PIIA 1A71A 1PEDA 3TQHA 3DB2A 1DRVA 5T8KC 3UHAA 3EHEA 3ZV5A 1I3MA 1R12A 1LU9A 1Z7BA 4KQWA 2ZB3A 4MIEA 2JCVA 5AQ1A 2V6GA 4IM7A 1YOVB 5ICMA 3K8ZA 4O6VA 1GEEA 3GRKA 1YJ8A 4CV3A 4DWVA 2X0NA 5G4KB 2RAFA 3WMXA 2IRWA 4BO1A 1ISGA 2GN8A 2VHZA 3WGOA 5HRUA 4TVOA 4DPKA 1I2CA 2SCUA 1MFPA 4FJ2A 4A26A 5KOIA 4WK6A 4Z3KA 3ETEA 3O8QB 4DQXA 2BLLA 2WDZA 3KBOA 3BXXA 2G82A 5EN4A 2OXIA 1N7HA 4AJKA 1G1AA 1J6UA 4B79A 4FD3A 4YB8A 1U1IA 2P4HX 2E4AA 2VRCD 4YJGB 1NAIA 3E5RA 4W7HA 3DBLB 2NTVA 3WDSA 4BMSA 1HLDA 2IZZA 4OAQA 1ZVMA 3H5AA 4XA8A 1Q0HA 2X86A 4R9RA 4CJXA 1Y7TA 4E2YA 2Y1CA 4CL3A 1OC2A 1HT0A 3VZPA 2W98A 4ZVVA 2VYND 4Z9XA 1H94A 1T2CA 4IIUA 1NM5A 2NWQA 2P5YA 3NRCA 3OSUA 2VTEA 2H1SA 1ENYA 2DQ4A 2UUOA 5EPOA 4FPXA 1IULA 4RGBA 4KMSA 3PEFA 2Z1MA 4YJDA 2BI7A 1LUAA 1IPEA 1ID1A 2X6TA 1H6DA 1UXIA 4FSHA 1PZGA 1DC3A 1O94A 4TWRA 4ZQFA 3ZN2A 4MIYA 4HFMA 1MUUA 1PZFA 1BW9B 4YBZA 2Y93A 4BHTA 2EV9A 1CJCA 1G6KA 4CV2A 4Z0PA 4J43A 4I8XA 4JP2A 1HZZA 1ADFA 5EJ2A 4O0LA 4CMAA 1EEHA 1S6YA 2PZJA 4ZRMA 2HRZA 4YWJA 1NYTA 5JYEA 2DM6A 4TRMA 4DPMA 2X58A 1ZUD1 1DIRA 1H6CA 4WECA 4CV0A 5L9AA 4IJUA 4B8ZA 3JD1A 1YBMA 4IZHA 1JKIA 4W4TA 3RSHA 3DBHA 1P31A 1C14A 4U5QA 3G79A 4O5OA 3ZU5A 4GX0A 1V3UA 1JAYA 3GC6A 3MWEB 2J3JA 1KC1A 1WWKA 2VZ0A 4YT8A 1GZ3A 1UP7A 2JL1A 4TQGA 1ZK4A 3QSGA 5A1TA 2E37A 4L4XA 3GG2A 2PFGA 3RVDA 4G5HA 2YJZA 1LXCA 2OFPA 4ND4A 4JJGA 3GNQA 1FDSA 4YRAA 5AXCA 1T2EA 1GCUA 4A7PA 2P68A 4WLVA 1Y5RA 1EMDA 3OEWA 1R6DA 3AFMA 4R3WA 3P5SA 3G0OA 1DPGA 4RO0A 1Q1NA 3UVEA 1M6WA 4Q39A 3DEYX 2DPHA 2PD6A 3W6ZA 3JD2A 4HV4A 1A4UA 5IAAA 1KEVA 5L4NA 1GUFA 1GTMA 4Q3CA 2VOEA 3AW9A 1M2WA 4BNZA 3E48A 3OJOA 4D3FA 4J9UE 1YE3A 4BO4A 2QRKA 3IMFA 1BRMA 3M2PA 4P8RA 3UH1A 2B36A 3WSWA 2Z95A 3D4OA 2C7VA 3Q9NA 2GD1O 4PZDA 2IEBA 3I9JA 1K2WA 3GGPA 5I7FA 4QFCA 3DHNA 3OF2A 3U0BA 3AFNA 4DLAA 4DYDA 3E5MA 1YO6A 3UKOA 2I67A 3RFVA 4TZKA 2GZ1A 2YV2A 1NFFA 2D8AA 3K2BA 4JK3A 1LDMA 1VKOA 2IXAA 4BO9A 1Y1PA 1IYZA 2HO5A 3NYWA 4LCJA 2O50A 5MGBA 1S7CA 4YQYA 1V6AA 4KDEA 4CMHA 1U9JA 2DPGA 1UUFA 1X0VA 4CLDA 2B0JA 1D1SA 4N54A 4R4JA 5A3VA 2ZYGA 4X54A 1I10A 2BD0A 3RD5A 2RH4A 3UUWA 3WNQA 4GSKA 1WZEA 1OMOA 5JLAA 3G3EA 3KYDA 4ALNA 5A9TA 1E1LA 1KETA 3PWZA 1M6HA 4L75A 2FR8A 4C7JA 5L7WA 1EK5A 2O2SA 4ND5A 3RUIA 3CMCO 4NU6A 4NJOA 3GEGA 1ISHA 5CP8A 3RJ5A 3I4FA 4BNLA 1AXEA 3DFZA 1ADBA 3DOOA 3JQAB 3KSUA 3ROMA 1IZ0A 2VQ3A 4KUGA 1DSSG 1B8PA 1UP6A 2FZWA 3ZV4A 3PJFA 3RJ9A 4CM7A 4M49A 2AE2A 1OC4A 3HG7A 1BTOA 3H7AA 4ALKA 4ZHSA 3L4BC 5TT0A 1CYDA 3H2ZA 4BNFA 4U6QA 4IJWA 3BAZA 2G0TA 4IY1A 3SLKA 5L7YA 3FWZA 3L6DA 4BKUA 1DLJA 3U09A 3TPCA 1WXDA 4NI5A 2GO1A 3C85A 5ITVA 2YHIA 1HTBA 3H5NA 2EF1A 3PGXA 4II3A 3JYOA 3SLGA 1NHGA 5JAQA 1KS9A 3DQPA 4WOKA 5JY6A 1ONNA 5G0VA 4ZU3A 4FN4A 2CD9A 3EGOA 3K5PA 1FK8A 2QYSA 3DFUA 4TKLA 2Q3EA 4R1NA 2I3GA 1ONPA 3DMTC 4JCOA 2VRBA 5I8ZA 4BV8A 5T67A 3WTCA 1LDBA 3H8VA 2CF6A 1JDJA 3NUGA 4HWKA 4FGWA 4YPOA 4EJMA 2DTDA 1MP0A 2X1HA 4L74A 4E5YA 4PLVA 2C82A 2HMUA 4E4YA 5JDCA 1YS4A 5IDWA 4N5LA 1U3TA 1EZ4A 4UREA 1NHWA 4ZRNA 4L9RA 5G2OA 1HF3A 3GN1A 1Q7GA 1V3TA 1SB9A 1MLDA 1NVMB 2DBZA 2I6TA 4NK5A 4BGEA 1O8CA 2PGJA 1MB4A 2JHGA 2VT2A 3OJLA 4AJHA 3HWRA 4C4OA 3V5NA 4D79A 1CQJA 2YZ7A 1BXKA 3NJ4A 1P0CA 5JBIA 3JQ6A 1BG6A 3JQBA 1Q0LA 1XLTA 2WYUA 3S8MA 5H82A 2D3TA 3VVCA 1ZFNA 1E0DA 4WNIA 3TSCA 1GQYA 3HFGA 1A7KA 4XGNA 3RFTA 4S3MA 1FDUA 4UVDA 2VHVA 5IFLA 5TS3A 4YCAA 2GNAA 2EP7A 1E3EA 1ZXBA 2B5WA 1Q7BA 3BZUA 4XD2A 5JCJA 3OBBA 1N7GA 2VWGA 4CMGA 3F5SA 1HEUA 5AVOA 1D1TA 2O7QA 1YB5A 1NWHA 3RC2A 2Y0DA 3ETGA 4UAGA 3ZU4A 1AUPA 3I9MA 1M66A 3BMQA 4ZJUA 3M1LA 3RU7A 1LSJA 3MJCA 4GX1A 5AXDA 4YR9A 2OBNA 3PJEA 1T2FA 4JJFA 4MJLA 2PGLA 3H9EO 2EKPA 2PD3A 1B8VA 3NT4A 4N5NA 2FN7A 2VZ9A 3LK7A 3U4IA 1LDYA 1XDWA 3ZNOA 1KVQA 1LDGA 3H2SA 5CDUA 1R66A 1RM3A 1XELA 3A28A 5KTKA 4D3SA 1WP4A 2BHLA 2GF2A 3T7EA 1Y8RB 3ZHBA 4IGFA 1DC4A 2DC1A 1VL0A 2VUSA 5KVQA 1F0YA 4A73A 4KQXA 1M67A 3ENNA 3JQEA 4CM1A 1UXHA 5HA5A 5IN4A 2Y67A 5I8WA 5JFOA 3VOSA 5FFFA 3U4HA 2AW5A 3WWZA 2YV1A 4CUZA 3GVPA 1GYPA 1WZIA 4CL8A 2FP4A 4PLHA 2JFGA 1LX6A 3GHYA 5BNTA 2DBVO 1U3UA 2GYYA 3O8QA 2HK8A 1QR6A 2Z1NA 5JMPA 5A9SB 1Y9EA 4I5FA 5ADHA 1ARZA 1T2DA 2DUWA 4JLWA 1XHLA 1NVTA 5H81A 1HSOA 2V6FA 3HFSA 2NUAA 3TN7A 2C2YA 3QA9A 5DP1A 4PIVA 1W4ZA 1A5ZA 1DJNA 3FF4A 4K6CA 1K6JA 3GN2A 4MIOA 4R9SA 4MVJM 4BMNA 2PZLA 4DREA 1P1KA 1C1DA 2Y1FA 3VH4A 2GASA 3SVTA 1NR7A 5G0WA 4QT0A 2DBRA 3FWNA 1ENPA 2GERA 3NT2A 3SJUA 3NAQA 1EDZA 1DIHA 2OMEA 2VHYA 4Z9YA 3LC2O 3ZWVA 4IDEA 1YKFA 3PIDA 5THKA 1HDZA 1IPFA 4NJMA 5I7SA 1L7EA 1WLYA 1W0CA 4NMHA 1SCUA 2Q1SA 3PGJA 5ITWA 1WAMA 4WLNA 3VAZA 2EERA 1NBOA 1CRWG 1YJQA 2G5CA 2Q99A 5DOZA 3U5TA 4ID9A 3AOEA 1LQTA 3A1NA 3EDMA 3PLRA 3MJSA 5TF4A 1T1RA 4XZ3A 1DRWA 3OQ6A 3QJ5A 3OQ1A 4RDHA 4YAGA 4YT2A 1LNQA 5LC1A 2BGMA 4BB6A 3ZV6A 2I65A 3IS3A 4RDIA 3FBGA 5JCJD 1E5LA 1VSUA 4DUPA 1EFLA 2NVWA 1ENOA 3RIHA 2OZPA 3E8XA 2OL4A 1VRWA 3TZCA 2NU7A 4J0EA 3O03A 1ISFA 1QRRA 3NDJA 5DN9A 5K0ZA 1TT5A 2IYPA 3K6JA 1E3JA 2RBEA 2BFOA 5DCWA 1M75A 2IZ1A 4XQGA 1QP8A 4MP6A 2X0IA 3RBZA 3WGGA 3C7AA 3TF5A 2R2GA 3HJAA 3WQSB 3VH3A 5IZCC 5CDTA 1U5AA 1Z82A 4D42A 3PYXA 4B3HA 4WLUA 1R4MA 3ST7A 3I1JA 4DRYA 5KKAA 7MDHA 3RC1A 3OJEA 5BSGA 4ITUA 3H9QA 1A4IA 4NFHA 1DB3A 2NADA 3KYCB 4YACA 3RAJA 3RKUA 1WDLA 2BH9A 1GPDG 1NQTA 3IAHA 4YJGA 3DTTA 2H6EA 4IIVA 4CPDA 1H2BA 5JMWA 1CETA 1NPTO 3DHYA 4TRNA 1PJCA 5COQA 4YEDA 4FFLA 5DCUA 5F21A 3GLQA 4EEXA 4CQMD 4LISA 2NM0A 2Q2WA 1DC5A 4GGOA 1FF9A 2NU8A 3LT0A 2Q4EA 1R4NB 3IKVA 2WD7A 4L73A 3U4DA 1HDRA 3D4NA 1XWFA 2JCYA 4DIFA 4WE3A 1YBVA 1N92A 1X7GA 3ANNA 3BTSA 3PHIA 4Y6RA 3GOHA 1BDBA 3D5TA 5T5QA 3UFXA 2I76A 4ALIA 2G1UA 4BNKA 4XDZA 3I9NA 1J4AA 1ZK2A 3A06A 3QV1A 4U0KA 3WTBA 4DLLA 3K2EA 3D0OA 3NTOA 4ILKA 3ZWNA 3OJ0A 3E9QA 1MC5A 1E3IA 3GEDA 1E92A 4YAKA 5CFZA 5K9ZA 2D1YA 1E5QA 2YQ5A 1XGKA 4J1TA 3VKUA 3WJ7A 4ND3A 3UOGA 2ZJ0A 4MINA 4R16A 1P1HA 1T4DA 3MZ0A 4MVJD 3DZKA 5T8KA 1IZ9A 5LCXA 3ROQA 4BNUA 3WWYA 5KKCA 4CUJA 3E1KA 1R0LA 2X0RA 1IY8A 1PJLA 3KM0A 3CZRA 4K6FA 4I08A 3QVSA 1DXYA 5DZSA 4N7RA 1PQPA 1AGNA 4J91A 1C0IA 1P3DA 1CDOA 3KTDA 3T7CA 2BGLA 3X2FA 1UXGA 3U49A 3N74A 1A72A 4I1IA 5DBFA 2WSBA 3ASUA 4E6PA 1T2AA 1EDOA 4GPD1 1P1JA 4GMFA 4XYLA 2ZYDA 4TSKA 1QSGA 1SMKA 1QV7A 4IS2A 3N58A 2UV8A 2JHFA 3O38A 5CDGA 1X15A 5JPIA 1I5RA 3GUYA 1F14A 1TA4A 3PK0A 4YAEA 5ER6A 5TC4A 2DAPA 4WCFA 2VCYA 1YQDA 1B2LA 3QVXA 4CV1A 4NIMA 4PVCA 2UAGA 4CLOB 3E03A 5GY7A 3B1JA 1ADGA 2PA3A 1E1KA 5L4SA 2CVZA 5TSDA 4XYGA 5EIOA 3GDGA 4E33A 3F6YA 3ONFA 4RPGA 1T24A 4YJHB 4Z3DA 5BSHA 1KC3A 4B4OA 4FFPA 5CG2A 3OA0A 3V2HA 4J7XA 1I3NA 3ON5A 8ADHA 3ZWYA 3EAGA 3W6UA 2YDXA 4YJFB 2AXQA 3L0DA 3AOEC 2O23A 4E5NA 4PLCA 1YB1A 2C07A 4XYMA 2ZQYA 3RQSA 1P0FA 3KHUA 4PLFA 4QUKA 1OBFO 2J5KA 2V7PA 4L76A 5GZ1A 5KVVA 3I9LA 3JQDA 3LC7O 1KVTA 3LT4A 1GUYA 2UYYA 3CEAA 1EBUA 1EQUA 3AK4A 4AL4A 4RF4A 1K6XA 4QECA 1L1FA 3FI9A 1NXQA 2Q50A 2ZTLA 3A4VA 2YHIB 1UAYA 3VZQA 4OSPA 5BSFA 1RM0A 4A27A 4OXKA 4UVIA 1EBFA 3E9NA 4RV9A 4OH1A 2C0CA 4FOOA 1ZIDA 2W2LD 3D7LA 4L4SA 2P9EA 2TMDA 3BYZA 3VPGA 2EIHA 3ZHXA 2EXXA 4S1VA 4AJLA 2VHWA 1JTVA 1LLQA 3RUEA 3ASVA 1SPXA 4WEQA 3NEPX 3TNLA 4Y9DA 1ML3A 2VN8A 3DMYA 1ZO8A 3AY6A 3PWKA 4OQZA 3I3OA 4O63O 2EGHA 1B8UA 3CTMA 1BMDA 3FNEA 3I52A 3QWAA 5G4KA 2NACA 4H16A 1Q0QA 2X5JO 4BNJA 1EUCA 3JYPA 5HS6A 1UZLA 1GL3A 1ONOA 4EDFA 5G0SA 2VZ8A 1HDGO 4CM8A 1V35A 4E2WA 1SEVA 5C5IA 1AN9A 2AHRA 1GZ4A 5CEEA 3JD3A 1EUDA 3W1VA 9LDTA 3EC7A 5C7IO 3PJDA 3ABIA 1MFZA 2A4KA 2VWPA 2CDAA 3DAPA 1PZEA 1XEAA 1I24A 1HLPA 4JIGA 1I3KA 3MEQA 3FPCA 4PCVA 3ZNNA 4LVCA 2Q49A 2CZCA 2Y1OA 1X13A 5EQDA 2RHRA 2AQKA 1LQUA 4E0BA 1HDYA 1ORRA 3S2GA 1PL6A 3CXRA 3MTJA 5EL0A 4P4NA 3JQ8A 4UEKA 2WTBA 4B4VA 4PN3A 1U28A 5F1PA 4A10A 1ZSVA 3E9MA 3MCVA 4GLLA 1IHXA 6ADHA 4JP3A 2IE0A 2EJVA 3JQ9A 1TLTA 1V9LA 3CINA 1E7YA 3I5MA 4I5DA 3L4SO 1U4OA 3ADOA 1GR0A 4RZHA 4DYVA 3P2OA 2C2XA 3MJTA 3DZHA 1WNTA 2CFCA 4OOEA 1PSDA 5BNFA 1WPQA 3RU9A 3TRIA 4H15A 1LEHA 4FB5A 3AY7A 2O4CA 1UZNA 3GH3A 5FI3A 3UW3A 2VYVA 1ZSNA 3LT1A 3VKVA 3BMCB 1I30A 4NFYA 3BA1A 4E2ZA 4D3DA 1EK6A 2HK7A 1V8BA 3RKRA 3UGKA 3C3XA 3KEQA 2FRDA 3KV3O 3QP9A 4RPJA 3CUKA 1WDKA 2LDBA 1GV0A 1PJTA 4JBHA 1C1XB 4IMPA 1B3BA 3PHHA 3VZRA 2WMDA 4DC0A 1XQ1A 3RUFA 1HE4A 5JSFA 1MV8A 4MO2A 5FYDA 1YL6A 1PR3A 4A03A 3AI1A 1LLDA 4RJTA 4OOFA 4GBJA 4XKJA 4II2A 4UUPA 5CG1A 1YL7A 2W2LA 3RASA 3SBOA 4BNVA 4E5MA 1Q7CA 3ZHYA 3GY0A 1SC6A 3D4PA 2C20A 4XJSA 3VZSA 4NH4A 3D3EA 4FC7A 3BIOA 3ZCXA 1JVSA 1N1EA 4CM3A 1GU7A 3COSA 4C7KA 3WBFA 1N1GA 4PG5A 5IDYA 3HZZA 5DNAA 4B4UA 1ISJA 1SB8A 1PJSA 3NKLA 4E13A 1DIAA 1UR5A 1C1DB 1FXSA 2BF7A 4RL6A 2TMGA 4UEJA 3QVTA 1NAHA 4IJVA 1SO8A 2Y05A 2RHCA 5I9MA 2X9GA 2PV7A 3L9XA 5U4QA 5KIAA 1TI7A 4ZQEA 2VTDA 4XCVA 3FPLA 3C8MA 4INAA 4LMPA 4NJMB 2QYTA 4OL9A 4BKRA 2O3RA 3F3SA 1U3VA 3EVNA 1LRKA 3L6OO 2EG9A 4HXYA 4TMFA 4F6CA 2QZZA 3NT5A 5L7TA 1GDHA 1X14A 1P33A 2J3IA 3BHMA 3PYLA 1B16A 3RUCA 2Q1WA 1QXSA 3INGA 5FI5A 4CMEC 4CMCA 3PZRA 3Q3CA 1FDWA 1HZJA 2PD4A 3RROA 4BKPA 1WVGA 2RH8A 1ZK1A 1DAOA 2WM3A 3ZW8A 4B3IA 3TOZA 3ZW9A 2FY8A 3L07A 4WGGA 3WR5A 5JC1A 1GQ2A 5TQVA 4HNHA 4XQEA 1ZBQA 4CM8B 4MP3A 5KJEA 4D46A 1Y6JA 2IXBA 1F8FA 1E6EA 2LDXA 3AM3A 1Z7EA 3JSAA 5A9SA 4HBGA 3DWFA 3PYMA 1X0XA 4IDBA 1ZK3A 1QV6A 4I9HA 4BQRA 3WS7A 4GI2A 2J6IA 3PHLA 4NZ9A 4OJNA 1GFSA 3VVBA 5AOVA 5HM8A 3U62A 1DC6A 3IC5A 4HUJA 2ZQZA 1HDXA 4CM4B 3WQRA 1VC2A 4ZQGA 3F4BA 2JCXA 4RVUA 2XPCA 3K92A 5BT9A 1OZAA 5ENVA 4OIMA 3CIFA 4L8VA 4DXHA 4HADA 2GCGA 4UUOA 4R5MA 3FRJA 4KWIA 5JY1A 4IDDA 1GY8A 2JD0A 4W9NA 4XX0A 4HKTA 3WSVA 3OH8A 3JQFA 2ZB8A 5IJZA 3F1LA 2DTEA 4TVBA 3H65A 4E32A 1C1XA 1GV1A 1UH5A 3JCZA 4B7XA 3A14A 1AE1A 1JQBA 3WGZA 2O2YA 4E5KA 2CDCA 3PXXA 3R0IA 3SXPA 3ZU2A 4QFDA 1YL5A 2GUGA 4OKIA 1U5CA 4YT5A 4XIYA 3BMCA 3IKTA 3JQAA 4WNCA 1ISIA 2GR9A 1YBAA 4DL9A 4NBRA 4O59O 2O3QA 1MGOA 3SX2A 4DTIA 3H3JA 4DGSA 1CIVA 5K6AA 4BNWA 1PX0A 1K0UA 1PL7A 4YQZA 1U8XX 3KRTA 3ZDFA 3QLJA 1Y5MA 3WYBA 1LLCA 5GZ3A 1GYRA 1LDNA 3WXBA 5KWEA 3KLPX 2IODA 4AJ4A 2YV3A 4I5GA 3I6QA 1B26A 2JFFA 1E6UA 4CQMA 5TJHA 2EWMA 1ZK0A 4YRDA 3TL2A 3ZZNA 1MG5A 4K1LA 2JFHA 2DBQA 1IOLA 2FOIA 1ZJZA 2J5QA 2AG5A 2DTXA 3ZV3A 3UCXA 2NV6A 1LSSA 2B4QA 1FJHA 1HYGA 3AI2A 4R3NA 4E3ZA 2DLDA 4D43A 3PPIA 2O48X 1YXMA 1E1NA
chains in the Genus database with same CATH superfamily
5KTTA 1Z7WA 2DZDA 3EGEA 3FYSA 2WK1A 4KTTE 2Z4SA 4BP9A 1ICIA 5EMMA 4GR4A 4ZI7A 4DM3A 3C98A 3QUQA 1H9BA 1KMHA 2C58A 2AGVA 2H4WA 3H5WA 3NHZA 1X39A 4MEJA 3ID6C 3UENA 3R0ZA 2FFAA 4YRTA 4MVCA 1N8SA 3IP9A 3IUJA 1BQEA 4WXEA 1UBGA 4RS4A 4TWJA 1R0SA 5TE9A 2HGSA 3MSCA 4N8DA 1P39A 3K15A 3Q2KA 3AZPA 1YCDA 1O5TA 1FVHA 3P71T 3UK2A 4W9MC 2NUBA 2R8EA 1E0JA 1E6LA 3INYA 1WCXA 1KIFA 4ZQHA 1JFFA 2FXVA 2H4JA 1NZJA 3ABZA 1VXRA 2QUZA 2QW0X 4IGKA 4URYR 2G9ZA 1OI4A 1W5BA 2OGWA 2C3YA 3C8HA 5DV9A 2YY6A 3G2IA 4RW0A 3N0WA 1NW9B 2DFKB 4RFSB 4M1OA 2FUNB 3QTTA 4H7HA 2IZ0A 3NP7A 3CKYA 5G3YA 1MW8X 1FNMA 2C04A 1HETA 1SQ0A 1XHFA 3LUAA 4PLWA 1I01A 2AN1A 3ABQB 3BXEA 1L5SA 3CO5A 3EOBI 4GYYA 4OA5A 4CEHA 1EJ2A 1YHZA 2H5LA 3BREA 2D4AA 2GVZC 3ORSA 2ZJZA 5LQKA 1DHRA 4RORA 4BZXA 1T25A 1P80A 4IIHA 4A8PA 3DZJA 5LPNA 1AXRA 1QCYA 2F4VB 1UXKA 1X7HA 4CTMA 4NMXB 1I5EA 2CFTA 3HKCB 3VKWA 1CS4C 1VL8A 2IOHA 2ORWA 4HDNA 4LBVA 4V3BA 3TW8A 4LF5B 2WF9A 1QIHA 1RWMA 3IILA 1C30B 1USWA 3RC9A 1I7SB 4KBYA 3CKKA 2HCTA 1OXUA 1FYVA 1E99A 4GMXA 5D5HA 2PMDA 5HOQA 1HLGA 3LFHA 3ZWAA 2ATCA 1GCGA 4F1WA 1XKTA 3L8DA 4HAZA 4YJ2F 4DMUB 1C9KA 5A6VA 2RHHA 2MINB 3IVRA 1KS2A 1M2FA 2FEPA 1QFMA 4H3VA 4D26A 1BQ4A 1MTOA 1NQOA 2VQEB 4LF7B 5HKKD 2X8JB 4EL5A 3NBYC 5LZ4A 1DIGA 3GRYA 3DT9A 2J3EA 2QHXA 1ZHHA 1XCPA 3HU1A 2A0YA 2VJMA 1UBLS 2WYWA 4BTVA 2CZGA 3MWDB 2BGIA 1Q0SA 2PNFA 3BTUA 2RGGA 1Z07A 4FR5A 2XXBA 3T5TA 1K88A 4QUJA 3HCPA 4I4TF 3WOHA 5BR7A 4HWSA 1XZGA 5K03A 2ID7A 4YNBA 2P0EA 3GB9A 3IAXA 1SHKA 1E1CA 3DE6X 3FA2A 4BBZA 4GPTA 4JOBA 3CVUA 4MUNA 5DGTA 4MDHA 3AX6A 1E7QA 1V7CA 3KD3A 4GLBA 4E30A 1SFRA 4J49A 3E84A 4KQJA 4R51A 5FV7A 3WGTA 3VMFA 1Q3KA 3CZ5A 2OTCA 4BFLA 3FTCA 1TRKA 1BA2A 3GIWA 4A2CA 1MX3A 1U3CA 2CJWB 2IXGA 3BTOA 1GLGA 1ZIOA 3BF7A 1FUIA 3C1AA 5TDHA 5BSWA 3DLBA 2QUAA 5K8JB 3WI7A 1CY7A 4OHUA 5ADVA 3QMVA 1BVUA 2PZ8A 3QQPA 5GONA 2IVFA 3N1UA 3W8FA 1W73A 2LZ0A 1XUOA 3BWBA 3WXMA 3PUWA 2CDBA 2G9UA 1GO2A 2H1WA 3DE0X 3ZCSA 1RBQA 4BLPA 1NOJA 5IJAA 621PA 2Z6AA 1CP3A 1E2UA 3GD5A 2FZCA 2H4FA 4B32A 1NJ1A 1SCQA 5BYBA 4LAFA 1DGQA 3NM6B 3GDFA 2YH2A 4AU1A 5ECGC 4EPVA 3G2PA 4HDSA 1YF3A 2G76A 3FGZA 4FZJA 4JYPA 1U1GA 4LZAA 4W63A 3EIOA 1UEIA 2AD5A 4MS1A 3C6BA 1SCDA 4Z1MD 2CUNA 2F1KA 2ETVA 1ZGGA 3N7TA 1SXJA 3M3HA 2NZVG 1NG1A 2N42A 3O9VA 3GLGA 4HYYA 3INNA 1VKJA 2DJIA 3HDQA 3LHDA 3QXGA 3C2QA 3VNVA 5FOUA 1GZUA 5GMOA 5ESRA 5H3HA 4LJKA 2HDHA 3K9QO 1OA0A 1QS0B 5KSWB 3NALA 3M4YA 3PEUA 3ZW7A 2PLRA 4AZWA 2B7LA 2ZRMA 2ZSFA 4JC5A 2HAEA 4NPHA 1ZA2A 2FW7A 4URFA 5LVAA 2HJHA 4W5OA 3ADDA 5K09A 1WD5A 1L4BA 3H1AA 4QWWA 1G6Q1 1COZA 4R41A 5DM60 1SULA 3HBMA 2AG6A 4YJKA 5CD9A 3KPUA 5COAA 5A62A 4S04A 4AY4A 2FFQA 3I09A 3HBJA 1D2HA 2FLKA 3ZBPA 4HX9A 4CL2A 2QI9F 4G36A 4QXQA 4R7GA 1IUKA 3IAS1 5J4VA 1YS1X 1LPMA 2A5LA 3R5FA 4J7UA 2GRAA 2GCIA 1N9GA 4WZZA 4DLZA 4HUTA 3TKLA 4W8GA 3FZQA 1TRHA 4HRAA 4YRSA 3R7WA 1GAWA 3DTYA 3MHPA 2FDRA 4K5QA 1C0LA 3JWIA 2JFOA 4XSGA 2XD4A 1W52X 2XMRA 1W35A 1C0KA 1ZUWA 2P9QA 4H1HA 4UUQA 1XYGA 2VDRB 4WLEA 4Z4FA 4X62B 2X5XA 2UVPB 3SC6A 4LFBB 3EC2A 5KHAA 1ZRNA 3S2UA 2PZGA 1NASA 4E6EA 4I66A 3AESA 1I3CA 1X7DA 3CEMA 4V3CA 1JKXA 3RU2A 4BMDA 2H1IA 3CURA 3E82A 2I9KA 3RC3A 1JJAA 2HOQA 3R5XA 1ZGHA 5DT2A 2WD8A 1X3SA 2ZJ1A 4L57A 4N0QA 2DYKA 1O4VA 1PD0A 4G5QA 5DNCA 4RTKA 2DT5A 3ZGZA 1G6OA 2H07A 1ILWA 2WIGA 3D1JA 3JRXA 4MQ4A 2G17A 2FNAA 4R8SA 3M6FA 3M6UA 2C1ZA 4BP3A 4FLEA 4IX9A 4YRNA 1E2EA 1GPNA 2X23A 3JYHA 1GGNA 1PJBA 2WVJA 4GE3A 5FTKA 3ITDA 3E2PA 3A1TA 4B87A 2DHRA 3PFKA 4UE6A 3BICA 2YIVX 2I0FA 1CEXA 3ZKWA 1KBOA 4ZZ0A 3G5MA 5FPKA 3ZWOA 4LC1A 3IPYA 4K9KA 3CEJA 2MYTA 1HYHA 2BCEA 1O0BA 4FYXA 3BFPA 3QVWA 4JJEA 2GF0A 3ABRB 2WM9B 5F9HA 2CDNA 1KJQA 1UZUA 2D0PB 4Q7EA 3VI3B 2IC5A 1H2EA 4WEOA 5J2UA 1QHHB 2EYQA 1XA3A 3HEBA 1X7WB 2FK7A 1QB8A 1FA9A 1QO0A 1EK1A 4WK0B 3W5JA 1PFVA 1LBSA 1QFSA 4HAXA 1MORA 1ZSYA 4JLKA 4O4JF 1CUAA 4NYMQ 3DDCA 2Y2UA 4ABTA 2IYLD 1HMYA 1DKNA 2J9FB 4RD1A 4DWWA 1E61A 2GK7A 1QIDA 3NKVA 4KIJA 2ZWMA 4PHGA 1CUEA 3JZAA 5JZSA 3UB4A 1CPYA 3Q2IA 2CHGA 1YDFA 2NUPA 1QQ7A 3TFWA 1FX1A 1OOEA 4GZMA 1NJGA 2WUEA 1N5LA 1WUIS 1G3IA 4RIFA 4BN5A 1M5RA 4L9AA 2O5RA 2I8AA 4GDFA 3WQBA 4QDJA 2RD2A 1U8TA 4XGIA 4GC5A 5JAHA 1BFUA 1QUEA 3IJRA 4KO8A 1CJTC 4NATA 3PXUA 1J8QA 1N6NA 3KDSE 4HGOA 2XAUA 1P2SA 4ZVNA 3IAM1 5IN5A 2X4DA 4I36A 4B3FX 4XJTA 4LDZA 4PX3A 2KQUA 3ESQA 1XP8A 3RIXA 3ECSA 3IP1A 4FQ7A 1RHUA 1TPYA 4DHEA 3GCWA 1WM1A 1EFTA 4KX3A 1E3SA 1JR3D 2V4UA 4UHCA 3TZLA 4Q3OA 3LLSA 2MHCA 3EDYA 1GLNA 3ILHA 2D13A 3L8YA 4WCDA 4TWBA 4KRFA 2V6MA 2W2QA 3NUZA 1X80B 3Q5EA 4ZQBA 3LM8A 2NU9B 3GROA 1A2BA 2BPOA 4FGLA 2ZOSA 4B73A 4Q1DA 2QZPA 4ALJA 2B4KA 2RHBA 5EIFA 3T12A 2YFHA 2PYDA 1SHUX 5K6RA 3M5CA 3IVGA 2Q46A 3N8DA 2OC4A 1QONA 4TT3D 2UVDA 4PZAA 2AFIB 1VJCA 1YKSA 4KLNA 4S1TA 3SLRA 5IXYA 5JSHA 5L3QA 2D0IA 5C51B 4GEKA 3MJRA 3TBHA 1W75A 1OXVA 1T6ZA 1BE8A 4AIIA 4OSEA 3R8CA 2VXOA 4HLNA 4E3WA 1SCAA 1FSSA 3IMEA 2Y76A 4JEHA 4QBTA 3T7TA 3OBIA 4YPFA 2C03A 4MKIA 4W7IA 2EKQA 4AN1A 4TKMA 1U11A 1KWGA 1MIOB 4J07A 4OVKA 4DQKA 5IBPA 2BGKA 1WTCA 2DH5A 2G0NA 3TB6A 3PRYA 5BV7A 3WLEA 4WY8A 5LM3A 2Z2KA 3DC2A 4ALLA 3TWOA 1ORVA 5DM70 4AAYA 1WU8A 3FIUA 4KRGA 1UKCA 5KDDA 1CF4A 1ZH0A 4L5YA 1G19A 4IFTA 4NECA 5BVGB 2JGDA 2HMTA 4HNQA 1KMNA 4ZYLA 3DFMA 1DWOA 4P32A 4UNPA 2FZEA 4N5MA 3DAFA 1JQ3A 1T4CA 4A9AA 2A1IA 3LVQE 1QE0A 3V32A 1GADO 4OQQA 2ZIVB 4EGCB 1G7SA 3S81A 1M1NB 5FWNA 2Q27A 2TMYA 3P9CA 2CMGA 1N2JA 4QAQA 4BQIA 4X65B 1J5EB 2I4IA 4IBOA 4OUDB 1SCUB 1JSLA 1C2YA 1L4NA 3RHSA 4UQLA 1L5KA 1BE0A 2GTIA 4IQ0A 4PBRA 5CTAA 5AXBA 4B44A 4M1SA 2HPVA 3OFNA 3PE6A 5I47A 1T43A 2RFLA 2GEUA 1RC8A 1DKMA 1E4YA 2XGSA 3NBXX 3OIDA 2WJWA 5HKAA 2OWDA 1DEXA 3RSOA 1YH3A 5T57A 4EY4A 4IV5A 1ODTC 3I5AA 3U80A 1EQ2A 5ALZA 3WSTA 6LDHA 4KN5A 4Z0TA 1DI0A 5K8TA 4CI9A 1AHIA 3NYIA 4AJNA 2VDPB 3AIMA 4NC9A 4XGKA 3WV4A 4US1R 1CDEA 3B9RA 1QKKA 4AJJA 1OXKB 4ZI2A 5JECA 4O3FA 4UUNA 1M1YE 2X2OA 1U6JA 4EI2A 2NNWB 4RVOA 3WWOA 3QY9A 5IT0A 1H2ZA 1N2EA 1RI5A 1F8GA 3CRRA 1DJOA 4QHTA 3ZDEA 4OK5A 4HCJA 2H16A 2VCHA 2JIPA 3L6EA 2B82A 4Z8YA 3ZDYB 1Z4QA 2A5GA 1M3SA 2BEUA 4U7JA 4BX3A 4EO9A 3CVJA 2JJ1A 2PT7A 5G1PA 2A7XA 3BWVA 1C3VA 5J3JA 1EJ0A 2CXXA 4ZICA 2XA1A 1PLLA 1V0JA 5JC8A 2O06A 2W6MA 1CKEA 3KSRA 4YRJA 4BLVA 1ZNYA 3EIHA 2RKWA 1EFHA 4LQCA 3WK9A 4OM8A 2O54A 2FPIA 2MSEB 3P0HA 2XSZA 2YW9A 2DU8A 3NAGA 4GU5A 4K9QA 4ZPXA 4KQEA 4QPCA 1WUJS 5TJ9A 4DFDA 5F7XA 5LL6P 4TQUS 1XALA 5HKLA 1FPQA 1XROA 5BSVA 3T5CA 2EU8A 3RT1A 1UAGA 1QYWA 2PSSA 2XKJE 3TZKA 5E4TA 4A0QA 4X8OA 3GRCA 3QA3E 3W2IA 1YU9A 3O93A 5TIIA 4RD2A 1GD1O 4TKVA 2SCUB 4UXJA 1YONA 1WABA 3TAHA 2XVZA 2I03A 1XK7A 2HCFA 1NT4A 2C0PA 2FMFA 2LE0A 1NQ5A 4BLTA 2QLMA 5J4YA 1EESA 4RHEA 2LWIA 4KXUA 4U9HS 2XD9A 2P90A 4MVJA 3B60A 1CZRA 4QQ8A 1QP7A 3FNGA 4CG2A 3KUXA 3DMRA 1XTIA 2D5CA 3HKEB 4DA8A 3BCSA 1MN6A 3C4JA 4QRDA 2IQ5A 3QE0A 4LJSA 2MOKA 4Q48A 2WV7A 2CY0A 4TMYA 4TN1A 3V97A 3ZE6A 2BI8A 1JIQA 2Q5OA 3PD7A 4MUIA 2XMSA 2Z8YA 2RARA 4AX4A 4ZYVA 5IF9A 3EZ9A 5DK4A 4BO5A 3SJAA 3LO5A 1VM6A 1OFIA 1KZGB 2J9FA 2IEAA 1CQXA 2ECPA 2FR0A 2W6JA 3C6YA 3KZ1E 3L7NA 1KR2A 4LW8A 4KN9S 5GP1A 2GHIA 2HB6A 5TMBA 1JALA 3SAJA 1WQ1R 2X9VA 2G08A 3LLMA 3EXG2 5HF6A 1TQ4A 2UZIR 3HU3A 3PZBA 4OJTA 2CF5A 2IUYA 2XSZD 3GJZA 2FMXA 5BURA 2OCBA 2Z43A 2ENWA 2FWBA 4AM8A 4KXLA 3FUCA 3M82A 4UDXX 5HJEA 4PV7A 4DR7B 5FOQA 2NXNA 4HB2A 2RBGA 5LXTA 2PRYA 3NONA 3RRYA 4JJ4A 1S2MA 4OHWA 2A7QA 2FHSA 4MA0A 4ARZB 4BB9A 3RVSA 5BYKA 2FGJA 4JQZA 3DGFC 5G0UA 3GQVA 2FWNA 1Z4MA 2J6BA 2Q4DA 3O92A 1C4XA 1FUEA 3CPJB 3DONA 1QIJA 3W1EA 1KGDA 1G20B 2WNSA 2Y1EA 4MW5A 5KOYA 1VBNA 3NGLA 4L95C 4KFRA 2BLNA 1QHSA 3JWEA 4EGFA 1F0PA 3HR8A 1QTRA 3QOYA 4V0MA 4O33A 2OPHA 2W71A 5J47A 4NX2A 2VYNA 3K4QA 2D5IA 4L1KA 4QULA 4D9BA 2CV0A 3H4TA 1A04A 3AEZA 5KYNA 5K6AC 3ILXA 3SU8A 4D9GA 4JI1B 3TLKA 2GESA 4ZCPA 3FJYA 2JFWA 4AO7A 2HJRA 3E23A 1Q50A 5I48A 3QX3A 2R4QA 5JSQA 1RWBA 4ZPJA 5CDHA 5JSUA 5LKRA 4AX8A 1XJWA 2H8KA 4XIGS 2EW2A 5EG5A 3TYXA 4PY2A 3OMWA 1KK1A 5DXJA 4QASA 1QYXA 4L9WA 1NFQA 3KU4A 3DMDA 2XVAA 2BAGA 4XXHA 3I2GA 4LCEA 4OCZA 5EQTA 2YR0A 4JLSA 2EZTA 2J0EA 2ZXEA 1YQEA 5KJFA 3ZDCA 4R68A 4CQLB 3QKSA 2Y68A 4UEQA 1GSHA 3VGJA 4HLDA 4G07A 3Q3EA 4NNOA 1F06A 4OMUA 3UICA 5DNDA 4PS1A 1Y3BE 2BFPA 1N9ZA 2I7VA 4KG7A 2ZYVX 1JSRA 3GCDA 3OX1A 4MVJH 2XUZA 1WBJB 4I6GA 4YCLA 5CVCA 1E6KA 2VDNB 4AF8A 4UHFA 3DOUA 1GCAA 2WFMA 3FD8A 4NOLA 4ND1A 4UHJA 5SYNA 4YUYA 3W5BA 1C9EA 2UYQA 5ICSA 2J7PD 2OORA 3FLEA 4EW1A 3DLHA 1OI2A 4GW3A 2C7GA 1PT9A 3L5OA 3VXKA 1G63A 3KK0A 5KO2A 4E31A 5JD4A 3UUFA 4EJSA 4FLMA 3DZIA 4Q3NA 2CNDA 1QPGA 4NR0A 5FPPA 4LWPA 4UAJA 1DCKA 5IXJA 1WQ3A 2EGUA 3T35A 1XBTA 3SHOA 1TM7E 4BO2A 4OBWA 2VTBA 1Z37A 4LSMA 2L69A 1E59A 3RRBA 3K16A 4F2HA 2NP7A 4JOCA 3AVTA 4JB8A 1U7UA 3W5SA 2NU7B 1WCIB 1V8ZA 4YGYA 1FVFA 1XKQA 4QPPA 5ERYA 1Z0KA 3E7FA 1AZWA 2HJSA 3MMSA 1HQDA 3EG5A 3K9CA 3PJGA 4Q03A 3TZQA 4ZZIA 4AF6A 2P79A 2P35A 1R4ZA 1TUIA 1P73A 2NZUG 1SA0B 1X87A 3AUSA 4M8SA 5L95A 4AUNA 4HFNA 3LX5A 1Q7EA 3T7DA 2FF7A 1MZVA 3ZWMA 5L51A 3CE6A 4DBVO 1G8FA 2XDQB 4A91A 4R9NA 4XD7A 2J9XB 2D2VA 2Z8YM 4C4XA 5LZ2A 1MB3A 3IHWA 4GP7A 4Q05A 3RTGA 1IHOA 4EL0A 1X80A 5AJXA 5EHXA 1OX4B 1W2WB 3FPHA 1PTJA 5AM2A 1JZQA 5BSMA 4N9WA 4JI7B 1J8DA 4IAOA 1HWYA 1MQ8B 3O9ZA 3OM1A 5B3KA 2DFTA 3UMBA 1J24A 4IFIA 1N77A 1UEJA 2NYRA 3JQ7B 3H4MA 1I3OA 2ZDGA 3KKLA 3TAXA 3PX2A 4DIEA 3B53X 3JYQA 5JO0A 3LIIA 3I23A 1RYZA 2E3JA 3JQCA 4QDUA 5FYQA 3WL6A 2FW9A 3HCWA 2CLIB 1SQSA 4MGEA 3IXMA 3F7MA 3NYQA 1LDEA 4KUEA 1JG4A 3Q6MA 4XM0A 3UY4A 2JIDA 1KEZA 2GZHA 4GLOA 5A06A 3H83A 3GMTA 5FNVB 5LZ5A 5L3SA 1D7AA 2O8NA 1LLUA 2QZSA 1QVVA 3MF4A 3UT5B 4YRBA 1O54A 1NXSA 1R37A 2EFCB 2GBLC 1PJAA 3TOXA 4M86A 3T5MA 4JGIA 3EK2A 3M6IA 2NU8B 1N2XA 1H2HA 3WKAA 4ZV4A 4HS4A 3UBTA 3O26A 1E7RA 1JIXA 3AOGA 4BQNA 3KTAB 3HM9A 4B43A 4D0SA 2YN0A 3QXSA 4QYIA 3W34A 1SPBS 1QB7A 1QGUA 3BMNB 4NBTA 4PF1A 2HF7A 1FTGA 3R0JA 5FPHA 2PVSA 3BZBA 3KXDA 3PI7A 4LHYA 4MSUA 4P3XA 4NBWA 3O47A 2O7VA 3OQIB 4CUKA 3DVSX 2ZE6A 5I9IA 1NWCA 1JP7A 1BXGA 1BMFD 3C3AA 2RJNA 2W2KB 1ZZEA 2B83A 2C4TA 3K1ZA 5EFOA 4PNPA 2R0QC 1CLUA 3B20A 4PXSA 4BWFB 3S4YA 3TW8B 1RXSA 2X8AA 4BEBA 5AJZA 3TLMA 4ZMRA 5JZMA 5KPDA 4FGZA 5L3ZA 5JJIA 4H60A 1B6GA 4N76A 2D2FA 4ZXFA 2VDOB 4A10A 2WIFA 3IEUA 1YR6A 3Q15C 5H16A 4TS1A 1E9RA 3PEWA 4AZ3A 1TYDE 1VE7A 3LY8A 3JWPA 2OAQ1 2QZ4A 4GO1A 2BC9A 4P83A 4TSFA 3V1TC 1O9HA 4MV0A 1YZLA 1QF9A 2D1QA 2Q6VA 4HNAA 3S44A 5G4LA 4BMVA 4FBLA 4HO1X 4IJQA 4A8JB 5KJCA 5CIYA 1YCGA 4H59A 4WUVA 3TQTA 5K3SA 2OGSA 3H2KA 4I9FA 5JBNA 5KJ6A 2ZQ5A 2WF8A 1MJHA 3LECA 5J43A 1J2TA 5JVDA 2JCSA 4HY3A 1PVOA 3NTXA 1YQQA 4YO7A 4B5LA 4AMYA 1G8KA 3BRWA 2ZAYA 3SQMA 1Z5UA 3HI6A 4CLRA 3FOAA 5AJTA 4XVQA 1KZ9A 4H2DA 1W8IA 5K45A 2V1XA 4FK8A 2WYIA 1RAIA 2CLOB 3HQ4O 4MW2A 3UF0A 3BQNB 1E8MA 5JTUA 1VYUA 5LQRA 1GNQA 5HX7A 4RELA 2FN4A 2B21A 1BHO1 4PINA 3H97A 2ZTHA 4HNGA 3RKSA 3OZVA 5EZQA 1IUOA 1JAHA 3KSZO 3I0NA 3ONVA 3WGYA 1VLMA 1WRBA 5KYTA 1ZOPA 3WIVA 2WFAA 3H5VA 1JLLA 1IG0A 1X1QA 1EZZA 2QLLA 3GGSA 4ZI7B 2BFAA 3A0RB 1M1NA 3GRFA 3HDHA 3OPYA 1KDTA 1Z2CA 3AONB 4JQYA 2B6NA 1UK9A 4JROA 1M33A 3ZWKA 1H66A 1FL9A 4U6SA 4RK1A 1CUUA 4XLTA 2EFJA 1KSGA 1ZLXA 4K6MA 3AIKA 4RNDB 4RVCA 4ND8B 2JLRA 3CH5A 4JOQA 13PKA 4GFDA 2QKYA 2R48A 1JBEA 5DBIA 3ROEA 2HHJA 5KKNB 1JG1A 3GEIA 1B7GO 2UU9B 3PRKE 1VCOA 1VJ1A 3OTWA 3CZCA 4OXXA 4PG8A 4RACA 3M4NA 3U81A 4HPJB 1RRMA 2FA9A 2ZBVA 4FE4A 3TRJA 1U81A 5HDQA 2P7IA 2QM0A 3PHJA 2HJVA 4R6WA 5JJLA 5DPMA 4CG0A 3MUNA 3AR6A 1THMA 3P4YA 4GVLA 4IH4A 4ZGWA 3HDJA 2XMDA 5F12A 1SVIA 1XDZA 4X6LA 4BAUA 2I5PO 3H1FA 3K73O 1DBVO 3EZGA 2XYVA 3BJEA 4YJ3B 3I1FA 4Y6PA 5FOWA 1FCJA 1NBHA 4A8JC 2M1ZA 2B1RA 5IZ4A 4AXXA 2H1HA 2FSGA 3IAS6 3Q3VA 4HAIA 3HCEA 4EA9A 2YWEA 3RWOA 4Y2TA 5KPJA 3U44A 1N57A 1ULTA 2XB8A 2IU0A 4WHMA 3IB3A 4NCHA 4QDOA 3ROZA 2VJQA 4GI7A 4EG7A 2FG5A 2WJIA 1SXQA 4CLHA 3WMRA 2J59A 3HU2A 3IQDB 1KEWA 1SRQA 1YZQA 3C8DA 5H3CA 1W0JA 3CIOA 2X0DA 2O8DA 3F8TA 2O3TA 4HJXA 3VSCA 4EELA 3CTPA 2P4QA 3FSGD 3GT0A 4PCLA 1AQUA 3O8OB 1F8UA 1W2HA 1PJRA 2AOTA 3LXMA 4N03A 2PMBA 4D7AA 3PEYA 3QFRA 1ECGA 1P44A 2V7BA 5H68A 1MKYA 1CY0A 4NBKA 4HJRA 3RFFA 3WLMA 1L5QA 3R2JA 3N9IA 4OP2A 1H5NA 2AG0A 4PTZA 1IXZA 4R40A 3KYJB 3G89A 3ZY3A 4UCWA 2YHUA 1U3WA 1TAGA 4JLNA 3X3HA 4YV0A 4M83A 3A36A 5F2OA 4P93A 1HLFA 2J48A 4WERA 2XA2A 5KUTA 2JIRA 2EW8A 3U60B 2COEA 5I9LA 2O1XA 3AHIA 2W43A 1KKUA 1LI4A 4LQLA 2AFVA 1PGOA 3AVUA 5J4HA 1P7VA 1TADA 1CHDA 2V45A 4Z4CA 4BFYA 3GK3A 1RE1A 4F06A 2J30A 4R8RA 4C6SA 2Z56A 2QS9A 3A58B 4NU5A 4QGBA 2OR3A 5EHGA 1UMBB 1IHYA 5TEWA 1EINA 1J2UA 1WXGA 3TL6A 2HQ1A 1ZJ4A 4HDQB 4LY9A 4MAMA 4V0KA 3SXJA 2YJ5A 2AIRA 5CH3A 2POCA 1VPDA 2G3YA 3IPCA 4KWTA 3M3DA 3RCBA 3CPEA 1JEYA 2I1WA 3MS2A 2C5BA 3LO8A 1IB6A 3L0CA 4UM5A 4IDAA 3Q7TA 2Z57A 4U0JA 5FTNA 4AMZA 2VVTA 4R54A 5M29A 1TVKB 2PWBA 1UWLA 1DDIA 5KC8A 2H5IA 5JS7A 3QKRB 5IT4A 2FQYA 3COJA 4KZPA 1XT6A 1NF2A 4NS4A 2HHLA 2AMJA 4CKCA 3MM4A 2FJUA 3CYFA 4JJZA 4BKOA 1HQKA 3G85A 4FZVA 1L7PA 4OB8A 4M21A 1EJ6A 4KMOA 1P4JA 4PFSA 4LWZA 4Y9SA 1JG3A 4PSAA 2BISA 4YP9A 1UK7A 4YHHB 2UVQA 2IP1A 4ILEA 5IVHA 1IUNA 3SPXA 1SUSA 1XF9A 1QNLA 2WIJA 4MW9A 1FS6A 1XTVA 4OQ4A 4DEVA 3EWIA 3PUYA 3IL2A 4YAJA 4CMJA 4BQEA 4D8TA 3D6FA 3HRIA 5MDHA 1V6SA 3RH0A 4TWZA 4Q7QA 2ZZNA 1SN7A 3EULA 1R4NA 1TJ4A 2ZTVA 3TJZA 4MVJI 4AUEA 1BX3A 4G9BA 4P4GA 4U9UA 3L77A 3AUJB 2W4QA 2RCYA 1MPXA 2E2WA 3W3AA 4QUGA 1RRGA 3DBLA 1A5TA 1FP4A 1NMYA 1XRJA 3HRHA 5EQFA 3UXYA 3FXAA 3U3XA 5IC5A 1H6BA 3O0TA 2EARA 4DMMA 1LC0A 4EMSA 2D00A 2ZPUA 3EZXA 4E5PA 2H63A 2HLNA 1PR6A 4RF2A 1IN1A 4ZAXA 1T9BA 1TO6A 2DMRA 3EAFA 3G1TA 4I9UA 5E9WA 5FO0A 3ZE1B 3W6OA 3L0YA 4J0KA 5F7OA 2X8BA 2KX7A 3GJ7A 4G67A 3WLQA 5P8WA 1F60A 5JFGA 5C31A 4BGVA 3G6WA 3L40A 4IMJB 4G6ZA 4F7WA 3H1EA 2V7EA 3EDQA 4O4IF 5CU7A 3COZA 3KWJA 3LU1A 2W6NA 1Z12A 1YR3A 1E2GA 3GDOA 2NVUA 4N12A 1EAYA 1SZDA 1J7JA 2IHKA 3AVPA 4WFQA 1IJBA 1Z2AA 2V6BA 1R6BX 3K9GA 1J5PA 4G0YA 1PGJA 1A27A 2X5NA 2LIPA 5EIWA 4Q6BA 5I7EA 3SSOA 2F90A 1BWRA 3OD5A 2HWXA 4ETWA 2QX7A 4NY1A 2QRMA 3JAKA 5GJBA 2D8MA 2FJPA 1VJTA 1KNQA 2RI6A 3VTKA 1EWYA 4HRVA 1ENZA 3T5AA 1V2HE 4ZJPA 1Z73A 1U90A 3TZHA 4QYIB 3RBAA 4XAQA 2C4WA 4DUGA 4H31A 2HNKA 3ZK7A 1WXFA 4C0SA 3WLFA 2GBGA 4M0LA 4FN5A 4YJ3F 4BC0A 3HHPA 1KYWA 3FMPB 3SR3A 2WT4A 4BWYA 2OCXA 3Q2OA 5A5DA 3VUEA 3NTUA 1XMSA 4QUAA 4EGQA 2FZVA 2NZWA 4HQ6A 4XWWA 3QY0A 4FGSA 1VZ2A 3EOZA 3DEZA 4ZDWA 3U7QB 1TXGA 3FHOA 2ESRA 4RVSA 1LSUA 3OZBA 3JZIA 1PNOA 2EP8A 3HKDA 3LBYA 4NSNA 3SK0A 2QX9A 2DFLA 4D44A 2YJ3A 1J8VA 1T3HA 4NYJQ 4EUFA 4Q3EA 4EPRA 4ASUA 4EKYA 2PZBA 3OETA 4IDGA 2QRLA 2VDLB 1S9DA 1I51A 2Q3FA 3A1CA 2HZ7A 2WZCA 4EF4A 4XW2A 2XGJA 1RW4A 3PDWA 4GOKA 2PRZA 1GZ6A 5A9RA 4GBGA 1E1YA 1ULUA 3LCVB 5AHRA 3ICWA 3N5CA 4CKBA 3DBVO 1E63A 3AF0A 4I9NA 3G68A 4R4JA 4UNIA 2B4RO 2R96A 1YA8A 4KO2S 4GI1A 4NABA 5IEJA 4CXMA 1IN7A 3AT1A 4LXUA 1F4PA 1KAGA 1CE8A 4MW4A 1W8DA 2HT1A 1IN4A 3KALA 4GZLA 1CSEE 3U7GA 4JLUA 2C1XA 3BT7A 1RYFA 1YJXA 3H2JA 1YVEI 5DYYA 5IM4F 3M8KA 1BHQ1 4RM2A 1GAXA 4MPPA 5K05A 2BJWA 4B09A 3UAGA 3F0TA 2VDUE 1JL3A 2Y4OA 4IX1A 1XRQA 3Q4GA 3S5JA 4ROTA 4ESOA 2V8BA 1GRVA 1V3VA 4HGQA 3KXLA 4KJZA 4PSDA 5A7HA 4GRIA 4YR7A 5KTYA 2PR2A 2POQX 4PR3A 1E7WA 2O1EA 3GZ4A 3PIIA 5EHIA 4GS5A 4CTKA 4JLBA 4DLKA 2VAPA 3UIEA 3M34A 4DCUA 5T8KC 3UHAA 3EHEA 4RGQA 4LSZA 4ZALA 1R12A 4GPEA 4DCCA 4HSGA 4NOMA 3KT6A 5KVAA 1FUKA 1DE0A 4P4TA 1FQKA 2P9JA 5FWAA 4O6VA 1GEEA 3CLTD 3GRKA 2DPYA 5G4KB 2RAFA 3WMXA 4Z3OA 1U9ZA 2VHZA 2YOHA 5BUSA 1USGA 1W36D 4DPKA 3UMFA 3IJ5A 5IULC 1WVIA 5B2ZA 2SCUA 1MFPA 2QYHA 3EYAA 2JGLA 4FJ2A 3VU1A 2ACWA 1JEYB 2PTHA 4Z3KA 5BPHA 5GV8A 2PEZA 3O8QB 4DQXA 5ENZA 2OXIA 5EN4A 1TCCA 2BR4A 1KI7A 1RVDA 1NV9A 5IEBA 4ERNA 1J6UA 4X97A 4B79A 1LPNA 2XHEA 1U1IA 1A9QA 2P4HX 1W9MA 3DG9A 5M04A 2JLBA 2W42A 3E5RA 5TY0A 3PVCA 3U16A 1RI4A 4BMSA 5FOXA 4F5ZA 4ZJZA 4ZYWA 5LD2C 1Z62A 4NWIA 4RSMA 4P2BA 1QZXA 1Z8HA 1ZVMA 3NTLA 1Q0HA 2GM3A 2X86A 5FX2A 1Y7TA 2YWXA 4E2YA 2UZAA 10MHA 2Y1CA 4H7DA 3KQMA 1OC2A 3VZPA 1VP9A 1VJRA 4ZVVA 3EXEA 4Z9XA 4BEWA 3VYTB 4O2LA 4BDTA 1H94A 1WXIA 4OK6A 1UFRA 3NIBA 2FG6C 3UA3A 3PNSA 2H1FA 4Q1BA 4F2GA 3VTAA 3PXEA 4WMLA 5BT8A 1P0QA 4IKOA 1R0RE 1TAQA 4MWOA 1WZCA 4H7KA 4KZKA 1SELA 4KMSA 2G1KA 4XIIA 5EZYA 1I94B 1NN1A 2A1UA 1OGYA 1ID1A 2Q3DA 1P91A 4YI3A 2FUG1 4FSHA 5KDLA 2AOTB 5FBWB 3CF4A 4MUAA 3PU6A 1GNRA 4ZQFA 2CL6X 5IAJA 5JZ9A 1KE1A 1Z47A 2ODEA 3DE7X 3HPRA 5KOJA 1G2OA 4TMKA 3RJMA 4XH9B 2PGAA 2EV9A 2H2FA 2JRLA 3CVXA 4DV3B 1FFBA 2NO0A 2I6SA 1JDZA 4N7JA 1E79D 2P78A 2FUEA 4H4EA 2EQAA 3M9LA 1AB5A 4ECEA 5E7JA 2WI8A 5JD6A 5EJ2A 4CMAA 4L0MA 1S6YA 5JQGB 3TQSA 5C8XA 1DTWB 2IK8A 3ILVA 5AK4A 4I2NA 4DPMA 1UKYA 1H6CA 3ORQA 5I5EA 5L9AA 3I04M 4IKPA 2PVPA 4U7PB 1XTBA 3UK6A 4B8ZA 3JD1A 1YBMA 1U0LA 5GIOE 4IO0A 1DL5A 4TSFD 4YXWD 4MR8A 4U5QA 5JI3E 3RYHB 2Z8ZA 1IBCA 5JRJA 1ZR2A 3E3AA 2Y8EA 1CDZA 2R8RA 3GC6A 3G0GA 4KKVA 1R74A 1KC1A 3MRVA 3V7NA 3PBKA 5A1TA 4Z4QA 1DWUA 1ZK4A 4AK9A 2E37A 4OD0A 3PQ7A 3EQZA 3DD1A 5BW8A 1Y3AA 3GT4A 5JS8A 4KDCA 3OOWA 3U44B 4QUBA 2YVLA 5AXCA 1KPHA 4Y1RB 1MOPA 3BE6A 2P68A 1P62B 2X19A 3ESRA 1Y5RA 2PWAA 5EXDA 2AC4A 1Z2OX 4GLJA 1R6DA 1NNI1 3AFMA 3SOPA 1H2RS 1DPGA 1VIMA 2HWKA 3DF7A 4RO0A 3SZ3A 3UVEA 1ORTA 4W5NA 3HVUA 4WBNF 1P61B 2GCOB 4EHHA 1LBTA 1E2FA 2ZRFA 4EB0A 1IDOA 3JD2A 2F9MA 3QXHA 4XPIB 4RHYA 4B83A 1I7DA 1J97A 2HA0A 3C39A 3DAOA 5CJ2A 5IAOA 1BD4A 4LG1A 2MYUA 2QE7A 2O8CB 4AKHA 1Z5WA 4Z2AA 2VXBA 5EHNA 1M2WA 3PTLA 1N75A 3E48A 5AH0A 2OQVA 3X1DA 2QWXA 2LPMA 3IMFA 3M2PA 1Z8NA 4BBPA 4KSBA 2R5NA 3OLYA 5AVRA 2O7RA 2RB5A 4LUCA 5DISB 1OTHA 2VJCA 1GPBA 1OJLA 2XE6A 1FVOA 2XIQA 2FSUA 3AWIA 3B7WA 4FYIA 4UBKA 2YW2A 3GGPA 4J94A 5DI3B 5FL3A 4YXWA 4D8VA 2GI4A 1Y6FA 3AFHA 2DQSA 3DVLA 1XTQA 3AFNA 3L92A 4IIXA 4M9QA 3UZUA 4C7XA 1QF7A 1VHTA 3B1XA 3OE1A 1OT3A 1YO6A 3UKOA 5GIPE 4L7QA 2I67A 4CKXA 1TO1E 3B1YA 1NFFA 3TINA 3HXMA 1G59A 4QATA 1VKOA 4BO9A 5AM4A 3NAZA 2SBTA 5MGBA 1RRPA 4HNAB 4L5JA 4DF3A 2QTVA 3UO8B 2IIPA 1CRQA 4LQDA 4EHKA 4O4LA 3QQ5A 1Z56C 4N7MA 4F4IA 4B3MB 4AS3A 5D6NA 3NCHA 1JEAA 3FGNA 4X54A 4BQFA 2ZUDA 5CFQA 4ARZA 3W5CA 1EI9A 3RD5A 1SD2A 1CUXA 2ECOA 5DTEA 1ZOLA 2ZYIA 3CFYA 3N6XA 4GSKA 4JI6B 2M1XA 3SDSA 2C9ZA 5D87A 1IQ0A 1USUA 4HEQA 2XQKA 3P9YA 5JLAA 2CKDA 1JYEA 1YR9A 1C4WA 5LKAA 1M6HA 1UC8A 2FR8A 3ZI4A 4Y1FA 5L7WA 4WY2A 3THXB 1V25A 2ZITA 1OB5A 3QE4A 3JQQA 4AIRA 3R6GA 5CFNA 4KIGA 5D2CA 4IHJB 4K6GA 4NJOA 4EBBA 4DCNA 4KO3S 3I4FA 1KYTA 3FW1A 2ORVA 4LV6A 4M0FA 1X94A 1MJNA 2XUDA 4PC6A 3ZHUA 2I3DA 5AO9A 1JBKA 2QRZA 2QORA 3JQAB 5CLLA 5I9MA 3WLTA 4DJAA 1EFPA 2VQ3A 3FOFC 2NW6A 1DSSG 1UP6A 2GHQA 4RTPA 3OQVA 4G1MB 3UUEA 3ZV4A 2NXEA 3QKWA 1X9HA 3QEMA 4R1OA 3IE0A 4D9KA 3HG7A 3FPEA 1BTOA 4ALKA 2C92A 1NP7A 3O4GA 1TCBA 1HY3A 4RTJA 3B2NA 1XD2B 2R4UA 3S0JA 5C46F 3O84A 3H2ZA 1TU3A 4IJWA 3TIIA 2OXCA 1NLZA 3DL4A 2G0TA 4BRSA 1SC9A 4LBZA 4IQ4A 3IOEA 4JWKA 4Y2JA 5L7YA 1S2GA 3LY5A 4FR2A 5BR1A 4B7ZA 4LRQA 4M9ZA 2OM6A 3CM0A 1D6MA 1CZLA 1QIIA 4WACA 5DLQC 1DLJA 2I1VB 1NG9A 4NI5A 1WE2A 3ECAA 3ESYA 5ALDA 5C1IA 4ZT2A 5EIHA 1P6XA 2G04A 5ETJA 3H5NA 4TS3A 4II3A 3T94A 4LZPA 3DQPA 4WOKA 1ONNA 5A4FS 1GUBA 4RMJA 2XT0A 3KL2A 4QFBA 4YFVA 2VPWA 3IIMA 3K5PA 4REQA 4ENPA 1U3GA 3IEKA 4MQBA 4ZU1X 4Z1MA 1Y1KE 5A7GA 5IYZB 1DO2A 3JPYA 3DPIA 2VRBA 2ACKA 5DHTA 1MO6A 1KHTA 1JDBB 2CLEB 5T67A 1SKAA 1LDBA 3WTCA 3ICQB 2A78A 1JPUA 3DPSA 2CEAA 1DEAA 4YCBA 4YPOA 2ECKA 4EJMA 2ERYA 1MP0A 4Y0NA 3N2NA 3UJ7A 1A4RA