1ENOA

Brassica napus enoyl acp reductase/nad binary complex at ph 8.0 and room temperature
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
297
structure length
297
Chain Sequence
b'LPIDLRGKRAFIAGIADDNGYGWAVAKSLAAAGAEILVGTWVPALNIFETSLRRGKFDQSRVLPDGSLMEIKKVYPLDAVFDNPEDVPEDVKANKRYAGSSNWTVQEAAECVRQDFGSIDILVHSLANGPEVSKPLLETSRKGYLAAISASSYSFVSLLSHFLPIMNPGGASISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKQNIRVNTISAGPLGSRAAKAIGFIDTMIEYSYNNAPIQKTLTADEVGNAAAFLVSPLASAITGATIYVDNGLNSMGVALDSPVFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENOYL ACYL CARRIER PROTEIN REDUCTASE
publication title Common themes in redox chemistry emerge from the X-ray structure of oilseed rape (Brassica napus) enoyl acyl carrier protein reductase.
pubmed doi rcsb
source organism Brassica napus
molecule tags Oxidoreductase
total genus 101
structure length 297
sequence length 297
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1995-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1enoA00
2NQTA 1HE4A 2RAFA 2BD0A 4FJ0A 3ZN2A 3QW2A 1UZNA 4XIJA 2PTGA 2DM6A 2FR0A 2ZATA 3EK2A 4IBOA 1E5LA 1A9YA 3WICA 3U09A 3G3EA 3JQAD 5AXDA 4M55A 2E4AA 2BFOA 5JW6A 5JDCC 2WMDA 5DF1A 4UUMA 3WMWA 4ZU3A 3I9OA 3GHHA 4RQUA 5TJHA 4R16A 4MVJP 3OF2A 4U5QA 4DMLA 2P4QA 1CRWG 1QV6A 2XPCA 3U4DA 4CR7A 4Q3EA 1VSUA 2O3QA 4XYMA 4ND1A 4YT8A 4AJHA 4NDNE 2Y1DA 1B0AA 5JDCA 3JQ8B 2VHYA 2X0IA 3VPXA 5TF4A 4W6ZA 1I33A 1DIBA 3F1LA 3RFVA 2XXJA 1HDCA 1YXMA 1HE2A 3RSHA 3RBXA 3ZWNA 4IS3A 1LX6A 2CVQA 3AM4A 5U9CA 3AOGA 5DNAA 4XQCA 1QG6A 4IDGA 4NJMB 5EERA 3ETGA 4Y6PA 1WMAA 3QVSA 1X7GA 4J6FA 4CMIB 2PK3A 5TQVA 3SX2A 3I23A 1DFHA 3HQ4O 2HUNA 3AUSA 4HFMA 3KLPX 3GAZA 4DVJA 3NKLA 2QX7A 2Q1WA 3LSYA 7ADHA 4CM5A 3JD0A 1VL0A 1BGVA 2JCYA 5A06A 5JSFA 2Z1MA 3S1LA 1I2ZA 3DTTA 3V8BA 2UDPA 2OHXA 3DMTA 3ZWWA 5CDSA 2DQ4A 4RQTA 2NVWA 5IZ4A 4LRSB 4OIMA 3PEFA 2OP1A 5IXSA 1HSZA 2HLPA 3OQ6A 2VZ0A 4KUEA 5EQFA 4B8ZA 3I5MA 4IUYA 1YDWA 1Y8QA 5CDYA 1NQTA 1E7MA 1R37A 2YV2A 1MFZA 2YHIB 4PCVA 4YJHA 5BQFA 1VPDA 1ZK2A 3GZ4A 3HE3A 1A71A 2CMDA 4Z6KA 5DCYA 4PLHA 1DFGA 1CIVA 3WWZA 4PG7A 1UP6A 2VRBA 1PWZA 2C20A 4YAJA 4XJTA 1U1IA 4CQMA 1UXKA 2AEFA 3ZWVA 4CM4A 4NG5A 2HKIA 3A06A 1GEEA 1WLYA 4RZIA 2PY6A 3PHLA 1AE1A 2J6IA 4X54A 4CM8A 1LLCA 4JN6B 3C1OA 4J0EA 3EC7A 9LDTA 1G0OA 1LXCA 2HRZA 3WIDA 1P1RA 2JL1A 2Y0CA 4IXTA 1GQ2A 2PKQO 1SOVA 2AE1A 4LMPA 5EN4A 2DBQA 4OSPA 4ZA2A 3TFOA 5IDQA 4YBZA 3E9MA 4P4LA 5TRTA 4WECA 3MOIA 1W4ZA 4DIBA 3HFGA 2P9GA 2AMFA 3DR3A 4IDDA 2WEKA 4II2A 3NT4A 3AUAA 1KVTA 1WWKA 1ZEJA 1JVBA 3VTFA 5B4UA 2W2LD 3ZWMA 1K6XA 5EIOA 3OIFA 2NVBA 2NACA 4ID9A 1E0DA 1K5HA 3L4SO 2Y0DA 2ZTLA 3SJUA 3SVTA 4D3DA 3I1JA 4XCVA 1G1AA 5TLSA 2EGHA 3B1JA 1NQAO 4NBUA 3JQBC 2B0JA 4D45A 5CG1A 2I9PA 4FFNA 1JKIA 2AEJA 4TRMA 4EDFA 2A94A 4E3ZA 1ZCJA 2DFVA 5COBA 3KSZO 2P5UA 4FFLA 3B20A 4MVJF 3DWFA 1NHWA 1NPDA 2O48X 5JO0A 3PZRA 4EUEA 4O1MA 1RPNA 3GR6A 1PS0A 4AL4A 2D5AA 5HTOA 3BMQA 4W7IA 3PHGA 2P9CA 1Z7BA 2WYWA 5IXYA 5BR7A 3JQBA 2JAPA 2TMDA 1PZEA 4I08A 1YQDA 2PFGA 4NBRA 1N1GA 2C54A 2PD4A 1IULA 3M6IA 4UUNA 4ALKA 1DOHA 4MKZA 4LSMA 3C85A 1DIRA 3SC4A 2GZ2A 3MJ4A 4YB8A 4JJFA 5IDXA 2WTBA 2UAGA 3ROMA 4RVHA 4U6QA 4A26A 4WEOA 1ISJA 1KVRA 4TZKA 3WLFA 2D3TA 4HWKA 4DBZA 1AXGA 2GN4A 1XU7A 4IZHA 4QUKA 3SLGA 1P1FA 4MJLA 4JCOA 4OQZA 1UUFA 2Q1SA 2VYNA 3KYDA 4LK3A 1C0LA 1O94A 3U4IA 3D0OA 3MTGA 3OJFA 1SCUA 4LSWA 4ESOA 4E33A 1F06A 3GUYA 1HRDA 1JDJA 1Q7CA 2CVOA 1R15A 1SMKA 4AJIA 1BW9A 1PJCA 1I01A 1XIVA 2UV8A 3WGQA 3F5SA 1HDRA 4ZHSA 1B8UA 2QQ5A 2DVMA 4GKBA 4KMSA 4G65A 5BT9A 3ZWAA 1SC6A 2OMEA 3WGHA 1O8CA 2ZJ1A 1YVEI 3A4VA 4ZD6A 3UCXA 2P9EA 4E32A 3DFUA 5A1TA 2X58A 1R0SA 2C29D 4UEOA 1DAPA 2X1HA 1WZIA 2ZTMA 5TC4A 3VDQA 2JD2A 4RVUA 2BH9A 3Q9NA 1IE3A 4IJWA 4LISA 3SBOA 4L4XA 1KEVA 3EYWA 4N5MA 3GGOA 3HADA 4F3YA 4R51A 1JKJA 2VOEA 3RD5A 4IGEA 4J2HA 3ETEA 1DRUA 3AI2A 1U7HA 2F1KA 1ZVMA 2WSBA 1WZEA 3G49A 3LT2A 1GPJA 2BFPA 4CLEA 4GMGA 4IDAA 3PWKA 3WIEA 2B69A 5HA5A 2NU8A 3GVPA 4ZRNA 1UDCA 4JX8A 5IDYA 4XQEA 3GRKA 3K92A 1YL5A 4UVGA 4R3WA 1XLTA 4UVDA 1OBFO 3JQ6A 1ZK0A 3E03A 4KP7A 1V35A 1ENPA 4YDRA 4YAGA 4QT0A 1TT5A 4J7UA 3H9EO 1WPQA 4KWHA 4U0KA 3RUEA 3QE3A 1GY8A 2GRAA 1QYDA 3GY0A 3KEOA 1NTOA 3EVTA 4W7HA 4J49A 3PFFA 2JFGA 4Z0PA 2J5RA 2HJSA 3ON5A 2X0NA 3JD3A 4D79A 1EBUA 2Q1UA 1CDOA 5AVOA 2EJVA 3H9GA 2BF7A 2BELA 1Q0LA 2HRBA 1JN0A 1FJHA 2ZB7A 3AY7A 3EAGA 1C1DA 1RKXA 2ZCUA 3Q11A 3A28A 1IZ9A 1T2CA 1UAYA 2W2LA 3U0BA 4P38A 3C7DB 3I4FA 3E8XA 2A9FA 2O50A 4B7UA 1TB4A 2HMTA 3ZU5A 4JBHA 1C0KA 3X2FA 1GUZA 3H5NA 4XRRA 4DL9A 2FSSA 2RCYA 1EVJA 4FIZA 4UULA 3RC2A 3BMOB 1X15A 3LLSA 1U3UA 1I3LA 5JC1A 3ROKA 4MVJD 1DC3A 2GZ3A 3A1NA 3ZU4A 4D43A 4QSMA 2YQ4A 1UXGA 3K73O 3Q1LA 1P33A 3L9WA 4XDYA 4W9NC 3MOGA 1KETA 1M76A 3CKYA 3RVDA 5C7OO 2I6TA 1YBVA 2VUTA 5FI5A 3DZGA 4ZVVA 7MDHA 1EEHA 1H9AA 4ND2A 2AQIA 2OORA 2ZTUA 1KIFA 1ZUD1 4IIUA 5ES3A 2PD3A 1WMBA 1TEHA 4E5PA 3DO5A 4R1UA 3TSCA 1O95A 4PG5A 3ROQA 5KNLA 1DB3A 2VYVD 4BQPA 1XCBA 3BXXA 3KSDO 4CLRA 1SNYA 4YAIA 5G2OA 1B16A 3DHYA 1E6WA 4XJSA 4B3HA 4QEDA 3P7MA 2A35A 4IQGA 3WQSB 5KCZA 2V65A 1M75A 5H83A 5JXWA 4W9NA 5AXAA 1U2GA 4GBJA 4JNKA 4CQLA 2JHGA 4K26A 1VL6A 3LK7A 2LDBA 5JCJA 4PLCA 5LDGA 4H7PA 3S8MA 4WJZA 4NPCA 4ZICA 5MDHA 2QHXA 5CP8A 3ADOA 3O38A 2ZKLA 5T5QA 3RIHA 3QWIA 2ZYGA 4XD2A 4TQGA 4M87A 3PYLA 3I6IA 1DJQA 2CUKA 3FI9A 2O23A 4FR5A 3JQ7B 5C7IO 5KOIA 4A7PA 1G0NA 1PJ4A 4NJOA 4PZCA 4BOYA 5TS3A 3RJ9A 1SPXA 1LUAA 4FFRA 1HT0A 4BO5A 2D8AA 3GOHA 5L4SA 1PSDA 3HZZA 3LLVA 1Z82A 4XWYA 4FFMA 4FOSA 1SOWA 1EE2A 3LT1A 4Q3AA 1QYWA 4D0RA 3AM3A 3E5MA 4W82A 1D4FA 5F1OA 4F46A 3C24A 4TMFA 1LDEA 1BDBA 3F1KA 1GCOA 3HHPA 4F6LA 3HDJA 4U0JA 1L1FA 4ONEA 1E3WA 3DOCA 1CWUA 5DOVA 3H6KA 3BZUA 3LT4A 3D3WA 3U9LA 3JD1A 4CLDA 3Q2IA 5A9RA 2J5KA 3L07A 2JD0A 5A3JA 4L76A 4MVJM 4XDZA 4LW8A 1EVYA 4AJLA 4YA6A 2FZEA 3PQEA 2TMGA 3LC1O 3RU9A 2V6FA 4BV8A 4JBGA 4HUJA 4R5MA 5AXCA 3V2HA 1X7HA 4DTIA 1YB4A 4I1IA 1JVSA 4DC0A 4B7XA 2QRKA 2NNLD 1R66A 2C5EA 3C7AA 2NU7A 1U9JA 4IS2A 2GASA 3FD8A 3UCEA 3RWBA 4EW6A 1LBEA 3TZKA 4EJ0A 3L4BC 1IHYA 1ZBQA 3WQRA 2Y0EA 2WD8A 3C3XA 1EUDA 3FWZA 4GGPA 3SC6A 1HDZA 1MG5A 2AXQA 4MPDA 3RC7A 4AVYA 1RM3A 4IMPA 2PWZA 3GNQA 5EESA 5TX7A 4BMNA 1VKNA 2NV6A 5EINA 4FQ8A 3WYEA 4QX6A 4A10A 3O26A 3ONDA 2BLLA 1PS8A 1LNQA 3KSUA 3VC7A 1XA0A 1H2BA 3VZQA 3FHLA 1L7EA 1ZMOA 1M67A 3B1KA 1P31A 1O89A 2C2XA 1HETA 4OXYA 2ZCVA 4BNTA 3L4BA 5LCXA 4B4WA 3ZDFA 1DAOA 4BO4A 2A92A 3AUTA 4GLLA 4TZTA 3ZWXA 3HG7A 4BO0A 1X1TA 3TDKA 1DC6A 2VT2A 3L6DA 1H6CA 5F3RA 4DIFA 2AW5A 1PQWA 3DL2A 2P5YA 2EHDA 1E77A 1DRVA 4I5DA 1HTBA 2GDZA 1B8VA 1OZAA 2AQ8A 3FWNA 2C82A 4PFJA 5DBFA 1QYXA 4PLYA 4ALMA 5G4LA 5KJCA 1MFPA 4RDIA 1NAHA 3F6YA 4CR8A 2Y68A 1NR1A 3BHJA 4J4HA 2IXBA 4Z9FA 1WVGA 2H63A 2EKQA 8LDHA 1KEWA 1XWFA 4NBTA 4XIYA 2ZQYA 5THQA 3JD2A 3W6ZA 2WE8A 1Y7TA 1EVIA 1ZO8A 4INAA 4W99A 3FNEA 1UDAA 2VQ3A 3WYCA 1DFIA 1PGJA 1PTJA 3NYWA 2G17A 4GVXA 4ZQGA 4CL8A 4GH5A 5BNTA 1UJMA 3CMMA 1HDXA 1ZSYA 4M86A 1UP4A 3MCVA 3QA9A 4JP3A 2EW8A 4GX1A 5C3MA 3KYBA 1PGPA 5A4DA 2QZ9A 2GLXA 3NRCA 3R3SA 3RBZA 3M2PA 1DSSG 3F4BA 4B4UA 4OOFA 3VH2A 4OAQA 1WDKA 1KY4A 1BRMA 3WXBA 1CQJA 1LDGA 1BHSA 4HADA 4PIVA 5JE8A 2YZ7A 4UREA 3GT0A 3CEAA 4GAEA 3T7CA 1D8AA 1NVGA 4RVGA 4ND4A 1DPGA 3UVEA 3DONA 4ZRMA 4ITUA 3K5PA 1V0JA 5L4LA 3OQBA 3DBHA 3TRIA 4WLUA 3E18A 3GZNB 4J9VA 2ET6A 4DPMA 5K6AC 2O2YA 5DBGA 5AOVA 4YT2A 1OC2A 3VAZA 3WMXA 4IY1A 5K0ZA 5JY6A 4HP8A 3D64A 4R54A 1GD1O 3WQQA 1LI4A 1BVRA 2O4UX 4MVJI 1FDSA 1ONNA 1P77A 3I9MA 2H5LA 5FFFA 4D3SA 2CNBA 3PIDA 3ZWOA 1GZ4A 1KERA 4ZN6A 3E9QA 1N9GB 4MIEA 3P19A 3ZWBA 5KVSA 5L53A 2DTDA 4Q3BA 3T7EA 3GPIA 1FDUA 3DDNA 2X0JA 2BRUA 4LVCA 5JLAA 1N8KA 1NNUA 4DWVA 1BWSA 2PZMA 4WNIA 5K6AA 1I36A 4IJKA 3FPCA 4PZDA 1LDMA 4WOKA 4WCFB 1QYCA 4O6VA 4NQZA 1R4MA 4YTEA 3TZQA 2ZYDA 3VKVA 2Z1NA 5LDHA 1E6UA 3KO8A 2NU9A 2NTNA 3O8QB 4YACA 3OEYA 5B37A 3MJVA 1P1HA 3GVCA 1LC3A 2WD7B 4MOWA 4R9SA 5I9LA 2O3JA 4MVJE 4GPD1 3AU8A 4B7CA 4P4NA 1PGOA 4XQ9A 4CUKA 2Y1EA 2DAPA 3JYPA 4E5YA 4NI5A 3PHJA 1NBOA 3TZCA 1JQBA 2R00C 4K6FA 3H9JA 2AHRA 4HX5A 3H3JA 4NFSA 1V3UA 1Z74A 1A5ZA 4U8GA 2X5KO 3GK3A 1MB4A 4KZPA 2C2YA 1LLQA 3NDJA 3H5RA 4BMVA 1U28A 2AG8A 2JKVA 1TLTA 1TT7A 1JWAB 2Q4EA 4DBVO 4CV0A 3MEQA 1GR0A 1ZSNA 2B35A 2B5VA 2CZCA 2DKNA 5IG2A 4WLVA 5BSGA 4IDEA 3QHAA 2V7PA 3FSRA 1YH3A 2J3KA 1LSUA 2VOJA 2NVUB 4YPOA 2OFPA 1UDBA 5DOZA 2D5CA 4GWKA 1P1JA 3WGOA 2R00A 4XB1A 4DMMA 1H6DA 4IDFA 4RF3A 1M6HA 3KETA 1UR5A 2PZKA 2PGDA 2YFQA 4BB5A 3IJRA 4O0LA 5A5FA 4UUPA 1PIWA 1XQ6A 2H9IA 3V1UA 4FBGA 1MX3A 1U7TA 4RPGA 4EEZA 5JNLA 2Q50A 3AI1A 1B3BA 1EDZA 3DMTC 1C0IA 1IB6A 2O4CA 4CV2A 2I66A 5ICSA 4E0BA 1ZXBA 3SXPA 1PJTA 3FNFA 1Q7GA 2PV7A 2ZB3A 2DC1A 4IZIA 1R0LA 2DFDA 4NK4A 1M6WA 2BKAA 3FPLA 3F47A 1C1XA 1K2WA 3HSKA 1GYRA 1OMOA 2JHFA 4FGSA 4IJUA 1V6AA 2GNAA 1U3WA 5I8WA 3Q6IA 1YL6A 3COSA 1ONOA 2WYUA 4G2NA 4CLXA 1NM5A 3DMYA 4LVUA 4BNMA 2C0CA 4HKTA 3DXFA 3AW9A 3DC2A 3LC7O 1TVEA 1B26A 4BNIA 5JY1A 1DEHA 4LMRA 3SEFA 2J3IA 3JQ8A 4ZQFA 1AN9A 3DAGA 1A27A 3OEWA 4CQMB 2BGKA 3NTOA 4CM4B 1U8XX 2HSDA 4FJ1A 4WEQA 2X9NA 4EGFA 5CFZA 1YDEA 1LRKA 4CM8B 4R1TA 4IMRA 2FSVA 3D4PA 3DZBA 5JDIA 4NJMA 2Q49A 1ZZEA 2GF2A 1ENYA 4CMIA 5I9MA 2HMSA 4TWRA 3IDSA 1E7WA 3QWHA 1B3RA 1Y81A 1HLPA 4NU6A 1J4AA 4CUJA 4WOJA 1C0PA 1U4OA 1KEPA 2A4KA 2Q46A 3GEGA 1DLJA 1HDYA 5COAA 3SLKA 1DHTA 3OFSA 1UH5A 5CEJA 2Y67A 2YHIA 1JAYA 4JBIA 4R69A 2J3JA 5DULA 3VH3A 4NFYA 3G17A 1E3EA 4CODB 4C4OA 4PLZA 2E37A 3M1LA 5LC1A 3M1AA 1I30A 1PR9A 2O3RA 4DYVA 3QQPA 4I5GA 3GEDA 3A14A 1ZIDA 3G79A 3F4LA 1A4IA 2VUUA 3F3SA 3LC2O 4H16A 2OO5A 4BGVA 4AJEA 1UXIA 3IQDB 3NGXA 2JCVA 5T67A 1GUYA 3K6JA 1LJ8A 2CDCA 2BFMA 1LRLA 4NBVA 1BXZA 3DHNA 1H94A 1VC2A 4YJFB 3Q3CA 3TL3A 5BSFA 3BMQB 1RWBA 2VUSA 1QXSA 3F9IA 4BNFA 2HK8A 1VI2A 1AXEA 3FRJA 3RUDA 4RGBA 3DAPA 3QWAA 3ZU2A 4GLOA 4ALLA 3PWSA 3QLJA 4TRNA 1BG6A 3RQSA 4J7CA 1C14A 1G6KA 4RLHA 3CIFA 3OJOA 4RZHA 5EL0A 3E1KA 1LTHR 3S2EA 5ER6A 3KBOA 4XGIA 5I7SA 3UCFA 3EUWA 1QSGA 1X13A 3LVFO 2HDHA 4W4TA 1K6IA 3K2BA 1IUKA 3KYDB 1ISHA 4FC6A 4J1TA 3D4OA 4S3MA 4EEXA 4BS9A 5EQDA 1UP7A 3H8VA 3L9XA 4BQRA 5KJ6A 1F8FA 3JQAA 3ANNA 1YBMA 1T4BA 3LT0A 2YY7A 1SZJG 1U5AA 4TVBA 3JV7A 4DREA 2X5JO 4H3VA 4QFDA 4G81A 4IXWA 1BW9B 4ND5A 3RFXA 3AY6A 2YJZA 4ALNA 4N18A 3TZHA 3IUSA 1L7DA 2P68A 1I3NA 1GCUA 5GMOA 5T64A 3WGTA 4BIIA 2OBYA 3WNVA 3MJCA 3MJTA 1JW9B 2IDZA 3ZGYA 3W8FA 1Z73A 4RVSA 1Z45A 1A9ZA 1H0KA 5C7LO 3CXRA 2FPPA 2E49A 4B4VA 1F17A 4MVJG 1V9LA 4D0SA 2OUIA 3K96A 4KTVE 2EERA 2WDZA 4YWJA 1KC3A 2DBVO 4DGSA 5IZCC 2HMUA 1RM5A 3BHIA 4J90A 1PZGA 1ID1A 3U5TA 1DC4A 5GY7A 2Z5LA 3GGGA 4MIOA 4WE3A 3C7CB 4E13A 3PZBA 1U3VA 3DBRB 4L4SA 2D4AA 3KYCB 3JCZA 1XHLA 2DTXA 2HMVA 4DQVA 3DHEA 1KVQA 4FB5A 1LQUA 1WAMA 5DT9A 2W90A 2FPGA 5DP1A 5ICMA 4Z9XA 4BNKA 5KJFA 4MKXA 4XX0A 4E30A 1Q0HA 5IZCA 1TT5B 1J49A 1NP3A 2RIRA 3KOUA 4WLEA 2IYOA 5L7YA 3DAFA 1QORA 3JD4A 1E7SA 3BHMA 1HZZA 4IGFA 4K1LA 4CR6A 3I9LA 4XB2A 1DHRA 1GL3A 3V2GA 2DUUA 2PGLA 2V6GA 4JGBA 1CERA 1XGKA 3PJFA 3TZ6A 2FR8A 4RPKA 2FZWA 3D3EA 1X0XA 4BKOA 2DBZA 1PQPA 3QP9A 3ZHBA 4CM9D 3ZW9A 1LDYA 4GI2A 1C1DB 3UXYA 2ZB4A 2BGLA 1HWYA 2IYPA 1O9BA 1YO6A 1PX0A 3IC5A 3V1TC 1PJSA 3QV1A 5ILGA 5MGBA 3BTSA 4D44A 4CM1A 1GZ6A 3NTQA 1DO8A 5G4KA 3W4JA 3W6UA 4RVFA 4Y98A 5IDWA 1B14A 5KVCA 3OJ0A 3RC9A 3KHUA 3N58A 1IPFA 2I3GA 3BA1A 3HNPA 2F00A 4B4OA 4E31A 3H9QA 1T4DA 4GGOA 4NHEA 4UUOA 4E2XA 3UAGA 1NQOA 2X86A 1MC5A 3CTMA 3JQFC 4GSLA 3HDHA 2ZK7A 3IS3A 1PZHA 2Z95A 3T4XA 1LQTA 3WDSA 3NAQA 1I3KA 5A3VA 2DLDA 3U62A 5CDUA 4BNGA 2I3AA 2VHXA 3ICPA 4E4YA 2HJRA 2Y99A 1T24A 1YOVB 2AE2A 3JQDA 1YQGA 3VOSA 2Y66A 3QWFA 4M49A 3KLMX 4QECA 2O7QA 1T2AA 5IN4A 3ETDA 3IOYA 1PJLA 2Q2VA 3F46A 2PD6A 4CLOB 4YVFA 4CQLB 1VLLA 3IMFA 1EQUA 3N74A 2WJPA 3FNGA 3PIIA 3JQFA 3BTOA 2VRCD 1TA4A 1SBYA 4NZ9A 4FSHA 4Q9NA 1IY8A 3VPFA 1E3LA 2IZ1A 4DYDA 1SAYA 4AJPA 5I7FA 3WX0A 1ENOA 3PHIA 3C8MA 3QVTA 1I5RA 4OYRA 2NADA 2X0RA 2X8LA 3GG2A 1NHGA 4PRKA 2GCGA 4L0QA 3W8EA 1O6ZA 4R5HA 3UUWA 3RC1A 1HDGO 1E7YA 2RH4A 4KDFA 1HEUA 3JYLA 5B1YA 3NT5A 1ISMA 1OAAA 4CUZA 4YAKA 5KIAA 1R0KA 1Y8RA 4IPTA 1KC1A 4UEJA 1CQIA 4PG6A 1LSJA 1NXQA 2EV9A 2X4GA 5L40A 4TSKA 5DCUA 1VJ0A 5HM8A 2BMAA 3INGA 2B5WA 1N92A 3OICA 4KOAA 1HLDA 3GMDA 1J6UA 4J9UE 4HFJA 3DB2A 3GFBA 3W4IA 4E2ZA 5TT1A 5CEEA 1FDVA 4YT5A 3VZSA 5T8KC 1YJ8A 4BV9A 3ZU3A 2X23A 3QVWA 1E3WB 2BHLA 4OH1A 2W2KB 5G0WA 3VZRA 3I3OA 2P91A 2XF8A 1MG0A 2PA3A 1WNTA 3GVIA 4URFA 4B79A 1Y5MA 1UXJA 3C1AA 4BO2A 5B4VA 1P0FA 4IQ0A 1D7OA 1I32A 1BVUA 5T8KA 1E92A 3ZCXA 1PL8A 1FXSA 1HDOA 3JQ7A 3S55A 4J91A 4AJJA 5CG2A 3DBLB 4FW8A 4RVDA 4WNCA 1I2BA 2PZLA 3KUXA 2NU6A 5KKCA 1QP8A 4DXHA 1X1EA 1A4UA 3B6ZA 1ULSA 4JJGA 3QIVA 2DBRA 1K0UA 2YW9A 1IYZA 3OQ1A 3TFQA 1BXGA 1MLDA 4XYBA 4YJGA 1OFGA 2PKQP 1VM6A 3Q0EA 1I10A 2JCXA 3PYMA 4PVCA 3ZV3A 3BMNA 3NUGA 1KYQA 1BDMA 1XG5A 2R6JA 4CM3A 4AG3A 4CM9A 1I0ZA 4K6CA 4LCJA 2P4HX 4AICA 4PGFA 4JJIA 4J4TA 3ANMA 4JQCA 5JPIA 3EGOA 3ASUA 4KQWA 5IFLA 1JU9A 3V1YA 2X9VA 2PH5A 4AFNA 3KZVA 2IZ0A 4HFNA 1J0XO 1M66A 2RH8A 1DJNA 2Y05A 1V3VA 2DPGA 1QR6A 1MA0A 3KV3O 3MZ0A 5H82A 1VKOA 3GHYA 3UKOA 3TF5A 2IE0A 2EWMA 3GFGA 4WK6A 3NDRA 3JQ9A 2QRLA 4L73A 4XR9A 3GLQA 2HK7A 5G0TA 4E12A 4OKNA 1BSVA 2FOIA 4L9RA 1Q1NA 4Y6RA 5J23A 3R6DA 2I65A 3QWBA 3NEPX 5ADHA 1B2LA 4S1VA 1LSSA 1NFRA 2DTEA 3PVZA 4BHTA 3TQHA 3W4KA 3WGIA 4BKQA 1E7RA 3PGJA 1DIHA 4MVJA 1ZK3A 1VSVA 3MTJA 4CMBA 4YR9A 5K9ZA 2C07A 1Z75A 2OGUA 4I9UA 5THKA 1MUUA 3U4CA 2J5QA 2D1YA 1H93A 4EYEA 3I6QA 3OECA 4IQ8A 4IDBA 3E9NA 3CMCO 4IIVA 4OXNA 1FDTA 4EI2A 3K8ZA 3K31A 4E2YA 3AFMA 3PRJA 3JQEA 4J2OA 3IAHA 4KUGA 4CMAA 2EXXA 2EF1A 3D4NA 4NR0A 2VYVA 1E3IA 1R4NB 4PLWA 2E48A 1DRWA 3H4VA 3RUAA 4N54A 2EP5A 2VN8A 3ITKA 3ZZNA 3STHA 1WW8A 4YCAA 1HE5A 1K3TA 1R12A 3R1IA 3HDQA 3DQPA 3TJRA 1UZLA 1ZJZA 2PZJA 4WPGA 2JD1A 1E3JA 3LF1A 3BTVA 2EIHA 2VWQA 1SB9A 1T1SA 3WTCA 4IJVA 4QTZA 2GN9A 3GDGA 4XRGA 3CPSA 5KKAA 4E6PA 3I83A 4EJ6A 1EZ4A 1ZJYA 4CL3A 4D3FA 3KM0A 4DQXA 3W1VA 4NMHA 1NFFA 4E2WA 4BNJA 2Q1TA 1HZJA 2FHSA 1Y9AA 1GYPA 2EG9A 2G1UA 4QO7A 1PGQA 3I52A 1KVUA 3DBHB 2UUOA 1BTOA 2Y1CA 1ZSVA 3BIOA 4MP3A 4H15A 4ZQBA 1QLHA 4C7KA 3K9QO 5A9SA 2E82A 1FK8A 2I67A 2QIOA 5CDGA 3PJDA 1K6JA 2R2GA 2C5AA 3UFXA 2B4RO 5L7TA 5A9TA 4P8RA 4XR4A 5I7EA 3JTMA 3PLRA 2Y1GA 3JYQA 4BGEA 4DPKA 4JLWA 3PQDA 4D7AA 2GN8A 2PGJA 2VWGA 4CQMD 1LDBA 3OH8A 1SB8A 3EZLA 1NASA 2IEBA 3ABIA 3RUIA 4CMEC 4BNVA 5I7VA 3KEQA 3HDYA 2GGSA 1XELA 1M2WA 1PGNA 3S2GA 5F21A 3EVNA 4GWGA 4CM6A 4O5OA 4AJOA 1P45A 1PQUA 1R4MB 4RF4A 4DA9A 4R3NA 1A7KA 1YBAA 2EKLA 4RCVA 4DLLA 3EW7A 1Y5RA 5FYDA 2WM3A 4BMSA 2QYSA 5C5IA 1GUFA 3GNSA 3GRPA 3OJLA 3QRWA 1Z6ZA 4M1QA 3CH6A 3GC6A 3UHAA 3WBBA 2GO1A 4I5EA 1CJCA 3S2FA 4CMEA 2CDAA 2JFHA 1QKIA 3DEYX 1EQ2A 4DQUA 3QSGA 4OO3A 5ITVA 4DLBA 1GU7A 3EZYA 3RUFA 1JLLA 2DU8A 1EK5A 2OL4A 4XYGA 1XU9A 1FMCA 1D1SA 2EEZA 1LC0A 2AQHA 3GH3A 1LSOA 3X2EA 2CF5A 1WDLA 2Y1OA 2C7GA 4BNLA 1MXFA 3N7UA 1E1NA 4CJXA 1ENZA 1PR3A 3D1LA 1RM0A 4FOOA 2AQKA 1P1KA 2IEDA 1NYTA 4DLAA 3NJ8A 1W73A 3GUCA 3BMCA 3I9KA 1VJ1A 5IAAA 2J3HA 3ICCA 2OOSA 3WNQA 1EDOA 3ZNNA 2X6TA 1YE3A 4J7XA 3AUUA 3GQVA 2WD7A 4GQAA 5DZSA 4RPLA 3LDHA 2B4QA 3HWRA 3JQGA 4CMJA 1ZMTA 5BSEA 1ULUA 4EZBA 4RO0A 3OSUA 4HY3A 2B37A 1B8PA 3VZPA 3ZV6A 2GPTA 4NBWA 1AUPA 4PLVA 4GKVA 1P74A 3E82A 3MWEB 2NTJA 2LDXA 2EGGA 3DOJA 4FC7A 3TN7A 4CV1A 2YDXA 3ONFA 3FTNA 2B83A 4A27A 4BNYA 2VYND 5L51A 3QY9A 2VNSA 1C1XB 5AYVA 4UEKA 2GERA 4YAEA 1ZEMA 2X9GA 3BTUA 1U3TA 3AFNA 3D5QA 5JMWA 3WJAA 1JKFA 5AQ1A 1WDMA 4BNZA 2YHUA 3L0DA 3P2YA 3R3JA 5TJ9A 4JK3A 4PG8A 1ZK1A 4FFPA 4WCDA 2NVUA 3PPIA 1ISIA 1OI7A 4KDEA 3KB6A 2JFFA 2BI7A 5JDIC 2X22A 2Q45A 3QVOA 4Q3DA 1Y8QB 2XOXA 3ZNOA 4YJHB 3KTDA 1ZXLA 2YFHA 1U2DA 4QQRA 1CYDA 4Z3KA 1GADO 3CZMA 4J1QA 1HYHA 2FY8A 2FWMX 1RM4A 2GUGA 4PLPA 1ZK4A 1ADBA 2O2SA 3RKRA 2FR1A 4FJ2A 4WLNA 3ZNPA 3ANLA 1Z7EA 5TNXA 4D46A 5JAZA 4TRRA 1VJTA 1BMDA 5JAQA 3IKVA 4AJKA 3TL2A 1ISGA 3RUCA 3WGZA 3ZW8A 6LDHA 5U1PA 2GN6A 2CD9A 1WXDA 1HL3A 4WUVA 5JAMA 4PVDA 4I8XA 3ULKA 3FNHA 4BO3A 2Y93A 4J3FA 1P3DA 4Z0TA 4YRAA 1EUCA 4RPJA 5L4NA 3R0IA 3WB9A 1JA9A 1UAGA 5EMHA 2NSDA 3FR7A 3IIEA 2VZ8A 2DPHA 4DC1A 1SO8A 3NGLA 2UVDA 3A9WA 1CETA 3NDIA 3Q2KA 3WSVA 3IKTA 2D2IA 4BO1A 3VHRA 2OP0A 2YV3A 4OKIA 2CY0A 1YL7A 3OA0A 5KVVA 5H81A 1IZ0A 1XKQA 4RF5A 5ENDA 3PFWO 1YONA 3VDRA 3PP8A 1H6AA 3T4EA 4J0FA 1IPEA 1HYGA 3VPHA 3HFSA 3OIDA 3O9ZA 2VTEA 3HUDA 4Y9DA 1PL6A 2ZJ0A 3RU7A 4BB6A 4Z3DA 1E1KA 2QG4A 3TOZA 2O3TA 2O3SA 4CMGA 2D59A 4M8SA 3ASVA 3PDJA 5CEFA 5L45A 3GG9A 1FF9A 1AHHA 1N2SA 2V6MA 2W4QA 4Q3CA 5ILOA 2ZYAA 3V2UA 5JYDA 4EUHA 4M89A 1PJBA 1NFQA 1R16A 2NM0A 2NWQA 2NLOA 2HQ1A 5DBIA 2EP7A 1PJQA 1E7QA 3AOEC 3VPSA 1S6YA 2FMUA 3AWDA 3GN2A 3L6EA 1LEHA 2VHZA 5U4QA 3PJEA 4BUCA 1P9LA 2NQ8A 4EBFA 3JQAB 3ZHZA 1B7GO 1YGYA 3IP1A 5C37A 3IL2A 1AHIA 1PJ2A 2G82A 1EBFA 1V3TA 4AJ2A 1GZ3A 1R6DA 3H5AA 1I2CA 5CAEA 4HBGA 4FGWA 4YYZA 1ADGA 4HNGA 3GVXA 5GZ6A 1YB1A 2RBEA 1EFKA 4YJFA 2J8ZA 4DPLA 3UW3A 4HV4A 3DZKA 1ZNQO 2VWPA 3AOEA 4M54A 4UVIA 4BO9A 2QW8A 3D7LA 3H2SA 1E3SA 5F1PA 4BNWA 3RBVA 1YS4A 1P0CA 2RHRA 1F12A 1XEAA 4K28A 3RROA 1D1TA 3GPDG 2H6EA 3JYNA 4TROA 1N7HA 4MP6A 3MWDB 1E6EA 3UOGA 5JCJD 4LRTB 5IF3A 3DOOA 1PU2A 2O3UA 5DN9A 1ADFA 1PEDA 1LDNA 1LLDA 1VL8A 1H9BA 1HSOA 4JP2A 4XA8A 2X7HA 4YJDA 4YEDA 1N7GA 2YV1A 1QYVA 2B36A 5CPFA 3ZHXA 3PGXA 2ZB8A 4Z0HO 5DDIP 3I9NA 1TXGA 4KWIA 3IJPA 1O5IA 1DLIA 1E1LA 2OBNA 4PLTA 4ROSA 3RAJA 4XGKA 1LA2A 3CSDA 2POQX 2VHWA 5A03A 3RI3A 2G5CA 3GMSA 1YWGO 4OGWA 4CMKA 3PI7A 1EE9A 1HYEA 2D0IA 3PTZA 4I5FA 1HXHA 2HU2A 4RL6A 3BYZA 4A0SA 1UZMA 1ML3A 1W8DA 2OZPA 1GV1A 3G1UA 4BO6A 4CMCA 3RKUA 3CE6A 3ZHYA 4CM7A 2IRWA 2PKRA 1FDWA 3ZV4A 2EJWA 2C59A 3KRTA 1E5QA 1ARZA 1PJ3A 1XYGA 3JSAA 4PLGA 1QLJA 3WOHA 4BVAA 5HBRA 2DT5A 3OP4A 1PZFA 5BNFA 3AK4A 1JAXA 3KXDA 3OMLA 4D41A 4YXFA 1LRJA 1KVSA 1ADCA 3ST7A 3DBRA 3LQFA 5EJ2A 4WASA 5G0VA 4P22A 3KYCA 4GX5A 4I9NA 4K9DA 4RV9A 4XGNA 1T2EA 2GYYA 3UN1A 5L9AA 2Q3EA 3MJSA 1GAEO 4PRLA 5G4KB 4BNXA 3E6AA 1DDOA 4R1SA 1EMDA 2AG5A 4KTTE 3RCBA 2ZTVA 4AJ1A 4L4RA 1NX6A 1C3VA 2AEMA 4L8VA 2FPIA 3TNLA 4MKRA 1A7AA 1PL7A 2NUAA 4Y6SA 5KJEA 3D5TA 1Q7BA 1T2DA 4F6CA 1D3AA 5IN5A 3ROPA 3VKUA 2Q2QA 1VE9A 1NAIA 2IZZA 1MP0A 2ZIZA 2G0TA 3WG9A 1YQXA 2Q4BA 3NTRA 2PNFA 2VCYA 3ZWCA 1ZW1A 4OM8A 4J1SA 1X14A 4QXMA 5I9NA 3VTZA 2HK9A 3SJ7A 1DIGA 2BGMA 1J5PA 2PLAA 4B3IA 3HB5X 3RFTA 4UVEA 4O59O 3P2OA 2VHVA 4B3JA 2BFAA 5CHEA 4CLRB 1I24A 3WS7A 3UF0A 1Y1PA 3WLEA 4FDAA 6ADHA 2QRJA 4UAGA 3LZ6A 2H1SA 4IM7A 4GX2A 2ZQZA 1GPDG 4GVLA 4A73A 3I4CA 4BKRA 4E21A 3LU1A 1Q2XA 3W8DA 5KWEA 4DIOA 3NV9A 1GQYA 4OSOA 1O0SA 1KEUA 4LCEA 4L75A 2HCTA 2O7SA 2X5OA 2ILTA 1X7DA 3HN7A 3EDMA 5HRUA 1W0CA 4BKUA 3MJEA 3BMOA 2CFCA 5T57A 3NX4A 1ZKMA 3FN4A 1Y8RB 4OL9A 5FI3A 4YQYA 4XYLA 3ONEA 4Q3NA 3ORFA 4EUFA 1H2HA 1NR7A 1YB5A 5ENVA 1HKUA 3OA2A 4OMUA 4BKPA 4DUPA 4RDHA 1YOVA 3CZRA 1MV8A 1Y6JA 4NH4A 5GZ1A 5AXBA 3O03A 1PS9A 3TOXA 4AJ4A 5JS6A 4F45A 4RLSA 1XDWA 5KVQA 3FCOA 4CLOA 3OHSX 3GAFA 3ZWYA 4JXKA 3EMKA 4ZQEA 2WWRA 1SEVA 4MINA 4N5NA 1T26A 3RASA 3WFJA 3IUPA 4NIMA 4JIGA 5A05A 1BXKA 2I99A 4U7WA 3WR5A 4PN3A 2VWHA 3HB4X 4IDCA 1NQ5A 3GA0A 1F8GA 3D3WB 4XKJA 2HMWA 2HO5A 4A2CA 5BSHA 4XEHA 5L95A 5JCXA 2Q2WA 3C1TA 3Q9UA 5HS6A 1IOLA 1F0YA 1YJQA 2I5PO 4NFHA 1F14A 4GX0A 2UUPA 4J1NA 2VZ9A 2JAHA 1DIAA 1PWXA 3DBVO 4N5LA 4GSKA 5FF9A 1JTVA 2QZZA 1Q0QA 1EVZA 2Y1FA 3KVOA 2VTDA 3HJAA 2VNAA 1H5QA 4QFCA 5F5NA 5ITWA 2IODA 3FF4A 4IINA 1BXGB 3INTA 4YT4A 5TGDA 2GZ1A 1LU9A 1NWCA 1RJWA 4OXKA 3O4RA 4PLFA 3GEMA 2WE7A 3GGPA 3M2TA 4R68A 4YJGB 1NVMB 4FD3A 3U49A 5T6BA 3U4HA 4TVOA 1T25A 4TKLA 3DZIA 3L6OO 3BMNB 4FFOA 4WKGA 4BNNA 4LGVA 5CDTA 2W2KA 3FBTA 4ND3A 1B15A 1ORRA 1A72A 1XR3A 1NPYA 3GF4A 3PHHA 3ADPA 2QYTA 3LF2A 4R01A 1DXYA 1NPTO 3JQ9C 1GTMA 5BNIA 2WYVA 5FEUA 3AJRA 2EKPA 4TKMA 5IJZA 1T1RA 1CEQA 1VRWA 5HS4A 5G0UA 3WTBA 3ENNA 4DRYA 2P2SA 5B4TA 4ZJUA 1YRLA 1N5DA 1P44A 4BGIA 4FPXA 2CSUA 1EK6A 2NTVA 4YRDA 5JC8A 1I3MA 2XAAA 3WFIA 4BNHA 1MGOA 4G5HA 3DBLA 4R41A 4FS3A 3WWYA 1IL0A 3PWZA 2GSDA 2PH3A 3EHEA 3GNTA 3PK0A 3IP3A 3AU9A 1GFSA 3VH4A 4RF2A 4ILKA 1KY5A 4J16A 4P4GA 5HWSA 4ZQHA 4O63O 2W98A 4XQGA 3H3FA 3OIGA 4OOEA 1LLUA 2OXIA 1DC5A 2CDBA 3VVCA 3NJ4A 2YUTA 1GEGA 3E48A 3H2ZA 1GDHA 5L7WA 2DUWA 4GMFA 1NVTA 2YDYA 5FWNA 4UVHA 2HAEA 3CINA 5L3ZA 4Q39A 3ENKA 4RORA 4E5MA 1GQQA 4BGUA 4MIYA 3E5RA 4MO2A 3GDOA 5TT0A 3FBGA 2BI8A 2PR2A 5JO9A 3VH1A 2C7VA 5TSDA 4QO8A 4CLHA 4WLFA 1MXHA 3ZV5A 3K30A 3I9JA 5CPBA 2VT3A 4LN1A 5F1KA 2G76A 3DTYA 3OETA 3RJ5A 5COQA 2YQ5A 3JYOA 3HN2A 2VRCA 3INRA 5EPOA 4BL5A 4N7RA 4BNUA 4EITA 4NNJA 5F5LA 3S2IA 1QMGA 3LYLA 3VPGA 1KBZA 4TRJA 3RUHA 5KJ1A 2FRDA 3B1FA 1KOLA 3G0OA 3ZWPA 1T2FA 2AA3A 2YYYA 3PLNA 4Z9YA 2SCUA 3WGYA 3WSWA 3NT2A 3WGGA 1EFLA 1ZFNA 4AJNA 1P1IA 1H6BA 1V8BA 4U6SA 1ONPA 5A9SB 3OM9A 1X0VA 1QRRA 3FTPA 5JMPA 3WJ7A 4HXYA 1RYDA 1NWHA 4E5NA 1GV0A 3H9UA 3L77A 3PXXA 4FN4A 5A04A 4MDHA 4BO7A 1OOEA 3AM5A 4D42A 9LDBA 3UGKA 3GDFA 1IHXA 4A5OA 3G1TA 5JAIA 1R4NA 5DP2A 3PJGA 1OC4A 1EUZA 3GN1A 2XXBA 4CPDA 2GR9A 5ER9A 4RJTA 2EW2A 1U8FO 4JROA 3ZI0A 3DFZA 1U5CA 3PQFA 5B12A 1MC4A 1XSEA 4NK5A 3B70A 3QVXA 2GD1O 3ZH2A 4MP8A 8ADHA 4J43A 5GZ3A 4XYEA 1I8TA 4R9RA 4FCCA 4HNHA 3GVHA 1AGNA 1N1EA 4R1NA 2RHCA 4I9HA 2B4TO 4KQXA 4YRBA 3QJ5A 1Y9EA 4WGGA 4CMHA 1GYQA 4C7JA 4CV3A 4A03A 5A02A 1UXHA 4R4JA 1HE3A 3AY3A 5JFOA 4E5KA 3WYBA 4II3A 3UH1A 4KUHA 1RYEA 3H7AA 2Q99A 3FR8A 3BAZA 2CVZA 2IXAA 3OBBA 1TI7A 2V6BA 4PG4A 1W6UA 5KTKA 3AI3A 2I76A 4J4BA 2JJYA 4NU5A 1YKFA 3GZNA 1JWBB 5JBIA 4ALJA 4ALIA 3OJEA 4WLOA 1ZH8A 1U4SA 2UYYA 3F5QA 4XZ3A 4WCFC 1XQ1A 4OJNA 4L74A 5I8ZA 3TPCA 2FN7A 3PDUA 3VVBA 5JYEA 5DCWA 1DBVO 3P5SA 4Y67A 1SEPA 3TWOA 3BMCB 3JQCA 2CF6A 1N9GA 2E6UX 4BO8A 4ZGWA 4OHUA 1S7CA 1K89A 4OQYA 1KS9A 3ZNQA 4B8WA 3V5NA 1HF3A 1CF2O 3DZFA 3DZJA 5G0SA 3CUKA 3ITDA 1ISFA 3U3XA 3UICA 4HFRA 4EJMA 3JQGB 4MVJH 5TIIA 1E1MA 3DZHA 1WP4A 4Y8VA 3K2EA 4RPHA 4WCFA 4GL4A 2W8ZA 3EY4A 3PYXA 4PZEA 4YQZA 1QV7A 3H65A 5A5EA 2FP4A 3O8QA 3WBFA
chains in the Genus database with same CATH superfamily
4COKA 1JV2B 3CW8X 4UNPA 2RAFA 4CQJA 3SSNA 1GGKA 3M89A 3ZN2A 4YGYA 1KMHA 1OX4A 2VYFA 5AI8A 4XIJA 4QPNA 2WNHA 5TQJA 5ALPA 3ZG6A 2C4VA 4TWJA 4IBOA 3GLIE 3HVHA 3G3EA 1XTZA 2JGJA 4I81A 1VE3A 3RSLA 1QF7A 2BKUA 4R1LA 4EG3A 4Y9SA 4UUMA 1RWXA 2AX4A 1QZXA 3NOQA 1EVKA 2XGSA 1E6CA 5CH8A 2WF9A 3I9OA 3GHHA 1XTSA 5L3SA 2RGNC 5TJHA 1RMQA 2RJ3A 4MR9B 4R16A 1FPMA 3T3EA 5LOVB 1O5TA 3E9CA 4U5QA 2WK1A 1GPBA 4L5AA 4OHXA 3LBFA 3T06B 3HVIA 1ICEA 3VR0A 5CJPA 1TD1A 3KPWA 2JDIA 1DAHA 1FEZA 2FK8A 5E2IA 3U4DA 1XXLA 3A04A 3MF4A 4ESHA 4DV0B 1S8AA 2CFOA 1TQ4A 3R75A 4YT8A 5DNYB 1OUMA 1NJ2A 4WXMA 2Y1DA 4PR3A 5JDCA 4EYKA 1L5HB 1B76A 2VHYA 4TXLA 5LBUA 5D84A 4QEZA 1I33A 3EFOB 3F1LA 1NVVQ 1PJRA 3H87A 3RFVA 3IB3A 2XXJA 1K5GA 1MZVA 1POXA 3AUXA 4KQIA 1OA0A 1TUEA 1YXMA 1MMFB 4RYLA 3ZWNA 3F3YA 5U9CA 3AM4A 1GUDA 2JFOA 1G66A 4XQCA 4BVBA 2RIPA 2VT7A 3BVPA 4G4GA 1R64A 2JH9A 4K9NA 1NTRA 3QVSA 4NJMB 4PC2A 4Y6PA 4YP6A 5FL7D 4ANFA 2PK3A 2FDXA 5TQVA 4R8VA 1R0BA 1XMVA 3SX2A 2P0EA 3I23A 3T94A 1E0AA 2P30A 4CW7A 2HO4A 5I5EA 2F9MA 5IBPA 3KLPX 3GH1A 1Z6AA 4DVJA 1RYBA 3CRNA 2CNKA 3NKLA 1U8TA 5BRJA 7ADHA 2CSXA 1VL0A 4FEYA 2W6JD 1BGVA 4GUAA 3P9YA 4EHHA 5A06A 2JIMA 1SWWA 2Z1MA 1JHAA 2ZAIA 3OE7D 1GP2A 4GBMA 4IIHA 2N75A 2P3SA 3V8BA 2VHUA 4WKNA 3BRCA 3ZWWA 1WG8A 4C0SA 4BRUA 3ZVMA 3NEJA 5IXSA 1HSZA 4YPFA 3E2MA 5HIMA 3UPUA 5EQFA 4KUEA 3AONB 1XCOA 3UMBA 3VZCA 3R7FA 4MWDA 2NZ8A 1NQTA 1E7MA 4MQ6A 4YJHA 5K3FA 5CDYA 3LCVB 1VPDA 1ZK2A 3LDAA 3KT3A 4BEWA 5CYFA 1LI7A 1VHLA 4KAXA 4LY6A 3QVMA 4PLHA 4QJ4A 3WWZA 1Q12A 5FLEX 2C20A 2RGCA 2VVTA 1O6BA 2AR7A 4BUJA 4OGLA 4CCYA 1JQAA 4CQMA 4F72A 1RI4A 1UXKA 3ZWVA 2OKCA 4KH1A 1QFJA 2WJAA 1T34A 1U02A 1ZUNB 4I99A 4UDYX 1BCRA 3U80A 4US2R 3D3NA 4R2IA 3C5WP 2J6IA 4Q6BA 1RTKA 4XD7A 4CM8A 4NCBA 4EKIA 3C1OA 4J0EA 2QW1A 3D8TA 1TMGE 4K7JA 3SQNA 2GVZC 2Z8YA 1G0OA 4RM2A 4C7OA 3WIDA 4TYMA 2ZSKA 2CFTA 4EJ2A 2PKQO 1SVOA 2ZXEA 2DBQA 3IQHX 3TRHA 4KN9S 4KQCA 1CUJA 2QMYA 3ED1A 4WBNA 2FZKA 3LFHA 4P4LA 5TRTA 2CC2A 2WWFA 4K87A 1K97A 5EJ9A 1HUQA 3HFGA 1X19A 2P9GA 4BKMA 4IDDA 4JI1B 4II2A 4UBNA 3MLAA 2QV7A 5LQKA 1X9HA 2RKOA 1ETHA 2XKAA 4JJAA 4D9MA 2BFDB 2X8JB 4KFRA 4BVKA 2GRJA 4RDCA 1GQRA 5CA0F 3CFYA 1M33A 2FX2A 3BJIC 3REOA 4EG0A 3F7TA 2NACA 3IPAA 4ID9A 5LU8A 3OFJA 3SJUA 3MD0A 3BA6A 3WMGA 2R97A 4U2CA 5L3VA 4XSHA 3GLHA 3OEHD 4B46A 5TLSA 2EGHA 1A1SA 1NQAO 4YCLA 1ZN2A 2IOFK 3WLPA 4B87A 1GKYA 1OW3B 3UIEA 4EDFA 2AEJA 4RC9A 5LNK6 1ILEA 1O0BA 4JLJA 3GNLA 2KWIA 2FRVA 3CVWA 4QPPA 3KSZO 1BMFA 3BILA 6Q21A 2XLCA 3OTOB 1GVNB 4I4LA 3QNWA 4QYSA 2QZJA 3DWFA 3K32A 2PWBA 4H1WA 3DV2A 3MNFA 3A4TA 5KTSA 1N78A 4KPEC 3ODGA 4O1MA 1NZFA 1PS0A 1TLLA 2P3LA 3ZXSA 1XU4A 5EHGA 4EZIA 1QRSA 1WPGA 1F48A 2PUHA 4YV7A 1GAWA 4NULA 1T0UA 4YWHA 1NXXA 2P35A 2JAPA 4RA9B 1AKQA 1N1GA 1VKJA 2Y9MB 4NBRA 3CEPB 4S2EA 1D9ZA 4KVFA 1UM9B 2O8BB 3STYA 4LSMA 3AR9A 1DIRA 3B89A 5SZKB 4D0LB 2D00A 1YMQA 2E5WA 1ZMXA 2Q6IA 4FLFA 2Z09A 4RETA 5AT1A 4F7WA 4KNYA 4RVHA 4GKKB 3H6HA 3WLFA 4TZKA 2FSIA 4B47A 5M34A 1AXGA 1Y7LA 4IZHA 1JG1A 1P1FA 3A8TA 1WU8A 4JCOA 4OQZA 1CFJA 3U0VA 1UUFA 1R9GA 2Q1SA 2VYNA 3DXZA 4LXGA 2WHRA 4F7DA 2AFHB 3F6RA 2AF4C 4G8JA 3D0OA 3WADA 2NX2A 3OJFA 3H5IA 1FTWA 3FPJA 1X38A 1BAPA 9ATCA 5K8LA 2AS0A 1F06A 3GUYA 4HAWA 2P1ZA 1HRDA 2BFBB 4ZPJA 5KCMA 1T3SA 5B58T 1R15A 2JB9A 3OIYA 1BW9A 1OU0A 1I01A 1XIVA 2Q9UA 2UV8A 4GOLD 1VBKA 4XTRA 5BO5A 1U94A 1N6HA 4X1KA 1B8UA 3GFRA 2BAGA 2DVMA 3COYA 1MNQA 4GKBA 3CR3C 5C8YA 1G18A 4CEJA 3BWXA 4C76A 1O8CA 4RTLA 2IEAA 2OD2A 2ZJ1A 3ANYB 3QYFA 1MORA 1YVEI 5AVJA 3UCXA 1P1CA 4D9IA 2P9EA 3DH0A 3DFUA 2YUIA 3IA7A 3L01A 3QOFA 1R0SA 2C29D 4UEOA 1DAPA 1W6RA 4INPA 1ECJA 2CNWD 2PX5A 3ITEA 1BEEA 1IE3A 4GOJA 2ZUVA 2ASEA 1XWIA 1E5DA 1OLUA 3I12A 4Q6WA 5EP3A 3TB6A 5C1PA 1J56A 1UBJS 5LM3A 1Y80A 3OC6A 1QU3A 2V7UA 4R51A 4JBWA 2C03A 2VOEA 2PMWB 2R8EA 4IGEA 2EFJA 4J2HA 3TAHA 4ES6A 2JCGA 4Z7QB 5B2EA 5TARA 1GCIA 5EJEA 1M0WA 4I7EA 4HVLA 3D8UA 1NA5A 3OT1B 3UBTA 4NBSA 1ZGJA 1T4CA 2BFPA 5HHTA 1Z2AA 3O0TA 3R0QA 4IDAA 3PWKA 4MEBA 3I5UA 3PB3A 4MQFB 4QYIA 3TTXA 3IRUA 4I55B 4MS3B 4NBNA 2NSJA 5A4JA 1N7JA 4MWZA 1F0PA 3AESB 1QPZA 4C20A 3UWPA 3GVPA 4ZRNA 3G5UA 3CXUA 3HCCA 3TCNA 4HEJA 4DBLC 3CWZA 3KB2A 4JX8A 4KQ9A 3P0FA 3GRKA 2QQFA 5FOSA 1NI4A 3VR3A 3HO1A 3ZHOA 1XLTA 1V43A 1OBFO 3L7OA 3HMQA 5ISMA 1ZK0A 4ZVUA 3W04A 4KP7A 5IVIA 4BMPB 1ENPA 3QKUA 2CLLB 2MSNA 1TVMA 3DQZA 4YDRA 2XZOA 3Q8KA 3JQPA 4J7UA 3KUKA 4J29A 2WUVA 3DDZX 2VTKA 3ORHA 2XA9A 5EJIA 2OXTA 3RHSA 3MJRA 1FZTA 4FYYA 1QYDA 1NTOA 2NPFA 5JHGB 1RBMA 4J49A 4CIXA 5A3QA 2J5RA 1BXRA 2P8JA 4RHTA 2X0NA 4ZT2A 3TLYA 4ACAA 4D79A 4E2FA 1EBUA 2GMWA 1CDOA 3CZ5A 1FL9A 4G25A 4HNQA 4AXXA 4I36A 3C3BA 5IARA 2ZB7A 4P92A 3I32A 3W9YA 1K66A 3ELWA 2XMZA 3LQKA 3MERA 1QKJA 3K09A 1RBQA 3Q11A 3VU9A 4EF5A 2C2WA 1T2CA 2V7GA 4B84A 3V7WA 1L7NA 3JZDA 1UAYA 2H5IA 3IXMA 3L8MA 1J22A 3MA0A 3U0BA 4FHGA 2Q62A 5EP1A 3RK4A 4B7UA 4C03A 5HKKD 3O74A 5FTJA 1YRAA 3KE9A 3KS9A 4JBHA 1H2RS 4NU0A 3ZKWA 3I58A 5K09A 2RCYA 3ZOKA 4FIZA 4BTEA 2R7AA 1WXHA 3QTLA 3A7EA 2LCQA 1UANA 3RC2A 4C21A 3LQ1A 1D8TA 4B2PA 1J42A 1X15A 4GPTA 2W58A 2RAUA 3V7FA 3DDCA 3V46A 1DC3A 2B2CA 2C9CA 4MUFA 1T43A 3FZNA 2GZ3A 2LVBA 3A1NA 3COZA 3ZU4A 4D43A 4QSMA 4YMVA 4KQGA 1UXGA 3Q1LA 3S68A 3L9WA 2Z2YA 4EJSA 4IHQA 1U3CA 3VYUB 3RVDA 1KETA 1U2GC 1ZL0A 3FWHA 4QVGA 4WV3A 4MI6A 2IXTA 2RGEA 3WB0A 2R5WA 1L7OA 3SMQA 7MDHA 3AVYA 4WMLA 2AQIA 4EELA 1DG1G 3A1UA 1YJXA 3CZCA 3OG9A 3DVAB 4IIUA 4N39A 1WMBA 5A0VA 3DO5A 5AVQA 1M5TA 4I4TF 3SJCA 3I2JA 4PIMA 3RVMA 4MO9A 3ROQA 2RGRA 3K1AB 1EJBA 5B57C 4FOLA 3BXXA 2R751 3KSDO 3TGPA 2KB0A 4Q1FA 4WJLA 4B3RB 3IIKA 4YAIA 4K86A 3DHYA 1E6WA 1TTTA 1AZWA 3A58B 2NTYC 3DE4X 5BNWA 4C4PA 1NRIA 1T8TA 2A35A 4G5FA 4IQGA 4BATA 2V65A 2K7FA 2YVUA 1C0EA 3RSOA 3ZJTA 5ALYA 2HT1A 4CQLA 4D4GA 1QZ3A 2P79A 4YMLA 3U1TA 4C4AA 1KDOA 3LK7A 5JCJA 5LDGA 5K5EA 3ZQ6A 2DFKB 2PXXA 1CUVA 3S8MA 5CVVA 2NZJA 1JX6A 1P2BA 1XT6A 3ER8A 4P7GA 1DV1A 4RADA 4EPVA 5LQJA 5MDHA 1B6GA 4TV9A 5KO2A 1C5KA 5KOJB 5TVGA 3WK7A 3ADOA 2ZKLA 1THZA 3LA8A 2ZVDA 1IDN1 4KIWA 2QVGA 1NI3A 1QHYA 2ZYGA 2R8BA 5IASA 1AQIA 3A05A 4MW7A 4U7PB 4XD2A 2ZVPX 4AECA 4Y2XA 3H05A 2ZIGA 4ZCMA 4X93A 3PYLA 3C4JA 1DJQA 1L5LA 2WNSA 1CY1A 3QFRA 3LSTA 2AC2A 3JQ7B 5KNBH 1Y8AA 1GKKA 1WA5A 4GEGA 5F7OA 3DVSX 2VK4A 1PJ4A 5B3AA 4NJOA 4G0MA 1T8YA 4QUHA 3ZWQA 2Z4RA 1SJ9A 2QUBA 4FFVA 2D5BA 4ZOQI 4FFRA 4FOTA 4B35A 3BJRA 3GOHA 1J1ZA 2CXQA 3FNIA 3HZZA 1Z82A 4I4CA 4B6RA 1IEWA 4FFMA 4XWYA 1KMQA 5H4GA 5BOSA 4W5RA 3RF7A 4Q1DA 1QYWA 3JASB 5JJCA 3TQRA 1D4FA 1HE8B 1V95A 4F38A 5FBQB 3F1KA 2C7BA 1D1PA 1VG1A 3GRRA 4F6LA 3EVZA 4U0JA 1L1FA 2YWXA 4ONEA 1E3WA 1CWUA 1XZLA 4JBXA 5DOVA 3H6KA 3M4NA 3D7NA 3NP9A 3D3WA 3KUDA 4F6RB 2A14A 3HYLA 4JQOA 1DUSA 3HC7A 3FYDA 4UU8A 4ZJPA 3I6ZA 1XNGA 2XYPA 3L07A 2VK2A 4FGZA 4CF5A 5AI9A 4F5DA 2ZVQX 1TQ6A 3KLOA 4L76A 3AFIA 2FZ5A 3ORQA 1EVYA 2CL6X 2I3ZA 4JUAA 4QDOA 4BN5A 3UPTA 2HXGA 4G4SO 2WWGA 2H7YA 4MI1A 4YP5A 3DEHA 3HBMA 3B9RA 1M1NA 2QS9A 2ZSUA 4PQGA 2QQGA 4DTIA 5I7AA 1RI5A 3QXGA 5FUXA 1Y1KE 2EX4A 4I1IA 3A1EA 4COOA 1STOA 5CFQA 2GZAA 3L7IA 2VHCA 3GEEA 5DU2A 1ZL2A 2HJGA 2FDRA 4MW0A 2C5EA 1GTL1 3HU1A 4R2WA 1DBWA 3GFVA 4E4RA 1OD6A 5DM70 1F2UB 1NJ1A 1LBEA 2GILA 3K7EA 3KTAB 2JAOA 5EXSA 3TZKA 5F12A 1HY3A 1PSZA 3MMZA 5IVDA 3L4BC 1IHYA 4UUQA 4EJ0A 1UBLS 1QRDA 1U8CB 2PJUA 2QBYA 1EUDA 2N1BA 1HDZA 3W3AA 2FEWB 3EQ9A 4DA7A 1RM3A 2CXTA 2PWZA 3HJNA 2GYUA 3UTCA 2B20A 4JUBA 4F21A 3VA7A 2WFLA 3DF9A 4DCUA 3RT1A 5EINA 3VR6H 2DUJA 4JAVC 3R3UA 1WXIA 2RI0A 3KOMA 4S1WA 3O26A 1W46A 4M8LA 1BKYA 1AN0A 1XA0A 1EWKA 2X41A 3EIOA 3FHLA 4GZ6A 1EFRA 1QIEA 1V1RA 1P31A 1XRSB 1Q0PA 1O89A 1HGXA 3NRJA 4HAIA 4LE1A 2C57A 2OEPA 5TQ2A 3IDZA 4NZOA 2P2NA 4S35A 1YB7A 1WBJB 1U0HC 3AB7A 2DQKA 1MH1A 3INYA 2IL1A 4WADA 5K3DA 1OGYA 3BEOA 4B4WA 4GLFA 5EQTA 2EC5A 2GPSA 3ZDFA 3ZD6A 4BO4A 2W00A 2A92A 3FTFA 3G5MA 3CEMA 4Q01A 3PS9A 3WZ2A 5IH7A 3W5BA 3HG7A 4Z2AA 1G21E 3RJZA 5IBQA 3TDKA 2G40A 1QH0A 2WZQA 4HAZA 1R5OA 1GA6A 1H6CA 5F3RA 1HEIA 2AW5A 1WW2A 3HA5A 3WKDA 2HV9A 3MW8A 4DIFA 1DRVA 3ZBQA 3W1WA 4B3BA 1VCOA 1AV7A 1BQEA 1PTJC 2X3YA 4GPIB 4QOIA 5BSWA 1TLFA 2C82A 5DBFA 5J4YA 4RZXA 3X0DA 4KGXA 4QLBA 4P35A 2I7VA 3GEBA 2XT0A 5CX1A 5AK0A 3K70D 1BH2A 3BFVA 3FZQA 2Y68A 1LK0A 3T9AA 2UYOA 5JCOA 1NR1A 4TTVA 5D87A 1K1EA 1RRGA 3RU2A 2G7ZA 2OZLA 4ESEA 2Q3MA 4KACA 5GVRA 5THQA 3GLGE 2ZQYA 1VB3A 3EVAA 4FX5A 1H3FA 1ODSA 5J4VA 2WE8A 1ZD9A 3Q7SA 4INAA 2YJGA 3L6CA 1VE6A 4WGFA 2JIPA 3T9EA 3GCGA 3ZBPA 4B1FA 3FCSB 3UK6A 4ZTZB 5BQPA 1OH5A 2ZM5A 1GGNA 2HCFA 4KXLA 5FQNA 2G17A 5C8YF 1QIMA 2B61A 3FOBA 2IEIA 1HDXA 4M86A 3UAXA 1BDHA 2EOAA 3QA9A 4J0IA 4E09A 2MYPA 2XMDA 1XX6A 4A0GA 4C3ZA 5C32A 1Q74A 4IRXA 3HVJA 3ICOA 2FUCA 2QZ9A 4B3FX 4IDPA 4N65A 1DSSG 1HTTA 5KYVA 3F4BA 1G5FA 1PT6A 3A9SA 1EM8B 3GLFB 3SGLA 1LVGA 2VJLA 2ECOA 2HY7A 3OLYA 3WXBA 3GELA 1HRKA 4ZJYA 1K8QA 3A25A 5JE8A 5LNK1 2YZ7A 5AJHA 4UREA 2W0MA 1XRLA 4N0MA 1CFZA 1LBSA 4NMXB 2RHJA 3G85A 4AF6A 2HQOA 4O25A 4GAEA 2BGUA 1D8AA 2FI1A 4MUJA 3S8EA 2O7RA 3FBWA 1QM5A 4RSGA 4A91A 2D1TA 2AWOA 1AQLA 2YXDA 3DONA 5DYGA 1RZRD 5L4LA 2GXUA 2I54A 3OQBA 1FFWA 3CEHA 4E70A 4WNAB 4QHTA 4J9VA 2YKGA 3MXTA 5ETJA 5K6AC 3CVVA 3L1JA 3OPQA 4P84A 2XVYA 4IVNA 4ZU6X 1V8OA 4IY1A 3QHPA 3WMXA 5K0ZA 2PQMA 1XYYA 3D64A 4R54A 4YI5A 4BP3A 2MYTA 8AT1A 5LL6P 4ZK6A 1ONNA 2A7QA 4KO8A 4EHDA 3W2TA 1P77A 4W5OA 3FZGA 4GQIA 2ATEA 3QH4A 2CNDA 2OYSA 2PUWA 3OY2A 3PIDA 3ZWOA 1QAOA 2J46A 3RYIB 1CR0A 1M8PA 1T9GR 1Y33E 1N9GB 1K8YB 1TYDE 1ZUHA 2AKAB 2VUIB 3BSYA 3JZMA 3P19A 2KX7A 4NICA 4O2BB 5E1DA 4ZQBA 3FWYA 1MO5A 4RFSA 2X0JA 2BRUA 1Q0UA 1KI3A 1ZCZA 5JLAA 1XLVA 3RTGA 3TQFA 1N8KA 1WEKA 2ZUUA 2H29A 4MI3A 1BWSA 1Z18A 2HJ9A 3AO0B 3G59A 4MYRA 1ESCA 4B32A 1KA9H 5ILQA 1XHEA 3FPCA 3U48A 3D0QA 1MJ5A 2XNKA 4NQZA 2YH2A 1QV9A 4HDMA 4G89A 4W8OA 2GCPA 2Y4NA 5LDHA 1J1IA 3X1MA 3MCWA 3PNVA 4PPQA 5B37A 3UMVA 3RPEA 2YQZA 3W06A 2G67A 4MOWA 5TPZD 5CB0A 4YCNA 1PFKA 4DAOA 4DHEA 3BL8A 2B5OA 2PLNA 3CTPA 3EMDA 4Z99A 4GPD1 2XKBA 1VRVA 1UL1X 1PGOA 1V7ZA 2A9QA 1U2EA 2HNAA 1RYZA 1ZM4A 2DAPA 2GVDC 3JYPA 4H2DA 2C8KA 4IICA 3VYRB 1F9AA 4E5YA 3B7GA 3TZCA 5EEHA 2AHRA 4NFSA 5FYQA 1S2IA 1A5ZA 1DQZA 1P1BA 1R8YA 2XZDA 4HLCA 2PRZA 2OESA 5CVEA 1CHNA 5HBGA 3A2KA 3C3EA 2I4LA 1TVCA 1UMCB 3GP8A 1LLQA 3GQBB 3NDJA 2FGKA 3H5RA 2A86A 1TPYA 1U28A 2AOXA 5KYNA 5JS1A 2VA8A 2FPLA 1PQYA 3BD8A 3SX0A 2DWCA 4MB0A 1GRVA 1TT7A 1FYEA 3R24A 3V7YA 1B6TA 3TNYA 4CV0A 3CZPA 3FX2A 2ERXA 2CXNA 4KNWA 3UAZA 3D59A 4X63A 3ROZA 3W2FA 5IM4A 3IEIA 2LTAA 3FSRA 3OPYI 1KDTA 1EFPB 2PIAA 2PWYA 1CDDA 2D5CA 1OQAA 2WB4A 2R00A 3G5LA 2G72A 3T3PB 3VX4A 2DP4E 2ZRDA 3USZA 1WS6A 2AOUA 3DDHA 3PDCA 4MGEA 5DV9A 1AUOA 2A6PA 2HHJA 2IPAB 3H2KA 1CHDA 1RJFA 1LZLA 2BR3A 5FBHA 3REQA 3NGMA 4N7MA 5G1PA 4CQNA 3PUHA 4HNRA 4DMUB 4QXRA 1CXZA 3N0RA 1FFCA 4AMBA 2BR4A 1NOJA 3X1ZA 4FBGA 3L8HA 4LXQA 2NUTA 5EKTA 4ZEXA 3KXPA 1ZN9A 5JNLA 4X64B 3IE2A 1REQA 4OD0A 1KJNA 3HP7A 1C0IA 1IB6A 2GAAA 3I2YX 3JATA 2QSZA 1M2VB 1N2CE 3NBYC 5HNKA 4ZTUB 1YIDA 3MHPA 4KFSA 1Q3KA 2EBWA 4FSXA 5B58C 3SXPA 2P5TB 2UZAA 1PJTA 4MYCA 3D8SA 2ZR8A 3FNFA 1DX6A 2PV7A 1KDPA 1Q0TA 4DIEA 2ZB3A 2DC1A 3O1HB 4EQZA 5JISA 2DFDA 2X5NA 2ZDHA 3OQOA 2EATA 1M6WA 4Y30A 4DMFA 4L5JA 4PZYA 4TUYB 2H65A 1GYRA 3ZHQA 3HMKA 1XDGA 1OMOA 4LXIA 1WX1A 4IJUA 4HRYA 2RDMA 1OBCA 3AF1A 1EUCB 4Q9KA 2UYCA 1P7WA 1YL6A 4UMVA 4LXXA 4JJEA 1IOZA 1X94A 4G2NA 1NM5A 2Z04A 1JHRA 2YCBA 2H8KA 2ZBEA 3B53X 4LVUA 1QHNA 2ZU6A 2C0CA 1XNJA 5D3KA 4FIDA 3LNTA 4CKWA 3AEKB 4BNIA 3FLAA 1DEHA 4LMRA 4ZV4A 5D6OA 1MOPA 1AF7A 3IMKA 1Y5IA 1F4VA 1N0HA 2ZRCA 5EIAA 1AN9A 1ECPA 1JNYA 4PQFA 5BRAA 1OXXK 1JIIA 4IV5A 5JAHA 1JF8A 2HQSA 1KSJA 2OQRA 1V6CA 2XCOA 4NCNA 5CFZA 2OWDA 2XUKA 1UJ4A 2XIJA 3TFOA 1RPAA 4JUIA 2C7RA 1TTQB 4M9ZA 2GHTA 4IMRA 1R8XA 5IKXA 4PTZA 5EUCA 2N0SA 3DGFC 4NJMA 2QORA 5AJYA 1X77A 2JPDA 1OV4A 2JAXA 2OCGA 1L5KA 4IIGA 3PFBA 3EJ6A 3IDSA 5LKAA 2BGNA 4ECAA 2XXAB 4PONA 1T5BA 1Y81A 1HLPA 2HXYA 2HYDA 4FP9A 4C9BA 2D54A 2WY2D 4LFBB 1XTIA 4B0OA 2Z3WA 4CUJA 1PJ8A 4DMHA 3KZOA 2UZ3A 4XIIA 3R9IA 3ROTA 3S2UA 3EVBA 3ZY6A 1PDWA 3LKDA 4O1IA 3VNVA 2XMSA 1SD2A 3GEGA 5EJFA 3HCDA 4H1UA 1DLJA 1JDNA 3E05A 3LI2A 1ACJA 5K4HA 3S7TA 3HR4A 1X74A 4GOMD 4BC1A 5EOVA 4B9AA 3AYZB 5CXQA 5DT2A 5EHNA 4MA4A 5B1DA 5CA1F 3VM6A 2FFHA 2XQGA 3GMTA 3E9RA 4QTUB 2J3QA 3G17A 3QZUA 5FLXA 4C4OA 1G8PA 2XTJA 2E37A 3S8YA 2NO0A 1JHVA 3M1LA 1G38A 3MJHA 4XSGA 5JADA 1JIJA 1GAJA 4YRTA 4EPTA 1Y7PA 2YWFA 3QUQA 5FL3A 2IXGA 3WMEA 2OO5A 3WK5A 4AJEA 4DIKA 1UXIA 1X7YA 1FNMA 1ZUNA 1T5LA 2JCVA 5T67A 5AD1A 3UAYA 2ZSDA 1JG4A 5LZ5A 4P9NA 3GDHA 2H7CA 1WPXA 2OBMA 3NHRA 4IIJF 1F60A 1VA5A 1ZY2A 2YJNA 4UNSA 4CNQA 5BSFA 2OK7A 4RLFA 1J8YF 1S4QA 5HQJA 3BMQB 4E14A 4DSAA 3EXEA 3VPAA 1NVVR 3IEPA 2NYVA 3HEMA 4DV7B 2GTIA 3CGWA 1UF9A 4ZYYA 1VLHA 1YI1A 2Z2XA 1ND6A 1AXEA 2OBBA 2F9FA 2YW2A 2DH6A 3FRJA 4GP7A 5HVNA 1G4AE 3KSRA 4RGBA 2COKA 3KWLA 5DBEX 1DC8A 2LW7A 2WAOA 4LGYA 3QWAA 3MCUA 5EXEA 4BEJA 2HM7A 1KFBB 1VP9A 4TRNA 1Z88A 1FE8A 1U9CA 3OJOA 4O4LA 4YMUA 3OCXA 2B1RA 4M6WA 1ZRNA 4TS4A 3TNJA 4AP9A 1LTHR 1V5FA 5ER6A 4RIEA 1O97C 5EXDA 2XCLA 1TIPA 4XGIA 1NBIA 1XRRA 1CSEE 3GJ4A 5E7JA 3UCFA 4JBYA 2OXFA 3LVFO 4W4TA 3QVLA 3I6MA 3QFHA 4J1TA 4LG1A 4S3MA 4OFZA 4UMEA 4Q1EA 3H8VA 3IOCA 3L9XA 1SU8A 4UEQA 1P4JA 4QODA 4GBED 1T4BA 4QPCA 3LT0A 1C2YA 2YY7A 1AZSC 3IDAA 5DGXA 3L4EA 4L8LA 3T5TA 4DREA 2X5JO 2Z30A 3ZE6A 2QP9X 1T10A 4H7IA 3RADC 4QFDA 3QMWA 1D5CA 1EXNA 4IXWA 4BLOA 4FCWA 3UWMA 3UEOA 3VSAA 3PEYA 3AY6A 3BXGA 3M9WA 1XKLA 4IG4A 4DN6A 1THGA 3N39C 3B12A 4JT4A 5EKDA 1QOQB 2ZRMA 4AN4A 5ARBA 1I3NA 4UU0A 1H3NA 5EJ4A 3O9MA 5T64A 3WGTA 2CJPA 2V3VA 4BIIA 3MJCA 3AVUA 2IYSA 3T3OA 3U3OA 3CNOA 3W8FA 4L8FA 4ND8B 2J0EA 4ENUA 1GIAA 1Z45A 4WKCA 2XBMA 3AVTA 3JRXA 3SXUA 1H0KA 3CXRA 1T8RA 4B71A 3O82A 3RLFA 2D8MA 2C42A 1B6SA 2FW0A 4MVJG 1GPH1 1V9LA 3PQ7A 4DS3A 5K7SA 2D3WA 1JKJB 2C7PA 1EP9A 2Y1XA 3AF3A 1C2TA 2QNBA 4MTCA 2XZLA 2WDZA 3EOAI 3ACBA 4LYAA 4MHOA 5JTTA 1FRVA 2J33A 4J90A 5FL7A 4ZDWA 4EY5A 1PZGA 1P2GA 1ID1A 4W5HA 5IS2A 3C5CA 3PF8A 1GLNA 1HZZC 4I0WB 4B43A 3C7CB 4OUKX 2AFHA 1UFRA 3O75A 1TJ3A 4ARCA 1ULTA 1EIZA 1PE0A 4YALA 2R6DA 4LIPD 2DTXA 1LPOA 3L1KA 3IPRA 2EBFX 2M98A 2W6JA 1P80A 3PEWA 4DQVA 1NVKA 3DHEA 1DEXA 2BH2A 3OE7A 2BFBA 3RAGA 1KVQA 5EIWA 1GR1A 3RAEC 1AB6A 2VPPA 3GXOA 4FZ5A 2I29A 1KFKB 2VNKA 2B2XA 1M0SA 1QQTA 2ZBGA 5FRDA 4X3CA 4PGHA 3TDNA 5KC9A 3ZEAA 3SNKA 1OLSB 1Q91A 2OZEA 5CIWA 1KOGA 1ZJ6A 1Q0HA 2HFJA 4MPJA 5IZCA 3RIEA 3B1VA 4WLEA 1X9GA 1VA4A 2IYOA 5L7YA 4LY9A 3WIUA 3N8DA 1QORA 3WBKA 1A9XA 3A1VA 3AF0A 1GXSB 1MD9A 4U2FA 1WOYA 5BV1A 1XTVA 4RGVA 4KE6A 2XT9A 2E4XA 4CR6A 2DFNA 2DWQA 4QWWA 1DP4A 4TN5A 1Y3FE 2DUUA 4JKYA 1YRBA 1YF3A 2OV4A 1NW8A 4LQ4A 3KKEA 3MRXA 1YUNA 3OWXA 5FAKA 1NGSA 3AUYA 3ZD8A 4M9CA 5B1SA 4BKOA 1HQDA 2DBZA 2ZZKA 1DU4A 3DL4A 3WRXA 4CM9D 3BDIA 5EWLA 3L7AA 2DXIA 3RSZA 1C1DB 3N0XA 4QDTA 3UXYA 4G5SA 4YQFA 4TWZA 3PUXA 1W94A 1RHRA 3GLHE 5JSUA 3D54D 4OEHA 3ZEIA 2BTOA 4MQFA 4ASUA 4I55A 4MS3A 4EJSC 2JATA 3QQ5A 3A2LA 4QZVA 3LUGA 3KDSE 5MGBA 2P6RA 4D44A 2J9GA 2SECE 4TMZA 3W6UA 2Z3VA 1NVAA 1J9ZA 3RC9A 2EZ8A 4UQPA 3LRPA 4QG3A 1P73A 5M3BA 1U80A 4HL6A 4JVNA 3BA1A 3SFZA 1FYFA 3OCJA 1J9EA 3MSCA 1GNVA 1MEJA 4JU8A 1OF1A 2CUZA 3H9QA 4IKEA 4E31A 3N87A 1T4DA 4MR8B 3HKEB 4UW9A 4L0CA 1EFAA 5BQOA 2R4TA 4MJ7A 1G2OA 2X4IA 4GSLA 4KXUA 3OEHA 2GAOA 1ORWA 3HDHA 1RHMA 821PA 2DR2A 3TBHA 3U62A 5CDUA 1YCHA 4BNGA 4GQBA 1EG2A 2PVPA 3D6HA 2QLMA 1Z0ZA 2HJRA 2QSYA 2Y99A 5F23A 2AE2A 4Q7JB 2GEDA 3M1IA 5C2JB 3WWOA 2PANA 2RJNA 1QYIA 3QWFA 5I51A 4KR6A 3M4XA 4RIFA 1T2AA 2HBYA 4LHSA 5KQRA 3FUCA 1JQEA 3ETDA 3IOYA 3UJPA 4QUGA 1OA1A 2Q2VA 3TLAA 1GPYA 3W5CA 4AS1A 5MHTA 3IAAA 1VLLA 5AI4A 4PO8A 1EQUA 3QYJA 2WJPA 3FNGA 3PIIA 4N47A 4B4KA 1QLWA 3GJYA 3K16A 2NZVG 4I19A 1XEXB 2DX7A 3RWMB 3IPXA 2ZIVB 4OXRA 4AJPA 3N5KA 1FXWA 3RS7A 1D2NA 1Z15A 4OF4A 1LK7A 3PCXA 2XECA 3QE0A 3USCS 3Q7RA 4OYRA 1FFBA 1WXFA 5H3LA 5KS2A 2NADA 3CX7A 2X8LA 1PSWA 1TF2A 4EW3A 4X6YA 4L0QA 4OFWA 4P3NA 2J0UB 4UM5A 2CJWB 1HDGO 1E7YA 4O29A 4IJ6A 3JYLA 4KYIB 4D8VA 1QGED 1VDZA 1EAMA 1ISMA 4CUZA 5KREA 5EA2A 2BR5A 2Y6UA 5KIAA 1WKCA 2XNSA 4L16A 1Y8RA 2PU5A 3UUGA 1T0HB 1KC1A 2MIIA 3DVAA 1LSJA 4MUMA 4QD3A 1RXWA 4HN4B 4GW3A 3MLEA 5CM9C 3ZQJA 1ZNXA 4CFYA 1XZKA 2BMAA 4FZJA 3PEVA 1IOWA 1N92A 4YIHA 1NY6A 2Q5FA 3FB1A 5EHXA 3AJDA 3UK2A 4JC5A 2GOYA 2I80A 3EWAA 3IDOA 4MLDA 4Q1AA 3GFBA 2JFUA 3II6X 4RZQA 2Q0SA 3IP8A 3AF2A 4BV9A 3ZU3A 2X23A 4JD5A 3AQIA 3OOYA 4PNZA 4EYSA 5LMNB 2WIKA 3FIJA 1T0JB 3KKLA 1V25A 4I3HA 2F1JA 2V4ZA 4LPSA 1X80A 3HHEA 1ESZA 1TCAA 1TF7A 2LGJA 1T8UA 4G8CA 3VZRA 2XMCA 5DHPA 2P91A 3HUUA 5CVJA 3W78A 3ET4A 2CNWA 3ZK7A 4HTAA 2CLCX 5KOJA 1P6XA 1N8SA 4FDMA 1S2OA 4YGXB 3T3GA 3PQ3A 5SZIA 2ALJA 3ZE9A 2BEUB 2VCHA 2PJZA 1N75A 3GROA 1P61B 1UDWA 3GWZA 4NNPA 4OV6B 3RF6A 1I32A 3L5OA 4NV1A 5T8KA 1K8RA 1E92A 1UOOA 3Q4GA 4KO3S 4G41A 3KAQA 1V71A 3JQ7A 4ND7A 2H1LA 5CG2A 1RYNA 2VXYA 4KLCA 1E6KA 2E7ZA 4L9SA 2NNWB 1G8FA 2PLRA 4DXHA 1ZD8A 3ZJUA 1FQWA 1ULSA 4IMIB 4JJGA 2QPLA 2DBRA 4LXYA 5BSKA 1SC1A 2JGEA 3PXEA 2IHZA 2LCFA 4FYXA 3TFQA 4FYIA 4NS4A 5KJFA 3ZHRA 3J81A 1SQFA 1A95A 3AHIA 2A78A 2QAGA 3JASA 2PKQP 1II8B 1TUIA 3VGJA 2O8FB 2XRFA 3FCUB 3OCZA 1UC5B 2WA1A 1E2QA 1Z29A 4PVCA 3BMNA 3WNZA 4CG2A 1X8LA 5J2UF 5JJKA 1XG5A 1E69A 2I6FA 3B3QA 4N03A 4Z4GA 1JDVA 3S1SA 3ZW7A 1V5GA 2GPYA 2WWTA 3V8VA 1LF5A 3ZWDA 4AG3A 1D04A 1ORVA 4LCJA 2ODTX 2ZYUX 3B6JA 4B83A 1ETUA 4AICA 4RH3A 3TUJC 3BN3A 1J2UA 2YHAA 3VHXB 3WGKA 3DV9A 1BGXT 3EGOA 3ZUPA 4KQWA 3UOWA 1HYBA 1JU9A 3V1YA 4AFNA 4XDHA 1M34B 3PICA 4G85A 4DE5A 4DCCA 1XD9A 2HA3A 1G9XA 1J0XO 1M66A 1TM4E 2H4ZA 2RH8A 4LOLA 4M98A 3MRTA 2AC7A 3SEQA 1MA0A 5A5GA 1LD3A 2YBDA 3Q3EA 1M54A 3UKOA 3TF5A 4JIMA 2IE0A 2EWMA 4QQ8A 3GFGA 4AF8A 1E2LA 4O2AB 3H4IA 1SHZA 1VYVA 4Q19A 2P6PA 2DSNA 2WYIA 2O8CB 4LBYA 1GHTA 2BHNA 4WVLA 5HKKA 4O4LF 2AOVA 2FSPA 5G0TA 4F60A 3PL1A 4PGMA 3KKQA 3E2IA 4Y6RA 3THXB 2ZAYA 2F4VB 5J23A 2P75A 3NEPX 1UWKA 3IAS6 4KNVA 4BE7B 3UGTA 1F2UA 2XOKD 4F3NA 4TYWA 3F71A 3W4KA 3VVMA 4G0QA 1U5BA 1M6VB 3WGIA 1THTA 1OFTA 1IBLB 1GGJA 3QYAA 4YR9A 2H0RA 2SCUB 3EBPA 5K9ZA 2AW3A 1QO9A 2J5QA 4HVTA 3OT4A 3WYGA 2D1YA 1H93A 4IQ8A 2DHQA 1EKXA 3ZLVA 2XDYA 4MAAA 4HG2A 2VJQA 3Q5EA 3K31A 2PSHA 3T5AA 1T3LA 4KXQA 1NC1A 3LXRA 1Y3CE 3JQEA 1F0KA 3D2CA 2GCEA 4S2UA 4DNOA 2P4EA 3V00A 2EF1A 2EXXA 2A1TS 4NR0A 3VR1A 4CMAA 1NN3A 2CVHA 4PLWA 1B0ZA 5EPEA 8ATCA 1MDBA 2VDKB 4JJ7A 3U7QB 1WW8A 4XWAA 4YCAA 2JBAB 3BWVA 5LBIA 4GR4A 2P8SA 2VBIA 1K3TA 3HO8A 1R12A 1O1YA 4QBHA 4CKCB 4XH9B 3HDQA 4A6EA 3RRBA 1UZLA 1HG0A 2PZJA 2JD1A 4WPGA 1E3JA 3R6WA 3OCVA 1JNXX 4ZAGA 1T1SA 3FGZA 3HB0A 3ROFA 3WTCA 4WL0A 2WC1A 5FO0A 4XRGA 1HR0B 5KKAA 5FB3A 3AVOA 2Z9BA 5IAGA 1NNSA 4L4YA 4BX3A 3I04A 3TL6A 5TPWA 4P0QB 1N1DA 3CLKA 4NMHA 3B51X 1L4BA 4E2WA 1HZJA 1WHTB 2FHSA 3TUIC 2ST1A 3J80A 1P7VA 4M9UA 3NHZA 3QUCA 4BB0A 2C3OA 4WZBA 3I52A 3DBHB 3RREA 4F4IA 2QMOA 1JEQA 4KXWA 4G1VA 1V4NA 4RVOA 4MQMA 2VPYA 4RSMA 3R7BA 2O8DB 3PJDA 1RC0A 4BMXA 1K5PA 1K6JA 4IZ6A 4KPUB 1Z0IA 5BYKA 3DWEX 5FPQA 3KQOA 5L7TA 2C58A 4JLPA 4P8RA 3IIIA 3TW8A 4BMYA 3EDYA 3H9BA 1I9GA 4EHLA 5BVHB 2JHAA 3ZDBA 1LJLA 3EQ7A 3NC1C 4UTRA 1NXTA 4K3UA 4DXAA 2OG1A 1ZD4A 1GPUA 2Z8XA 3ABRB 4D7AA 1RQNA 3OH8A 4ESVA 1T1JA 5A4IS 3V8PA 2ECQA 3FJOA 1KZ7B 2Z2ZA 3K9NA 3DYBA 3IURA 5LJLA 4R81A 1EM8A 4G5QA 5EJMA 3GLFA 3S2GA 5ECWA 2FEOA 1NJGA 3LG2A 5F21A 4DNXA 3IHKA 2IUEA 1XCPA