2D0DA

Crystal structure of a meta-cleavage product hydrolase (cumd) a129v mutant
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
271
structure length
271
Chain Sequence
NLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNSFGGGLAIATALRYSERVDRMVLMGAVGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-hydroxy-6-oxo-7-methylocta-2,4-dienoate hydrolase
publication title Improving the catalytic efficiency of a meta-cleavage product hydrolase (CumD) from Pseudomonas fluorescens IP01
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
total genus 109
structure length 271
sequence length 271
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2005-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2d0dA00
2C4HA 2R11A 1GPNA 3WK9A 1QOZA 2C0PA 3IA2A 1DWPA 5AKLA 3UUFA 1TIBA 3STVA 4NS4A 3O9MA 5AHXA 4M0FA 3QPDA 5FV4A 5JYCA 1GQSA 1CUBA 2H7XA 2PSHA 3N0TA 3VJMA 3FWHA 1TCAA 3G9ZA 3HLKA 1WPXA 4OUKX 4FFVA 5ALOA 1Q83A 4X91A 3H2KA 4B82A 4FBMA 2ES4A 1YASA 1QGED 3D0KA 3C8DA 1NX9A 4DGQA 3W9UA 1AMNA 2H7CA 1WB4A 4DSAA 4FMPA 2BUCA 1UK9A 1ZI8A 2XLCA 2C5GA 4X93A 5FKJA 1QTRA 2B9VA 5JIBA 3G8YA 3OPMA 4EY7A 3AZOA 3WKCA 4H35A 1Q0RA 5EHQA 4FLFA 4N8SA 3FLEA 2JGEA 2QR5A 3QMVA 5JASA 5ALGA 1JJFA 5AKXA 4AZ0A 3WA7A 3VISA 5AK6A 5DYWA 4W1RA 4HXFB 2WFMA 2WUFA 2VEOA 2XQGA 4FKBA 3BL8A 5IVIA 5J3JA 5CT8A 4B84A 1WPRA 4B6GA 1QIDA 4BC0A 4QEKA 4A16A 5ALSA 1MT3A 1T2NA 3WIBA 4UHCA 5HF8A 5JZ9A 2OCIA 4ARBA 4E46A 4XIIA 2OGTA 4PSDA 1LGYA 1JJIA 2WHQA 3ICWA 4U2CA 1DT3A 1FFDA 1W75A 3WJ1A 4WCVA 4ZV9A 4DNOA 3STWA 1E8DA 4X6YA 4J0CA 4Y2RA 2DHEA 3K2IA 2Y1KA 2FX5A 4P9NA 1J07A 1HPLA 1ZGCA 2JEZA 3ZLTA 3BDVA 1Q0ZA 5HK8A 4FNMA 1UFOA 2OG1A 2DR0A 4OU4A 3PFCA 3D3NA 1KEZA 1VE7A 2OXEA 1SC9A 3RLIA 1E3QA 3LCRA 1MAHA 4OPMA 1GGVA 5ALRA 4BBZA 3R3YA 1A8UA 4JNCA 1JMYA 5K3FB 3FBWA 3V1LA 4UBMA 3PF9A 2WFLA 3C45A 1FSSA 4I4CA 2H1IA 3HABA 3WQHA 2WHPA 2HFKA 1OILA 1W4LA 2XMZA 3C5WP 1H23A 2WSLA 4UBKA 1E89A 4G4GA 3HJUA 1CUWA 1VXRA 3O9VA 3BE8A 5LZ7A 4EA6A 4UHFA 1MX1A 5LZ2A 2XMDA 4IH9A 5IKXA 4XX1A 4B9AA 2AJCA 5T4FA 1Y7IA 3H2HA 5ALHA 1ACLA 1JKMA 2BAGA 1IUNA 4KJXA 3W05A 2V9ZA 5LZ5A 4BRZA 1ACJA 2Y6VA 1K8QA 1AGYA 3JYHA 5DNWA 3C43A 5AM1A 1QIJA 3IUQA 5YASA 3TJMA 4Y9SA 5CRIA 2WG0A 5EFZA 3WWCA 3AINA 1UK8A 7YASA 2ECFA 1B6GA 4W1QA 5D3KA 2OCLA 4QDOA 2C5FA 1CVLA 1AKNA 4A5SA 3SC2A 4GLBA 1GPKA 1YAHA 4H7KA 4EBBA 5HFAA 3VVMA 2IIVA 1TK3A 4BB0A 4XWGA 3PUIA 4H7EA 4PSCA 1UZAA 2WG1A 4UHHA 2ZSHA 5K3CA 4DNFA 4U2FA 4PQEA 1JJBA 1L7QA 4TGLA 2CZQA 1VE6A 5LIPA 4M0EA 5AM4A 4Q3LA 3MVEA 2WUDA 3HEAA 5AK3A 5ALQA 4DTCA 1VJ5A 3WYDA 2PX6A 4C89A 1Q84A 4DMKA 1CUFA 3H19A 4D9JA 3I28A 5AKKA 4CCYB 1E5TA 3LIIA 3HYSA 4UBNA 3HRHA 3D7RA 2FJPA 2O2GA 1QIFA 3I6YA 4X71A 3WWEA 5EI5A 3AFIA 4NZZA 1WCYA 2BUAA 3CXUA 4PF1A 4F5ZA 4QWMA 3PI6A 4Y2VA 3C6BA 4G5XA 5AKEA 5T4EA 1C7IA 2CEKA 1BCRA 4BCDA 2OPHA 5CXXA 2VTVA 4B7ZA 4V2IA 4KE6A 3BJMA 4H77A 3WA6A 1WM1A 1MN6A 3PE6A 2E3JA 3T52A 4LIPD 4PSUA 4Q82A 5AM0A 3I2KA 1K63A 1JFRA 1YS1X 1SCIA 2BJHA 1IZ7A 2CKMA 3RKSA 4DNQA 1CUJA 4G8BA 3EBLA 4GDMA 5BWBA 3SX4A 1CUZA 2O2IA 2QTBA 3QPCA 5ALTA 2ZJFA 3W9BA 3B5EA 5JARA 2JGJA 4HRYA 1EDEA 1G42A 5JD5A 2DCMA 4ZRDA 4Q3OA 2JGKA 1NU6A 3BIXA 3FCYA 4GWLA 5EHZA 3FLAA 3H17A 1XZIA 5LKAA 1QZ3A 4X6XA 3GELA 4IQ4A 3ZI7A 4HZGA 4OD0A 2IX9A 4K6GA 3NGMA 3ANTA 2XUOA 1UOOA 2ZJ7A 5E4YA 2VSQA 1CUUA 5K3FA 3A70A 3DQZA 5D3ZA 1YSCA 4BP9A 2OAEA 5AI4A 4MYSA 2GYVA 4WFJA 4HRXA 2YASA 5D6OA 2BKLA 4ZI5A 5JATA 5JAPA 5AKIA 3YASA 1UWCA 1LPSA 1X2BA 4BVJA 3F8SA 5AOAA 1R9NA 1IMJA 4Q1VA 3GZJA 2OCKA 1CEXA 1IUOA 4U2DA 3QZUA 3SK0A 1XZCA 3WWOA 4AX4A 3STXA 5A7HA 3G0GA 5ALJA 2QUAA 3KDAA 5BOVA 2XT0A 1RYYA 2XMCA 5D7BA 1CUXA 3TRDA 4LXHA 1FFBA 5SYNA 2J4FA 2HRRA 4F0JA 2JEYA 3QMMA 4IHAA 4HTAA 3H18A 4K5QA 1JT2A 1LPMA 3G0DA 4J0IA 4C4ZA 2AJ8A 4JYMA 2PUHA 2HM7A 1A7UA 2VT6A 2ZYSA 2PSJA 1EINA 5AI0A 1HLGA 1YA8A 1ZI9A 2G4LA 4ROTA 5AI5A 4KE9A 5HCUA 1GXSA 5LKRA 1FJ2A 2WKWA 4Q3KA 3LIPA 1EB9A 1USWA 1YS2X 1S8OA 3BJRA 1ZGBA 3R40A 1MNQA 5DTIA 3WJ2A 1XZFA 1QIEA 4XVCA 1ZIYA 4JH0A 2HA0A 4CCWA 2WHRA 2ZYRA 4BRSA 5JD4A 3STTA 3STUA 1ZD5A 1EH5A 1Y7HA 4FDMA 4BCCA 1X70A 3ESAA 1PJAA 3C5VA 5LP1A 2WTNA 2XB6A 3W06A 1R1DA 2W22A 3C8HA 2VAVA 1ZICA 3WK6A 3D59A 2YH2A 5CH5A 2CB9A 5EIEA 4B80A 3S2ZA 2QJRA 2HU7A 2HA6A 1TQHA 3IUMA 2HADA 1AX9A 1ZI6A 2NW6A 2QXTA 5LZ8A 1R3DA 5ALXA 1MX9A 1R4ZA 3OOSA 4N8EA 1JU4A 1G66A 4OCZA 1EVEA 3A2MA 3V1NA 3CCCA 3DKRA 4EY6A 3R3WA 1ZD3A 5C8VA 2QM0A 1W76A 4E11A 4J3JA 1XKTA 4Y2UA 5HZGA 4O08A 1N8SA 1SOMA 4HVTA 5FOQA 5CH8A 2O7VA 3O95A 4LKOA 3O4JA 1O6GA 3F96A 3HC7A 4U2EA 1TAHA 2WLSA 1UT6A 4LYDA 2XMBA 2WU4A 2WQZA 1VLQA 3IULA 1BU8A 5HF6A 3AUKA 2PU5A 3FOBA 1VA4A 4L3WA 4AMYA 1L7RA 4ITVA 4C6HA 4BAGA 4AXBA 2PVSA 3A2NA 3M81A 5JAUA 4ARAA 1A8SA 5FRDA 2VJDA 2XMQA 2HA7A 3WL7A 1CR6A 5HKAA 3L1IA 5K3EA 4Y2PA 4RPCA 1O6FA 2RHWA 4OB8A 1T4MA 1ODCA 3B3QA 1MPXA 1AURA 3DOIA 1EDDA 2WJ6A 4KAAA 3O4GA 2HIHA 2JGMA 1RP1A 2XE4A 5KWIA 4OB7A 1H2ZA 4INZA 1UXOA 3U1TA 5JANA 5H3HA 2XQIA 2QKYA 4EUSA 2O2HA 1WB6A 2VA9A 1ZD4A 5AI8A 5AJHA 4B83A 1DT5A 1QIIA 3DKKA 5T4HA 3WKBA 4I3FA 1DX6A 3R41A 2JIDA 3HI4A 1ZJ5A 3U0VA 2GBIA 4MQLA 2C7BA 5LYYA 5I8PA 3E3AA 4QNNA 5DLPA 3WKAA 5EIAA 5DJ5A 1FFCA 1CUAA 5AKZA 1U2EA 4L0CA 2QS9A 1M33A 2VF2A 3I2HA 5ALKA 3EQ8A 2WIJA 4LXIA 1CUHA 4F21A 4C01A 5DYTA 2XI4A 4DSZA 4N5IX 1GT6A 2GBCA 1XKLA 4C87A 1ORWA 3OG9A 2Q0XA 1JU3A 4JEIA 4B0PA 3FYUC 3DYIA 3IURA 2R8BA 1UKAA 3QBJA 3S8YA 3G0BA 4K6KA 3UMJA 2XUIA 3B12A 4WY8A 3H2JA 4AO8A 4FBLA 2PBLA 3W04A 3EQ9A 1A88A 1YAJA 4L9AA 2V96A 4DNPA 2VJAA 5C7YA 1J06A 3G0CA 4RE5A 3D2CA 3BIWA 5FPQA 3NWOA 4X85A 1N5MA 3ESBA 2VJCA 4BCBA 5I9IA 2FJ0A 5C81A 2J4CA 1DWOA 1VZ3A 4U2GA 5AOBA 5ALPA 5BWCA 1PV1A 2I78A 3FYUA 3M82A 3QITA 4FWBA 3LS2A 1CV2A 4Q34A 3CN9A 5ALZA 4B9EA 4AO6A 3F98A 3AIKA 2HA2A 5IVHA 5EHXA 5ALWA 3BF8A 3Q0TA 4OYYA 2ACEA 2WFZA 2BGNA 3BF7A 1XRMA 1UOQA 1BEZA 3HSSA 4EHBA 1XFDA 3N2ZB 2OCGA 1JMKC 2XUJA 4FOLA 1HQDA 1XROA 2JGIA 3QPAA 3VKFA 5K5EA 2XLBA 4BTLA 3DL7A 2Z5GA 3WZLA 2PPLA 3VJLA 5ALVA 1LPOA 1B41A 3FLBA 4UHBA 1QO7A 1TKRA 1MX5A 4U2BA 3NUZA 3WKDA 4LHEA 5CT6A 2IITA 5HF5A 2PM8A 1EI9A 4GXNA 4S0XA 1DQYA 4OYLA 5BV7A 5HQ3B 2XMRA 2B20A 5AOCA 2GBFA 4WJLA 1VXOA 4LYEA 2YYSA 4KAJA 4BVLA 2HL6A 3IIIA 4Y2QA 1LZLA 2CMFA 5AM3A 5EHNA 3MUNA 1ETHA 3VJKA 3GUUA 3TEJA 5SYMA 2QUBA 1QIMA 3HACA 1YR2A 4W1SA 3RK4A 2CBGA 5ALFA 1F0NA 2VATA 3RARA 2AJLI 3VVLA 4CG2A 4IH4A 5C8ZA 1XZDA 3VXKA 4H7DA 2QT9A 3R0VA 2I3DA 3WMRA 2RGUA 2OQIA 1KU0A 4MJ3A 2WUGA 2JF0A 2XUDA 4NVRA 1LPBB 3DDUA 5ALDA 5CT4A 2RHTA 3QMWA 1LNSA 2H9YA 1U65A 3G0IA 3PFBA 1P0MA 4DMHA 3TGLA 2Y2VA 1K5PA 2ZJ6A 1G5FA 4UHDA 2C58A 5KWJA 2P8SA 2PUJA 3ED1A 5AIAA 2DHCA 2WILA 5FLKA 3R3XA 4QWWA 1LBSA 1MTZA 3I6MA 3C6XA 1AQLA 1J2EA 1QE3A 1GKLA 3I2IA 2LIPA 4Y2YA 4ZREA 2X8BA 4ZWNA 1SFRA 2B61A 4IO0A 4KR0A 4E14A 3JW8A 4XJVA 1CUYA 3DOHA 5A6VA 3PF8A 1ODTC 2B4KA 4PW0A 1XZHA 1F0PA 2BFNA 3DL4A 1Y37A 4W63A 3G02A 1HKHA 3OC0A 4W1PA 3DNMA 4AQDA 1UOPA 3D5EA 3F97A 5AM5A 2WG2A 4UBOA 2ZSIA 4MWTA 2RIPA 3IVMA 2PU7A 5CXUA 4I19A 2GYWA 2I3ZA 1XLUA 1QIKA 5A2GA 2D0DA 3QM1A 1Z68A 3QYJA 3KD2A 2JGLA 5HF9A 4CG1A 1JI3A 4MXDA 2DFPA 3MGAA 2AJDA 4PO3X 4PV7A 4B81A 2AJBA 3DJYA 3V1MA 1WHSA 1LPNA 2WJ3A 4BVKA 1HBJA 1RWQA 5A7GA 4RGYA 1A8QA 1CIJA 1GZ7A 1W6RA 4TVKA 2Z3ZA 2PKYX 4HS9A 3RM3A 2PSDA 4WFIA 4EZIA 3ILSA 1C7JA 5HFNA 4B85A 3WZMA 2XUFA 1XZEA 4Z49A 1IUPA 4DIUA 1GQRA 4BZZA 4C4XA 5JADA 1UK7A 2EDAA 4HXGA 1UK6A 3P2MA 3DLTA 2WFLB 2UZ0A 2Z3WA 4M0MA 1CUCA 1HDEA 4ZGBA 2WHPB 2D5LA 1X2EA 4W9RA 4QLOA 4N8DA 3PUHA 2AXEA 4G9EA 3WKEA 4J0DA 3IUNA 3DYVA 2V98A 2FUKA 1MNAA 4AMZA 3FYTA 2HA3A 4QDZA 2I03A 4P92A 4UBJA 4QDXA 2RAUA 2DHDA 2OLEA 3I2FA 1DQZA 1ZOIA 1FFAA 4CG3A 1XQWA 3LLCA 4CCYA 1CUVA 3D2BA 3BDIA 5HKBA 3AIOA 2OAGA 2HRQA 1QLWA 3K6KA 3GBSA 1TCCA 3FVTA 3DEAA 2WIKA 3QH4A 4X92A 1R9MA 4MQMA 4G8CA 5JAHA 1UKBA 1W52X 2JBWA 5ALYA 1LBTA 2GZSA 3WK4A 2WIDA 5ALNA 4GECA 3EF3A 3WWDA 3ESCA 4G4IA 1BS9A 2Y2UA 5JZSA 1WB5A 4YASA 3EQ7A 4AZ3A 4FTWA 3LP5A 1H2XA 2QVBA 4GHWA 3GA7A 5I7UA 3WK5A 4GEGA 1YCDA 1NU8A 4RNCA 3GFFA 3A2LA 1XRLA 3AZQA 5AK5A 4WDRA 2WIFA 1ORVA 3T4UA 4BE4A 5AI9A 4YPVA 3L1HA 4X7BA 4WY5A 4KE8A 1TCBA 5FPPA 2OGZA 1XZAA 4BYMA 1QFMA 1U4NA 1YB7A 4J0HA 1OXMA 3E4DA 5CT9A 4K2AA 2J3QA 1E8MA 1KU6A 4NMWA 4TPKA 1AC5A 2VT7A 1DTEA 4PNZA 2XDWA 2WUEA 5DWDA 2K2QB 3HXKA 4EB0A 5CW2A 3WK8A 2H7YA 4DMFA 4CIBA 3G9TA 5JAOA 2HU8A 2WIGA 2XMSA 2YXPX 3KSRA 4QE3A 4EY8A 2QOEA 4Q05A 1EVQA 5IVDA 4UFOA 5A71A 4OSEA 4G4JA 1MU0A 4Y2XA 3H0CA 2OQVA 5AKGA 3WK7A 1R88A 3Q8WA 1BE0A 3C70A 5AKHA 4QDUA 4KYVA 4P93A 3QVMA 2DQYA 1P0QA 5ALEA 4ZXFA 4UPDA 4LXGA 1DX4A 1XQYA 4OU5A 2GZRA 3WL6A 4B0OA 2QJWA 2XQJA 3V48A 4N5HX 1BRTA 1XZMA 3AILA 4Y2JA 1L7AA 4DYHA 4HXEB 1CUIA 3FCXA 1AUOA 3KWJA 2CUTA 4FLEA 4UFNA 4KACA 1J1IA 3WL5A 1BN6A 1LPPA 4BP8A 4JYPA 4BDTA 1K4YA 1EXWA 3WLAA 4OB6A 5AICA 3VDXA 5A62A 2PL5A 5K3BA 1F8UA 5AI6A 3ZPXA 2ROQA 3IUJA 2WTMA 2V97A 3C6ZA 4BE9A 3KXPA 1E66A 2HU5A 2EEPA 2Y6UA 1F6WA 3FNBA 3WWPA 2QXUA 1XQXA 1XRNA 5E2IA 3ESDA 1EA5A 1XLWA 3R3VA 1XZJA 1CUGA 3ANSA 3O0DA 4BC1A 5CURA 1XLVA 1XQVA 3I1IA 1QFSA 4KRYA 4K6HA 4BATA 1XZBA 3ZV7A 4C88A 1EHYA 3M83A 1CUEA 4DLNA 1EK1A 5CBKA 4FFWA 5CH3A 4WDQA 5ALIA 4X3CA 4H7IA 3PICA 2XUPA 1W1IA 5AKYA 1DU4A 1BN7A 2X76A 1LLFA 4QA9A 3C87A 2QRUA 2HA5A 4ETWA 2QZPA 5DNUA 5CMLA 4FNGA 4A23A 4X94A 3OTQA 3CN7A 1QONA 4IH1A 4AO7A 1EK2A 1VKHA 2G5PA 3OM8A 2ZVDA 4AN0A 5C8XA 1WHTA 1ZJ4A 2G5TA 5AKJA 5ALUA 3G9UA 1TRHA 3BWXA 5AIBA 1H2YA 3H04A 1WOMA 4CFSA 2GYUA 3FSGD 2ORYA 2Z8XA 4H7FA 4H7HA 3H2GA 3E1GA 5EIHA 3L1JA 2RI6A 3IB3A 1ODSA 3DD5A 3FAKA 1E8NA 4J0KA 3SWWA 5A7FA 4X90A 3ZLVA 5AO9A 2X5XA 2XQFA 5K3AA 3WIOA 2XMGA 4L72A 4BTVA 4J0JA 5AH0A 1CRLA 3O4HA 1AZWA 2DQZA 4QZVA 2ONCA 2WU3A 1GKKA 1XZKA 1UKCA 1H2WA 5AP9A 1U8EA 1XRPA 4GI1A 4MYDA 3JWEA 2HDWA 1FFEA 1MAAA 3V1KA 5AK4A 1LPAB 2GBGA 2OGSA 4QDTA 3WL8A 1CQZA 3D2AA 1SCQA 6YASA 5F4ZA 5KREA 4DMCA 5IVKA 1K6EA 4UUQA 1EDBA 1VOTA 4KEAA 3G9XA 3AJAA 1R50A 3PDCA 3H2IA 4X97A 5CTAA 1LZKA 5FXMA 4Y2SA 2ZYHA 3I6ZA 2RONA 1CUDA 5LLSA 3H1AA 4UHEA 1SCKA 4YX9A 5ISMA 4E15A 5DTJA 4H18A 5KBYA 3R3ZA 1GPLA 3V9AA 1N1MA 1HL7A 3AZPA 3OURA 4WFKA 1CQWA 3D4LA 5ALMA 3IDAA 1ISPA 1YB6A 2PSFA 1QO9A 1VA5A 3K9BA 1XRRA 4UBIA 3MUOA 1N5RA 3CCBA 1CPYA 3IBTA 4H7JA 2J3DA 3AIMA 4YK7A 5DNVA 4C4YA 4RE6A 5LZ9A 4JUIA 2JGFA 1QIGA 1BEEA 1ZD2P 5E4JA 3GROA 4BAUA 1THGA 5JZBA 2VAXA 2QMQA 1XZGA 5K3DA 5FDFA 1BCSA 4AN1A 4G1FA 2VJBA 4DM7A 3I2JA 3EIOA 1MJ5A 5IH7A 1YA4A 5JALA 3W2TA 4GW3A 4GBGA 1EX9A 1C4XA 1EB8A 4CI9A 2BUBA 2EDCA 3UUEA 4KAFA 3H1BA 5E4TA 4BAZA 2XUGA 4MEAA 4AB1A 1IVYA 1G4HA 4F60A 5T4BA 1DINA 2ACKA 2W6CX 5EGNA 4QLAA 3ZLUA 2XUKA 3X3HA 3I1YA 2VQ6A 1P0IA 1VZ2A 1PFQA 1P0PA 2HA4A 4G9GA 4G8DA 3KOOA 1QJ4A 2HFJA 2G63A 1MO2A 4J0GA 4BDSA 3NOXA 3R3UA 2PSEA 4Y7DA 5DYYA 2CJPA 1H22A 3ZWQA 5AM2A 2HHAA 2ZYIA 3F67A 1CFJA 5HK9A 2WJ4A 4KE7A 3DS8A 3F9CA 3DCNA 5ESRA 2XUHA 2C0QA 3HZOA 3KWFA 1CUSA 5CT5A 2WM2A 4X00A 1I6WA 1OCEA 4UFPA 1BROA 3WYNA 3FSGA 2XUQA 3G7NA 2XQKA 4CIAA 3C6YA 2Z8ZA 3E0XA 2BGRA 4X6UA 3WI7A 4H0CA 3A6ZA 4Y2TA 4X95A 4FLMA 4ZV7A 4J03A 1THTA 1CLEA 4FHZA 4BZWA 2BCEA 1D07A 1XZLA 1ZIXA 3FVRA 3BXPA 1IZ8A 4P08A 1XRQA 3I2GA 4UBLA 5FUMA 5JD6A 5HQ3A 5FP0A 5ALLA 5LZ4A 1QTIA 4MEBA 4EY4A 4HAIA 3O4IA 4J7AA 2DSNA 3FYUB 3M3DA 1DWQA 2O7RA 3ICVA 4EY5A 3STYA 4MWSA 4KRXA 2XUAA 1QIHA
chains in the Genus database with same CATH superfamily
5JQGF 3P71T 2CUKA 3FR8A 2IHVA 1A9XA 2NU7A 1Y7PA 3WMEA 3BXEA 3BK1A 3F71A 2ONKA 5LBIA 1RZVA 2D5IA 4BS9A 4CJXA 3ZK7A 2R11A 4QTYA 4JI7B 4L08A 1E1RD 2FUEA 3IFSA 4R54A 3MGBA 5EMHA 3RJTA 1EGHA 1J8QA 1C30A 4AY4A 3H1PA 3IAUA 4MRMB 2BZ0A 3QW2A 3T4PA 1VYVA 1H1DA 5IMBA 4W7IA 2OWDA 3B3AA 4GM0A 3A28A 3RYCB 2VDUE 2ZBEA 1GNVA 1T9ZA 1BW9B 1HYBA 3QE4A 3QPDA 4CEJA 1ENZA 1GU1A 3NETA 4NJMB 3UV3A 5TMPA 5FV4A 2PMFA 3U4IA 1CUBA 2H7XA 2X0JA 2EKPA 1OGJA 1YCHA 1XTKA 1J23A 1YIDA 2PSHA 3N0TA 4LSWA 3SJ7A 3SJZA 5L3SB 3VJMA 4N01A 3RIHA 1HL3A 3OEHA 5JWRA 1H1LA 1T2DA 1TCAA 1DBQA 4K40A 2DE0X 3LVRE 2Q4RA 4XYEA 4AL4A 5DHPA 3HKDB 5A9SB 2CVFA 4OUKX 3ODPA 3LQRA 4FFVA 3VR3A 3T94A 3LLUA 2I1WA 4BL5A 4B3JA 1IHOA 2M1ZA 1XCOA 3L0BA 5E7IA 1JZQA 4DLRA 2E85A 1PT7A 2ZRNA 4RYLA 4QFDA 4G0ZA 4ZGGA 1TLTA 3AEQB 3BUSA 4WCDA 5IDXA 4AKIA 3W5DA 1FNNA 3CUEF 4MUIA 5IM4A 1Q0TA 3B6KA 4Z0NA 4JOBA 1L4LA 3A1EA 3O38A 3QVGA 2X0FA 4LCBA 1YASA 2Z56A 1R6XA 3ZI0A 3ROFA 3AM5A 2X9QA 1QGED 1SOUA 3D0KA 4K7JA 3EMKA 3U6BA 4DCGA 2NSDA 2KSQA 1QPZA 2DY1A 1OR8A 1OX4A 3T4XA 2IOQA 5G3YA 4MMYB 3DWIA 1AMNA 3N6VA 3W9SA 3WGQA 5DX8A 1E96A 1XCPA 4B7AA 3UMVA 1XU7A 4NL4H 4JJZA 2MINB 1IPEA 1G2PA 1XTZA 2Z5FA 4BTEA 5CA1F 5JUWA 2P65A 2C20A 1BS1A 2P4QA 2X1VA 3AEZA 1NMSA 3EPHA 3ONWA 5JIBA 1J2RA 4RPGA 4PICA 2GFIA 3DZBA 1GTMA 3E18A 3VI4B 4CMBA 3H5WA 4H35A 2FVXA 4IRXA 5EHQA 1UCFA 4OBBA 4N8SA 3O82A 4FEAA 2QPOA 3DB1A 4ZCSA 2V55B 3DZIA 2E21A 1HNWB 1VMKA 1KY2A 1KO7A 3ADKA 1FMTA 2QUZA 1FDWA 4RZIA 3QMVA 1V6AA 2AFIE 2PVPA 1A8HA 2DOKA 1GNPA 1X3SA 1JIKA 3I9MA 3VPSA 5J1SB 5LMNB 4Q7KA 1V3UA 1OC2A 5ALGA 4O4IB 4U3JA 1Z2NX 1QB8A 2BTOA 2ZXFA 4I3GA 3U3OA 1JJFA 3N2NA 3TBHA 3UYLA 3MMSA 5I4BA 3KT3A 4B3HA 4L85A 4YRPA 3VISA 1NI4A 5GV8A 1DCTA 3QA3E 4PC1A 3CA8A 4IDFA 2K87A 4ZD6A 1M0SA 4HXFB 1TI7A 1XK7A 2ZRBA 1VCIA 1FNSA 2WFMA 1WMEA 2WUFA 3BRCA 3NH6A 1WMBA 4EARA 2LWIA 2DPXA 3N39C 4BIMA 5LOVF 2BFFA 2QL9A 3BL8A 3JRNA 2QPLA 4P22A 1D2MA 1YV9A 3KVYA 3O8LA 4LZOA 2I6GA 3AXSA 3D8SA 2O5CA 1RFGE 1Q6YA 1E94E 3LY8A 3NYIA 2BGKA 3DSRA 3M33A 2D8MA 1XO1A 3OWXA 4NONA 4TTVA 1E1YA 2QD4A 5JCJA 5JISA 4QEKA 3JXEA 2ZRAA 2OZPA 3MMZA 1ZJWA 1ZX1A 5ECWA 2NADA 4LJ9A 3VOTA 3PFNA 3UJNA 2AW5A 3NORA 3IESA 5MN6A 5KPJA 1T2NA 4GKBA 2VRBA 3WIBA 3HKEA 3QW4B 4RKWA 5LN1A 4Z54A 1LCIA 1FTNA 3NANA 4RY2A 3LQYA 4HCJA 4EY3A 5KX5A 1Y4DE 3JV7A 1US8B 1J70A 1JX6A 1KI2A 4E46A 5K45A 4GOND 3THWB 1XRJA 3IUEA 4Z7QB 1E9AA 3NO4A 4PSKA 1M7HA 5COBA 5E6UB 2WD7A 2H52A 3AP3A 3LGSA 1A5TA 2XNJA 4H17A 4HYYA 4PSDA 3UC9A 4E1VA 1VP9A 3MQ4A 3TSWA 1HZZA 3GV0A 5L4NA 1LGYA 2I4RA 3ES9A 5A3JA 1JJIA 1PWXA 1SUWA 2J5BA 2YV3A 2YWXA 3D4BA 1CHNA 4FDLA 1T13A 1LK5A 1AKEA 4UCQA 1D3AA 1AM4D 4DLAA 3N2LA 4KLAA 4OQEA 3SX0A 4U2CA 5CD9A 4NV0A 4MUGA 3OICA 4JT8A 1PGJA 4CIYA 2XTZA 1FFDA 5JG7A 2BM0A 2N0SA 1BXZA 4WCVA 4LDAA 1PFUA 4UDXX 1E5VA 4HFNA 4DNOA 5F4BA 4TXJA 3K5WA 4FCWA 3UFXA 3FA2A 2ODBA 4V1CI 3ACCA 1HTBA 1FSFA 1WSBA 1XA3A 2DHEA 1GG9A 1ZM7A 4UKDA 4BLUA 1QF6A 1DAEA 1C4OA 1TJ5A 1J0XO 1QCDA 2VJMA 2QGNA 2N47A 5DRTA 1HPLA 1XAJA 4HGNA 2QP4A 4MRPA 3PVSA 2B30A 3ZLTA 1NN1A 1VPDA 3BDVA 2JI4A 4QOEA 4WERA 4FJ2A 3GLFB 5BSHA 3DFZA 2O3RA 1QHGA 4NH0A 3SKYA 3SC3A 1GYPA 5KOJB 3ANXA 3OJWA 4AQ7A 2ZOSA 4NFYA 1Q20A 1UFOA 3MJCA 3S1AB 2G82A 2QVZX 5JXWA 2P2NA 1L1FA 1X77A 2DR0A 2IPAB 1A04A 3PFCA 2P27A 5CU7A 1M0WA 2EXXA 3ETGA 4XPIB 3WBFA 2HWUA 1DCMA 1X7HA 3HV2A 1XZPA 2BRUC 2OXEA 4NOLA 2XY4A 2R7AA 3ENWA 4K6FA 3LCRA 4R2MA 4ZAZA 2J5XA 3FOZA 3KFXA 2PBFA 1S4QA 2EBUA 3M3PA 4JNCA 1F8YA 5HVNA 1BH2A 1G7TA 3FBWA 3LI2A 3EUWA 2I1VB 4BJ6A 4P0QB 4GMXA 5F7ZA 3V1LA 4BKPA 1LJUA 2J3JA 2ZZNA 3RAEC 3PF9A 5A3VA 1CJVC 2IXAA 3WB2A 1FSSA 3JYNA 2ZRLA 3Q0EA 5G53C 3WQHA 3HABA 1OBFO 3OM0A 5A04A 5CNJA 2WSIA 3GWGA 3MJEA 4LKRA 3AR2A 1PW5A 1QM5A 2P1RA 3LBFA 3FZGA 4LE2A 4BBJA 5HGXA 5KVVA 1S3GA 5GJBA 3OIYA 4C4RA 1OILA 5CM2Z 2MMCA 2PFKA 4MPJA 5CLHA 1AK9A 1JFFB 4BB9A 1QQAA 2I7CA 1Y9ZA 1GUZA 1X8XA 3IP5A 3M6MD 4QXQA 2WSLA 3O8OA 4TLDA 5F12A 3EGDA 2YVUA 4L4XA 3ZWKA 2O2XA 2W2NA 3N58A 4G4GA 4AMZA 4LMRA 1CUWA 1VXRA 2FKNA 2HD4A 3P27A 1T4BA 3BE8A 5LZ7A 4A0SA 4EA6A 1UM9A 4REOA 2HN9A 3KDSE 2DPHA 1IEQA 4UHFA 1UUFA 1EXVA 3ZDQA 5LZ2A 3AX6A 2UZ1B 4P4SB 5K8UA 3PCXA 1G8SA 3CH4B 4B9AA 1KAGA 2JIRA 2D1RA 1NXPA 2RAFA 5HE8A 1SB8A 4D98A 3IQIX 4B8ZA 2BRUA 1Y7IA 2QTMA 4TMYA 5DNEA 2GM5A 2QG9A 1KDOA 1ACLA 5AJZA 4DKJA 3NI2A 1XE3A 5FUYA 4D4LA 2DSTA 2FUCA 1LK0A 3AY7A 2ARKA 3T5GA 3FOEC 3EGCA 3K1AA 1WHSB 3K8YA 1TYAE 5ICFA 2Q8PA 4NYMR 1WLYA 5BYKA 5FOXA 3GVHA 4J4HA 3O3MB 1UXJA 3PXGA 5DZSA 2BD0A 4LMAA 2FY8A 1LS6A 4LJ5A 1W2GA 2R25B 2GZAA 3ER6A 5BNTA 2A3NA 1XT6A 3I58A 4Y9SA 4DBLC 5KTMA 1JBKA 3HSYA 3VU3A 2WG0A 1Y89A 3PITA 1KOFA 3MWDB 1TADA 4HDRA 4QTUB 2QX6A 4ZQBA 3WWCA 3L6EA 4TYPA 5BQ3A 4M9SA 3FPHA 4B35A 3AINA 1UK8A 2UXBB 1EE9A 1SM4A 2ECFA 3CTMA 3VOBA 3TR0A 4EPRA 3BMNA 3WB0A 1W5EA 1S4MA 1SQ5A 1UDRA 4KXNA 5BW4A 4TRMA 2VSNA 5FTJA 4IGIA 3NUGA 1IN5A 2O0HA 5LQSA 1CVLA 2GRJA 4F3NA 1GGFA 3RGWS 2FG5A 1PVVA 4BFVA 4YY3B 2HMAA 2Y1OA 3H4IA 1HC7A 3L8FA 5ICCA 2JFFA 2W8BB 2HLDA 4YUXA 4M21A 3UMSA 1GPKA 3U7IA 1LRKA 3HJBA 2Q4BA 2QL5A 2F1OA 2QPAA 2K7FA 1FQWA 2J6BA 4MK4A 4WE3A 4EBBA 2GUWA 5KEIA 2NO6A 3G49A 4P2BA 3PB3A 2EG5A 1GGHA 1FFXB 2FPGB 5AMXA 4KRGA 1CC1S 3FI0A 4B7UA 1U9IC 4M36A 4QUJA 2RGDA 4RVSA 2B34A 3BRQA 2KLBA 1IY2A 1P5HA 1U2QA 2BI7A 1Q21A 2VYND 1UZAA 4MVJG 3LX6A 1XF9A 4RHYA 1D6NA 1GL7A 1JQLB 4LS3A 1PDVA 3FMVA 4TQ9A 4TV9F 2QLTA 5H83A 4UHHA 2F43A 1Q17A 3WYCA 1SK9A 3GPBA 4JQYA 2ZSHA 2D0PB 2JGDA 4JP3A 2XKJE 4WFQA 3D6MA 3C1OA 1OIWA 4JXKA 4KFRA 4MWZA 2ZRQA 3RREA 3LECA 5IXJA 3I5UA 5AQ1A 3KP1A 3EPRA 1ZOSA 1L5SA 1JJBA 1L7QA 1PDOA 1U2SA 2XODA 4HK4A 4ALNA 4RTQA 4MW6A 4XCQA 5LOVA 4WN9A 2DB3A 4K0KB 4HV4A 3HYCA 3L40A 5AM4A 2ECOA 1EVLA 3BZBA 3VSCA 5AK3A 3HEAA 5JY1A 1NR5A 1L4FA 2H92A 1KGSA 4HLUC 1JHDA 3Q9LA 2O9JA 4OBWA 5DLEA 3WYDA 4NV3A 1P6XA 2HHHB 2PZGA 2Q29A 4CM3A 4G67A 4OK6A 2WABA 4JQCA 2E4YA 3HY6A 5CDHA 3ZKWB 1JQAA 1VBFA 4TKLA 1V8OA 4V0ME 4R05A 2WR8A 2ADOA 4IM7A 1GJRA 4RD1A 4DR7B 4KR6A 1XXHB 3EVGA 1E2MA 4CMAA 4XR4A 3NATA 4CM7A 2CE2X 4AUMA 4YMHA 4G5GA 3CUUA 1Y9JA 3DLAA 4NULA 3IDSA 4AMGA 1T0HB 4GPBA 1MQ9A 4G56A 3PJDA 5DKFA 1A4XA 1U9IA 1NZJA 2KI5A 3I6YA 4CG0A 2XWPA 1YUBA 1ZA1A 3DDHA 4U7JA 4XEUA 2W0MA 5DCLA 5EWJB 3AFIA 4LI3X 4NY1A 1PHPA 5DHFA 1TTTA 5JBNA 3TNLA 5JZVA 5K51A 2OC9A 2BUAA 3CXUA 1HXHA 1UZMA 4NS1A 4HAUA 1SJ9A 2IUFA 4QWMA 4F5ZA 4F6RB 1JAZA 4DJTA 2PA3A 4X54A 4ARIA 4Y2VA 1DUVG 3C6BA 3ORFA 3KJEA 2R6AA 2X42A 1KI6A 4YP1A 4QFBA 4EFMA 1L5KA 3ROGA 1U0LA 3BAFA 3T3NA 5ESXA 1KR2A 2FP3A 3EBPA 4MUAA 4YNBA 3UMCA 2ZAMA 3CZMA 4G0WA 1EP9A 4Q1CA 1BCRA 1VP3A 2WIAA 5IANA 1AZSC 2Z1MA 4JYBA 3UOWA 1V6SA 1ISJA 2XH8A 3PK0A 4MVWA 3CPEA 4U7DA 2J3KA 2B69A 5CXXA 1UMKA 4ZA2A 2X0EA 2NIPA 2XDAA 2AWNA 2CDCA 1Y9EA 4FZVA 4JEHA 3K09C 4IR7A 4XJXA 3TD6A 3WA6A 4KO1S 3RS0A 4J7UA 4QPDA 5DNDA 3EFOB 2QP3A 1JQ3A 3R74A 1U7UA 1NVEA 3PDHA 4RO0A 4OXXA 5A5GA 3A9SA 1NNI1 4DDWA 3Q4GA 2W48A 1TZ2A 1THMA 4IJVA 2NU6B 3B13B 1UDWA 4LUCA 2Q6TA 1OLXB 4A0RA 3OE7D 1H0RA 1IN4A 1HDGO 1P9OA 3SF8A 1MO6A 3OJEA 2BJHA 1SO8A 2G7ZA 1TJYA 2RCYA 3GLGB 2XYHA 5H3LA 4G8BA 1VE3A 1H8HD 1ZCZA 4DQDA 3SIPA 4GDMA 4RPIA 4BNVA 3JQ7B 3LUFA 3N2GB 3SZLA 5BWBA 1PR1A 5L51A 4BMPB 4BO4A 3QWAA 2VTBA 4AY3A 1VIVA 1HRDA 4F3RA 1F8XA 5JARA 4YJHB 2GOYA 1AG9A 4GOKA 1W46A 3GJ6A 1DEOA 4EGFA 2RGNC 1G42A 3PFIA 5CLFA 4ZRDA 2WHXA 2LKDA 5DP1A 1ZNQO 1RRFA 1KDTA 3FPEA 4ZT6A 1NU6A 3UAXA 2BTQB 3N2IA 2V7WA 2V0NA 4EJSA 2WQ7A 1D2CA 1RWPA 2G8LA 3FCYA 4B7XA 4Y9DA 1A9RA 5LMZA 1G2OA 2D7JA 2GARA 3FLAA 3UJ3X 1EQ2A 5K6TA 3NW9A 3K9GA 3ZDDA 1O94C 2MHCA 3PQCA 1Z4LA 2A1TR 2XXJA 3L4JA 2UYHA 1QZ3A 4JFAA 1KARA 2OHHA 4X6XA 5E7JA 1KZ7B 3SKXA 1RWMA 2AUMA 4EGAA 3K09A 3ZI7A 3TUIC 2GD6A 1G8YA 2KB0A 3B8EA 2NZXA 2EFEB 4K6GA 1P73A 1T1SA 4QOFA 4X8MA 2XUOA 2D06A 2VSQA 5K3FA 3D3WA 1Y3HA 3OVMA 5DFAA 5EZSA 3CSUA 1QP4A 2RFLA 2IYLD 3KALA 1XL1A 4BP9A 4JBXA 1OLUA 1U63A 1ZVKA 3DE7X 2SKDA 5EWMB 4XGRA 2XDQB 4DCSA 4Z4GA 3SNHA 4GVXA 1OFUA 3JS5A 4II2A 1F3LA 1RKXA 1OY1A 5CDFE 4HRXA 2YASA 1K3FA 1PJ3A 4ZI5A 2HH9A 2VYVD 1B76A 1QG4A 1LB1B 5AKIA 3T3MB 3ZHZA 1U2ZA 3IIEA 4D8YA 3AF0A 3TZQA 1UWCA 2EBWA 4WLVA 2G83A 4B2IA 1YONA 1JDPA 1TVEA 3BTSA 4HH0A 4BLOA 3ZE1B 1JV2B 4BVJA 2RK4A 5JXGA 2RGNA 2MMGA 2H31A 3B52X 4MS3A 1PGQA 5AOAA 1WAMA 3KK0A 3P0RA 3VYRB 3G2OA 3K2QA 2NNWB 1HT1E 3GZJA 1I80A 1ONOA 3QA9A 5DV9A 2P4HX 2P62A 2FGJA 2QW8A 1SUDA 3D6JA 3PEEA 4NBRA 4BHTA 4FOSA 4DHEA 4UXJA 3NBXX 4OHFA 5FWXB 5ICSA 3WRXC 1IUOA 3KTFA 1PR2A 3ZV4A 3JVEA 5G0TA 3HXOA 3WLSA 3A6JA 1XZCA 2IZZA 1O94A 1AGPA 4TZTA 1GL6A 3KZNA 5AW9A 3UGTA 1IZ9A 1XZNA 3G8AA 3I01A 1S3SA 5EP1A 3OEWA 4RVOA 1BGXT 4U2KA 4ID3A 5ADUS 1XK6A 5IU6A 3GO4A 2QUAA 1F60A 3ANMA 5JRZA 1G9TA 1RYYA 5LBUA 3ZW7A 3PR2B 2O5EA 2JASA 2VDWA 2VH2A 2X8JA 4C08A 1IN6A 1CUXA 4A0GA 4D0RA 2Q3BA 3RS5A 4J0QA 4KBFA 1CY6A 4FOPA 1C7EA 3KL2A 2J3HA 2ZRDA 3DV9A 1KJYA 2HRRA 2YJGA 4WBXC 1VB5A 4HQKA 4P3XA 1T8PA 4RH1A 2WAMA 5ULLA 3KTOA 4F8YA 3IOMA 4IVQA 3WXBA 4FB5A 5HILA 5IEJA 5KJ6A 1ORHA 4JT9A 4JA2A 4IZIA 4HPJB 2YL2A 3MNFA 4AUKA 3JVUA 5JI3E 3GLSA 4XB2A 5K0SA 4E32A 5FF9A 4TL8A 1P75A 1J1ZA 1P3JA 4Q6BA 3NIFB 4RDCA 2MYTA 5C80A 1JWAB 4GLLA 5JTTA 2YY5A 4OQMA 4L28A 5BSGA 3CE6A 2AQKA 1W8IA 3I53A 3CF6R 1KK1A 1GRRA 2QWXA 3OIDA 4MLZA 2HWYA 2VBIA 1HH4A 2E6KA 4MGEA 4RESA 3V4PB 1UXKA 4FYHA 3WRXA 1EX6A 4F2WA 4N0QA 1MOZA 2NVOA 3SYLA 4LC1A 2P2DA 5DK4A 3JQDA 3LLMA 2FQXA 1OYYA 4PONA 3CO5A 3NTOA 5AI0A 2XRZA 2IHNA 3BTOA 1LKZA 2PUFA 1NDQA 1P3DA 1RXUA 1ZI9A 2JI7A 4ROTA 1SG6A 1H2BA 2X9LA 1DUSA 3PG5A 1MEJA 3LYAA 3ZE9A 5KNCD 1GXSA 3HU3A 2Y66A 4U7HA 1SQ6A 3OHPA 5KKNB 4MWDA 4OIMA 1CNFA 1FJ2A 3NVDA 3MMNA 4PBSA 2XYGA 4Q3KA 1TMKA 4F2DA 3LIPA 3K7EA 3G89A 1NOKA 3CEMA 2NUPA 3RABA 3QE0A 4X1IB 3ETDA 3BJRA 4G85A 4ZOLB 1T2EA 1Z56C 5IHXA 3NRCA 2PLAA 2ODWA 1TJ4A 5I8ZA 2CW5A 4L7QA 5EJ4A 5JH7B 1REQA 3KEGA 2Q07A 2YHBA 5AHRA 2H2WA 1MW9X 3CUSA 4BRSA 4G65A 4YRGA 4QIHA 3GB9A 3TRJA 3AVQA 4IJMA 1S9HA 1L4UA 3F78A 5EZYF 3UWDA 5ICGA 2A3RA 1ISSA 1RC1A 3PPVA 3DDOA 3P8ZA 5JSKA 1G20A 2F90A 1FVFA 1C14A 4RNDB 2VHJA 3BS4A 4HGPA 2RD2A 3QVKA 2H00A 3IVXA 3SHQA 3V2IA 3W7VA 3HVUA 4WLEA 3V00A 4RMGA 1UJ4A 3KKOA 4X1KA 4ZI7F 1QHIA 1Y3AA 2JCGA 4JBGA 2P75A 4OX9Y 2BGTA 2TMYA 3AUTA 4GPZA 2AK3A 5T6MA 3PGA1 1X70A 2KQUA 5EY5B 3C5VA 1TK9A 5AVUA 2MSEB 3LY7A 2EV9A 5B1YA 5BR4A 5JJCA 4LMBA 2XKAA 1Q12A 1Y7LA 1IATA 1PS9A 2PMWB 3EIHA 4IOLA 1PG0A 4NCHA 2CLSA 2VAVA 1FSPA 3L8HA 4OTZA 5G0VA 1G2IA 3LXMA 2IXDA 4LNAA 4C7KA 1IZYA 5FL7A 1ZPDA 3BHNA 4V2UA 3JQBA 4J4BA 4HD8A 1DWUA 2J5QA 3JQ8B 1DAMA 5CLGA 4B80A 4KWEA 1PZGA 1JFLA 4Z0PA 2HU7A 4E4YA 2OVFA 3NIDB 3PRKE 2HA6A 2VHTA 1WHTB 3PNBA 4BO5A 3JVVA 2ZBPA 2MOKA 3ZUPA 4X7RA 5I9NA 5FBHA 2I8CA 3RVBA 1MCZA 1LBIA 1K7XB 3NYRA 3F5DA 4IDDA 4QUGA 1Z12A 4X3PA 1J20A 4JUAA 3GR6A 5ALXA 3TN7A 2SHKA 3KB1A 1C2YA 4PFKA 4XVQA 3W8FA 3WP0A 5JDIC 5MGBA 3G2LA 5FEMA 1E58A 3OOSA 4ZCLA 1RXWA 1EKXA 3E84A 2OORC 1SQ0A 1X1SA 3L7BA 4N8EA 3CJRA 3VBCA 4BN0A 4CN9A 5BN4A 1N36B 2VYCA 2DH6A 1XMOB 3WG9A 1LJ8A 1FCJA 1IQPA 2FOIA 4EY6A 4WBNF 1ZD3A 5REQB 1P1CA 5C32A 3AKCA 3VGJA 1A5BB 4Q9LA 4CFYA 4EECA 4J3JA 5LYJF 4PGMA 1QHHB 4J6FA 1MQAA 5KJCA 5BUQA 1KEEB 1ECCA 4RS4A 4DSUA 4U9IS 5BXYA 2NV0A 4NBNA 1N0WA 2JLYA 1YZTA 3MJFA 1M2OB 5JW6A 1KF0A 1S02A 3HCOA 4JP5A 2E37A 4HUQA 4QJ4A 3BGVA 2AT1A 4ZYUA 1ECLA 2I3AA 3NBYC 4OL9A 5E4FA 4ZEVA 3O95A 3LKBA 3DULA 1EVZA 3Q8KA 2CHGA 3HJGA 3ZGNA 1DIRA 4K6CA 4D5EA 3FHCB 4EKYA 2GJ4A 2JVIA 2Q3FA 2A7XA 3O4JA 4ID9A 1QH8B 3J7TA 3K9CA 4B7CA 2JDIA 2BKUA 1TYEB 2YIJA 1R16A 2J0QA 1P31A 5TJ9A 2CLCX 5F1KA 2Z2JA 1K8RA 2WLSA 2VDJA 4IKOA 3T0FA 4GSLA 3K4QA 5GP1A 2HMVA 1QVVA 1L7XA 3A25A 5DTEA 3HLYA 2WU4A 1NV9A 3WGLA 3PHGA 3ZC3A 1QAMA 3ZE2B 3EK2A 2ZB3A 3EMVA 5HF6A 1I30A 2NVWA 4TV8F 3AUKA 5JDIA 5JPIA 1GG8A 2NZJA 2PU5A 2JJQA 4A6PA 4AMYA 4L15A 1OPXA 4R1UA 1L7RA 1KO8A 4ITVA 2GK6A 5DMHA 4JR0A 4BAGA 2P1ZA 2R96A 2BKEA 1Q1ZA 2C7GA 2OORA 2IPXA 3R9XB 4IUYA 2AD1A 3OKFA 5JAUA 2C2YA 4XQ0A 5TF4A 1CBUA 4CQLA 3AGQA 3KHUA 2IZ6A 1AZLA 3QE2A 1CEEA 1GCIA 1RJ9A 3VR6D 3U39A 4S1PA 3WIEA 1GZ3A 2XKBA 1CR6A 3LRPA 1R6TA 4I5GA 4RQUA 5H4HA 1BD4A 4RZ3A 4KXXA 4YR7A 4H4CA 4I14A 2VO1A 3MTQA 1T4MA 3R7BA 5CB0A 1OH6A 2G07A 4U9UA 4YT4A 3CVUA 2WUWE 2E2WA 1MPXA 1AURA 4I6EA 3KPJA 1POXA 1S1MA 1BMQA 1V37A 4RVUA 4YS6A 5FBKA 5L3QB 5ELXA 3EQZA 1MF7A 1A4IA 1MUUA 1Z4KA 2GKOA 1JILA 2XE4A 1I2DA 4HRVA 2OO5C 2YS6A 4OB7A 1LSOA 2GHRA 2O1WA 3GPCA 2NSLA 4URYR 5C35A 4MDEA 1EFRA 1H2ZA 1YQDA 4LE0A 2YFYA 2HF9A 5D5HA 5FHQA 4EZBA 2CXXA 3OHSX 2C2XA 3IAS6 4G1BA 2VZLA 3H7IA 4JJIA 2IOHA 4NHOA 4IJUA 1VRWA 5H3HA 2XQIA 1IY0A 1JQDA 1W59A 3H87A 3T34A 1QGYA 3VYUB 5BV0A 1QH9A 1V7PC 1WB6A 5AI8A 1II9A 5FNVB 3V8MA 3D4OA 4G0XA 1R0KA 1PL7A 1Z15A 1C41A 1YBHA 3LOQA 3O4RA 3FNHA 3O3CA 3QLEA 2J4DA 2NU9A 4YRQA 1NUPA 1EZ1A 1V8ZA 3R9IA 1S3FA 4OJTA 1UFQA 1M2EA 3QYAA 4D25A 2C1XA 4XR9A 1V11A 1PSZA 4P82A 3KYDB 2QM7A 4HQFA 4QBTA 4BJ5A 5ED4A 2IXGA 2EFDB 4QYIA 4K03A 2C8LA 3P4UA 1ZW6A 2ADMA 3BA6A 4NBKA 2FOLA 5E2AA 5GMOA 3FKSA 1OB2A 4MUXA 4K87A 2AKAB 3QXGA 1P4AA 2BBWA 2FHPA 5DJ5A 3MPOA 5I9BA 3STHA 2YWRA 1O4WA 2C3MA 4HQLA 1X1BA 3H6GA 1Q5PA 1M33A 4GO1A 3SHVA 1KBOA 1KDVA 5TGTA 1C3LA 2WIJA 4FJ0A 2QR3A 4K9DA 3SHWA 4C01A 4XM0A 3ZDRA 2XWQA 4A92A 3ZWDA 2WD8A 2XI4A 1ZKMA 3S3TA 4CQMB 1QS0A 4DSOA 4DSZA 4N5IX 1K9SA 1GT6A 5DSXA 1BHO1 1F06A 1XKLA 2OO5A 4JDPA 4EKNB 1PGNA 2GO1A 4QRDA 5DLQC 1MGPA 2YC2C 4JEIA 2AC2A 1ZZGA 3UQYS 4OM7A 3FCOA 3IURA 2R8BA 5ECDA 1UKAA 3GGPA 4YDQA 3TLMA 4PG5A 1DBIA 2E18A 2VJLA 3TPCA 3KQVA 2QBYB 4B40A 3P2JA 5KWEA 3L4KA 3WMXA 3G0BA 1Y1SA 1KORA 1NLYA 2FPWA 2Q5OA 4PTLA 3X1DA 3I5AA 3BSWA 5EZYA 2QAGC 1AO0A 1ZD1A 4NDZA 5ER9A 3ELWA 2WV7A 3B12A 3K0BA 2CLDX 3P0EA 2G72A 2PA0A 1EIWA 4AO8A 4YPFA 3NTXA 3IMKA 5J2UB 3EG9B 4ZI7A 1T4CA 1KRXA 1MXFA 5IX8A 3AJEA 5EMNA 4AI6A 1R66A 2FI1A 2IHBA 3DGFC 3K30A 3HCPA 3WQBA 3ETJA 4N6OA 5B7GA 4RKQA 3PUVA 1FP6A 5IM5A 1K7CA 2P6UA 3A36A 4ENTA 2RHJA 2V7GA 2X4IA 3G0CA 3BQMB 2E1PA 3D2CA 3D1VA 2H2DA 2RH5A 1YFKA 2YV2A 3QUAA 4X85A 2Z6QA 3QVXA 4FFBB 3UJ7A 2OLJA 2YZNA 1JHZA 2EX0A 3EXHB 4GI7A 5I9IA 1Z4NA 2HGSA 4KLNA 1B3RA 1WUTA 4L73A 4ZP1A 3WLMA 3GF4A 1WDMA 4ZU3A 3LK6A 2BFCA 4ZICA 2C2ZA 1NMZA 5L45A 5CFRA 1JXQA 1U04A 1WP9A 3IT1A 3OX2A 1U9JA 4YFVA 5ALPA 1E1NA 4CL3A 4RJTA 1PV1A 3RJMA 2W6ZA 2QLNA 1KK2A 3KXIA 3MT7A 4EELA 5DI9A 1AJEA 1Y6JA 1JG7A 4YV1A 1BFDA 4FWIB 3PRJA 3SOPA 2QMUA 4BO3A 2ZJ3A 4M1EA 2J0VA 4LZLA 4WT7A 4B6EA 4MAMA 3LS2A 5KSYA 1ODJA 1RACA 3A32A 2BSAA 3N05A 2B37A 4Q93A 2HWKA 2O8DB 1NL3A 3AWDA 5FTNA 2G1UA 4XLTA 2PEYA 4RJJA 2QAGA 1L1EA 2D5AA 2IY7A 1JEQA 3LWDA 4PHTA 2OHJA 4CMHA 1N25A 2C5EA 2R6R1 4KLZA 1GKYA 2HO4A 3GCZA 1TPYA 3BD9A 2F6RA 3KLPX 4ODIA 3KTAB 4QD3A 5KTPA 4CZ2A 5EHXA 1UDXA 4WBNA 1JYSA 3GZNB 2AFRA 2YXNA 3KVVA 3AL2A 3GWZA 4Q4JA 2BGJA 2KYRA 4G0UA 5TDHA 3EZGA 3LHDA 4ZHQA 1VB3A 3UT5A 4DR3B 2F8TA 1NQXA 2BGNA 2ENUA 3PKZA 4FFPA 4FFOA 1HT2E 5NULA 3PS9A 1XVVA 1NXQA 3BF7A 4FHCA 4KN5A 5FTKA 1P44A 4IQGA 3TIGA 5M3BA 1UOQA 3B48A 1GHTA 5A4JA 5TE9A 4IF6A 1OF1A 5C53B 4I7EA 2RGBA 2QUKA 1CHDA 2COKA 3EWSA 4KN8A 3CLSC 3NC1C 4LV6A 5THKA 3TL6A 2ZXUA 4ICIA 4Q24A 2BTEA 1YR7A 1JMKC 3B9BA 3ZDZB 3B6EA 1XEAA 2JGIA 2YZ7A 2ZJBA 3CEJA 4E2FA 3ZWPA 5KJ1A 1YB1A 4GH5A 2FN7A 4HQRA 5DXAA 2XLBA 3UGKA 2IS6A 3IQHX 5AT1A 3AC0A 2PUVA 1U0FA 3SX2A 2LD4A 2IQIA 3BC1A 1G3RA 4PN3A 5GGYA 3L1KA 1DG1G 1Z5OA 3FOFC 4RZSA 3VJLA 1E0KA 4DMRA 3HXPA 2WZDA 1GEEA 2IPOA 4TTRA 3T3GA 2J46A 1B41A 4R2IA 3N5KA 4TV8A 2FF7A 2EKZA 4N6GA 3FYHA 1J7JA 2IPNA 5E95A 3AP1A 2WWRA 3IMEA 1KBQA 3IDFA 3PCTA 4EQ6B 3I32A 1MX5A 1EVKA 2V4ZA 1BKDR 2JIZD 4OP2A 3EXG1 1NDHA 3HFSA 5AJTA 4EAAA 1W94A 2AN1A 2NYRA 2ZR8A 3K0CC 3PGXA 3QNWA 1IDOA 2IITA 5HF5A 4DBZA 1B1CA 2QV7A 4EQZA 2Q2OA 2HLHA 1FW6A 2Y1DA 3SYNA 4YR9A 2R6GA 5TF0A 1EJ0A 5KYWA 4GWKA 2V9CA 3TL2A 1OYWA 4UUBA 4S0XA 3IR6A 1MHTA 3OMWA 3UV7A 2Z6UA 1C8VB 1HX7A 1L5MA 2HNAA 1KZ1A 3JARB 4IILA 4O2LA 5C3UA 3RFTA 4R9RA 2H11A 5CFQA 3SY8A 1KOGA 2ONZA 4ZMSA 4RWEA 1P74A 4KQKA 2QRNA 3M0EA 2QTFA 4G0PA 1RJFA 4Y2QA 2O8FA 4KXLA 2CMFA 1KYXA 4N5DA 3MUNA 4J3FA 4RA6B 1CZKA 2B82A 2XCSB 1ETHA 2WVAA 3EDOA 3VPHA 3HCEA 4N3CA 2FEKA 3IO5A 4O2BF 2BOVA 3JR3A 4TSRA 3VJKA 4LFAB 4ZANA 1BFUA 3AU8A 2HJ9A 2GN1A 3GUUA 1NLUA 5SYMA 1AKWA 3C74A 4C6RA 3W3AD 2Q9AA 3DQPA 4I1VA 4YCJA 3T1NA 3WGNA 1RHKA 2WYUA 4IXMA 3JYQA 2QR2A 4TRJA 4JLNA 3A1VA 1YK1A 3DYBA 4JIGA 2UXDB 3HDYA 1T91A 4I1IA 1OWPA 4NRDA 1V9CA 2X0KA 2YCBA 4PLGA 4X44A 4I1RA 2OMKA 1ONBA 3GRAA 1LVUA 2C2MA 1VGVA 4MVYA 3ENVA 3CVOA 1F2TB 3K0CA 3NM5A 4C6TB 3DCJA 2JFOA 4H7DA 5ITWA 2JLXA 3WTCA 2I3DA 2QTRA 2YUTA 4E5MA 3FCSB 1U0BB 2OQIA 1GNTA 3BGDA 2EL9A 4MJ3A 2WA2A 4O4JA 2WUGA 2OWEA 4P53A 2JF0A 4L74A 2L42A 2XOKA 3ADPA 4BLWA 5KYUA 2GLXA 2QMOA 5EE3A 4NVRA 1K68A 5FBVB 4DIOA 5FUVA 2C2HA 3SEZA 2Z9CA 4YEDA 4ZT5A 1KC1A 2Q3EA 2BFBA 3B1YA 3DOOA 5K8IA 1TA9A 2P69A 3PA6A 5FOUA 2BFPA 1LNSA 3KQOA 4NK4A 3T3DA 1U65A 1MQSA 4YP9A 1U7OA 4QXPA 5C7IO 4L95C 5JCOC 1HNXB 3ZHXA 2A9KA 3F4KA 1YJCA 2QGZA 2Z6AA 5CVTA 2QQ5A 2QZSA 3GH3A 4GM4A 4QM7A 1XU4A 2QDXA 3KT0A 4M7WA 3OQNA 4QXAA 4BWVA 1VLZA 4GRIA 4QOGA 4Z9FA 3ZXSA 4ZOQI 5TS3A 4TL6A 2P11A 2PS1A 4G5QA 4XWYA 2NUAB 1MVLA 2R1TA 2D59A 5J4VA 3PHBE 5C1DA 4I1OA 3AV0B 1T5OA 1P1HA 4G84A 3LZ6A 4DM4A 1QDEA 3FWZA 3DH0A 1U0JA 1ZH8A 3ED1A 3I0NA 4LDRA 1J8YF 3SKVA 5C18A 1H3EA 3F46A 3HY3A 4MITA 1BX3A 4YCSA 3HVHA 2BH2A 3U49A 1D8AA 1M6VB 4AMVA 1KI4A 1F9EA 2VPWA 5GM2A 1GG5A 1LBSA 3W2IA 1L6IA 4C4OA 4OXIA 2ZRMA 3OJXA 3MCVA 4F4UA 1P7VA 2ZRGA 1PUJA 1J2EA 3GN2A 4HNGA 4MO2A 5HKLA 2ZSJA 3GJ0A 3CJQA 2KWIA 3PNQA 4H16A 3RUPA 3VR2A 4ECEA 1OB5A 1GKLA 3EBOA 1EFPA 3I2IA 4DLPA 1OC4A 3EMBA 1SD1A 2QQFA 4R8KA 3RT9A 3CGWA 1JPNA 3SJCA 3U9SA 3AF4A 1AKMA 1JZTA 1YKSA 1NT2A 2X8BA 3MJHA 4ZWNA 5KYXB 1S9DA 4AZ0B 2B61A 1SBZA 1ZRNA 2DWPA 4HAVA 1HE2A 3B60A 1DAOA 1V5EA 5FB3A 2Z0MA 3JW8A 3IKLA 4IHJF 1W5BA 2NU8A 3RUAA 2B78A 2POQX 1WZIA 4F6CA 2Q0QA 3EWAA 3EXIA 1D0VA 1EXNA 1M73E 3QHPA 5K6AC 1BKSB 1M83A 2AW3A 1C3OA 1QH1A 3IERA 4JKIA 5K4GA 2XRMA 4I2VA 3ZCXA 4D9IA 2AFIA 4OQYA 2VSFA 1AKQA 2OXRA 4CT5A 2GF2A 1T1RA 5CPFA 4ZEXA 4PIVA 1BHQ1 1KIFA 3OQ1A 1N8NA 4DDMA 5JAMA 3GFGA 3C15C 3X1JA 3REFA 4B6FA 2H07A 2IY9A 1QHEA 3DNMA 2E5WA 2OHOA 2LW7A 4GC9A 2PKEA 1UOPA 4TS9A 3F2VA 5D85A 2E55A 3ZD6A 3OTHA 3F97A 1KY5A 1NVBA 2N1MA 2GD1O 1ZISA 2GN0A 2Z04A 4UBOA 4V0NA 2EGUA 3TTYA 2ZSIA 5CA0F 1VHDA 4LJ6A 1JUDA 5CYGA 4HQ0A 5CXUA 5KDOA 4MYRA 4BV8A 4DDTA 1NQOA 4WZAB 5HPYB 1X8JA 3BD6A 1PSWA 4UHJA 2LRHA 1WJGA 4BWYA 1L9KA 4F4HA 1FJGB 2D0DA 1Z68A 4OHXA 4LRQA 3W2FA 4GL4A 1ZYUA 2JGLA 4QAJA 5HF9A 4PCLA 3SVTA 2I2DA 1IL0A 3A0RB 1UQTA 5L7TA 5LM3A 3L49A 2XCRB 4L5BA 5L95A 1ZRMA 4CKXA 5AFSA 1TW2A 1SXPA 3FNIA 2AOTA 3ZHUA 4QVIA 3IV6A 4I5FA 3R23A 1T6XA 1TZMA 1EFCA 3VFDA 2IZ0A 2PZJA 3P2OA 3HWSA 4PO3X 3D8NA 2QW1A 4PX9A 4URFA 2QN3A 2DX7A 3DV2A 3VC7A 1QV6A 2EG9A 3B6MA 5K6AA 1OJ7A 3HI6A 3BOSA 1J9GA 1V16A 3PWSA 4HNAA 4HFJA 4K6MA 5IJXA 4CDMA 2CVPA 3O1LA 3K9QO 2FSUA 1RWQA 5DU2A 1I7NA 4YN3A 1OVMA 1YBMA 3QI7A 4HEHA 5A7GA 3U4CA 4LQDA 3GVCA 4GZ3A 1SVWA 3VR6H 3JZDA 2ORWA 3UM9A 5B55A 3DLIA 1PV2A 1GZ7A 1HQKA 4A91A 2ACVA 4HZUA 1X1EA 4L7VA 4DCCA 1GTSA 1J24A 1UP4A 3FYCA 3R7WA 5BMOA 2Z3ZA 3CLRD 3W8EA 2JHFA 4YRZA 5F35A 4MQFB 4J1NA 3IOBA 4EZIA 1Q92A 1U0HC 4MQEB 4R01A 4Y18A 3NM4A 2WSBA 1HDZA 5JOQA 1S2OA 3MYYA 3EQ2A 1D6JA 2BSQA 5HIJA 3CUVA 2H5LA 3K3PA 4POAA 2NUTA 3SD7A 1ADGA 1U11A 2HTFA 3TEMA 2Q27A 2POCA 1MLDA 4BQQA 1Z6QA 1MRSA 1MO4A 1YS6A 3E9CA 1Z22A 2MIIA 2XV1A 3A0UA 4J2TA 1Q1QA 5DXJA 1PTJC 3EY4A 1Z0FA 3L43A 4LOIA 2NP7A 4F56A 3FGNA 2OBMA 3QP9A 3JATB 2WWGA 2DGDA 1EWVA 1GWNA 3DC2A 3INNA 1UK7A 3LQQA 2EDAA 4EPVA 1ITZA 3AJRA 3EW9A 4I1SA 4PGAA 4RBNA 2HIAA 2WFLB 2UZ0A 4LY0A 3VNQA 4BMDA 1K6XA 4XD2A 2EFJA 4K8RB 4B5LA 5TQVA 4GYYA 2WPDD 1OGYA 4RLHA 2P4SA 1M1YE 1P4RA 2VUSA 3O74A 3OY2A 1G5QA 1PSDA 3DAHA 3V34A 4RK0A 5LDHA 4NZYA 3LX8A 5SYAA 1QP7A 4HMPA 2I1LA 3QQPA 5FQNA 4OHRA 1TTHA 3PUYA 1AUVA 4NE7A 3WOVA 4G9EA 4TT3A 3TW8B 1JHXA 2ZKIA 1K0FA 2I3GA 3UGQA 5HRCA 1W34A 3R5XA 3OCUA 4O2BA 3T5DA 4H3VA 4J0DA 1KR5A 3GPDG 1P1RA 3K1JA 1VL8A 4PRLA 5DM4A 1Z63A 2V1XA 2IEBA 2VQDA 1G8GA 3DQQA 2V98A 3OJCA 2Q5QA 4P34A 4QVGA 2BF4A 3D8UA 3FE2A 2CBXA 4V0OA 3K70B 2C7VA 2XVXA 1QCCA 1KI1A 2WM9B 2QXYA 5B7NA 4QEDA 6ADHA 5K0JA 2FP4A 2M9MA 1X39A 2OD7A 2HZ7A 3N3BC 4RZUA 2O8BB 1M34A 4IJWA 1Z75A 3K70D 1O5TA 2FK8A 4Q48A 1EWRA 2F3RA 2WKRA 2OCYC 1ESEA 1PQWA 1KJZA 1XMVA 2OLEA 1W85A 3DBIA 3A3NA 3VPAA 1DQZA 1MQ8B 2O05A 1ADCA 1PHRA 5TEVA 1XQWA 2P6PA 3INYA 3S1LA 2BVNA 1VKZA 1I4OA 1IWBB 2ZJ1A 1KEPA 2O6HA 3REOA 1G6HA 3IDZA 4BBPA 1U7TA 4KQXA 4CV1A 1NONA 3BKXA 1I01A 3BDIA 2HV8A 1UINA 1CY2A 2QIPA 721PA 1CS0A 4LYFA 5HKBA 4JBWA 1OYOA 4UCXA 1WXQA 5I7AA 1LFDB 1EGAA 1NVVQ 4JOQA 5J40A 3TRHA 4MR9A 2X3FA 3KZMA 1LC0A 5EKDA 4N39A 3EOAI 2VHXA 1HG0A 4BP1A 4C0KA 5CB4F 1VJRA 3ETCA 3ORRA 1FRZA 2RJ3A 1XGKA 1ESCA 2GILA 4YDSA 4FDTA 1I5OA 3CFYA 3VHXA 3CO0S 1K8YB 2R8EA 3A6HA 1QMPA 1UKBA 1DAKA 4HPWA 3Q8XB 3H2BA 4KWTA 2QMHA 2QM8A 4I8IA 5BR7A 5LLDA 2ANCA 2A0YA 2MSWA 5EL0A 4UREA 4XYLA 1UBHS 5MHTA 2GXAA 4GX0A 3EEQA 2OQ2A 3IVCA 4EVRA 4M22A 2GZSA 3W5VA 3RYTC 4RY9A 2C5LA 3LUJA 4UVHA 2PIDA 2W6NA 5FNZA 3RVMA 4NICA 3ZCRA 4GECA 3A6EA 4Z1OA 1EIZA 3Q8LA 4IIDA 4KB5A 1L8LA 3PA8A 1M6EX 4AZ3A 4MUYA 2RHOA 3MD0A 3CTPA 3OZRA 1RRPA 2OESA 3U3JA 3OPYA 5EZ6B 1LH0A 4V0LA 1Q77A 2FSHA 4P4UA 2JAOA 1E3WA 4CMKA 1BDBA 2QVBA 4RIHA 1F6BA 4PYOA 3GC6A 2QDKA 4I46A 1S96A 3GA7A 3H4VA 3Q11A 4NBSA 1USIA 3DE5X 3DFMA 3IQZA 4YCAA 3N5CA 1GAEO 1NU8A 1UEXC 4X0EA 1IXKA 2GZDA 1RRCA 3Q7PA 2J9GA 4HMQA 3GFFA 4PZUA 1E98A 3W8RA 3AVUA 4M8NE 3SLGA 2ZGVA 2PG3A 2GKSA 1UBTS 4BP3A 3H97A 3MS7A 1T3GA 1ZN9A 3AZQA 1O5IA 4M7PA 4KQCA 4PR0A 5BRNA 4YONB 1MB3A 3AL3A 1DO0A 4DR4B 3P0FA 5AI9A 3IA7A 5DNCA 4QXOA 5JYBA 4XDHA 4IIXA 4UDOA 4QARA 3L6UA 1RMQA 3U44B 3EVCA 5DTRA 2BJWA 4BNGA 1W7AA 3AB7A 4R40A 1AB6A 1AKTA 4L07A 2HRBA 4X7BA 1PZEA 4R9UC 1NHWA 3O8QA 3LL4A 3PE4A 3EFHA 3FTNA 2FPIA 3K1ZA 2AN4A 5FPPA 4IIJB 4M76B 1FU4A 3V1UA 1TTQB 5HZHA 3REGA 3E7PA 4C14A 3N7TA 4H0FA 1N33B 2IF2A 2R8OA 1YB7A 5CP8A 2Z2ZA 2FPPB 3LXRA 4BQRA 5JXJA 5K8LA 3ZXUB 3A2KA 1OXMA 1T0JB 3I72A 3UCXA 4D6XA 1FS4A 1I3CA 1RYFA 1T3LA 5HQJA 3A6PC 5CT9A 1K8ZB 4HATA 1RM3A 2NSHA 2J3QA 1R8JA 2VAWA 5HFJA 5L7YA 4DIBA 4BQFA 5F7OA 1G1AA 1W0KA 2CV0A 4XQ9A 4QRIA 4DCPA 3FRJA 3INRA 1DTEA 4WN3A 3DWEX 5CVVA 2WUEA 2A9RA 2R7MA 2QJOA 3ZD7A 2FETA 2FSGA 5DCUA 3BILA 4YCCA 4OLJA 4V0MA 1IM2A 1HEIA 3KE9A 3GRRA 4DCMA 1FSZA 4EB0A 4EDFA 3JVDA 5F1OA 4DMFA 5JAOA 4U7TB 1ATIA 4ENQA 1HE3A 1U0NA 3KJFA 4WESA 5JYDA 3U7FB 4QE3A 3CS3A 2IVZA 3ZXYA 421PA 4DYVA 1PLLA 1H5UA 2ZS8A 1AK1A 4E13A 2RK6A 1UC8A 2IL1A 3OKPA 5IVDA 5A2QA 4MV5A 2IYWA 4IDHA 4UFOA 2AI1A 2CUZA 2D4HA 3DTVB 4FE4A 1X0XA 2IODA 2YUIA 1DIBA 1UPTA 2OP0A 4NKRA 3ZH9B 4CEHA 1G8AA 2Q9BA 3EXEB 4IZOA 4EGJA 3IQXA 3KEOA 1LRLA 4K2HA 1MU0A 3NT4A 4MW4A 4LYYA 1NYTA 1HNNA 3OOWA 2OQVA 2YHIB 5AKGA 3RAFC 3DTVD 3R75A 1G8JA 4RXMA 2F9FA 1R88A 4LK3A 3L7DA 1ESDA 1GAQA 4MDYA 1EX7A 4Q12A 2VZ8A 1YA6A 2KHZA 3AG6A 3K4HA 3R6WA 1R0BA 4NWIA 4YI3A 1DE0A 1HYEA 1R0ZA 4LF6B 1FBNA 3IC5A 4UPDA 3L84A 5BSMA 3S2YA 2VWHA 4TMWA 4UMVA 1PYOA 2GN8A 1WQ4A 5TMDA 3W3AH 1NQWA 3W6UA 3ZJYA 1UEJA 3RC3A 1KIAA 3R6TA 1T3SA 4L78A 4WK2B 4D9GA 3HCNA 3V48A 1XEFA 4B8WA 3M1LA 5CFLA 3DVAB 2W5UA 1QRAA 1Y1KE 2EZUA 3AI3A 3CB2A 1L7AA 1GNRA 3MIZA 3OZUA 2C3YA 3AO0B 2R8PA 3FPLA 3L7MA 7ADHA 2P6OA 2QVCA 1F2VA 3GEIA 4NJEB 2I7XA 1E64A 3OQIB 4TYWA 1RQXA 2E87A 2BFWA 2FXVA 3FCXA 5HNKA 4LXQA 3RRJA 3SLKA 1JI0A 2SICE 1M1NB 3KWJA 2VPPA 1OH7A 3HFRA 1ZCFA 1AUXA 1TPZA 1R6AA 3EEYA 4X7MA 4EG0A 2X15A 1YU9A 2Y77A 2YMLA 3S28A 5BMVF 1IUKA 1NW4A 3LP6A 5K3OA 3JPYA 1STOA 2FW7A 1ANKA 3OZCA 1JTVA 4JYPA 4XUCA 4BP8A 2QG4A 4O4HB 4Q00A 4ND8A 5UKDA 5A62A 2IUTA 2CC2A 1P3Y1 4FT4A 4GGMX 2PT7A 5ITZB 2XOXA 2OFWA 1JECA 4L8YA 5AXDA 2ZSFA 4MVJD 4NU6A 3ADBA 4MPDA 1Z83A 2IHYA 2R97A 3CHYA 4OBEA 1YOVA 4RF2A 5LP6F 1LF5A 1XHEA 2B4QA 1QVAA 4K28A 4KQEA 3SSMA 4AP5A 2HCJB 4BB6A 1WKBA 1OASA 2HU5A 2Y6UA 3M49A 4JCOA 1G5TA 3RB8A 1LBHA 1S7CA 4NYIQ 2AR9A 4A8JC 2IPMA 3NIWA 1LC3A 2YNMC 3IXMA 3L7KA 4FHGA 5JE8A 3U17A 1R0LA 3MM4A 5ITVA 1C50A 2J32A 5EUMA 1KYQA 1K7YA 2GZMA 2ORVA 3MRTA 5FA5A 3G23A 3VHLB 1PVDA 3OI7A 2AD5A 1JSCA 3FTEA 3DBRA 4GYKA 4DMLA 2CXRA 4Z7OB 2DECA 2X23A 3L41A 3QOWA 3WMFA 4CLOA 4IXNA 4KXVA 2BGGA 4UOQA 4E5UA 1VBKA 1TKBA 3K8ZA 4L5YA 4B2LA 1UBNA 3T0IA 1E20A 2H4ZA 3I6BA 1XVAA 3H99A 4KIGA 5CURA 1JG1A 2X6TA 5JR3A 3LHFA 4TKVA 2JHGA 3D3JA 4BKQA 1HM5A 4TKUA 1A9ZA 3I1IA 1QFSA 3VH1A 5LQRA 4D57A 1EXMA 3KSMA 4JJAA 1VGRA 2Z4TA 4WQMA 2GMWA 4K6HA 1VG1A 1ZUNB 4QDKA 5AHKA 1QUEA 1EBBA 3DP9A 2OV2A 1XZBA 2O1EA 3ZV7A 4C88A 4BKUA 2C03A 3TECE 1DRVA 2IOFA 3HFJA 3QKSA 4LX0A 4QXMA 2ILTA 4RGQA 3G0HA 3AUAA 4EW3A 2NO9A 4FFWA 4JLVA 5CH3A 4NATA 1GLNA 1P5JA 4GZ5A 5IC5A 4ATNA 4JKOA 4XDGA 3SAJA 1SXJE 1JGTA 2CHEA 1JAYA 3CUWA 3FFTA 3G7SA 4TYQA 4X3CA 4JI5B 4O8ZA 2WWYA 2PZEA 3WYEA 3LA6A 2XUPA 3PICA 4R1MA 5KQRA 5KSPA 1RRKA 1RZ3A 4IPTA 1BN7A 4KKXB 3QF4A 3RK1A 3RSSA 4M0CA 3D4NA 1B6RA 3K71B 3Q9NA 4PZ9A 4A6EA 4JJGA 4CM8B 1XSEA 5KI6A 4CXMA 3PP8A 3PHCA 3TBFA 2ZZKA 1ZA2A 3CZ4A 4RJIA 5FT9A 3FPGA 4JZYA 2QZPA 3QOFA 5DNUA 3CRQA 1NR7A 5E1DA 4AZWA 1E1CA 1XKQA 1Y82A 1Q1BA 3GZTB 1T9GS 2LXNA 3CURA 4I4TA 4A23A 1FFYA 2O8CB 3C5EA 3EWIA 3UANA 1QONA 2Z9DA 5DEIA 3HS3A 4W9MC 5EIBC 5FWYB 1U3CA 3U5TA 1XWWA 3HBJA 4P54A 3VQTA 3S0JA 1NKVA 2WAXA 4B3MB 4IH1A 4O2AA 2YS7A 2RBGA 1N2HA 2PTGA 2QZJA 2ZVDA 1FNDA 5C8XA 3D7SA 1ZJ4A 4M9UA 1EFDN 3U4GA 3SE0A 3TKYA 1TRHA 5TR9A 2WINI 3CH5A 1Q7GA 5FOWA 3BWXA 1H2YA 2BMVA 3H04A 3RYHA 2IP2A 3LZCA 4F5DA 2QTAA 3T1VA 3K5IA 5IJ9A 4N9WA 5JFOA 3SVLA 1U0RA 2GYUA 2I80A 3MA0A 4MIYA 4CFSA 1UJ6A 4R2WA 3EFBA 4IWNA 1OSNA 2WHYA 2IUEA 2WW8A 4UUMA 1FMJA 4TLMB 4MWCA 3ZBUA 2CL7X 3WSVA 3E8SA 1ODSA 3DD5A 5AXCA 3KOZA 4RHCA 1Z33A 5GONB 5H3CA 2NTNA 3Q72A 5HIMA 3A9VA 3WGHA 2HK6A 5BQ5A 4X90A 2PD4A 1EWTA 1F0YA 3CLUD 4PLVA 2X5XA 5JQWA 3QPUA 1SN7A 4EFNA 5KQGA 2ZB2A 3VNBA 3R5FA 1I1OA 4BTVA 4E2XA 1M2GA 4J0JA 3F5QA 3PC6A 1RKVA 4HPXB 4N7BA 5J63A 3CF4A 1IAQA 4GE3A 1UIMA 5FL3A 1U1FA 1CQIB 3O2SB 3W2GA 4WAUA 1QTNA 2FWRA 3DNPA 1XZKA 2NTEA 2R4QA 1UKCA 2XXBA 5AP9A 1CE8A 1JG4A 3GT4A 2J48A 5TMBA 1QMGA 2WM3A 3V8PA 3X2SA 1XEXA 3CUTA 2AMYA 1KNXA 3NXSA 1W0JA 3MPUA 3CF0A 4KV9A 1EVYA 1B8OA 2GNOA 2PCJA 4HDMA 4F3CA 2FQWA 2GBGA 1GM5A 3JWPA 2OGSA 2FWNA 2I3BA 3OA2A 4OATA 3WS7A 2FEWB 4RADA 4KFSA 4UM5A 1BG6A 2PYIA 2CNWA 2G0TA 2W2VA 4LWZA 1IAVA 3WL8A 2UZ4A 1ZOOA 4LOKA 3KSAC 2VCEA 2HBYA 1VJ1A 4MX8A 3IAXA 4LRUA 3TZ6A 3BE5A 2BLLA 5ELLA 1IVNA 3KT8A 2XA1A 1Z25A 3D31A 3R5JA 4D26A 5E38A 1Z5GA 2V4MA 1JA9A 1ZMBA 1OT5A 5LP6C 5IVKA 1PE0A 4G5SA 3MW8A 4J07A 3UXMA 4Q7JB 4DIMA 5CJPA 5JHHB 2X58A 2V5UA 4QULA 3RVLA 1KO4A 4IL5A 2X19A 1RZRA 1CF2O 1Y1QA 4NXMB 3DOCA 2HSJA 1FNBA 3E1SA 4HXYA 2DFKB 3UWKA 3ZJ5A 4R68A 2ATIA 4V0KA 3HVKA 5J5CA 1D5WA 1YRLA 3HB5X 5G1PA 3TQQA 3HYRA 1YDMA 5FXMA 4Y2SA 4PEVA 1JS1X 2V7BA 5HIAA 2REQA 2AOUB 4JL8A 3SZMA 4NPHA 3MILA 5DW3A 1CUDA 5LLSA 5JXIA 3FWKA 1DIGA 1SCKA 3FMPB 4DREA 4EL0A 1RRMA 3SS8A 1IHUA 3OEHD 2VHCA 4AJIA 4CV0A 1DO2A 4DT1B 2H5EA 2AG6A 2ZI3A 2EU8A 3LK7A 4LSMA 4LXUA 5BQOA 3TQFA 4F6LA 1OZHA 1CW2B 4IGFA 3VR3D 2CF6A 4DC9A 4Q3CA 3HKBA 1WO8A 2Q4EA 2VZEA 1HL7A 3R9KA 2YZKA 1E4OA 2EQ5A 1VMAA 4WFKA 5FTMA 4U4AA 5G2OA 1L8QA 2OZVA 3K9LA 4JUBA 2PQ2A 1E2GA 3GLHE 2JLCA 4IFBA 3IDAA 5B1SA 3R7DA 5BMVA 2CK3D 3LQFA 2CHUA 1SU8A 4FB4A 3B3FA 3DOEA 1L6RA 4PLWA 4ZVSA 3K9BA 5FULA 1FQJA 4I6GA 5T5QA 4DOMA 1RYMA 1NPYA 2OUIA 2FYTA 1KSJA 1RXVA 2GHIA 1Z0ZA 3IILA 1V35A 2JD1A 2YWHA 1YB5A 4JP8A 2AZMA 2DJIA 3DONA 4H7JA 5AD1A 1X1AA 4KVAA 1R4MB 2AFVA 2PGIA 4Q9KA 1WCXA 2R8ZA 2VNKA 3I1JA 1AXRA 4KHPB 3F0TA 3T7IA 4AD8A 4C0HA 4BNWA 4D80A 4ZI3A 1MV5A 2W2KB 2VF7A 3N07A 4C03A 4UULA 2VOEA 1IOLA 2IZ5A 4Y9RA 2A7QA 2OMEA 4FGSA 1WDKA 3P9CA 4B4UA 2PZMA 1XXLA 5DI3A 5E4JA 1Z0UA 4URHA 1NM5C 3KKQA 1R8YA 2WMYA 1G8PA 3W78A 3R5SA 4FR5A 2C4TA 1CJTC 3JYPA 3W8DA 4PIMA 2A2ZA 4V0QA 1KJ9A 2FEXA 1D4OA 3TXYA 4BAUA 4ZDKA 1CVIA 1WB9A 1G1MA 1VTKA 1YR9A 4A26A 1XZGA 2X4DA 1Y5LA 1YULA 5CDYA 1PL6A 1NG9A 3T1OA 1PQUA 5C34B 1FDUA 1JDSA 2HXGA 4MS1B 4TVBA 3OFSA 4KIFA 1BCSA 4XX0B 4DV7B 2VJBA 1VHTA 2ZYTX 2MYPA 3PNKA 3ZD9A 1MJ5A 4DLLA 5EXDA 4KXUA 3DMFA 1QK3A 2ZYWX 2D2XA 5GZ1A 4IDOA 3RSQA 4GW3A 1DC7A 1XNJA 2X2EA 3FRIA 1PO7A 4MVJI 1EX9A 3VKUA 3LU1A 1WW3A 4BX9A 5JCJD 3EZ7A 4PR3A 2FV8A 4DIKA 1E1LA 4DMUB 2I71A 3ZEIA 2G6TA 4DCOA 1E9FA 4DR1B 2QJFA 2JG3A 4MPPA 1N2BA 4PXSA 5E4TA 3ZE7A 4NC9A 2XUGA 1ZOPA 3CVJA 2FR8C 1P0FA 3AERB 4BVGA 1CFZA 4AB1A 2GVNA 4WIAA 4Y1FA 3K1YA 3D6AA 4KQIA 5TC4A 4D3XA 3H42B 5BYAA 2HKIA 3ZE0B 4FSXA 2V59A 3LY5A 2W6CX 4GF5A 5EGNA 1E2EA 1SHKA 3Q5GA 2I9PA 1AKUA 2EJVA 2WWWA 3MRXA 4MR7B 1DSSG 1N3IA 2BEUB 3BVPA 1BFKA 3MHTA 4DA8A 4ZYYA 2ZJOA 1G3QA 1T2CA 1LQTA 2EFHB 2FK7A 1JMVA 2H4JA 2CLFB 2IDZA 2OCXA 1VZ2A 5EUQB 1NM5A 1PFQA 3HP1A 4I55F 4CIVA 4W8OA 5JROA 2Q3MA 3Q8MA 2CYAA 1L5HB 1IWOA 2BF7A 5SV2A 2FFJA 3N8DA 4ZAGA 2WF6A 1JHUA 2PSSA 1SQSA 1GNLA 2PD6A 5KQLA 4FYXA 2J59A 3ZHYA 2C2GA 2M6RA 2WSSA 3GL9A 4HT3B 4WADA 1RYBA 3HNOA 4NE9A 4QFMA 1Z16A 1GR1A 1GZ6A 4MR8A 4Q3NA 1Z73A 1QNLA 1RLTA 2B8JA 2FFHA 5IKPA 3G2JA 1QX4A 3QXCA 4EHJA 1NBOA 4GZLA 5LQNA 4RPLA 1XTIA 2PRSA 3KSBC 1ZJJA 2PMCA 4QPZA 1GRNA 1IBCA 2EWVA 3BEOA 4JJ7A 1PLJA 2OB1A 1M1UA 4LBZA 5KVQA 2H2AA 3WL4A 1UMBB 5DYYA 4BMCA 5KDLA 2V7VA 1F12A 3M5WA 2Q1WA 3DR5A 2IXEA 1JEYB 2YHSA 4H31A 5HWSA 2HSZA 1WKCA 5BNFA 3PEWA 2PV7A 3CVXA 1IQRA 3DS8A 3PC4A 5AXAA 4K0RA 2AEEA 2C0QA 2WE8A 3K16A 4RJ2A 2Z09A 3O8DA 3KWFA 5GJWC 2MT9A 4KIJA 3ZLJA 3B78A 3BWBA 2ABWA 1N57A 1OV6A 2FWAA 3ZK8A 4BGIA 4C0WA 4CFZA 2IKQA 1EM6A 4X00A 4D41A 1PR3A 1I6WA 4MJXA 1A82A 1OCEA 3CT4A 1NFQA 3PGVA 4M83A 1OGIA 1TUBB 2K4MA 4DCJA 2PUEA 4HGQA 4LHYA 4Y6QA 2I33A 1BROA 5IAEA 4UFPA 2WSMA 1M1ZA 3FTPA 2G0AA 4ESVA 5BN5B 4QAQA