2D0DA

Crystal structure of a meta-cleavage product hydrolase (cumd) a129v mutant
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
271
structure length
271
Chain Sequence
b'NLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNSFGGGLAIATALRYSERVDRMVLMGAVGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-hydroxy-6-oxo-7-methylocta-2,4-dienoate hydrolase
molecule tags Hydrolase
source organism Pseudomonas fluorescens
publication title Improving the catalytic efficiency of a meta-cleavage product hydrolase (CumD) from Pseudomonas fluorescens IP01
pubmed doi rcsb
total genus 109
structure length 271
sequence length 271
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2005-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2d0dA00
5JAOA 1JI3A 4X6XA 5AIAA 1EK1A 5ALNA 1CVLA 3K6KA 5AOBA 4C88A 1EHYA 1WOMA 4G4JA 4DSZA 5AM0A 2XMQA 3WK9A 3EBLA 1R4ZA 3G0IA 3WK7A 1FFEA 1QTRA 2DHEA 5BWCA 2BFNA 5KBYA 4KRYA 5DTIA 1DWOA 1NX9A 1BEEA 3SWWA 3WZLA 5EIHA 3ANTA 5KREA 3V1LA 1UK9A 5ALZA 2Z3WA 5FOQA 2Y6UA 1UK6A 2PVSA 4G8CA 1CIJA 3WYNA 4MYSA 5HQ3B 5IVHA 3FYUC 1TCBA 1GPLA 2PL5A 1SOMA 1JJBA 2V98A 4KEAA 5AI0A 5J3JA 3DYIA 5HFNA 4N8SA 4B6GA 4EY6A 4Y2RA 4CFSA 1B6GA 4RPCA 2ZYSA 1R9MA 4Q05A 4UBOA 2ES4A 1LBSA 1ZJ5A 1XZLA 3DL4A 3FOBA 1J2EA 2PUHA 1MAAA 2HA3A 4QZVA 2WG1A 4X97A 2AJLI 4DLNA 3QZUA 1JMYA 5DWDA 1ORVA 3FLAA 2XLCA 4CI9A 1MX1A 2PU5A 2CJPA 2HRQA 1E89A 5EHXA 4QDUA 5EIAA 4GBGA 4YK7A 4HS9A 1EH5A 1JT2A 1EX9A 2C7BA 2XUDA 4P92A 1XZFA 1LPAB 2CBGA 2HA6A 4Q1VA 5AI8A 1MJ5A 2HM7A 3L1HA 2XMZA 3I2GA 4NMWA 1E8MA 4KJXA 2H7YA 4Q3KA 3VDXA 4HVTA 3DEAA 4JNCA 3QM1A 1PJAA 1VOTA 2H9YA 5A7HA 2FJ0A 3T52A 2QS9A 3DDUA 3DS8A 2ZJ6A 1CQZA 4JH0A 3X3HA 5CT9A 2O7RA 2WIFA 4WY8A 2RI6A 2ACEA 1YA4A 4EZIA 4UHFA 1YS1X 5FXMA 1GPNA 3PUIA 3G0BA 3HI4A 3W05A 3DOIA 3Q0TA 5AKJA 1JJIA 5JYCA 5CH5A 3I2HA 1I6WA 4KRXA 5LLSA 5AM1A 5E2IA 4RE6A 1UKAA 1P0QA 2QTBA 4L0CA 4YPVA 5JD5A 2HFJA 5JASA 2DHDA 3I2JA 4X00A 5HCUA 1CUDA 5BV7A 1R1DA 1IUPA 1W1IA 1GKKA 3V1MA 3VVLA 2HA2A 2YXPX 5FP0A 5A62A 2VTVA 1XQYA 1X2EA 3FLBA 4INZA 1LPPA 1UKCA 3AINA 3C5WP 3HJUA 3STTA 3A2MA 3W2TA 2XE4A 1N5MA 5ALDA 5ALFA 3QPCA 5LZ8A 3H19A 2GBCA 1CFJA 2WJ3A 3H18A 4LKOA 4X95A 4OYLA 2WIKA 4PSUA 4TPKA 1QGED 2YASA 3O4JA 3QMMA 1SCQA 4CCWA 5C81A 2H7CA 5CT5A 3BF8A 3WJ2A 1A7UA 5CMLA 2VT7A 4KE8A 3IUMA 2FUKA 5C8VA 1DX4A 3KWJA 4FFVA 3QBJA 1N1MA 1Y37A 2JGFA 2BAGA 1VXOA 2HA4A 1TK3A 3ICWA 5KWIA 5IVKA 2XQGA 3D7RA 4E11A 4ZV7A 5I9IA 2AXEA 1YB6A 1E3QA 5KWJA 2DHCA 2V97A 2VJDA 3F9CA 1TAHA 1XQXA 3E0XA 1KEZA 5ALRA 4PV7A 1HLGA 5ALXA 2XUIA 4BDSA 2XQIA 3WIBA 4WFIA 4KR0A 3V9AA 1DINA 1K6EA 3IA2A 3YASA 1U8EA 1CUIA 1MX9A 3WKEA 2XT0A 4H7JA 1CUFA 3UUFA 5LP1A 1AUOA 5A71A 2EDCA 3EQ9A 1B41A 1WHTA 4X93A 5FPPA 4BCBA 4X7BA 4BCDA 5AKZA 1MNAA 2ZYRA 1HPLA 5FDFA 1HDEA 2WHRA 4BAZA 4Z49A 1ZOIA 4V2IA 2H1IA 1R3DA 5FPQA 5EGNA 1VE7A 1USWA 1QOZA 4L9AA 2WHQA 3F97A 5AKYA 1CEXA 4AN1A 2VQ6A 3OM8A 1MN6A 4OB8A 3C6ZA 2DR0A 2WJ6A 4IHAA 2WTMA 2OQIA 3CXUA 2WUFA 4UBMA 2DCMA 3QYJA 4Y2SA 3GZJA 3C6BA 3VJKA 2Y6VA 5AI5A 1QIMA 4S0XA 5YASA 1QTIA 2B61A 2OXEA 1UOPA 4L3WA 3RARA 3G8YA 1IMJA 4EB0A 5ALGA 4CIBA 1YSCA 3AIMA 5ALTA 3D0KA 5JIBA 1WM1A 5AP9A 2WFMA 1BCRA 1F6WA 1QIEA 2Z5GA 3SC2A 3A2NA 1YB7A 3C8HA 1MT3A 2XUHA 5E4JA 1R9NA 3HLKA 4LXIA 2XLBA 4QLAA 2XQFA 3TJMA 2UZ0A 4DIUA 5LKRA 2I78A 4IO0A 4X6YA 2GBIA 2DQZA 3DCNA 3MGAA 5JALA 3KSRA 3H1AA 4Q3OA 1DTEA 4XIIA 2HA0A 1AQLA 3O9VA 4AX4A 2YYSA 4AXBA 3A2LA 1U2EA 2WU4A 3HEAA 3KD2A 3QPDA 5SYNA 5I8PA 4B0OA 3AUKA 4GHWA 5BOVA 3R3YA 3ESAA 3FSGA 3NGMA 1ZD4A 2OG1A 3AFIA 2VA9A 2JGMA 3SK0A 4H7FA 1W6RA 5HKAA 2OLEA 4PQEA 4I19A 4RNCA 2IX9A 1XKLA 3PFCA 4JYPA 2JF0A 2XUGA 4JEIA 4AMZA 4X71A 5ALPA 1D07A 3LP5A 1JKMA 2ZJFA 4KACA 2JBWA 1X70A 5ALHA 3W9UA 3FCXA 5CXUA 3JWEA 4P08A 3A70A 5ALLA 1QJ4A 3G0CA 3STVA 2CMFA 4FTWA 1ZGCA 4MWTA 4A23A 4BVJA 1AX9A 1IVYA 2DFPA 3FSGD 2V9ZA 3D2AA 5H3HA 3WK5A 1AZWA 3WA6A 2BUBA 1EK2A 1H2XA 2XUAA 3D3NA 3DQZA 1DQYA 4KE6A 4BCCA 4OB6A 4FMPA 2GZRA 5CTAA 5AK4A 5A7FA 1W52X 4NS4A 1QZ3A 5DYTA 1WPRA 1ZI9A 1ZIXA 1ZJ4A 3FYTA 1C7IA 1ODTC 1EXWA 3O4GA 4A5SA 3M3DA 4GXNA 3WWDA 3MVEA 4WFKA 3L1IA 3G9XA 1CRLA 3VJLA 5HF8A 3WIOA 4H0CA 3F67A 3S2ZA 3DOHA 2VJAA 3GA7A 2PU7A 4Y7DA 4UPDA 2XUQA 4J7AA 1YASA 3G9TA 2H7XA 5ISMA 4DGQA 2DQYA 2ZSHA 4FNMA 1RWQA 4CCYA 2XB6A 3HYSA 3H2KA 1P0MA 2OAEA 4CG2A 5JZBA 2CEKA 1LPOA 4B82A 3EQ7A 3WKCA 2PPLA 1BCSA 1CUXA 1TQHA 3N0TA 4U2BA 3STYA 2WQZA 5C7YA 4QE3A 1XZHA 2XQKA 1WB6A 2X76A 2JGIA 5AHXA 1SCKA 1XLWA 5E4YA 4ZI5A 4UBLA 4MXDA 3LLCA 1OILA 1XZCA 3ILSA 2OPHA 4LXHA 2OCLA 4H7KA 1BROA 5K3FB 3BDIA 2XDWA 2GBFA 5LZ9A 4OD0A 3I2KA 3D4LA 3E1GA 2VSQA 5ALQA 3WWPA 2J4FA 2O2IA 1QONA 2OGSA 3KWFA 1XRQA 2XI4A 2QJWA 3CN9A 3F8SA 1O6GA 4XJVA 3U0VA 4OCZA 3TEJA 4FLFA 4BDTA 1E8DA 1C4XA 1Q83A 1WB4A 5IKXA 5AIBA 1YS2X 5AOCA 1GPKA 1LBTA 1N8SA 3ZI7A 4QLOA 4B80A 4BYMA 1JMKC 5BWBA 1OCEA 2WG0A 1DT5A 2QKYA 4FBLA 5HKBA 5HF5A 3WK8A 1ZIYA 4UBIA 4X90A 2NW6A 1H2ZA 3C70A 3WL6A 2G63A 4DNOA 5D7BA 4B85A 3WKDA 4N8EA 1Y7IA 2QVBA 1J1IA 2HHAA 3B3QA 1MTZA 3PF8A 1UKBA 3I6YA 3C8DA 5K3FA 1ZD3A 3STXA 3ZLVA 2D5LA 3BXPA 4FBMA 3OURA 3QMVA 4G1FA 1AC5A 4KE9A 2JEYA 4UUQA 1YCDA 3VVMA 2HU7A 3OG9A 3VKFA 1DWQA 4X92A 4B9EA 5HK8A 1UOQA 4BVLA 1A8SA 3FYUB 3I28A 2EEPA 1ETHA 3HRHA 1AURA 1XLVA 1BN6A 1A8QA 3I1IA 4CG3A 4J0JA 1XLUA 3QITA 4L72A 3AJAA 2D0DA 2WUGA 3WLAA 2BUCA 2BKLA 4BRZA 4FNGA 1P0IA 4LIPD 1XZGA 1FFCA 4M0MA 3O4HA 4FLMA 3WWEA 4AMYA 3B5EA 5AJHA 1RP1A 2AJCA 4NZZA 5FUMA 3I1YA 4UHDA 1H23A 3B12A 1Y7HA 3F98A 1ZGBA 4PSDA 2RAUA 2VAXA 5ALVA 5K3EA 1QIGA 3I6MA 5I7UA 3PICA 4QDZA 4BE4A 4XWGA 1F0PA 3BJMA 2JGJA 5HK9A 3V48A 3TGLA 1THTA 4AZ0A 3OTQA 2ZVDA 3FNBA 1EVEA 5EIEA 2O2GA 5AKKA 1XRLA 2QM0A 1EB8A 2VATA 3ICVA 1L7AA 4HXFB 1CUSA 4KAAA 3O95A 1W75A 5FRDA 2XUOA 1E66A 2I3ZA 2WFLB 2XMSA 4J0HA 4BATA 4GDMA 4F5ZA 1ZD2P 5CXXA 1J07A 4GEGA 3I2IA 4AB1A 3IULA 3JW8A 1CUGA 3DNMA 5CW2A 5ALMA 3QH4A 2AJ8A 3NOXA 5C8ZA 2X5XA 3PUHA 4CIAA 4IQ4A 5IVDA 1XRMA 1ZD5A 4BC0A 3R0VA 1MX5A 2WUEA 3U1TA 5D3ZA 3FBWA 3C45A 2C5FA 2CUTA 3FWHA 4UHCA 3ZV7A 4DTCA 1IZ8A 2PX6A 4B84A 2QOEA 5LYYA 3UMJA 4EY4A 4FOLA 1VXRA 3V1KA 3TRDA 4GLBA 5JANA 3WWCA 3V1NA 2OAGA 4ITVA 2ZJ7A 5JARA 4B83A 4PW0A 5ALIA 3IB3A 5AICA 4C89A 3ZWQA 2J3QA 1ACLA 3IDAA 3IURA 5D6OA 3P2MA 3FYUA 2C58A 1CV2A 4U2CA 4DMHA 2BGRA 5K3DA 4QDOA 2RHTA 2OGZA 2CZQA 4YASA 5JAUA 5ALSA 1F8UA 3GROA 2XUFA 5FLKA 3EF3A 5IH7A 4Y2JA 5EHNA 3G7NA 4LYEA 4BTLA 4UBNA 2Y1KA 1G5FA 3OC0A 4DYHA 4OYYA 2WIGA 5JZ9A 1MAHA 1A88A 5ESRA 1QFMA 1LGYA 3NWOA 3H0CA 5ALEA 3DLTA 1IZ7A 3WKBA 1MNQA 5DNVA 4C6HA 2GYVA 4N8DA 4E15A 4N5HX 5CT6A 4QA9A 4AO8A 4G8BA 3E4DA 4F0JA 2WKWA 1DU4A 1CUAA 3CN7A 3GELA 2C0QA 4A16A 3H2HA 3STWA 1CUVA 1TIBA 4QWWA 1XZBA 3G0DA 1ORWA 2PBLA 2C0PA 4KAJA 4WJLA 1L7QA 1XZKA 2W22A 2WHPB 5EI5A 1MPXA 4ZXFA 5AKHA 1CLEA 1A8UA 1FFAA 1GQSA 1VA5A 3ESCA 1P0PA 2PSFA 4NVRA 5A6VA 2GYUA 4E46A 1UWCA 1JU4A 1VA4A 1KU6A 3HACA 4KE7A 1JU3A 3IUQA 4OU5A 4I4CA 2PUJA 3CCCA 4EY7A 2J4CA 1CUEA 2FJPA 2WM2A 2ROQA 1AKNA 1Q0RA 3ANSA 4IH9A 3O9MA 3R3UA 4WDRA 3PDCA 2GZSA 3G9ZA 3HC7A 1CUWA 4J0CA 3W06A 1MO2A 2JGKA 2C4HA 1E5TA 1RYYA 5DNWA 4GI1A 4HRXA 2CKMA 4Q3LA 3DYVA 3DKRA 2WHPA 2BGNA 4HZGA 1PV1A 4WFJA 4X91A 4BC1A 2ZYHA 2JGEA 4G9EA 4ZRDA 1Q0ZA 1LLFA 1GT6A 4C4YA 4OUKX 3HSSA 1DQZA 1QO9A 4PNZA 5CH8A 2WG2A 3STUA 5CURA 3NUZA 4BVKA 5ALKA 3RKSA 4C87A 2HU8A 2VEOA 5A2GA 1UXOA 5K3BA 4P93A 4W9RA 4DNQA 1L7RA 4Q82A 1BRTA 2Y2VA 5DLPA 5AI6A 5CT8A 1CUCA 5K3CA 1UFOA 3C87A 1FJ2A 1UOOA 4UBKA 5LKAA 2OCGA 3EQ8A 3E3AA 1XZIA 5T4HA 5HFAA 1THGA 3K9BA 4J0IA 5AKLA 2XUJA 1NU8A 4CG1A 4FHZA 4K6HA 4EUSA 1T2NA 5CH3A 3O4IA 2B20A 3WJ1A 1VE6A 4Y2PA 3BE8A 4OU4A 4W1PA 5T4EA 1BU8A 3EIOA 4OB7A 5T4FA 2HDWA 1EI9A 5IVIA 1XZMA 3KXPA 2EDAA 3BL8A 1AGYA 4B9AA 1CQWA 3ESDA 2AJBA 2E3JA 3D2CA 4OPMA 4ZWNA 5DNUA 2WLSA 2WSLA 3JYHA 2JIDA 1UT6A 3R41A 5ALWA 2WFLA 4RE5A 4IH4A 2XMRA 4ETWA 1BEZA 3AZQA 4C4ZA 1XKTA 3WL7A 2WU3A 4ROTA 1CUUA 1EDDA 4KYVA 1Z68A 1EB9A 1FFDA 3R3VA 1LPBB 5LZ2A 1GZ7A 2RHWA 5FV4A 3H04A 4G5XA 4TGLA 4BP8A 2VF2A 1J06A 1W76A 3R40A 1ISPA 4FDMA 3WK4A 5LIPA 5FKJA 3LIPA 4M0FA 4IH1A 1CR6A 2FX5A 5E4TA 1NU6A 4J3JA 2QXTA 4Q34A 2ONCA 2R8BA 1UK7A 3WQHA 3BIWA 1H2YA 2I3DA 2QUBA 1QIJA 4MYDA 4G9GA 3IUJA 2QJRA 3T4UA 2WTNA 2ACKA 4QWMA 3UUEA 2JGLA 1G66A 1F0NA 1QFSA 3C6XA 2AJDA 1VZ3A 4DMFA 4K5QA 4BTVA 1Q84A 4UBJA 1JFRA 4HAIA 2QUAA 2XMGA 3I2FA 5AI9A 4U2DA 1LNSA 4X3CA 1BS9A 4HXGA 2QZPA 1QIKA 3DJYA 1K4YA 2ECFA 2K2QB 3DKKA 4H7HA 4G8DA 4N5IX 5ALUA 1O6FA 2VT6A 3Q8WA 4OSEA 1U65A 4MWSA 5AM5A 1YA8A 4MQLA 5JAHA 1HL7A 4BAGA 4AN0A 3W9BA 2VAVA 4WCVA 1S8OA 3ED1A 4FKBA 3LIIA 1R50A 4BP9A 1BE0A 1ZI8A 1PFQA 5C8XA 4AO7A 4BAUA 3AIKA 1LZLA 3OOSA 1VKHA 5EFZA 2J3DA 3BIXA 2WJ4A 4DMCA 3IIIA 5LZ5A 1XRPA 3D59A 2IIVA 5SYMA 3GBSA 3R3ZA 4PO3X 4TVKA 5AK3A 4CCYB 1TCCA 3WYDA 4BBZA 4YX9A 4X85A 4J03A 4GWLA 4BE9A 4EA6A 4W1SA 2C5GA 3WKAA 1QO7A 2ORYA 1XZJA 3DL7A 3HZOA 2PSJA 1DT3A 3D2BA 1LZKA 1QIFA 1GGVA 3H1BA 3AILA 1SC9A 5DJ5A 4H7DA 3KOOA 3G9UA 5ALJA 4MQMA 4FFWA 4ZREA 5LZ4A 3FVRA 2ZYIA 1HKHA 1TRHA 4HTAA 1UK8A 4Y2QA 1GXSA 4DNPA 1G42A 3AIOA 4ZGBA 1LPNA 5EHZA 4AO6A 4O08A 1VZ2A 1EINA 2Y2UA 4UFOA 2O7VA 2PSHA 1MU0A 5AK5A 1EDBA 5K3AA 1U4NA 2VJBA 2WIDA 1UZAA 4AQDA 2P8SA 3L1JA 4UFPA 5HZGA 2PSEA 5AO9A 3PI6A 5AOAA 2BCEA 5JD4A 1EA5A 5AM4A 2G5TA 1K63A 1ZICA 1ACJA 4XVCA 3F96A 2GYWA 2HADA 5DYWA 5AM3A 1XRRA 3M83A 5AH0A 1G4HA 2OCIA 4P9NA 1N5RA 3WK6A 4UHEA 4LHEA 4ARBA 1OXMA 4J0DA 4C4XA 3BDVA 1TCAA 1LPSA 3QPAA 4K2AA 3IBTA 4MJ3A 4U2EA 2W6CX 3GFFA 3O0DA 5ALYA 5K5EA 1GQRA 3LCRA 4GW3A 4G4GA 3SX4A 5D3KA 3M81A 3QMWA 1WB5A 4UFNA 2X8BA 1QE3A 4X6UA 2OCKA 4F60A 4Y2TA 4Y2XA 3D5EA 1FFBA 2QMQA 5A7GA 2PSDA 4EY8A 3C6YA 5HQ3A 4W1QA 1VLQA 2R11A 1K5PA 2O2HA 3VISA 3A6ZA 4B0PA 4Y2VA 4H7IA 1WCYA 2CB9A 5AKXA 3H17A 3WL8A 5AK6A 2QXUA 2JEZA 2GBGA 4UHHA 4C01A 3QVMA 3WWOA 3H2IA 3S8YA 2RONA 4E14A 5CBKA 3FCYA 4RGYA 1VJ5A 2BJHA 4BZWA 1CPYA 5JD6A 2G5PA 2HA7A 3K2IA 2PKYX 5AKGA 2LIPA 5AKEA 5LZ7A 5DYYA 1H22A 4JYMA 3WZMA 4K6KA 3KDAA 4WY5A 1KU0A 2XMBA 1QIHA 3G0GA 5T4BA 1XZAA 4I3FA 4D9JA 4LYDA 3FAKA 3ZLTA 2I03A 2YH2A 2OGTA 2Z8ZA 3RLIA 1XFDA 1R88A 1SCIA 5CRIA 1XZDA 1CUZA 2XUPA 2RGUA 3PE6A 1EDEA 4X94A 4ZV9A 2OQVA 4PSCA 3IUNA 4EHBA 4GECA 3WMRA 2HL6A 1CUBA 3BF7A 1QLWA 4U2GA 2XMDA 2HFKA 4QDXA 1EVQA 1C7JA 2XQJA 4QDTA 4Y2UA 4JUIA 3BJRA 2DSNA 4W63A 1XRNA 3PFBA 2HIHA 2B4KA 3ZLUA 4MEBA 3ZPXA 4G4IA 4H77A 3HABA 1M33A 2G4LA 1YAJA 2WILA 3CCBA 4DMKA 1T4MA 2PM8A 1H2WA 3MUOA 3IVMA 1JJFA 4M0EA 4EY5A 3AZPA 1XQVA 3RM3A 2WFZA 2Z3ZA 1TKRA 3R3XA 4WDQA 1GKLA 2Q0XA 3WL5A 3OPMA 3H2GA 2WUDA 3WA7A 1W4LA 2V96A 3W04A 2XMCA 3WI7A 1X2BA 4J0KA 4UHBA 1XZEA 1YR2A 2HA5A 2VJCA 4BZZA 4DM7A 4XX1A 5JZSA 5HF6A 2Z8XA 3G02A 3RK4A 3GUUA 1DX6A 3HXKA 4DSAA 1XQWA 5HF9A 4H7EA 3PF9A 3MUNA 2WIJA 3C43A 5AM2A 4H35A 1YAHA 2ZSIA 4HXEB 2HU5A 1BN7A 2QT9A 1ODSA 5CT4A 1SFRA 3DD5A 2IITA 3C5VA 2HRRA 3M82A 1DWPA 4HRYA 4H18A 4QEKA 4F21A 5JAPA 3FLEA 2B9VA 4LXGA 3FVTA 5ALOA 2QRUA 4AZ3A 5JADA 3I6ZA 3H2JA 3N2ZB 4EBBA 2XUKA 1K8QA 3VXKA 1WPXA 3LS2A 1IUNA 4FWBA 1CUJA 4B7ZA 1XROA 1HQDA 1LPMA 4U2FA 3VJMA 2BUAA 4FLEA 1AMNA 5F4ZA 1CUYA 1WHSA 4KAFA 4DNFA 4W1RA 6YASA 5EHQA 4MEAA 4J0GA 4ARAA 1CUHA 2RIPA 4B81A 5AI4A 1HBJA 3AZOA 5AKIA 2QR5A 4Y9SA 1QIIA 1E8NA 1ODCA 1QIDA 5JATA 4BRSA 5DTJA 4K6GA 1ZI6A 3ESBA 4PF1A 4Y2YA 1IUOA 1FSSA 7YASA 4QNNA 3R3WA 3BWXA 4BB0A
chains in the Genus database with same CATH superfamily
4G37A 3CLHA 3T1OA 3OWOA 5JCJA 4ASUD 4MINA 3KJZA 3RHTA 1EK1A 1K7YA 1NBIA 3SR3A 2IXDA 5KTPA 3RFVA 1Z5WA 4R2HA 2AV6A 5K0GA 4W5RA 1WA5A 2KI5A 4XX0B 3T9CA 5J1TB 2Q07A 4YMTA 1W0JD 5C32A 3ILXA 2DP4E 2UVDA 3K1JA 3CURA 1VYTA 3F71A 3RS8A 4M76B 3AHDA 3QEKA 3WK9A 5PNTA 2JFYA 4MWZA 3WMGA 3OD1A 1F20A 1G1MA 5TB5A 3O73A 1FQKA 4MVJE 3VPAA 1PT5A 1J7JA 4B31A 4P3KA 5JTUA 1G63A 3TS1A 3CH6A 3LJKA 1DIBA 1T4DA 3VU1A 1UT8A 5CXQA 1DDIA 1MQAA 4IWXA 4S0ZA 4UOQA 1GTZA 4B6PA 1EP1B 4YTEA 4TL6A 1TW2A 5EIHA 3VNBA 4B3FX 1E0JA 1R4NB 1KHHA 3ANTA 1P2TA 2EIHA 2PMKA 4UW9A 2HIMA 3RQSA 4BVEA 3GYBA 4X45A 1CTQA 1AQNA 4PZDA 3H5VA 3KT3A 3KAQA 4FI3F 3N2YA 1U1EA 4HPWA 1PTKA 4KQIA 3PYXA 4UUAA 5HIJA 1SQGA 1Y9JA 4QU5A 1F6BA 5F7ZA 4WESB 4DXDA 2YINC 2WSMA 2Y6UA 3L8HA 4RHUA 1VHDA 4JLNA 4QHSA 4IXTA 1PAUA 2YWXA 1WABA 3QSYA 1VJRA 1JWBB 2BM9A 2OXIA 3AY6A 1C29B 1WKBA 4Q4CA 4CKZA 4E1VA 4NNOA 4RWEA 3TMYA 2EBHX 1PW5A 2PKXA 3AF6A 1DS6A 4NEQA 4F4UA 2LKCA 3EPRA 1NBHA 4BKOA 1ILWA 4OHUA 4GKAA 5JFOA 3EGIA 2Q3MA 5JI3E 5HQ3B 2FP3A 3VUEA 1BCRB 5IVHA 3W6OA 1XD9A 4Z4EA 4XQ9A 1SOMA 1C50A 5JNLA 2X6QA 3OSZA 5MF6A 5AJVB 2LD4A 2XIQA 3JQAB 3KEFA 3LSTA 5ENZA 4RTSA 3B2NA 4CKBA 1SKYE 4E7OA 5KEIA 1QV9A 2HRCA 2WYVA 3CH4B 1KEWA 4DHWA 3HNPA 4N8SA 4YV1A 2IUSA 2ECPA 3TKLA 3F6SA 4Y2RA 1WKCA 2AN9A 4DFDA 1W46A 1WXQA 1DJLA 2V74B 4DCCA 1K06A 3OIUA 2PNJA 2FRVA 2HDOA 3BFPA 3L0SA 1YUNA 3LDHA 2XYGA 3BCUA 3L0OA 1UOEA 1LBSA 2H9IA 2ZSBA 2FZVA 1LB1B 2ZWOA 2IUEA 3OZGA 3MAJA 4K2HA 1L5KA 3VDRA 2W6JA 4KMOA 4LXYA 3RANA 3PD0A 1KMHB 3ZK9A 5LQAA 4QGAA 3CLRC 2PUHA 2HA3A 3OLYA 3PEWA 3KJIA 4YA6A 5FTKA 3DW1X 1RQLA 4MV8A 1NLZA 2YWHA 2J0EA 1TGVA 3HCNA 1W0CA 4HLUA 1OH8A 3L8YA 5TC4A 2AI1A 4TXMA 3EWSA 3MF4A 3T5CA 4TTIA 4PFQA 3QZUA 4DG5A 5JAZA 3LHIA 1B42A 1JMYA 2DB3A 5DWDA 2QRVB 4JK3A 2LE0A 1NI3A 3RYHA 1XVLA 2XE7A 2EWVA 4NU5A 1D6NA 2J6HA 2HRQA 3A4VA 1KJNA 4JGIA 1AD2A 4ND7A 3VZSA 4EPVA 2GBPA 4MGZR 3IEIA 3HO6A 3II6X 4FSDA 4QDUA 5I7WA 1PJZA 2AL7A 4HS9A 5EG5A 5GAJA 1QRAA 1JT2A 2F43B 4BX3A 3BWVA 5E3HA 1KVTA 3LDFA 3OC6A 2XUDA 3QENA 4P92A 5E6UB 4IIJA 3VHQA 3BC1A 1XZFA 1LPAB 4Y0NA 1Z75A 3WGZA 3D8SA 1J09A 1PT6A 2XKAA 3FDZA 4IF6A 4HTFA 5TGTA 3IMFA 3OQPA 4DCJA 2PX8A 3UHOA 5P21A 3DZCA 1O95C 2HM7A 3C7KA 3PV0A 1XLTA 3MCWA 3ZJ5A 1B8UA 1GHTA 1NE2A 4BBJA 3D4BA 3L1HA 5GIOE 3N70A 1EK6A 1USGA 3LECA 1OKKA 4YRLA 2NXJA 4JP3A 4LE1A 4E5PA 1A77A 1KPGA 2Y0DA 4TWZA 2CJWB 1OYVA 4NMWA 2XNJA 1WMBA 3IDOA 3ACBA 2HNKA 4FD3A 1FJHA 2H7YA 4YJ2B 3V7YA 1LVGA 4JNCA 4BKRA 5JJ5A 1FVHA 2IP1A 5A9SA 5HNKA 1Y1RA 4TYQA 3T52A 2QS9A 3FZGA 2BM1A 3LT2A 2I6QA 4L5YA 2VT2A 2MYPA 2PH3A 4K3UA 4J76A 2G06A 4KL8S 4MGIR 4O4LF 4UMFA 3E9RA 5CT9A 5CCEA 5BW6B 3RH0A 1ID8A 1IK6A 1XXLA 1C8BA 1MOPA 3C3XA 1AZSC 2H8KA 3MCZA 1YA4A 4J07A 4GZMA 4ZVTA 4G2TA 1A8HA 2UZ4A 1ZK4A 2G76A 2GJ4A 4R2KA 1SD5A 3GGSA 1GPNA 5IW8A 4CWAA 3G0BA 3W05A 1EM8B 3BREA 4AIIA 1OH5A 3B60A 1UFRA 4RVOA 1N2CE 2FUEA 5ADWA 3Q0TA 1QSGA 3ZHQA 1YI1A 2W8ZA 1KY5A 4QVGA 1QCDA 4RCYA 4XCXA 4Z4GA 5E9WA 4XWOA 3L0DA 1PT8A 1WP4A 4OHPA 3R0QA 2O20A 4YJKA 3HDVA 4YN3A 5LLSA 4B3GA 1R64A 3PUVA 4I50A 4X6LA 5CNJA 1XUOA 3WLNA 5AM1A 3LE8A 5E2IA 4G2NA 1E32A 1WSWA 3PJEA 4PC2A 4WNAA 4F45A 1P0QA 4D25A 4HAZA 1H4VB 2IYZA 4MW2A 1MHTA 3E9ZA 2HFJA 3J80A 4MVJG 4WXEA 1Y5IA 1WV0A 4URVR 3R7AA 5AVXA 1TZBA 2PPVA 1PYDA 1X8XA 4LA4A 1IUPA 3P5BA 5LUBA 3V8VA 1GKKA 4EJMA 4TKZA 1P7YA 1PTJA 4KMMA 3QUSA 3V1MA 2B4RO 4NEHB 1BJKA 2H2WA 2ON6A 1ZSNA 3FETA 4MP6A 2IBSA 1EVJA 3AR8A 1N8KA 4MMYB 2YXPX 4DWWA 4EPTA 5LQDA 4EHHA 2VPZA 5F77A 4I9FA 2PIAA 3JYQA 1H2BA 3WRXC 3JAWA 1ISRA 4HYQA 4PVCA 2O3SA 1B74A 3OP1A 4DNXA 2RJOA 2RAVA 3L7KA 4TKVB 4I1PA 1PWHA 3FLBA 4P83A 3I37X 3TYXA 2FR8A 1O9HA 1R15A 4EB6B 1O87A 1ZO8A 1E7SA 1U3TA 1SXIA 3PUJA 4INZA 4WADA 3D6HA 5FNVA 6REQB 1LPPA 2F8SA 1VECA 4GMHA 1SBYA 4PQGA 1J90A 3NB0A 4DJ5X 3GZNA 4BO4A 2K2WA 2MSEB 5DU2A 4ZAYA 3WGHA 1BVUA 5KKNB 2CNOA 4YP1A 3TRIA 2DXIA 4QTUB 1J5EB 3W2TA 5FD8A 1DAGA 4KXQA 1ADGA 3GGPA 1PFUA 3QWHA 2ECOA 2OQ2A 4JLWA 4M9QA 5KJFA 1VYHA 2F3UA 3KO8A 2PVCA 2RH9B 4U6QA 5BY2A 1GOTA 1T8UA 5G4KB 2FU5C 2V4MA 5HE9A 3KWMA 4G25A 5JSYA 1NVUQ 2Z09A 3HA5A 4DDKA 2PQMA 3LUPA 1RFLA 1SKYB 1KAQA 4UEWA 4RK5A 1UDWA 1NXVA 4JC4A 1SQFA 5GJVC 4BV2A 1ZKDA 1R4MB 2W2LA 3D8HA 3IUSA 4G5GA 4LKOA 4URUR 5FHQA 2ERXA 2REOA 4ESOA 5D85A 4DYDA 2Q3CA 1UCFA 4Q37A 1REQA 2QZSA 1TUBA 1QV7A 1JA0A 4YV2A 4AC9A 3W1EA 1J8QA 4MIYA 1ZW6A 1GCIA 1KDVA 2IHBA 2FPKA 1PG0A 4RENA 4PSUA 3S70A 1D6JA 1IOZA 2YASA 5L53A 2EFJA 3QVSA 1B73A 3DE5X 1KAMA 1BHSA 1KVSA 3R3SA 4IIBA 1I5EA 1JQBA 1JW9B 1MVOA 4JITA 1N2CA 2BI7A 2X6RA 2GVZC 1SCQA 4RSMA 4FE7A 1NX6A 1RBMA 5H70A 4D98A 4LAFA 4F9GA 5B3KA 2R6JA 1E1DA 1N6LA 2CDBA 2W6OA 4QO7A 3RAJA 3PZBA 2R6AA 1T4CA 1E3MA 3FWKA 4LZOA 1ZUIA 1G5QA 2GI4A 4KN8A 4WRRA 4JYCA 4XJSA 1JHMA 1QHFA 1GCAA 3VGJA 4EHIA 4GR5A 3HPQA 4JXZA 4HY3A 4RK6A 5ITWA 3LKVA 1KYYA 3GCXA 3RRNA 2FUKA 5IPFA 2G7ZA 2LDBA 1JE1A 2DZDA 1XJ5A 4AYWA 1IIRA 3IRUA 3TAXA 4M1YA 3RYFB 1JR3A 4L0MA 1U4OA 2PV0A 3FN4A 4R81A 2VDWB 4EG7A 4PCVA 1P7CA 3K32A 1WDKA 3KYJB 5CX1B 1CJVC 2XWJI 3BE6A 1KTVA 1ZA2A 3K9QO 1ZCBA 4NABA 1DOHA 1U9JA 1F4VA 2HA4A 4OF4A 3R7LA 5C1OA 1F0KA 4YJ3A 4AJKA 3VKGA 1TK3A 4P0PB 4GP9A 2H2GA 3WVNA 1II8A 3ZDRA 1CLUA 1LW6E 1EFDN 2XA1A 3D64A 1Z28A 3LL7A 2Z6UA 5K8IA 3PQ3A 3D7RA 1P4RA 2F4VB 2HD4A 4F72A 5BORA 1NQUA 2TRSB 2DE0X 3BHJA 3M9XA 1D6MA 2DPHA 4R83A 1XWIA 1Q0TA 1OREA 1VSTA 5KIAA 4BE7B 1M6HA 1I9GA 3ULKA 4R0NA 2IQIA 2V55B 2EG5A 5KWJA 3BMXA 3I2YX 3OF2A 4GI5A 5KDDA 1PUJA 3PYMA 3F9CA 1H93A 1KMQA 3N8GA 2I8LA 3Q87B 4S2EA 2Y9MB 4YT4A 4QUKA 2EP8A 1BE6A 2OSVA 3E0XA 4IJUA 1WZNA 2IEDA 4IVNA 3W5CA 1HLGA 3GPBA 4HDNB 2XUIA 2A84A 3SYKA 4F38A 1JXMA 4TKLA 3WIBA 3WBKA 4FDTA 1JB1A 4XPIA 3W06A 5JC1A 4YP5A 2P6PA 1U99A 2F3SA 4YUXA 1DINA 4DZRA 1DBVO 4UM7A 1YJAA 2VSOA 1GDHA 1C9JA 3HBJA 1OBHA 2ZT8A 3ZIDA 4LHVA 4LBWA 3IVAA 1KKLA 1EFLA 4C0KA 2Z1MA 4IJWA 4TWJA 2Q4BA 2Y1GA 3GLHB 2XT0A 4QICA 2R68A 4M1SA 5IAEA 3V2HA 5A9SB 5MHTA 4IOJA 4KXXA 4FW8A 1NAHA 2CSUA 1CUFA 2J3IA 4GC5A 4YT5A 3UUFA 1Q7TA 1I7PA 4JIGA 4H6WA 1RAHA 2R85A 1NNEA 1T5BA 1HFJA 1ECCA 1KH1A 2XB4A 2CHUA 3EJWA 3E82A 4YCBA 3V4SA 4C14A 1DSSG 1KYTA 1S7GA 5B4TA 2IQ5A 2WDPA 1UBLS 5FUVA 1M66A 5AVTA 5JDIC 3TIVA 2YHBA 1CFZA 4CM1A 5FPPA 2UZAA 2Q3FA 3CRZA 4X7BA 2ADMA 1MNAA 5SZJA 1PWEA 2JZOA 5D5PA 5JLAA 4HVLA 5C51B 3DHEA 3JAMA 3LPLA 2DH6A 1RRCA 1LX7A 1GL7A 4Z49A 5JH7B 1Y8ZA 3VAYA 1C1XA 1DG1G 2VYNA 1PSZA 4RVGA 2WNSA 4V2IA 3U1VA 4EFKA 3UJCA 2HEIA 1XNRB 1QMPA 4PFKA 3X0DA 3IIMA 1USWA 1XC7A 2WC1A 5CVVA 1LFAA 1QOZA 1Q7EA 1UJNA 5BOSB 4CEJA 2GBLA 3F97A 4NCIA 1KWGA 4ITRC 3OE7A 2FG7C 3JAKA 5FUYA 4QLBA 4YLYA 3INGA 4P22A 3QHQA 1XP8A 3OM8A 4PAQA 5EZQA 4MQEB 4XKJA 4CV0A 4AUEA 1RXCA 5M04A 4HFRA 3GLUA 2VRCA 1B0ZA 4EG4A 3PIIA 1NXSA 5U1PA 2NZYA 1I2ZA 3N59A 3AXTA 5FYDA 4LVCA 2P9ZA 4OATA 3N0XA 2AHRA 3VNUA 1OXXK 1CR2A 3RTGA 5KNCD 4OFXA 2WE8A 4MKGA 4ZO9A 4IQ0A 5DRTA 4ZZ2A 4HBGA 2J0VA 1E1KA 3GZJA 4Q18A 3UKDA 3U4AA 3ORQA 2DWUA 3PC3A 4C4TA 5AI5A 2WAOA 1QIMA 4BL5A 3D7SA 5B30A 2QYHA 1SKBA 4B8YA 4TMTA 2WW8A 1IVSA 4Y6RA 4L3WA 3G88A 3DTVA 4HWKA 5BQFA 1VKOA 2J4DA 1DXHA 4RAOA 2YN4A 2ZCUA 3ML1A 4IJQA 2G1KA 2CW5A 1QK4A 1O97D 5EAIA 4EB0A 4RTOA 3QKRB 1Y81A 5IP5A 2CL7X 1UPXA 1T3HA 2HWUA 3IPRA 1EVLA 3D0KA 4I8DA 4UULA 5TQ2A 4DQUA 4ZI2A 1W4AA 2V58A 1T43A 1WM1A 3OHSX 3OLWA 1KDYA 2YS6A 1KDRA 2WFMA 1BCRA 5BSTA 3TZEA 2Z5GA 3GLQA 2YWGA 2NSYA 4YNBA 2QUJA 1ZH0A 1N0HA 3GFGA 3N8HA 1E96A 3PQDA 1P2SA 3A2NA 4LOAA 2REQB 2AOVA 4GGOA 4D8VA 1BQEA 2CYAA 1OHHD 1HDGO 3D54D 4OKSA 1KO5A 5C5EA 1P45A 1YIOA 3KKPA 3I73A 3C8HA 3OIVA 4JI5B 4TV9A 1D04A 3R7FA 1HDRA 1N5LA 2XUHA 4HNTA 1D0VA 3TPCA 3UCXA 2GEDA 1A3CA 2IEBA 2NSJA 2YZGA 3AR9A 1M7GA 2YJ6A 3LY8A 2LCQA 3QE2A 4URXR 4I5DA 3OO0A 1T1RA 3BRCA 3JQCA 3HA3A 3KSRA 4YMUA 3N8DA 3GJ5A 1I14A 2D0IA 1CS4C 3H1AA 3M9LA 4QPZA 2AK2A 1DTEA 3AW8A 4XIIA 1MVLA 1AQLA 1M72A 4MIOA 3S1AA 3MJCA 4WN3A 4DLZA 3PGKA 1HE1C 2WU4A 5BNTA 2OORC 1B8OA 2R4UA 1QDUA 4JSYA 3QPDA 2NPFA 2F8TA 5I7HA 3JRXA 4PZYA 4J16A 4MJ7A 2PZ8A 2IHKA 3MLAA 3G6KA 1M2KA 3M1AA 4EZEA 2QXYA 2I2FA 3L18A 1KIMA 3ESAA 3CV3A 2WT4A 3A05A 3PNPA 2EW2A 3RRMA 4GICA 1VLJA 1QTNA 2XT9A 1W0JA 1A72A 1YJ5A 2INGX 2OG1A 1EFRD 1S3FA 4QUGA 5IF3A 3EVBA 3IPYA 3TBFA 1E79A 3CUYA 4I1SA 1Y82A 3A28A 5B1DA 3B8EA 4KXYA 1HXHA 3BB1A 5HKAA 3B6ZA 3H4TA 1GZVA 3ED5A 4IFEA 4LOJA 1RI5A 4R9RA 4M87A 3PFCA 4UHKA 1GU1A 1U63A 2BGTA 2JF0A 4JC8A 4D4HA 1A1SA 1YS6A 3P26A 1EX1A 1IZYA 4MYHA 4ZYYA 1HE3A 1GSOA 1OAOC 2AJTA 2GD6A 2ONZA 4PNPA 4ZV4A 4JMLA 1GPUA 4G1EB 5ALPA 1GNLA 1DELA 4Z9FA 3H5AA 4GWKA 3V00A 1GZHB 4BKMA 2ZJFA 2AOTB 1NNSA 2JBWA 2XEDA 2IOYA 4C1BA 3FCXA 3F3YA 1AF4A 3WLJA 3EFEA 3SOZA 1Z0JA 3A70A 5HVNA 3UAZA 4C7BA 2O8DB 3G0CA 3STVA 1E9VA 1QGUA 1PLLA 2CMFA 2GVDC 4B8WA 3O8LA 4FTWA 2OBBA 1MH9A 1XBTA 3K5WA 4FYWA 2RC6A 1QR6A 3R5SA 2I80A 1F1BA 1Z0SA 1ZJZA 4LNUB 2WD9A 1RYEA 4I4NA 2VF4X 3B6KA 3GWGA 4Q1CA 4X24A 4DSTA 2IUFA 4BFSA 2TMKA 4DC0A 5HCNA 1J39A 2I4TA 3ORFA 4LJLA 3ZIUA 3AFOA 1EK2A 1R6VA 4RV9A 3T3NA 1YZHA 4QUEA 3R0IA 4GI2A 1OOEA 3A9RA 1NPYA 1R0CA 4GMDA 4KE6A 3VZRA 3GRUA 4IKPA 4XUDA 3THXB 3DKVA 2FRDA 4Y0VA 2GZRA 4Q9NA 5CTAA 5EHGA 3OIWA 3G3EA 3RBVA 3SY8A 5JS1A 5EP2A 3UHFA 1UWLA 4ISCA 2Z6VA 4M9CA 4NS4A 4PXYA 3GUYA 1QHNA 2P7HA 3Q7IA 5IG2A 2XCLA 5BT9A 3D0RA 5DYTA 2IHTA 4DG9A 5B7GA 3DVLA 3EZ2A 3DNPA 1SXGA 4IGKA 1ZI9A 2BI8A 3ND9A 1SVSA 2DWPA 3T15A 1R6AA 4URYR 1OYYA 2JGDA 1D2RA 4P3XA 1UC9A 3UG6A 1PSWA 3GW8A 4YJGB 3IILA 3C85A 2AR9A 4NE9A 2QN1A 2AFHA 4IYRA 4YS6A 3K0HA 3O4GA 1VRWA 2Q46A 2IV7A 3SSNA 4BNJA 4DMGA 1U9CA 3E4CA 5KJCA 1E77A 4BLQA 5CU7A 4ARUA 2FSPA 2ACWA 3JYPA 3MMZA 3ZVKA 3M70A 4KQ1A 3WWDA 1X39A 5EWLA 3RUAA 5AUOB 3KAPA 5A4DA 2X0EA 2RBKA 2C9ZA 1MJFA 3FCSB 3OE4A 1RE0A 3CLSD 3A26A 1LJUA 1ST2A 3T5GA 4YAGA 2IH5A 5IJ0A 2W42A 4DAEA 2CDNA 1G7RA 1XYYA 1DGQA 2G9ZA 1G3UA 4OQQA 5DCLA 3S2ZA 3DOHA 2VJAA 3PYLA 2C9OA 1TJ3A 5DI9A 1J70A 4OL9A 4U63A 5AJWA 3IELA 4LTDA 1RWPA 5E0KB 5HJ2A 3UYKA 1RMYA 2XUQA 4RW0A 2GCPA 1KXJA 4U6SA 1UBFA 3GHYA 5ISMA 2Y1WA 3V4PB 4DGQA 2JHCA 2Z9DA 2DQYA 2ZSHA 4GU5A 4DUGD 4ER7A 2XYHA 1S8NA 3L92A 4FNMA 4WHMA 3MT0A 4YCJA 4CCYA 2FRDC 2QL9A 5HM6A 5JQGA 1D0SA 2XB6A 3HYSA 1XPJA 1SCJA 3H2KA 3WQBA 1TE2A 1S6YA 1W25A 2OAEA 2Q0QA 1L7NA 3AWDA 3WGYA 3L07A 5JXHA 2ZS9A 3RK0A 3ADOA 3LO5A 1LPOA 4HWOA 2YVQA 1PQYA 1EBUA 2D5AA 4IDEA 7ADHA 1XCPA 1L9XA 4O2BA 4B40A 3GNLA 3EXHC 4LJAA 3EQ7A 2SKDA 2PPLA 3WKCA 1II0A 3R6DA 1BCSA 2VDRB 1QAQA 1DWUA 2QVCA 3AEQB 2RAFA 3B3JA 4DBVO 4CTMA 5BSWA 1OLSA 1XAGA 2DOKA 3RS9A 3LLVA 3T61A 1QKJA 3TQCA 3AKEA 4QE3A 3V6LA 2ZBEA 2H57A 4WBNF 4M7RA 2CD9A 3RLFA 4A6EA 4GVLA 2QTRA 4KGDA 4KI7A 4BQEA 5TPWB 1QBKC 3DA8A 4HQLA 3PX7A 3T0FA 4QGGA 2ZFUA 1QLJA 2QMYA 4J2OA 1XLWA 5AJYA 3DO8A 1S3IA 5AVZA 4ZI5A 2DT8A 4IMRA 3QLUC 4B46A 4BFYA 3B9PA 1D7OA 1C3VA 3D3JA 4UBLA 2PXAA 1JFSA 4YT8A 2I3AA 4LFAB 2O5VA 3PPWA 1FNBA 1L5YA 1XHEA 4KQGA 4HYTA 2ILVA 3LLCA 3DDCA 1OILA 3PNQA 4HEA1 4K0KB 2J9ZB 5FTLA 2AI3A 3AVQA 1ULHA 2QGNA 1NSFA 4HWPA 3I3SR 5EPOA 5FTNA 2RGNA 2P62A 2IEYA 2OPHA 4RPHA 1YR6A 4W5QA 1H5NA 4NCXA 1K0FA 2D1YA 3DMHA 3WNQA 2OCLA 4XWWA 1GTVA 3N6RA 5FQNA 1NW5A 2JFHA 3U37A 3RREA 3ZIAA 5K3FB 1H4QA 1VFNA 4H3VA 3QVGB 5LZ9A 1ZVKA 3JYLA 3S5JA 3VR6A 4EX6A 1GQYA 2AN4A 3IR5A 3QXXA 4K3VA 2VPQA 1ECBA 3H4VA 3GAMA 1ZUNA 3LT5A 2XWQA 1NSYA 3E5HA 4WLOA 4ZOLF 3DKPA 4KREA 2G77B 4J2TA 2GKOA 3QF4A 3KLMX 5HBGA 1E9BA 1WCIB 5FLEX 3DPIA 3ESYA 5F1YA 1E59A 2FTKE 2G8NA 3RT9A 3CVUA 2HSGA 4TKUA 1BCSB 2GVNA 1XRQA 1DXOA 3KWFA 1E7QA 4H3SA 2GCIA 4G4SO 4YDRA 1RI3A 3D81A 3P7MA 3F8SA 4MPDA 1O6GA 4XJVA 3DP7A 2EKBA 2XJ9A 4E4YA 4IEFB 1XTIA 3S4YA 3U0VA 4OCZA 3U31A 1Z0FA 4HRAA 1XMQB 5M2QA 1WB4A 5IKXA 1U98A 3OQJA 1P1RA 5AIBA 2IZZA 3HJAA 5D87A 5C31A 4YJHB 1C9MA 4IGFA 1XTBA 2FOIA 3CPEA 3N1UA 5TJHA 2OA0A 4UTNA 1LBTA 4NOLA 4ZEOA 2Z58A 1N8SA 1NDHA 1G8HA 5LM3A 4BLRA 4ZVOA 4W7HA 5ERYA 4B4VA 4RC9A 3KEQA 2WF8A 5HUJA 1IOWA 3CR7A 1UFQA 1ZNWA 2CFIA 2RGRA 4PPNA 1E3WA 1IONA 3GG2A 1SUWA 3TW8A 4GZ6A 4BYMA 2O8DA 3TDNA 5BWBA 1KO7A 3DDOA 2HK9A 1Z7WA 1HSZA 1Y8QB 5GPBA 5A4KA 4MWOA 1UMDB 2QKYA 2YCBA 3BFXA 4S1VA 2H00A 4Z8YA 2G3YA 2ZVQX 4HDRB 2IKQA 3VZQA 2FP4B 3U16A 3HCCA 1ESEA 2PWBA 1PDOA 2X0FA 2GZAA 1P6UA 1WQ3A 3FOCA 3M6IA 4D9EA 1OI3A 1GG5A 2BONA 2FFJA 3IAAA 3NGLA 5E3IA 3WL6A 3TUZC 3KE8A 3HCFA 3AJEA 1NVVR 3LKDA 3E3NA 1JALA 4IXMA 2QVBA 1Y7IA 3HADA 3ZG6A 3K1YA 1BFDA 1DAOA 3RIYA 1U0TA 1EKXA 3F9IA 1A9XA 2ZT7A 4D8WA 3EZ6A 1DRUA 4MRRA 1Z4OA 2RB4A 3PF8A 1YQQA 3GJ7A 3I6YA 4MWEA 3GXBA 2FN7A 3OZWA 2WU0A 1EGHA 4LGMA 1RKUA 1P3JA 4MDFA 2WVJA 3HJTA 3QE3A 2OLKA 1JI0A 4D0GA 5FV7A 4HNAB 5K4GA 1U04A 4YWHA 1XHLA 1W59A 1ZD3A 3T0GA 4ZI7B 5BSMA 2ZSJA 5KWVA 3HQ4O 5DHQA 2MSNA 3IP9A 3GEIA 4EHFA 1FRNA 2YRFA 3QMVA 3EGVA 4OMCA 3VHXB 3EG9B 1GVNB 1NWHA 2ZTHA 2FPPB 5AXBA 3KPJA 4IDGA 1ULUA 5BSGA 3VVMA 3LFUA 2HJRA 2PZBA 4KMRA 1ZR2A 2APJA 4N9WA 4HWGA 4OQDA 3HR8A 3SC2B 5B1HA 2NTNA 3ETJA 3NUGA 3ONNA 2Q5OA 1DWQA 4X92A 3VKFA 1RXIA 2ZEJA 3BULA 4B9EA 3KIPA 4NESA 4ERNA 4NICA 4Z54A 5FYQA 1GPMA 1A8SA 2HU2A 2R8YA 3FYUB 2VYND 3S27A 3V7UA 4BVBA 1JEJA 3I34X 2PAAA 3E03A 3LA6A 4YDQA 4R1NA 4M1OA 4XQGA 5IM5A 3TE7A 1WY5A 1H5UA 1NW8A 3G2HA 2XNCA 1AURA 4LZLA 1W88B 1XLVA 1RJEA 4PQYA 1SG6A 1F0YA 3EZLA 3V4ZA 5JROA 1IBKB 3O3OB 5DW0A 4PPQA 1WDWB 1PEKE 3HHPA 2NV6A 3CZMA 3G23A 1XCBA 1AKEA 1LSOA 2E85A 2OL4A 1L7OA 4PC1A 5EQFA 4MA5A 2QX4A 4UZSA 1JAHA 4CG3A 3QVKA 4YYZA 1FYXA 5ARBA 1EXVA 1XD8A 2XNSA 1CE8B 1YVEI 2WUGA 3L0BA 1DIRA 8LDHA 1WDMA 3EIUA 2BKLA 3GZTB 3JQAD 3NJRA 3P2KA 1LBEA 5DYGA 1EUCA 1MT0A 2Q8QA 4JI6B 3ZW8A 3REGA 4OOFA 9LDBA 3U80A 3ZV3A 4LIPD 3PL5A 3TZBA 1V7ZA 1FFCA 3UKOA 4JDPA 1YRYE 1ORIA 5ARCA 4AMYA 4I4TA 2GUWA 1YVRA 3UPDA 5L3ZA 2PAFA 3B5EA 4FT4A 5EIWA 4BQPA 3DDZX 3UMYA 2BGGA 1MVNA 2MR6A 3OPYB 4OIMA 4O4LB 1RP1A 3TNFA 5F23A 5HKOA 5LL6P 1E2BA 1AKYA 5CDHA 3SICE 1G8JA 1Z06A 4D45A 1LVHA 2JZCA 1LKZA 3UAVA 3I1YA 5FUMA 4CXMA 2H59A 4P7BA 3B12A 1E79D 1XNJA 2X0IA 3DHYA 1Y7HA 3B6MA 1ZGBA 3DO6A 3OH8A 2ZWPA 3DTVD 5DXAA 3T7TA 3CVWA 2RAUA 4OJMX 5BW4A 3DHNA 4R69A 3FMFA 1K27A 4RL6A 3G5UA 3PFKA 1QP0A 5ALVA 2P9TA 3GLVA 4D9GA 1G4AE 3FRJA 1SG0A 2XX3A 1FP4B 4QFDA 3PC8A 5IT5A 4HDOB 4MWGA 4RJKA 5H82A 4PX3A 2HZ7A 4XRRA 3ZWWA 4BE4A 4F8YA 4J6FA 5FQOA 1L0BA 9ABPA 1GJRA 3X1XA 4M8SA 5HK9A 2FZCA 2VJMA 1T3SA 5KYKA 4AP6A 1NRJB 5TT0A 4D82A 5BUSA 4RTPA 1X42A 4L9RA 3HNRA 3K5PA 3EJ6A 1HV8A 1RC1A 4AZ0A 1Z62A 3SQOA 1UEXC 2IDMA 4QBGB 5KMGA 1ISSA 1TM2A 3C5EA 5C1PA 2QLJA 1DE0A 5CVCA 3FNBA 1WXGA 4RFSA 5CYPA 2ZW9A 3FROA 1C8KA 4NBNA 3ZWOA 2WWFA 4G9BA 3WGOA 1JEYA 4I55B 5AKKA 1DC3A 2P9YA 4F9FA 1XRLA 2QM0A 5I4BA 5JZMA 1G8PA 1SC4A 4PIPA 3FCOA 4EG8A 1CETA 5AW3A 1UXKA 4KO2S 4AECA 4CI0B 1VCOA 2XUOA 3CX6A 1E66A 3DUWA 2I3ZA 1WHTB 2WFLB 2X1HA 3OEED 4M8KA 1ESDA 3TSWA 2JHGA 1BJTA 3QLTA 1E3JA 1EXMA 1RYZA 1R0WA 1U28C 1XJCA 1LS1A 2BIFA 3I9JA 1R9GA 2J3JA 5DRYA 6ADHA 4XSVA 3ZIAD 1P60A 1OX6A 1P77A 1W49A 1MJGA 2IXTA 2L17A 2PWAA 2X14A 2ZE7A 3KYCA 4HUQB 4BNXA 5IJZA 3L8CA 5F51A 2COKA 2AVDA 3I2IA 3S3TA 2VKQA 1A2BA 1FFWA 3K30A 5KCMA 5IYZB 4M46A 1PGNA 1MO3A 2PLNA 3RPEA 3TLJA 3HKCA 3C7AA 3H86A 4D4MA 1EDOA 2PGDA 2XTJA 3JQFA 4JJ7A 1JHQA 1IHUA 3CT6A 2AOUB 3TD2A 4FX5A 4DQKA 1IE3A 2QRNA 1SIUA 2Q1XA 5C8ZA 2QV7A 4MWDA 1VKRA 2A35A 3ODGA 3TR5A 5KTMA 1SQSA 1PZXA 2P8JA 1H42A 2QPLA 2POCA 4MV4A 5L3SA 1A82A 2RKBA 3VYRB 1XMSA 4CKEB 1UBMS 1ZD5A 1X9HA 4PLFA 1T8TA 2I87A 4X9XA 1MX5A 1L5QA 1TF5A 5CK4A 4UNNA 2AD1A 2Q28A 3PA8A 4H1HA 3IEVA 3FBWA 3U7RA 3DEYX 4DR4B 2AZ4A 5EUBA 3P20A 4UC0A 1KE1A 1A8PA 1FF9A 2I91A 1E4EB 2HJHA 3FWHA 4B3DA 5FNZA 4XOIA 3ZU3A 2IYOA 2OXFA 2EFHB 4Q7MB 5C0OE 5C37A 1G64A 3LX6A 1IZ8A 5IAJA 5CDTA 4IFBA 1Z8HA 1YB1A 3N2GB 5BW8A 1Y1SA 4MS1A 4TTJA 3OA0A 4ZEWA 1JQ3A 5FCDA 1P61B 1V9CA 5LA6A 4ABTA 1BSVA 4MAFA 4AJ4A 4FC7A 1GAJA 2Z2YA 5BYBA 5A0FA 1NUUA 3ORRA 5C4MA 2XSZD 2VRWA 5LDHA 3QNUA 4ZICA 2AFVA 2B34A 3Q5DA 5HOEA 3H5TA 1WAMA 2FCRA 2CXOA 4HOYA 2G0NA 2QRPA 3HDHA 1U0FA 3LKBA 4M60A 4ME6A 3UMJA 2CSXA 16PKA 3I5AA 3TRHA 3E1SA 1DKQA 5F2EA 3QBEA 4XFKA 3AM5A 5THKA 4C7XA 5BPHA 5CG2A 1J4AA 3TRDA 2CKDA 4GLBA 5JANA 5ES4B 1JIQA 4YR7A 3RSSA 2M6SA 2WHXA 2PYDA 1EVIA 3A3YA 4FEGA 3V1NA 4IX9A 3WFZA 2DBRA 3B89A 3OLVA 5KDLA 3BWMA 5TVGA 2OAGA 4WZ6A 4DS3A 4ITVA 3K1AB 3TXYA 1J2JA 3CZAA 2FOXA 3D7MA 5IU6A 4Q3DA 3PE4A 2VXCA 1HEYA 1GTG1 1TD1A 2D00A 2I2BA 2JRCA 2VZLA 2FUG1 4NJMA 4LRWA 1VG9B 3KQPA 2IH4A 3NDBB 2J3QA 3W3ZB 5KDOA 1GM5A 1ACLA 4OHYA 1Z4NA 1Z7EA 4UUOA 3IURA 5D6OA 5EJEA 2E4UA 2PFKA 3A9WA 1BDJA 3HJCA 4OKIA 1Z7YA 3VSCA 4GEKA 3DXFA 3QPWA 3THWB 4MRPA 4O2BF 1GZ3A 4U2CA 3JWHA 4CL3A 3MUEA 2QTMA 1G21A 3H1FA 4AICA 4E5MA 4A0FA 5J2UB 1N32B 4ATNA 5JSHA 2C3PA 1ZC3A 4LN1A 2RHTA 1XMOB 2RG7A 3UB2A 1SAYA 4YCNA 2AZDA 1KXZA 1OX5A 4ZOBA 4CL8A 4DMLA 2BFPA 1NQ5A 1M5TA 2OM6A 5CFMA 1QZXA 3ILVA 5DHAA 5FLKA 1J0BA 4Z7JA 1DTWA 2OCAA 3DBHB 2IDZA 5FFFA 3C48A 5T3UA 1MQ9A 4UKDA 1EZ1A 2FZ4A 4A36A 4C6TA 4ZQEA 4JD5A 5AJZA 2DLCX 3FWYA 3CSDA 5CLHA 5AJXA 4L9SA 1W36C 5COQA 1WBJB 3OC0A 2B7LA 3LUBA 2DC1A 1MAHA 2ET6A 2I1LA 2VCEA 1EWKA 2W37A 3AFHA 3NM5A 3KSMA 1UFVA 3IJ5A 3NWOA 4P5EA 1EP2B 3OLZA 1LD3A 1DFGA 2V5VA 2AS0A 4R7GA 3RS2A 3BUSA 2OV8A 3DM9B 3QPUA 4EGQA 1KGSA 2I7VA 2VH5R 2C8LA 1X38A 3B2QA 3G2NA 3NHLA 1QVRA 1FE8A 4YRFA 2R1ZA 4R16A 2GYVA 4NK5A 1VLLA 3LG2A 2ZUTA 4C6HA 4CT4B 2VSNA 4E15A 4F1JA 4QA9A 4D80A 1Z8NA 4QQKA 4ZEVA 1DIAA 2GARA 1F2TA 2O0MA 2WKWA 1YQ9A 4B4UA 2WQ7A 2F3QA 1CJMA 4B2IA 1M5UA 5BNWA 3RJ5A 3GELA 5L40A 1L7VC 3FD8A 2QMZA 5AXAA 1KWKA 3STWA 2XHEA 3D3EA 1CUVA 3EQZA 3MM4A 3OKFA 4QUDA 1YBFA 3RRJA 3G0DA 3P2JA 2ZIVB 4WCDA 2NWQA 2VHQA 4AWAA 4EMUA 2PBLA 4KFSA 3K8YA 3BA6A 3IQXA 4MS4B 1L7QA 4NQRA 1NDUA 2FPUA 2OHVA 4FT2A 3KUXA 2IEAA 2B8WA 2OE2A 5KTOA 2R2AA 3ABRB 5FORA 1XA4A 4NYMR 5IKOA 4OI4A 5IMSA 3P96A 5ICGA 2GD1O 3VNVA 3NHSA 1HDXA 1CLEA 2EJCA 2AYYA 3IEXA 5H5JA 4DPMA 1A8UA 1J97A 4Y30A 1JG6A 2C2GA 1FFAA 2CJFA 1VA5A 2VJOA 3ESCA 4PG4A 4MUNA 2AQIA 2FEOA 4QOIA 5T6BA 2JNWA 2RIRA 1HYEA 3H5IA 4NVRA 4MGEA 3OQ6A 5A6VA 4RETA 1CVIA 4P8RA 4V39A 5CLIA 3ER9A 4Q4DA 2Y05A 2PKEA 3VPGA 5LLTA 1T6ZA 2WSSD 3TIIA 5F9HA 4TZTA 1W85B 2YQ5A 4JP2A 3RHFA 3O0TA 1VA4A 1ZSYA 4BNTA 1WMAA 4CMJA 1GTRA 3SU8A 1VL1A 3I5UA 1RHQA 2Y27A 1Y5RA 2M9MA 1UPFA 1K7SN 1UXHA 3DFKA 3IUQA 2H4YA 4I4CA 2O0KA 5DXFA 5FAXA 5FWAA 2DM6A 3AP1A 3O91A 4EY7A 4UOZA 4NCBA 2O8CB 1V37A 2FJPA 1CB7A 2NZ2A 1WO8A 3AERB 3DEHA 3L2OB 4IH9A 4EUKA 1PR9A 3T9AA 3UV3A 3MWYW 4WE3A 3K2BA 5FJJA 4Z4HA 3PDCA 2M2IA 2C94A 3I6QA 2Z5LA 5DI3A 5AYVA 4BQSA 2X9LA 3ISTA 1A9XB 1C3EA 4MUIA 3D1JA 1OBFO 3HC7A 1YJXA 1WW2A 3LPAA 1KYVA 1NVAA 1TKAA 3CF4A 3NAQA 3MQFA 4J0CA 4IJKA 3NP7A 4GYKA 4MDHA 2P9QA 4MRSA 1MO2A 4Q4JA 4GPBA 4ZT3A 1NN3A 3Q9SA 1D1QA 3OZUA 4AYXA 3A4LA 1RYYA 3GUHA 2QN9A 1C9EA 1NFFA 1UEJA 2JD2A 3FNEA 4GI1A 1JWAB 4YAOA 5DNWA 1YVPA 2FETA 2CKMA 4Q3LA 4EP1A 3DYVA 4J1QA 1VP9A 4F2DA 2QD5A 1LC3A 2WHPA 3BMCB 5F64A 4EI8A 1XDZA 1C41A 2GM3A 3MJ4A 4RJLA 4LZNA 4E94A 5CHYA 3TTTA 5K0SA 3SJCA 2ZYHA 5KTRA 1U8ZA 3QXSA 4G9EA 4UZEA 1LEHA 2QU8A 4K9DA 4PGMA 4PYLA 2N3ZA 4C4YA 5HZKA 2YHIB 2ZVPX 2CNWA 3LYHA 1L4KA 1MO5A 1QO9A 3GJYA 1QGZA 3BOSA 1UFKA 3LPNA 4WEOA 3SBXA 3TLAA 5A2QA 1KI6A 4QOJA 4UPEA 3ZY3A 3DTYA 3WBBA 3WGTA 1PFVA 1ZJJA 4BFWA 4BVKA 2WYWA 2YIJA 3AUJB 4GSKA 5H81A 1IHXA 3RKSA 3WDMA 3ZD7A 4LVUA 3T35A 1QYXA 3H9BA 4TKMA 4XUCA 4W9RA 3DMNA 1SU7A 4TTVA 1HI9A 2VRBA 3CSSA 3F74A 2J46A 1BRTA 3NVDA 3UJBA 3GLHA 1TJYA 1OFIA 5DLPA 3QW4B 1HUQA 1H9AA 3AF0A 5K3CA 1IB0A 5AVSA 1UFOA 3LAWA 1W34A 2GWRA 4GLFA 4F3KA 2QSUA 1WZ2A 3NMUF 1T9ZA 4DOMA 1YZKA 4ZDWA 4GOJA 2PXCA 2IDKA 4A0GA 2B4YA 5LKAA 5ENVA 3E1KA 2ZBVA 3EQ8A 2XADA 5CHEA 2EBFX 4LYJA 2GZ3A 5C8YB 2VYFA 3N86A 5HFAA 3K9BA 4F4IA 2FW1A 2XUJA 1NU8A 3ZXSA 1MXFA 2Q4OA 3L8EA 4Z9BA 2BGMA 4EI2A 2WB2A 4BB9A 1A2QA 1RRGA 4E13A 2WSYB 1G291 1PJRA 3VR6H 2CYCA 1PK7A 3Q40A 1XV5A 2RHBA 1ILEA 2NSDA 1AOXA 1EK5A 3GQBB 3WJ1A 1S0UA 1AKVA 3UAGA 2M1ZA 1PNVA 5L4LA 1VE6A 3J7AC 2HKIA 4OU4A 4N4AA 4OHVA 2GN1A 1C1DB 4Q4AA 3IRVA 5HIIA 4C07A 2HLHA 3PHHA 4UUBA 1M6WA 1CF2O 2PVPA 1EI9A 3AH8A 4CTOA 4Q1BA 2LDXA 4C0SA 1P7WA 2RKOA 1ZD9A 3H2ZA 3OT4A 4EG0A 3SS9X 5A0TA 2EDAA 3E2PA 3BL8A 1EVZA 1SXJE 2YRWA 4NBVA 5GVRA 1MG5A 3BMQB 4A2WA 2R6FA 3PLRA 2QL5A 3W6ZA 1P74A 3KV3O 4OKNA 4M9XA 3Q3GE 1CQWA 2JJ2D 3NEYA 1N6PA 2AJBA 2IYVA 2E3JA 3OA2A 4N7MA 4R2LA 5A3SA 1I3MA 2IP4A 1U0JA 3SC4A 4HZUB 1T1GA 3U7QA 4EFNA 3FPSA 4MQEA 4MW4A 2JK1A 5SV2A 4MLPA 3PUXA 5AHRA 2I4IA 4RMHA 2X5OA 2GEBA 4M1EA 5IJ9A 4RD3A 2JIDA 4JBWA 4BLOA 3QE9Y 2GESA 1UT6A 2ODNA 3FMIA 3K35A 3EPLA 3OE7D 5TS3A 1YS7A 4YHHB 1AHIA 1CJCA 2A59A 4RPIA 1U7OA 2WFLA 2AUMA 3CEAA 3FDJA 3LVBA 3FR8A 5EFOA 1A76A 3W2FA 2XZOA 5IM4A 4IH4A 4ONEA 4U7JA 4D9KA 1ZEMA 3C3AA 5GOTA 4ETWA 2CLKB 4Q5IA 1OGJA 3AZQA 3V42A 4V1CA 1XKTA 2AFHB 3ANLA 1L5RA 3WL7A 2E9SA 2J9FB 2W8BA 4K7JA 5DZSA 2ZP1A 1XRSB 3UTCA 1I3KA 4ARBA 2GTPA 5LNK1 4C4SA 2O8FA 1EDDA 2O2SA 4D96A 3OOEA 3ZBUA 2O7QA 4U8GA 5HM8A 2QL6A 1QF6A 1FFDA 4FYHA 1ONPA 1QH9A 3H8WA 2ZQZA 1LPBB 3L4BA 3OT1B 4X1YA 1W4BA 2PRZA 2HUNA 2R5NA 3TSZA 4CVNA 1NN5A 3DL0A 4O4JF 4B33A 4FILA 4WZBB 3TE6A 2R84A 2G40A 2PD4A 2RHWA 2VYCA 3NGXA 4X7MA 5FPKA 3DTTA 3H04A 4N18A 5K3OA 4G5XA 3LY9A 5DX8A 5J2TF 4F93B 5EVCA 5E9JA 4BP8A 2EQ5A 1OIWA 1LK0A 1LBHA 2JFQA 1G2QA 1W76A 1R5OA 3WGLA 1ZZEA 2VYVD 4TV8B 4EL0A 5LYJF 4G0QA 3WK4A 5LIPA 4DV6B 1O95A 4G5OA 1EHCA 1PZGA 1SEVA 3MGKA 1OLXA 5IYZA 2A58A 2Y1FA 2FR0A 3I9FA 3O5AA 5F3WB 3MMSA 3IPXA 2A57A 2Q62A 3FE2A 3E7WA 5E4TA 5EUQB 5IULC 1ENPA 3E9YA 4PX2A 4RF2A 3CLTC 4A0RA 5JJKA 4AY6A 3AEKA 3H0KA 1SWWA 1VRVA 1H94A 2OB2A 1C2YA 3WYGA 4PHTA 4E21A 3ZU6A 2CLFB 4U6NA 4J3JA 3DF7A 3EXIB 3GFOA 3P5SA 3FVVA 1U7DA 1Y48E 4I5GA 4JEHA 1JR4A 3VO8A 1ZGJA 5THQA 5K20A 4RIFA 1Y3IA 3ZDAA 2AN1A 2WP0A 4X1KA 1J0CA 3ZE1B 3BIWA 2PANA 4M49A 4JYZA 3DXYA 3RIHA 1OXUA 4NBLA 4RADA 3WRVA 1V2HE 2VOEA 1YE8A 3GARA 4CKYA 2IS2A 1VCNA 4MGHA 3UMBA 1M10A 1JIJA 4ZVUA 4JNKA 1DBQA 1O5OA 1UINA 4CEIA 3RHZA 5JCOC 1U7UA 2BBOA 4Z7OB 3L40A 5KVVA 4IGEA 4M9SA 5B3JC 1I30A 3H8SA 4V0OA 4B6RA 1QFSA 1K5GA 5JPIA 1NSTA 5CCXA 4Q3EA 1V47A 2ZS7A 2O50A 2QR3A 1G20A 1O94D 2HX1A 2REBA 2ZJ3A 3Q15C 1EJ2A 2VL7A 3ENWA 3F7MA 1EFRA 3V1UA 3N0RA 4TTAA 3M1LA 1TM5E 3O94A 4UBJA 1U9ZA 4HAIA 2AA3A 1JFTA 2I4LA 3JQBC 1AUVA 1MPTA 1XWWA 2C4UA 3I2FA 4U2DA 2VXBA 2QIOA 5LB2A 1JEEA 2GCEA 1MRSA 4C6TB 4W9NC 4HGQA 1YL5A 1KI4A 4I8XA 4EECA 2DLDA 3DJYA 2X1LA 3DE1X 1I9CA 4YFYA 2GHTA 4KFCA 1BX0A 4KBGA 4RDIA 2WQ6A 1DKPA 1XD2A 5IAGA 3NHRA 4DDUA 4H7HA 3WHLA 4DLWA 3CX4A 5A02A 1JJ7A 3OCXA 4O5OA 3A10A 4S1WA 2H2IA 3ETLA 4ZVLA 2KS6A 3GLIA 2W7TA 4BO0A 5AM5A 1YA8A 4D46A 1F8YA 3BCSA 4EMTA 5AW5A 1HL7A 3CM0A 5BR8B 1Q12A 3KAJA 4TT3A 3VMMA 5A6SA 2HY7A 3ZWVA 1T34A 4ZVKA 3NDJA 4AN0A 3ZDBA 1TVKA 4IVRA 4BOYA 4PAGA 1U0HC 2XOEA 1DEKA 2JJ8A 4ER0A 1BD3A 1W30A 2ONKA 5IXSA 5LSAA 4HNQA 1YZQA 2QMEA 2VAVA 3Q7TA 3EUWA 3KZNA 4KDCA 2I33A 2ZLBA 4KQKA 4JVLA 1FVOA 3NTVA 4YY3B 2XR1A 3KT8A 1IAQA 3LIIA 1EFTA 3I09A 2FQ1A 2WF9A 1G21B 4LOIA 1U4SA 4X63A 4BP9A 3CZPA 4BJ5A 4IHQA 2QMUA 1SXJB 2E1RA 3O3NB 3HK2A 1FS4A 5GV8A 1V1MA 3E22B 5IDVA 5JNWA 4MUGA 2YYZA 1UJ2A 1XPUA 1SWVA 4AO7A 5EE9A 4PC6A 4D97A 4HO1X 2PEYA 1FRFS 3AIKA 1GUFA 1WZIA 3U7EB 3C39A 1R7RA 4DBLE 3SBOA 1VKHA 1Z8DA 4QDKA 4OLJA 1SKQA 2V4ZA 4FCVA 4MNTA 1W0KA 2HOQA 2V7GA 4AZTA 2WJ4A 4DMCA 4EB3A 2X22A 4S04A 4HMOA 2ST1A 1OU0A 4NYJQ 5LZ5A 2FWNA 2LZ0A 4RKQA 4ITUA 2EU8A 4BZQA 2NU7B 5SYMA 1RAIA 4WUVA 1UDXA 2JBHA 3K2QA 5JNSA 4MICA 1E2IA 4TVKA 3X1JA 4WI1A 3D6AA 3P27A 4P4LA 3AVPA 4EA7A 1TCCA 4PLCA 2PMBA 4MEJA 5KINB 1G3RA 2VJNA 1OWLA 4KUEA 4OGFA 4Y18A 2GM4A 1KYZA 1MABA 3QU7A 4K81B 4Z99A 2VZEA 2DKFA 3CPJB 4L8GA 4BO1A 3TNYA 1SXJA 5E38A 3PC8C 3ZZMA 2IU0A 4JBLA 3KJFA 1QYRA 3OMLA 4KIWA 3DL7A 4PQRA 2HMAA 4BPBA 1MRNA 2PSJA 5D7NA 5GJBA 1L8LA 4FR0A 5FNVB 2V1UA 3LUDA 1Z4IA 1IDN1 1SC9A 4ZTBA 2R44A 4OXIA 1J9GA 1TDJA 2ZB7A 4Q4HA 5DH9A 5LC1A 1TK2A 3G9UA 1XRJA 3A11A 4ZJYA 1E18A 2UYOA 3WLFA 2J9RA 2NU9A 5ALJA 3OZRA 5BSRA 2PMWB 5GJWC 3U3ZA 4DC1A 4MAAA 4NCKA 4ZREA 2XCOA 4CJXA 3C3YA 4Q01A 2ZYIA 1TMGE 2P1DA 1SPBS 2ZS8A 1WKVA 4RBNA 3KZOA 4KSBA 3KKZA 4QATA 3ROMA 3JU3A 1CY6A 2H4ZA 4Y2QA 2E6KA 3WXMA 1KJYA 4DNPA 1ZHFA 4QG7A 2B1IA 3QV1A 4EHKA 3TCXB 4ZGBA 3G89A 5HXAA 1A1VA 4F91B 4FONA 1GPYA 1E61A 1ZXBA 2WBLC 4O08A 1VZ2A 4BX2A 2C5HA 1JSXA 1G5PA 4LDAA 4ZHQA 3UJNA 5JZ9A 3SQLA 1Y6JA 3QYFA 3OZDA 3VTFA 2ZR7A 3CB2A 1MUUA 4R1QA 4JU9A 4D9FA 5KHAA 4I2NA 1L4NA 4DEYA 2HGZA 3G2KA 3V6MA 4DL9A 2IZOA 2GZHA 4HP8A 1JJVA 3ZVMA 1YB4A 4B4OA 3KHSA 3BFKA 3KQQA 3KR1A 4G56A 4HB3A 4PYRA 4UTOA 2BFDA 3U17A 4YMVA 4AQDA 5JSZB 1ONSA 3JAKB 1S4QA 3L1JA 5HZGA 4RK4A 4QU0A 1JKIA 4KI0A 4OAPA 1L8OA 1XNGA 1SVLA 1V9LA 2BP7B 4V2UA 3VI3B 3GXOA 2NU6B 1WUTA 1AKUA 1E62A 1D7AA 4BLWA 3FW1A 2HWYA 1T4CB 3K5HA 3OVMA 4H6XA 3W77A 5B2FA 5HQ3A 1A98A 3UH0A 1EA5A 5KWSA 5AM4A 3FHTA 3ZDCA 2W4IA 1K63A 5DMHA 3LUAA 2VHVA 3S2SA 1ZICA 4L74A 4YJ2A 4FSHA 1Q15A 3G2OA 4XVCA 5DYWA 5AM3A 3ABZA 2ENWA 4IIJF 2GJSA 1UKVY 2H0QA 4D79A 4DLRA 2Y92A 5AH0A 4LV8B 2OCIA 1T5LA 4Y0AA 4IVQA 1N5RA 2CVOA 2OCPA 3EOZA 3SDSA 4B7UA 1KA9H 5JTTA 1MO4A 3ND5A 3F6BX 1OZGA 2BFBA 2PCJA 2W6IA 4GM0A 4J0DA 2CHVA 2L18A 2ZJBA 4LHEA 2VHCA 1QRTA 4A8JA 3KPUA 5HHTA 1OLOA 3NW9A 5C7IO 3BDVA 5J2TA 1P91A 3QBVA 1LPSA 4DJJA 3LHSA 1EUYA 2J7KA 3I64A 3VR6D 4UEOA 3ZY2A 1J49A 3G49A 4KN5A 4EUEA 4IHJA 1N57A 1IN7A 1PVDA 1CS0A 1GA1A 1CQJB 1ZH4A 2W6CX 3ODPA 3R3HA 2CT8A 2MJLA 5K5EA 1V3QE 2YX1A 1VLVA 1ZNZA 5AW0A 2A1TS 1EXDA 3PDWA 2G28A 3T06B 2DEUA 4ECEA 1XPOA 1T15A 2GN2A 2RCNA 5IBPA 2FPSA 1E9EA 1WB5A 4E4RA 3W5DA 1H6DA 2MINA 5IZ4A 3F6CA 1R6BX 1SUDA 2CVPA 1FS6A 2GZMA 2QENA 3L8GA 4KKVA 4RDHA 1LJ8A 3P2EA 1NASA 2X19A 5DGIA 3D5EA 2A0XA 4XARA 3UB4A 4AVYA 4U7WA 4NTZA 4X20B 4NG4A 3SNKA 3HVRA 1QAOA 3HVHA 2QMQA 5G1NA 1XQ1A 2GN4A 3OFJA 1SRRA 4EFDA 5REQA 2JCGA 2PSDA 1KFBB 3R1IA 4LHXA 1AKWA 4ZCLA 5IAKA 3HRIA 1PU2A 2GPNA 2YS7A 2Z2KA 1ZUD1 1NJ6A 1K3UB 1R00A 1UQTA 3C6YA 3N87A 1RIFA 3Q2IA 5LQSA 3DV9A 3SIPA 3V4VB 4PQFA 1VLQA 4BIMA 1JHZA 1PS9A 2AVNA 1H3EA 5DSXA 1OYWA 2R11A 4OAQA 5KYYB 1QE0A 4P3YA 2GT1A 1QZZA 5F33A 4LRXA 4TLCA 4NCJA 4MSUA 4MCJA 1EJ0A 1FDUA 1S01A 2O2HA 3EC1A 3INTA 1U2PA 4LZJA 4MCAA 2X2EA 2FW6A 2GFQA 2I71A 1WCYA 2ZQ5A 3EG9A 1JNXX 5K4AA 1V5EA 1TM7E 3LYAA 4Z0PA 3H17A 3HXTA 1A5AB 4U7PB 2UUAB 2GA9A 2LKDA 3RSQA 1T2UA 3TLGA 1LBQA 1SUBA 1WF6A 5IXJA 5DNYB 3BQNB 3CX8A 4U5QA 4X20A 1Z4JA 4MPRA 4GLJA 2PRYA 4TV9F 5H8WA 1SOWA 4PBRA 3AWIA 4FK8A 2XRZA 3SXUB 1K92A 3ENZA 4ISBA 2HRBA 5BQ3A 5CM9C 3UXEA 1T8WA 1RXSA 4B87A 4P32A 4QELA 1V0JA 1YRHA 2G70A 2D1FA 4NRDA 3WWOA 4B6QA 2JVIA 4P33A 1VBMA 3TO5A 1I36A 1PQ4A 4YBRA 1GNQA 3M4XA 3THXA 1P1FA 1H65A 2AOTA 2BJHA 3MB5A 4IQ8A 4UEJA 3USES 4CUKA 3ZHRA 1PFYA 2AX3A 3MQ2A 2XXAA 3BRWD 3NRCA 3OQ1A 4HGRA 4RKFA 4RX1A 2KSQA 5ICEA 2YXBA 5AKEA 5FWXB 3QX8A 3DFFA 5HDBB 2AI2A 4QJIA 5KYVA 5LZ7A 3PWSA 1Z13A 1I3LA 4L5BA 3C7CB 3AR6A 4LFBB 2BBWA 1Y6QA 1V3TA 2YHAA 3S6JA 3EBPA 2ZROA 3WHIA 4E51A 3RR2A 5GQSA 2A0UA 5E9QA 1ESCA 4MO2A 3PR1A 3TEFA 4P4TA 4UDYX 1CULC 4ZGGA 1QZTA 2GTHA 2HXYA 4MUFA 3VZDA 3GMIA 1MGPA 1YZGA 4KV9A 1BXRB 1NVGA 1U5BA 2ZB2A 2P9EA 3BWYA 3KTFA 2GGSA 4Y9RA 2Y1CA 1N2ZA 3QOYA 1N34B 5BRAA 3KFVA 2IHVA 1XZAA 3L7CA 5T4BA 2XNDD 1F6DA 1L3BA 1PSDA 2VSYA 2DSTA 4TZ0A 3RUDA 1XEXB 1OB5A 1ZQ1A 1EWVA 2GKGA 2I03A 2HYDA 5EWJA 2ZPUA 2X8WA 3RLIA 3R9XB 2WU8A 2ZPTX 1JDBC 3T99A 2O3QA 3ZVNA 3SP1A 8AT1A 1R88A 2GHRA 3N3AC 3CIFA 2IOHA 5JCPA 5LIRA 1H8EA 2XUPA 4KR9A 2O2DA 2RGUA 2QI9F 3T7JA 3PE6A 3VX4A 2LTAA 2RFLA 2JCVA 4PR3A 4X94A 3G0HA 2O4CA 3ANMA 4M9RA 1C7ZA 2GOYA 4JVOA 1DRWA 4TUYA 1B4DA 2R8XA 3WGJA 3D8RA 4BNLA 4J2HA 4B48A 2F1KA 2B2NA 4LRYA 4GECA 4NR0A 1HA3A 3S2FA 3L7MA 1P9RA 3EIQA 1O4VA 1IY9A 4QEDA 3IOBA 4FEEA 1T8PA 4YO8A 5D5HA 1XN1A 2IYXA 2SNIE 1QLWA 3GT4A 4JL8A 4P38A 3PQ4A 3ZDQA 2O1XA 3BMNB 5CTJA 4KITB 1IMOA 3SIXA 1EVQA 1G9SA 3ESRA 2BFCA 1RACA 2CXQA 1CQIB 1JQJC 3KKLA 3SJAA 4F06A 4ZAWA 3C8MA 4WD3A 1T1EA 5JUWA 5DEIA 1T9BA 1IBLB 2MDTA 1KVQA 3IP3A 3BERA 3DCIA 1EQUA 2DSNA 3R5KA 4CGZA 4WK4B 3AW9A 2IV3A 1XTJA 1M0TA 4IOLA 3TI9A 1SXQA 1UWKA 4MEBA 3OFNA 1JLHA 1YRWA 2VLBA 2BFWA 3MTGA 2J9YB 3OZBA 4G4IA 2XNDA 1XMJA 4I1OA 1ODJA 2QNIA 3LCMA 4RF5A 1YAJA 2EFYA 4UASA 3GU3A 3TTWA 2WJHA 3CRRA 2FE4A 2CJWA 3CCBA 4MZDA 2A5YB 3F0TA 4DMKA 4WTOA 4LF4B 4AULA 1EFAA 3NU1A 3IAHA 4YMSA 2HBZA 2BFEB 3QFHA 1JJFA 1LDMA 5HCIA 4LF5B 1SIWA 3IP7A 4GKJB 2E7ZA 5JZVA 4M0EA 4EY5A 1JLLB 1GTMA 2IRWA 5SY9A 3AZPA 1ZUWA 3BHIA 2W2LD 4JCOA 2DHQA 3PVCA 2HN9A 5KU7A 3WMEA 1COWD 1Q0UA 1V7QA 2EZ8A 1TKRA 1X7DA 3MWKA 1QS0B 2B5VA 4JQSA 4OLBA 3A37A 5LQJA 1M6VA 1Q22A 5JD3A 3TR6A 1NMQA 2QLNA 5TPZA 2NU7A 2G07A 3I04A 2R5FA 2Q0XA 1PR1A 4TMFA 1FXSA 2E5WA 3HKDB 3WL5A 1PQPA 5FA5A 1ZVJA 5L95A 5EMLA 1X9IA 2WUDA 2XTNA 1RI2A 3KR9A 4RLFA 4RVDA 4L22A 2KPOA 3NWJA 3WA7A 4QOHA 1V26A 4K9MA 1W4LA 4V1CB 2F4NA 2IDJA 3BMQA 3QIVA 1KH2A 1VHLA 4QAJA 2VIIA 2BEWA 3LUJA 3WI7A 2VPPA 5KUTA 3W3AH 2AW5A 4UHBA 2F2TA 5AWFC 4TZKA 5CEFA 5JT1A 3HM9A 4KVZA 1OSNA 2I34A 5I4KA 1YK0A 3QX9A 3SF8A 3W8DA 4B6FA 4LCJA 2HA5A 4LY9A 2ZCVA 1AV7A 1SBZA 1DKOA 1M1YA 1JDVA 2VJCA 4WKGA 3RBXA 4CLOB 3KV1A 4FOTA 4IP0A 4DM7A 3OPQA 4OUDB 3G0OA 3WMFA 2ZM5A 1U2DC 1VBFA 5BV8A 3RS7A 1TYCA 4JUFA 3FGNA 1K2WA 4GPIB 4IICA 1P4GA 4BQOA 1IBRA 1TQ2A 1ZZGA 3GUUA 3VZCA 1AKRA 2A2ZA 3K9LA 2JLZA 4REQA 5BNIA 1ZOOA 3NTQA 4H7EA 4LQ4A 3PF9A 1SG9A 4D26A 5DO9A 2WIJA 4GPTA 5D00A 4ALIA 1PR6A 2O3TA 5DCWA 1TAUA 4G5HA 1CY8A 1RFGE 5A06A 4RCZA 2JFWA 2I67A 3AEXA 3OI7A 2A8YA 1C0LA 2R6HA 3MXTA 5LA6B 3W7VA 3QBTA 4BO8A 3Q11A 3EWIA 3DD5A 4GPZA 2FN4A 1NYLA 1W7AA 4DBZA 2IITA 1BGVA 2HRRA 1Z08A 2GAJA 3NT2A 4B71A 1ZLXA 1A4UA 4PM4A 1E92A 1N78A 3KKQA 4FFMA 4QEKA 5K8LA 1RXEA 4MWCA 4C6SA 4EUNA 3EFOB 2NM0A 1NI5A 3BYZA 3V4OA 4LY0A 5E8RA 5DP1A 2WMOB 3RJZA 4NENA 4W5HA 4LXGA 3KVRA 3RIXA 4C0BA 3GCGA 5HRCA 3OWHA 5MN6A 4B34A 1COWA 3LRXA 3UPTA 1U1GA 2GB4A 2WWRA 5C5DA 2XKKA