3NBYC

Crystal structure of the pki nes-crm1-rangtp nuclear export complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
171
structure length
171
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGLEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NES consensus redefined by structures of PKI-type and Rev-type nuclear export signals bound to CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gtp-binding protein/transport protein
molecule keywords Snurportin-1
total genus 43
structure length 171
sequence length 171
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3nbyC00
3AVYA 2IYQA 3RRZA 1QHIA 1G6OA 3K0FB 4CEHA 1IAQA 4MUAA 4M1MA 5KDOA 4JZKA 4NYIR 2XNDD 4HSEA 221PA 4A8JA 3AEZA 4KVAA 3DZ8A 4PANA 4FN5A 4JVMA 1E1RA 1HV8A 2NO6A 4Q4HA 3BK7A 2ERYA 1HYQA 1NJFA 3LBNA 1DAFA 2CL0X 3UG7A 3UMFA 4AURA 2D2FA 3N70A 3B13B 1W7AA 3RRYA 4CF7A 3C15C 1X1RA 2HCBA 3RANA 3B78A 2FDCA 1FTNA 4KFTA 3UPUA 1QBKC 4S2EA 4B75A 1JXOA 2VTKA 1GNRA 4FW9A 4F93B 1SXJC 4OI1A 3IDQA 3DOFA 1DE0A 4PO1A 4FMDF 1Z0JA 4QM6A 2CVHA 4KI0A 4ZO4A 1CRPA 4QHYA 3T34A 4ABYA 1KI3A 4DDWA 3GFTA 3TUZC 2WWYA 1T0JB 2ATVA 1WP9A 4GMXA 4A1FA 4RZUA 4TLDA 3NEJA 3R9IA 1COWA 2DWOA 2EYUA 4A82A 2F6RA 4B74A 1W44A 2Q21A 1ESMA 4Z1MA 1YVDA 1G6HA 2XNSA 4ZI3A 1YR8A 3BGWA 4NBSA 3GLIA 2H5EA 4O25A 3ZVRA 1DPFA 2CK3A 3S1AA 1E69A 2HT6A 1G3IA 2AXPA 3DDCA 4FIDA 5FTKA 4EJSB 3CRRA 3PJRA 4DLRA 1Q20A 1S9HA 3CR7A 5J4HA 5JJKA 1OYYA 2BKUA 2YJTD 3QNUA 1ZU5A 5G53C 2Q9BA 4BEJA 3OEED 3KKNA 3KQNA 1FNMA 4LJ9A 3PENA 1HE8B 3UMSA 2ANCA 5C46F 3IIKA 3LBIA 5EE9A 4YDSA 2H17A 3E1SA 1VCIA 3EPHA 2J1LA 4OK3A 4AYXA 1MV5A 2P2LA 2O5VA 3MMPA 3A8TA 4LZZA 2CJWA 4MKHA 2O8FB 1GSIA 5ELXA 3LH5A 4B48A 2JLQA 4TQUS 3SBDA 1QHHA 2ZRAA 4MYTA 3ZGXA 3ZDQA 1Q3TA 2OZEA 5C4GB 2DFKB 4C0BA 5JRJA 3QKSB 2QQEA 1ZUNB 4TL9A 1ODFA 4RSGA 2AKYA 2FZ4A 4UXJA 2ODWA 4JBYA 3TR0A 3Q9LA 4QRHA 2Z6VA 1RFLA 4B76A 2IYTA 2JLXA 2XGJA 3P4YA 1NVUQ 2HYIC 1KGDA 4DEYA 2Q3HA 3V00A 3QEJA 4BZXA 2W6IA 5K8IA 4IDHA 1ZCBA 3PUZA 4WOPA 2IEYA 5E7JA 5HE8A 3SR0A 4AI6A 5JZVA 3GLFA 1MOZA 4PPGA 1NBME 2XITA 2RGNA 1IOZA 5DI9A 4YXWD 2JA1A 1HA3A 3EASA 1KDPA 4M1WA 2JLRA 2C9OA 2UZ3A 3PEUA 1XTRA 1LVGA 1XU4A 1EX6A 1J8MF 1LNZA 1PLLA 1X8LA 1N0WA 3FFBA 3GEHA 4NCJA 1D2NA 1JR6A 3RSLA 1KOFA 2ZUDA 2PMDA 4HDQB 1E32A 4DLUA 5BN4A 1FP6A 3L0IB 1KZGB 2XTNA 1OIWA 5FI0B 4JIMA 5BXQC 5HKKD 1G8GA 3QENA 2IF2A 1SQ5A 1KY2A 3CBQA 4MKIA 1KJYA 3KJGA 2QP4A 4PQFA 4KSBA 3U3JA 5BYKA 1US8A 5LPNA 1G5PA 2IYXA 1KK0A 1YRAA 3QF7A 1TF5A 4A0RA 2ZRFA 2ZE7A 2OILA 1Q44A 1R5OA 5EQTA 1T5IA 5F2EA 4Q1AA 3L0SA 2B92A 3LVRE 2ODNA 3NDPA 2A9KA 3U61B 3OFND 2GBLC 4C4PA 4MGIR 2WTUA 2MSDB 3DM5A 2O8CA 3TQCA 2CVFA 1E9EA 2W6JA 4E09A 2A30A 2V6IA 3BB1A 4IOMA 5CYPA 3FKSA 4ESHA 1E79D 2OFOA 1E9FA 1OFTA 2H1LA 3H84A 3NKVA 4P4SB 4PO9A 4R7ZA 3AF4A 2BOVA 3JVUA 4KFRA 3LW7A 1XD9A 1RE0A 1ZUHA 2B8TA 4PSAA 4MYUA 4HUTA 2GF9A 1Z0FA 3WMGA 3RS4A 4GDFA 3GLIB 2WM9B 3B1YA 3RWOA 5C4MA 1N5IA 4PHGA 4WXPA 3X1DA 1P4SA 1XFAA 4ZCMA 2VBCA 1RYFA 3TAHA 3K70D 1WRBA 5GVSA 5TDHA 4QJ5A 1Q3HA 1GKUB 2QE7A 4P32A 2W0MA 1OIXA 3DVLA 2VF8A 1TPZA 1CULC 2HLDD 1IXRC 4MKGA 3LXRA 2WV9A 1SXJD 4V02A 1DADA 4OYHA 1A4RA 5KNBA 4MRRA 2GJ9A 5KYKA 3EZ9A 2ORIA 2PMKA 5JECA 1E9AA 1NLYA 1XD8A 2ZAOA 2J9RA 1D6JA 4JYCA 4EFMA 2WOJA 1ZMXA 3Q5DA 3ADBA 4TQAA 1KO4A 3RS5A 1V43A 1E9BA 4LSGA 4DT1B 1HEIA 1LTQA 3U44B 3BFKA 2C5LA 3KXLA 3BJIC 4GPTA 2DCUA 4FCWA 1BMFA 1KI7A 3B82A 2P5TB 2JCSA 2ZI6A 2DY1A 2QENA 3ZYCA 1T5LA 4G1UC 4B2PA 2WWFA 1PLJA 1G3QA 1ZU4A 1NVVQ 1R2QA 1YZKA 5JEEA 1E2DA 3RDPA 1R7RA 4DCTA 4ZDKA 1MR3F 1G7RA 5EZ6B 1T8TA 2KB0A 3OIVA 2ZANA 3CF2A 3QI2A 4AIIA 1EG7A 1W47A 2X2FA 4I1OA 1I4TD 2ZS8A 1VHTA 1XP8A 1II9A 4W7SA 1FX0A 2PEYA 1U0LA 3DEFA 2ASEA 2VSFA 1X1SA 3FPAA 1KMHA 1NVXQ 2RGEA 3QOFA 4KBGA 3I73A 1IONA 4W5HA 4TMKA 2GETA 1JAIA 4BZQA 1FUKA 3QSYA 3AF3A 2BBOA 3ZVLA 3MWYW 3LX5A 2HCJB 2C9CA 2W00A 1Z29A 1P5ZB 4IVRA 3IIMA 3PEYA 1Z2AA 1R4AA 4KFUA 3REGA 4UXHA 1G3UA 3FOZA 2VO1A 4KYIB 2XTMA 3VX4A 4PX9A 1T6NA 1IBRA 1T3LA 1VHLA 1IJEA 3LX8A 3A4MA 1E4YA 3QY0A 1ESNA 4M4SA 4V03A 4D4KA 4AYTA 3ECCA 4URYR 1X3SA 3SEAA 4CEIA 3EA5A 4LJ5A 4YQFA 3PIRA 4NCIA 4L16A 2W58A 4QGGA 3VX3A 2XX3A 4C0JA 5KUTA 3K0FA 2HYDA 1XMIA 2ZYUX 3MWLA 1ZP6A 2AK2A 2QU8A 4G01B 3EZFA 1KSHA 3LXXA 4DLXA 4GT1A 1R8QA 3BFVA 4KAXA 4A8JB 2F55A 1ZUIA 3U7HB 3AKCA 4QGHA 1Q0UA 3PUVA 4Q4HB 1GG2A 2KWIA 4IDNA 3VNUA 4TLCA 1DARA 1UKZA 4GOJA 2A7QA 3BH7A 1ZIPA 1KO7A 1MABB 1SGWA 3A1TA 1JQLB 1M74A 2FSHA 1FOEB 4O2RA 2FSFA 2DWQA 4JBWA 4MRPA 4Q7LA 3U4QA 4MGKR 1YZNA 2G0TA 5B58C 2GK7A 4NYIQ 1TNDA 5JJIA 3AGQA 2O8BA 2W6JD 3K0EA 2HF9A 2F9LA 2IHBA 2QY9A 4CRWB 2ZTSA 1G7TA 3JZAA 4XD7D 2ZE6A 3U7EB 1HH4A 1YHNA 1W48A 1GRRA 2QAGA 3CO5A 3GEIA 3RWMB 5J4LA 3OIYA 1WBBA 4MDEA 2WVJA 5FBLB 1A5TA 2VH5R 2ZYVX 1OIVA 1A2BA 2J87A 1KDOA 2ZYTX 2KJQA 1OF1A 4JL6A 2JAQA 1R8SA 3A4LA 1Q1QA 4IHQA 3LLMA 4UQOA 2QI9C 4A2WA 3U44A 1VCNA 3B1XA 2CLCX 4V0NA 5DISB 3WRYC 3ICEA 3K9HA 4F4IA 4RFSA 1LB1B 4Z54A 3AVWA 1E9SA 1E9CA 1G8HA 4DWJA 3N2EA 4DUGD 2QMOA 3QXJA 4MQBA 3CB4A 5GADl 3KUCA 3QF4A 3TK1A 2ZUBA 2EYQA 3BOSA 3R9XA 4G3XA 2RGDA 2ZJYA 1E6CA 1N6LA 3IEUA 2D7CA 3H4MA 4HZUA 4A2QA 1NBMD 3W90A 3X1XA 2AWNA 2ZJAA 5BN5A 2AR7A 2ZROA 4B35A 4DSNA 2QM7A 2QGNA 2BWJA 2DFNA 2CEAA 4LUCA 4OHVA 5HZKA 2FEMA 1UBCA 1YQTA 2OBLA 2FFHA 2QUZA 4X8OA 3P20A 1KK3A 3RC8A 1PJRA 1W0JD 2QG6A 3A6PC 1IHUA 3HR7A 1XRJA 2EQBA 2GA8A 4R9UC 1BYUA 2X77A 1S1MA 3KKMA 5J4VA 4QNRA 3O8RA 1JB1A 1TUIA 3ADCA 5B64A 3PUXA 4BLOA 2NZ8A 2RGCA 3BBPA 2C77A 4PZLA 4YLGA 1GNQA 3OIWA 1LS6A 3L43A 1KTVA 4B43A 2WKQA 3HP1A 3FMPB 2GJKA 2JASA 2JJ1A 2ONJA 4OHZA 4KLNA 3EWAA 1CR2A 2F43B 1E2KA 1G18A 4EAQA 3K0SA 4HAWA 4OQNA 5KDLA 5DN6A 2WMNB 3RABA 1D2EA 4Q1BA 5C1BA 4ZKEA 3RLFA 2ZJ5A 1QHNA 5JEDA 3NHBA 3ZS8A 2V6JA 4WW0A 4QBFA 4QHSA 3NH9A 2VYFA 1UBGA 4WZAE 3QXXA 4BLPA 4TT3A 3SI7A 1AJEA 5SZKB 2YOGA 2IX3A 3KFVA 2X2EA 2ZI5A 5DLQC 5KO2A 3TE6A 4B3BA 4OJQA 3ZZ0A 3VFDA 5JBQA 1UDWA 2BJVA 3AGPA 3P4XA 1IN7A 1YU9A 2XXAB 3AF2A 1VYTA 4Q1FA 5G40A 1NI3A 5KDDA 3KQLA 5TARA 4QM7A 5TVKA 3U4QB 3TKLA 3I8XA 1HQCA 3AVVA 1WF3A 1ZC4A 3NBXX 3ICQB 4Z8XA 1VIYA 4DLTA 1P9NA 5J5CA 1IY2A 1KDTA 4JLOA 2GXQA 4D0NA 1UAAA 1LY1A 1M34E 3B5JA 1SVOA 3WBKA 1G5TA 5L3QA 3THYA 2ZQ5A 3T61A 3MD0A 3GLGE 4S35A 1WBDA 5CLQA 2IS1A 4OBEA 3ND9A 2BEKA 4D0GA 3LRPA 1T3HA 5C18A 4I4LA 3EAQA 3K53A 3N5CA 3LFUA 1DG1G 4C0AC 4PQYA 3CZPA 4LX0A 1BO6A 5CITA 2WJYA 3VR2A 1D2MA 2BC9A 2WAXA 3HPRA 2G77B 1RVDA 3FWYA 1R10A 1XD2B 4Y0VA 4DSTA 2R6FA 2QQ0A 1KYIA 4MDFA 1VKJA 1ZBDA 2QBYA 1X8KA 2E87A 3A1UA 3THWA 3LNCA 1JAHA 2VL7A 3VMFA 4Q01A 1M7GA 2NO0A 5JFGA 1OFHA 3WP0A 3MG9A 1Z6GA 2JIZD 3FHCB 2ORVA 1ETUA 1DAGA 4URZR 1DAEA 2WSSA 4OQLA 1G4UR 4E03A 3ZVMA 1EESA 1Z06A 4ZV4A 1E2LA 1HT1E 3WYGA 5FOWA 3U6BA 3GJ0A 3CRW1 1JPJA 1ANKA 3HJNA 1L7VC 1OHHD 4D4MA 3THXA 1W4BA 4BPBA 3BAFA 3SOPA 1OXTA 4JS0A 4TLBA 5AJWA 1KK1A 4LOAA 3SFVA 4RKEA 4DBLC 2FGKA 3I62A 2EVWX 4GBMA 4YXWA 1E2EA 1G17A 2XJ4A 3QPVA 1KI6A 2UKDA 3B7GA 4M9SA 2IS4A 3HPQA 3REFA 4XJXA 1M1YE 1S1CA 3MRSA 3TW4A 1UDXA 1XMSA 2IEZA 1FTSA 4IVQA 4K46A 4I1UA 1W2HA 5GJCA 5TY0A 1EFHA 2D74A 4HI0E 2YC4C 4RKFA 5JRZA 4A4DA 1OJLA 2BDTA 4P4TA 2Z4SA 4ACBA 3NC0C 1Q22A 3GLGA 2VRWA 3IKJA 1TF2A 5FL3A 1CJTC 1YZTA 1GAJA 1XDBA 3DZDA 3RYTC 1R0WA 4P31A 1NL3A 3VKGA 4UNPA 1NMXA 4KV9A 4LBWA 2HDNB 4MKFA 2QM8A 3RRMA 1UPTA 2O52A 4LJ7A 5JHGB 2KE5A 2PEZA 3K9GA 1SVSA 4BECA 1U8ZA 4DEXA 3EPKA 3I1FA 1Z08A 2UVQA 3QVVA 4V0LA 3C14C 4AWXA 2FA9A 1RKBA 4LJ4A 4HAYA 4I81A 1HT2E 4IEEA 1MH1A 4FCVA 1AS0A 3BFXA 5JWHA 1XZQA 2H7VA 1CR1A 2J45A 4NONA 1XF9A 5KNCA 2IW3A 1YR6A 2C8VA 3IEVA 2GK6A 4BLTA 3M6AA 1TQ6A 4TTPA 4HUQA 2MSCB 1XCMA 2J0UB 4NPHA 3CWZA 4O3MA 4GNKA 1FL9A 4HB4A 1GM5A 1ELOA 1E0KA 5BQ5A 3K0CA 3CONA 1TL7C 1WCV1 2H8KA 1DTSA 3FHOA 2AD5A 5H68A 4FD2A 3PV0A 2E1RA 5KHOC 4W5JA 3IO5A 4BFZA 3HYRA 4PSVA 4NCNA 5FPSA 2QP3A 4BRWA 2KBFA 3J81k 4HB0A 3ZD6A 4F38A 5BN3A 3D6TB 2JGNA 4Q4JA 3GFPA 4QGAA 2O8DA 4IOLA 5HPYB 1DOAA 3P27A 1FZQA 1GL6A 1IM2A 4HDCA 2G88A 2ZI9A 1TQ2A 2OESA 2BBTA 3QBTA 4Q5IA 2WJJA 2FG5A 5FPTA 4MYHA 3TMKA 5JCPA 1G1MA 2J46A 4LPSA 4FMCF 4B2IA 2OHFA 3EC1A 1FQKA 3AP2A 4OI2A 4Q21A 1DO0A 3A1SA 4X8MA 3ZQJA 5JCZA 1UKYA 3I61A 1HUQA 1XPUA 2Z0MA 1NBMA 5JS8A 1WB9A 2QEQA 5CLLA 4B34A 1LFDB 4YMTA 1OYWA 4KVGA 3AV0B 3RNLA 5DI3B 3THWB 1UEIA 5FTMA 4C0KA 4JMPA 1NSTA 4WA7A 5FOUA 3W8RA 2MMGA 3KTAB 1Y63A 4RD0A 3TSWA 1GP2A 2CNWA 1N3BA 5B30A 3P1JA 4GI7A 1CJMA 3BH6A 5EP1A 4N1AA 4LCBA 2ZVQX 4GSYA 1L2TA 3THXB 3NBZC 1U8AA 3TRFA 1RJ9A 1VIAA 2QA5A 3VR1A 3A58B 5C2JB 2DPXA 3CPJB 3PCRB 2NGRA 4NTZA 3FMIA 1XEXB 2ZRJA 1AQYA 4Q19A 1JR3E 3U6KA 2W2TA 5KSYA 1NF3A 3UWKA 1NN1A 4Q4AB 1TUEA 4D81A 4HAZA 1KSJA 4BFUA 2JLYA 4J0QA 2Y8EA 1G21E 1SXJB 3E70C 4KBFA 2JATA 1P2SA 2YHSA 2IYYA 4U00A 1M7HA 4HLUA 3LQRA 3B8HA 4JLNA 4KHZA 4C0LA 1OKKA 1DVRA 2VSXA 4IVPA 5CM8B 3U60B 1XTKA 1O3YA 4BASA 2IS6A 1W5SA 3BD9A 2GVDC 5L3RA 3B85A 2REXB 4OK6A 4A2PA 2YKGA 4XWAA 4ITRC 1D9ZA 1G8YA 3BWDD 2CHVA 3X2SA 2FV8A 1ZW6A 3W34A 1YJ5A 4A0GA 4WBSA 4W5WA 3SZRA 2GRJA 2A5GA 3QPWA 1G8PA 4UJ5A 3X1ZA 4P4UA 3C16C 4QBIA 4AD8A 2KBEA 4NE2A 4C7OB 2HXSA 3NHAA 2VP0A 2RAPA 5DYGA 2I1VB 3BERA 3AVQA 2FGJA 2EW1A 3VR4A 4XVUA 2ZJBA 4BRUA 3W3ZB 4TYNA 1OV4A 3VHLB 1KAGA 2OXRA 4EPYA 2RGAA 3NEYA 2IS2A 1SXJE 2DWPA 2GJ8A 3IHLA 3SC3A 2LKCA 4OJKA 3TLXA 3UATA 2CL7X 1CEEA 1KI2A 2V55B 4M9XA 5DSZA 5FR2A 4LC1A 1ZD1A 2VLIA 2ZJOA 3TH5A 4BFSA 3BH0A 2HV8A 1XJQA 4IFEA 4A0HA 1XTQA 2GAOA 4LHWA 1CLUA 2R6DA 4FI3C 4HLDA 1RPZA 1SKYE 3SFZA 1NNEA 1DO2A 1ZD9A 4E5UA 5EE0A 3PEWA 5GJBA 4JLJA 1KO1A 2MSEB 3MWKA 1YKSA 2V7QA 4BQSA 3EPJA 3SYLA 2QPOA 2RGNC 1CR4A 2WSSD 2XOKD 2VHTA 4XIGS 3IPYA 2VHJA 3WHKA 4IKEA 2P67A 3BC1A 4PC7A 4PC2A 2GEVA 5AWFC 4P0TA 1SVKA 2QTHA 3Q7PA 4AKIA 1EFRD 2WKRA 3KZ1E 4PHHA 2VHUA 5L3SA 4HB3A 2QZ4A 3THOA 4UKDA 1CJVC 3EIQA 2RHDA 1WDTA 3IBYA 4AK9A 3B60A 4V0MA 1EK0A 4U5XA 3KQUA 3T1QA 1R0YA 2ZS7A 4YONB 2FSGA 1GFIA 2BVNA 1IN6A 4RD2A 5EZ5A 4NH0A 1K6MA 3CX7A 1TX4B 3WMFA 1N6NA 3T06B 1H65A 3GCGA 5DI3A 2AWOA 1W1WA 4DCVA 2ZRPA 1UKVY 2WKPA 3B9QA 5HTKA 5ANRB 1SULA 4DUGA 4N0DA 3O8BA 3LV8A 2XB2A 2QAJA 4N3NA 1XJ0A 4TLAA 4G0NA 1RC8A 2C04A 2NTYC 3I32A 4JVSB 1CF4A 2P3SA 3AUXA 2NO1A 1KKMA 4C3ZA 2IK8A 2IYUA 1T3SA 3EC2A 3U3OA 5TMPA 2R6AA 4EDHA 1N25A 3CF6R 5CB8A 1CP2A 3Q3JB 1F2TB 1UKEA 5IK2D 5HZHA 4ZI2A 3GQBA 4K81B 1AIPA 3LDAA 4JBXA 4PQRA 3AKDA 2HLDA 3QKRA 3QG1A 4XD7A 3TJZA 4TZ6A 1OW3B 2WJHA 4QHTA 4WAUA 2A78A 3DKVA 1JJVA 1R5NA 1FMLA 3TSZA 1XMJA 2CCJA 5TV2A 3D7MA 3VR5A 4BFWA 2QBYB 2ZSAA 3AVXA 1RW4A 4D2IA 5E7MA 4DSOA 4C0QC 1JBKA 3F5FA 2FH5B 4AKGA 1XX6A 4GL2A 1KI1A 4HEJA 1TAGA 3SBEA 2QP9X 4HAXA 3NBYC 1K5DA 2GEDA 4II7A 2IXFA 4B6FA 2ZI3A 4LPKA 3LBHA 1FFHA 2IYWA 1NG9A 4CEHB 2JLVA 3AF0A 4CW7A 5EE3A 2IXEA 2ZSBA 3GJ3A 4DLSA 2J0SA 3CRQA 5EXSA 5AUQA 2IT1A 3MWJA 1VTKA 1OXXK 4LJYA 4GFDA 4F91B 2CK3D 4Q9JA 4ZIRB 1QRAA 1Z0DA 1J7KA 1VPLA 2CL6X 5CB6A 1VG8A 2I3BA 1E2IA 1F5NA 3HYTA 4HAUA 3TVTA 1QF9A 1Z0AA 3W9YA 2GXAA 4KJZA 4MITA 1XEFA 1JR3D 2YWEA 3EW9A 4RZXA 1IXZA 2AK3A 4TMWA 3VU9B 2FMXA 2G3YA 4LC0A 3FHTA 2FFAA 1YZGA 1RIFA 4BFVA 2ERXA 3EXAA 1BIFA 3NH6A 1Z83A 1E2JA 1V5WA 2NZJA 1ZM7A 5FI1B 4B44A 5JI2E 4B2LA 4IXMA 5FUXA 4DLZA 2NQ2C 4QC2A 2R8RA 1VYUA 5A4JA 5JJLA 4FMBB 4BLQA 2J5XA 5KSOA 1TU4A 4M1OA 1O87A 4PC1A 2P6RA 2PX3A 2IA5A 1NVVR 4Q4LA 4Q9IA 1N6PA 4DHEA 2A3RA 1A82A 1UFQA 3SDZA 1JQJC 3QXHA 2ZRGA 4ZDWA 2BV3A 4LI0A 2WJIA 3GJ7A 5FTJA 1NLZA 1NLFA 4UNQA 1NKTA 2IWRA 5J4YA 1PZNA 2IWHA 1N0UA 1NJGA 3L82B 4RD6A 4YDHB 1GOTA 4YMUA 3EARA 1ZRHA 2EFEB 1E1QA 4AY2A 4BEBA 4JSYA 1MO4A 421PA 2J0UA 3L2OB 1N5JA 3SYNA 2JDID 5SZJA 3UXMA 1U90A 1N6OA 2D3WA 3S1AB 2ZRHA 3E2IA 2Z5FA 5EXXA 3SQXA 1G41A 3CUEF 4EJSA 2ODBA 3LWNA 4RJLA 3RHFA 2ZI4A 2FFQA 1J70A 2DR3A 2OCYC 4LY6A 4Q1EA 4TT3D 4JT2A 2A2ZA 4GMDA 3L0OA 1QHHB 1SVMA 1UADA 2H92A 2P65A 5FH9A 3VHXA 4LBVA 3KKQA 2P0EA 2J7PD 2ZJ2A 4PR0A 2QMUA 4RZ3A 4Q4JB 4ZPXA 4NHOA 4NCHA 2B7CA 4DDVA 1II8B 3GP8A 1AZSC 3PXGA 3LVQE 4DIDA 4ILEA 4NYJQ 2BBSA 1F2TA 5GVRA 1XCGB 1PUIA 3WRXC 5TXGA 4BWYA 5F9FA 1JALA 3JVVA 3K0AA 2AN9A 3LY5A 4C9BA 2O8EB 2FPKA 4PC6A 2CXXA 3K09A 3T15A 3AF1A 2Q0HA 3X1YA 2GNOA 3DMNA 3G0HA 3LQQA 4Q7JB 4Z51A 4US2R 1N5KA 3WNBA 2YWHA 2YV5A 1U98A 1E1RD 2WWGA 2ZE8A 4ASUA 1J2JA 1K5GA 4Z1MD 2OXCA 4Q00A 3GMTA 2DB3A 3LD9A 4D4LA 1W0JA 1H8HA 3T5GA 4CVNA 1FPMA 1Q57A 2W6ID 3QUSA 3UK6A 1BKDR 4URXR 5HR5A 3ZLJA 3CRMA 2OV2A 5CK4A 1KNXA 4TL7A 5FBRB 2DYKA 2RB4A 2FWRA 2Q3FA 5GJWC 2V7QD 3A1VA 2FSIA 2GJAA 3MLEA 2XOKA 1OH8A 1VCMA 4BGDA 3MJHA 3Q7QA 1D9XA 5CM9C 4Q4AA 2XEXA 3NDBB 1QG2A 1LV7A 1S4QA 1US8B 1F2UA 1K8RA 2XZOA 4CIDA 2IYRA 3DL0A 5F9HA 2F3TA 1GL9B 4G5OA 2HT1A 1GDDA 4I1VA 2ZXUA 3CW2A 4ARZB 3U2QA 4C2UA 4QNMA 5F98A 4QGFA 1E2QA 1W49A 1C1YA 1NN3A 5H70A 521PA 4EQ6A 3EIHA 5IRCD 2EFDB 1KKLA 3PEVA 5L8VA 3W6PA 2FPLA 4IFBA 5CJPA 4B6EA 5JSZB 2XNDA 3WP1B 4MH0R 1EFRA 1TU3A 1YE8A 4F4CA 3CWQA 4TTRA 1A1VA 3ND8A 1ZNYA 3H2YA 3AKYA 4KFSA 3SN6A 2IBMA 3I4LA 2KSQA 4TMTA 3QG5A 4PAMA 2QMHA 1DG3A 5AJZA 3AUYA 4GRAA 3ZD7A 3SJAA 3OEEA 4UNNA 2WJVA 2C95A 2YOHA 2YOFA 3KXKA 2HJGA 4H9GA 2R6CA 1F60A 2O8CB 4D26A 1Z6YA 2ZPTX 5E7IA 5JI3E 5K8LA 2RH5A 4DB4A 3CKLA 3OAAD 2GKSA 5B57C 4YC7A 2OFXA 1KHTA 1HQYE 2QTFA 3P32A 1JEDA 2F1IA 1EWRA 4UNSA 4M53A 1KMQA 4WVFA 4BFXA 2OE2A 2GAAA 1U0HC 5DN6D 1UJ2A 1Z22A 4DRZA 3C8UA 3OE7D 4C2TA 5FFMA 5CJ2A 2GILA 2F3RA 4M1SA 4Z8YA 3SNHA 1XCPA 5FOVA 1YRBA 1U9IC 1I2MA 1NY6A 2BJWA 1AA9A 1BOFA 4NU0A 2XSZD 1G9XA 4AG6A 2J0QA 3KKOA 3GD7A 4A6PA 2IUUA 1AGPA 4QXAA 5UKDA 5FPYA 1FUUA 3EWSA 2AD1A 1EFUA 1BH2A 3AKEA 4PXAA 4NP6A 1SVIA 4FWTA 4IDQA 2MMCA 4FWIB 4JLKA 3HWSA 4BLRA 1G16A 3KL4A 5EP3A 4TYWA 1Q1EA 2IYSA 3T5DA 2R62A 3O47A 1E2HA 3F8TA 1W46A 1AM4D 3K0AB 3TQFA 4FINA 1WXQA 1B23P 3OZXA 2OCAA 3WXMA 2ZR7A 1NIJA 1R0ZA 3BB4A 3O8DA 4B71A 3U3RA 3GJ5A 4XTRA 4LBYA 4IDPA 4O2LA 2P6NA 3CNOA 5IK2A 3DO6A 3K9LA 4BZPA 2VA8A 4L9SA 5AJXA 4A8JC 1B0UA 2ZJZA 4CT5A 5LB4A 3OAAA 2Z83A 2D62A 5J4KA 3G5UA 4PHTA 1CR0A 1RRFA 2VHQA 1XZPA 3U3MA 2ZEJA 4MGYR 4TSFA 4EPTA 1OFUX 3ADKA 2J41A 4IEIA 1Q12A 3C7KA 4ACAA 2ZU0C 3I92A 2CJWB 3SU8A 4PPNA 4A15A 4QJ4A 4CGZA 2FX3A 1FMJA 1RZ3A 1M6NA 4Q47A 3RS2A 2ZM5A 2CMKA 3IIJA 1JXMA 4HYYA 4BLSA 1Q1ZA 3QKRB 3QVUA 1F2UB 2EFGA 2QSZA 1MO5A 3EA0A 3WYFA 2R9VA 2C03A 1UBFA 4GZLA 4YMSA 2A5FA 3AH8A 2ZI7A 2V8OA 2WWXA 4EKDA 1F3OA 3HU3A 1E79A 1ZM3A 3UWOA 4DZZA 4OHXA 1W4AA 1ZNXA 3OEHD 4NDZA 1S3SA 1RYHA 1UBEA 3TR5A 2XTZA 1CIPA 2OEPA 1E0AA 3UIEA 5J40A 1QHXA 1H8EA 1HTWA 3TIFA 3ZZUA 1FP7A 2JJ2A 2C99A 3MGCA 2WIAA 4OL0A 5JSZA 3AVTA 4EPWA 1ZAKA 4LK2A 2C2HA 5IT5A 2CCKA 1N6KA 1UM8A 4F92B 4QOSA 3W6OA 3FFAA 1E2FA 1KSFX 2I1QA 1HURA 4AG5A 4F4JA 1OKKD 3K09C 4ZCLA 2R2AA 4EUNA 4GP6A 2ZVPX 2WMOB 1GVNB 1DAIA 1CU1A 2GVZC 4TLEA 2REOA 4D6PA 4DVGA 1RRGA 4PFSA 4V0ME 1JR3A 5DE3A 2P6UA 4M21A 1W5TA 2RGBA 2QTVB 4AYWA 3IQXA 4TL8A 4GOKA 3VU9A 3CF0A 1TADA 4PTLA 3SS8A 3QIAA 1GIAA 3UKDA 1KNQA 1ZM2A 3ADDA 3N2IA 2IUSA 1ONBA 4LYHA 2JEOA 621PA 2PBRA 1EFTA 2VIIA 5BYJA 1MT0A 5JLJA 2QAGB 4L15A 5D3QA 2WSMA 1I2DA 1ZJ6A 4MA4A 4LHZA 2ZIAA 3FTQA 3FB4A 1AK2A 3SJZA 4MYCA 4Q02A 3ZH9B 1BMFD 2C96A 3KFXA 2J0VA 1YZUA 4HDOB 5JMTA 2WPDA 1DAKA 1E1QD 2VP2A 3FMFA 4ZDJA 3JZMA 1ZVQA 1BS1A 2LCFA 1E4VA 3IO3A 1XWIA 5HCNA 2PL3A 3GLHA 4ESVA 1CKEA 2G6BA 5GJVC 2ONKA 2QRNA 4AC9A 4DKXA 2G1KA 2OBMA 1Z07A 2F7SA 2OG2A 1TQDA 5G3YA 4LJ6A 4RFSB 2H16A 1CXZA 2ZRLA 2FJUA 1UF9A 2V54A 2H18A 3KJHA 1H8ED 2OT3B 4P4SA 5H1YA 3BORA 5KPJA 3FGNA 1P2UA 1E2GA 3OE7A 1XB2A 3QKUA 5DIFA 4UJ3A 5LD2B 4B33A 4LDJA 4A0FA 4CZ2A 3TW8B 3BIFA 4I99A 1IJFA 1OLOA 1W2GA 2CHQA 2ZRKA 1ZNWA 2AX4A 4P33A 1P2TA 4HATA 1NIPA 4TZ0A 3IGFA 4B3GA 1E0JA 2UZIR 3CZQA 3T1OA 2VPPA 4G5QA 2V1UA 3FYHA 1U99A 1G7CA 2BM0A 3CNLA 3VQTA 3I8SA 2GJSA 2ZRMA 2F1RA 1W0KD 1G64A 2AXNA 4HZUB 2PCJA 4LYAA 5IF9A 1W36C 1PVOA 3C4JA 4BUJA 3W3AA 4OQFA 2NIPA 4Q03A 1SKYB 2ZJ8A 5H8WA 1ZD8A 3GLIE 1SHKA 1AKYA 4OQXA 3R8FA 1CTQA 1KO8A 2OUKA 1LF0A 4DT1A 2LKDA 3EZ2A 4EFNA 3DPUA 1DS6A 5EUQB 5E3HA 4MRVA 3LW8A 4ZCIA 3UANA 3BE4A 4BFYA 3EZ6A 3K1JA 3QQ5A 5DNYB 5KSZA 1NMYA 3MAAC 1Z8FA 4HB2A 1QHSA 4LV6A 3B1ZA 4RD4A 4ASUD 3C5HA 4R98A 5EXPA 2QSYA 3ZJYA 2WJGA 2ZRNA 3VTKA 4BE7B 3KQHA 2FFBA 3KJEA 2L0XA 4R71A 1ZYUA 2CBZA 2ZRDA 3IQWA 4Q1DA 4OHWA 2GESA 3GJXC 3LA6A 4XOIA 1GKIA 4LRWA 3Q85A 2GCNA 2JDIA 5K8TA 5LD2C 4QL3A 1XTJA 1TQ4A 3Q5EA 3GFOA 1AQUA 4XVQA 4OI0A 2IF0A 3L0PA 3KB1A 4RZ2A 4KLZA 4DCUA 1NG1A 2WICA 3PFIA 3ZIAD 1EFCA 4L8GA 4LWZA 4TYPA 4EPRA 5EP2A 4PZYA 2GZAA 4EPXA 4IOJA 3W5JA 2Z43A 4KYUA 4JVNA 1XXHE 2X8AA 3AP1A 3A36A 4M2LA 1WA5A 4B32A 2BMJA 1IY1A 2J7PA 4BFTA 2QORA 2C78A 1YR7A 3DOEA 3RC3A 5AUPB 2B7BA 4OQMA 1EGAA 4Q48A 5FR1A 4QBHA 1SKQA 1G3RA 4EQ6B 1L4YA 4M1YA 4PC3A 1A2KC 5DYIA 3SJBA 2SHKA 1SVWA 1OHHA 1C4OA 1U2RA 2BCGY 2G0NA 4G5GA 3FDIA 2XXAA 3THYB 1R5BA 2VSOA 1W36B 1NVWQ 1IN8A 3A37A 2PJZA 4I1SA 2CCGA 5FUVA 1NSFA 4CEIB 3AVOA 2YNMA 5DH9A 1GZSA 1XXHA 4JSTA 4LYFA 5KTYA 3U5ZB 4JLVA 3PUWA 4Q66C 1MO6A 5FUWA 1MABA 2A5JA 4TSFD 2BMDA 2ECKA 1VDZA 5EE1A 5L3QB 3H0KA 1S96A 2DHRA 5B2ZA 2D2EA 1PV4A 2HJVA 3MSXA 3MFYA 2BMEA 3BRWD 2RGGA 3ZVNA 4D80A 1VG9B 4QKQA 3UG6A 4PPFA 4LV8B 2LWIA 3W5IA 3KX2A 1Q21A 5EJEA 2QNRA 3WHLA 2AFHE 5FOXA 1IY0A 4LBZA 4OI4A 1P72A 1YZLA 2QGZA 2V1XA 3ZIAA 2JLUA 4NL4H 4CDGA 2G1JA 2O8BB 1MKYA 2IHYA 2ZSFA 4NCKA 3GPLA 3A1WA 2YZ2A 1WQ1R 2D4HA 4EIWA 5KSPA 2PZEA 4RFVA 2ZUCA 1N2CE 1OXVA 5P21A 4NYMQ 3OIUA 1QG4A 4KXFB 3QXSA 2N1BA 3GLFE 3QF4B 2CLDX 2K5UA 3CM0A 2FOLA 3FE2A 1A7JA 2ZSDA 2AHOA 2OFWA 3NXSA 4DCSA 2X19A 5KOYA 3HR8A 3MUFA 1NRJB 3EIEA 1E99A 1X86B 1QVRA 2QN6A 4C30A 3RVBA 4IRUB 2ZETA 2XZLA 3H1TA 4FXPA 4B3CA 4E22A 2GBLA 1I4DD 3K0CC 4PPQA 4D4JA 1S8FA 2ANBA 2WWIA 5J47A 5IDVA 5HE9A 4LHYA 2OO7A 4M1TA 2OLJA 3X1WA 3OEHA 1N6IA 2IC5A 1OB5A 2JLWA 5DGXA 1ZINA 1XPOA 2FU5C 4DB2A 1S0UA 2EU8A 5K8UA 1EWQA 3B2EA 5CK5A 1T8UA 1E3MA 5FL7D 2JIZA 2QRZA 2NPIA 1VECA 3HU1A 4JLDA 2G9NA 3WBJA 4JVLA 1E9RA 1RRCA 3I5XA 4KU4A 5CIWA 1P3JA 3FKSD 1Z63A 1KK2A 3EG5A 4DIEA 2ZRIA 1COWD 1GTVA 1X6VA 2RCNA 3V4FA 4EPVA 4KITB 5KU1A 1U8YA 1DBSA 1G5RA 3K70C 1Z2CA 3G82C 4RCZA 1XEWX 3D8BA 4AKHA 3KUDA 1E9DA 2YWGA 4DSUA 2GDJA 4M9ZA 5EE5B 1SVLA 3C41J 2B6HA 4TQ9A 5BWMA 4Q9LA 1TEVA 2HEIA 4CEJB 2JJ2D 4HUQB 4LV5B 3I3SR 3GEEA 1OH6A 4NMMA 1U94A 3QEOA 4ERNA 1Z6XA 2QE7D 1Z47A 1XPRA 3PVSA 1JPNA 2ZR9A 2B8WA 3U7GA 2FPMA 3ASYA 1KIMA 5L3VA 4Q9KA 1Z5ZA 4M22A 1AS3A 4U02A 2F43A 3TGPA 2P5SA 1MRNA 4HLCA 1G4AE 1J8YF 3BS4A 2VF7A 3SYKA 4PAQA 3MCAA 3TSOA 1XJCA 2N42A 2OAQ1 1E0SA 1LS1A 3CNNA 4FMDB 4M0LA 2NMVA 3QKTA 5AUOB 4G5RA 1ZCAA 821PA 1HY3A 2ZREA 4FMCB 2RKOA 4U7DA 2IYZA 1W4CA 3BB3A 4F7WA 2WOOA 4IW3B 1IQPA 1Z6AA 5LDDC 1QVAA 1R6BX 2A5YB 2FE4A 2O0HA 3RS3A 2EFCB 5F3WB 1W0KA 2GHIA 4LJ8A 2O8FA 1JEEA 1N0VC 2XJ9A 4UNRA 1N6HA 3RRNA 4YMVA 2GTPA 1JJ7A 1MO3A 5LB2A 3B1VA 1KZ7B 1PUJA 3VKWA 1GILA 3W6NA 4TYYA 4RD3A 3SQWA 1OT3A 2VEDA 1G19A 3GLHB 1FQJA 2V4ZA 3KTAA 1TEXA 1X8JA 1Q1BA 4OKSA 3WMEA 4Q18A 5FOTA 3RSOA 2GXSA 2DBYA 5E4FA 3K70B 3PR1A 3ASZA 1KI8A 5DO9A 1OE0A 2IL1A 4DLWA 1SXJA 1SHZA 3SE0A 3FVQA 4JLPA 2ZYWX 1Y3AA 1N5LA 4E07A 1C9KA 4TMZA 1RRPA 4TMXA 1NN5A 2ATXA 2G83A 4NYMR 2PLRA 3M1IA 3BXZA 2RHMA 2W2VA 2YWFA 1QHYA 3NWJA 1EXMA 1GNPA 3HU2A 5AJVB 2NG1A 3PG5A 1ZM9A 2V9PA 3CRVA 4L5BA 1F48A 1XBTA 4MRNA 3H86A 4JKIA 4QBGB 4WXRA 4XSHA 4C0SA 2ZSEA 2TMKA 3IUYA 2PZFA 1XD2A 3AVPA 3GJ8A 3R7WB 1QHGA 4TYQA 3U3KA 4NYJR 3DKPA 4JJZA 2YYZA 1OH5A 2OLKA 2QL6A 2ZE5A 3IPXA 1I4LD 2REBA 4MUBA 3UMRA 3V9PA 2H57A 1VYVA 5AUNB 1L4UA 4K8OA 2QAGC 1F6BA 3QE0A 3L8YA 1DELA 2Q9AA 3GLHE 2EWVA 5FUYA 3WNDA 1Z0IA 1KI6B 1NY5A 3F3YA 5HCIA 1EX7A 4L9WA 4KSCA 4R2IA 5A5GA 3OHMA 4Q7MB 2VP4A 1UEJA 4FCTA 1XMVA 5LBIA 1BYIA 4CT4B 2XZPA 2EFHB 4US0R 2WWHA 3E5HA 5JHHB 2ZR0A 2WHXA 4C7OA 1NKSA 4W9MC 1YZQA 1GRQA 2GXUA 2FF7A 3GLGB 5BW8A 2PCLA 3IHWA 1MRSA 2BIFA 3SHFA 1HE1C 2CE2X 3QBVA 4LHVA 5CDFA 1P9WA 2PT5A 3NC1C 4A6XA 1TMKA 1ZC3A 2F1HA 121PA 1U0JA 1G291 1P62B 3KXIA 1LW7A 2WAYA 1E96A 2VHCA 3CPHA 3NBFA 4EJSC 4QFMA 2ZAMA 1CRQA 2R6GA 5JWRA 3FKQA 4DLYA 1Z0KA 1E98A 3R9WA 1OB2A 4OK5A 5IHPA 4KO8A 1FNNA 3I72A 4X8HA 4EFLA 1S3GA 2Q6TA 5CDFE 2A5DA 5AK0A 3VR6A 2ZRBA 3CIOA 4DLVA 2VQSA 2PZGA 2CNWD 1T9HA 4WZBE 4JT4A 3P26A 3PQCA 4QJ3A 1T4GA 3HDTA 3B6EA 4NZYA 5EUMA 2OSBA 1P2VA 2C9YA 2QT1A 3T12A 1J90A 4XWKA 4D25A 2GCOB 5FTNA 5G41A 2QT0A 3NG1A 4A36A 3Q8XB 4DDTA 2GCPA 1YR9A 2BCJQ 721PA 4MGZR 3A4NA 1XNJA 2R65A 2HF8A 1U81A 2J59A 1LF5A 1JNYA 3ZS9A 1GKYA 2XB4A 3C5CA 2OAP1 4XSGA 4M9QA 4IJMA 4Q7KA 3NVAA 1XXHB 2BHRA 2EWWA 2F1JA 3MJRA 2V3CC 3VNVA 1G3MA 1PLKA 4JKYA 1DEKA 3D3QA 4O0MA 2Q3MA 5AJYA 2DFTA 3TBKA 2CLSA 1II0A 3KKPA 5FOSA 1S9DA 1P61B 3EZ7A 2FN4A 3QKSA 5G3ZA 2R44A 3KDSE 1OSNA 3CH4B 2PLFA 5FTLA 2O8DB 2WPDD 4KCGA 2YVUA 1QZXA 2JLZA 2Q9CA 1L8QA 2E9SA 2NOAA 4URUR 1KAOA 5DHAA 2JJ8A 2RGXA 4A92A 4TN1A 1JI0A 4JLBA 2XSZA 3TAUA 2ZS9A 2VP5A 2ZRCA 1IXSB 3B9PA 3K8YA 2OBNA 3O8CA 3PUYA 3U7FB 3LO5A 5JWOA 3I5YA 5E95A 3WYAA 4MRSA 4B73A 4ZIRA 2J3EA 4ZKDA 2NO7A 4NKRA 5TB5A 4B47A 2FNAA 1Z3IX 1XEWY 4JYBA 4PHFA 5D3MB 4XH9B 1GWNA 4XTCS 3LLUA 1Z28A 4XVRA 4ZDIA 4M8NE 4V0KA 1RJ9B 3T1TA 5SZHB 2B21A 1E2PA 4RVCA 4US1R 2IUTA 3M4YA 3WNCA 2C98A 2AFIE 4Q1CA 3CX6A 1OXSC 1XEXA 3NTUA 3K9NA 4JLAA 5SZIA 5AR1A 4OHYA 2NPFA 1OXUA 4TTQA 2BKEA 2J7KA 4R2HA 2GWHA 4B3XA 1KO5A 2YC2C 4QG7A 2HUPA 3M0EA 5CYOA 2QROA 4H1UA 1AKEA 3W8NA 4URWR 1E94E 3TNFA 1P73A 1VMAA 2AKAB 1WMSA 4IDOA 2IXGA 5FBQB 4DXAA 2ZU6A 2OCBA 3VAAA 3B1WA 3CLVA 3ZZTA 2IYLD 2QMEA 3DM9B 1D5CA 3CH5A 4PO8A 3IILA 3QJYA 4JLMA 1WE2A 2AL7A 3EX7C 4H1VA 1OFIA 3R20A 3V4RA 5FL7A 5FPHA 4DC9A 3CX8A 4JL5A 2CDNA 4WZ6A 4TL6A 2Z4RA 1KSGA 1AZTA 1DAMA 4P3YA 4C0HA 1D8TA 4HZIA 2D06A 1XTIA 4URVR 4PAOA 1CBUA 2BEJA 6Q21A 4DDUA 3DMDA 3KQKA 2WWWA 4L4UA 4CYMA 1OPXA 2BM1A 3F0TA 2RMKA 1DAHA 1KDRA 4LGMA 2X1VA 1IN5A 1AGRA 2GCOA 8OHMA 5HKKA 1CS4C 1P6XA 4LHXA 2PX0A 1H8HD 2ORWA 2OCPA 3CR8A 4CEJA 2JLSA 2OM2A 3ETLA 2GZHA 1NMZA 2I4IA 2CE7A 5M04A 5EP4A 1KJZA 4KODA 3GJ6A 3EPLA 4Y0AA 3Q72A 4D0LB 1P9RA 1G7SA 2IYVA 3CPEA 1TF7A 1T91A 4HLUC 2W2XA 2GZDA 4V0OA 3QPUA 3T1VA 1E2NA 2GEUA 5KPDA 3AM1A 2YINC 3IBGA 3VKHA 3OFNA 1G8FA 1M7BA 1P75A 2O0KA 2QPAA 3DHWC 4M1KA 2QPTA 5FPKA 2PH1A 3AVUA 1P7CA 4X8LA 2XAUA 2BBWA 3KB2A 3ONWA 2WBLC 1NN0A 2DFLA 1VG0B 1VCOA 2VP9A 4PZZA 2NO9A 1N6RA 1FW6A 2FEOA 4DJTA 1KJWA 4GOXA 1II8A 1AN0A 1S2MA 3PITA 5L3SB 1P60A 1GL7A 4JJKA 2N46A 4XWOA 3RS7A 4IOKA 1W36D 1M8PA 1M2OB 1NP6A 1KI4A 3KJIA 4B3FX 3LAWA 4PSKA 3AQ4A 2CHGA 5KNDA 3AP3A 3QXCA 3SJCA 4WIAA 3WY9A 4RD1A 1VG1A 2D7DA 2O8EA 3ZQ6A 1KY3A 4B3DA 1SZPA 4LJAA 3SHWA 3TUIC 2W0SA 2WIBA 5DHFA 3RAPR 4A9AA 1CJKC 3FMOB 1W4RA 5FBVB 1GRNA 1GUAA 4YMWA 1QDEA 1Z6TA 5FBWB 2PJRA 4ON9A 1FX0B 1IN4A 1XTSA 4N0EA 3TVDA 1T0HB 5JS7A 3T35A 5D3MA 1KMHB 2FZLA 4DCNA 4JL8A 1J99A 4TMVA 4AKEA 5CIQA 5A0FA 4ARZA 3AB3A 1CJUC 3TUJC 2BMFA 2JJ1D 4HLQB 2KI5A 4Q9HA 1G20E 1ZM4A 1GITA 4D82A 1U9IA 4GZMA 4RY2A 1E2MA 2WZQA 1ZIOA 4LYJA 3GJ4A 4GP7A 1AS2A 1R0XA 3R8CA 3D31A 4IXNA 4HAVA 1KI9A 3OF5A 3R7WA 3OESA 2O0JA 2W83A 2ODEA 4G5SA 3NIBA 2VP6A 3GLFB 4POAA 4UXIA 1TTTA 1OH7A 1JECA 2ZITA 3RS0A 4TWZA 1ZNZA 2GF0A 2HXYA 3VR3A 4RCYA 2PT7A 3L8ZA 5EXTA 2F9MA
chains in the Genus database with same CATH superfamily
1OXBB 3K6JA 1KAMA 3HJUA 5ALGA 4RTRA 2G80A 1YBMA 3IDAA 5FX2A 1QHIA 4C2BA 3KJXA 4ZFNA 2VPXA 1Q1NA 5CX1B 1BD4A 3ILXA 2ON6A 1Z7BA 2G40A 3IQGX 4N49A 4P5PA 5F3DA 4CEHA 4WN3A 4JZKA 1XDGA 3SXUA 4HDMA 2HBYA 4HSEA 1PW5A 1UC8A 2AE2A 2H85A 2MSLA 1TJNA 3B52X 2V7BA 2NNLD 4NVRA 4RKYA 5ALIA 2GRAA 3DBRB 4B6OA 3B3JA 2NN3C 4JVMA 3NHKA 1O6ZA 1DJOA 1HV8A 4Q4HA 1HYQA 1NJFA 4OP1A 2CVPA 1ULAA 3GZJA 5BSEA 4FPXA 4MVWA 3FX2A 2CL0X 1P1RA 4ZZ2A 1HFJA 4RLSA 4BNTA 3BT7A 2VNIA 2N9UA 3NGXA 3N70A 3TNJA 4CNQA 3AG6A 2C4TA 3SHOA 3ITNA 2Y0CA 2HCBA 2X5OA 1BAPA 4A0SA 2MINB 3B78A 4Y1EA 3IAS6 4BNJA 4CG1A 3OZGA 2G1PA 1ZL0A 4YJ3F 2WJAA 1BD3A 1I7PA 1U3TA 3KTFA 1DEAA 1IB0A 4HGPA 1GNRA 1SBHA 4MPDA 1SXJC 2NVWA 4B40A 1KL7A 4JIGA 2P2YA 4EHNA 5LWHA 1DE0A 4H7EA 1NOIA 2R8OA 3HKCA 4L85A 4AG3A 4FYXA 3URMA 3YASA 4ABYA 3V8RA 4C04A 4JN6B 3V8NA 3GFTA 4DDWA 4U2BA 3U1VA 4GMXA 1KKUA 4XIFA 4K26A 4A1FA 1XNQB 4CMKA 1FNDA 5H3CA 3GW8A 5DT2A 4A82A 1PNVA 3T7CA 1YC2A 3O1HB 4L7VA 2F6RA 4YUYA 1SB9A 3FPFA 1XC7A 3KO8A 4B74A 3DCJA 1W44A 4UBNA 3PX7A 4MVCA 1ESMA 1H2BA 4R31A 5ALOA 4CTOA 1U9YA 3ZE0B 4JB8A 1Z2OX 2YVLA 4E1VA 1YR8A 3BGWA 1AC5A 2RH8A 1PVVA 4G4SP 3G59A 4IG9A 4NQZA 1DPFA 4O25A 5SYNA 1M72A 1T13A 3S1AA 4V1CA 1RJFA 5B55A 3QMWA 2HT6A 2JH3A 2OGSA 2Q0XA 2AXPA 1LEHA 2P2SA 3DDCA 4PXSA 2UUBB 1PEAA 1H6BA 2QRHA 5JJKA 3S8YA 1FFWA 1LTKA 1OYYA 2RHHA 3LDGA 4RWZA 3ABOB 2VRNA 3QNUA 2G28A 2WT4A 3ZTWA 1I3NA 3ZEAA 1P81A 3LL4A 3KQNA 1FNMA 1MUUA 3OQ6A 4E32A 1HE8B 3LZ6A 2ANCA 3Q7EA 2XYHA 3FMGA 1P2DA 4ZI7A 5C46F 5EE9A 1GN9A 2NSJA 4QECA 1X9IA 3AIKA 2KYRA 5E6SA 4X20B 4MULA 1RHRA 2I62A 2OHJA 1J1ZA 3A8TA 4RS3A 4TXNA 1FDUA 3CVOA 4ZP1A 5A9RA 5AHRA 5ELXA 2YXPX 1HRKA 4I4CA 1PGQA 4LF6B 5AYVA 4RY9A 1Z26A 2QUBA 3OP1A 4WZAB 1QHHA 1K5PA 2ZRAA 3DAGA 5IUKC 2RK3A 3PRYA 2VDJA 16PKA 2DFKB 2N0SA 1ZL2A 3QKSB 1ZUNB 4OYLA 4EYSA 1XQWA 4WY5A 4CETA 1JA9A 3OSZA 4MPPA 4RGVA 3MA0A 2ODWA 4MR8A 3B5IA 5TS2A 3O2SB 2GYVA 3Q9LA 4QRHA 4X63A 2IYTA 1OJ7A 1U7WA 4NECA 4P8RA 3D0QA 3TLAA 1E66A 1G9TA 2R7NA 4NPCA 1J4AA 2HXGA 4DEYA 2VRCA 3QEJA 3JQ8A 2HV9A 4MA5A 3GGOA 3PHCA 1GARA 5E7JA 3SR0A 2WV7A 2H9IA 1ZI8A 1CJSA 2QB5A 4WL0A 5JZVA 3ZX5A 1ONOA 3GLFA 3TSYA 2O54A 5I8PA 2GZ1A 3RIMA 4YXWD 4JASB 2BRUA 2I8AA 1VBNA 4NK5A 3EASA 2C84A 2R6JA 1N1MA 1HSZA 1NVAA 3KPYA 5D1NA 3EG9B 1UMBA 3NOXA 1WULS 3DE2X 1XU4A 1J8MF 1X8LA 3R40A 3QBEA 1N0WA 3FFBA 4NCJA 1QR2A 1D2NA 1J49A 3C87A 4I4TA 4UVIA 5FLYA 4XASA 1KOFA 3RSLA 2PMDA 4UU7A 2IXTA 2Y1GA 4DLUA 1L7MA 2HWWA 5KI6A 5JDIC 3V1YA 4HN2A 1G6Q1 1ZVJA 1YRHA 2R85A 2XCUA 3KOUA 1OIWA 3P5BA 3KQPA 4C03A 3CE6A 4GDMA 1M6VB 5JH7B 3CBQA 4YRJA 1DX4A 1KJYA 3JD1A 3SX0A 3IPCA 5JAUA 1Q7EA 2P4UA 2RGUA 3G0OA 4NNJA 1WKBA 5BYKA 1SCKA 3H0CA 5LPNA 3ETCA 3RUPA 4I19A 2Q5CA 4C7XA 4A0RA 3AL2A 2VUIB 2YZGA 5LLDA 4MDHA 1I7SB 3B51X 1E8NA 4YV7A 4MEBA 3GN1A 1Q44A 2WM2A 1RAAA 3D7SA 5F2EA 4DMCA 1MENA 2HHHB 4P7KA 2JD2A 1MC5A 2ODNA 3I28A 1N2XA 4FYMA 4WXHA 5C9ZA 5DYWA 3X0DA 1VJ5A 2PBZA 5C4IA 4UC0A 1GPBA 2MSDB 3DM5A 3EODA 1M5RA 2O8CA 4OBWA 3TQCA 4O2BA 3M6VA 1D3AA 3KLOA 1NYRA 2J5BA 4KQIA 3UAVA 1EVJA 1J23A 1ICEA 2LTAA 4E09A 4OJNA 1I33A 4P82A 3PPWA 4AZ0B 4RPHA 1E9FA 2OFOA 1OFTA 4XGIA 3AF4A 4Y9SA 5FCDA 3JVUA 3LW7A 1XD9A 4QT0A 3PXDA 1L5LA 1RE0A 4E5SA 4MMXB 1VKHA 3MMSA 1AMUA 1R9MA 4PSAA 4MYUA 5AIBA 1E7YA 4L8WB 4AWAA 3ZCRA 1WSDA 1Z0FA 1P7WA 3CJQA 2D7JA 1UBJS 4PLPA 4Y6QA 1K06A 2WM9B 3IULA 3RS4A 3RWOA 5C4MA 1DXHA 2YV3A 4H0NA 3X1DA 3PUIA 1EG2A 1LSUA 3KETA 3OLYA 2I6QA 3COVA 1EIZA 1RYFA 1RP1A 5GVSA 3OU2A 5TDHA 2G67A 3FA2A 4QJ5A 3UHPA 2QE7A 4MS3B 4RANA 4CL8A 2ACVA 2VF8A 4MVJD 4R41A 1NP3A 1RJGA 4S24A 1ID8A 1LPPA 3RFUA 1PFKA 2XUIA 3QU2A 1ZXXA 1B43A 5JVDF 1AO0A 2CSUA 4DJ5X 1SXJD 1JG1A 4V02A 4G97A 1A4RA 1WQ4A 4CLDA 2ALJA 1ZO8A 3EZ9A 2FZCA 1ZA2A 3HN6A 3PK0A 3Q12A 1H0RA 4PFJA 2X0FA 5HP4A 3HCFA 2JIMA 2QLTA 1VGVA 1CRZA 1FTWA 1E9AA 2HIMA 3BKXA 5B6JA 4CM8B 2GOYA 3N2NA 1IATA 5JAZA 1LBHA 4NCBA 1UMDA 2ZAOA 2EDAA 2HK6A 4QQ8A 4LISA 1VZ3A 3E3LA 3FCXA 3WL6A 1ZMXA 2HK9A 1DIRA 5L9AA 5BUCA 3MHPA 1OCEA 2Y76A 4DV3B 2C2OA 1WPQA 3C7DB 5AT1A 1TRKA 4G9BA 3B82A 3DF9A 3H18A 3K71B 2XYQA 1Q3KA 5EHXA 4CV2A 1JG3A 2DY1A 2HO4A 3F2IA 4MW7A 4O5AA 5F2KA 2CNLA 5CDGA 4KKVA 2AG5A 4B46A 4QE3A 2WWFA 5AW5A 1M3SA 1RZRD 3HY3A 4RH3A 4O2AB 3UAOA 4L8FA 2DQYA 1W85B 4GKAA 5EYPA 3T3IA 1MAHA 4EI7A 2QDKA 2DCMA 5COAA 2Q29A 4NATA 1E2DA 3L8CA 4G85A 4HEA6 4OM8A 2NUAB 3SHQA 4XSVA 3RDPA 3LGAA 1PD0A 3FLMA 4R8VA 1MR3F 4AN4A 2VYVA 1G7RA 4A5SA 3WYEA 2ZANA 3RUFA 2FMFA 2PZJA 3GRVA 1DV2A 2OK8A 1W47A 4KPYA 5AM2A 2R6ZA 3PGVA 1R74A 1ZMRA 2P62A 2ZS8A 3E81A 1XP8A 2NYAA 3NHZA 4W7SA 1B7GO 4DSZA 3UBTA 3BXGA 2XWJI 3QU4A 2VSFA 4PLWA 1N9GA 3EISA 2RGEA 2XQVA 1QIKA 2H1VA 2NSYA 2AR0A 1D5WA 4H3KB 3B20A 1M66A 4XOUA 5DBEX 2PYDA 3ITKA 1DJLA 1TAHA 2G1UA 2XMPA 4OA5A 4TMKA 2NYUA 4AW9A 6LDHA 1ACLA 2VUTA 3NTVA 4BZQA 2QJWA 4FTWA 3QSYA 4UMVA 1VRCA 3TRDA 3MWYW 3LX5A 1YUNA 2JNWA 2C9CA 2OGTA 4OPMA 1GZUA 1TJ3A 4XEHA 5EZYB 3AF6A 4IVRA 1KP3A 3V3KA 1IQ0A 4W6ZA 3FOZA 4LFAB 1U8UA 1OZGA 3KE9A 3F7TA 3N5KA 1M73E 1T6NA 1J42A 1IBRA 1K8XB 1LC3A 3TDKA 4AUMA 5AVVA 5C1IA 4OQ4A 3PL5A 3A4MA 1PR3A 2J5RA 3ZHVA 4ZYYA 2X7HA 4AYTA 3IXMA 3V42A 1X3SA 5LZ4A 4CEIA 4PPYA 1N32B 3OKAA 3R74A 1XAGA 2PX6A 4G0QA 1YU6A 2P27A 3FTPA 4BP9A 2Q28A 4NCIA 3TQSA 4JGGA 4UARA 4L16A 5JPIA 2Z95A 2B61A 5KC9A 3VX3A 3G0CA 4WEOA 1TAQA 2HYDA 1ULZA 4JP2A 4UM9B 1X13A 1XMIA 4JODA 3AYZB 1IJBA 3MWLA 3SC6A 2QU8A 4F9GA 1R3UA 1VHDA 3AZQA 1KSHA 5COQA 3LXXA 2YWBA 4TXMA 4GT1A 5L53A 5C8DA 1VE1A 3EUEA 4K86A 4Q3OA 2WIGA 4X7PA 3U7HB 2B2NA 3AKCA 1O6BA 2J85A 2AMJA 3FPKA 2WU3A 4PCUA 4ETIA 1UKZA 1MC1A 5SICE 5ARCA 2A7QA 4LYGA 4QUDA 1D6NA 4TUYF 1ZIPA 4MMYB 1MABB 4V2IA 1RWKA 4HMPA 3FCSB 1JQLB 1BHO1 1M74A 3MEQA 3U37A 3DVAB 2G6TA 3U4QA 4HR7A 4Q7LA 3CEMA 3ML1A 4MRPA 5K3FB 1F06A 1AF4A 4XRGA 1XUOA 2GK7A 5JJIA 3P0HA 2W6JD 3ZI0A 3NATA 2F9LA 3LO8A 4GQIA 2JFUA 4WLEA 3RSQA 4CRWB 3GLUA 2LBPA 5KWJA 4F2GA 1HH4A 1KAEA 1BWPA 1EB9A 2H3EA 3PDIA 4UUNA 3GEIA 5FHRA 1XYVA 3RWMB 3CO5A 2JGDA 1CHDA 2AJ8A 4E1AA 2RHRA 2W4MA 3W6ZA 4WOJA 1WUIS 2E48A 3EUWA 4MDEA 1V9LA 3EQ2A 3GNLA 4LNUB 1A5TA 1SCNE 2VH5R 2GNPA 3A3OA 4I8IA 2WTNA 1ZUD1 1A2BA 2TSYB 1P7VA 1NU6A 1T15A 1ZOLA 2GEBA 3DONA 4IHQA 4ARVA 2B1IA 4JI8B 2QI9C 2W98A 1ISSA 4A2WA 3HJCA 3OD1A 2I71A 4M0PA 1TTPB 5K3AA 1FJXA 2DFPA 1AH2A 1VMEA 3U9LA 3WB2A 3K73O 1FP4A 3I39X 4J4BA 1EUDA 3WRYC 2VTDA 5KTSA 3VVLA 4EA7A 3QPBA 4PCAA 1E9SA 4QNNA 1E9CA 2EQ5A 4QGSA 4YUWA 2QMOA 4DMLA 3OWHA 3DTTA 2IYEA 4F21A 3TK1A 1CW2B 2YNMC 2ZUBA 3KB8A 3R0IA 2C8LA 2O1EA 3BAZA 1GQ2A 3R9XA 1N33B 2CUKA 4G3XA 2RGDA 3LNTA 4MQEA 2Z3VA 2FLWA 4L72A 1QMGA 1A9ZA 3N8KA 1ZK4A 3Q3GE 2ZBVA 3VPSA 4ZV7A 2HPAA 2ID4A 1GXSA 1KGSA 2ZYGA 1NBMD 5IC5A 3THSA 4CUZA 1QRSA 4N18A 4CDMA 2C3UA 1V3QE 4Z53A 2DPYA 1GGHA 4B35A 2FMIA 3JWIA 3L93A 1AY0A 4BHTA 3IUNA 2I80A 1DC4A 1E5QA 2FZGA 1ODCA 1P9LA 2JRCA 4N6GA 3RYHB 4RPCA 3VSDA 2XLCA 3DYIA 1I4WA 2CEAA 1T9ZA 4KMOA 4OHVA 3UXHA 4BNLA 3KOXA 4QAJA 2QIOA 2OBLA 3CIFA 2FFHA 1IG3A 2QUZA 4G8CA 4IUDS 4YGXB 3TPFA 3T3OA 1FDWA 1JQAA 3P20A 3VR6H 3J81A 1ZJWA 2C5HA 4KN6A 1IQRA 4M7WA 2IOFA 1IHUA 3ZDRA 2GQ0A 5KSWB 1Q84A 4R9UC 1BYUA 3FTEA 1GTZA 2X77A 4BZZA 3LI2A 1XVUA 3JYNA 3KKMA 3MZ0A 1F7UA 2JHFA 1BDHA 3IE1A 1JB1A 4DWWA 1VJRA 4J0FA 4XRRA 4D42A 3QNMA 4X3PA 4K9LA 2NZ8A 2QMZA 2RGCA 4WUTA 3BBPA 5TEVA 3V4VB 3VSCA 2C77A 2YXDA 2FUG6 1XU9A 4RZSA 4YAJA 1AUXA 5DOVA 5ELLA 1LS6A 4MHSA 1HE3A 3BRWA 1H3EA 1SIUA 3HP1A 3IEKA 4H4EA 3RV4A 3FMPB 3OD5A 2OV4A 1F6DA 1CUEA 2GJKA 3AR5A 4H7HA 4OSPA 2JJ1A 4X6YA 1ZLXA 3M1LA 3DJYA 5TPZA 1PVDA 3EWAA 1CR2A 4G41A 2F43B 4N3GA 4E2XA 1DTWB 2V7PA 4DNXA 1NWCA 4OQNA 5BR4A 1IHXA 4MXDA 5DN6A 2J67A 1D4FA 2IPNA 1ZI6A 4Q1BA 5C1BA 4ZKEA 4Q05A 3RLFA 1KS9A 2HSWA 4CFSA 4I4TB 1FDVA 3L6UA 3OTHA 1W8IA 3TTVA 3ZS8A 1HDXA 4DREA 4HNTA 3KLBA 2C9ZA 1NT4A 2VYFA 2P9JA 1ZKMA 1QPBA 1WHSB 3AUTA 3HDGA 4TT3A 3SI7A 3WYNA 4BLPA 3IMCA 1M6VA 4XQGA 5DLQC 2PJUA 5PGMA 3RHTA 1NPDA 2OFPA 3M83A 2HNAA 3MELA 4QO7A 1AN9A 1UDWA 2BD0A 2XBUA 3AGPA 1IN7A 3GLKA 4NG5A 2XXAB 1MX3A 3AF2A 4MGHA 2PFGA 2RJOA 5G40A 2WYHA 2RC6A 3KQLA 1BCSB 2P5YA 1HMPA 5TARA 4AJKA 3IBFA 4JLWA 3TKLA 2JPDA 3MBIA 4F11A 1HQCA 1Z25A 4FVTA 3V6LA 1DLIA 1WF3A 4G4JA 1NNSA 4IH4A 4JQSA 4K6CA 4OIFA 4X95A 3KDPA 1X8XA 1MGOA 1VL0A 2IYAA 1UKCA 2C3PA 3CUVA 4N40A 3QM1A 5D3ZA 3L1HA 5DT9A 1SCQA 2P9ZA 1D6MA 4DV0B 3D4LA 4GKJB 2XVXA 2YJZA 3GI1A 4RACA 1QTIA 4FC7A 5L3QA 1SVOA 3THYA 3D2CA 3H2ZA 3WLNA 3GCDA 3T61A 1XMPA 3AL0C 1CQWA 2HRDA 1QZ3A 1JNXX 3H9UA 4OBEA 5BMVA 3RVOA 2Q0SA 5DGHA 1W76A 1UOQA 2IU3A 3E9CA 4INPA 3BSYA 4IKPA 1KFEB 3L8HA 3N5CA 1Z4PX 2DE0X 4F7DA 1F17A 1D2AA 3DO5A 4FBMA 2LVBA 3MM4A 4LX0A 2WJYA 5CFPA 1ITZA 3BA6A 3JAKA 1WMDA 3HPRA 3C5VA 4L4RA 4LYEA 1R10A 3NIGB 2RHLA 3RO7A 2Q4OA 3CLKA 5LM3A 3AKZA 5A5EA 2O14A 2GLXA 4BMYA 2M6SA 4L2IB 4WRRA 2VL7A 5KYWA 3H42B 3DEJA 2PBFA 1OFHA 3EA4A 3OT1A 4BDSA 5JFGA 3BCHA 2IS2A 1JDZA 5ERXA 1ETUA 1N2GA 1PZHA 1ZGAA 2MSKA 3UF0A 4E03A 2QTTA 2WHPB 4JDPA 1E2LA 4HGNA 1V26A 3VA7A 1EGQA 1JPJA 1O9GA 2Z8YM 3HV2A 1ANKA 1O95C 2CD7A 3HJNA 3JQGB 1L5QA 2I91A 4M0DA 4N5HX 1OXTA 2C7OA 5ALRA 1NYQA 1F1BA 1PNTA 1AKUA 1EB8A 1QPGA 2NXEA 2VAPA 3G02A 3L18A 1T26A 3GWZA 3KD3A 3MNFA 4MS1B 4YRSA 4LIPD 5KIAA 1YDMA 2EVWX 4TVBA 4ZREA 5B58T 1E2EA 3SKXA 1A7UA 3VYWA 1L6RA 1C81A 3CEJA 4MMZB 1F8FA 4GVLA 4RTLA 1YT5A 3B7GA 3NUGA 3M6WA 4I36A 1I6MA 3AFIA 3STTA 3F3KA 4ND8A 4DXHA 2WM3A 2A9JA 2I2AA 2IEGA 1LJ8A 5AOCA 2XA1A 5ALHA 4DQXA 5JO0A 3CN9A 4Y7CA 4X3OA 4B4WA 1IPHA 1W2HA 5GJCA 2BR4A 1EWYA 2NTJA 2FPGB 3PQEA 2YC4C 4XUEA 1C5KA 3WWYA 1A0OA 1GHTA 3UQYS 4H7PA 2PANA 4E5NA 1QGYA 4WA8A 2XDQA 1CV2A 1T1SA 1MB3A 1TF2A 3MMZA 4MTLA 1W9MA 4BBZA 1CJTC 1YZTA 1ZS9A 3DZDA 4L0MA 3RYTC 1R0WA 4P31A 1JEYA 2FHPA 4ECAA 1NXPA 2IOQA 3VNSA 5AKGA 2Y93A 1OLSA 1QHEA 4YRPA 1P1HA 3UUWA 1Z38A 2HMYB 2QM8A 4IG4A 1BTOA 1TVKB 1XIVA 2IZ7A 4BLVA 3T7DA 3F78A 3COSA 5B2EA 3LKVA 3R7SA 3FGPA 3EGXA 2X15A 2WG0A 3M6XA 3MCVA 3WLPA 1E5LA 4MVJG 4BECA 1GTMA 2WLSA 1K88A 1AK1A 3F8WA 4CF3A 1Z08A 1E6LA 3QVVA 4GX2A 5LQMA 3A9SA 4V0LA 5IAKA 4ID3A 4FHDA 4QDTA 2FA9A 1RKBA 5K8CA 4HAYA 1HT2E 4IEEA 4R5MA 5LMNB 1G55A 1Y6RA 3HCRA 3VO1A 3HM2A 1C9JA 5JWHA 4ARIA 3OU6A 1Z17A 3PNBA 4I55F 2NUPB 2VNKA 5KNCA 3GDWA 5EC8A 1YR6A 5B7QA 2PIDA 3M6AA 4DXDA 4TTPA 2F1OA 4HUQA 2HAEA 3PFHA 1XCMA 3D4IA 2BMVA 5JDIA 4C87A 3H5OA 3QW2A 4GNKA 2B30A 2IDMA 2P68A 4I55A 1RE1A 1E0KA 1UZMA 4FE4A 1RWOA 1GZ4A 5CT4A 5KKAA 1TL7C 3D3WB 3VRHA 3EXIB 3TTTA 2B98A 3FHOA 3LBAA 1J24A 4PZUA 2KMLA 3WL5A 5H68A 1QKKA 4EHAA 3VH2A 5JNUA 3IO5A 2NU8A 3TLGA 3T7KA 4BFZA 4KIJA 5HFAA 4F2DA 3AJRA 1FRQA 2VTVA 1Y3DE 4J0DA 1EUCA 3D6UA 2VHWA 3ZD6A 4UTZA 4YAGA 5FADA 3WKBA 4PS1A 1J0XO 4F38A 7ABPA 4Q4JA 1EFPB 3KK0A 5ENVA 5EJAA 2XD9A 1E3LA 1Q0ZA 2H52A 4D9MA 5A3RA 3P27A 4HK4A 2CBXA 5H7XA 4D74A 4MV5A 4FJ1A 3QHPA 5F9MA 2OESA 3A0UA 2BBTA 3KZCA 2Q5FA 2I4RA 3QYPA 1WM1A 4KN8A 4MYHA 5FPTA 5JCPA 1G1MA 3B36A 2J46A 4L8YA 4XWWA 4JC4A 2OHFA 3EC1A 4Q21A 2P9EA 3AP2A 2EIXA 3PHIA 1XLUA 4X8MA 3WRVA 3ZQJA 3I61A 1XPUA 1QK5A 2HM7A 2E55A 1KRXA 4YBZA 1PT9A 4YALA 1M2KA 3UC9A 3A6HA 5CLLA 2C3OA 2EZ8A 4ZQHA 4NV1A 4EYGA 5TQ2A 1APBA 1OYWA 5EIXA 1HWYA 4DILA 1N8TA 3RNLA 3TCKA 3THWB 5HKAA 5GONB 5FTMA 3JZFA 4P0PB 1NSTA 5FOUA 3AXTA 4TWAA 4MQFA 2H48A 1CNFA 4A6DA 4OXXA 4UUMA 1SHUX 3B3FA 4IGAA 2CNWA 2SECE 4BTEA 5C7OO 4B6JA 2EP5A 2RDMA 3C8HA 3I2KA 2P9FA 3BN3A 1RZVA 2FW8A 3JZIA 4GAEA 4KK4A 1WPRA 3ST7A 1BEZA 1A9YA 3ZD8A 2ZVQX 2Z8ZA 3UHOA 1CY1A 3NBZC 3TBFA 1O6CA 3MT0A 1E6WA 3UJ3X 1GPJA 2DFDA 1K98A 3OLQA 1O8BA 1ZR2A 1Y1RA 2DPXA 1ODSA 4YAIA 1UXIA 1I0LA 1NAHA 2NGRA 2WTMA 4G5XA 2HEGA 2GHQA 2ZRJA 2BFBA 3K5WA 4J8PA 4Q19A 3U6KA 1KIFA 1CZKA 4GWLA 3N28A 9ATCA 1NF3A 3UWKA 4E21A 3RK4A 4Q4AB 4XAQA 1IJKA 2AMLA 2ZBPA 3GY0A 1HOTA 4BFUA 3DAPA 5JSFA 4EUHA 1TM1E 4KBFA 4HNRA 2F48A 2JATA 1P2SA 2I33A 2YHSA 4JLNA 1JSRA 1E3WB 2HU8A 3GHYA 3HWRA 4KHZA 4NS4A 2UYCA 3FSJX 3K35A 2VSXA 1FUYB 4YP1A 1L3BA 3OPYB 5CM8B 2XNCA 3ACBA 3K9CA 3HNRA 1W5SA 1KZ4A 3FHLA 4R4JA 1HYHA 2GVDC 4OHUA 5L3RA 3SBOA 1I1QB 4O59O 1NC1A 5DXFA 1W35A 1MG0A 2Q6KA 4TUYB 2HMVA 4BNHA 2AZMA 1H2RS 1U7OA 3OFSA 4EKIA 5J2UF 3W34A 3L6EA 4MS4B 4A0GA 2E4WA 1W59A 1DG9A 2PUTA 2QVCA 2ZYHA 3V4OA 1A50B 4I14A 4C6SA 2PX4A 1G8PA 4AZVA 5EGNA 3PPVA 5DM70 3C16C 2DERA 4LRQA 4NENB 4ARAA 3BMQA 1V39A 4C7OB 1Q15A 1LDYA 4Y2HA 3RSFA 2G5PA 3ZGZA 3R8XA 1P5JA 1NBWB 1Y1KE 3BIJA 4C88A 4XVUA 2ZJBA 1ST2A 4BRUA 1C1XB 5F23A 3MT7A 3PCXA 5LP1A 1KAGA 3LCJA 2V0GA 2GPAA 5FKJA 2QX4A 1SXJE 1VLZA 2GJ8A 4JX8A 1QH1B 3O26A 4OJKA 3R6GA 4WLVA 5KNDD 3H05A 2CL7X 1VI6A 2HJ9A 4Y67A 1GCUA 2HZ7A 4XXHA 4M9XA 4WNAB 2VJKA 1XA4A 4S2UA 2P3LA 1ZD1A 1QUFA 4HDRB 3A2MA 1VQ1A 2LR0A 4NICA 1OWMA 1E5TA 3TH5A 4JI4B 1CUBA 3L4BC 4IFEA 4LHEA 4EYOA 1FDSA 2GAOA 1CLUA 2R6DA 2AS0A 3N6XA 4FI3C 1SKYE 3AOGA 4G9EA 1XP5A 4IMRA 1GNLA 2XKBA 1ZD9A 4I5FA 1VRVA 4PLTA 2R4QA 3U7IA 3PEWA 4DR3B 3DXZA 3M89A 3NNNA 1T2EA 2CW5A 2MSEB 1CUGA 3N7UA 1EUCB 1DDOA 1C3EA 3CPSA 2VHTA 3IPYA 2FPOA 1ZXLA 2FW7A 4LSZA 2P67A 3X3HA 5C3MA 2VZEA 2I7VA 2Y77A 2PZMA 4V38A 3AZPA 1B41A 2GEVA 4OHFA 4PC2A 3SYRA 4P0TA 4BB9A 1WCIA 2QTHA 1ZN9A 4CV1A 4AKIA 3A3KA 5JCJD 2PAFA 3G5AA 1BWQA 4WKCA 4PHHA 3AUAA 3CRZA 1X94A 3CINA 2QZ4A 4LXTA 1BVUA 2BUCA 2PRSA 3RIHA 3PZBA 3EIQA 2RHDA 3WIVA 4B0PA 1QCZA 5KNCH 4V0MA 2NW6A 4OIMA 3AHFA 4X92A 2VDUE 3GFGA 4GLBA 4GYJA 3EQ6A 3SVZA 3CX7A 4FHFA 4O1HA 4IGIA 5BSKA 1H65A 3GCGA 1B2RA 3G0GA 2XMZA 3Q0TA 1W1WA 1CUYA 4QEDA 4S1WA 3NCTA 2WKPA 4RHXA 2JZCA 2E18A 4QUBA 3EOZA 3L6CA 5E6UB 1Y9AA 4DUGA 2OOSA 2XRFA 3LUDA 2WZBA 3AU9A 3DMTA 1SKAA 3JD2A 2Q3BA 2QAJA 3HC7A 3QVMA 1MX5A 2L69A 4TLAA 2JFFA 4Y2UA 1V45E 2A9RA 4JVSB 2DUMA 1YGYA 3RREA 2NO1A 1N34B 2F3PA 1L8AA 3JPYA 4YR9A 3E2MA 3EC2A 1T3SA 5TMDA 2I4LA 3U3OA 4PSDA 2R6AA 3EXFA 5M7EA 4RVGA 4EDHA 3VJRA 3Q6IA 3CF6R 3VI4B 1GDTA 5E3JA 3TIGA 4BP3A 1UKEA 3HACA 2WB4A 5DTIA 1B0ZA 2V3WA 3AKDA 3F97A 3TJZA 2RHTA 5CHEA 1MIOB 3M82A 5G4KA 3S7ZA 4WAUA 3UA4A 4HAXA 1JJVA 1Y5LA 1R5NA 1N9ZA 2AJBA 2FP4A 1V1MB 3PXBA 1NA5A 2CCJA 3TSZA 4V1CI 5T3YA 2ZSAA 1TKRA 2ZCVA 1XX6A 4ENSA 4MJXA 1UPBA 2NT4A 3PHJA 2HDHA 3SBEA 5T57A 3MB5A 3HU5A 3WL7A 5AW1A 3FDZA 2KS6A 1CRLA 1IDN1 3M34A 5CX1A 4B6FA 2ZI3A 3LCMA 4JLUA 2HCFA 1W5EA 5GGXA 1V47A 3GT0A 4LDPA 4P93A 4C20A 4C06A 4FSXA 2B4AA 4RUKA 5HG0A 2IDZA 2IXEA 1BJTA 2JFHA 6ADHA 1T5OA 5CPBA 2UYQA 2J0SA 1BS2A 3CRQA 4G4SO 2GYUA 3SVTA 3I5MA 1M2FA 2A0UA 3K5PA 1TGYA 2ECOA 3GELA 3K1ZA 4O02B 5IJWA 1N5DA 3V1NA 1QRAA 4E5PA 4EY5A 4DKJA 1C29B 1J7KA 1Z0DA 3OMXA 1A8IA 1W93A 3JAWA 4AO8A 1HF3A 1F5NA 4HAUA 3TVTA 3AFGA 3CVVA 1I4EB 1MV8A 5CLFA 1HT0A 3OA2A 3EW9A 5FD8A 4RZXA 2AK3A 4BWFB 4FFBB 1T9KA 2IYOA 2IYNA 3EEYA 3FHTA 2QK4A 5HZGA 2QL9A 2HF2A 3KSDO 4S05A 1E2JA 4QSHA 4B3RB 1QV7A 3ONDA 1WNFA 2EL9A 4H0CA 3HY4A 4B2LA 1DINA 5FUXA 3K9WA 4MV7A 4DLZA 1PJ4A 1GCIA 2HRRA 5A4JA 4HRAA 2CDAA 5DNDA 1LBIA 1N3IA 4FMBB 4AU1A 4BLQA 4I6GA 5IJZA 4GOOD 1VL6A 2BKXA 3C6MA 4M1OA 2WA2A 1ZH2A 1RCFA 2Q8PA 3ED5A 5COBA 5GV8A 2DSNA 3LIPA 4HQFA 4FFWA 1EDBA 2HRZA 3FYTA 1I2CA 3G7NA 4CV0A 4IIHA 4AJIA 2PX3A 4PYJA 4Q4LA 2A3RA 2GYYA 3HLTA 1USGA 3MBKA 2P69A 3AEKA 5ALFA 3DTNA 1MZPA 1L0BA 4OQEA 4KQKA 3RASA 4B7UA 3BFPA 1C1DB 4OEHA 5FTJA 1RS0A 1JV2B 3KJQA 1TTHA 3GO4A 3LT2A 4XDGA 1LWNA 4UUAA 4BCCA 1NJGA 4YDHB 2JL1A 1IOWA 4BX3A 4ZICA 1QIJA 1VFNA 1JKJA 3AM5A 4CR7A 2EIHA 2RBEA 3RODA 4LF7B 3HR4A 1C9NA 3GV0A 8AT1A 4HWOA 4GMHA 4JSYA 3W8EA 5JZ9A 4HNUA 5IKMA 421PA 5DTJA 1QAMA 1NF9A 1WZEA 2BEVA 1N5JA 3SYNA 8ATCA 4K2HA 3ZCVA 3FRIA 1N7IA 3R7NA 1U90A 1N6OA 3UXMA 1DL5A 2WKSA 5JY1A 5KTOA 3L46A 4RIEA 1IYZA 2ZRHA 3E2IA 3P2IA 2YV4A 3G9XA 3SQXA 3LYHA 3QU9A 1G41A 3CUEF 4MYDA 4RJLA 2ZI4A 1YA4A 4RK5A 5KBYA 2DR3A 3U39A 1X7GA 3ETHA 4BB6A 4LDZA 4TT3D 4JT2A 1Y8ZA 1THZA 4XARA 3HVRA 3ZWWA 4GMDA 1QHHB 3M3PA 3HY6A 3NYIA 2H92A 1ZICA 3ZCSA 2CV1A 3WGHA 4QU5A 4LBVA 1EFVB 4YMHA 2MYTA 5LP6A 1EK6A 2ZJ2A 2XNKA 4FYPA 4Q4JB 1E77A 2ZBFA 4QO8A 2ZR8A 3VTAA 4G0VA 4MWSA 4PAGA 1AZSC 3PXGA 2CF5A 2YYSA 4ILEA 3MCWA 2BBSA 2E5LB 1XZJA 4IP0A 1F2TA 1B8NA 1FU8A 1YDEA 5ESDA 2I1LA 1K6XA 5HSGA 3P52A 2VJBA 4WZAA 5L95A 5F9FA 3NWEA 1JALA 2INGX 3VYVA 3LY5A 2BMAA 3I52A 4ALNA 1KVTA 2RCYA 2FPKA 4LOLA 2CXXA 4X9XA 1Z6PA 3K09A 3AF1A 3HB0A 2G5TA 5CLGA 3B1FA 3DMNA 3I01A 2XIQA 2QU7A 3CY6A 1LQTA 3TW6A 5TMEA 2YV5A 2ES4A 4YJDA 2DAPA 1OWOA 3NXKA 1GA4A 1E1RD 4XCVA 2GZRA 4MUNA 4MIEA 4CMAA 5KWVA 2Z2IA 2HSZA 3EULA 3PQDA 1JMKC 4GVXA 1JPVA 4LTDA 1W0JA 1H8HA 1RLMA 3TS1A 2VWGA 3T5GA 4YHHB 4W7HA 5A71A 2QRGA 3HCPA 5HR5A 4HNAB 3MTIA 2JKVA 3ZLJA 3CRMA 4IIJA 5K5EA 2HHAA 2FWRA 5ALWA 2DT5A 4H27A 4JUBA 1WZCA 3X43A 2V7QD 3JQAB 1C0IA 4UE2A 1OH8A 2PS0A 1VIVA 3Q7QA 5HGJA 4P34A 1J0EA 2UYOA 1A77A 2PGAA 5AXBA 3ZDDA 2XEXA 4RTQA 2ZVJA 4M54A 3G1TA 2IYRA 4K9QA 3DL0A 2EG5A 1RYBA 5E4YA 5CFLA 3V2UA 1M0SA 5I7RA 1ZONA 3M4NA 3S3TA 2ZXUA 3CW2A 4FKMA 4H08A 3U2QA 1N2CB 4EG4A 5F98A 3HN2A 4ENRA 2F8MA 4KE7A 1C1YA 1NN3A 1P6UA 2QZSA 1MXFA 3EIWA 3IT2A 1AZWA 3QVSA 1UFVA 4QDZA 521PA 2O19A 1AT1A 2Q1TA 1KKLA 3PEVA 2F67A 3Q2IA 4JK3A 3E4CA 1OZ0A 4O4IB 5IJAA 4DSAA 4WFIA 2VP3A 4AZTA 4CMEC 4EO9A 2H1IA 2Q4DA 4KO4S 4ZRNA 3I0MA 3PC8C 3H2YA 4KFSA 5D5QA 5B12A 3QEAZ 3ZD7A 1HNWB 1GU0A 4IGKA 3GIWA 1PL8A 3HI6A 2ESRA 4HXGA 4UNNA 2C95A 1U0SY 2YOHA 4AY4A 5JYCA 1NV8A 2R6CA 3RU2A 1OA0A 5E2BA 3VC7A 1P80A 1THTA 3ONVA 4ZZ0A 3C48A 5JI3E 4FHEA 2RH5A 3K4HA 4S1VA 1U7TA 3IJ5A 3OAAD 3Q9UA 4QEZA 4G09A 3QZUA 4ZODA 5DV9A 4CF6A 4LY3A 2DQSA 4ZV9A 3JQPA 1BE0A 2CZGA 1DBVO 2PR2A 5AXCA 4HDRA 1NU8A 1G0NA 4WVFA 4X3CA 1IOVA 4BFXA 1KRWA 2Z9CA 2OE2A 5F35A 1ONPA 2GAAA 1U0HC 5CLHA 5DN6D 4EX6A 1ZRNA 5GINE 1UJ2A 2NXWA 2A6PA 4P7BA 1XF1A 1AQ6A 2R48A 3VH1A 4BNYA 4DMHA 5CJ2A 1U04A 4IJWA 5B1YA 1UMDB 2GILA 3OJOA 1UP7A 4M1SA 2ZB4A 3UJBA 4PBTA 1XCPA 2GH1A 4JI3B 3H2HA 1W5FA 1TKCA 1YRBA 4IYJA 4EF5A 3EK2A 3KAKA 4BATA 5K3OA 1EFVA 1V4NA 4Z5XA 1G9XA 3P71T 1V8PA 3NC4A 1QNFA 3WGUA 5D6OA 3FPGA 4OJTA 2DY0A 2P4HX 3FRJA 1HC7A 3HBAA 3R5XA 3SMVA 1MAVA 3EWSA 3WLQA </