3NBYC

Crystal structure of the pki nes-crm1-rangtp nuclear export complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
171
structure length
171
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGLEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Snurportin-1
publication title NES consensus redefined by structures of PKI-type and Rev-type nuclear export signals bound to CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gtp-binding protein/transport protein
total genus 43
structure length 171
sequence length 171
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3nbyC00
5L8VA 4URVR 3Q3JB 3I73A 3TE6A 1MABB 3H1TA 4NYIQ 4PZLA 2XOKD 3LVRE 3RRMA 4R71A 4W5JA 5KOYA 1KI4A 1SKQA 4ZV4A 3CLVA 4PPGA 3VTKA 4ZDJA 1WCV1 2HLDA 3FKSA 1UBGA 1TADA 2C9YA 2Q3HA 2YOHA 1A7JA 1W7AA 3LAWA 1XWIA 1OKKD 1XDBA 5GJWC 5FTLA 3FGNA 3FMFA 5FR2A 2Z6VA 1E2PA 4MKGA 1XEXB 3ADBA 3OE7D 4A0GA 2EYUA 3PQCA 2C2HA 2B92A 4IOLA 5C18A 5SZHB 1Q57A 3ONWA 2FV8A 1UBFA 2GF0A 1IONA 3LO5A 3VU9A 5HPYB 3CH4B 4Q4AA 3MG9A 4UXIA 1Z63A 1AS0A 3AVQA 4H1UA 4TL8A 1EFTA 2DWQA 1DAIA 2K5UA 4FMCF 2BC9A 5HKKA 1OE0A 3GJ7A 2EU8A 2XTZA 5E7JA 1UEJA 4AYWA 3PFIA 1ZCAA 5FL7D 4ZIRA 4MRRA 2F43A 3LV8A 4UXHA 3NBZC 2UKDA 3IO3A 1OPXA 4PSKA 2ZJYA 3IEVA 3LD9A 1AN0A 1MABA 2VIIA 1KI9A 3M4YA 4HAZA 5GADl 1NIJA 2WWGA 2O8EB 4F38A 1KI3A 3QEJA 3SQXA 1A5TA 4I1SA 1GUAA 2QSYA 4ZPXA 4F93B 4PAQA 1FQKA 5UKDA 2ZE6A 3HU1A 1VDZA 3ZH9B 3FMIA 1T4GA 5JMTA 3CM0A 1VCIA 3D31A 4XVUA 5JECA 4LV8B 1NF3A 4IOJA 2XITA 3KTAB 3X1DA 5K8IA 1XEXA 4HI0E 2ZITA 1RYHA 2JJ1A 1UBCA 3RC3A 1HTWA 2GBLA 1D2MA 1EFUA 2IUTA 2ZJOA 1HH4A 4K8OA 3GFPA 2DYKA 4N0EA 4EKDA 4NMMA 3BXZA 3SI7A 2QRZA 3GLGB 4DCUA 2CLDX 5DHAA 3U7GA 2D2FA 4FIDA 1OYYA 4DUGA 1YR8A 4BLTA 621PA 4KITB 2ZR0A 3SYNA 1IBRA 4FMCB 1ZVQA 2DWPA 2WOJA 1PLKA 2GEUA 2AWOA 4MRNA 1UPTA 5CM9C 5H1YA 3CO5A 4NL4H 4QGAA 2NO9A 4LJ5A 1F6BA 2IYRA 2ODNA 1KY3A 2CJWB 3I8SA 2UZIR 1ZRHA 1U98A 1EFCA 4JLKA 1NKSA 4O0MA 5D3QA 3RVBA 5J4HA 4A0RA 3ZVMA 1YZNA 1GFIA 4NYJR 4DHEA 1TUIA 4M9ZA 4OJQA 3EIHA 5CK4A 1E1QD 1O3YA 3K0EA 4YDSA 2ZR7A 4LHXA 3QEOA 2O0KA 2O8EA 2XTMA 1KHTA 3QVUA 721PA 5DI9A 3RSOA 3I5YA 2IYVA 3LLUA 3PVSA 1ZUIA 4LBWA 2I4IA 3K0CC 1L4YA 1R0YA 2ZSBA 2ANBA 4JVNA 3TR5A 1VTKA 1KI2A 4B33A 4LSGA 3DOFA 3AGQA 3M0EA 3FFAA 3KTAA 4Q03A 2O8FB 2RGBA 4MGYR 3DM5A 1RJ9B 5SZKB 4LCBA 1N5JA 4QBGB 3AUXA 1W0KD 2WJIA 3B1XA 3KJIA 3OEHA 5F2EA 4E09A 3U4QB 4DLZA 5A5GA 1S3SA 3THOA 2AD5A 3NBFA 3L0IB 3GLGA 4I99A 2FF7A 1RPZA 4KVAA 2PL3A 2PJZA 1CJVC 1FL9A 1VHTA 5HE9A 1TTTA 4DIDA 4JT4A 5EXXA 3UWKA 3MJRA 2IYZA 2FZ4A 4L8GA 4BLQA 4BFWA 2W0SA 1TEXA 4CIDA 3CZPA 4HB4A 2CJWA 1Q3TA 4MYHA 4RD4A 3QG1A 4ACBA 4ZDKA 1AKEA 1J90A 5CLQA 5AJXA 3FHCB 1IHUA 2KWIA 1FOEB 3P20A 3GD7A 3BH7A 2H18A 1Q0UA 4KVGA 4ZDIA 1AS3A 3A1UA 4TLBA 1II9A 1XJ0A 1P72A 2BBSA 3AVVA 5FL3A 3WRYC 1KNQA 2OBLA 2VPPA 2OG2A 4IHQA 4A6XA 5C1BA 1LS1A 1W46A 1W4RA 4F92B 3W5JA 1W48A 2G88A 2D7CA 5KDLA 1QDEA 5G53C 2YJTD 4KYIB 5CYPA 2C5LA 2JAQA 1OXXK 1HT1E 3EASA 4AC9A 2FJUA 2O8FA 4UNSA 2GAAA 1GL9B 3ZQJA 1OJLA 5E4FA 3TUIC 3U4QA 4WXRA 3OHMA 1LF0A 1QF9A 4A6PA 5B30A 1W2HA 1ZD1A 2V6JA 4A2WA 1FQJA 4G5OA 2QBYB 1S1CA 1VHLA 4P33A 2LCFA 3I4LA 2D2EA 1N2CE 1U8ZA 3OFND 1AGPA 3A4MA 1K6MA 1R0WA 2FOLA 2JJ2D 5ANRB 3DMDA 1W47A 4QHSA 3EIQA 1EFRD 4HZUB 2R8RA 1ETUA 1KDTA 4DLSA 4Y0VA 1MT0A 4CRWB 3SYLA 1TQ4A 4RY2A 4OHZA 4ZCMA 2X2EA 1QHGA 3TNFA 1M1YE 3WP1B 4Q9KA 1P5ZB 3B7GA 3TKLA 4PXAA 4G3XA 3TUZC 4RZ2A 4B6FA 2QMHA 2QT1A 3MAAC 1KOFA 3SDZA 4CW7A 3CRVA 3K9GA 2REBA 4RZUA 1GRQA 5J5CA 1XCPA 4JKYA 2QPAA 4NZYA 2WZQA 3KJGA 1ZW6A 3GFOA 2ZJ5A 4Q4HB 4BFTA 4DJTA 4EJSC 1NG9A 4BQSA 1N6LA 1ZUHA 4QBFA 4KFTA 3T1QA 1KSJA 4B3DA 5H8WA 1FNNA 2JLYA 3BJIC 3B8HA 1E9SA 4F91B 4XWAA 5FUVA 2W6JA 3P26A 2EW1A 2ZS8A 2ORVA 4URWR 4MDEA 1VG1A 2QBYA 2F55A 1KZ7B 3C4JA 1CR2A 3QOFA 2AXPA 2IC5A 3SEAA 2ZAMA 2A9KA 1PV4A 1KK1A 4ESVA 1LFDB 1DO0A 4RSGA 5J40A 1CJMA 3TBKA 1E1RD 2F9MA 1N6KA 4HZUA 1QHXA 3SJBA 4KHZA 1JXOA 3CPJB 4HAYA 1FNMA 3CONA 3GLGE 2IYXA 2OCYC 4DSTA 3B2EA 2EWWA 1B23P 4LC1A 1VYTA 3RRYA 1LY1A 2JLUA 4LYFA 4MGKR 1E2MA 4LJ8A 4NCNA 4NYIR 3NHAA 4NH0A 4OK5A 3P4XA 1LF5A 3K1JA 1OXUA 1Z28A 1CXZA 1Q1QA 2GCPA 2RB4A 4LHYA 1G3UA 5DH9A 3REFA 4TZ6A 4B3CA 1KZGB 4TT3A 3VKWA 2GKSA 4B34A 3KB1A 5JWHA 2J7KA 4DLXA 3J81k 3TAHA 2SHKA 4Q4HA 4LBYA 4DLYA 2ZYTX 2WJGA 4I1VA 1E9FA 2B8TA 2VSXA 1RVDA 1XCMA 2Q6TA 1AQYA 1UFQA 1COWA 2VQSA 1DOAA 1Z8FA 3D3QA 1KDRA 2OBMA 1OIWA 2DFLA 3CKLA 1IXZA 4B3FX 3IUYA 2BHRA 5HE8A 4PZYA 2NGRA 3GLHB 4A8JC 2BCJQ 4ILEA 4JLNA 1QVAA 2A3RA 2V54A 1K8RA 4G1UC 2R9VA 1IXSB 3N5CA 2GA8A 2GDJA 3HYRA 2JIZA 2W6IA 4B6EA 4KAXA 3EWSA 3TQFA 1TEVA 5FBVB 2OM2A 2CBZA 2YNMA 1GITA 2CL7X 1P2UA 3ADDA 2GK7A 3EARA 3GJ0A 4M1SA 4LHWA 4POAA 2RGNA 3DZ8A 4N1AA 4C0SA 2CCKA 1GNRA 4Q7MB 1T3HA 4E5UA 5LPNA 5E95A 4TN1A 1M74A 1TAGA 2RHMA 3KL4A 4B73A 5JCPA 3FHOA 1YRBA 3ZZ0A 4OL0A 1SQ5A 1KO8A 4D81A 4D4MA 4D4KA 4IEIA 4MYTA 4KLNA 2E9SA 5G41A 4TLEA 1Y3AA 4QGHA 2IEYA 4L9WA 5EJEA 4YMWA 3CB4A 1W4BA 1N6PA 4Q00A 4G5GA 5TV2A 3WYGA 3K9LA 1AA9A 3CRW1 3GLHA 1DEKA 2NTYC 2UZ3A 4QJ5A 1DG1G 5DHFA 3HU2A 4O25A 5EUMA 3NKVA 1OXTA 3EIEA 3QKUA 1NJFA 2J5XA 4QJ4A 1XRJA 4B3BA 1OLOA 4PAOA 2QAGC 4B75A 2ZJAA 3VNUA 5EP2A 4Q47A 2W00A 1WBBA 2ZRIA 3DKVA 3FTQA 4B3GA 2QL6A 1KIMA 2O8BB 1XU4A 4YMUA 2PEZA 4CZ2A 5HR5A 3CNOA 3IQWA 2WM9B 2HF9A 2BM1A 4MKIA 2GAOA 2RGAA 1OIVA 3EA0A 1F2TB 3OIUA 5EP3A 1NI3A 1A4RA 1NBME 4D2IA 1Q3HA 1EFHA 1W44A 2C04A 3R7WB 1DADA 3U6BA 4LJ6A 3UPUA 2I3BA 2BMJA 1ANKA 2GXSA 2DFTA 3A1SA 3T1VA 3EC1A 1CBUA 4M9QA 2CNWD 2J59A 3C7KA 3SOPA 5F98A 4A2PA 2XNDA 2EFGA 3C5HA 3NBXX 3UK6A 2QP9X 1NLFA 4C9BA 3F0TA 2NIPA 2ZSAA 2YHSA 1KJYA 2YWFA 2AL7A 3NEYA 1HE8B 3MMPA 4KJZA 2ATVA 2IF0A 1XPOA 3CF0A 2JLWA 2O8DB 2QA5A 3FWYA 1G5PA 1T0HB 4ASUD 1W0JA 5KSOA 2O0JA 4W7SA 4JL8A 3TMKA 4KLZA 5HZKA 1RE0A 1ZCBA 3G82C 3TK1A 1G8FA 4NYJQ 4F4CA 1SVMA 2Q0HA 1IM2A 1E79D 1DARA 4BECA 4DEYA 3ZS8A 2O8BA 2EFCB 4KSCA 4J0QA 4M1TA 2WPDD 2GRJA 2P6NA 2ZSFA 4OHXA 5H70A 5KYKA 4V0ME 2JDID 1FMLA 4CYMA 2QQEA 2RGGA 4HEJA 4A9AA 3SQWA 4LYAA 4RJLA 1F2TA 1KI6B 4FMBB 2VP9A 3BOSA 2VYFA 1OH5A 5DISB 3R7WA 1LTQA 2GNOA 2O0HA 2BM0A 5EZ6B 2R6GA 4EFMA 1R8SA 2ZROA 1SHKA 3Q5EA 4HDOB 4U5XA 4M8NE 3BC1A 1SZPA 4MGIR 2B8WA 1CEEA 1EWRA 5AUQA 2WKRA 3BFXA 3ICQB 2IYSA 2G1KA 2ZPTX 2D74A 3AF2A 3QVVA 2IS2A 1G8YA 1G8HA 5HZHA 3EPLA 2I1QA 1KSGA 5FPSA 4DSOA 4RFSA 4GPTA 2IA5A 2RGEA 4BLSA 1W36C 2IWRA 1JI0A 2IUSA 2O8DA 2XSZD 1D5CA 3EAQA 5KNCA 1Z2CA 2BCGY 1UEIA 1TX4B 1ZAKA 4DLTA 1XMIA 2ZI9A 3HWSA 4KFSA 2IBMA 3BBPA 4JZKA 4XWKA 1IY2A 4JVLA 5DE3A 3LW7A 2ERYA 1WQ1R 3N2EA 1OFHA 3TR0A 1NNEA 4PSAA 3K9HA 2YWGA 2W83A 1KI6A 4E03A 4JLJA 3CWQA 4DVGA 1DAFA 1I2MA 2AFHE 4DRZA 4Z1MD 1BS1A 1KSHA 1P9NA 1ZC3A 2BJWA 2WIAA 4G01B 4MQBA 3U3JA 3DKPA 2QMUA 4KO8A 2XJ4A 4NYMQ 3H2YA 4L4UA 1JBKA 3I72A 4QL3A 1NY6A 3AH8A 2IW3A 4A2QA 4QGFA 2CXXA 3HU3A 4Q7JB 2EQBA 1VCNA 3VKGA 2REOA 4A36A 2IYLD 5DGXA 5CJ2A 3RRZA 3SFZA 5EXPA 5EZ5A 1KY2A 3IKJA 1SXJC 5DO9A 1E9EA 4IVRA 3LXRA 3AVUA 2HJGA 1HV8A 3JZMA 1ZNXA 4LV5B 4Q66C 1E9AA 2FG5A 3A1TA 5FTNA 5IRCD 4AY2A 4DIEA 4PC6A 1MO6A 2IXFA 2PT7A 2PLFA 4HATA 4IW3B 5IK2D 1CRQA 2KJQA 4GFDA 3PR1A 1KYIA 1ONBA 1NVWQ 1WA5A 4WXPA 2XZOA 3QXCA 3A1WA 1P3JA 1ELOA 1E2NA 3QKTA 2C9OA 3I62A 5CIQA 4GOXA 2VP2A 2ZJZA 3TAUA 3MWJA 2OLKA 2QORA 3AVPA 1XB2A 4ERNA 4P4UA 3NC0C 2FSGA 3EZ2A 2V3CC 4GBMA 2MMGA 3SNHA 1Z07A 2W58A 4B43A 2J0VA 2F7SA 1G1MA 5LDDC 4LHZA 3QKSB 1PZNA 4XJXA 3X1XA 1G64A 4XD7D 5L3VA 1AM4D 1KI7A 3A4NA 1EGAA 3K09C 3QENA 4PQRA 4HZIA 2XOKA 2WKQA 4C0HA 4M53A 3CUEF 5B64A 2FPKA 4US0R 1VCOA 2BEJA 3PEWA 3CR7A 1U99A 4QBHA 4LPKA 4ZCLA 3PUZA 3REGA 6Q21A 3IQXA 1DE0A 3H4MA 2EFDB 3DMNA 3VAAA 2WVJA 1TPZA 2BWJA 4BUJA 2GWHA 2J7PA 2BMEA 2J0UB 3OE7A 2OCPA 1P9WA 3MWYW 5G3ZA 1FP7A 2LKCA 2F43B 2XTNA 1A82A 2QENA 1DO2A 1Z5ZA 3QBTA 1H8ED 1P4SA 2F1HA 1KK0A 2DPXA 3T5DA 1N3BA 2ODWA 3G5UA 3MSXA 2B21A 1Z06A 5C46F 4JYCA 3RNLA 4WZAE 4DEXA 1MOZA 3W90A 2WWFA 3SBDA 4PHFA 4JBXA 3VFDA 2VF8A 2QGZA 1P75A 4M9SA 5FL7A 4PQYA 4OQLA 1N25A 4IKEA 4OI1A 4LV6A 1F5NA 3T1OA 1H8HD 3EZ9A 3QKSA 4URXR 3R9XA 3WYAA 1OB5A 2VHJA 5EP1A 2V4ZA 4KI0A 1T8TA 1QRAA 1EXMA 3LNCA 4PX9A 2H57A 1JEDA 4PC7A 2XB2A 2H92A 3O8RA 4B35A 2VTKA 1DAMA 1KDOA 1W4AA 3U3RA 4D6PA 3IHWA 2DBYA 4B47A 1AKYA 3GLFE 1GNPA 4A8JA 1X6VA 2ZR9A 2VH5R 5IF9A 1RRGA 2JLRA 3BE4A 4OQNA 2J0UA 2P6RA 4KFRA 2ZXUA 4JS0A 3JVVA 3FPAA 2UVQA 3E5HA 2YZ2A 1E9RA 5DYGA 1CLUA 2GXQA 4IXMA 4CVNA 1M6NA 2B7CA 1N6NA 1TF7A 1RRFA 2HEIA 3BERA 2HF8A 1JQJC 4TL7A 1X1SA 2JCSA 4B44A 4DLRA 3NEJA 5JEEA 2CDNA 4LY6A 5FBRB 3QUSA 1WXQA 1Z22A 3CH5A 4JLOA 1DBSA 1I4TD 3QBVA 4OBEA 5SZIA 4IDQA 4D4LA 1OXVA 3TRFA 2YC4C 4YMSA 2JA1A 4JBYA 5BN3A 1GILA 4JT2A 3T35A 2ZETA 1R2QA 2AWNA 2XJ9A 1E1QA 4AIIA 3OESA 3TIFA 3TSOA 1AJEA 3WNCA 4PANA 3SYKA 4HSEA 2RAPA 4Q18A 821PA 1E2GA 4D0NA 5JZVA 1U0LA 3OAAA 4BRUA 5FH9A 1UAAA 2XB4A 3PUYA 4Q1EA 3B13B 1OHHD 4M2LA 5FPYA 4Q4JB 2JLVA 3KDSE 2C8VA 5FOVA 1W0KA 2ZRJA 2ZYUX 2ZI4A 5CIWA 4DBLC 2GZDA 4B76A 2NO7A 1ZBDA 2IHBA 2VBCA 3QE0A 4JSYA 2CHVA 2C98A 3MGCA 3HR7A 4D80A 2H1LA 2Z5FA 5BWMA 1L7VC 1Q44A 3KQNA 2QSZA 4P0TA 1I2DA 1Z2AA 5KUTA 1NVUQ 4P4TA 1U9IC 4V0OA 1RRPA 3EX7C 4DZZA 4ON9A 4JMPA 3SZRA 3LXXA 3NHBA 4FN5A 2WICA 3PUVA 2GCOB 1NMXA 2PX0A 2N46A 3P1JA 2F6RA 1Z6AA 4TLCA 5J4YA 4EDHA 5JLJA 1ZC4A 5F9HA 2JLQA 3CX7A 3KFXA 2HCJB 2ZS9A 3FE2A 5JSZB 3ASZA 2O8CB 4LWZA 3GP8A 3SN6A 3MLEA 1R4AA 1Z0FA 2OLJA 1NG1A 1S2MA 1N0UA 1CULC 4JL6A 3QF7A 5KSZA 3W6OA 4C0KA 1XXHE 5FR1A 4Z8XA 3PENA 4NCHA 4DUGD 1QVRA 4WW0A 2FSHA 2R44A 3CZQA 3NIBA 2Z83A 4C30A 4FCTA 2QN6A 2A5FA 1ZNYA 2X19A 4TYYA 4Q4JA 4E22A 3Q7PA 1XJQA 1QZXA 2Z4RA 3CWZA 1E0AA 2IX3A 3FYHA 1GG2A 2D62A 3SC3A 4B2PA 5BXQC 3EW9A 1XTQA 2GZAA 5B2ZA 3AV0B 5KHOC 1DAHA 1IJEA 2ZSEA 4D26A 3CPHA 2ZUBA 1BO6A 5KDDA 2WWIA 4B2LA 1KTVA 1G7SA 3TVTA 4R9UC 2FPMA 3VMFA 3SE0A 2V9PA 3TQCA 4TMWA 2C9CA 2OAP1 3OFNA 3AUYA 4YLGA 4TYNA 2JJ2A 1G5RA 3NH6A 3K53A 4TL9A 3MJHA 4PO9A 1Q1BA 4OYHA 3F3YA 1EFRA 2GCOA 1CJUC 521PA 3QF4B 1HURA 2QP4A 1N6IA 5JSZA 3RAPR 1S0UA 2O8CA 1W4CA 2ZRMA 4C2UA 1UKEA 2QG6A 4NYMR 3PITA 3U3MA 4IXNA 4WZ6A 5JS7A 5AJWA 2YC2C 3OEED 1Z0AA 4E07A 1R6BX 2FFBA 4NCIA 4UNNA 1ZM9A 4TZ0A 4MKFA 2PEYA 3CBQA 3T1TA 1S4QA 1GAJA 3PIRA 4XH9B 2BOVA 4M9XA 3TJZA 2F1RA 1XEWY 1RYFA 5EE0A 3TSWA 3GPLA 2HYIC 1ZJ6A 5KPDA 3BB1A 5TXGA 1CJKC 1XTJA 3UMFA 4C0AC 1NL3A 2ZS7A 4DKXA 2H16A 4DCTA 3ECCA 1GOTA 1T3SA 1JR3D 1E99A 2VO1A 3T15A 4BFUA 3P27A 2GETA 4QOSA 3PJRA 1J99A 1FFHA 1RIFA 1DVRA 4WBSA 1S1MA 1TL7C 2FEOA 4DCVA 3U61B 3T06B 3RANA 2YWEA 4EPXA 1Z0JA 1ZINA 2XEXA 2AHOA 3EWAA 2W0MA 2NPFA 3DEFA 1W36D 1E1RA 3ZIAD 2FPLA 3SR0A 1BKDR 2AR7A 3R20A 4FW9A 3AB3A 3QF4A 3V9PA 4G5QA 4HLCA 2VP4A 3IPYA 4TMXA 4ZO4A 2GTPA 4OK6A 4PR0A 2ZVQX 3R9WA 4KSBA 2WWHA 2J41A 1FPMA 1YZQA 5JS8A 4MDFA 4W5WA 4U7DA 4LJYA 1LW7A 4URYR 4HLUA 1UDWA 1UKYA 2C78A 2F3TA 1NKTA 3EA5A 3IBGA 4HAXA 2IT1A 3IIKA 4YMTA 1G3MA 2VP6A 2BEKA 2ZUCA 1XMSA 1AQUA 5CYOA 4RCYA 1T9HA 4PAMA 4C3ZA 3WRXC 1OT3A 1AZTA 1R5BA 2I1VB 5CJPA 4BZXA 4QGGA 1AIPA 1NBMA 3EPHA 1NP6A 4M22A 3UMRA 4BZQA 4LBVA 1UBEA 5AJYA 1Z08A 4BLOA 3SS8A 1CP2A 1V5WA 1XNJA 5LD2C 1ZNWA 3C16C 4D82A 4NCKA 3EZFA 1U0JA 2ZE7A 4JLBA 3FVQA 1G19A 2ZEJA 4KFUA 1SVWA 3PEVA 1X8JA 3KZ1E 2GJ8A 1SXJD 3W6PA 5KPJA 1VG9B 3CRMA 3AVWA 1N6RA 5L3SB 1Z0IA 3OIWA 1YR9A 3TUJC 3Q8XB 5FOUA 2OFOA 2W2VA 3W9YA 4KU4A 4UJ3A 1L2TA 3E2IA 1G4UR 2ZRGA 2H7VA 3T61A 2PZGA 4Q48A 5CB8A 1OXSC 1E2EA 4R2IA 5BYJA 3CRQA 4BLPA 1QBKC 1OFUX 5J4KA 3U7EB 4IDNA 4PSVA 2AKYA 1A2BA 2RGXA 4ZDWA 5BW8A 4TSFD 4C2TA 3VHXA 3K70B 1KI8A 2VHTA 2ZE8A 3A6PC 4LPSA 1J8MF 2BKUA 4V0MA 2W2TA 3B60A 4EPVA 1JR3E 4RZ3A 3AVTA 1HEIA 3QXHA 2QT0A 1JPJA 2PMDA 4D4JA 1HA3A 3U44B 1OH7A 4JVSB 121PA 3A8TA 1LV7A 2VRWA 2BMFA 1YZKA 3O47A 1LS6A 4IDOA 2JATA 4EIWA 5JFGA 2CL6X 3GLIE 5FFMA 4M1MA 1P62B 4O2LA 2GEDA 2BBOA 3AF0A 2DHRA 1XMVA 3LRPA 1JXMA 4TL6A 5EP4A 3WNBA 1G41A 4DSNA 3L0SA 4B74A 1KKLA 4D0GA 2HXYA 1J2JA 2GJ9A 1P61B 2PX3A 2G77B 3L2OB 5L3SA 1ZIOA 3L8YA 1UADA 5EE5B 5JHHB 4OHYA 3IO5A 4JJZA 3VX3A 2VA8A 3ZVRA 2XNSA 2F3RA 2NO6A 2FDCA 4RD3A 2RCNA 5AWFC 3ICEA 3K70C 3EC2A 1X8KA 1SKYB 4I1OA 4BLRA 1JEEA 2Z0MA 1U90A 2PT5A 3KX2A 2IK8A 1B0UA 1COWD 2WSMA 2OCAA 3UANA 4QKQA 2OZEA 1OSNA 1JNYA 4EPRA 3ND8A 3LDAA 4IJMA 2BIFA 2MSEB 4FWTA 4MITA 2ZSDA 1TF5A 2WMOB 4JKIA 4GI7A 3RYTC 1OFIA 1AGRA 2WKPA 4GP7A 3VR4A 2WJVA 4HLDA 3U44A 3GJ6A 4KXFB 2NZJA 4LZZA 1XZPA 3PUXA 3N70A 2A7QA 1Y63A 1GVNB 2YOGA 1QHNA 2OFWA 4A4DA 1D8TA 3A58B 4PQFA 5G3YA 1G291 2HDNB 2OO7A 2QM7A 2F9LA 1SXJE 2WTUA 3BFKA 5P21A 3UG6A 4HLQB 1P2TA 4XIGS 3ZVLA 4GMDA 2V7QD 3GJ5A 2GF9A 4AYXA 4R98A 2QTVB 3RS4A 2JLZA 2IWHA 4ASUA 3I92A 2ZRAA 3W5IA 4M1OA 2BVNA 5C2JB 4UNRA 4EUNA 3U7HB 4C0BA 2OE2A 4QNMA 1SHZA 3AVYA 4NBSA 1E79A 3NDBB 2EFHB 2VF7A 1RFLA 3C8UA 2GXUA 2X2FA 5CM8B 5JCZA 3TVDA 2WPDA 1PUJA 2IF2A 2FWRA 4WA7A 3OIYA 3VR6A 4HUQB 5FUWA 4BFXA 4OK3A 1KMHB 2ZQ5A 2JDIA 1Q22A 2PZEA 2QNRA 2NOAA 3B9PA 2D3WA 2A5DA 1OV4A 4WOPA 1GRRA 4YXWD 4CEIB 2DCUA 2MSDB 2Q3MA 3U6KA 1G16A 3LVQE 3MFYA 2DFKB 4RFSB 2WBLC 1GKYA 2R2AA 5FBLB 4C0QC 1KDPA 1NMZA 4HB0A 1Q20A 1E4VA 3GEHA 4UKDA 1U8YA 1PUIA 1KKMA 4Q9JA 2F1JA 4KCGA 1WE2A 3V00A 1U9IA 1VYUA 2TMKA 4NE2A 1XPRA 1YQTA 2G9NA 3D8BA 4I81A 2J0SA 1P9RA 2X1VA 2BBTA 1S3GA 2H5EA 2P5TB 1MV5A 3K0CA 1G20E 1R8QA 1G6OA 1VMAA 4NU0A 4JBWA 3GLFB 1ZYUA 2XSZA 5GJCA 3QKRB 4IRUB 4QXAA 4XTRA 3T5GA 1F2UB 3ZLJA 2HXSA 1M8PA 3X2SA 5JRZA 3BIFA 5FTKA 3LBNA 3QSYA 2YWHA 3VR3A 4OI0A 2LKDA 3UMSA 4GZMA 2FFAA 4II7A 3ZJYA 1S96A 3AP2A 3V4RA 4HUQA 4EPYA 1KMHA 4MGZR 1HQCA 3GJXC 1JQLB 2XNDD 3Q7QA 4RKEA 5IHPA 1HT2E 3R8CA 4CEIA 1GZSA 1HUQA 4KODA 4RKFA 4NP6A 5FUYA 2FFHA 4KV9A 1P60A 1YJ5A 1KK3A 3LBIA 1G8PA 1C9KA 3B85A 2GVDC 4BASA 1D6JA 2GJKA 4U02A 1IJFA 2Q3FA 2OESA 5JBQA 2MMCA 4PC1A 4NONA 2FU5C 2JEOA 3WMGA 4O3MA 1XZQA 5TDHA 1P73A 2DFNA 4M1KA 4PHHA 5IDVA 2IS4A 3U7FB 1BYUA 4Q1BA 3B1YA 3RHFA 1M7GA 2G3YA 1XCGB 3TSZA 4C4PA 1N0VC 2O5VA 4JLAA 3FDIA 3GLFA 3SJCA 4X8LA 3RS2A 4I4LA 3QKRA 5DN6D 2QE7D 3UXMA 2J1LA 5K8TA 2JJ8A 1F2UA 4EJSB 1S9HA 1LNZA 5IK2A 1DAGA 3ZZTA 3OIVA 1XP8A 4OI2A 5C4GB 2OT3B 2XXAB 3NWJA 2Z4SA 3LLMA 1IQPA 2HCBA 4UNQA 3JZAA 4WVFA 1Z83A 4WAUA 1GM5A 4HAUA 3AM1A 2OHFA 1BH2A 5AR1A 1CTQA 1NSFA 5GJBA 2WSSD 4Q1AA 4LOAA 1EX6A 2CL0X 2XGJA 1DAKA 5KO2A 1GL7A 4TMTA 1XD8A 3PEUA 4ZCIA 2ATXA 2V8OA 3PCRB 3ZGXA 2ZRLA 1BOFA 1Z0DA 3DHWC 2O52A 2C96A 4V0LA 1CIPA 1E2DA 1W2GA 4HAWA 3BGWA 4TQUS 4XD7A 5KSYA 2J0QA 1V43A 2J87A 1SKYE 4NHOA 1ZNZA 2N42A 3B1ZA 421PA 3U3KA 3ADKA 2ODEA 4GP6A 2GJSA 5E7MA 1DG3A 2AD1A 1NLYA 4BFVA 5JJKA 1KSFX 1KJZA 3NC1C 1X8LA 2FN4A 2QPOA 3QXSA 3H86A 5FTJA 3F8TA 2IHYA 5D3MB 4DWJA 5EXTA 1MO5A 3WYFA 4OQFA 4IVQA 3WBKA 1LB1B 2CLCX 4P4SB 4A15A 2AX4A 4IOMA 1FW6A 1BYIA 5LB2A 1E6CA 1G3IA 4Q4LA 2KB0A 1KNXA 3PG5A 4YQFA 1T0JB 1ZM3A 2ZRBA 1XXHB 3N2IA 3Q9LA 4EJSA 4D0LB 5JI3E 1H8EA 2CK3D 4JJKA 5FBWB 3IIMA 1ZP6A 2WWYA 2IEZA 4FMDF 2XXAA 4DB2A 1BMFD 1JALA 5FOXA 2FA9A 1VIAA 3IIJA 3X1YA 2FSFA 2AK2A 2NMVA 2CVFA 2ZRNA 4TMZA 2ASEA 3NH9A 3BAFA 2HV8A 2ECKA 2AK3A 3THWB 3HR8A 3AQ4A 5DYIA 2E1RA 1UJ2A 2CHGA 2YV5A 4A8JB 3CX8A 1NN1A 4XVQA 1NRJB 1OKKA 2JLSA 3M1IA 1H8HA 2QROA 4RFVA 2ZRKA 4X8MA 1W5SA 3RSLA 4DDUA 2PJRA 1SVKA 1U81A 4R2HA 4YDHB 4ZI2A 5CK5A 1TU4A 1WP9A 5JRJA 1CRPA 1D9ZA 4CEHB 3AP1A 4HB2A 4TTRA 4XSGA 1CJTC 1YZTA 1MRSA 2REXB 1NN0A 2ZAOA 4X8OA 5D3MA 1KJWA 1PLLA 3H84A 4P4SA 2P5SA 3DOEA 2RGCA 2HJVA 3NG1A 2XAUA 1XEWX 4PPQA 1QHIA 3VR5A 1D2EA 3HP1A 1XXHA 2QMEA 3I8XA 4HDQB 2QY9A 5CLLA 4BE7B 1GWNA 3UIEA 4A0FA 1I4DD 1Q1EA 2CVHA 2OUKA 1EK0A 2C77A 3SHFA 4ZI3A 3X1ZA 5H68A 1KGDA 3U60B 4FMDB 1JECA 2EVWX 3I5XA 2QTFA 1NVVR 4O2RA 5EQTA 2CEAA 2KBFA 3DDCA 3EXAA 3A36A 3RS0A 3UKDA 1E98A 2CE2X 3W3ZB 3THWA 4NDZA 4A0HA 2RGNC 5KNBA 4MRVA 4Q01A 2PMKA 2OV2A 2ZVPX 1UM8A 4CT5A 1R10A 3FOZA 1E0SA 2Q21A 2ZRHA 2VSFA 5CDFE 2H17A 4N0DA 1SVLA 1II0A 2BBWA 2J7PD 3B82A 1MRNA 1G3RA 1XMJA 4Q21A 2QAGB 4MKHA 4CEHA 1AZSC 2FFQA 1MO4A 5TVKA 3VR1A 2F1IA 1GRNA 4IOKA 1XTSA 1EWQA 2QUZA 2VHQA 2FGJA 2YVUA 2R6FA 3ETLA 3Q85A 5TY0A 3SJZA 1F3OA 2QGNA 3Q5DA 4JL5A 2NZ8A 1CR1A 5K8LA 3RC8A 1N0WA 2YYZA 5L3RA 3W8NA 3K0SA 2HLDD 3FKSD 3Q72A 1OHHA 4V0NA 3RS5A 4B71A 2FNAA 4G0NA 5FPKA 3A1VA 3KUCA 1QHSA 4CT4B 2WV9A 3C5CA 1ZM7A 5BYKA 3QG5A 2VEDA 2IXEA 4V03A 1U0HC 4A82A 2DR3A 3QPVA 2P67A 1XEFA 4GZLA 4IDPA 2HT6A 3U2QA 3L0OA 4JYBA 4RCZA 5CB6A 4FCWA 3CF6R 4LHVA 1S8FA 2PLRA 3B1WA 1XF9A 2ZI3A 1IXRC 4UNPA 1SVSA 1TMKA 3NTUA 4L16A 5TMPA 1R5NA 4LX0A 2EFEB 3S1AB 5HKKD 2VL7A 1G3QA 2ZANA 2QAGA 3NDPA 1VECA 5DNYB 1PVOA 3KQLA 3WHLA 3CF2A 4B32A 2FX3A 1KMQA 2GILA 4LJ4A 4HYYA 1II8B 5DIFA 3K70D 2FEMA 4DDTA 1ZD9A 2KBEA 1AS2A 3HJNA 2G0NA 2FZLA 4MYCA 4LRWA 4OQXA 3SBEA 1E0JA 1KO5A 3VHLB 2PCLA 2XZPA 4JLPA 3K0FB 4IDHA 4A92A 3RWMB 3KJEA 1KO4A 1W5TA 2ZRFA 2ZYWX 1IY0A 2BJVA 5E3HA 1YVDA 1QHHB 3RABA 1CR4A 2R6CA 1YZGA 5BQ5A 1E0KA 5IT5A 1JB1A 4TMVA 5LBIA 1J70A 4ZKDA 2WJYA 2JJ1D 1G8GA 2QPTA 4DCNA 5A4JA 3CNLA 1FP6A 3BFVA 2P2LA 4B2IA 2FSIA 3ZD7A 4D25A 4W9MC 3GLIB 1SVIA 2AXNA 1N6HA 1NVXQ 2OAQ1 4XTCS 3ZS9A 2QZ4A 2OCBA 2ZI7A 4K46A 4HB3A 4Q5IA 1W36B 3S1AA 3MUFA 3OAAD 3WXMA 1YR7A 5GVSA 4RD0A 2VHCA 1U2RA 4P31A 8OHMA 4PPNA 1GNQA 3GJ3A 1RW4A 1VG8A 5FOWA 2X77A 4JSTA 5F9FA 2XZLA 2ZU0C 2P6UA 2WIBA 2PZFA 1II8A 3CNNA 3RLFA 3OEEA 5JJLA 3FMOB 4PC3A 3O8DA 4HDCA 1LVGA 3QQ5A 1TQ6A 1IN5A 1X86B 2L0XA 3T34A 5JWOA 5KNDA 3MRSA 1XTKA 3GEEA 2CE7A 3K0FA 4MYUA 4P3YA 3WHKA 2ANCA 1OB2A 2NO0A 4AG5A 1YZUA 1XD2B 1JR6A 1QHHA 5FI0B 3KQKA 1ZU5A 1E2HA 1JR3A 1QHYA 2A5GA 4H9GA 2W2XA 2IYWA 3CRRA 2KSQA 1G7TA 3WMFA 3OEHD 3W34A 2GXAA 3TW8B 3GLIA 3L43A 1CS4C 4Q7KA 5HTKA 1TNDA 4PPFA 1Q12A 3BWDD 3NBYC 3TLXA 1SXJB 3EZ7A 3QJYA 4NKRA 4EPWA 5C4MA 5JJIA 4HUTA 3ZIAA 4URZR 1N5LA 4EFLA 1XJCA 4LJ7A 5EE1A 3EPKA 2C03A 4JLMA 4M4SA 3AKYA 2C95A 1RJ9A 4RD2A 5AUNB 1IN8A 2VSOA 5EXSA 4BEJA 2J46A 4ARZB 2AKAB 1E2KA 3PEYA 4IFBA 5G40A 4DSUA 5JWRA 4QG7A 1Z6YA 1JJVA 1XBTA 2ZJ8A 2ZRCA 2OILA 2JGNA 2FE4A 2ZIAA 1IY1A 2VP0A 1E2IA 4F7WA 1KI1A 5ELXA 2G83A 1G7CA 1TQ2A 1XD2A 4AYTA 1T8UA 2KI5A 2RH5A 4JVMA 2B6HA 1Q21A 1NSTA 4GSYA 4JIMA 1CKEA 1Z0KA 3T12A 4BFZA 1NIPA 4K81B 2IUUA 3B6EA 4DXAA 4LC0A 1U94A 2QI9C 3E1SA 4PO8A 1E3MA 2HYDA 4IEEA 3BORA 1TUEA 1L4UA 4W5HA 3V4FA 1MH1A 2R65A 1A2KC 2GVZC 4RD6A 3CX6A 4KYUA 2A5YB 3SFVA 5CITA 1D9XA 1NN3A 2QU8A 2FMXA 2ODBA 4LGMA 4ABYA 1SXJA 2VLIA 2A78A 1JAHA 3KFVA 3K9NA 2P0EA 4C7OB 2PH1A 3VR2A 3R8FA 2NQ2C 4IFEA 1ESMA 1WRBA 1XFAA 1S9DA 1OH8A 1DAEA 3NVAA 2ZTSA 4ARZA 3AVOA 3KKPA 5E7IA 3A4LA 1XPUA 5A0FA 2A2ZA 4CDGA 1T91A 1P6XA 4TSFA 4Y0AA 3KQHA 3IILA 2MSCB 1E32A 2PBRA 1IN7A 3UWOA 4MH0R 2ZU6A 4F4JA 4Z51A 5AJZA 1Z6GA 1F60A 4Q9LA 4I1UA 5FUXA 1M7HA 3UATA 2V6IA 4Q9IA 4CEJB 2G0TA 3DL0A 1GKUB 4DC9A 3AKCA 4QFMA 1MR3F 1G9XA 3K09A 4Z8YA 4UQOA 3TH5A 4WZBE 1WBDA 2NG1A 4JLVA 3IPXA 2R6DA 3QPUA 2IYTA 4RVCA 1E2LA 1VPLA 3KXLA 4TYWA 3AEZA 4M0LA 4QNRA 2ONJA 3O8CA 4QBIA 4B48A 1NMYA 2GZHA 1FX0B 2WOOA 1IAQA 2OSBA 3IBYA 1E4YA 2W6JD 1KAGA 3K0AB 3AF3A 1T3LA 4WIAA 4EFNA 3IEUA 1M7BA 1EESA 3IDQA 4RD1A 1WB9A 1GSIA 3DPUA 4C7OA 4XVRA 4AI6A 2YINC 4GMXA 2QM8A 4DT1B 4CGZA 3HPRA 3X1WA 2BKEA 2QQ0A 1OIXA 3BS4A 2IL1A 1GP2A 1RKBA 1VYVA 4NCJA 4NTZA 4CF7A 3LH5A 1N5IA 3LQRA 1NBMD 5FTMA 3SJAA 4AKHA 4PTLA 5B57C 1A1VA 3KXKA 3BH0A 2WAYA 4ZKEA 3NXSA 3B9QA 4AK9A 4FI3C 1TU3A 3AKEA 4AG6A 2ZUDA 2IXGA 5K8UA 5J4LA 4KBFA 1P2SA 4GL2A 4CEJA 3WMEA 1D2NA 4DLWA 1X1RA 3WNDA 2Q9CA 4ACAA 1IN4A 1RZ3A 2WWXA 4GRAA 4TT3D 2DB3A 1TF2A 4BPBA 3ADCA 5GVRA 4V0KA 1M34E 2ZRPA 1EX7A 1AK2A 3THXB 1HE1C 1NVVQ 3DVLA 1Z6TA 3JVUA 2BDTA 3THYB 2WWWA 3D7MA 3RDPA 3QY0A 1FX0A 5JEDA 2V7QA 4XOIA 2GCNA 1Z3IX 1UKZA 1ZM2A 2BMDA 3FKQA 2IS1A 3K0AA 1VG0B 5KU1A 2E87A 5EUQB 4TLDA 4PZZA 2OBNA 2ONKA 1C1YA 4FXPA 4OKSA 5TARA 3AF4A 5DSZA 5JHGB 4DT1A 2YOFA 2DY1A 1YHNA 1QG2A 4ITRC 4QC2A 3CIOA 4DCSA 2IS6A 2R6AA 1SGWA 1NN5A 1G18A 4S35A 2WMNB 2JIZD 4AWXA 2W6ID 3KXIA 1FZQA 1E9BA 2CNWA 5F3WB 2OXCA 2GBLC 1JJ7A 2ORWA 3IHLA 3U5ZB 1H65A 1ZIPA 3BD9A 3L8ZA 4Q9HA 3ZQ6A 1E9CA 4X8HA 1JPNA 3KQUA 2RHDA 4XSHA 1OF1A 3LY5A 4YXWA 2HT1A 4XWOA 3ZD6A 2WJHA 2ERXA 4G5SA 1J8YF 1JAIA 4G5RA 2RKOA 5EE9A 2V1UA 2Q9AA 2ZRDA 4US2R 4U00A 2D4HA 2X8AA 2Z43A 4S2EA 1YE8A 3FMPB 1XD9A 4V02A 4MUAA 4LYJA 4UJ5A 3VX4A 4FD2A 2KE5A 3TW4A 3THXA 4PHGA 1DS6A 1UF9A 1WDTA 2V55B 2AN9A 2WHXA 3THYA 2YKGA 1IOZA 4MRPA 1KAOA 4DDWA 4L5BA 3OZXA 3K8YA 1M2OB 4TTQA 5AUPB 1IN6A 5FI1B 2VP5A 2G1JA 5BN5A 4BEBA 2FGKA 5J4VA 4PO1A 1VCMA 3FFBA 4FINA 2DWOA 1SVOA 1TQDA 3H0KA 2LWIA 4OHWA 3VKHA 4IVPA 1E94E 4Q1CA 4Q7LA 1HQYE 4OJKA 3WY9A 4LYHA 1HY3A 1VIYA 5SZJA 1KO1A 5FOTA 5JI2E 4BRWA 1OYWA 3L82B 2VHUA 3QXJA 4LUCA 3GFTA 2HUPA 3KUDA 2EWVA 2QRNA 3BB4A 4HAVA 1RRCA 2IYUA 4EQ6B 1XTIA 1KK2A 3CR8A 1J7KA 4QHTA 1P2VA 4LI0A 3O8BA 4ESHA 4QJ3A 3HDTA 1UDXA 4M1WA 3RRNA 2OXRA 1OFTA 3I3SR 1GIAA 2QEQA 5HCIA 1T5LA 3AKDA 2ZM5A 3B5JA 1MKYA 1W49A 1G21E 2WJJA 3C41J 3LW8A 4TLAA 3MCAA 1G17A 2P65A 3EPJA 3GMTA 4BGDA 5FOSA 4YC7A 1NJGA 5KTYA 1K5DA 3ND9A 3LX5A 1KO7A 1ZUNB 1C4OA 3LWNA 4GOJA 4A1FA 1OH6A 1HYQA 4TQ9A 2P3SA 5HCNA 2GESA 2N1BA 3EZ6A 1E2QA 3F5FA 1ESNA 4UXJA 4EAQA 3G0HA 4KBGA 2A5JA 1FUKA 2CLSA 4TYPA 3EG5A 4DDVA 4LJAA 4BZPA 1OW3B 2J9RA 3MWKA 4DB4A 5KSPA 1ODFA 5DN6A 2QE7A 1E69A 2ZI5A 5FBQB 3KKMA 1YU9A 4LBZA 1G6HA 1F48A 4Z1MA 3KKOA 2GHIA 1EG7A 3WP0A 4DLVA 2QAJA 5EE3A 4FCVA 1GDDA 2ORIA 4OHVA 5DI3B 3ZZUA 2NO1A 1W1WA 3W6NA 1NY5A 2FH5B 4Q1FA 1U8AA 1W0JD 2QMOA 4JLDA 2GK6A 3KB2A 4L15A 4QRHA 3TGPA 1P7CA 1WMSA 4EQ6A 4AD8A 3ZVNA 4C0JA 1Z47A 4GT1A 2WSSA 3DO6A 3GJ4A 3RWOA 3BB3A 4M21A 3BH6A 4Q1DA 4F4IA 2OFXA 5AJVB 4OQMA 3LX8A 1T5IA 3ZDQA 2R62A 2RGDA 4TMKA 2QP3A 4LK2A 4H1VA 4QM6A 3W8RA 2ZE5A 1US8B 4L9SA 2GEVA 2CHQA 4RZXA 3UG7A 2ZI6A 1N6OA 2Y8EA 3KKQA 4TQAA 4MA4A 5CDFA 3GJ8A 5FPHA 3BK7A 2J45A 3ASYA 3KKNA 4AKIA 1CR0A 4Z54A 4MRSA 3I61A 1N5KA 3MD0A 3DZDA 1WF3A 1T6NA 4Q19A 3SU8A 2C99A 4GOKA 1I4LD 221PA 1R0XA 3SHWA 1K5GA 1ZMXA 4TWZA 5LB4A 3GLHE 4MUBA 4PC2A 1NLZA 4BFSA 2D06A 1FUUA 3QNUA 3QI2A 1PLJA 3CW2A 5L3QB 5J47A 1DELA 2IYYA 1R7RA 2B7BA 4C0LA 4FWIB 1G7RA 2GJAA 3U3OA 4GDFA 2CK3A 3GEIA 5DI3A 3P32A 1R0ZA 3HYTA 5GJVC 1BMFA 1DTSA 3B1VA 2OEPA 4YMVA 5AK0A 1SULA 1VKJA 3BRWD 3P4YA 5FPTA 1RC8A 3RS7A 1E9DA 4LDJA 5LD2B 3B78A 1GTVA 2CCGA 3I32A 4PHTA 4OI4A 3C14C 1BIFA 3MWLA 1YKSA 1MO3A 3GQBA 2J3EA 1FMJA 2Q9BA 1G5TA 3M6AA 3AGPA 3PV0A 5TB5A 4B3XA 1Z29A 1L8QA 3FB4A 1US8A 3PUWA 4HLUC 4LJ9A 4P32A 3R9IA 1X3SA 3LBHA 3QIAA 1XX6A 2PCJA 2XX3A 2JLXA 3AVXA 1PJRA 3VNVA 4R7ZA 3QPWA 3LQQA 3RS3A 2WAXA 1O87A 2CMKA 1FTNA 3E70C 3L0PA 5BN4A 2D7DA 3FHTA 2CCJA 4GNKA 5B58C 5AUOB 3AP3A 1R5OA 1FTSA 4M1YA 3I1FA 2ZJ2A 1UKVY 3LFUA 2BV3A 3A37A 4NPHA 1G4AE 3ZYCA 1ZD8A 5KDOA 1E2FA 2A30A 3DM9B 4AURA 4PFSA 1Q1ZA 3KJHA 1QG4A 4YONB 2ZYVX 5L3QA 2IYQA 1GL6A 4DLUA 4BFYA 4EPTA 5M04A 3C15C 3QXXA 2NPIA 4URUR 4BWYA 3PXGA 4AKGA 2ZJBA 1YRAA 1E96A 3LA6A 3AF1A 1DPFA 4QHYA 2EYQA 3GCGA 4TYQA 1CU1A 2AFIE 2G6BA 3D6TB 1GKIA 3HPQA 4QM7A 2RMKA 3VU9B 3WBJA 1Z6XA 2V1XA 4AKEA 4Q4AB 2JASA 1CF4A 1ZU4A 2H8KA 4Q02A 3VQTA 4TTPA 1ZM4A 1XTRA 4N3NA 1YZLA 4US1R 4ZIRB 3W3AA 5DLQC 2ZREA 3OF5A 3CPEA 1YR6A 2QTHA 3IGFA 1E2JA
chains in the Genus database with same CATH superfamily
1H23A 1R9JA 4YPVA 4G86A 4R1NA 4B0OA 5P8WA 4JB8A 2J32A 1PUXA 1ZQ9A 3ANYB 3QVGB 4YCDA 1MABB 3TE6A 4NYIQ 4BX8A 4PZLA 3LCVB 5EXDA 3RRMA 5DGHA 4ZMBA 1AH2A 3S70A 3PDCA 4HR7A 1KI4A 2R5WA 1W73A 4B7XA 4AU1A 3USZA 1DINA 1NQUA 2H59A 2ZWVA 4GICA 4KQWA 3VTKA 2HLDA 3FKSA 3D2AA 5EHXA 3OWOA 1M2EA 2DBRA 1TADA 2AG8A 2C9YA 1U1DA 2DFPA 2Q3HA 4GMGA 2K7ZA 1A7JA 5IG2A 2GHQA 3LAWA 1XWIA 5GJWC 4RV4A 3T7AA 5KU7A 2NWQA 1M83A 1KEEB 4YRKA 3G2OA 2WNSA 2Z6VA 3DLTA 3HKCB 1E2PA 2YJ4A 1XEXB 3MIZA 1NVMB 3OE7D 1I32A 1ZXLA 2OBYA 2QQ5A 1N36B 3HO1A 3HBLA 2HHAA 5HIIA 1S8OA 4KN6A 4MR8A 4Y6OA 3B2NA 3K1AA 3R3UA 1UBFA 2GF0A 4H27A 1ZD3A 3WB2A 4A6DA 1JVNA 2PA3A 1OYVA 1AS0A 2F90A 1EFTA 4UOEA 4RHCA 4R1PA 4YEDA 4ER3A 1YKGA 1CY0A 4BP1A 5FL7D 4JR0A 2TMGA 2KW5A 3LVBA 2F43A 3LV8A 4IAOA 4R2JA 4DM3A 5U1PA 3M9XA 2IY8A 4YJFB 2ZJYA 1QLWA 2A58A 1OTHA 4UHFA 3LUHA 5LJLA 2X5OA 3LD9A 4D8XA 1X7YA 2INGX 4XVCA 2VIIA 4M8SA 3PNOA 3I01A 4WCFC 3HR4A 1VIDA 5IN5A 3CX3A 1MX3A 2XCLA 2O8EB 4P38A 3ZXXA 2WSBA 4NZNA 5CA0F 4I1SA 1GUAA 2QUHA 1H9CA 3BZBA 1K89A 1ZCZA 5G4KB 3GT3A 1ACLA 1BHQ1 1GPMA 1VHWA 2OP0A 3CSUA 1VDZA 3ZH9B 3WB0A 1T4GA 1PW5A 3MCVA 1U2ZA 1VCIA 3D31A 3JQAA 3PXXA 2AFRA 4XVUA 2PKQO 1TM1E 2Q1YA 2WP8J 3I9KA 3INNA 1HPLA 3O4FA 4X92A 4CGYA 5K8IA 3AR6A 1JQDA 1ULHA 2C4WA 3L0BA 4QASA 5CH8A 4F5DA 1XZNA 3EEOA 1SUFA 1UBCA 3BXGA 4BEWA 3ZQKA 3DLCA 4DY4A 2IUTA 3O4GA 1J9EA 3R5FA 4M99A 3OQMA 4BMPB 1GAWA 3SI7A 3BXZA 1H5UA 3IOBA 4ZOQI 2QRZA 4K6MA 3AR9A 1SAYA 4BJ6A 3COYA 2CLDX 3HHPA 2D2FA 2PU7A 3UQYS 5CDYA 4KITB 4BLTA 1QOZA 1UAYA 2F8MA 4WLFA 4PZEA 3SYNA 4QOJA 4TUYA 4YCMA 3WDLA 2AWOA 1JIXA 1H05A 6REQA 3NTRA 2NO9A 3V3TA 1JKJB 2ODNA 3VRHA 4D9HA 3I8SA 3IT3A 1SIOA 3JSAA 1ZRHA 3D4IA 1VZ2A 2B1JA 1V7ZA 2C54A 4PQEA 5D3QA 5L4NA 3I5AA 4AZWA 5F23A 5J4HA 4A0RA 3O3NB 4ZCPA 3ZVMA 1YZNA 5I7SA 1JJAA 2D1RA 4DHEA 4Z4IA 1LWOA 1VA5A 1O4WA 2JANA 4C03A 5CK4A 1E1QD 3GNSA 3K0EA 1XL1A 4I14A 2ZR7A 5CB4B 3QEOA 3OU2A 3P2OA 2YJ3A 3QVUA 2J85A 2MSWA 3H2KA 3IJRA 4NZZA 3MTJA 4X45A 721PA 4OXYA 2IYVA 2ZYDA 1BEZA 4OP1A 3RRJA 2I4IA 3K0CC 2QPLA 2ZSBA 1TOAA 2XRFA 4Z4GA 1NQ5A 4MZXA 1ZSNA 3T5BA 3OTIA 4LSGA 4AF7A 3DOFA 3VNBA 1F4VA 1B14A 5K4AA 3M0EA 2BSXA 4ALMA 4I36A 5ILOA 1Y7HA 2O8FB 4QDKA 1RJ9B 4MAFA 4LCBA 1ODSA 3EGXA 4MS3B 4MUGA 3ZHBA 1KYQA 1WZCA 3RYHB 3KJIA 5GGYA 3OEHA 1YULA 4YHBA 3KU4A 3FNBA 4IIYA 3ZV5A 4EAAA 2ZSIA 6AT1A 1VHDA 4NAUA 4I99A 4FDUA 4H0FA 3SX4A 4XD2A 1OLSA 4FFNA 5AW4A 5EQDA 3PSHA 4DMMA 3F5MA 5EMLA 2J3IA 2VJPA 4JR1A 2VPXA 2JAUA 2HDHA 4U8GA 3S1LA 4ER5A 1BE8A 3I52A 5AI4A 4MVJM 2H2DA 5JPDA 4L8GA 1HFJA 4R0MA 1PR6A 1H94A 2QVXX 1IBKB 2W0SA 2ZXEA 2AG1A 2VBGA 3PWSA 2MIIA 3CNHA 3KZKA 4HB4A 3B6KA 1EG2A 3V2UA 5F7XA 3UJNA 1AQ6A 2QG9A 3HZHA 3NJRA 2QWXA 3LC0A 4RTLA 4IIXA 2M98A 1J90A 2WB2A 1XTVA 1K8QA 1XVIA 3FHCB 1Z17A 4JFAA 1ATZA 1DRKA 5AJXA 3RT9A 2O50A 2DH6A 5GQSA 3MM4A 1XQ1A 3P20A 1RC1A 2JI4A 3BH7A 4L07A 4DSAA 5A04A 4HSGA 5AJTA 4ZDIA 4AP5A 2OG1A 4A27A 4ETWA 4TLBA 1GZ4A 4BDSA 1MAAA 1P72A 2BBSA 3ILVA 3MT8A 5CT6A 3TTXA 4EMSA 4A6XA 2VPPA 2MSNA 3LOQA 3NOOA 4NDNE 4YPOA 4IYRA 4WKOA 4D4HA 1W48A 3SX2A 2D7CA 4FYKA 3IR7A 2C5LA 5BSRA 1EWKA 1HT1E 3EASA 2FJUA 4HQ6A 2GAAA 1KJIA 3DV0B 1W85B 2AJLI 4PICA 1GL9B 4YWJA 5BNTA 2JGFA 3ZQJA 4NECA 3TUIC 3U4QA 3I0NA 2FPPB 1K4KA 1JG7A 1LF0A 1X74A 4A6PA 5A3JA 3KHKA 5FEUA 3N8NA 1MIHA 3B3QA 3M5CA 1U65A 4NBKA 2V6JA 4E5NA 2Y2VA 4A2WA 1XJ5A 1ZSYA 1FQJA 5LZ4A 1EDDA 4V24A 2QMYA 3SHQA 2CMFA 3ESAA 4BNDB 4F9EA 3DE6X 1A9ZA 1OWMA 2LCFA 3I4LA 3IRUA 1ORVA 2D2EA 4RSMA 1N2CE 4F5YA 5LZ2A 4MO2A 4W6QA 1YB2A 4RKQA 3IVXA 4MAAA 4DCCA 4PLVA 4BNXA 3QV2A 3HVIA 5ALXA 4RAOA 2OHXA 5FOQA 4G0UA 3L4EA 2OECA 1IAVA 1DJOA 1DJNA 1KR2A 1CIVA 1SN7A 4JENA 3DF7A 2AZ4A 3I0MA 3AJAA 3M82A 2W4MA 3VZCA 2JVIA 5I01A 3MJ4A 2OMKA 1VFPA 4Q9KA 1P5ZB 2HA7A 4BY9E 3B7GA 3VPAA 5FXMA 3R7DA 1L5VA 3QMMA 2QT1A 3HA2A 1VQ1A 1TZBA 3MAAC 4JA2A 1FEZA 4GPBA 3SDZA 5C3MA 1GFSA 1WABA 3EH1A 3K9GA 3KOUA 1ZLXA 5A1JA 2OGWA 3MWDB 4HYQA 1BWRA 2WDPA 1YL6A 2R60A 2WF7A 2XWPA 5BWLA 4TGLA 4LC9A 1Z2NX 2W6OA 4DJTA 5C53B 4YJ2F 1VJCA 1N6LA 3GT0A 1TI7A 1JT9A 4IJ6A 3PPIA 4UMFA 3WK8A 4ZZ1A 5HKBA 1FNNA 1ZJWA 4RVUA 3ULKA 2G5PA 1NLMA 5FUVA 3HJTA 3DBLA 1T0BA 4XQGA 1EDBA 2CMDA 2DX7A 5G1NA 4MDEA 4Q6BA 1VG1A 2J0EA 2QBYA 4HQOA 1VXRA 4B6QA 1G8JA 2G04A 3C4JA 1R6TA 4EW6A 4OPMA 1CR2A 2CBGA 3QOFA 2XUAA 4MTCA 4BO3A 1M76A 3T1HB 2CUTA 3R5XA 3ZIUA 3OLZA 2Y0EA 5B7PA 1ZX1A 1DO0A 3Q0IA 4BVEA 1I7SB 4J8PA 1CJMA 4KQJA 3TBKA 4KHPB 1D0SA 3G0BA 3D0QA 1Y8RA 1XMQB 3QLUC 5E1MA 3CPJB 1I8TA 3EOAI 5TVGA 3GLGE 1BX3A 2QN8A 3B2EA 2C9ZA 2C58A 1U1EA 2H4WA 5JDCC 2HMYB 1LY1A 3RRYA 1OX4A 1SC9A 3D4LA 4ZQEA 4NCNA 4EA9A 1ZMOA 2CL5A 4ILKA 4LXGA 4NYIR 4EY7A 3SQDA 4ZHQA 4E13A 5EJ8A 1UIRA 1Z28A 2EHDA 3K1JA 5DH9A 3E23A 1TKCA 4W5OA 1YV9A 2P6PA 4ISCA 3RTAA 2ZB3A 3COSA 3LECA 4C4XA 4TZ6A 3VKWA 4G0OA 4ADSG 3FAKA 1JVBA 1EWTA 2HNKA 1TTQB 4DLXA 1J8QA 2XYQA 3R7BA 2RGUA 1OPRA 1KEWA 3MB5A 3EZNA 3FDXA 3TAHA 3DGFC 4OQZA 4AJKA 4GPAA 2QNBA 1NRXA 4RMIA 3CSSA 4TKUB 5JCXA 2V97A 3RUEA 1RVDA 3NHPA 3ZOKA 1LI7A 2Q6TA 3PK0A 5B12A 5NLLA 4YK7A 2XCQA 4FHFA 3X2FA 2VQSA 3URKA 3FAZA 3ZBTA 5IYZB 1AMUA 1BVUA 2OBMA 1J21A 3PS9A 5K51A 1WEHA 4N9WA 4AJEA 3V5NA 2B3TA 2H0RA 1HEUA 4XB1A 3GLHB 2X1LA 1RS0A 2M1ZA 4XGIA 4CM3A 4DUZB 1KH1A 1P1RA 4JLNA 3ZWDA 3DCJA 1MB0A 4MR7B 3ZVKA 1VI6A 3KDAA 2R1TA 3N5CA 1YUBA 3NJ8A 4CT0A 2H51A 2JIZA 2OORC 2WYUA 4FB5A 2CLKB 1GQOA 2NUTB 3REOA 2GOYA 5FBVB 2CBZA 2CL7X 1P2UA 4NE9A 4R54A 1YDHA 2G67A 4M1SA 1VE5A 4LHWA 1DFGA 2WM2A 5K0TA 1NRIA 2CXPA 1GNRA 2OHJA 2DR2A 2FVXA 1O8CA 4UVGA 4E5UA 2ADFA 5E95A 3U4IA 3D2LA 1OY1A 5AO9A 2RHMA 2HMAA 2G9UA 3IEMA 2VCEA 3I34X 4HTFB 3USCS 3UH0A 2H1IA 3ZE9A 1SQ5A 4B84A 4X1IB 5DTJA 3DAGA 4D4MA 4WT7A 3SLKA 3ZNPA 1S89A 4KLNA 1IEQA 3ID6C 1GT91 3W3AH 4RK5A 5LQMA 2IEYA 2YFKA 2Q5IA 3PQ5A 4L9WA 2JIBA 2RI0A 1PR5A 2PTGA 4GO1A 3CUUA 2PFKA 3NETA 3RF7A 3WQHA 4CG1A 1W4BA 3QEMA 5JXHA 1NNLA 4OSEA 1L6IA 4Q00A 5ETJA 3ZQUA 5HZMA 3WYGA 3VBEA 3K9LA 1FRQA 1X1AA 3L79A 1XELA 4H31A 1XVVA 3CRW1 3G89A 3Q2IA 2Q62A 2NTYC 1C9EA 2UZ3A 1B7GO 3WOVA 4BO7A 3VZPA 1JDBC 3KV3O 1OXTA 1RYZA 1SG0A 2R8XA 4W1RA 5DMHA 2NV2B 5EWJA 3N2KB 1B0AA 4RZIA 5D85A 4DMUB 1Q7TA 5LP6A 1YRHA 3PDIB 1FFBA 4UDYX 2QAGC 2M32A 4B75A 1J07A 2H1RA 5JXWA 4KKXB 2W00A 1EVLA 1TKBA 3FTQA 2I1WA 3LPLA 4QYSA 1XGKA 5DGDA 4BYGA 5FX2A 2AYXA 2O8BB 2PWPA 4BPRA 4O2BF 1WDKA 1Y1LA 4B3MB 5DYYA 4X6YA 2I6SA 4KI7A 1RTKA 4ZV4A 4TTTS 2AOUB 3CNOA 1QR2A 4ZOLA 4BMCA 1IOLA 4AG3A 2VXOA 1GDHA 2PD4A 4IIVA 3RV4A 3CG0A 3RVOA 1QVWA 2W2KB 3VBCA 1V1MB 2CDAA 3COPA 1A4RA 4F5WA 1L7MA 1A9OA 1HI9A 1I80A 1Q3HA 4L8YA 2HIHA 4RK0A 2Y27A 1VI5A 4X20A 3R7WB 3U6BA 3MCZA 1CY7A 1GTZA 9ABPA 5DCUA 2PBLA 1Z68A 2E4XA 3L01A 4ICIA 3S1SA 4Q3KA 2FW1A 4JLSA 1G6KA 4N8EA 2WJWA 4ED9A 4M9QA 2J59A 2XE4A 3C7KA 4NZOA 4UHEA 2NTNA 3RT1A 3H1GA 1TZMA 1Z7BA 1RI3A 4Q3AA 3C5HA 2QP9X 1FX1A 1LSOA 3PQFA 4JU9A 4C9BA 4PFKA 2OFPA 3W2HA 3IPAA 3GIWA 2J5QA 2Z2ZA 3C87A 1ZO8A 2VHYA 2V4MA 3P2KA 5HS4A 3MMPA 1MGPA 4JWTA 4KJZA 1Y1PA 4LF5B 2X3YA 2JLWA 4W5TA 5LR6A 1ZJ5A 1G5PA 2FWMX 3VDRA 1JDSA 3AUJB 3TDMA 3JARA 2O0JA 2JFZA 1AKRA 3DMRA 1UQRA 2YXEA 4ROTA 3ZEAA 4DMHA 5JBIA 1EVKA 1G8FA 5DNCA 4ES6A 1JU4A 1E79D 3G9QA 4JSRA 1AV6A 1AN9A 3L7JA 2I6QA 4E32A 5M5BA 2EFCB 4I2NA 5AOBA 4M1TA 3WIUA 2WPDD 3NCHA 4OHXA 3ZV7A 4EG0A 5JQGA 1A8HA 4UUNA 4V0ME 5SY6A 1M2VB 1WXXA 3ZHRA 4ZT3A 1ECBA 4K6OA 3RRBA 2QLTA 3DXXA 4CMIA 1K9VF 4NJOA 5AD1A 1Q2XA 4LYAA 3SQWA 3DLAA 4R1UA 1S7CA 3GT4A 3M5DA 1BTOA 4PGAA 1TO6A 1YFKA 3BOSA 4L9AA 1HETA 1OH5A 2AQKA 3E5NA 4OREX 2Q6KA 4FFRA 5IJAA 1CF2O 1B16A 2W2LA 1Z39A 3LQKA 4CXMA 5EZ6B 4BX9A 1XDWA 4V1CA 4C4TA 3V8NA 1ZPDA 3EUWA 4AO7A 5B7QA 2VNSA 1E64A 2OB1A 4K05A 1EAMA 3Q5EA 4HDOB 4Y9DA 2XF8A 1KZ1A 3TNLA 1MTOA 3KWFA 2FXIA 2JIRA 1DI0A 3GOHA 3ZN2A 2WKRA 3LHFA 4J0GA 1N8NA 2G1KA 1ZLYA 1U6KA 2D74A 3AF2A 3GYBA 3PR2B 4DADA 1Q16A 4WZAA 4XSVA 3CVWA 3F73A 1AOXA 3AI1A 3QVMA 2I1QA 3EPLA 1CY6A 2O7NA 4DR2B 3GFGA 8AT1A 1BKYA 3CA8A 1ZK1A 4OL9A 3AETA 2H1VA 4GYWA 1W36C 4KNWA 2IUSA 2ZAYA 2HFKA 2PV7A 4Q3LA 4CU5A 2CXRA 3BRWA 4M9CA 2OOKA 3B8EA 2QRVB 3EIXA 3ROTA 2BCGY 4OH7A 1J0DA 4FYXA 1UEIA 1NMQA 3MC1A 5FIUA 1YBHA 4H59A 3G79A 4IIGA 1TX4B 1E7RA 4QOHA 1XYYA 1T2DA 1ZAKA 4MEAA 1ZD2P 2AUTA 2WP0A 2IHZA 4DNFA 3L7AA 1ISSA 4ZAYA 3JATB 5IAJA 2OQ2A 4BQQA 3ZCTA 2Z98A 2Q7XA 2ZYRA 2DOKA 3OZUA 1C1DB 2B1QA 1XKXA 1WAMA 4EGSA 4WGFA 4WN3A 4PSAA 7YASA 4HF7A 2JARA 4ZYWA 2Z9CA 2H4JA 2FQWA 4K9RA 3AOEA 4V2IA 3AYZB 4DVGA 3WKDA 1I2MA 3LUGA 2F8SA 1KSHA 1P9NA 1IPEA 1J1ZA 3JD0A 1ICEA 2IGBA 4G01B 3FMVA 4MQBA 1TCCA 2QMUA 4XAQA 3INRA 3N0WA 4GRDA 1JBKA 1P91A 3NPAA 4L4UA 5DTQA 2M6RA 2IHUA 2HDWA 3IERA 4A2QA 4ZC1A 2A8YA 1DC6A 2CXXA 3VV2A 3HU3A 4U39A 5JDIA 1HRDA 2EQBA 1L5MA 4XE5A 5H4GA 3VNAA 5IM4A 3ICCA 4NABA 3VKGA 1E4EA 1U4OA 1XMPA 2REOA 3U16A 4A36A 5CJ2A 3AM3A 1L5QA 5EXPA 3RVDA 3IKJA 1YR3A 1DKMA 1L0BA 2J5BA 1E9EA 4G36A 3AVUA 1F3LA 3CUSA 3JASA 3IV7A 1ZIXA 1ZNXA 2PQ0A 5TPWB 3H99A 3MELA 4HX9A 2DTDA 3HABA 4IV8A 1MO6A 4HBGA 4GLBA 3BSYA 1GQ2A 1DOHA 3M7IA 4UDXX 1BEUB 4BQNA 4GFDA 3DBOB 5DHUA 3QM1A 2QD5A 1ONBA 4WSOA 2VFAA 3WLKX 5KX5A 1G8MA 2XZOA 1GPDG 3A1WA 1A5AB 4P2BA 2F1OA 2HU7A 1E2NA 1UOOA 4MMXB 2PKYX 5CXQA 2AGVA 2ZJZA 1RZVA 4K9LA 1WV0A 2QORA 3FHJA 4WXEA 3UK7A 4O4HB 1W5EA 3CNBA 3DMTA 2VQFB 2WVHA 3MHTA 2W58A 1OLUA 3KQQA 4XFKA 4BCDA 4NBRA 4G1MB 2G76A 1PZNA 4B9EA 1Z45A 3X1XA 4TRJA 5L3VA 3UMYA 1NA5A 4EJFA 5L7WA 4N18A 3WJAA 2CFRA 4H7KA 1ONSA 4UDOA 3RJMA 3CUEF 4HFMA 2FPKA 2OGUA 3B3GA 3D8UA 4IGAA 4GIBA 2B98A 2ID4A 4LPKA 3REGA 2ZWAA 1XKLA 2IOHA 4PBTA 4AMBA 3HDGA 4AJPA 4HGNA 2ZTUA 1DE0A 1R9GA 3WS7A 1X80B 2D5IA 5BV1A 5CX4A 4CDRA 5KTNA 1P1KA 2YXDA 4XDHA 5TQ0B 5KKCA 4UASA 1DBRA 2J0UB 4YUYA 3LYHA 4XFDA 1P9WA 1FSGA 2K2WA 1BMDA 2DF8A 1Q15A 3G85A 1W5FA 1U2PA 3QUTA 1DO2A 1BW9B 2YCLA 4RMGA 1H8ED 2B99A 2ODTX 1UMBA 5BMOA 4QFBA 1YFZA 1KK0A 3KR2A 2YMMA 4ALLA 1KJ8A 1V7CA 5ENZA 1RXWA 1N3BA 3CLRC 4MB2A 4FFBA 4DUYB 3F97A 2K2QB 1YU6A 3GW8A 4J91A 3W90A 4BOYA 1EWYA 4DEXA 5U9CA 1JQ3A 2J9ZB 3F90A 3SBDA 4PHFA 4JBXA 2W2PA 1PEKE 3NDIA 2EKBA 1A69A 1X9GA 2X76A 3G2JA 4M9SA 4PQYA 4XB2A 2P75A 1VP3A 3G1TA 1N25A 2QY6A 3NIDB 4ZI5A 4IKEA 4OI1A 1RPAA 4DC0A 3OZRA 2J31A 3K32A 2WILA 1USUA 4FLEA 3I2FA 5LIPA 4TWJA 1Q14A 2ZPUA 3R9XA 1GRVA 3DVAA 5IC5A 1F1JA 4L4SA 5AK6A 1OB5A 1DXYA 5EZQA 4DJAA 2PRZA 1AKNA 5ECDA 2OPBA 2WUDA 4C7JA 2H4HA 4CLEA 3OG9A 4G0QA 4O1HA 5K3FA 1EXMA 4RPKA 1DUIA 1ZN7A 4TS1A 1DHRA 4PC7A 3M1LA 2H92A 1L1EA 3PVZA 4Z9XA 3FZEA 4B5LA 4YR7A 3O8RA 3AERB 3RU9A 1A1SA 1IATA 1KDOA 2HCRA 2RKWA 3O4HA 2I71A 1B8NA 3GLFE 2DBYA 1AKYA 2FEXA 3D81A 1GNPA 1RP1A 1RWBA 2ZR9A 1D1SA 1RJWA 2PRIA 1A95A 3U0BA 2QLMA 3UK0A 1DIGA 4PRZA 2YTZA 4FR2A 3BE4A 1SNYA 4OHOA 3GUVA 4Q3CA 3W8FA 4EUEA 2ZXUA 5K1ZA 3JVVA 3FPAA 1HK7A 1FW8A 4URFA 5F77A 3DQZA 3GO4A 2WD7B 3RBXA 1BGXT 1X7XB 3R0IA 1E9RA 1CLUA 3EEYA 3E4CA 4IFIA 2WY2D 1M6NA 2B7CA 5A5EA 1UC5B 1YBAA 3G2LA 2XNKA 1D8AA 4FHGA 2I3AA 2X6QA 3BERA 1YGYA 2BP7B 1XEAA 2V74B 2VRCD 1JQJC 4GX5A 5JISA 3WAGA 4DWOA 4UBJA 2YW9A 3ANSA 4CLOB 5IUJC 2H1HA 3NEJA 5KNBD 1PQYA 5JEEA 4LY6A 1KXJA 1QFZA 1RM5A 1XDGA 2QLLA 2FDXA 3CXRA 2A0UA 4JLOA 3RO7A 4HNAA 1PL6A 3SD7A 2ORED 1PN3A 5JH7F 1QDLB 1T1JA 3JYHA 3KZNA 4FDLA 1L9KA 3VM6A 3BYZA 1CUWA 4YI3A 3R5SA 3DNMA 3FGPA 3OU6A 3DVQX 3T35A 4KYVA 1TK9A 2XJ9A 3LTNC 3ZX5A 4LS3A 1HZJA 3F98A 1SOUA 3CX4A 2ZIXA 3PFWO 4PS0A 4RESA 3G7NA 1AJEA 4AJHA 4I50F 3WNCA 1U2GA 1Y1QA 1Y9ZA 5ESRA 3GLUA 1XVLA 4HSEA 3OZAA 4E0BA 1M1YA 1E2GA 1FSSA 1GGJA 4JGBA 1R37A 7AT1A 4D0NA 1J2YA 5JJ5A 3B38A 2QRPA 5FH9A 3DP7A 4QEZA 2XB4A 3PUYA 4EL0A 1QKKA 1VSUA 2CHUA 3M5WA 3O8LA 4Q1EA 1XZCA 3L46A 5EKXA 1ZW1A 3KDSE 1W0KA 4FOOA 1BRMA 2L17A 4KQGA 3IE2A 2R5FA 1AHHA 4BBZA 1YMVA 1RAGA 2IHBA 1U5BA 4RJJA 4ZK2A 1FYWA 2Y1XA 4JSYA 4KO2S 4BGVA 4D80A 5CB4F 4C07A 2H1LA 4MROA 1L7VC 1Q44A 4JJ7A 1MOQA 5KUTA 3BHMA 2X5KO 1MHTA 1COZA 4LF7B 4RF3A 3IQZA 2JHGA 3DBIA 4X71A 4L0CA 3PT5A 2P9CA 2WA1A 3S44A 2B69A 4P84A 1M73E 3EX7C 4ON9A 3ZE7A 3OZTA 1SD2A 4EY8A 1QFJA 2POCA 1VJDA 1NMXA 2PX0A 2CB0A 1H4TA 1Y3BE 2N46A 3I2IA 5DWQA 3FETA 3LHSA 5D00A 1R6AA 2JLQA 3KFXA 5JSZB 5DV9A 4CTOA 4B4DA 4YRQA 1Z0FA 1TMOA 5BQXA 1N0UA 2TMDA 3DMYA 1WWKA 4MWOA 1SHTX 1HKUA 3ABIA 1ZKMA 3R7NA 2FPGB 4NCHA 3N5KA 2WIKA 3MBOA 4M76B 2WIGA 3N3BC 2FSHA 4WNAA 5A06A 4C30A 2WFLB 4N82A 3TIIA 4HRYA 4UEKA 3CGWA 3ABOB 4Q4JA 4RHEA 3SJUA 3CWZA 1E0AA 3GELA 2YV2A 3N9IA 3FYHA 5F1OA 1X9HA 3SC3A 4G56A 3TW0A 3EW9A 1KE2A 3IYLW 1XTQA 4F3TA 2ZSEA 3M2PA 1BO6A 3ETHA 4KGZA 4R69A 4KACA 3RFCA 2WWIA 5BR4A 4B2LA 1XAIA 2Q6VA 3I42A 4PX2A 4EY3A 5LU8A 2ADOA 3DO5A 1G7SA 4ZO7A 1BOOA 2Z1DA 3UY4A 4GRIA 2Z3VA 2ISCA 4RVOA 4BKRA 2PD3A 3WXBA 1IPFA 4IJQA 1NX9A 4PPYA 1FNSA 3Q3HA 4MXDA 1TUGA 3MJHA 4PO9A 4M55A 3CZ4A 3F3YA 3H16A 2LP4Y 1CJUC 2VCYA 5DX8A 3QF4B 4LTMA 2GPBA 2OD2A 4DWVA 4Y7CA 4QX6A 2JBAB 1SH7A 1S0UA 3MWEA 2O8CA 3M9LA 3PXUA 4EGQA 1Y3DE 3EVZA 3FTDA 4XGNA 5D84A 4DUPA 2EG9A 1GZ3A 4L0DA 4FKZA 4PBSA 4R2MA 3EQ7A 4WLEA 2PFSA 3STTA 1YNSA 2HDOA 4EG1A 4EI2A 3O8QA 4YT4A 4PG7A 5JYDA 4J94A 1R6BX 4JY7A 2NN3C 4NCIA 1DQSA 4N0QA 3VC1A 3GROA 4A2CA 4TZ0A 3CBQA 4IH4A 4DV3B 1MNAA 1S4QA 2X14A 2PVSA 5KNDD 3DOUA 4XH9B 1O9BA 1G0OA 2BOVA 4M9XA 4DM7A 3LIPA 3OKAA 5IH7A 1KJJA 4QOIA 1L5WA 4Q05A 5EE0A 3KEGA 4FEGA 1T26A 1IZ9A 1E4OA 2BFMA 5TXGA 2QL9A 3K4QA 3ACDA 1ZGBA 1V1RB 2Q6OA 4EB6A 3ENNA 1B73A 3UAOA 3ECCA 5A3QA 1JR3D 2QR3A 3EXHC 4YDQA 2D13A 2F59A 2AOWA 4YAFA 2ZWOA 4BFUA 4DRYA 1UDAA 2QX8A 3C3KA 1EM8B 3DP9A 3EY4A 3P27A 4DNPA 5MGNA 1E1LA 3O95A 4WBSA 3KYCB 1MB4A 5TPZD 1Q1AA 4J0DA 1S1MA 5GM2A 3V80A 3B6ZA 1SKMA 2M6SA 1GQFA 1I9GA 1E6MA 1ZEJA 2DUUA 2NM0A 3AZOA 3FIUA 3PFBA 4J3NA 3T06B 2YWEA 1Z0JA 5HUJA 1SBIA 2XEXA 5K5EA 3DEFA 4J1SA 2FPLA 4FP9A 2BEUA 5ALGA 3V9PA 1PT7A 4DARA 4QTTB 1IOWA 4HLCA 2VP4A 4JOSA 4YI5A 2GTPA 2AQ8A 2FWJA 3TYXA 2V59A 3GLTA 2ZVQX 1C9NA 2E4AA 2W71A 2EP7A 4I4IA 1CD5A 1VBFA 2J41A 2WWHA 3WB9A 1P2DA 2G4VA 3L04A 3JQBA 4PF1A 4YFYA 1LNQA 3A9RA 3WWEA 3REQB 1T0UA 2DLNA 3T41A 1T6XA 3I64A 1FNCA 2FN9A 3WJ7A 2XUDA 2QMQA 2D1FA 4IDGA 1PP4A 4MUKA 2JA2A 2ZUCA 1J0EA 1LRJA 1UT5A 2OLEA 1Q19A 4IJ5A 4J29A 1Z13A 2ZB4A 3H6KA 2FMKA 2B82A 2DLDA 2AV6A 2QRMA 4C3ZA 1R5BA 2N75A 3PQ8A 5CJPA 2C5SA 3TR6A 4U2EA 3DEHA 3ZWPA 1DUVG 1NBMA 2PYIA 3UMRA 1M5TA 1QFMA 3KIPA 1Z08A 2YWCA 1J8DA 4KXMA 4NMXB 4RIHA 3I2GA 3N58A 1CWUA 3A27A 3BD7A 1CP2A 1FNBA 3HLTA 3GT7A 3QA9A 3QMPA 4H35A 3SS8A 4INZA 2G1AA 3W79A 3WKEA 1PJBA 3A6ZA 2QGFA 1P0QA 1F4PA 3HXMA 3FVQA 1G19A 5T8KA 3KPVA 4GXTA 3ND6A 4ALIA 2CLLB 4ZOAA 3BF7A 3WB1A 5FUMA 1QKJA 1HLPA 4MDHA 1SXJD 3MTQA 4KIWA 1ZHOA 1Q0PA 3AVWA 1USKA 3HB4X 1L3CA 3FW1A 5KAPA 1DDOA 2JFYA 3K96A 3VR2D 2IHTA 2HBYA 5H59A 3VZRA 3DCYA 1C2YA 3WWDA 5KVSA 3I30X 3GA5A 2BFPA 4KU4A 3S5UA 3S28A 5C81A 5I5GA 1TXGA 2ZRGA 1C3LA 2FJPA 5HG0A 4Q48A 3BDVA 1E2EA 3STXA 3JQ7A 4BLPA 1SUEA 1EK2A 1QBKC 5J4KA 3U7EB 5K05A 4BQOA 1S8AA 4PSVA 3LXUX 4KKVA 4OMDA 3A7EA 3OQHA 3VHXA 2JFUA 1PKXA 1C7IA 5JE8A 4EENA 2JFNA 2YHIB 1EP3B 4J4HA 1T4CA 4M6WA 1L5GB 1FJGB 1GAQA 2W2TA 2ZM6B 2VJLA 3UAZA 3LM8A 2ZT8A 1EK5A 1T10A 4BB9A 1JPJA 3NM5A 4GVLA 4YA6A 3SP1A 4ZYVA 2ACKA 3HFJA 1SU7A 2B5WA 4BE4A 4O4LF 3HLKA 4COKA 3GWZA 1LV7A 3D8HA 2BMFA 2NVUB 3O47A 4FONA 4EIWA 2OQIA 3RFTA 3GLIE 1XQVA 5KI6A 4TLLB 2PGOA 2PFGA 3QELA 2Q5OA 4O2LA 3RSZA 2VR1A 4DYVA 3ZWXA 4HN4B 4YRFA 5TMDA 3T7SA 3RTCA 2P35A 2VA9A 1SU8A 2DHRA 3AF0A 3EF3A 3HA5A 3LRPA 3QFHA 1JXMA 2C9BA 4WFKA 5EP4A 3RRFA 3BDAA 2UZAA 4PQGA 5LQDA 5KREA 4B74A 3LP8A 2J4FA 1N9GB 4G0MA 5BURA 1E1CB 3NBQA 3Q2KA 5CMLA 3G9UA 1P61B 4IQGA 2G77B 3HRHA 4OSOA 4ZU6X 4MB6A 5K2MA 1L7NA 1PJ4A 3L8YA 1BWQA 1XP5A 2A14A 4QSHA 4CETA 4OHYA 1E1MA 3VX3A 1EFPB 2P9GA 2VA8A 2IW1A 3BJEA 3VH1A 3ZU6A 2F4VB 5K0GA 1TM3E 1Z4QA 4RD3A 3K70C 4B5KA 1QO7A 3EC2A 1RQPA 2FCRA 4BLRA 4RWEA 4BWFB 4AJNA 4DF3A 4F06A 1P9OA 2ZZKA 3ENZA 2FWAA 1U7TA 1YDMA 5J63A 1U90A 2PT5A 5IJWA 1COWD 4EJMA 2FZ5A 1N2OA 4TZKA 5DTEA 4K9PA 5HJ7A 2OCAA 4KTVE 5JG7A 3W1WA 4AZTA 2GLTA 1J9GA 1H2AS 2HBZA 3ZKWB 4DR5B 4FFSA 4HDRA 3WGGA 4FWTA 2HRQA 4FFLA 1NYLA 1TF5A 1YA4A 2WMOB 1EZ1A 1G8KA 1WUYA 2G9ZA 1A98A 2QU7A 4GI7A 4V3CA 1MJFA 1CUFA 1R27A 3HVHA 1OFIA 4QGBA 3RYTC 5K2OA 1W1IA 2C3YA 4GP7A 4M89A 2WJVA 3CRNA 2NXEA 3K72B 4QOEA 5K8JB 2NPOA 1NXOA 2CMHA 1I5EA 1WU8A 1JTFA 1XZPA 4YRMA 4A4DA 4NPCA 2E5FA 3G6WA 3A2MA 4WCFA 5G3YA 2IIBA 1GU0A 4NOJA 2G0AA 3BIOA 4ZALA 3PJGA 1FMCA 2ST1A 1Z75A 3JYOA 1SHUX 5P21A 2WAMA 5I9LA 3ZBPA 3GRKA 3K20A 1W88B 3T94A 3ZLBA 1UK6A 2A35A 4LN1A 1C3VA 1OMOA 3HZZA 4AYXA 1JQEA 1JEYB 1EFAA 3BRQA 3RS4A 3L4JA 2JLZA 2ZRAA 2OBXA 2BVNA 4UNRA 1V4NA 4EUNA 4ZAXA 3BCHA 3OI7A 4NS1A 1KXZA 2QW8A 4C0BA 3DT8A 1DKPA 1YS9A 4K6GA 4M86A 4XYBA 2C2YA 3BXHA 2OWEA 4YLYA 2EFHB 3M6IA 2VF7A 3NDBB 4NSNA 1QH9A 4L27A 2H1CA 2XMDA 5T6MA 2D3TA 1NKVA 3TVDA 3Q12A 3X44A 1WUJS 5HS6A 5ALTA 1BXRA 3AG6A 3AEQA 4RLQA 5CBPB 4OBBA 4CMEC 1KMHB 2PNFA 2QRQA 2ZQ5A 4H3VA 4D3ZA 5LNK1 3IAS6 2BZSA 4G0VA 1C0IA 1R50A 5FT9A 3EGEA 1AQLA 1OV4A 1PAUA 3WKCA 4D3YA 3ZDCA 1C5KA 4X94A 1IG3A 1DKOA 2DCUA 3WWYA 4MQFA 1M2GA 3FLEA 3U6KA 3AY3A 1G16A 3MFYA 4GMHA 4G2NA 4OM8A 5ITZA 4RFSB 2WBLC 1FUYB 1GKYA 2N9UA 3IX7A 2G5TA 4ID9A 5FBLB 5CCDA 4E6PA 4MIKA 2JIDA 2GUWA 3K7EA 1M8KA 4QUKA 3QFTA 2J08A 4Y6QA 2WTBA 4CMKA 1U8YA 4NXMB 1NR1A 4Q9JA 1VGQA 1X1CA 3LFHA 1ZCFA 1GKKA 1XHEA 3V00A 1XPRA 5LOVF 4MV0A 2COKA 2QRLA 1GVHA 1F2VA 1QOQB 3D8BA 4I81A 4WUTA 5JSFA 1AK9A 1K98A 1FS6A 1VL0A 2X1VA 5GONA 3U80A 3PEEA 4EW1A 3SC2B 1I36A 2GSDA 4DMRA 2ATEA 2FHSA 2H5EA 6YASA 2DEUA 2GI4A 2P5TB 3K0CA 1Q0LA 2R4UA 3Q3CA 1R8QA 3EHEA 1VMAA 3T5CA 3V2HA 3IXMA 4I8DA 1XZKA 4JBWA 3GARA 4KRXA 4WN9B 3GLFB 2XSZA 1CNEA 4DW8A 4MUHA 4CIXA 3D6AA 3PTZA 4JB0A 4MVJH 3EVDA 3OLVA 2X42A 4M7PA 1M8PA 1PQ4A 2OAGA 4PLPA 5JRZA 5ALHA 5FTKA 4AJ2A 2PUEA 5FDFA 2IIVA 5HRAA 3V8MA 2YWHA 4OI0A 4PRKA 2I6XA 2FFAA 3AU9A 2QV7A 3C1TA 4GZMA 4II7A 3UMSA 3ZJYA 3U48A 1FS4A 3F4LA 1J23A 1QOPB 3CBGA 4RVGA 5DOVA 4KVZA 2Y0DA 1XRRA 1YDEA 3EIUA 4BVKA 5CA1B