3NBYC

Crystal structure of the pki nes-crm1-rangtp nuclear export complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
171
structure length
171
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGLEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gtp-binding protein/transport protein
molecule keywords Snurportin-1
publication title NES consensus redefined by structures of PKI-type and Rev-type nuclear export signals bound to CRM1.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 171
sequence length 171
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3nbyC00
3FMIA 5KUTA 1IN4A 2VP0A 4HAWA 2F3TA 3TIFA 2J0UA 3IIMA 4Q7JB 4QNRA 1MO3A 1TF2A 4V0MA 5KTYA 5DE3A 3KXLA 4AG6A 4A92A 5B2ZA 2HEIA 3L0OA 2H18A 4Z8YA 1TMKA 1G17A 2IF0A 3OEHD 1CRPA 2F1HA 2RGEA 4BWYA 2ZE7A 4M1OA 3HR8A 5JJIA 4AIIA 2A78A 1TTTA 2VTKA 2I3BA 1EFTA 4FI3C 4MRPA 5KPJA 1VPLA 2GETA 2VO1A 3AF3A 1QHIA 3BFKA 1Q44A 3L0SA 4JBWA 5CLQA 1ZJ6A 3BWDD 4LV5B 4A6PA 1T3LA 2EQBA 4ZV4A 1JR6A 2GBLA 1P9RA 2FFAA 2JDIA 2O8FA 1KKLA 4OBEA 3GFTA 4Q02A 2IYVA 2EFEB 4IRUB 5CDFE 2G0TA 1OYWA 4MKHA 1F2UA 3EIEA 3GLIB 5FUYA 1IXRC 3LXRA 3QEJA 1KYIA 1SVWA 2GEVA 3I32A 5C4GB 1KI2A 3CWQA 4C0JA 4CZ2A 1XNJA 3FHCB 2X19A 2C98A 4MGIR 2CLCX 3OFND 4GFDA 4DUGA 2GJAA 3W3ZB 1W1WA 2BOVA 5F2EA 1N6RA 1NVUQ 4QHSA 4URUR 4JLJA 2GXAA 1AS3A 3DL0A 1Q12A 3MMPA 1XZPA 1HT1E 5FL3A 1D5CA 2OILA 4HLDA 3T12A 1RE0A 1VG0B 2VBCA 3T35A 5JEEA 4TSFA 1H8ED 4LUCA 1ZUNB 2CE7A 4QBGB 2PJRA 1NN0A 3M0EA 1GL6A 1MABA 3NIBA 3U6BA 2QAGB 4CEIA 1SXJD 2ZRKA 4RKFA 2ZJOA 2ZTSA 3CIOA 1UEJA 2D62A 1SULA 4AKEA 5FL7D 1OFHA 2OM2A 2RHMA 3NBXX 5L3QB 3F8TA 4M1TA 4NYJQ 3JZAA 1YKSA 3MUFA 2OCAA 4KSBA 3GMTA 1DVRA 1W46A 3T5DA 3VX3A 3I1FA 3IKJA 3AH8A 3DDCA 3HU3A 3K9GA 4O2RA 3RNLA 1GSIA 4LBYA 1DO2A 1YR6A 2VP6A 4B34A 2GXUA 1UFQA 2WMOB 1EXMA 4BRUA 4L8GA 5FBWB 1CJVC 3GCGA 1CEEA 4E5UA 1HURA 3NBZC 2NO0A 3WMEA 3EWSA 5L3SA 2BMEA 2QP3A 3U5ZB 3BK7A 5IRCD 2Z4RA 5AUNB 4QC2A 4NYIR 4AI6A 3KJIA 4DIEA 5FPHA 1AJEA 3PUXA 3WP0A 4C2TA 1QHNA 4QG7A 3MWYW 3BBPA 3DKVA 3N70A 4NPHA 3VKGA 2FMXA 1YVDA 1LV7A 1E9AA 4NU0A 1KY2A 2G0NA 1I2DA 4I1UA 1FNNA 3AP3A 3DZDA 2JA1A 2YC4C 4EDHA 4KO8A 1OH6A 1RRCA 1E2HA 3FKQA 4AYXA 1IHUA 1T3SA 3AVVA 1UF9A 3TBKA 1W49A 2ZU0C 1N0WA 2W6ID 1OFTA 2PT5A 3GJXC 3K9LA 3W8NA 5JS8A 3FHOA 4W7SA 1XD2A 4JZKA 3THYB 3SFVA 3K70B 4KITB 1YZLA 3Q8XB 4QGAA 4B3BA 4YC7A 3RVBA 4AURA 2KWIA 1XXHB 1XPRA 3GLIA 4C9BA 1NJFA 3KB1A 2FEOA 1R7RA 1OHHD 1WA5A 4LBVA 4V0KA 5F3WB 1SKYB 4TL9A 2FFHA 4TZ6A 4AKHA 1R0WA 3TMKA 2AFIE 1QG4A 2XITA 4PZLA 5KSOA 2IYSA 2NGRA 1QHHB 5J5CA 3RS2A 3T1QA 4NCIA 3RC8A 1CLUA 1FP7A 4KBFA 5FR2A 1X1SA 5TVKA 1G21E 3A36A 4BFTA 5FOWA 1KJYA 2EWWA 2N1BA 3AF4A 1FPMA 1OKKD 2BM0A 2EU8A 2JJ2A 1UPTA 3C4JA 1ZD8A 4B43A 1W4CA 4KFUA 4B6EA 2F55A 3LVQE 3NHBA 4TYWA 2ZJZA 1XBTA 3ZD7A 2WWFA 2QAGA 2IXFA 4BZXA 1N0UA 2HLDA 4V0ME 4DDVA 2IYWA 1XJCA 3VHLB 2BCGY 2FDCA 3J81k 2W0SA 1NKTA 3VU9B 4QBFA 4L5BA 1U2RA 1NMYA 1XTRA 4M9ZA 4NYMR 4X8OA 4A1FA 4D25A 5FBRB 3BFXA 3EG5A 4MYTA 4ARZA 2V1UA 4BFVA 3QENA 2EFCB 1CP2A 2RGNA 1XEWX 3QKUA 4LPKA 1GFIA 5TDHA 2O8EA 1H8HD 3TKLA 3QUSA 3KKPA 3QXHA 4C30A 1E2DA 1I2MA 2ZJ8A 3QE0A 4LV6A 5IDVA 3T34A 3TK1A 2GK6A 2QMEA 4MUBA 2CLDX 1WE2A 4W5JA 5CIWA 1YZGA 3CNLA 1YZQA 2JCSA 4LX0A 2ASEA 2AWNA 1ETUA 2QRNA 2QT0A 1G8YA 1Q1QA 2VHTA 4RJLA 4ZCLA 3MWJA 4PPQA 4B35A 1A7JA 1F6BA 3M6AA 3SQXA 4OI4A 3WY9A 5SZJA 2AKAB 2DFKB 4PO8A 1Z0IA 2VEDA 4OI2A 3FB4A 1Z0DA 1T91A 5AJXA 1G4UR 3FTQA 2R6AA 2XOKA 4IOJA 4YONB 1P9WA 4CEJB 2XAUA 2A5DA 4MRVA 1U8YA 1OFIA 4FCTA 1YE8A 5KYKA 1OH8A 3RABA 1MO5A 3C8UA 3RS3A 2BC9A 3T15A 4EUNA 3UATA 1FFHA 4RFVA 2QQEA 3IQWA 4JSYA 1NVXQ 1X8LA 2ERYA 3SE0A 4A2PA 2D06A 1GL7A 3ZZTA 1GWNA 4QGHA 4TTRA 3A8TA 1SVKA 4WVFA 4NDZA 4C0BA 2A7QA 2ZRAA 4PC1A 1OE0A 4GOKA 2QSZA 1XXHA 3LLUA 2R6GA 1N3BA 1MV5A 3CZPA 2W2VA 1XPOA 3PR1A 4PFSA 2Q6TA 1GZSA 3I8SA 1YHNA 4DZZA 4GI7A 4U5XA 3A4NA 2PJZA 4L15A 1QHHA 1N6NA 2BEJA 1IXZA 2W6JA 1E1RD 1NVVQ 4PQFA 5JBQA 3R7WA 5LBIA 3QBVA 2WOOA 1F60A 4XTCS 1HE1C 2RGAA 3SN6A 1X3SA 4DXAA 2R2AA 2FOLA 1FUKA 3TGPA 2HYIC 1PLLA 4XD7A 1E2LA 1NIPA 3RRYA 2J46A 1KZ7B 2C5LA 1NN1A 1EFHA 4ERNA 4PPFA 4C7OB 1PUJA 4BPBA 4AD8A 4PHHA 1XMIA 3AVQA 1ZYUA 2PMDA 3MFYA 3VU9A 4KAXA 3UKDA 1L7VC 4LCBA 2XZOA 1UBCA 4XSHA 2WWGA 1Z6YA 2WSSA 4A36A 3NXSA 4HAXA 2V4ZA 2JIZD 4JL8A 2ZE6A 5FBLB 2D2FA 5DO9A 1ZMXA 2WJYA 4RD6A 1ZP6A 4JLMA 1SVIA 1UKYA 2B7CA 1TAGA 3RSLA 3ZLJA 4M21A 5G3ZA 1KMHB 1UKZA 2OSBA 4BLSA 2IS1A 1Z0AA 2LCFA 1NJGA 1VKJA 1W2GA 4IOLA 4TYPA 5FTLA 4QGGA 3VKHA 1XJQA 1QDEA 3IPYA 3NVAA 5TV2A 4DWJA 2JLZA 1NBME 2P65A 1R4AA 4TTQA 1GG2A 2X2FA 1ZIPA 2FG5A 3A4MA 4A0GA 2AD5A 5J4YA 4DLYA 4E03A 1QZXA 1IJFA 3T06B 2QPAA 1XMVA 4GDFA 3GJ7A 3MWLA 1PV4A 2KI5A 2WJHA 1PLKA 4HB0A 2WWHA 4LYAA 2IXGA 3VMFA 2ZS8A 4QHYA 4DVGA 1U0LA 1CR4A 4CVNA 3OEED 4HLUC 4JVSB 5EXPA 2REOA 4ZO4A 4UJ5A 2OFWA 3EC1A 1DTSA 2XSZD 3GEEA 4FD2A 4B71A 5E7JA 2NO1A 1N6IA 4BRWA 4IDHA 4DB2A 3CRVA 4AC9A 4YMTA 2GRJA 4WZ6A 3EA5A 2RGXA 4JL6A 1OXTA 1ZNZA 4ABYA 2BMJA 3ICEA 2PZGA 3U4QB 3QVUA 4IEIA 2DFNA 1Z83A 3K53A 4TMXA 1KSJA 1AN0A 1GP2A 2HDNB 4TLEA 2QG6A 2CEAA 2XEXA 3VR2A 1T0JB 2WAXA 3SC3A 521PA 4G5RA 4JMPA 4B2IA 1ELOA 2OHFA 1RVDA 2RGDA 2D7DA 2QTHA 3C41J 3CPHA 1KJZA 1YZNA 2RB4A 3TE6A 4Z51A 1N25A 1VG1A 3U7FB 2WWIA 4UJ3A 2C03A 2QE7A 4D0NA 1N5JA 3FFBA 4IVRA 1GUAA 2QU8A 4OQXA 2F43B 1U94A 1TU3A 4IDPA 2QP4A 4POAA 2A5GA 1AA9A 1HE8B 4LJ6A 4FINA 3R9IA 2QRZA 2H92A 2ZAOA 3DPUA 2BBOA 1DOAA 1II8A 1JB1A 3P27A 4C7OA 2CXXA 3IUYA 3ETLA 5FUWA 2WKPA 4Q4HB 2H8KA 1OYYA 1M7HA 1KSHA 3SYLA 3U3OA 5HE9A 1MO6A 3LRPA 1XMJA 3KFVA 4JLVA 4IOMA 1KI3A 2QL6A 4FN5A 4TQUS 5BYJA 1JPJA 3QG5A 1UEIA 2ANCA 3SDZA 3CO5A 4A2WA 1G41A 1EESA 1KMHA 4BFYA 1T0HB 1IJEA 1Q57A 1YRBA 2NMVA 1Z29A 1NLFA 2Z43A 2QT1A 4B6FA 1BOFA 2B92A 1ANKA 2FEMA 1C9KA 5GJWC 4KYIB 1UJ2A 4TLAA 3CONA 4B76A 2QNRA 4ACAA 4M0LA 1DELA 1GVNB 3TR5A 1II9A 4OJKA 4DBLC 2ZUCA 1K6MA 4ZKDA 1XCPA 2VF7A 2ZSBA 1FNMA 4DIDA 2XNSA 1G8FA 4R2IA 4HAZA 4PR0A 3OIYA 4BGDA 2C9OA 4NCJA 1E32A 2ZI7A 3TAHA 3NDBB 1G1MA 3IILA 4YXWA 2CVHA 4DCSA 2F1JA 2J7KA 2ORVA 3RAPR 4PC6A 1NSFA 1TF5A 1YZTA 2IUSA 3U7EB 1VG8A 2C8VA 2FGKA 1MO4A 2GJSA 3TR0A 2ZQ5A 1MOZA 3HJNA 1SVMA 3A58B 3ZQ6A 1SGWA 3AKEA 1AK2A 1NIJA 1E1QA 1T4GA 3I62A 2FNAA 4B74A 4ZIRA 3NH6A 4LHZA 4DLZA 3U4QA 2CMKA 3D3QA 3D7MA 5DISB 3Q5EA 1KOFA 3LV8A 3R20A 1EWQA 4OL0A 1TQ6A 1CIPA 2W2TA 4M9XA 1A82A 2ODWA 1QHGA 2J87A 2GZAA 4H9GA 3HR7A 1KI8A 1W36D 1E79D 1KAGA 5C2JB 1G20E 1G64A 1RRFA 121PA 3BJIC 3SYKA 3A4LA 3EIQA 1ZM2A 3VR1A 1OH7A 5J4HA 1KNXA 1M7BA 1S96A 4S35A 4P33A 2C04A 5FTJA 3TSWA 1HQYE 2ZVQX 2L0XA 2E9SA 4GT1A 3F0TA 3KL4A 4DSOA 3VKWA 2V6IA 3FKSD 2F43A 5DGXA 3GJ4A 3U2QA 3X1XA 3X1ZA 3UIEA 4Q7LA 1G9XA 4Q4JB 4Q9IA 3T1OA 2VP4A 4NCHA 4G5OA 3WHKA 2ZYVX 1O87A 4K81B 1Z2CA 5JS7A 1ZCBA 2OBMA 3KJHA 1IOZA 4DLTA 2CK3D 3L0PA 2VP2A 3H2YA 5IK2D 4JL5A 4YMWA 2K5UA 3PQCA 3QXSA 2P6NA 2Q9AA 3I5YA 3DOFA 3A1VA 5TXGA 3BFVA 3R9WA 2AD1A 3OHMA 2PZFA 2GESA 5AUQA 5K8UA 5SZIA 5C18A 1TUIA 3GJ6A 1W0KA 3B78A 1J8MF 2A5FA 4OQMA 3B9QA 3RS4A 1KMQA 4M9SA 1SVOA 1FTNA 3K0CC 2AFHE 2Z6VA 2BIFA 3FMFA 1M6NA 3KQLA 3BRWD 2YWEA 2RCNA 4QM7A 2RH5A 1E96A 3C7KA 5E7MA 2A5YB 1U8ZA 4DLRA 3PEVA 1LNZA 4BZQA 2IWRA 3WNDA 1G4AE 2FH5B 4KFTA 2DCUA 3QY0A 2CL6X 4CT4B 3ZH9B 2QUZA 4Q01A 3AKCA 5EE3A 4U02A 1IN5A 3C5CA 2LKDA 5HKKA 1BO6A 4CF7A 2DYKA 1XD9A 2IF2A 2ZUDA 5LB4A 2OXCA 4DLWA 3UANA 3ASYA 1CS4C 1G291 1UBGA 4HUQB 2ZJYA 3KQUA 3O47A 1NY6A 1R8QA 4Q4LA 1Z06A 2XXAB 1XX6A 4Q1AA 1ONBA 2VH5R 4OI0A 1MT0A 1S1CA 2WBLC 1GITA 1DAIA 1KHTA 3BH0A 4CGZA 1KK3A 2OLKA 3MSXA 2CJWB 4EPYA 8OHMA 3TQFA 2AX4A 5KPDA 1GKUB 1SXJB 1OB2A 3GQBA 3E1SA 3KX2A 3AVUA 4NCKA 4A0RA 2EFGA 2J0SA 2IHBA 4LJ8A 4PHTA 2WWXA 4A0HA 2O52A 3LBIA 3P26A 4LK2A 1AGRA 5HTKA 2BVNA 3FFAA 2P0EA 5CJ2A 3BH6A 1D6JA 2RGBA 5B57C 4DHEA 4TWZA 2ZI4A 1U98A 3WRXC 1XEWY 2O8CB 1KI6A 4Q1FA 4RD0A 2BM1A 2VLIA 1E2FA 2I4IA 3ZZ0A 4PQYA 1HTWA 3LY5A 3TJZA 1LF0A 3BOSA 3QVVA 4DLUA 1YU9A 1I4TD 4LHVA 3SJZA 4U7DA 5KSPA 3QXXA 4PQRA 1JEDA 2J7PA 1K8RA 3EARA 2JDID 2DFLA 2RAPA 4G5GA 3RS7A 2VSFA 4Q1DA 1QRAA 4WZAE 2Q9CA 1TEXA 4Q4JA 1X6VA 3B1XA 1E4YA 1NSTA 4G01B 2ZR9A 1CRQA 1S1MA 5BWMA 5JI2E 3THWB 4TN1A 4LJ5A 3HPRA 1KNQA 3SFZA 4HUTA 4DCUA 4BLPA 4A6XA 2H5EA 5IHPA 4HLUA 2IBMA 3KDSE 3OE7A 1ZC3A 1VIAA 3W9YA 5FTNA 4MYUA 1EX6A 1WXQA 4ZI3A 1CKEA 3EASA 3TSOA 2P6UA 1RYFA 5JWOA 2IX3A 2BEKA 2ODNA 4O2LA 4TQAA 5KNDA 3OEHA 4TSFD 721PA 4H1UA 4MITA 1JECA 2IYXA 3QPVA 3CH4B 3LVRE 4FMDB 4B2LA 2OXRA 1MRSA 1P9NA 2FZLA 3LA6A 3E5HA 4Z1MA 3BB4A 3L8ZA 4TMZA 3ZIAD 2ORWA 1FQJA 2F1RA 4KI0A 3PUVA 5F98A 3CZQA 2YJTD 3BXZA 4D2IA 1NVWQ 2FA9A 5K8TA 1P60A 1WF3A 5EXTA 3GLFB 5ANRB 3B7GA 2VL7A 3B1YA 1E4VA 2GCOB 1ZM9A 3E2IA 3KQHA 1OIWA 3SR0A 1KAOA 3QXCA 4RSGA 4ZDWA 3H84A 3WHLA 2NOAA 1KO1A 1Z07A 4TYYA 1TF7A 5B58C 2XZLA 1VCNA 2OV2A 1O3YA 3Q5DA 4ZDKA 1GNPA 3QF7A 3IO5A 4QRHA 3GLGB 1ZCAA 1EFCA 1XU4A 1NLZA 2Z5FA 3FYHA 3GFOA 3WP1B 1AGPA 3ONWA 3U44A 1W44A 4AKGA 3L2OB 3OFNA 3U3MA 2ECKA 3FVQA 3WYGA 4E22A 1E2PA 2D7CA 2ZETA 4XVUA 4A8JB 3BIFA 3EW9A 2NO6A 3L0IB 2XNDD 4HUQA 4EQ6A 3I72A 3CLVA 5AWFC 1QBKC 2XX3A 4A4DA 3THXB 2RGGA 2XXAA 4V0OA 1XFAA 3DM5A 1H8EA 2B8TA 1FUUA 4XVQA 5GJBA 1TL7C 2JLRA 1JALA 1Y63A 4PHGA 2ZRIA 4M1MA 2CDNA 1KO5A 3AKYA 5CM8B 4MRSA 3FDIA 1E0SA 1GM5A 1QF9A 1E2IA 2CVFA 4C0LA 1VYUA 4B3CA 3KJGA 1CJMA 1K5DA 4WAUA 3MWKA 3SQWA 1JJVA 1GILA 2A30A 3AGQA 4NONA 4OK3A 2WICA 2O5VA 1X8KA 1TQDA 5GADl 3OAAA 2O8CA 4P4TA 1K5GA 2F9LA 4Q1CA 4HZIA 4NZYA 3T61A 1BH2A 2ZROA 3LO5A 4RD1A 2ZI5A 1TPZA 4DLSA 2GEDA 4XJXA 4JBYA 2PH1A 2FSGA 1NBMD 1F5NA 2FSFA 1G8HA 1T5IA 3AF1A 1KGDA 3CR8A 4IOKA 5FTMA 5KO2A 2ZIAA 3CKLA 1S9DA 3PCRB 2PX3A 4LC1A 1E6CA 3THWA 1QHYA 1FMJA 4ZDJA 3BB1A 4TTPA 3ZD6A 2AK3A 2YNMA 2FE4A 1VDZA 5LD2C 2G3YA 1E9FA 3IQXA 2WSMA 4LZZA 5AJYA 2O0HA 2D4HA 3QQ5A 1D9XA 1C4OA 3GJ8A 2DY1A 1T8UA 1KJWA 5J40A 1ZM3A 4EKDA 1XZQA 4AWXA 3CRRA 4AYWA 3JZMA 3CF6R 2HLDD 2YWFA 4DRZA 5JHHB 1P2TA 2LWIA 1FTSA 4P0TA 4FMDF 3WBJA 2YZ2A 1NG1A 1Z08A 3AVOA 5GJCA 3GLFA 4UNNA 3EAQA 5UKDA 1XTIA 4C0QC 4EFLA 2GCOA 1VMAA 1W0JD 3KKQA 4D4LA 1TUEA 2JLYA 2GTPA 4KFRA 3W6OA 1Z6XA 2N46A 2JGNA 4EPWA 5L3QA 2Q9BA 4LOAA 4PX9A 2ZREA 3TW8B 4BFXA 4DEXA 5JFGA 1PVOA 4DT1B 4EPXA 3IEVA 2PCJA 2YOHA 1G8PA 2VPPA 3D6TB 1A1VA 1N5IA 3NH9A 3EC2A 1LTQA 2G77B 4M1YA 1U8AA 2QMHA 1UDWA 1GRQA 4YDSA 1EGAA 3OIUA 5F9FA 2CHVA 4RZXA 2PT7A 1CR1A 3THXA 1UBFA 1DAEA 1EK0A 1Z6AA 2QY9A 4BZPA 1KDRA 5G53C 4UNRA 5TB5A 3RRNA 2OAP1 3W3AA 1Q21A 1BYUA 3CH5A 3BD9A 3FMPB 4FCWA 3MLEA 3ZS8A 1YZUA 4Q21A 3C15C 1DAGA 1MH1A 2OCPA 2YVUA 4CIDA 4IDQA 2X77A 2ZI9A 3NG1A 3PUWA 4URXR 3UWOA 1OXXK 4FCVA 4HEJA 4I1OA 2XOKD 1SQ5A 3IGFA 3MRSA 3B6EA 2FFBA 4DDUA 5CITA 3TUZC 3HU1A 4ZCMA 3CRMA 1GAJA 2BBTA 5G41A 2EVWX 4DCVA 1DEKA 1P61B 2R65A 3K0CA 3EPHA 1P72A 3FOZA 1H8HA 1M34E 1W36C 2LKCA 5HR5A 5JCPA 5EP1A 3PEWA 4F7WA 2FSIA 4LWZA 2C78A 3NEYA 3LNCA 2ANBA 1KK1A 2ZRHA 3QEOA 4LV8B 3I5XA 3QXJA 2RMKA 3K70D 4O3MA 2UVQA 3AM1A 1VECA 1PZNA 2IYTA 2VP5A 1U90A 3PIRA 1I4DD 2IEYA 2QTVB 5DHFA 4BUJA 1E99A 4RZUA 1R8SA 3THYA 4M53A 1R5NA 2HXYA 3SOPA 4KLNA 4LJ4A 4JLDA 3VR3A 1P73A 3C5HA 2W6JD 5TARA 1H65A 4Z54A 2HXSA 1OXVA 3S1AB 1KO7A 5JSZB 2OBNA 1JXMA 2IYLD 4DJTA 3RLFA 3EZ6A 3QSYA 2ZSAA 2V55B 1LVGA 1YJ5A 2FPKA 4QOSA 2V1XA 3ZQJA 1YQTA 2IS6A 2SHKA 5JI3E 4XVRA 4PSVA 3DMNA 4LYHA 1IY0A 1CU1A 3H4MA 4Q9KA 2V7QD 3WNBA 4CW7A 3K9NA 1J70A 3QG1A 2H57A 4US0R 2PCLA 4L9WA 3AEZA 1KI7A 3GD7A 3W90A 3UMSA 2CLSA 5FOTA 1ZNWA 3SJAA 1KO4A 2WSSD 4OHWA 3MJHA 2NTYC 3EIHA 5GVSA 1KK2A 2MMCA 3UWKA 4MRRA 3LAWA 1XEFA 5KNCA 5KSYA 2YV5A 4PAMA 3K1JA 4IDOA 4N0DA 4YMVA 5BN5A 2G83A 4ZKEA 2P3SA 4X8MA 4KJZA 5JZVA 2O8BB 1S4QA 3OF5A 4BFZA 1E1RA 2PEYA 1S0UA 4GMDA 3ZVRA 5H70A 3ADBA 3MAAC 3UPUA 5DHAA 2ODBA 4A15A 1G7TA 4JJZA 5C4MA 3DOEA 2AKYA 2ZEJA 3NBFA 5KDLA 3PV0A 4LGMA 4XOIA 2HUPA 5AK0A 3ASZA 3GLIE 4RFSB 5LD2B 3A1UA 2ZANA 2HJGA 5FOXA 3GJ3A 1LW7A 1WDTA 5E4FA 4I1SA 1A5TA 2G6BA 2DHRA 2GCPA 3OZXA 5JEDA 2VYFA 4D0GA 3B8HA 3U7GA 2PMKA 4JLPA 1IN8A 5DIFA 4GRAA 4Q48A 4NYIQ 1QVRA 3I8XA 5BQ5A 1ESNA 5CYPA 3SJCA 4JIMA 2JLQA 4LYJA 1LS6A 1P75A 1CF4A 2GK7A 5E95A 2H16A 4MRNA 1UDXA 6Q21A 1W5SA 3G0HA 2GJ9A 3UG6A 1OH5A 1COWD 2R8RA 1X8JA 3GLHB 4WXPA 4B75A 4C3ZA 2YKGA 1G7SA 4CEJA 1B23P 4EPVA 1P2VA 4JSTA 4TL7A 3Q7QA 5L3VA 4LPSA 4OK5A 3G5UA 1U0HC 3PUZA 5EZ5A 4QJ4A 2GHIA 2ERXA 3JVUA 2RKOA 4R98A 2IUUA 2REXB 1WCV1 4PPGA 4TT3A 2REBA 3B5JA 3T1TA 4IKEA 1E2NA 1N6PA 1NI3A 1V5WA 3B9PA 3D31A 2GKSA 2OO7A 4M9QA 5H68A 4RZ3A 3SNHA 2IA5A 3CW2A 2C95A 2YWGA 3ZGXA 1E9CA 1BMFD 5DYGA 2AL7A 5JSZA 4R2HA 2CNWD 3L82B 2QE7D 2ZSEA 5AUOB 3I73A 5EE5B 1DO0A 1FX0B 3DZ8A 3BB3A 2W83A 2OFOA 3ND9A 4US2R 1QHXA 2WV9A 4V02A 1AZTA 5LPNA 1QG2A 1FMLA 4IHQA 2XSZA 1F2TB 3BS4A 1N6KA 2HCBA 1UBEA 4KFSA 4MUAA 4YQFA 4TL6A 4URWR 2F3RA 4C0KA 4JLNA 1DBSA 3SEAA 4L16A 1NP6A 2V3CC 2J0VA 3R8CA 1IAQA 3CF2A 3BORA 4GSYA 2J1LA 2J41A 2GXSA 1R5BA 3EZFA 4FIDA 2PZEA 1KY3A 2QN6A 3M4YA 2HF9A 1X86B 5HZKA 1P2SA 3C16C 2Q3HA 2Q3MA 1W36B 1Q22A 4JYBA 1SXJC 2ODEA 2RGCA 2ZRDA 3DM9B 2O8BA 4W5WA 1RYHA 3FPAA 3CF0A 1HH4A 3NHAA 4LHXA 4NYMQ 3TH5A 3BC1A 5DN6A 4MKIA 1G3MA 1R0XA 4QXAA 4Q9HA 4D4MA 2FSHA 4HLQB 3KXKA 5EZ6B 4DSTA 5JHGB 1G5PA 4G5SA 5FPTA 3KTAB 4N3NA 1M2OB 1FL9A 1XXHE 1HV8A 1XMSA 5BXQC 1RPZA 2ZI3A 3A6PC 2OZEA 1DE0A 2GXQA 1SKYE 1P4SA 4BFSA 1Q1BA 2X8AA 3DMDA 1NMXA 2QQ0A 3IPXA 4PANA 4YXWD 4X8HA 3B1ZA 5SZKB 1G6HA 3ZJYA 2JLUA 3ADCA 1SKQA 2WWYA 1WB9A 2OCYC 4UXJA 2P67A 5AJVB 3B13B 2OAQ1 3QI2A 1JAIA 1GIAA 3Q3JB 5DLQC 3GLHA 3DKPA 4D4KA 5BYKA 2WIAA 3EA0A 3LXXA 1ZUHA 5K8LA 2Z83A 1OJLA 2UKDA 4JLOA 4ACBA 1XP8A 4F91B 4F92B 4NYJR 5EJEA 1HY3A 4OQNA 2KSQA 1B0UA 3MD0A 1SHZA 1MKYA 3QKSB 1RFLA 3LWNA 3P4YA 2KBFA 4MYCA 2D3WA 5GVRA 1WRBA 2N42A 3ZVNA 3Q85A 4NMMA 4KYUA 2VQSA 3ZVLA 5SZHB 3U3KA 1JPNA 4MKFA 4WW0A 5J4LA 5J47A 5B64A 4AK9A 1JAHA 4M1SA 4BQSA 2TMKA 3PEYA 1ZU5A 2G9NA 4W5HA 2Q3FA 3GPLA 5C1BA 4QL3A 1L4YA 3NKVA 3HWSA 3P4XA 1FX0A 3CX8A 3NDPA 2ATVA 3LQRA 4E07A 2C77A 2G1JA 4ESVA 2IYZA 1F2TA 2HV8A 2O0JA 4KSCA 2YOGA 1CULC 1G19A 4WA7A 2GVZC 2OBLA 3U6KA 1GKIA 1WQ1R 2JJ1D 4Q00A 2BV3A 4OHYA 3DVLA 4L4UA 1E2GA 4DLVA 3QKRB 4NKRA 1VHLA 3Q72A 4OI1A 3F5FA 4A8JC 3LX5A 2UZIR 2R44A 3I92A 2J45A 4NCNA 1OXSC 2A3RA 4PHFA 3AV0B 5HCIA 5J4KA 2FWRA 2Z4SA 5KSZA 4Q4HA 4DSUA 1OIVA 3JVVA 2GCNA 4C0AC 3EPLA 4TMTA 3UG7A 1DADA 1U99A 4R71A 4IEEA 4PXAA 3RYTC 1N6OA 3IBYA 4URVR 5JJKA 4HDCA 3ZS9A 3AVXA 2WJJA 3WRYC 4UNSA 4YLGA 3D8BA 4GMXA 2J59A 5JWRA 2QGZA 3QIAA 4GZMA 1DG3A 1JBKA 1EFRD 2WPDD 2IT1A 4ON9A 2ZRPA 2NG1A 4R7ZA 5EXSA 1AIPA 4PAQA 3UK6A 5EQTA 3Q7PA 2IYUA 1ZD9A 5FPSA 3LFUA 3KUDA 4KV9A 4ESHA 3VR6A 2QAJA 3R8FA 3RDPA 1F2UB 2DWOA 2ATXA 1P7CA 1ZNXA 4GZLA 3TRFA 2YOFA 1P62B 4B3XA 2IYQA 4XWKA 3CM0A 1E2JA 5KOYA 2BWJA 2C9YA 1KDOA 4CDGA 1YR8A 1BKDR 3WBKA 1QHSA 1Z28A 4IJMA 3EZ7A 1G3UA 1BYIA 4OQFA 1G3QA 1M1YE 4XWAA 4BLOA 4KXFB 4RY2A 4EAQA 4QJ3A 2OCBA 3IIKA 1G5RA 2VF8A 2ZXUA 2ZS9A 4GBMA 3SHFA 4CRWB 4JLKA 1LY1A 2JASA 1Z6GA 4FWIB 2QPTA 4Q9LA 2FJUA 3F3YA 3V4RA 3B82A 1MABB 1LB1B 1FZQA 5FTKA 4CEIB 5CLLA 4A82A 1A2BA 2QEQA 1GKYA 4GP7A 4JBXA 1G6OA 3LBHA 3O8RA 4F4IA 2J3EA 1CR0A 4G3XA 3QKSA 2B7BA 4D4JA 1X1RA 4JJKA 3LX8A 1D2EA 2C99A 1ZINA 3WYFA 1W4AA 5P21A 3U3JA 4YDHB 1AS2A 2AHOA 2MSEB 2NZJA 3P20A 4A0FA 1T3HA 4BFUA 5KDDA 4OHZA 1JEEA 3IDQA 5FFMA 1BS1A 1ODFA 2DFTA 4NH0A 1W7AA 1JR3A 4ASUA 4KLZA 4C0SA 1T9HA 3ZVMA 3CB4A 1GTVA 1KDTA 4F38A 4S2EA 2P6RA 1XRJA 1NLYA 2KJQA 2ZRFA 4DC9A 3AF0A 3KJEA 3B60A 4PC3A 1BIFA 2VA8A 5L3SB 1XB2A 2GF9A 3KKMA 2XZPA 5AUPB 2DR3A 2HF8A 3GEHA 3SS8A 3PVSA 4LHYA 221PA 5K8IA 2MSCB 1HQCA 3QKRA 5FI1B 2Y8EA 1EFUA 1Z0KA 2ONJA 3TUJC 3X2SA 1Z6TA 3FMOB 3OE7D 5KU1A 1TNDA 4TZ0A 4K8OA 5L3RA 1E94E 3VX4A 5DH9A 3G82C 4DDWA 2E1RA 4Z8XA 4OQLA 4JS0A 4BASA 3GLHE 1E98A 3I4LA 4EFMA 4DUGD 1E9DA 2DWPA 1M7GA 2AR7A 2EYUA 2GJKA 3QF4B 1Z3IX 4KCGA 4MH0R 3PXGA 1HT2E 4Z1MD 1UAAA 4HDOB 1KSGA 4WIAA 2RHDA 1P5ZB 4U00A 3FE2A 3TUIC 2GVDC 3W5JA 3EPJA 2PBRA 4FXPA 4KVAA 4C2UA 4EJSC 2WHXA 3WNCA 1ZW6A 2FN4A 1JXOA 4MA4A 2V9PA 1XD2B 1AM4D 2QPOA 1L4UA 2KB0A 4HI0E 5FH9A 3HDTA 3PEUA 1D2MA 3LDAA 3N5CA 4I99A 4MGZR 4WZBE 1J2JA 3U7HB 1NRJB 1U81A 4TMWA 4D81A 4F4CA 4GOJA 4MGYR 4MGKR 4MYHA 1GDDA 4Q7KA 4RCZA 1Q20A 2Q0HA 3X1YA 4JVNA 1R5OA 4UXIA 1DAMA 1NVVR 1NG9A 1KI9A 3AGPA 2F6RA 4A2QA 2ZAMA 3EZ9A 3CPEA 3A1SA 3NEJA 5HE8A 4ILEA 3LW7A 4TLBA 1A2KC 1ZUIA 5B30A 4XH9B 2YC2C 3PG5A 5DSZA 2WKRA 3K0AB 2FPLA 1VG9B 2JEOA 2UZ3A 3CX6A 4KBGA 2AK2A 2NPIA 4IDNA 4I4LA 4DCTA 1TEVA 3ECCA 4PC7A 3ZIAA 1OV4A 4V03A 1Q1EA 1W48A 2ZJ5A 2A2ZA 2NQ2C 4LI0A 2EYQA 4RCYA 4BFWA 2B8WA 2AXPA 2XJ4A 1N5LA 3QOFA 1TQ2A 1U9IC 2FZ4A 4TL8A 5G3YA 2CE2X 2CJWA 1VTKA 3SJBA 4E09A 821PA 1SXJA 1XTSA 2BBWA 3A1WA 3GP8A 5EXXA 4ARZB 3W6PA 4BLRA 1AKYA 1RRPA 3OAAD 2JLVA 2P5TB 5FL7A 3VR4A 3WMFA 4Q1BA 2ZRLA 3GFPA 1NL3A 3AVPA 3PENA 1EWRA 4OJQA 2QTFA 3RWMB 2O8EB 3TAUA 1N6LA 2OLJA 1N6HA 4JKIA 4LHWA 4N1AA 5FI0B 2ZJ2A 2EFHB 3KB2A 2PLFA 4IXMA 1RZ3A 4IFEA 5HZHA 1KZGB 4MDEA 2GILA 1CJTC 3KKOA 5BN3A 1E9SA 1XTKA 4V0LA 1Q1ZA 3HYTA 1CR2A 4M8NE 1UKVY 1SVSA 1JQJC 4D6PA 3A37A 1A4RA 2XNDA 2QZ4A 4Q5IA 1TQ4A 3PFIA 5AJWA 3KFXA 3LLMA 2WIBA 3V9PA 5CYOA 1OPXA 2W0MA 2NPFA 2AXNA 2JJ8A 2JATA 1FP6A 3TSZA 4HYYA 4P3YA 4LJYA 2H17A 4I81A 1NN3A 4PSAA 1G16A 2J0QA 1ZC4A 4ZPXA 2FF7A 3H0KA 2YWHA 2OEPA 4XIGS 2NIPA 4FW9A 1E3MA 1RIFA 3KQKA 1E9BA 1S8FA 1DS6A 3SBEA 2ZI6A 1D9ZA 2WKQA 5DI9A 1M8PA 1E69A 2BCJQ 3EX7C 1W47A 3QF4A 4YMSA 1XWIA 1RRGA 2ZE8A 3SZRA 2R9VA 1LFDB 3A1TA 4NBSA 5LDDC 3O8BA 3CPJB 2BKEA 3K8YA 2ZUBA 1HA3A 4IW3B 1ZRHA 1R10A 1Z8FA 5AJZA 2JJ2D 4HAYA 4HB4A 1YR9A 5IT5A 5M04A 1RW4A 2CCJA 4ZCIA 2R6DA 3KKNA 4CEHB 2VHUA 1AKEA 4QFMA 1NBMA 2GNOA 4Q47A 2W6IA 1YRAA 4RD3A 4X8LA 4LSGA 1G18A 2WMNB 5EUMA 1RJ9B 1JR3E 2ZYWX 2ZRBA 5LB2A 1S2MA 3I61A 2PL3A 3NC1C 4C0HA 1IY2A 3SYNA 2ZM5A 4NHOA 1UKEA 1E2KA 4HATA 1L8QA 3ZDQA 5TY0A 1T5LA 1P3JA 3LD9A 4LYFA 2QM8A 5A5GA 3AVYA 1T6NA 3R7WB 1R6BX 1OHHA 3GLGA 1XDBA 2CL0X 2GZDA 3REFA 3K0AA 4V0NA 4PC2A 1GRNA 3K09C 2Q21A 3CR7A 3IHWA 4HSEA 3IBGA 1W2HA 2IK8A 4A8JA 3OIVA 1ZVQA 3RS5A 2O8DB 3V00A 1OKKA 4LJAA 1P2UA 3THOA 2GWHA 5JJLA 4M1WA 3CX7A 3T1VA 3VR5A 1SHKA 4MKGA 1II0A 1IY1A 4G5QA 1W0JA 3EXAA 1D2NA 1J7KA 5FUVA 2XTZA 3KUCA 3MG9A 1ZNYA 2D74A 4B3FX 4DB4A 3ADDA 5JLJA 2A9KA 1F3OA 4P32A 2P5SA 1P6XA 4NE2A 2AWOA 4LBWA 5FUXA 3W34A 2QGNA 4A9AA 1XEXB 1XTJA 4EJSB 4RVCA 3HU2A 3O8CA 1OLOA 4UNQA 3H86A 4HAVA 3KQNA 1IXSB 1CTQA 3CNNA 2QM7A 2R62A 4QBIA 3TVDA 3CRQA 2EW1A 1XCGB 1Q3HA 2XTMA 5D3QA 4NL4H 3IO3A 3KZ1E 4ZDIA 2OT3B 4P4SB 1DARA 2IXEA 2V6JA 2IS2A 1T8TA 3IIJA 3QPWA 4TMKA 1J99A 3IEUA 3NTUA 4OYHA 4TQ9A 1HEIA 3RSOA 2A5JA 1N0VC 5KNBA 3KXIA 2AN9A 2V8OA 1OFUX 1HUQA 1E0KA 4OK6A 3QJYA 2DB3A 1KDPA 1RC8A 4UKDA 4CYMA 4PAOA 3AQ4A 4PTLA 3HPQA 4KODA 1DAFA 1Q0UA 4XD7D 1SXJE 3OESA 3ZZUA 2QI9C 1VCMA 3BGWA 4LC0A 4CEHA 1E0AA 5EUQB 1WBBA 4UXHA 2ZPTX 4Q4AB 1AS0A 4RD4A 1V43A 2BKUA 3GEIA 4FMCB 4AKIA 2QENA 1DAKA 2ZE5A 4JT4A 4P31A 3RS0A 1SZPA 1RJ9A 3FGNA 4G1UC 1Z47A 3LW8A 2Z0MA 4PPNA 2KBEA 3W8RA 4IXNA 4BE7B 3VTKA 2DBYA 1DAHA 2WJVA 3BH7A 2O0KA 1YR7A 1OB5A 2BJWA 2QORA 5CM9C 2MSDB 5EE9A 2R6FA 1Z5ZA 4G0NA 4DT1A 2YHSA 1OSNA 4B44A 5CIQA 1KI1A 1NN5A 4DSNA 4YMUA 4B32A 2QP9X 1II8B 4LBZA 4TYQA 4M1KA 1IONA 2QMUA 2V7QA 5KDOA 3AUXA 2ZRCA 2F7SA 3N2EA 4TLDA 3LBNA 3W6NA 1Y3AA 5CK4A 4DKXA 3DO6A 5GJVC 3WMGA 5A4JA 4F93B 5CK5A 1SVLA 5HPYB 2ZJBA 4W9MC 4QKQA 3GJ5A 4AYTA 2ORIA 1FOEB 5EE0A 2QROA 1IQPA 1GNRA 5BN4A 3K9HA 4AG5A 2VHJA 2WAYA 1XEXA 2CCGA 4JT2A 5D3MB 3EWAA 4EJSA 3U60B 5A0FA 2IYYA 3X1DA 1NY5A 4PO1A 1WP9A 2XB4A 4DCNA 1KK0A 2BMDA 2JIZA 1E2MA 1KO8A 4Q03A 2NO9A 3GLFE 3P32A 3V4FA 1UM8A 3TW4A 4K46A 2E87A 3NWJA 4TT3D 4HZUB 1CBUA 4HB2A 1MR3F 3K0FB 2VRWA 2VSXA 4P4SA 3U61B 3GLGE 1GOTA 3AVTA 4Q66C 2KE5A 1FQKA 1ZBDA 2ZITA 4M2LA 2GBLC 1OF1A 1VHTA 4RKEA 3UXMA 2JLSA 4BEJA 1IN6A 4MDFA 4JVLA 3L8YA 1W4BA 1J8YF 3I3SR 3VNVA 3S1AA 1OT3A 2OESA 4H1VA 2DWQA 3ICQB 3AUYA 4PZZA 5JWHA 5JCZA 1MRNA 2IEZA 2VHQA 3B1WA 4OKSA 3VQTA 4PZYA 4QJ5A 1E2EA 2G88A 3BERA 1COWA 3OEEA 3WYAA 4XWOA 5JECA 2CBZA 3L43A 5BW8A 1ZM4A 5JRJA 1U9IA 2GA8A 1LS1A 1Z0JA 4ZIRB 2HYDA 5E3HA 2IW3A 3TQCA 2F9MA 4LY6A 1U0JA 5H8WA 1HYQA 4Q4AA 1LF5A 3FWYA 2QA5A 1OW3B 3B85A 5FPKA 4IVQA 5H1YA 4HDQB 4UQOA 2CCKA 3B2EA 2VHCA 3T5GA 2XTNA 2EWVA 2C9CA 2ZRGA 3N2IA 4B33A 2D2EA 1G5TA 3QKTA 4FMCF 1FW6A 4C4PA 1C1YA 4HB3A 3LQQA 1XD8A 4AY2A 4HAUA 2OE2A 3CNOA 2IL1A 1BMFA 4O25A 2FV8A 3ZYCA 5DN6D 1EG7A 2ONKA 5AR1A 3SU8A 2QBYB 2CNWA 1L2TA 1R0YA 2CHGA 2WM9B 3E70C 3O8DA 3DEFA 3R9XA 3VAAA 2WTUA 1W5TA 2FU5C 2BDTA 3LH5A 3RRMA 4ITRC 2F1IA 3AB3A 1N5KA 2BBSA 2IC5A 3GJ0A 1PLJA 4D80A 1CXZA 3NBYC 4BLTA 3K0SA 4Q7MB 2WVJA 4HLCA 3AP1A 3AVWA 2DPXA 2OFXA 1VCOA 4B3GA 4ZI2A 2ZJAA 4QM6A 5JMTA 1Z22A 5FBQB 1IM2A 3ND8A 5FOSA 5FBVB 1G8GA 1NKSA 1TU4A 4LRWA 5TMPA 4KVGA 4Q19A 4XSGA 3SBDA 2WWWA 2ZYTX 2XGJA 4RFSA 3W5IA 1XF9A 2ZYUX 3RHFA 1UADA 1G3IA 5EP4A 3TNFA 2J9RA 2QSYA 2PLRA 5CB8A 3H1TA 1S3SA 1KTVA 3MJRA 1XJ0A 1GL9B 5D3MA 4NTZA 5C46F 4LJ9A 4J0QA 4GP6A 2IWHA 3EPKA 3C14C 3VNUA 1ZIOA 3PJRA 2C2HA 1RKBA 3RRZA 4JYCA 2I1VB 2V54A 1E9EA 4EFNA 1NMZA 421PA 1E1QD 4O0MA 5IF9A 1M74A 2YYZA 4R9UC 4RZ2A 3REGA 4M22A 4LJ7A 1I4LD 4HZUA 2CL7X 4M4SA 1PJRA 2OG2A 5DI3B 1GRRA 2G1KA 2WJIA 3DHWC 4JLBA 4D26A 3K0FA 5KHOC 1TADA 2XB2A 1AQYA 2JAQA 2W00A 1NNEA 4PSKA 4B47A 4TYNA 1Z2AA 3RC3A 3MGCA 3K09A 1JJ7A 2HT1A 4B48A 1VYTA 4Y0AA 2FGJA 1VYVA 3BE4A 3TLXA 4II7A 1US8B 5CDFA 4KHZA 3IHLA 3X1WA 5F9HA 2IS4A 1E2QA 4P4UA 4OHVA 3QBTA 4B3DA 3PITA 2YINC 4JKYA 2X1VA 1YZKA 2MMGA 3B1VA 2J5XA 5FPYA 1JNYA 4MQBA 4IVPA 1IN7A 2ZVPX 1EX7A 1VIYA 3AP2A 1S3GA 1OIXA 621PA 2NO7A 3CRW1 2IUTA 4TMVA 5JRZA 2ZSDA 4JVMA 4JLAA 1Z0FA 2FFQA 2QAGC 4LDJA 4TLCA 2J0UB 1PUIA 4B73A 4Q18A 1KI6B 1G3RA 3CUEF 5CB6A 2OUKA 1F48A 4EPRA 4QGFA 5EE1A 1E79A 2QBYA 1TX4B 1JQLB 2B6HA 1W0KD 5FR1A 4RD2A 4DDTA 1E9RA 2W58A 3QPUA 3VHXA 5DYIA 2X2EA 1W4RA 2HJVA 2RGNC 2WZQA 2WJGA 4F4JA 2BMFA 2H1LA 4URYR 4WBSA 3UMRA 1KSFX 4BEBA 2JJ1A 4Q1EA 3FKSA 3KTAA 2BHRA 2ZS7A 2O8FB 4B2PA 1GNQA 1KKMA 2HT6A 3RANA 1Z63A 1KIMA 1ZAKA 4DLXA 4EIWA 1IBRA 1ZM7A 2IYRA 4N0EA 2GAOA 1QVAA 4XTRA 1J90A 2ZRMA 2VP9A 3SHWA 3OIWA 3Q9LA 3VFDA 2QMOA 1ZD1A 3EZ2A 3SI7A 2ZSFA 2CK3A 4NP6A 4WXRA 2GAAA 5HKKD 1KI4A 5IK2A 4EPTA 2PEZA 2EFDB 2GDJA 2ZRNA 2HCJB 2FPMA 1D8TA 2VIIA 3PUYA 3TVTA 2C96A 4PO9A 4US1R 5E7IA 3UMFA 2GEUA 2P2LA 3K0EA 4GL2A 1N2CE 3AF2A 1R2QA 2GJ8A 5CJPA 4Y0VA 5DNYB 4D0LB 4CT5A 5L8VA 3BAFA 3P1JA 1DG1G 4BLQA 2GZHA 5ELXA 2JLXA 3AKDA 1EFRA 2WPDA 4KU4A 4FWTA 1JI0A 4URZR 5J4VA 1NF3A 4GPTA 5DI3A 3U3RA 2VSOA 3M1IA 4I1VA 4QBHA 2W2XA 4OHXA 2ZR0A 1XPUA 3CBQA 5FOVA 2B21A 3ADKA 5EP2A 1Q3TA 4DEYA 1WBDA 1OXUA 2XJ9A 3QNUA 1JR3D 4ASUD 3K70C 1VCIA 1XTQA 4Q9JA 5HCNA 1ZU4A 1G7RA 4BECA 2ZRJA 3MCAA 3U44B 2JLWA 4WOPA 1US8A 5G40A 4L9SA 4QNMA 5EP3A 1G7CA 3NC0C 4IFBA 1S9HA 2ZR7A 1E0JA 2FX3A 3HP1A 3HYRA 4GOXA 4EQ6B 1DPFA 1AQUA 3RWOA 1WMSA 4FMBB 2PX0A 2J7PD 2CHQA 3WXMA 2ZU6A 1AZSC 2BJVA 2GF0A 1CJKC 1XCMA 4GNKA 1ESMA 2IHYA 2NZ8A 2O8DA 2H7VA 2I1QA 4D82A 1CJUC 5FOUA 2R6CA 4UNPA 2WOJA 1R0ZA 4QHTA 3FHTA 3CWZA
chains in the Genus database with same CATH superfamily
1M0SA 1T1SA 4L75A 5H9VA 2ZUEA 1Z9BA 2C2WA 2NP7A 3U7QB 3WZMA 3TD6A 4QNRA 1MO3A 1MAWA 1J07A 4V0MA 4C6SA 3MS2A 5KTYA 3FYCA 3PXBA 4LWQA 4BWFB 1IU9A 1UZNA 5B2ZA 4TVSA 4I08A 1QF6A 3O83A 1BDIA 3UWDA 1TMKA 1Z5VA 3C1TA 2JFZA 3KD3A 2CVQA 3OEHD 1GHTA 2F1HA 1IPFA 2QPLA 3PDJA 4MYRA 5EYPB 4BNFA 5JJIA 1U2GA 1ST3A 3J81A 1KFKB 4UMFA 4AIIA 1TTTA 4J8PA 1N57A 2OCDA 4I2VA 2AYYA 2CZCA 1XK7A 3Q1KA 1CJCA 1C7QA 3O0DA 1VPLA 4WBNF 3NO4A 5KPJA 3K32A 2IU4A 2PANA 3DZIA 3T5PA 1IQUA 2IU6A 4GLBA 3BWDD 3C6BA 3QX7A 1QYWA 4BV9A 4UOEA 4AWBA 1ZH0A 4AJJA 3KJQA 3GFTA 3ITKA 1VHDA 2IYVA 4Q02A 4W8GA 5ITSA 4ICIA 4DNPA 1F2DA 2B94A 2Q9UA 4RDHA 3RTEA 1OYWA 4I4NA 4MKHA 5AI9A 3VI3B 3EIEA 3GLIB 1MV8A 5FUYA 1SVWA 1T1JA 4CKWB 2YH2A 5ALFA 3SR3A 4CZ2A 1XNJA 1ZL2A 2EW2A 2X19A 3W6UA 4MGIR 3ZN2A 5CVEA 3ORSA 4HJXA 5H59A 4KR6A 2GBPA 1G5IA 3OFND 4GFDA 2VAPA 3K9CA 2GJAA 4HK4A 2F90A 3KQQA 1A1SA 3CZAA 2BOVA 3AI3A 5HM8A 4C1BA 1OAOA 2Q7OE 3GA5A 4J03A 4JOCA 1MN6A 3MMPA 4HYTA 4R8KA 4U7WA 3WLQA 1XZPA 1HT1E 3DOUA 1D5CA 1RZRD 3B3AA 3F6RA 1PEAA 1U7OA 1SH7A 2HM7A 3IHTA 4J3FA 4F12A 4LUCA 3ZW9A 1XRLA 4NXMB 1MABA 2X6RA 1X8XA 1SXJD 2VP3A 3AI7A 4FQ5A 2ZJOA 4EY6A 3ZHTA 4CR7A 4DR2B 4EUHA 2ZTSA 3KT3A 2O4UX 1IG3A 5FL7D 3OLCX 3GLTA 3CEJA 3F8TA 4NYJQ 3SEFA 4Z2YA 1DAOA 2BY4A 2G70A 2H2GA 3DNPA 3EOBI 1U31A 4IFIA 4UFNA 5JY1A 1POWA 1DVRA 1V1JA 2PR7A 3G2QA 1W46A 3L0BA 2IUFA 3W4JA 1BA3A 5EKSA 2A1UA 5F5XA 1KZYC 5KINB 4FGUA 2VYND 3DE6X 3HU3A 1AKWA 1CUJA 1DEAA 1ULUA 2HA2A 4BVGA 4NECA 4HDKA 1Y9AA 1YR6A 1L4GA 2BHLA 1UFQA 1B26A 1Y3CE 4RCVA 2AOTA 3EVEA 4DSZA 1T2FA 5A5DA 4F72A 4CM9D 3D8NA 3H9UA 5A3QA 3ZCPA 3FTNA 3WIEA 1U7DA 1UBHS 1V7ZA 3G6KA 3C8DA 3HWWA 4P4LA 1U9ZA 2XUPA 2H3EA 3IUPA 4RF2A 1WZ2A 3EWSA 3VYRB 2IHVA 1XEAA 3U5ZB 2HA7A 3BK7A 1Z34A 1L1FA 4LAFA 1W35A 8GPBA 1ZRNA 5BSUA 3W79A 3JV7A 1KP9A 2X5NA 4K9MA 4NATA 3OO0A 1I9GA 2I4TA 3PUXA 3MIZA 4B0PA 4E6PA 3WP0A 4C2TA 1AJEA 2DPLA 5THQA 1UK9A 5DP2A 1KYZA 3ETHA 3K1AA 1MNQA 2PLAA 3BBPA 3JS5A 1GV1A 4S2UA 3UB4A 1XMOB 3A3KA 3FFWA 1GUFA 1LV7A 1EDZA 4CDMA 4J3NA 4J7AA 3C6KA 4KGXA 2PZBA 3NASA 1QKJA 1BCSB 5EYPA 5J2TB 5JU6A 1I24A 2BZGA 4UPDA 4XDHA 1EQUA 1IHUA 1T3SA 3F3SA 3NGXA 1THMA 4DMRA 2Z6QA 3IAM1 1IRIA 1UF9A 3TBKA 2V7TA 1HLPA 4EX7A 5DMXA 1V45E 5BSFA 3HH8A 1OC4A 3I52A 3LT5A 4V1CI 4MIYA 4N5DA 3FHOA 4P3KA 1AHNA 1TFRA 3DC7A 3PGLA 4HY3A 1CQIA 1DC8A 4LZAA 4PSDA 4GRDA 3KOWA 3SF0A 2GYYA 4Q7EA 5AVYA 3WGYA 1YZLA 3Q8XB 4FKZA 4G63A 4QXRA 2KQUA 4FGSA 3RSFA 2ZYAA 4LJRA 3VZRA 3IAAA 1TVMA 1MEOA 3C7CB 3GLIA 4C9BA 2WB2A 2QTMA 2FEOA 2QAIA 3GY0A 3KB1A 1WA5A 2D00A 4LBVA 3DVQX 1IB6A 3DUFB 2MT9A 3NHMA 4TL9A 3TMKA 3U37A 2JAHA 3ZR4B 2NGRA 1UMCB 1VL6A 3UB3A 1TLTA 1AG9A 3ICVA 5I6DA 2OGUA 4BNMA 4AY2A 3KVYA 2FX2A 3ZHRA 4AS3A 4RPJA 2ST1A 3TBFA 1VPVA 3RT1A 4FGJA 1CLEA 2PDAA 5JATA 3SE7A 2CWWA 1MVOA 2A9OA 4BDSA 1X2BA 1U2EA 5FOWA 3W2HA 4LW8A 4RVDA 2BM0A 3WRWA 1SIWA 4L7QA 4COKA 2F55A 3LVQE 4XYEA 4MWSA 3DKIA 3BIOA 2IXFA 2H1SA 4JA0A 2HLDA 1SZJG 2EHDA 3IV6A 3BWEA 4CKZA 3GJTA 1J7JA 1ONOA 1UKAA 3HUTA 2BCGY 1NZJA 2N1MA 1T1EA 4L4YA 2HU7A 4MVWA 2ECFA 1FVFA 5FTWA 3B1FA 1CETA 4QBFA 2BN4A 2HADA 3GRUA 4YV1A 4QEZA 4OA5A 1M2JA 1XTRA 3ZE0B 1T8PA 2FI1A 3WJ1A 2YMLA 2RHBA 3W2FA 2V1UA 4D3FA 4GI1A 3QENA 3H6HA 2P9GA 5BP7A 1CP2A 1WV0A 2M6LA 3QKUA 2R1ZA 4X1IB 2GZ2A 4U7JA 5IARA 1KP3A 5U4XA 2D2XA 4D98A 4ECAA 2O8EA 2GN6A 2Z1MA 5DZSA 4LFCB 2IQIA 2WHPB 3KKPA 3L7DA 4P5PA 3WYEA 2VH2A 3QE0A 3HRIA 2H5JA 3NONA 4QPZA 1ST2A 4KBYA 5IDVA 1LTHR 1N4AA 4BVKA 3KZXA 4D4IA 5EMJA 5KJ1A 2ZIXB 2DBQA 2QMEA 2OK8A 3OMXA 2B0JA 4L28A 2JKYA 3R9KA 1S8AA 4I9HA 4BYGA 2GTIA 4BXOA 2AWNA 5DT9A 1ETUA 2QT0A 1G8YA 3DTNA 2F2TA 2QUHA 3EGOA 4OSPA 1SUCA 4DMKA 5FAKA 3FUWA 5BUQA 4RF5A 4GGOA 5A5VA 4KK4A 1XLTA 2AKAB 4PO8A 5NLLA 3EXG2 1Z0IA 5DOZA 3PC8A 1F2VA 2VJOA 4EA8A 1Z0DA 5AJXA 2VTEA 5C81A 3HV0A 1PFGA 1GUZA 2JCBA 3LG2A 2L19A 4U5QA 2R6AA 5IYZF 2XOKA 2O2XA 3CTPA 3PUKA 4YONB 4MUXA 4CEJB 5J2TA 1JH8A 4JELA 3L8FA 3OO1A 5KYKA 4FCTA 1YE8A 4BGEA 2VK1A 3C8UA 3D0QA 4LOLA 3H1FA 4BYMA 4E1VA 5CLJA 1QLWA 3OC0A 3IQWA 2GZ1A 3OZRA 3PUIA 1XL1A 4JSYA 2BP7A 4GPEA 5A71A 2VUHB 1X8LA 1N34B 4MOWA 2JH9A 2D06A 4YMLA 2FLKA 3IV7A 4O4JB 4DYHA 2O5EA 3I2FA 1YUNA 4AB1A 1PZEA 3RSGA 4AUMA 2A7QA 3DB1A 4PC1A 1IZZA 1H0RA 2G67A 2RI1A 4GOKA 2QSZA 3IE2A 4H0CA 3GGPA 4ALIA 3HXQA 3HB0A 1ZJWA 1A71A 4TROA 4GPAA 4PFSA 2SICE 3I8SA 1QWSA 4R8LA 5EEHA 1P5JA 1YHNA 3K16A 3F6SA 3GRCA 3E22A 1N6NA 1IXZA 2W6JA 1NVVQ 5JBQA 2AJCA 2HRQA 3JTMA 4EGAA 3EHDA 2AG0A 3QBVA 2WOOA 3K1ZA 2OP0A 1F60A 2C8KA 3D7RA 3LUKA 4XTCS 2VDUE 2ZM6B 5LMUB 1Z38A 4CKEA 1TZCA 1IBCA 1X3SA 2X9VA 3M4NA 4LSWA 4DXAA 4CKCB 4MSUA 1FU7A 3F78A 3PBKA 1D7OA 4L3OA 1MQ8B 1UEXC 1NIPA 5DDIP 2G06A 3H4IA 1N5MA 3KVOA 1NN1A 1EFHA 4C7OB 4PPFA 1ID8A 1PUJA 1N2BA 2FWPA 4H3SA 4AD8A 4JQYA 4DM4A 2PMDA 2Y0DA 4PEVA 4KAXA 3U39A 4X6UA 4LCBA 5CH3A 1TO6A 2XZOA 4XSHA 1IH8A 2WSSA 2BFEB 4HAXA 4LMBA 5J5VA 3RUAA 1HE4A 2P8JA 1N3YA 1ZMXA 3HBMA 3OUZA 1ZP6A 1SVIA 4X1IA 2YHIB 4NESA 2PYZA 2AMFA 3HCAA 2OSBA 5B3JA 3LY7A 2IQ5A 4QQNA 4RPCA 3HL0A 5FTLA 3W5CA 1P39A 4DA8A 3J7AC 1E3SA 4K1XA 3IPYA 2PSHA 1NT2A 3NVAA 2P2DA 2JLZA 1R4AA 2YMQA 3NUGA 4TTQA 2ZIXA 1UC9A 1PT8A 2C4KA 1EUYA 5ALUA 1ZIPA 5HOQA 3PXXA 4BCCA 2YWXA 2CBXA 2V4UA 1L4KA 4ZT5A 2DPMA 3CT6A 1VIVA 5CRIA 4E03A 3DVAB 4XWYA 3HB4X 1IJFA 3D02A 3UJPA 2ONZA 3AHFA 4GDFA 1DU4A 1GGEA 3MWLA 1NUAA 3OZIA 4HVAA 4WZAB 7MDHA 4FYXA 1RI5A 1T2UA 4B1FA 4RH1A 5LUAA 3VV3A 6AT1A 1ZOIA 3KIPA 2WWHA 3ZHQA 4LYAA 4UAUA 2OKGA 4K6GA 3AEKA 3VMFA 4RTPA 4DVGA 4QHYA 8ABPA 4JQZA 1U0LA 4WEOA 3MERA 1ND6A 1PVVA 3AZPA 1DQZA 5CYFA 1MTOA 1XALA 4DPKA 4PYLA 2OFWA 1ADGA 3TB4A 2XGMA 3MW8A 4LFAB 4B6JA 5GQSA 5E7JA 1DKOA 1KL7A 1OTHA 1YBVA 3CRVA 3OTWA 1Q0LA 4IIYA 4WZ6A 3UT5B 4KNYA 3QVWA 3NHUA 3HCRA 1U5BB 1ZGJA 3ZWWA 1OXTA 1EX1A 1W52X 2Q3EA 2UDPA 3GBPA 3QSGA 2EATA 3U4QB 4IEIA 2X23A 2ASVA 3UOGA 2DFNA 4K7JA 6PFKA 2AOXA 4IZHA 2AFHA 1V2GA 1E77A 2A58A 3UAXA 1RD4A 3PFKA 5HCUA 3ZTTA 4JYZA 2QRUA 2J07A 4TXMA 4XFKA 1JEAA 4O4JF 2M32A 3IR7A 1U63A 1QIEA 5HFAA 2GB4A 4PQEA 4HNVA 5KTOA 3ELDA 4Q3OA 3RAJA 5AVOA 4Q16A 4FMPA 1PN3A 4M9UA 5BY2A 2QTHA 4PNPA 4GLJA 1U02A 4P8RA 1J0EA 2IV7A 1ZWKA 4QUDA 4Y2VA 3N6XA 2P5UA 3H9EO 3NTLA 2WWIA 3DL7A 3DYVA 3PNYA 1QR2A 2C03A 1TUBA 3GVXA 3FFBA 3C3PA 3VVMA 5F1KA 4CDRA 4DPLA 2CSXA 1JMKC 4BNWA 3VBCA 2J3IA 1HE8B 1V2HE 1M75A 2R1UA 4FINA 3R9IA 4CKCA 2PUTA 1DOAA 4LTDA 1RXUA 3JQGA 1JB1A 5LMCA 4AMUA 4C7OA 2JVIA 1FTGA 3G9QA 5JNVA 1T2CA 1XYVA 2YIJA 4E2XA 1ACLA 4Q4HB 3H1AA 5BNFA 4AUKA 2C4WA 2FUG6 2BGKA 1KSHA 4M89A 4DR7B 4OSEA 3DT9A 3ZK9A 3LDFA 3QBEA 5L51A 1O9HA 4JLVA 4KE7A 2QHXA 4IOMA 1WMFA 1A2QA 1ID1A 4IS3A 1NP3A 2BFEA 4FN5A 4OXNA 1WNTA 4TQUS 4AAYA 4GMGA 5TGTA 4DUYB 1YE5A 5BYJA 1JPJA 1XMXA 3IBCA 3T5CA 1MDBA 4ZGWA 2ANCA 1R12A 3MBKA 1T0HB 2G63A 1IJEA 4JUBA 2P41A 5KX5B 1JU4A 4UCWA 2CXNA 4B2YA 1ANKA 1JHAA 1C9KA 2EERA 1PWHA 5D5HA 1YRLA 2QN7A 1ICIA 4WNAB 5ALTA 5EIOA 2JFYA 5T4HA 2ID4A 4HQKA 1TVCA 1Y4SA 1ISHA 4FOOA 5IAOA 4G4SP 5ER9A 2H54A 3P9XA 2Q1SA 5CYGA 5SY4A 1GYQA 1GA4A 5H3HA 2ZCVA 3DVAA 3TR5A 1QP7A 2G07A 3NBKA 4RENA 4OJKA 5K99A 5JROA 1G63A 1FNMA 3B1KA 1EDOA 4DIDA 1IY9A 4WZAA 4PGHA 1IATA 4R2IA 3KV1A 1DQNA 4HAZA 1L7QA 5DM2A 1I14A 5CNIA 4X94A 4DMLA 4F85A 1E32A 2ZI7A 3DFUA 3TAHA 4DA9A 3NDBB 2P4UA 4IV8A 1G1MA 2QF7A 3BFPA 4R7GA 1QFMA 1MQSA 4V0RA 2ORVA 16PKA 1YBFA 4NQZA 4PLTA 4GBGA 4M0UA 4EA6A 2IUSA 3H5AA 3KEFA 4K5QA 3AFIA 1MO4A 3KYJB 5MGNA 4MR8A 3TR0A 1UKCA 2B2NA 5DK6A 5LMZA 3UMVA 1SVMA 3A58B 4ETNA 1H6BA 1G0NA 4CNBA 5GPBA 2YQ4A 1N2EA 3BT7A 1CUCA 4BQRA 3RIEA 1T4GA 4N65A 5DBGA 2QXYA 3AONB 5FI3A 2CWDA 1CERA 1RLTA 3G89A 4ML3A 4PX5A 1UWVA 4TRRA 4LIPD 2CMKA 4AQDA 3U4QA 5DISB 2V03A 5ITWA 3Q5EA 1WCIB 5F64A 3PGA1 1ND5A 4M0PA 4PINA 5DLYA 4E08A 1NVTA 1IOWA 4E94A 3EEYA 1CIPA 4ZV7A 4EAAA 5AI4A 1QHGA 2J87A 5DK4A 1W36D 1KI8A 1FLNA 3JVDA 3NJ4A 3RAFC 5C2JB 4EMUA 1PFQA 3PA8A 1VSTA 3KZNA 4YRDA 3GAFA 1RRFA 3ZLTA 3FSJX 3O84A 1UM9B 4EM6A 3A4LA 2REQB 3EXEB 5J4HA 1M7BA 3ZV6A 2QSJA 5CT8A 1J4AA 1LQTA 2VDMB 4W1QA 1RLMA 3FWHA 4GT1A 2E4YA 3B3FA 2NAFA 2PVCA 3MTJA 1KEWA 1SEVA 3F0TA 3KL4A 2X8JA 2V6IA 4J0JA 4ZXFA 3VKWA 1GPLA 4UUBA 3AIOA 2NU9B 3U2QA 2BE7A 4DLKA 1SBHA 1FRZA 1BWSA 2IUEA 4C3OB 3WLKX 2VP4A 4NCHA 3WHKA 2ZYVX 2OD9A 1KAEA 5C1PA 3L7BA 1Z2CA 2YW9A 5JS7A 2WNHA 1IOZA 1LPMA 2VP2A 3D7LA 3G0GA 4WOJA 3H2YA 5IK2D 2OZLB 3UAOA 1MVNA 2K5UA 2RHLA 3E8MA 3GRRA 3PQCA 2P6NA 4FZRA 4HN9A 2AN5A 1KVUA 4BO3A 3EF3A 1VJ1A 1Y34E 1L0BA 3NATA 4GI3A 4R41A 2VK4A 3BFVA 1JPUA 3UOAB 2GPYA 4BU0A 2XLBA 2HW8A 1JE1A 2MSNA 3JALB 1M33A 5SZIA 3MGBA 3C6XA 3V33A 2HK9A 3FCOA 5KX5A 3LL7A 4OQMA 1USVA 3A2MA 1H2XA 4M9SA 4R1OA 5HK9A 4RV9A 3ORQA 2TMYA 3FMFA 3N53A 3BSSA 4ZGBA 4WNAA 3BM5A 3BRWD 4LWPA 4WOCA 1MB0A 1TM5E 4RXMA 3C7KA 4WRRA 1DGQA 2CDRA 2QSUA 4R1QA 2FB9A 3B7PA 4NJMA 4JP1A 3IOYA 1G4AE 4BOYA 2VUSA 1LI7A 1SHLA 4B5KA 2ZZKA 2DCUA 3U1VA 4ZICA 2AJDA 2P8SA 4ER0A 5KHLB 4G0QA 1I33A 2C9MA 2IYFA 3EOZA 1YR1A 3AKZA 5IJWA 1K6JA 2ZULA 2O7VA 4U02A 1IN5A 5DNVA 3NANA 2HREA 1THGA 2CFRA 3EF1A 4GAEA 1N78A 4PWZA 2OXCA 2CHEA 1XA0A 1QLHA 3I04A 3OE1A 5KWSA 2IP2A 3ASYA 1CS4C 1NTOA 3FTDA 3K31A 4N8EA 4EL5A 3UYKA 5J2UA 1Q2XA 1R8QA 4O4IB 2XXAB 1BX1A 1VKRA 4Z9XA 4Q1AA 1ONBA 1RNLA 2X14A 3P9CA 3KQYA 1GITA 1DAIA 1CYDA 4HWSA 4CGZA 1T5SA 3MS7A 4YNBA 4EF6A 1ULAA 5HILA 1KK3A 2OLKA 3MSXA 8OHMA 3TQFA 2AX4A 1SXJB 3NU1A 4CTMA 2HPHA 2OFPA 3KX2A 4NCKA 1WCIA 1Y37A 2IY9A 1Q1GA 5TQ2B 5F76A 4A0HA 3LBIA 1W29A 1AKRA 4EG4A 5HX7A 2BVNA 1XNQB 4OLAA 2F3UA 3FFAA 2VRNA 3HRKA 2I4NA 4YIKA 4DADA 4DHEA 4TWZA 2A4KA 1XEWY 3WRXC 4Q1FA 2YIDA 3OZAA 5IKEA 3C3MA 3SXUB 1MB4A 5BN3B 4QOJA 3HA2A 3RVLA 2I4IA 3ZZ0A 4UE6A 3DAFA 3PHHA 3DLBA 1H1LA 1LF0A 1UPXA 3S2ZA 4GM4A 2JCGA 1YU9A 4KUHA 4ZU1X 3W4KA 5CH8A 5KSPA 4F6RA 3V1NA 2IXAA 2J7PA 3VC2A 3LYLA 1PF7E 2BKXA 2DFLA 2EKQA 2NU9A 4Y7DA 4LDNA 2JF0A 4BWGA 1GPBA 2WJZB 3L6DA 4RPHA 4Y3UA 1XJWA 4DVJA 3PHGA 2X0KA 3ZJUA 2C5BA 2BMWA 2ZR9A 1YF3A 3P94A 4JXKA 1G8AA 1KNQA 4QUBA 5KS2A 3SFZA 5IAJA 3E35A 2QV0A 2X86A 1PEDA 2OZLA 3H3JA 3HJTA 3JZDA 4JUCA 4BLPA 4DCUA 5BNIA 3L93A 5IHPA 3QITA 3B7WA 5ESRA 4IVNA 3MK31 3ZYZA 4ZAXA 2QUJA 4MYUA 5DB4A 3NP9A 4YJDA 3TSOA 1RYFA 2L82A 2QL9A 4BPRA 3UHFA 5A6SB 1V25A 4O2LA 4CN9A 2C3UA 5KNDA 3OEHA 4TSFD 3QEMA 3KYBA 1PKXA 4MITA 1YDGA 1CHDA 4JB8A 2F4VB 2QUIA 2BKAA 2I7CA 3QKWA 3R3ZA 3BRQA 4FMDB 5JC1A 2FZLA 3FOCA 3L8ZA 4DAOA 4TMZA 1JEYB 2ORWA 3K15A 1RQNA 3I0MA 3PUVA 1AQNA 3BXZA 4WNCA 4YMTA 5C52B 2NUPB 4F9TA 5K8TA 1P60A 1WF3A 3NLLA 2I54A 4QT0A 3QTBA 3UFBA 1YS1X 1AB5A 5E1MA 1M1UA 2FWIA 3E2IA 3G17A 1OIWA 3GUZA 1SEPA 3JYOA 4QLOA 3RWBA 3SR0A 3WHLA 4DREA 2NOAA 3D4NA 3WIBA 3GLGB 4PCVA 4DXHA 2D8AA 2QOEA 1U7ZA 5I7WA 3T9BA 4O2AF 3WP1B 2YQZA 3ONWA 3U44A 4QODA 1O77A 3OFNA 1J1IA 3FVQA 3U3MA 5TMBA 1NBIA 2QN2A 4RTQA 4EJ0A 1OILA 4MUGA 2JGMA 2HR1A 2CLKB 4F5DA 5T6MA 1NQVA 1JWLA 1Z2PX 2XX3A 1W34A 3W77A 4WFKA 4EATA 2XXAA 2XYQA 1EVIA 1JEQB 2EHJA 3WGLA 3DM5A 3Q3IA 4DJAA 1S2OA 4HRXA 2B8TA 2TSYB 3R7BA 3EF0A 4QT4A 5GJBA 2XUQA 3I9V1 3ISVA 1GYRA 4EG5A 2WVHA 3FSGD 3K8ZA 2ZRIA 4U2BA 4GWGA 2O2SA 4O4IF 3AKYA 3KPUA 4N9WA 2QJTA 1PQPA 2BGMA 4MRSA 1SZCA 4S1OA 4BQOA 1EX9A 1FLDA 4PG6A 5B5SA 1E2IA 1L4HA 4MPPA 3M2PA 3EIFA 2CVFA 4GEGA 4B3CA 1VQ1A 4QASA 1I1NA 3DBRB 1RXWA 2Q2WA 2ONYA 2H51A 5FWNA 5LZ9A 1PG2A 3X3HA 3ZY2A 3ZHYA 1JW9B 1RFGE 2WICA 1B3RA 2XMBA 1UXGA 3BAZA 3KTDA 4GIBA 4M76B 4QDJA 5IBPA 3T4EA 1GRCA 1YQWA 2F9LA 2VJLA 2VYNA 3GLUA 3H16A 4Q1CA 1VE1A 3PJGA 4QOIA 4LTNA 4NZYA 1XV5A 1JKJB 3ECSA 2Y76A 3ES9A 3GVHA 4JEIA 1CZNA 4JIGA 2ZROA 1BDMA 2CJYA 3DBHA 3KLMX 3LQYA 4OB6A 5LM3A 2PUAA 3OX3A 3RROA 2C3PA 1QX3A 1DOZA 4GNRA 1ZPDA 3JXEA 4CM9A 1JJIA 5HFNA 4MCAA 4F3TA 1C9NA 2NSHA 1F5NA 3S99A 1E8MA 4LDPA 4PG8A 2ZYDA 1GARA 5KO2A 4RWEA 3E61A 1S9DA 1V7QA 2IHTA 4MUKA 4MQFB 3K05A 1C0IA 5L3ZA 2FCAA 3HBAA 3AW8A 2ODAA 5E6SB 2RIPA 1E1DA 3H5RA 3NDIA 5EIBC 3PEEA 1PT5A 3JWEA 1Y6QA 1XTZA 2Z8XA 4WY8A 5CCDA 3KKKA 2FE4A 2GFQA 2KW5A 2VTVA 1GEGA 4RE5A 1DDOA 2FCRA 3AR6A 5LD2C 3H17A 3PQ2A 3ZW7A 3R3WA 5T4FA 2WSMA 5IUKC 2ZCJA 4LZZA 2HU5A 2D4HA 2O0HA 3JYPA 1D9XA 3QQ5A 1C4OA 4S1WA 3UHOA 2EZ4A 2IPNA 1YQUA 1V96A 1T8UA 2DY1A 5AOBA 5A6SA 4QU0A 4TTSA 2AS0A 2E4ZA 5CLIA 3UJNA 2R68A 1DXYA 4UHKA 4G2TA 5LZ8A 2VRCA 3UJDA 5LZ4A 2RAFA 3CRZA 1NHGA 1JEYA 4MV6A 2R60A 2UUCB 4RKWA 1GFWA 3CF6R 1OFVA 3Q8KA 4DRZA 4UUQA 1P2TA 1X38A 2LWIA 4EJFA 2GYWA 3HWX1 4HDSB 4P0TA 1MIOA 4FMDF 2NUPA 2R86A 2JFXA 2ZIUB 4BNGA 3I9KA 5C5CA 1AZLA 5JAUA 3WAKA 4I1RA 5IKXA 2W2OA 1XKXA 2Q4TA 4C0QC 4BBZA 3VOTA 3OT1A 1DKNA 1T9CA 1W0JD 3C74A 3KKQA 1JE0A 1HL7A 2RG7A 2FPIA 1L7EA 1TUEA 2EOAA 3W6OA 1BNCA 5AVVA 2QZSA 4WCDA 3BCHA 3E2MA 5EIAA 1HORA 3ABQB 5EIFA 1GJRA 1MRZA 1Q92A 4KQGA 4BFXA 5MFZA 1RKXA 4FFVA 2COKA 2A67A 1A3CA 4RABA 3EW7A 1WPQA 1LTQA 3EC2A 4M1YA 4B3RB 1R4MB 1C81A 1CUEA 3O93A 4YDSA 2PGJA 4ZN6A 4RL4A 3WK6A 3L4BA 3NM5A 2PT7A 1YCGA 1CR1A 2OCKA 4FC7A 4BGVA 2H9IA 4B7UA 1I36A 2DFPA 1QC5A 5DN6D 5D01A 4B6GA 1WV1A 2JGEA 4RKRA 4YWHA 3RRNA 2BUAA 4KOAA 2XOEA 4EBBA 4QUKA 1Q21A 2P3QA 3BD9A 5HA5A 3ETGA 4FCWA 4Q21A 1EJ0A 2Q8NA 3C15C 3T7SA 3FDFA 1QU2A 4CIDA 4X93A 2AG6A 3IB3A 2ZI9A 4JI3B 4ZMSA 1URPA 4RA6B 4JU8A 2XE7A 4XI9A 3AETB 4PAWA 3DBRA 1NW8A 1J8VA 1QQ5A 2ZBPA 3IGFA 1T25A 1J23A 2FFBA 1M2FA 1TM2A 1ENOA 3HU1A 2ZB2A 4Y2RA 4ZCMA 2QN9A 5LNK1 3MHTA 1R6XA 2VHWA 2BR3A 3MPOA 3LY8A 4ISCA 1REQB 3ZQKA 5AKLA 4OHOA 2P9TA 1P72A 3FOZA 4Z86A 1BWQA 3C1OA 6ADHA 5HF5A 1M34E 3COPA 4C0XA 2DC1A 5JCPA 3EFHA 4FCCA 4GLLA 3HYNA 4K3UA 2C78A 5SYNA 1LLFA 2CVZA 2ANBA 1LK0A 2J85A 2ZT5A 3AXTA 3DP7A 3EJWA 3QXJA 3K70D 4R2MA 2OC4A 4P84A 3WLAA 4D0RA 2C4UA 2D1SA 4S24A 5CM2Z 3GROA 4V2IA 5ALIA 5YASA 3U9LA 1R27A 2ESRA 1KYWA 2QTVB 1M0WA 3NBMA 3VZSA 4EGFA 1I7QB 3L04A 2PH5A 3L0YA 3G2MA 5CNJA 1AH2A 3THYA 2I91A 4CQJA 2C2KA 3GEBA 3SOPA 1LBEA 5EC8A 1GN8A 2XMCA 2X5OA 1G5FA 3REOA 2ZK7A 4BQPA 3H7IA 2YICA 1E1KA 4B0OA 3NRJA 3A05A 3I5MA 3TPCA 5ESDA 4GXRA 4ZC1A 3GW8A 1Y7LA 4YBZA 1PR5A 3EQZA 2ECOA 3WYNA 2GMWA 2I80A 3K1TA 5D5PA 3ANTA 2V1XA 1OA1A 4NAUA 4RANA 1KC3A 2E82A 2SHKA 5LLSA 5JI3E 3U4CA 4XVRA 3LDUA 4LYHA 1CU1A 1TCUA 1FDSA 3KYDB 4IQGA 5DYTA 4CLEA 4E4RA 2AR0A 4BTLA 3G79A 3NMUF 4URFA 4P92A 2V7QD 2V5UA 1ZICA 3D4BA 4HDSA 4F9GA 1W88B 3QG1A 3ROKA 4XVHA 1ILWA 2PCLA 4BMVA 4KKVA 3UMSA 3AOEA 2CLSA 2BFOA 3D0KA 1H6AA 2CEKA 5EWMB 3PXEA 2J9ZB 2NTYC 5GVSA 4D96A 2MMCA 4HJRA 4CV0A 3CR3C 3OLXA 4JWTA 1B3BA 1V3QE 3DWIA 1XEFA 2CLEB 2OZKA 3QLEA 2HHCA 2YV5A 2E0IA 1GPWB 3I09A 4ATNA 3EEQA 4IDOA 3VMMA 5C8VA 5KVAA 1XZDA 2G83A 5B3KA 2H63A 4X8MA 2HSWA 3EQ7A 5DOVA 3OF5A 2XHEA 4YQYA 4GM1A 1E89A 5KOJB 4MIKA 5KCMA 3RI3A 2Y0EA 3UPUA 4M7RA 2ODBA 3KLNA 4J94A 5LKAA 3MS4A 4A15A 1G7TA 4A16A 3DMTC 3E9ZA 2QUAA 1ESCA 1PR9A 1UKBA 2P91A 2ZAGA 3PNKA 2R85A 2YZGA 1PV1A 4HT3B 2QK4A 3AJ9A 3PIIA 1P1BA 2Q5FA 4BL5A 1Y1SA 1W1IA 2C2ZA 1NQTA 2FX5A 1KDYA 1X80B 1GLVA 4GPZA 2X5JO 3OZSA 2AXQA 2NYVA 4XGIA 1GPDG 1I2ZA 4GRAA 3MSCA 3I8XA 5EHGA 2FSUA 3SJCA 4GG1A 3ZU5A 4IIJF 1XWWA 2R97A 3KOXA 1QUEA 1U2SA 1P75A 1RPTA 3E5RA 2GK7A 4KXUA 4RX1A 4HV4A 1W2WB 4DG8A 2W6QA 1AV6A 1E1YA 1REQA 2FQQA 3G0HA 2VRBA 3LVFO 3QXGA 4J7CA 3IUEA 1ORTA 1S7GA 1UPFA 3SC6A 3X2FA 3USCS 2DE0X 4PZ0A 2R8RA 4C3ZA 2XY4A 2YKGA 1EBFA 1QGYA 5JJKA 2WM8A 1B23P 4Z99A 5HUHA 3NYWA 3OZEA 4JSTA 3TIXB 1KZ6A 4LPSA 3PQ6A 3NP7A 2HSJA 1MDFA 7REQA 2I6SA 3II6X 3D8UA 1XRQA 1R0RE 1U0HC 3PUZA 5EZ5A 4ZAGA 1PDVA 2CNKA 2QTVA 1JAYA 4O29A 4YPVA 2FUCA 5KMGA 4H27A 3B5JA 1BXKA 1N5OX 1N9GA 1YHZA 4OM8A 1ULSA 5AM4A 4U6NA 2YRWA 4ADSG 3QV2A 3S3TA 3IAUA 1ORWA 2ZJ1A 5F77A 1V5WA 5ER6A 2GKSA 3DB2A 3ZGXA 3ED1A 1OQAA 4RZ3A 2ZYGA 5H68A 4EFMA 2YWGA 4K1LA 2C3MA 3W8EA 4M36A 4XW2A 5LCXA 4I8IA 5A3SA 3ENVA 2A94A 4JA2A 1O97C 2E5FA 1M67A 1WZNA 4TTVA 2GD2A 3N2GA 2GN4A 3FBWA 1Z39A 4AJLA 5J3JA 1EFAA 2YJGA 2ZSEA 3I73A 3DF9A 1SUWA 5HRCA 3FW1A 2W8BB 4AJHA 5BYBA 4RHEA 1F12A 1AZTA 4KDRA 1A7KA 3EGWA 3IBFA 1FMLA 5G0SA 4IHQA 2WU8A 1USIA 1F2TB 1UR5A 5FHRA 4NSNA 3AZOA 3SSNA 3EAGA 3KYDA 5BWNA 3N8NA 4MUAA 4WOBA 3IVAA 4DDKA 1J8QA 5D51S 3C1UA 3SEAA 3WFIA 3L79A 1W88A 2V3CC 2PS9A 2LCQA 4GSYA 4BNZA 4QOEA 4U7PB 2FN8A 5D87A 2ATEA 2ZJ0A 3L77A 3TXXA 3EZFA 2FXIA 2N75A 4WSOA 1CHNA 2GAFA 4QUJA 2QN6A 4YJKA 1D0SA 3FIJA 5EWMA 1JZTA 1A9YA 1IB0A 4AP6A 4CKBB 5EGSA 1P2SA 5ADWA 2JGRA 1JKXA 3DXYA 2XQJA 3VHRA 3PWSA 4DABA 1O03A 2JGAA 2Q3MA 2QN8A 1UBOS 1SR8A 1J5EB 1W36B 1XF1A 4FT2A 1X7WB 2QUBA 1Z12A 1SUPA 2ODEA 2OCLA 1GNLA 5B53A 3BYZA 4LS3A 1UP4A 1XO1A 1EBUA 2DBRA 2HPAA 2WJ3A 3DM9B 4XEHA 1XKLA 3FPAA 3CF0A 2OVBA 3DHYA 4KZKA 2CB0A 4LHXA 3AJDA 1XXLA 2WKSA 3BXHA 4IIEA 1R0XA 1H2EA 2FTKE 1E0DA 2Y0BA 4HXEB 3V1YA 4LTMA 4GZ3A 2PNJA 4D4MA 2G72A 2JFUA 2WZDA 3A1NA 3DXXA 3O3OB 5F4ZA 1NVAA 5EZ6B 1KVTA 1B42A 2A9JA 4EMTA 3K20A 2E2WA 3EVFA 1G5PA 4OYYA 5FPTA 1G9SA 3KTAB 4F4UA 4N76A 2QYHA 1W73A 4UUNA 5SY9A 2HK8A 4UAVA 4FBLA 1ZK2A 3ZI4A 2WRZA 3VPDA 2GXQA 3PXAA 1I0IA 1RM0A 5H5JA 2G7ZA 3DMDA 3IPXA 3MCTA 1LLQA 4G65A 4GKBA 1FU4A 2WSLA 1BW9A 4C6HA 1G6HA 2JGFA 3V7WA 1S2IA 4G9GA 2D1YA 3DAGA 3PZRA 2WWYA 1WB9A 3Q3GE 2L17A 4OVKA 5ED0A 5DXFA 1F9EA 5AJVB 2Y6UA 3A6DA 3WKDA 3BEDA 1Z18A 3NW9A 3QI2A 2QX9A 2R6ZA 1WDKA 5HEKA 1JAIA 2ISCA 3O03A 4EHJA 4BMXA 5WRFA 1B8OA 3ENQA 4W6ZA 1U3CA 3USZA 3DOIA 4ZCRA 3EA0A 3LXXA 2BZSA 3AFOA 1ZUHA 3KZOA 4PYRA 4ZAFA 2HQSA 4Z0PA 4A2CA 5K8LA 5KYTA 1NM5A 1OJLA 1T2VA 3OWOA 3N3BC 4JLOA 1PFYA 2PAAA 1HY3A 3IE0A 1GQRA 3MD0A 1ESEA 1B1AA 1N7HA 2P3LA 3IBTA 3W9SA 4BX0A 3P4YA 4N5IX 1F8UA 1MX1A 4U0KA 2AN3A 3ZWKA 1U3UA 3SQMA 1L4FA 2D3WA 3C4VA 5ALNA 1WRBA 3F6EX 3IKLA 4N82A 3UUEA 4JV5B 5KC8A 4TWAA 2FHSA 3RKSA 4NMMA 3EDRA 3LUBA 5FPQA 5CX1B 1JPNA 1SIBE 1JDSA 3CXRA 4AK9A 1JAHA 2ZCUA 5E0KB 3PEYA 1ZU5A 4EA9A 1WXDA 5ERYA 4B3IA 1LPOA 4AFNA 4W63A 2G09A 4IWXA 4M7PA 3GPLA 2C7VA 4L0MA 1JXAA 3ORRA 3P4XA 1A9SA 2J08A 2B61A 4EY7A 1HEUA 3LQRA 1R64A 2ORYA 4CUJA 3GBVA 3N07A 3B52X 4MQ5A 2IZ0A 2C77A 4IMPA 1F2TA 2B0CA 2HV8A 2O0JA 3CFYA 2WF8A 4LGVA 4ND4A 5JDIC 1CULC 1HI9A 2D59A 2OBLA 3LBYA