3HL4A

Crystal structure of a mammalian ctp:phosphocholine cytidylyltransferase with cdp-choline
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
176
structure length
176
Chain Sequence
GLRQPAPFSDEIEVDFSKPYVRVTMEEACRGTPCERPVRVYADGIFDLFHSGHARALMQAKNLFPNTYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGISTSDIITRIVRDYDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Choline-phosphate cytidylyltransferase A
publication title Crystal Structure of a mammalian CTP: Phosphocholine cytidylyltransferase catalytic domain reveals novel active site residues within a highly conserved nucleotidyl-transferase fold
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 51
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature ec 2.7.7.15: Choline-phosphate cytidylyltransferase.
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3hl4A00
5KWVA 4YP7A 2DR2A 1VL2A 3QTTA 5IJXA 3RK1A 1Q19A 4ZCSA 1JMVA 4MWDA 3ND6A 1NURA 4EGAA 2AZXA 1O94D 3N2YA 1EE1A 1N2JA 4DLPA 2BYTA 3FETA 4QBTA 2YWCA 3FG9A 4MVXA 4DDHA 4AS1A 2X1MA 1O0BA 4K0RA 2H29A 3AIIA 1Y42X 3CR8A 4PBSA 2V0GA 1CT9A 1K92A 4TS1A 2I1LA 5LM3A 3L93A 3PRHA 2CV1A 3ILVA 1O0CA 4MVCA 1Q15A 3IOCA 4EF6A 2WQ7A 2EJCA 2JAXA 4AQ7A 3D6VA 1F9AA 2A88A 5J5AA 2E0IA 4KR9A 1GN8A 3COYA 5EKDA 4CDNA 3AG6A 1MC1A 4MVWA 3ZJTA 1YUNA 1M8KA 2YXNA 1UFVA 4MUJA 1N77A 3H97A 1N1DA 1IQUA 3A05A 5JBNA 3MLBA 3FI0A 5TS2A 2IP1A 2XRZA 1K97A 1NUPA 2A1TS 1PFUA 4YP6A 3K9WA 4KR6A 4NATA 3KT3A 4X0EA 3CLRC 3FWKA 2QJFA 5HUJA 2QTNA 4ZT6A 1WQ3A 2Z08A 3VRHA 4F3RA 3MLAA 4XFDA 5TEWA 1JHDA 1YI8A 3CLTC 2GOYA 1YUMA 3H99A 3H05A 1JECA 3VGJA 4MUKA 5TGTA 2HMAA 1N2OA 1WKBA 3CLRD 3SEZA 3ND5A 3PNBA 1G8HA 1KH2A 2PZAA 1XNGA 1N75A 1JZQA 4MUEA 2QUJA 3CLTD 2YWBA 2HZ7A 2V0CA 1GTRA 1M8PA 1KQPA 4UZEA 1NUQA 3E27A 1YULA 3HFJA 1WXGA 3MUEA 2IJGX 2C5SA 4RPIA 5KHAA 1NP7A 3C8ZA 5KCMA 4HJRA 3TZLA 3ZJUA 1O96A 4I6EA 4WNYA 1COZA 3IODA 1U3CA 1OBCA 4DDMA 2DETA 3QTBA 4CT0A 4MUNA 4G5YA 4ZT2A 3L92A 1Q11A 4DJAA 3K32A 4XFJA 1MB2A 3NV7A 4MW4A 1N2IA 1TYBE 4RUKA 1M8GA 4MW6A 2XRYA 1Q77A 4OUDB 1J70A 4ND7A 1T6XA 4DNXA 5FNZA 3S3TA 4ZT4A 4MW9A 1V8FA 1QRUA 4I6GA 1EUQA 2VTBA 4MW0A 4K03A 1WXEA 2EL7A 2WB2A 4JXZA 2CV0A 3P0HA 1KKUA 1KP3A 1EFPA 1TYAE 1U7XA 2QJOA 1I6LA 2J07A 1N2BA 2PFSA 3UMVA 1TFUA 1I6MA 4ZCTA 4ZCQA 1TYCA 4EG1A 2X0KA 3IVGA 1VLHA 1M83A 5DEOA 1FYDA 1P7PA 1X8XA 4FZJA 4Q16A 3SZ3A 3TZEA 1H3NA 1EFVB 4E1AA 4UZFA 1GLNA 2X3FA 4R2MA 1T6YA 1K4MA 3DV2A 3IUBA 3N8HA 4QRDA 3I05A 4MULA 4ARCA 3PNVA 1I2DA 2DUMA 1U7DA 2A1UB 4MUGA 1KH1A 3DLAA 1F7VA 3G6KA 4PY2A 4L2IB 4YMIA 1MJHA 1H1TA 3TS1A 3AL0C 2JA2A 4NAHA 2QUKA 3RBAA 3H9BA 2E21A 1T9GS 4DDKA 5H16A 2CYAA 3IMCA 1D2RA 4F4HA 3UY4A 3DPIA 3TNJA 4MVYA 1EUYA 3ZJVA 2GM3A 3SDBA 3QE4A 2QJTA 2PZ8A 1VBMA 3PNYA 1MOPA 2X1LA 3FIUA 1QU3A 1U3DA 1J20A 4MUIA 4MUFA 3NBKA 2E89A 4U63A 3X1MA 4A91A 2DPLA 1OWNA 2DEUA 1MB9A 1MRZA 3M5WA 4OJMX 1LI7A 3U1VA 1DNPA 4QREA 2PG3A 1KH3A 1J09A 2CT8A 1WOYA 1VBNA 3OTWA 2BTEA 2JANA 1M1ZA 3DO8A 3X1KA 4Q93A 4KPUB 2QUIA 4HJXA 5J59A 1MAWA 3G5AA 4MW7A 3OP1A 4U8HA 2CV2A 3ZXSA 3ZIUA 5K0TA 2CYCA 2YY5A 3KT8A 3ND7A 3INNA 1PFWA 1WJGA 3CVYA 1NUUA 1N3LA 3IOBA 2PXHA 4HK4A 3LOQA 1G8FA 3FH0A 4J76A 1LW7A 2J5BA 2AKEA 4MWCA 5DK4A 1M8JA 2OV4A 1T9GR 2A1TR 2RE8A 4EFKA 4MUHA 4GU5A 4G5FA 2RD2A 1MAUA 1IFXA 5HG0A 1RQGA 3UOWA 1JIIA 1JEDA 4ZCPA 4EG6A 5K0SA 1ZJWA 3P52A 4MAFA 1I6KA 1PFVA 3PXUA 1TEZA 3TQOA 4EG8A 4WSOA 5FO1A 5DB4A 4MW1A 3KT0A 4CQNA 1ULHA 3FDXA 4MLPA 5H7XA 3AKZA 2NSYA 3D6UA 4ZT3A 1S4MA 1SURA 2PZBA 1O97C 1JIKA 3H9CA 2O8VA 2DERA 4YBRA 3LE8A 2HGZA 4OUDA 2NZ2A 2OQ2A 4P2BA 4U7JA 5F23A 4JXXA 1N2GA 4H3SA 1A8HA 3KT6A 2TS1A 3IOEA 1J1ZA 2D54A 1QNFA 2D5BA 2AG6A 2ZP1A 1V47A 4KKVA 2B7LA 1VBKA 1O97D 1R6TA 3FOCA 5TEVA 4EG5A 4G6ZA 1NI5A 4KR7A 3IMEA 2Z09A 1QU2A 1R6UA 2VXOA 3P0JA 3ELBA 1KP2A 3F3MA 1N78A 3N9IA 1OBHA 1K4KA 4MW5A 3IUEA 1ZH6A 4JZYA 1WZ2A 1YIDA 1G59A 1KR2A 3IVXA 2CSXA 5AHWA 1TYDE 1OD6A 1EXDA 3ZGZA 1EFVA 4NX2A 1O95C 3IVCA 2Z3VA 3N05A 4PBTA 1XNJA 3CVVA 1J21A 5LLTA 1OWLA 1NUTA 5IHXA 3ISJA 1WY5A 2A1UA 1NUSA 1LI5A 3COWA 2J4DA 3MXTA 1R6XA 3ZUGA 2CFOA 3HZRA 3X1JA 2D13A 2QTRA 4ZT5A 4NAUA 4L2IA 1PG0A 1O95D 2J08A 2IELA 1HYBA 1OWPA 3ZXIA 1QQTA 3FNRA 4NZPA 2A4MA 5FO0A 4MQ6A 1IRXA 4NDAA 3HL4A 1ZH0A 1JGTA 2CYBA 5DASA 3IDFA 3SP1A 1H3FA 1KAMA 3CLSC 3AG5A 4JFAA 2CUZA 1WQ4A 1KAQA 1T6ZA 4EG4A 2ZUFA 1QRTA 3TQIA 3CVXA 1EJ2A 1KORA 1JZSA 3GUZA 3LCJA 4DE5A 1QRSA 1KQOA 2ZUEA 1M8FA 1OWOA 1XNHA 4CDMA 4MW2A 2A84A 2H2AA 3GLVA 1B6TA 1X6VA 5J58A 1ILEA 3SZGA 1WXIA 3CLSD 4ND6A 1J1UA 1O5TA 1OWMA 4ZCRA 3RFFA 4KPUA 1NYLA 1PG2A 1GPMA 1IHOA 1BS2A 4S1OA 1GZUA 4BWVA 3NBAA 2DLCX 2WSIA 1ZUNA 3HGMA 2GKSA 2PIDA 4PBRA 3HV0A 3MMXA 4GRIA 1QTQA 1O96B 3IMGA 3Q12A 1MBZA 1XJQA 4YP5A 1NSYA 5HUHA 4JYZA 3RHSA 1F4LA 3G59A 1O6BA 3FHJA 3CA8A 2O5RA 3COZA 1WXHA 2DXIA 1U0BB 3JXEA 3GMIA 1KQNA 4ARIA 4EG7A 1FFYA 3RJZA 1WXFA 3HMQA 1F7UA 3IH5A 3COVA 4I6JA 1IVSA 1GAXA 2E18A 3A04A 2QUHA 4J75A 3CLUC 4EG3A 3A4IA 1QJCA 1JILA 2J09A 3AFHA 1JIJA 3Q4GA 4XSVA 1N2EA 1GTSA 2VTBB 5LFAA 3Q10A 2A7XA 4HPWA 1YIAA 3CVUA 3BL5A 3SYTA 4ZT7A 1N2HA 4MWEA 1EFPB 2R5WA 3CLUD 2QTMA 3UC5A 1H3EA 3UK2A 3SEQA 3VU8A 3KFLA 1IQ0A 1G8GA 3CVWA 1O94C 1IH8A 3P0IA 1PFYA 3RK0A 1TQ8A 4MWBA 1NZJA 1JEEA 3FY4A 3A2KA 1IQRA 2G36A 4R2LA 2WQ6A 5BNZA 2A86A 4R0NA
chains in the Genus database with same CATH superfamily
2CBGA 1FX0A 4IINA 4RL4A 4QYXA 1J8VA 2N46A 1C9MA 2GVNA 2LIVA 3EAQA 3D64A 4MWDA 2ZRKA 2UUAB 5DJ5A 2Y1CA 3OA0A 4AKEA 2QU8A 3W3ZB 3FFXA 3IIMA 4ZGGA 4AC9A 5JZMA 1LF5A 4C20A 2PMCA 2GPYA 4IV5A 2F9MA 2GN4A 1WOMA 1LK0A 3RASA 2WICA 2C8LA 3KJIA 4DLNA 1MA0A 3FKJA 3UUWA 1FW8A 4OK5A 1KY5A 2NP7A 1OLUA 1K66A 5J5VA 4QUGA 5IUNC 1L4NA 1OYWA 2W2QA 1TADA 2HL6A 3G8YA 3I8OA 4DADA 3DJYA 2CJWB 2FWPA 3OM0A 4Q3BA 3RIMA 5HJ7A 3Q0IA 4OLHA 2AZ4A 1AGYA 1GFSA 2ODAA 1Z26A 1KRWA 3DFMA 1KBQA 5E6UA 3H4VA 3UM9A 3LLMA 1EK5A 3RKUA 2A9KA 3TOSA 5LQJA 3N7TA 3FPSA 4YYEA 2ZBUA 2EKDA 4REQA 1XTSA 3AU8A 1VRVA 3AG6A 3KB1A 4O2RA 1IEQA 5AH0A 4AUNA 4BNTA 2V55B 3EOBI 4N3AA 3NOQA 3BIJA 4LJ5A 3ZLVA 4HV4A 1Z5OA 2PUCA 3KVVA 2C0CA 1IQUA 4MMYB 1NXQA 3DYBA 3BGWA 4WOJA 1E79A 4YFVA 2QZJA 4Y2QA 4PHTA 1EUCA 3IUPA 4KWEA 5CIYA 1Y7HA 4KR6A 1QE3A 2CSUA 2XNSA 4KMRA 1YQEA 5LKRA 4BVLA 4XFKA 3RWBA 1WXDA 1QIJA 2I4NA 2KQUA 3CX6A 2F55A 4CKWA 3SBEA 1WQ3A 2DB3A 1GRNA 3MINB 4XE5A 4NBRA 2BMFA 1XXHB 4BFUA 5JG7A 2P9BA 2ORED 1N2ZA 2BY4A 1NPDA 2XB9A 3AKDA 4FYHA 4HDNB 3LQYA 1E0DA 3MWGA 3OOYA 5CYPA 5FBKA 4EHIA 3EDRA 3SLRA 3V6MA 1ZMXA 4C21A 1RD4A 4L8GA 2ACVA 3AX6A 4EKNB 2VLBA 3PQFA 1ZIYA 2P9YA 1W76A 3M9LA 3AUSA 5M2QA 4AQYB 3KJFA 3IVAA 4JSRA 3SEZA 3ND5A 3IBTA 1EXMA 4FYVA 4YTEA 1R6BX 4OHOA 1GUAA 1AS0A 4CUZA 4TTTS 3THYB 1RTTA 3T5CA 3AM1A 3VI3B 2LV8A 2PPVA 2A9RA 2RHGB 2V0CA 2A3RA 1C2YA 2IUEA 3LT5A 3X44A 2PAFA 1IJKA 1I9GA 4U9HS 3S81A 3F6SA 5BSRA 5FR2A 1JJ7A 2H9IA 4QPCA 1ABEA 1ZX1A 3OF2A 2R6GA 1QOPB 4RV5A 1CP2A 2O8FA 1ISJA 3FYHA 4URHA 3NJ4A 2GD0A 3RU3A 3WOVA 4RCYA 2QMOA 5CLLA 4NSNA 2J0SA 2ZETA 5KVQA 1UH5A 1VGVA 3EDMA 4H0FA 4UUAA 1NOKA 2Q6KA 4KV7A 5ALRA 3ILSA 5JYCA 2IGBA 3FE2A 2I2CA 2MTBA 3A2LA 1SFRA 3F1KA 1CUWA 5BSVA 2QZ9A 2C82A 2H1WA 1SRRA 1UDAA 1R6VA 1FDVA 2WIGA 4L5YA 5FH9A 4DCCA 1R8YA 4OLFA 4Q05A 3PWZA 4S1NA 1R4MA 2M2IA 5AHRA 3N76A 1SBIA 1Q11A 1ULZA 2H1VA 1OZFA 4HGRA 1CUYA 4Q9DA 3VU0A 3VYSB 4D02A 3RFTA 3LDHA 5BR7A 3TEFA 1QMGA 2ZWOA 3AI7A 5KNBA 3ITKA 1N6IA 3H2HA 1QO7A 4MGKR 3UT0A 4HDSB 4O02B 4CQJA 1NIPA 1SPXA 2R3SA 4A0QA 3ZNOA 3SZLA 2AMYA 3D4BA 3ES9A 4NE7A 1XJ5A 7GPBA 2YN2A 3SIWA 1T1IA 2FN9A 4L9RA 1KZ4A 1XALA 1YFKA 3KVRA 3OKFA 1FDRA 4BNWA 5A4IS 1IQPA 1PTJA 2JFYA 2G1JA 4REOA 5GAJA 2R96A 4FKBA 3VSEA 1V8FA 4KDCA 2DTEA 4E6PA 1AQYA 1Z37A 2PWZA 3RM3A 4CLRB 1TE2A 2POCA 3U5ZB 4MKFA 4FX5A 1CFJA 4TL9A 1AQIA 3ZV6A 1F3OA 1EFPA 1LBTA 1TYAE 2QJOA 5H4HA 4TQGA 2D0IA 2QW8A 3W1VA 5T57A 2Q3FA 3BWXA 1OIXA 1QNLA 2I2WA 3F97A 2PBZA 2NO4A 3HSSA 3DZGA 1WW2A 4C6HA 3T7DA 3OT5A 1EGAA 1T36A 3LA6A 5KOJA 2IUYA 5KSWB 1LK5A 1H6AA 2ILVA 1MT3A 2F1HA 1DHRA 3FFWA 1C3OA 4J3FA 4LI0A 4OHRA 5DEOA 2JJQA 1FYDA 2Y1FA 1RZ3A 4FDAA 5JNLA 4BCCA 1YZQA 2C7GA 1VPEA 1TO1E 2NTVA 3IEKA 2PTGA 3S27A 5BW6B 3CGWA 2AN9A 4LXHA 4JHLA 1KI9A 3V34A 4A26A 5JNUA 3R40A 1JDTA 5AJHA 3PGKA 4ZU3A 3PJEA 2GN8A 4YP9A 4EYSA 1ZMRA 3SJUA 1U1DA 4R2WA 3ZHTA 1T6YA 2B34A 2CNBA 5JEDA 1J0EA 5FB3A 3PNVA 2TSYB 1BS1A 1UT8A 2XMPA 2XRMA 4P3PA 1U28C 1ECJA 3UBMA 4ZEMA 5I45A 5E7QA 3OPYB 1AUPA 2R47A 2GCOB 2XE7A 2ZVPX 4LNUA 4E0BA 4D3DA 2WB4A 1Y6ZA 3ZDAA 2DOKA 1RHUA 3V1NA 2H0QA 3DLAA 2WTXA 4QD3A 2WD7A 2XYGA 3IT2A 3K09A 3TNDA 2K6GA 3IRUA 1E5DA 5EWLB 3TPCA 1JMKC 1CR4A 3PF8A 3EZ9A 4MCAA 1YO6A 3V4OA 1SG9A 3L4KA 3FPKA 3ST7A 1CP3A 2CUNA 3SFTA 5IMSA 1Q1AA 2HF7A 4YO7A 2H8GA 1SVMA 2PUTA 4W7SA 5ENZA 3ESQA 3IEVA 2HFKA 3RC1A 1NKSA 2FR1A 4TL7A 1ZWKA 4JYPA 4QA9A 4XKJA 3W6ZA 1GYQA 2OCDA 2QX9A 1XMXA 5IAEA 2OENG 521PA 1JDZA 3ROPA 4EY6A 4LI3X 3T3EA 4GM4A 4E3ZA 2WYWA 1NM5A 2HLHA 4DCNA 3NQ41 1WBBA 3L0CA 1JHXA 2B8WA 2XNCA 4Y2YA 5ALLA 4CM4B 1TK2A 4DLRA 3M3DA 3MJDA 2DPLA 4O25A 1RRCA 3F5QA 3BMXA 1JR3E 3H4IA 2B8NA 3HDVA 2ACEA 3F6BX 5D01A 1G3UA 3W8FA 1X39A 3H3FA 3Q3JB 4Y9RA 1AGXA 1ZQ1A 3GB9A 3U4GA 3SWWA 1KYIA 4TV8F 3L18A 2YICA 2VHQA 3LHIA 4GXNA 3T3OA 2QM7A 3ROMA 1REQB 4KN9S 1UPFA 3T7SA 1Y5NA 4R3UC 2QRPA 1LI4A 2FWNA 3RVSA 2Q45A 2FW0A 4O1IA 4PLCA 3ZCVA 3G5AA 3LT0A 3OOJA 1RPJA 1L2TA 4TSKA 1P1IA 4Q02A 3ZIUA 4BXOB 1D03A 2IU6A 3PXEA 2YY5A 5CGQB 2O0LA 3C7AA 3DV0B 4DMRA 3RYTC 2YBDA 1JFLA 2O7NA 2DT5A 1B74A 1GPBA 3C48A 4JUDX 4QQNA 4ESOA 2EVWX 3H4TA 3C4JA 4AECA 2C57A 4BX2A 1EDBA 2BT4A 1JKXA 3IGFA 4I4IA 4W99A 5A5EA 1GU1A 7MHTA 2WEKA 4A15A 5DULA 1L5LA 1TLTA 1QC5B 4D4HA 4FBGA 4O0MA 1CSEE 2A59A 3AEQA 2HU5A 4WUTA 3BMNB 5AYVA 3JQ8B 3KSUA 4CT5A 1L7AA 3IP7A 1C30A 1RQGA 1IY8A 1J0XO 1XUOA 5AI6A 1JEDA 2E55A 5K4AA 1I1OA 3IO3A 3GEIA 3ZXXA 3B6EA 3NTQA 3BMOB 3GRPA 3B1YA 3E1SA 3I52A 3L8DA 4IHQA 3M2PA 5AJTA 4ARZA 3ZCSA 4CI9A 2FEKA 5K3OA 1H94A 4HXFB 1Q7GA 3DUFA 4K6OA 4G5XA 4XA8A 1J0BA 2AK2A 2AMFA 3OZCA 4G41A 1ZD4A 4RY2A 2A4KA 2RE8A 2FWAA 2ZQZA 4GBMA 1GNRA 3H1PA 3NCTA 1O2DA 3O9ZA 1T5SA 1FEZA 3GH1A 1FYXA 5K8TA 1JVNA 3QOWA 2ZDQA 3HDQA 2NGRA 3NBZC 3V4ZA 3WFJA 4YBRA 5DW3A 1EBUA 3T9AA 4HTFA 4OUDA 4EKYA 2BHRA 3AR8A 3EAFA 4UMEA 4E88A 5JAOA 2BD0A 1VCIA 1YRYE 1DEAA 1LX7A 2AFIE 4MKIA 4X92A 5AUQA 4K9DA 1AMOA 1HX7A 3SDSA 1N2GA 3PXBA 2P40A 2PGLA 3DMYA 2O19A 4H9GA 4L02A 3VC3A 4G1CA 1HXHA 4DMUB 2YJGA 4C2BA 2B7LA 2PXAA 3NZEA 1P5ZB 3PTZA 4WDQA 3PNQA 1I6WA 5IEJA 5REQA 3O93A 2QTLA 1KEEB 3RTGA 5H9WA 1UOPA 3CNLA 3HI4A 1CRWG 1YR8A 1ODFA 1FFWA 3HA7A 3IR5A 3QLTA 4QULA 5H3LA 3DKIA 3TSCA 4JN6B 4XUEA 2VUHB 3EA4A 1BOOA 1C7RA 4L5AA 2Z5LA 4NZZA 3RHZA 2Q2WA 4F1KA 4F6CA 1W29A 4K86A 4WZ6A 3MF4A 2HF2A 2WWHA 1KYYA 1HGXA 4TWZA 2OK7A 1CJVC 5TY0A 3T5BA 3WMRA 3SKYA 3D43A 1SH7A 2OXIA 4DTIA 2NO0A 1PLKA 4GKBA 2IIPA 5D2CA 2C07A 2B0CA 4REMA 2QLFA 3MT7A 1BDJA 2UVPB 1SOUA 2D0OB 3H3JA 1RQ7A 3KQMA 3B3FA 4J0JA 1ZMTA 2C31A 4CVNA 4RKWA 5HQ3A 1Y9AA 5LWQA 2NTEA 5E4FA 5KYXB 1QSGA 5AI5A 3JQBC 2Q8PA 2H57A 5IM5A 3QEJA 4GUAA 1LSOA 2OFWA 4GI3A 1B1AA 2ECOA 2EKLA 1Z3CA 5JWHA 3G0BA 5A7FA 4OBXA 1FNMA 4G85A 4G9GA 5TPWA 2REQB 5F73A 4GR4A 1O94A 1NNLA 1GRRA 2V7BA 4L8FA 3DZHA 4MRMB 1XAGA 4KQWA 4OXIA 4D4MA 4TKUA 2R6FA 3WLOA 4UHCA 4AG5A 1E69A 1ZUIA 3BD9A 2VPIA 3CXRA 4D45A 2CN1A 4LZPA 1EMDA 1I9CA 2HQ1A 4YK7A 2CF5A 2Z9DA 1DE0A 2PL9A 5H9VA 3DF9A 1IRXA 2LNDA 3B1ZA 3KKOA 3ZE8A 4OBWA 1E0SA 1XD2A 2HWKA 4IDBA 5DRTA 3QF4B 2Y0BA 1LQUA 1Z4QA 2UZAA 1F0NA 1V3QE 3ENKA 3LUDA 4X00A 5T41A 3CSDA 2CY0A 4MICA 3TZBA 5DI3A 3O0DA 4JD5A 4JIMA 4ASUD 2ZUFA 3W8DA 3WJ1A 1B8UA 1QIFA 1OXVA 1X1SA 1LC3A 4C04A 1NZDA 1OGJA 1ODIA 1TCBA 2SKCA 2YVAA 5LN1A 2R8BA 4FYWA 2C0QA 3RTAA 1MN6A 2Q1XA 1LNSA 1Q0LA 1XZEA 3RAPR 1J23A 1RYEA 5D7NA 4EEXA 1E9SA 2EATA 5CVTA 5CTJA 1AJEA 4PQEA 5CP8A 1DJMA 1W30A 4GLLA 2VSXA 1R4ZA 4AU1A 1GUDA 1GUZA 1JHZA 1O5TA 4LV5B 2VQDA 3UQZA 3HYSA 4A0HA 4MLDA 3LI2A 3DWEX 1VLMA 2B61A 1JP7A 2HHJA 3OE4A 1GZUA 2XF8A 3QFHA 3VJKA 1RXIA 1MNQA 2WHQA 1K2VN 1IBRA 3FNFA 5F51A 4R05A 3QQ5A 1ZHHA 4PBRA 1NSFA 1S9HA 2P9CA 5EUMA 4CIDA 1DBWA 1VE6A 4RPGA 4PF1A 1VI6A 3DL4A 1RIFA 2HIGA 5H68A 4MNTA 4ER6A 1JH9A 5TB5A 4AL4A 2Y2UA 3VPXA 4PAQA 4D1YA 4B83A 4MA4A 3R24A 3OETA 1PJLA 4U7DA 4ZICA 3KJZA 1MU0A 4BUJA 2IY8A 3FTQA 4ARIA 4Q9KA 4UNQA 3RJZA 5F1PA 4FDTA 2NM0A 2IV7A 2HF9A 3RS7A 3BEDA 3HC7A 2I22A 3A04A 5K6TA 2XOXA 2DH6A 3CLKA 2PZFA 3HR4A 3MWEA 1TXGA 3BGSA 3N0XA 2AB0A 4GQIA 1CE8A 4Q7LA 2FKAA 1Z36A 2VK8A 1N6LA 4EARA 3QF7A 4EQ6B 3Q8LA 3SGLA 2AC2A 1LVUA 4X97A 4XWGA 2QHXA 1KJZA 3GGJA 3VI4B 4FT4A 4MDEA 2PBFA 1JIJA 4GZLA 1DFIA 5C1IA 1E6EA 5IKOA 3TUIC 4CQMD 4W8OA 1I2BA 3GNTA 3GRKA 2OZVA 1HLPA 1P7CA 3EZLA 1RPZA 3MCVA 2I6QA 2JKVA 3CLUD 1CS0B 1YF3A 2QTMA 4S1WA 3TZHA 4FHDA 3UK2A 3VV3A 3FWNA 1WUKS 4CLHA 4YV1A 5GINE 2VUIB 2O0MA 1H4SA 1HTTA 2E4XA 3DMTC 2IU0A 4FBMA 4K1LA 1WHSA 3AXTA 3U19A 1CQZA 3HJCA 2WQ6A 3F46A 4XQ9A 2M6KA 3I5XA 3TUZC 2GRJA 3QXSA 1C2TA 3EZ2A 4AN0A 4HZUA 1CRQA 4MV3A 4QVIA 5G0WA 3PA8A 1TU3A 1A8UA 1ZC3A 4U7WA 2QDXA 1MQ9A 1PKEA 2C0PA 2HHAA 4K9RA 2ZRHA 5EXPA 2P0EA 3LUPA 1ZM9A 3SFVA 4FBLA 2R1ZA 2HRBA 2VTVA 3TRFA 3EDCA 4Z7JA 5IFLA 2I2FA 3P0EA 4N5HX 3U7JA 1SXIA 1YRWA 4UTOA 4W6ZA 4ZZ2A 5LP6A 2CMDA 1WDKA 4PBSA 4NMHA 2F3TA 1CT9A 3CISA 4Z3KA 1Z5GA 3PWTA 3KLBA 4IFIA 1VI2A 1A9OA 2VQSA 4OXQA 1ZK0A 2FZLA 4PYNA 5DLYA 3T61A 1O0CA 2YWGA 3JQFA 3K73O 3UMMA 3UQYS 3IQXA 1W5FA 4G89A 2BI7A 4NV3A 1EHIA 2OC9A 2XTJA 2X9NA 3OCJA 1CZKA 3CW8X 2Y1OA 1FDIA 2CW5A 4WXRA 5ESWA 2ATCA 2P5UA 2ZUVA 1LDNA 1RABA 5KOHA 1BX3A 4GD3Q 4MVWA 2DCMA 3W8RA 4LF8B 2QLBA 3BWMA 4Q15A 4XARA 5B53A 1CDEA 1W5BA 4ZVQA 1Y48E 1A4XA 3VPAA 2CEKA 3LT4A 5ADUS 3BCUA 1JAYA 3SJBA 3A05A 1HZZA 2Y1LA 3VPHA 1T4DA 2QENA 2J3JA 4ZJPA 1BU8A 2Q4BA 4ZP1A 4CUJA 2XRZA 3E82A 5AM4A 3HB9A 5HCNA 2X0FA 3OQNA 2VNHA 2NNWB 3IQHX 5E7JA 1C1DA 3I39X 3PNKA 4MCHA 2HT1A 1EGQA 2YIMA 4RESA 1Y8CA 2DHDA 3ACDA 3FWKA 1WUIS 3N2EA 4L76A 3ZDFA 5L9AA 5C35A 3NBUA 5FOXA 1I51A 3KE8A 1TM5E 3KWMA 1HQDA 4PC3A 3UGQA 4S3MA 5ITZB 2FFRA 3FSGD 1N4AA 1XQ1A 2FEMA 3UYLA 1YI8A 1CR1A 3NT5A 2F9FA 4F85A 2GSWA 2PJUA 3MQ2A 3NWJA 5HJ5A 1O54A 2IQIA 4YCNA 5I9SA 1YBHA 1PFQA 3WIBA 4DLSA 5EGNA 5I7AA 3HFGA 2OCYC 4RAOA 1JR3D 4JX8A 2ILTA 3MGKA 4TTRA 3IUSA 1ND5A 3PNBA 1LQTA 1GZ6A 1C7QA 4MV8A 1EAMA 1UWCA 2X0NA 3LX6A 3QENA 1LS1A 3KHKA 3BJMA 3OU2A 3PQ5A 5EPOA 5M34A 2HU2A 4RULA 5COQA 4A6EA 4P32A 2PYZA 3O4GA 4HS4A 3VR3D 4XM2A 3EWIA 1UMDB 3J7AC 2WP0A 1P1FA 1TK9A 1R27A 3JAWB 2ATXA 4EM6A 1YS4A 2BZ0A 3PQCA 4BP8A 3B5EA 1RQPA 3GJ6A 3MILA 4LYDA 4CIAA 3KM0A 3UN1A 2JHFA 2XZPA 5G0SA 1QRAA 1RBQA 2X9QA 1Y89A 2JJMA 16PKA 3SHWA 4YLEA 5JH7B 1UZUA 4X44A 3LKDA 4KFRA 3Q9SA 5HJ2A 3T1HB 1EX7A 3Q3GE 3IHTA 3A06A 1UMBA 4AKTA 4DDMA 1FJHA 3GGSA 4NG4A 1ORVA 1U0EA 2G82A 3EXAA 3ZCQA 3DEFA 3FVRA 3KUXA 4FT2A 4UM7A 3NJRA 1T9HA 3ETNA 2NV6A 5EIWA 5DNYB 2YKGA 1P1HA 2XE8A 1DEKA 3V2UA 1JI0A 2Q5QA 5EP3A 4B71A 3A9VA 2IA5A 4U7HA 4GZ6A 5HTOA 2AE2A 4BP3A 2FPIA 3ITDA 3ZXUB 1RCTE 4WZBA 3JAKA 3U49A 5AVWA 1EKXA 2V7GA 3AK4A 5CFNA 2IHKA 4WX2B 1J70A 4IWXA 3WXBA 3WGIA 4ESVA 3QBTA 5JXWA 3GVIA 2ONKA 3ZUPA 4J29A 1WULS 1HDZA 3AMVA 1DEOA 1VPTA 3S3TA 1L5FA 1QRUA 1BWQA 1IHDA 2ZKLA 3PCRB 3EGDB 3U4IA 2LBPA 4HMPA 4J90A 1GN9A 3L82B 3MD9A 2NU8A 3I04A 2QL5A 3DCIA 3DOFA 4C0AC 2WB2A 4LF5B 1QDUA 5CA0F 3EISA 3FJOA 3IT3A 3PIRA 4Q19A 2BI8A 3JQQA 3EHDA 4N9WA 3VH2A 1XTJA 2W6JA 4I4TB 1DRKA 3E3AA 1U7UA 3L6CA 3ZCXA 2OMEA 1TEVA 4H7DA 5JFGA 5TMPA 1XRMA 2PFSA 3FHOA 5JPCA 5F12A 4G9EA 3KKEA 2O5CA 1H5NA 3C3JA 2EERA 4CL2A 4J0CA 3VDNB 2O2DA 4RA6B 2JIPA 2ESRA 3VSDA 3UFXA 3HLKA 4KQCA 4TS9A 3BZUA 3NHWA 3JCZA 4TRJA 2DPHA 2KBFA 2EKPA 2X0KA 1E1DA 1CR6A 1FU4A 1Q6ZA 2HD4A 2QORA 4OHBA 3R75A 1X42A 4RJTA 2I3BA 3R2JA 5K0BA 1R0BA 2C5FA 1P7PA 1D8AA 2EYQA 4PYQA 2C2HA 1Q16A 2BTOA 1FDTA 2XMGA 1ZN8A 3ILXA 3K1JA 1U5CA 5TMDA 3H11B 3OZXA 4J0KA 3VR6H 1HUQA 1DI0A 2XMDA 3RVOA 4XH9B 2O7QA 3TB6A 4YCSA 3R9XA 2PUJA 1XMQB 3BCRA 121PA 2FZ4A 2ZJ7A 2HRZA 2CL6X 3I05A 3LPNA 3CSUA 3RT9A 5DTIA 1DTWB 6Q21A 2IHJA 4ADSG 1VL8A 3GQVA 2IIVA 4WKBA 5DE3A 2XX3A 2ZBPA 4L3OA 3BWCA 1DKRA 2B92A 3R6TA 4YJ2F 4EVRA 1ENOA 1JG3A 1F4VA 1GU7A 2YQZA 3JR7A 1HYHA 3CFYA 3QVGA 4L2IB 2NTNA 3OCYA 4QBKA 4Z9XA 3S5UA 5E7MA 1ZEJA 4L5CA 4NAHA 4HAYA 1FYWA 1DOHA 4X90A 2VDLB 4LBWA 2ZITA 4UNPA 1OTHA 4O4IA 4DDKA 3AVXA 4MZXA 1H23A 1XJ0A 5FTKA 2IHTA 2WMYA 3EZ6A 2NUPA 1L4GA 5CA1F 2O8DB 4JOCA 1QG2A 2GK7A 2JJ1D 4WLVA 1YK0A 2ORWA 4WJZA 2O7VA 5A1JA 4LXYA 2QJTA 4PGAA 3MXOA 4WNCA 3UJCA 3W05A 2ZROA 1CULC 2AF3C 2X1LA 1TOAA 4PN3A 1E6WA 1U9ZA 2FF7A 3BH6A 4UC0A 4G81A 3NBKA 2FMFA 2D06A 4KAAA 4Q1BA 4ZQEA 4DQLA 1R7RA 5DNUA 4RTPA 3EGXB 4TKZA 1R9MA 3E0QA 5K0LA 4OHUA 4RZUA 3WGJA 1GZDA 1W0JD 3I30X 3WBFA 1C0EA 1Q5PA 2G40A 1KHTA 1UUFA 2VYQA 3QKIA 1MB9A 4LSZA 3VMMA 1MORA 1NHWA 1T8UA 2FLWA 2XCRB 3IP6A 3DZIA 4HNAB 1WZUA 2BEVB 4Q7EA 2Y2VA 3G8DA 3OEYA 1DUIA 3OZBA 3SC6A 3V7UA 2X3YA 5IF9A 4LK3A 1RBYA 2GAFA 3U7FB 2NVWA 4CM1A 3WQBA 3GN2A 3NTRA 4IV0A 2EZ9A 4UU8A 2HBZA 3DQPA 4QHSA 1G9SA 1ZONA 4ZWNA 4MGYR 2IHVA 3E23A 1AHNA 3R3WA 4PG8A 2QT1A 3ZNPA 2X6TA 1CB0A 2IC5A 3GJ5A 3R44A 4B4KA 4ENVA 1OH8A 2CYCA 1ACJA 5C2JB 3HDTA 3KUKA 3INNA 5EJMA 5HUQA 3ZDCA 4PINA 4CHTA 4JEMA 3UAXA 4IUBS 5CCBA 1H6CA 2VBFA 3D2BA 1WZEA 4YJDA 1G98A 5ERYA 1HFWA 2VJMB 2GBGA 3AONB 3LOQA 2O2EA 2GXAA 2W8BA 1JG6A 2CLCX 4O4JA 4TRMA 1YZ3A 3FR8A 1D4OA 3L02A 1E62A 2VSFA 2WF7A 3QLUC 5JT1A 4C22A 5HZHA 4G5FA 3RR2A 3WLJA 3AEKB 5K51A 3UOWA 1GG5A 3ROQA 4Q21A 1USKA 2FDXA 3RSOA 1C50A 4OAPA 5JJCA 4I5GA 3IRVA 2Q5HA 3BVPA 5COAA 4F5ZA 4RANA 5HFAA 3QW4B 2Y4NA 1USIA 4IDHA 5EERA 2ODNA 2J31A 4KUGA 1CUXA 1J0AA 1PHRA 2QX6A 3UPUA 4Z99A 1Z25A 1NI4A 5DTEA 3TLAA 3GGDA 4BKOA 2IGTA 2QRZA 2OKCA 4H1VA 1Y6GA 5LYJB 5JY1A 1WE2A 3HCFA 4G26A 4RMNA 5A2GA 4GDMA 3CJQA 2R1VB 2VJKA 4HG2A 5EIBC 4Q7QA 3PEWA 2QD3A 5C1PA 5A0TA 2OM2A 3CZMA 3VC7A 2KS6A 5AVZA 4MKRA 1TTPB 5F23A 1KOGA 3MYYA 3KOMA 3KZ1E 3U0BA 1W4AA 4R51A 3IOEA 2OV8A 3VYVA 1XZHA 2AG6A 4MX8A 3PRKE 3UAZA 1VJ0A 3ZHUA 2PH1A 3CH6A 2BBTA 4OK6A 4XTRA 1M2OA 4MUXA 2VDUE 1X38A 3O4FA 3HKEB 1PVVA 1V16A 3I1YA 3TCXB 3ZLUA 4BLVA 4KR7A 2YXEA 4ZVOA 4MWGA 4CT4B 3ZDDA 2AG5A 1I5RA 4A8TA 2GM4A 1EQAA 4QYIA 5BQPA 2H9YA 4H17A 1XTIA 3P9CA 5BVHA 3S29A 3TVTA 1BDBA 2QAGC 1FFXB 3PDIB 4EB6A 1OBHA 2B6NA 1XPUA 4ZQCB 4EJSC 4XVQA 4OSPA 3TTSA 2JBAB 2WAMA 5AK3A 4NZYA 5J47A 2BEUA 4XB2A 2QG6A 3KU1A 2VEOA 3C6XA 4ZU1X 3MWFA 1O3YA 4TZTA 4GX0A 3DVLA 2RCNA 2I2XB 1GVNB 1Y3FE 1VG1A 5LBTA 1RCUA 3TZKA 1GSOA 1B14A 4GRAA 3A6HA 3P9QA 3V8RA 4I1PA 1NY6A 2I55A 2QYTA 4QC2A 1N0UA 2BP7B 3O82A 1JPNA 5FUWA 3UVEA 2H1FA 4P80A 1LGYA 3WWEA 3MTAA 4BQIA 5D3MB 1XA3A 1F2TA 4Q4DA 1A9PA 5DP2A 4URZR 4DV7B 3OKPA 4EELA 4IJUA 3U3OA 4DA4A 4KI0A 1LDYA 4J1QA 1H9CA 3IE2A 2HOQA 1RKQA 2I6GA 3K0CA 1E98A 2D13A 1RMQA 2CL7X 1F0PA 3GFSA 3QU5A 3IAEA 1PG0A 3TSYA 1KAGA 3T7EA 4O33A 3E3MA 1IULA 1DAMA 2OBXA 4X84A 1EUZA 3PIDA 2QVYX 3LX8A 1FA9A 4V0NA 1A5BB 1MKYA 4XPZA 3RSHA 2D62A 3L0SA 3KPJA 9ATCA 4ZHQB 3DZDA 2JDID 4RHUA 4EY7A 3JD3A 1WABA 1SKMA 3PTLA 3FMVA 4OLJA 5I4CA 3NTVA 4NJEA 1PJRA 2WINI 3TL3A 1U9CA 4NY1A 5E6SB 3FI9A 5DNCA 4G1VA 1A5SB 3OMLA 1PT7A 2Z2XA 4JWTA 3H5RA 1KF0A 2DFVA 3NTXA 5JAZA 2VHTA 2G5TA 3KZKA 5EHNA 5CFRA 1SUWA 2BH2A 3GEPA 1A88A 2V45A 5GJBA 2HN9A 3ZWWA 1PCXA 2PJZA 4RLFA 3GLHA 2ZE6A 5AP9A 1P2BA 1E18A 1PUXA 4PLGA 1QGZA 3DFZA 3Q3HA 1ZHFA 1P77A 4MVJA 1RWQA 2F48A 4NONA 4OYLA 3AUFA 4B45A 5BURA 3OQIB 3QX9A 2WU4A 3ETJA 3U6KA 1Y3CE 2ATVA 2CJXA 2W71A 1KOFA 4XQGA 4E2ZA 2G7ZA 1LBIA 1A98A 3LHDA 5BWNA 1QM5A 1X80B 1R00A 3R3ZA 3ASYA 4BFVA 3S8MA 1YKGA 3LPCA 1DX9A 1E7WA 1K68A 2KBEA 1KY4A 2QD5A 3KO8A 4ROSA 1Q74A 5EEHA 2IS6A 3UG7A 1WUYA 3B7PA 2OR3A 4M22A 1JFFB 2EFGA 2SCUB 2DLCX 1KNQA 1X0VA 2OXEA 1NJ8A 2OB2A 2L19A 2ZTHA 5CB4F 5IW8A 2VNSA 4Y7DA 3ZG6A 1G6KA 4F12A 4HRXA 3HXTA 4EUSA 5KVVA 2ZYHA 3UMGA 1GL6A 3AF0A 2I34A 3RHSA 2O3RA 2IDMA 1ULBA 1NF2A 3TI7A 4HQRA 2HC9A 5IAAA 3T0IA 3H8VA 1RI5A 4OFXA 2FPPA 2FF5A 3KCNA 5FLYA 1E4OA 1JPJA 2O06A 3H18A 3S28A 3V1KA 4YRGA 1TVCA 1WXFA 2FGJA 3GYBA 5HA5A 4EL0A 3LUBA 4N7JA 3B78A 3ZU4A 4RF3A 2FKNA 4KIJA 3F73A 4FCCA 2PHZA 4PR3A 4DY4A 3BFKA 1QAOA 2E6KA 4O59O 1YZUA 1XAIA 2RAFA 1EEXB 1YR6A 2FSHA 3HBJA 3BULA 1T0BA 3LIIA 3Q5GA 4ZXPA 5L8VA 1H2YA 1ZZEA 3SXUA 4UM9B 1DKLA 2PUHA 4LCJA 3PFKA 3SJCA 3SYTA 5C1DA 1JAHA 2ECPA 1H8HD 2J0UB 2RAPA 2ZCUA 3D0OA 4MWEA 5LQKA 3DAGA 1CW2B 1JYEA 2Z98A 3T94A 1IBKB 3KQVA 1OIWA 5GWXA 4DIKA 3QFFA 4QOHA 4ZVLA 4K6GA 1E92A 4OTZA 5K8JB 4TYWA 3RK0A 1VSBA 1Y3IA 3R5SA 1TAHA 3IXLA 1NOJA 5AWFC 1YIOA 2J9FB 1G5PA 1HT0A 2E37A 4W1SA 4ZC8A 1P0MA 3WGNA 3LT1A 2H59A 2PBLA 4NR0A 3KRTA 5I4BA 4Y6RA 4E15A 2OZLA 2OHHA 3A27A 4Q3DA 4GOLD 2Q28A 4JOBA 3A0UA 4FEGA 4EOGA 2QF7A 5IH3A 3ENWA 1I2CA 2YV1A 2RB5A 1QV7A 3B2NA 3OIUA 3P5SA 3FFAA 5EPEA 5IARA 1IY0A 5JAMA 2FRVA 3NWBA 4BQFA 4MR9B 3FNBA 5BNIA 1MHTA 4ILKA 1VJDA 4QXOA 3BSYA 2XWBF 3D8RA 4IX9A 1II0A 4ALMA 1TT5B 3UV6A 1QKIA 2I1LA 2Z5VA 2O0JA 2QM0A 4X7RA 4ZOLF 5NLLA 4IDCA 3C39A 3VH3A 5DHPA 1TI7A 3M1IA 3E3NA 1XQ9A 1UKZA 3MCAA 1P2SA 2DMRA 4GLBA 4BKUA 5KQGA 2UXCB 2J9YB 1V1RB 1F9AA 3Q9UA 3F49S 4DXDA 3EUWA 2PX5A 1E8NA 2P1ZA 2V6JA 3DXFA 3LSTA 1LSJA 2E0IA 3R4CA 3L6DA 1OH5A 4UEKA 5F2NA 2QVZX 1JWLA 3PG5A 4L4RA 3WKEA 3JQRA 3UMCA 2AE1A 2ZXUA 3HZZA 3KUUA 2RDMA 1BW9A 3STWA 2DTDA 2F3UA 3NP9A 5ARCA 4FQ5A 3V1YA 3C7KA 1U11A 3KQHA 3G9ZA 1ULTA 1L1RA 1B8PA 4CMJA 4CF4A 4OHCA 4YXWD 3K9WA 5ALKA 3L0PA 3R5JA 3OJXA 2NZUG 2PH3A 3MMZA 4M86A 1R0WA 2IT1A 2VATA 4KUEA 4M49A 4F7WA 2JHPA 2ZJBA 4IRUB 1JUDA 1AC5A 1LWOA 4CL3A 1BDMA 3E9CA 1TZJA 4KBGA 5BW8A 3JWPA 4Q00A 1G8YA 1E3MA 1T0PA 2I54A 2PKEA 3AUYA 3BJIC 3P9SA 5FTJA 2REBA 1N2CB 2H85A 2FWJA 4N18A 1DBIA 1OJ7A 1ORDA 1L9KA 1RLOA 2AN3A 2I4TA 1Q57A 4QJ3A 1OI7A 1P4JA 4H6XA 1IEXA 1KMHA 2ZBDA 5JAIA 1JAZA 3H9QA 4TUYF 1W47A 2C5BA 4F46A 5D3KA 2ZPUA 1NJ5A 4MDHA 4YPOA 4LFBB 1TKAA 4LAFA 1LLDA 1M8PA 4YCAA 3EZYA 1KIAA 1KQPA 2MSKA 5CXQA 2PD4A 4TRNA 4UZEA 3UH1A 5IDXA 1YULA 2IXBA 3UWMA 2BDUA 3GP8A 3AETA 4KB5A 1JMYA 3BK7A 1DC3A 3MUEA 4LE2A 3EIXA 1MRSA 4DMMA 2WPDD 3KOUA 3DLHA 5ALMA 2YFQA 1U3TA 2D74A 3A11A 5IYZF 4YJHB 4EBBA 1X94A 2HSWA 2HLPA 1IHPA 2Q27A 2WSBA 1K98A 4LA4A 4J2TA 4CCYB 5SYNA 4BIMA 2G71A 2HTFA 2Q50A 1GTJ1 3QNUA 1EK0A 3ZY6A 1YVRA 2W93A 5JTTA 3FN4A 1V5GA 1CY1A 1L7EA 1P7YA 2ZYGA 3VZPA 4GZ3A 2QQ0A 5TARA 4AO6A 1VE9A 2QLNA 1Z34A 1PUJA 1YZKA 2I7VA 1BH2A 2IZ0A 1JHOA 3AJDA 4YRCA 1QQBA 5E4YA 3L92A 2R1TB 1BVRA 2PVSA 2CNOA 1L8OA 2XBUA 3MS4A 5ESDA 3WA6A 4EKGA 4O4HF 3T99A 1FXWF 4MW6A 2A3NA 4CG3A 5KYKA 3IAXA 1V4BA 2PTHA 2YJ4A 4QQ8A 5F4BA 3TUJC 1XMJA 4JCOA 2B35A 1GKUB 1W2WB 2WJ6A 4LGMA 5AXBA 1UKBA 4R8RA 5CMLA 1EZ1A 1XG5A 3BJEA 2OAQ1 2AWOA 2H2DA 5TPZD 2VUUA 4PZCA 5TC4A 5EXXA 4DNXA 1HSZA 4MUBA 1AA6A 1RT9A 2IL1A 3IV6A 1JZTA 1J42A 3L7IA 1ZEMA 3GLUA 4MB2A 4US0R 2RHRA 3ZDXB 1U2ZA 4E5PA 4PX5A 3OVMA 2XNKA 1BE0A 2UKDA 2FWMX 3UTDA 4DQVA 5CLJA 2EG9A 2EP7A 2G63A 5K4GA 1KP3A 5EXDA 4QVKA 4DV3B 2CLLB 1MFPA 1KAEA 1Z4NA 1YS6A 2OUIA 4Q3AA 3RLFA 5L3QB 1EDOA 2J3HA 4L8LA 5IJ0B 4FHEA 2WKSA 4GBED 4LJRA 3K6SA 4XJSA 1U9JA 2JGEA 3HYCA 4M7WA 5G3YA 3NEYA 1V8BA 3OM8A 4BJ3A 4W5WA 1AURA 3DW3X 2ZT7A 3L0IB 1Z7YA 3RS5A 3EXHB 1G21E 1OU4A 1X7HA 2V98A 3REQB 2ZUSA 3VC2A 1TLLA 1G66A 2JD2A 3U62A 4O2BF 4UE3S 3C6YA 5HRUA 4JP1A 3O8QA 4AF8A 5CJPA 4JQZA 4LTNA 4CKBA 1M7GA 4NECA 3KB2A 4ZYWA 3JYHA 1J7KA 3HHPA 3R3SA 2PCLA 4A82A 2ZR9A 3GQBA 5CPBA 3PBKA 3EBLA 2B2NA 4JX9A 4P0PB 2X1VA 5DXFA 2FV8A 1WD7A 4TVOA 5ALTA 4MDFA 3AVQA 4F2GA 2FMHA 2IUSA 1ZJZA 2QLTA 4COOA 1F2UB 3B9BA 3DONA 2Z95A 5AHOA 2XOKD 4XWOA 2OFOA 2O2IA 5CLIA 3D3JA 3FNQA 4UATA 3I8XA 2DBVO 4TKMA 5AVQA 4URUR 3TS1A 3VR0A 5BV2P 4BNYA 2F1OA 4FQ8A 4YJ3F 3C16C 2XKKA 1QV9A 4D25A 2W6QA 3OLXA 2C61A 1A7UA 2GRUA 1N5IA 2A5DA 3NS7A 3ZIAA 3OURA 4HMQA 4Q1VA 1C0LA 4Y9SA 2ACWA 5H16A 1AV6A 4NS1A 4GXRA 1NT4A 4AQDA 2CYAA 2NVUB 3VAAA 4AJHA 4RE5A 1XNRB 2QV7A 3PEEA 1Z39A 1Z5NA 2J9GA 3R5KA 5HQTA 4WACA 2IPMA 4YECA 4IIYA 1G0OA 1UIRA 1BWPA 3C41J 4NS4A 3RV4A 4L5IA 1Z4IA 2WHPB 1QAMA 4IVNA 4DIBA 4DQXA 2PE5A 1E1NA 2C2XA 3FKQA 5CRIA 1E9EA 3WDLA 2HMTA 1U7OA 2BKEA 3ZQJA 3MPUA 3HPQA 4X3OA 1FTWA 1T4BA 2Z43A 3H65A 4IW3B 4Y2PA 4F96A 3D8SA 4FGLA 4BMXA 4CMIB 2PUAA 4PC6A 4RHXA 3SNKA 2O6LA 2ZTUA 4GWKA 3M5WA 1JU4A 4JENA 2PFGA 4TV8A 5EMNA 3INTA 3AUTA 5DN9A 2BFBB 4KO2S 3P2EA 1O6FA 3VPCA 2XB2A 3GJ3A 1NU6A 3HDJA 5ALIA 3UATA 3X1ZA 2OBYA 5EIEA 4DANA 5D5PA 2EHDA 2JRCA 2IDKA 3BG5A 1Y34E 1MAWA 3LY7A 3NCHA 4R2KA 1K86A 3F3SA 3GDWA 3B70A 1PTJC 3PUZA 2UAGA 4DRZA 3QKSB 4ZVTA 1DZIA 2MINB 3PR3A 1WU8A 4KQFA 4QTTB 1E94E 3AB8A 3KT8A 1KZ6A 2ODEA 3HCDA 4OYRA 3RF6A 3V7YA 5ER6A 1Y6FA 2V7QA 2Q4TA 2Z3ZA 4N9QA 1J4AA 4LMRA 5KYUB 4AMUA 2QM8A 5CDHA 1QQAA 1L5HB 3D6NB 2R8PA 3L3BA 3KFVA 4Y7CA 4CNQA 3K0SA 2PZJA 1NVVR 3UT6A 3EEBA 2A1TR 2XVAA 2G5PA 2OTCA 3TB4A 4BVBA 5M7EA 1N9GB 4KQXA 4D9GA 2Y0EA 3GGGA 3OMWA 5TQ2B 2KLHA 2RD2A 3EGCA 1IFXA 2V4UA 1LVGA 4RETA 3DGEC 1JIIA 1D0VA 1S7CA 3M34A 4HX9A 3U4CA 4EKIA 3OZFA 3EZ7A 4PN7A 2O50A 5MN4A 4EHHA 1JTEA 1K5HA 2X0JA 3QBEA 2ZWMA 5FL7A 4BGDA 3NW9A 3A9WA 4AS3A 2VH2A 4TZ0A 3TQOA 2I7TA 1PWXA 1ZCJA 1VSVA 2PZGA 4B76A 1G63A 1XU4A 2XUFA 1AGNA 4EG8A 4Z4CA 1GZSA 3LCCA 5JD6A 4HDRB 1QFZA 1T0UA 2V5VA 4MW1A 3LY9A 4P36A 1IZYA 2EIXA 2H1CA 3ELYA 4G2NA 2FQQA 2FW9A 1HG1A 3R6GA 3SEFA 1QHSA 3V3KA 2BFEB 1UXOA 2F62A 2HT6A 5JMWA 2DERA 5F2OA 2EIHA 2HGZA 2CVPA 3CZ5A 3K1ZA 5AOBA 5B37A 3STHA 5HS4A 3MOIA 2NZ2A 5FBLB 5EZQA 4AKHA 1FOEB 1Y7PA 4ND3A 5GONF 1D4ZA 2WU1A 4W1PA 4R8LA 4H3SA 3QVSA 4KQJA 3PUJA 3O03A 2BCGY 2XJ4A 4CWAA 4FXPA 4TRRA 3K09C 1ZQ9A 4O1HA 5I8WA 1M2HA 3Q5EA 3QELA 4OJYA 5DCYA 4EHNA 4X66B 2Q9CA 3QMMA 3Q3VA 1JVSA 5EUQB 4J07A 2PQMA 4UUOA 5EIBD 3QY9A 3M6AA 5EHGA 2C96A 3JD2A 3WRXA 3GFQA 1FQWA 5HE9A 3CLHA 2CZQA 2FOLA 2PUGA 1O9GA 4KIWA 4XGRA 2XB8A 5IKEA 1SAYA 1Z6QA 2AJBA 1SCKA 1C5KA 4LXTA 5T6BA 2ZAYA 1K7XB 3GA5A 4WZZA 3W1WA 5JC8A 1E7RA 1N1MA 1NM5C 1D6MA 3FZQA 4JZYA 5EA2A 2XCLA 3HCEA 2PL3A 1TU0A 3TEJA 5JSZB 1WZ2A 1XBTA 5L3SB 1SHZA 2QSYA 2VWQA 2XD9A 2JLZA 1P0PA 2IX3A 1SQ5A 3SVTA 4FLFA 3D3KA 3CUWA 1J2RA 3I9KA 3H5WA 1EXDA 2G4CA 3HLYA 1JBQA 4KHZA 2OSVA 3KZVA 4LXUA 4UNNA 3WLSA 1NC1A 3NIDB 3Q1KA 2AD1A 1OZAA 3IVCA 5DX8A 5AI0A 4C7KA 2GHRA 1VL1A 1SWWA 3ACCA 4ZOAA 1EP9A 5CBKA 2Y67A 3CVVA 3OAAA 4ZU6X 4HX2A 4DJFC 1HZJA 1OWLA 5C51B 3K6RA 1DV2A 3ISJA 4H4EA 2K5UA 4X24A 1E8MA 4UOQA 2ATEA 5E8RA 1RAIA 3GFRA 4RZXA 3RVRA 1DGQA 4ZYTA 3KZCA 1ZNZA 2AOUB 3OX3A 5KBYA 1J2JA 3DL7A 1XXHE 1NXXA 2CFOA 2HI0A 3TLEA 5KYYB 2X6QA 1C1XA 2PSJA 3B1FA 3F2IA 4KBFA 4MHSA 2JBHA 4EA9A 3WL5A 3PITA 2XMQA 2XUZA 3D6FA 4FE7A 3AF1A 3UXYA 4BYMA 2YXPX 4L75A 4WBNF 3I4LA 3B6KA 3CH7A 1D0SA 1GADO 2IIBA 1HT1E 2R60A 4I1VA 4XR4A 4EGCB 5I9IA 1GT6A 2A4MA 2XAUA 4A73A 1P2DA 2Q0QA 2IY7A 2R66A 3UJDA 4JI2B 3TCNA 3OJEA 4M1TA 1VM6A 1GR1A 4EHDA 5JJIA 4Z54A 2GWRA 4PXYA 1J39A 3DAPA 3VR4D 1RQ2A 2YZGA 3G68A 5JAPA 2ZYWX 3DBRB 4C0LA 2QSJA 2FOIA 1KAQA 1DQYA 4DS3A 4JSTA 1U8ZA 3VBCA 3OLYA 2FOXA 4JB2A 4M7PA 3U3JA 4OHMA 1GL3A 1QRSA 1U9YA 2ZE7A 3AVUA 1BO6A 4DMCA 4CDMA 5LXTA 1MZPA 1SU6A 1PJ8A 3REFA 1NIJA 1X86B 1NBAA 3LP6A 3OWHA 2HEIA 2VXYA 3ZW9A 3CZAA 2W9XA 1WZIA 2NYRA 1XX6A 4O0LA 2MSEB 1KP9A 1IUKA 1W6UA 2DYKA 3DVAB 5AJWA 5IBPA 4ZCRA 3MMNA 4QUJA 5BSKA 1N8KA 4XJTA 4CJXA 2RB4A 1KRHA 4GECA 4NNPA 3ZWAA 1WHTA 2FK7A 2V7XA 3I0MA 2O54A 2AQKA 4IYJA 1XCGB 3SDZA 5F7XA 3FYTA 3TR5A 5CBPB 3ZLJA 3MMXA 1CKEA 3MQ4A 2YXBA 4JSYA 4OQEA 2WV9A 4CM5A 1LA2A 5H02A 1W9HA 5AW7A 2QW0X 2GB4A 1NMQA 1RVDA 1ZLYA 1YDEA 3AR5A 4BLWA 1OLSB 1QCYA 5CIQA 4DUGA 5BQFA 1ABBA 3GFPA 2IZ7A 1TZKA 3G59A 4QBFA 4MQFB 3FCEA 2EFCB 2B2CA 1TA4A 2FSSA 2JJ2A 3JXEA 2IF2A 4WZAB 2WT8A 2SECE 1Z88A 2YDXA 1TQ2A 5ALDA 3UNXA 1WCWA 4Y2TA 1CVLA 4G5HA 4NBTA 4TLDA 4UQLA 1XTQA 2ZQYA 4EATA 2FW7A 1CYEA 3Q11A 4YQFA 1VCHA 2WVGA 1GFWA 1CNMA 1RXWA 2B1GA 2XEXA 4R1LA 1MPTA 1ZOPA 2F9LA 2XVXA 5DTMA 4A16A 1UZAA 2ZJOA 1S3GA 4HHEA 1GTSA 3OZEA 3MAGA 3N6VA 4U7PB 2A7XA 2PMEA 1EESA 3CVUA 4YRDA 4OKSA 3KQNA 3UJNA 3RSGA 3QE0A 1QIEA 1XLTA 5KDOA 4Z9BA 1ZRMA 1RADA 4H6WA 4NFYA 1UEIA 4JMPA 1O94C 1W85B 1V11B 2JFHA 4LRUA 3SF8A 2J4FA 1Y3HA 2I3ZA 2B4QA 3MS7A 1M1YA 5ICCA 5HXAA 1IQRA 1YZGA 4PFKA 4U9IS 4MJ3A 2G7MC 5FOWA 1X7GA 1M6VB 1U2RA 1X87A 2FSGA 3B13B 2P27A 3DOUA 2BR3A 4YP7A 1YRAA 4BJ6A 4EHBA 3F5MA 4HP8A 5IJXA 5C8ZA 1IXKA 1ONNA 2OXFA 4ZAFA 5K6AA 2IEGA 5LA6B 1J0DA 3AVYA 4QXMA 4S1PA 3ND6A 1MH9A 2ZAMA 3D3NA 2QNRA 4Q4JB 2OV6A 3D3QA 1KXZA 2BYTA 3W5BA 1KDYA 4Q7MB 1TUGA 1UOQA 4QBTA 2AG0A 4MVXA 5B7GA 5AVRA 1VA5A 4ZVVA 1V1JA 2K7FA 3VVLA 3VA7A 4K0RA 4O6VA 3AIIA 1E7MA 2YQ5A 1BE6A 1V8ZA 5IH7A 4JVNA 1MAAA 3KQYA 5L3ZA 5GV7A 3KS9A 4FTWA 4JBYA 4QDXA 2FRDA 3LTNC 3PB3A 4JDPA 4JITA 5KQLA 2QZSA 2B2XA 2RAUA 4KGXA 1I4TD 1VPLA 4BE9A 3BWBA 4BU1A 3A6EA 4E33A 3GMSA 4O4LF 4NU8X 4ZOQI 5BXYA 3TG2A 1GN8A 2WA1A 5ALUA 3U7HB 4DB2A 5JXJA 4FGZA 3KYCB 1LRJA 1SUEA 2QX8A 4QQRA 3AVTA 4MUJA 4MLCA 1W5AA 3N58A 1EM8A 3QXCA 1JDVA 1KETA 4G0YA 4EHJA 5JZOA 2K87A 2EEPA 1X9HA 2ZEJA 3DBOB 3QSGA 2FSUA 1ESMA 2P0AA 4YP6A 2C9YA 3A3PA 5HWSA 1PL0A 3CV3A 1A4UA 2AQIA 1PD1A 5LOVF 2IEZA 4MR7A 3VR2D 4ZV4A 1DKMA 3ZE1B 2JFNA 1DXOA 3AJEA 4AMVA 3K2QA 1E3SA 2AUMA 3RG8A 4Q9HA 5H8WA 1L7BA 4EMTA 5A03A 1Z5VA 3U81A 4E6EA 1LXCA 5A9SA 3JWHA 2XCIA 1U2GA 2GOYA 4AG3A 1W0KA 3OOSA 1E2IA 1F60A 5B4VA 2G88A 4QVGA 5BXQC 1HKHA 1SHUX 4RZHA 1GXSB 5EZYB 1YMQA 4R1UA 4AJKA 5K3EA 2MWMA 4B6OA 4XWTA 1LNQA 1ES9A 2P6MA 1ZISA 4I8DA 1NRXA 4KU4A 5F9FA 1M76A 4FDVA 2YIJA 1EXWA 1DFGA 3PFNA 3PS9A 2PO5A 3WWPA 3HXOA 1CG6A 1VECA 4HQKA 2GA9A 2HNKA 5LCXA 4PSVA 1CD5A 2I2DA 3A28A 2VJPA 1B76A 1RLTA 3PQ6A 5FI0B 1OE0A 3P9PA 1H66A 1DMSA 3BTSA 4QPPA 2JZOA 5LZ5A 5HFJA 3OX2A 1DO2A 2J59A 4UQOA 4ZYLA 2YY7A 2QE7D 3ZEAA 1YQ9A 3BGVA 2FRXA 5HKKD 1CWUA 1M2VA 4QGSA 4NXNB 4NOLA 3HR8A 1GU0A 5CG2A 4HPXB 3I5AA 4MV7A 2EJBA 2BF4A 2IK8A 3TK1A 1E6KA 3GK3A 1T26A 1IAVA 1Z73A 1OBVA 2AJDA 1JG2A 1RJ9B 3IQWA 3O94A 3BMOA 4UPVA 1QZZA 3KAKA 4ZO6A 1GAJA 1KEUA 4YRTA 3WL8A 2GTHA 3JS5A 3OIYA 1WP4A 1TTQB 4Q6BA 2HA2A 2JH3A 1CUUA 1N2IA 1TYBE 1M1NA 3TM5A 1TVKB 1ODJA 2JEYA 2WM3A 4AO7A 2E1RA 3DTYA 3QUCA 3MD0A 2OLEA 5C8VA 3DBVO 2WJ4A 1ABFA 3KTAA 2JK0A 1CX9B 2XDAA 4I5FA 4RTSA 1PF7E 1JHYA 3CPJB 5PGMA 3KTOA 2FG7C 4Z2AA 5JD4A 2KSQA 2C5GA 2ZWIA 3JQFC 3OO0A 1WBJB 3IQZA 5BN5B 2JFVA 2IU3A 3D2AA 3DMNA 1Y9EA 4M1MA 5CA0A 4C06A 4I6GA 2Y71A 1RTKA 1P74A 1K4YA 4NZMA 1E4EA 1WTCA 1PZGA 1Z74A 2QG9A 2VPYA 4KXXA 2GCEA 3N59A 3CR3C 4NYIR 1M1UA 3NEPX 4QRIA 3GRRA 4JKYA 4R81A 4NZ9A 2ZJ2A 4UHDA 5DNEA 2CLDX 3N8KA 1I6LA 2FHPA 4IQ4A 5L53A 5FTNA 4RTNA 1N2BA 5A9TA 1DTSA 3GPCA 1VLQA 1HZZC 4TS3A 1ZJYA 1WB9A 1WWKA 4BMCA 4IV8A 3RVDA 4ZCTA 2HKIA 2XMSA 4QL3A 3C97A 5FDFA 4GWLA 1ZJJA 1C41A 3U39A 2P6RA 2YH2A 3EIWA 3PYXA 1QIHA 4A36A 4LG1A 4EAAA 1I4EB 2FCAA 3THRA 5JQGB 4M6WB 5LQCA 4MPPA 4OOFA 2QOEA 2AN1A 1J8QA 1HO3A 4C4RA 2DFTA 2PT6A 1H3NA 2ZDGA 5LFAA 4E1AA 1O57A 2ZDHA 1OKKA 3H5AA 3JX9A 3V2GA 1NQ5A 3ZHRA 2PDAA 4D82A 4LHZA 1ULAA 2X3FA 1CY4A 4FNMA 2FY8A 4BMDA 2BGKA 4MP3A 4UULA 4L5BA 3ZQ6A 4NENA 4OLAA 5D3QA 1WTAA 3W7VA 3BJZA 3VNQA 5AKHA 2JH9A 4LISA 4YHBA 5KJFA 4YJ2A 2ZM6B 4H7EA 1H6BA 1NQUA 3T1VA 3G0OA 4JLJA 1YONA 3PDCA 3KBBA 5T3UA 4PANA 3I6IA 5DWDA 5IZ4A 4NCJA 3NYWA 1T4CB 1DWOA 3WK7A 5DM70 3ASVA 4IIGA 4ZYZA 1A8PA 5DHTA 2BBSA 3AR6A 3EXFA 3KLPX 3Q1LA 4RJLA 3I9FA 4OXRA 4KPFC 1AKWA 4YN3A 3OJOA 3P0FA 3K2EA 4NWIA 4YFYA 2LE0A 5CA1A 1YR9A 1UFKA 2VHZA 3NIBA 5AK6A 3EUFA 1GVHA 5FBHA 2BC9A 3BORA 3G2NA 4RSHA 4LDZA 4ZI7B 4YAEA 5A9RA 4R2JA 2DQZA 4J43A 2CKDA 3T3MB 3WBBA 1WS6A 1ZESA 2PZ8A 5LBIA 5KHOC 2WAYA 3W77A 1YCDA 2NOAA 4WY5A 2V6FA 4MUFA 5HDBB 4KXWA 4A4DA 1SN7A 1MX3A 4YGXB 5FOUA 1L4UA 5K8LA 4P7BA 1I4WA 2IX9A 3AR3A 3FJ1A 1NASA 4XDZA 2BOVA 2OFXA 3QOXA 3G2QA 2H54A 4HDOB 4MI3A 1QIKA 2PG3A 1N5MA 3LQ4A 3UKJA 3HXKA 1UWKA 1RJDA 1WOYA 2L69A 3NJ8A 3NTOA 3QK7A 4ROTA 3T9EA 4BGVA 2X7XA 2R0QC 3U7QB 3CZPA 1PWHA 3F5DA 2WJWA 3KHTA 4JXJA 3BMQA 4D81A 1W96A 3T9FA 5FADA 2VOJA 4CG2A 2C9MA 2CFCA 4HJXA 1GGMA 3FOFC 5KKNB 1SXQA 2Z5GA 4S0ZA 1FYFA 3SDBA 5K8VA 1TO6A 4YQYA 2CCJA 1NG1A 1A7AA 5B1HA 2VWGA 2PO7A 4MIEA 5KNBD 2QTVB 4AZTA 5I7FA 5E1BA 2FSFA 3V33A 2C98A 3AKCA 4BC1A 3C3KA 5ALWA 2HTEA 4BC0A 4F8EA 2RJ3A 4MQUA 4HK4A 3ZWOA 3QHAA 3IJPA 3HH8A 3EVCA 4INPA 5J2UF 4P33A 2VHUA 1WXQA 4LN1A 3TIVA 4Y1GA 3CUYA 3TXXA 4EECA 3BXOA 4ITVA 3J7TA 1NJ6A 4X1YA 4OG2A 4EI2A 5IJWA 2D2VA 3ZCPA 2VCHA 2ODTX 2PEYA 5JMOA 3NB0A 4EFMA 4LS3A 2QRMA 4BBAA 1U4SA 3W9UA 3LL4A 3E8SA 3FB4A 1R8JA 4UOEA 1JJVA 5JNTA 4J0DA 2IHUA 5B1DA 4Q3CA 1LUAA 3ESZA 4YJFA 4FFDA 5DEIA 4OMDA 4X8MA 5FO1A 3TRJA 1H6DA 3QZUA 2CVFA 4K5QA 3U7RA 5C4IA 3M6MD 3NFRA 5EC8A 4EQ6A 3CUSA 2VRCD 4HADA 1YQXA 4ZAWA 4FVTA 3CRW1 4C87A 2QQFA 3G13A 4EPWA 1I7QB 2Y68A 3THWB 3LOUA 1EVZA 3USZA 2D00A 4PIPA 4IVPA 4D56A 4CMAA 1Z47A 1RXCA 4X6LA 5KX5B 3PE6A 3UCEA 4I50F 3W9BA 3UHOA 5DLDA 4CEJB 5C7YA 1Y1SA 4ZQGA 3G7NA 3OZGA 1J1ZA 2D54A 2JJ8A 4J16A 4I9GA 4WA7A 3OD1A 4ER0A 4FMDB 3TLBA 2FW8A 3KB8A 2GRAA 3O95A 1EGVB 1MOSA 2JCSA 3G88A 2IYSA 1H22A 1VBFA 2R00A 3C45A 3SICE 2VHEA 1XEWX 3PNLA 3HFSA 3GLKA 3KPVA 1JL3A 1Z5ZA 4X8LA 4CMKA 1K7EB 3N0RA 3PPWA 1E0JA 3H2IA 1SUCA 4ZODA 5B30A 3ECCA 1N0HA 3LZCA 2X1HA 4MEJA 1YJQA 3KEGA 2FEWB 1JEYA 1A8QA 1KJNA 2IZ6A 4S2UA 1UBLS 4B9AA 1NVWQ 2QP4A 2ZB2A 4ZZ1A 1E1CB 3D4PA 1TVEA 2IBSA 2O8CA 4LECA 3ECSA 4F9GA 3RS0A 2QZ4A 1KR2A 3FLAA 3HBMA 3KYDA 3R4VA 4CTNA 5CFPA 1KZ1A 5FQOA 4RTOA 2CMFA 1E2LA 1RRVA 2BMEA 2O07A 1JB9A 1M2GA 1ZJ5A 3O7WA 4L50A 5T7BA 2GTPA 4NX2A 3O91A 4Q9IA 1IG3A 1TQ6A 1U1GA 2X8BA 1LTHR 5C4GB 4AZ0A 4XVUA 4RKQA 1PHPA 3A6ZA 4PZYA 3M4YA 3QHQA 1V7CA 3SC4A 3AHFA 5B3AA 1K27A 1O58A 4D42A 4HLNA 1VL0A 1SCUA 2AC7A 4HSGA 4OGKA 4RCVA 1FU8A 1P0QA 3ZU6A 3GLGB 5JD3A 1JDUA 1Q7RA 2B69A 2NVOA 4EZBA 2VQ3A 3GCDA 2NSLA 3PZRA 3MXTA 3JAMA 4NESA 1T0JB 2Q5FA 3DE6X 4B7ZA 3QPVA 1PS8A 4D8UA 2HCFA 3QU9A 2J08A 4JL6A 4LSMA 4OQZA 3T7TA 1GG8A 5LC1A 5CDSA 1Z4PX 3EGEA 4MWOA 1XEFA 2X6RA 5BMVB 3SX0A 3TW0A 4AJ9A 4HLCA 1VDMA 3D54D 1OY1A 3W5IA 5CFZA 4XB1A 5JS6A 3A4LA 1MC5A 2BGTA 3WMWA 1Q6YA 1CR0A 1FPQA 2HCTA 4NMXB 3WIVA 4B3SB 2Q5CA 2WDPA 2X4DA 1LPAB 1B0PA 4G01B 4W5HA 5AHKA 2C8JA 4PFSA 5NULA 3FPCA 1N33B 2NU6B 3IT1A 2AEMA 4PVDA 5DGIA 1UPAA 5JMTA 5ALPA 3TLGB 1IBSA 4LEIA 3I5MA 3FW1A 4ZOBA 4CLXA 3NMUF 1ZVVA 2C88A 2JL1A 2VT6A 1HDIA 3QVKA 1KFCB 3DEZA 4PNHA 3RRFA 1UXJA 2X5KO 4JQCA 2A94A 2PL5A 3AZOA 4FK8A 3FZYA 4RK1A 4HYYA 2Z9BA 3ANLA 5P8WA 3HY6A 3O8NA 2QN2A 3AERB 3PNPA 3GLFB 4Z9YA 5DGCA 5IT9A 4H6PA 5CDYA 4L4XA 3W78A 3WB0A 1CS4C 1ISIA 4ND6A 1WEHA 1PV4A 1D9ZA 2VG8A 2WZQA 3ESXA 4JR1A 1NBHA 5DHUA 4KPUA 5B1YA 1W52X 4BAZA 5J4VA 1JDBB 4LMPA 2CL0X 5IJAA 1IZ7A 2LD4A 4UFNA 1L7VC 3LPDA 1SIBE 1JFSA 2HPAA 4M9RA 4I55B 4Z49A 1ZUNA 1HE1C 4OGWA 4L5JA 1L9XA 3ON5A 3IMGA 2J0VA 2QRNA 3CLVA 3NATA 4OMUA 1D6NA 4P4SB 5DTRA 4DV0B 5HUHA 4DR7B 1CY2A 1CYDA 2HDNB 5A3SA 2QTTA 2C5AA 1Y5RA 2PS3A 1EBBA 3MJVA 3IC5A 3C3DA 3L77A 2C58A 2P2SA 3ADPA 3OE7A 3BICA 3MRTA 3Q6IA 5CNMA 1EIZA 2AXQA 4D3ZA 1NMYA 3N5CA 1SXJA 3ZK8A 4IQGA 3K35A 2AOVA 2BMVA 4P5PA 1QZ3A 3V6LA 3VNVA 4TTVA 1LJ8A 1XT6A 2Q29A 4NMWA 5ALFA 3T9CA 2ZSEA 1XB2A 3T1YB 2FYTA 2ZRCA 2SBTA 4G63A 1X1CA 4WNAB 2JAUA 2Y77A 1SM4A 2ZUBA 4V0LA 1JIXA 2DHCA 1T1RA 1QP4A 1HFKA 2IHZA 5D85A 2C8KA 1W73A 2VI5A 2Y1KA 4WCFA 5F2KA 3ZD8A 2XGMA 4W1RA 4M0PA 4ZVMA 1ZHOA 5FEMA 3OT1A 3R5XA 4WT7A 5KREA 1AE1A 4Y6QA 3R7WA 1N2HA 1ZH4A 1HL3A 3NBMA 3MHPA 1TCAA 2DBYA 1BQEA 3IIJA 3EIEA 5BP7A 1XLVA 1TZ2A 2EBHX 2AXPA 3JATB 2Y05A 2GESA 2RBGA 4O8ZA 1DBQA 5D8DA 3K0CC 3MUFA 3O92A 1UDBA 3TINA 2HSDA 3CRRA 3FBWA 4HNHA 4RFSA 4JC4A 5GY7A 4C5AA 3FNHA 4BIIA 3V4SA 3A2KA 4P2GA 3WBJA 2J30A 3EH1A 4OI4A 2MMGA 2JVIA 1GNTA 2GN6A 1XZIA 1GQFA 3RCBA 4ARAA 5FPTA 1EWTA 1ARZA 2NV0A 1WCIB 5HOQA 3MIIA 5JDIA 5JWOA 5F9MA 1FIUA 4PAOA 2HYDA 1SC6A 2Y4OA 4HZIA 3ED5A 4KFSA 3VVMA 1AQNA 1KMNA 3QBJA 2AZXA 1O94D 4C0HA 4GPEA 1J2TA 4FGWA 3RSFA 4A8HA 4ZARA 5IXJA 2IS2A 3F5FA 4L6IA 4EHAA 4B5LA 4KIUA 4X1KB 5KOYA 1U0GA 1Z4MA 3IESA 4TXLA 1TPYA 1G55A 3BIFA 1ZCBA 3PK0A 4NE2A 4DEXA 4ZOLA 5K0FA 3IB3A 3DKPA 3OT4A 5GIOE 3L9WA 3W5AA 3T3PB 2B8EA 1F8YA 4X91A 3ETEA 4JI8B 2JI8A 3PRHA 3SKXA 3WYEA 4B8WA 3G49A 4B4DA 4BWGA 3Q2KA 3ZWDA 3F98A 2N1BA 4S1TA 2BHSA 3EPRA 5LPNA 2AA3A 2XZLA 2ZJAA 2Y0DA 3FTPA 4WEQA 5JISA 5GPBA 3WK5A 1THMA 3CX8A 3H1FA 5FWXA 4KO3S 1LX6A 1G5IA 1RJFA 1UKEA 5AOVA 1FNDA 4ZVUA 3GCGA 2AVNA 2GR9A 3FDZA 2XIQA 2AK3A 4B46A 1T2FA 1AQ6A 2Q3EA 1CPYA 3VZCA 4NH4A 4R2HA 3T6KA 1OAOA 3EWAA 4C1BA 2H4FA 1KU6A 3D81A 1GD1O 1H8ED 4Z2YA 1KDVA 4ZALA 5ICMA 2A1TS 3L6OO 4UM8B 2WJ3A 1W87A 4XM1A 1K8RA 3QHPA 3BHIA 1US8B 1ESEA 1THTA 3KEMA 2XQFA 4N8DA 4NP6A 3OPQA 5HUJA 1FBNA 3L7JA 4QXRA 2F43A 3H9UA 2QRJA 3UG6A 3F90A 1YB2A 3MC1A 3QG1A 3A7DA 3GG2A 4YGYA 4E5DA 2O57A 1J0CA 3IAS6 2JFBA 5AW0A 4U3JB 3WLEA 3REOA 4N40A 1AB6A 4HNAA 4TUYA 1Y1PA 5EE5B 4R1SA 3A2NA 2R85A 3MEQA 4LQCA 4YP0A 5IVIA 4E03A 4MUKA 4RQAA 1YL7A 2WM2A 4FUQA 4XX0A 1YGPA 1IHXA 4RKRA 1F17A 1MABA 1JRLA 2FUG1 3RV3A 2AI3A 4AKSA 1JPVA 2VXBA 4TKVB 3QKRB 1BXZA 4WXYB 1O8CA 1NW3A 2B7BA 3K1AA 4LYEA 5L45A 5CH8A 9LDBA 2Q0XA 4C6SA 5ICSA 1IBLB 1GTRA 1OFUA 4H60A 2UXBB 1RFGE 2BPOA 4F5EA 5AW4A 1FJGB 2OKGA 1G4HA 1CUHA 1JSZA 4CKZA 1P39A 4IGKA 3UAOA 2FMIA 2IJGX 2L18A 3NRCA 5IYZA 3JYPA 4FI3F 4AFNA 1ZN7A 2JFPA 2JAPA 2NO6A 2Q9UA 1Q7BA 5JR3A 2E48A 1BFKA 3C7CB 1JNYA 2LPMA 1G42A 3ZBQA 1Z6TA 4GMFA 2AJCA 3O8OA 1GGKA 4NVRA 3AY0A 3SX2A 4XWYA 2GNAA 1OZ0A 1SKUA 4QWWA 1VKRA 4F21A 1Z75A 4PSDA 5IUKC 4MYUA 5KTMA 2QBYA 3GXOA 2YJ5A 2EWMA 4NIMA 2OZEA 1BCRB 5FNVF 4Z9AA 2JBWA 3HCWA 4B34A 1J24A 4GKAA 4K05A 4D9IA 2BDEA 4O4HA 1IOLA 1FXWA 4FGUA 1KKMA 2RC6A 3QA9A 1JXOA 4TLLB 4XFJA 4LK2A 2G76A 3TGLA 4IIVA 3A7EA 2PRYA 4JBNA 4NQRA 4PPQA 3WLPA 4ZYYA 2K4MA 2CXOA 5ITWA 3KCQA 2R7AA 4BFCA 1HMPA 4I2VA 2CD7A 4EA7A 1CRLA 2G17A 1EQUA 1MIOA 1TGVA 1KO4A 1UR5A 2WA2A 3AB3A 2IH2A 3W4IA 2OV3A 1A77A 4TWRA 2GJ8A 3AY7A 2CEAA 5T8KC 4QARA 1IN1A 1K8ZB 3CWCA 4RK0A 1L7PA 2ZZMA 3K7EA 4GAEA 4K03A 5CDTA 3I0ZA 3UT5A 1CY0A 3E22A 3O1IC 2OILA 2XVYA 2WNHA 4D98A 2WWFA 3A14A 3TSWA 2J07A 4LPKA 2W11A 3JD0A 3ZE0B 5AKKA 4G24A 3RUHA 3BQNB 3PC6A 4ZAYA 1G20B 1IBCA 4P3KA 5FCDA 1NW7A 2H2HA 5BMVF 3W5VA 4ZRDA 4CQMB 4XGNA 2XF2A 3WHLA 4EG1A 3IL2A 1KHHA 2H5EA 1T6NA 1KWGA 1D2GA 3E1GA 3QMWA 5EE0A 4RTMA 4IEFB 4YXFA 2OWEA 1GPUA 2G0TA 5TQ0A 1GSAA 4L51A 2GJKA 4O2BA 2QA5A 5F3RA 2EQBA 2PSSA 3ITEA 3JTEA 4MR8B 1E66A 2XXAA 1Z2DA 2EGHA 3NVMB 4DMFA 1Z8DA 1T15A 2NVBA 2NUBA 3WGLA 3C70A 4QPDA 4NF2A 1QHHB 1UFOA 4DPLA 3I09A 4Q4HB 3T3NA 1X7ZB 4EGFA 1HTWA 2O23A 3A3OA 2QUAA 1K4MA 3IUBA 5EQDA 2JHGA 3LVQE 2A0KA 5FI5A 3REGA 4DHWA 4RMHA 3B7GA 5JASA 1QH8B 2QP9X 2ZRLA 1O9BA 2ZT8A 4AY4A 4DGSA 1Y4SA 4GOOD 1JTFA 4C6TA 4B8ZA 3HKDA 4A0GA 4WK0B 2DQYA 4HVTA 2XKJE 4NULA 1Y8RA 4YJ3A 4ND8B 3E18A 3WLRA 4AVYA 5A06A 5IXSA 3ML1A 4QGBA 2XUIA 3I12A 5E3IA 2I3AA 2O0KA 1FFBA 1JX6A 2QUKA 3FWZA 3I9JA 3AO0B 4ID3A 2OBBA 5U4XA 5BN3A 4RNCA 1QBGA 3IQEA 2YYZA 3WLIA 1N5DA 2CE7A 2X77A 4H4DA 2Y3IA 2H52A 2HUPA 3KSDO 2O8EA 1GCUA 2FPGA 2FFJA 1EVYA 3BXHA 4MS3B 1DOZA 4DUYB 4Z0PA 4NG5A 4BVEA 1FDOA 2PXCA 3WGUA 3NC4A 1Q50A 3K05A 3MJFA 1PZMA 4AWBA 5DYYA 5KC8A 3LVFO 1BTOA 2O1XA 2WY2D 4J0QA 3ROEA 3ZJVA 1POXA 2A30A 4RMJA 4S2EA 1VBMA 1YL6A 4BB9A 1MOPA 5EJFA 1FNCA 4TT3A 5E6SA 1EXNA 3IVRA 4A91A 5ITSA 1DKNA 4H08A 4XQCA 1NE2A 1WMBA 2CFSA 2ZREA 1SBHA 2EW2A 3PNOA 2GZDA 3AJ8A 4GOXA 4H1HA 1R4NA 3M70A 4JJIA 4ANFA 1L3BA 1KO8A 3ZYZA 5J1TB 3SU8A 1KI7A 1FVHA 1LSUA 1VL6A 3EULA 4RF5A 5T4FA 5K0EA 2E2WA 3BSSA 3A6KA 1AUOA 2R8ZA 1A04A 3VOBA 4DHEA 3UFBA 1G38A 4Z53A 3PHJA 1E3WB 3ZCTA 1VJTA 2MT9A 4L0DA 2ZSDA 1H1LA 1XKLA 2X76A 1YOBA 3OG9A 2H63A 3PEVA 4MW7A 1U7TA 4OREX 4U8HA 2CV2A 4LNAA 2VDKB 5IBRA 1ESNA 2NZ8A 3LBHA 1ZPDA 3W3AH 3X2EA 3PTAA 1PQYA 1QQ5A 2PX3A 2VNJA 2QTBA 3IEPA 3OM1A 1LJUA 2YWDA 1C9DB 2GT1A 3LIPA 1TQHA 2AW3A 2H2IA 2A8YA 4GRDA 4BLUA 2ZPTX 2H5JA 2TMDA 2P65A 1NVGA 1AD2A 1UBCA 3FH0A 4E07A 4HVLA 3RAFC 3ZHZA 1GG2A 2HYIC 3U3XA 2ZI5A 2VDJA 3KR2A 4Q1CA 3RC7A 1ZD1A 3K9GA 5IWCA 3F7OA 3KZOA 1W25A 4J49A 1IN5A 2HF8A 3K9NA 4QPJC 3WB9A 4EUHA 5KYWA 3E3OA 4B7UA 1TA9A 4FJ2A 4IJQA 3EG9A 4UE6A 3UO8B 1QB7A 4CTKA 2W6JD 3I6BA 3T52A 4ABTA 2XE4A 3HYRA 1PGQA 3CCBA 4UEWA 3ITNA 1QLJA 1IONA 1AK2A 4DZZA 4HLUA 3O1HB 5I7EA 4AJOA 3WA7A 3BXZA 2P77A 3A2MA 5I4IA 1PJ4A 1PSWA 1NLUA 3PV0A 1BEZA 4RVDA 5ALHA 3V00A 1CCWA 2O8BA 2BBWA 5BSFA 1CVRA 2CHEA 2C9ZA 2IUTA 4IMPA 1TM1E 4CM9A 1S01A 3R7SA 3UPTA 5GONA 4AMBA 1T35A 4OQ4A 4WLFA 4MYTA 1ZRHA 2ZRFA 5K3SA 1E9RA 1A0OA 1BJTA 2G9NA 1G4UR 1V6CA 2GLUA 3KT6A 3NO4A 1XQXA 2OCKA 3NORA 1I3MA 4CEIA 4J94A 2Q2NA 1QNFA 3KYJB 2GN2A 2G9ZA 4RELA 4ERNA 5ADWA 5TEVA 1C4WA 3IKLA 2XCTB 1UPXA 2BR5A 2QY6A 4TYMA 4NZOA 4DJ5X 3ZGVA 3FZEA 3H17A 2J46A 1A9SA 5FWYB 1SUSA 3IBYA 2WC1A 4KREA 5F5NA 4DNFA 3IEIA 3LBFA 3KAJA 1Z6XA 1GG9A 4LZAA 4TX1A 3T7AA 1XELA 4E7PA 4YRIA 1G3RA 3SQWA 2B6HA 3WVNA 2W2KA 4AP9A 4RMGA 4YR7A 3JQ7B 2A5GA 3LLVA 2ZIZA 1SEPA 1UMCA 2VDOB 4IHJB 3V2IA 1L1EA 5A5FA 2L82A 3EVEA 2X8LA 4FC7A 1ZH6A 2IYTA 1KPGA 2C42A 3FGNA 1V8DA 5FV7A 2XKAA 4BNVA 3EZGA 3A32A 1J8DA 1M6EX 4G37A 2NU7B 1OFTA 1SB8A 2VF2A 3LZDA 2H2FA 2QBYB 2WSYB 3ZTTA 5JOQA 4HOYA 3SQLA 2YIVX 2ZI7A 1YNSA 5E2BA 3OMXA 3LFHA 2O2XA 2VJNA 5IK2A 4MQLA 2FJPA 4PBTA 4BQOA 3OTOB 1J21A 4ILEA 4YNBA 1K6JA 1XP5A 2P9ZA 2AC4A 4C7OA 1DBRA 4V1CI 1MC4A 3SG0A 2IPNA 3K4HA 4FFSA 3UANA 4OB7A 1Z3IX 2APJA 2HEGA 3GAZA 3PGMA 3HZRA 4CQLA 4JB3A 3B9PA 2QTRA 1N2CE 2A5FA 3UTCA 1I5EA 4WBNA 1RE1