3HL4A

Crystal structure of a mammalian ctp:phosphocholine cytidylyltransferase with cdp-choline
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
176
structure length
176
Chain Sequence
b'GLRQPAPFSDEIEVDFSKPYVRVTMEEACRGTPCERPVRVYADGIFDLFHSGHARALMQAKNLFPNTYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGISTSDIITRIVRDYDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Choline-phosphate cytidylyltransferase A
publication title Crystal Structure of a mammalian CTP: Phosphocholine cytidylyltransferase catalytic domain reveals novel active site residues within a highly conserved nucleotidyl-transferase fold
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 51
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature ec 2.7.7.15: Choline-phosphate cytidylyltransferase.
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3hl4A00
1F7UA 1O5TA 1O97C 4NAHA 3COZA 4DLPA 1TQ8A 4KR9A 1YUNA 2E21A 1JEDA 4MWEA 2WSIA 2Z3VA 3HV0A 5KWVA 3A2KA 1K97A 4RUKA 1IHOA 2X1MA 3HZRA 4EG7A 3LCJA 3DLAA 1XJQA 3CLTD 4XFJA 4CQNA 1TYDE 1YIDA 2CV0A 2QTRA 4DDKA 2I1LA 5IJXA 1P7PA 3VU8A 2QUHA 3CLSD 1WXGA 4WNYA 4MAFA 1GN8A 3KT6A 1NI5A 4CT0A 3CVWA 1G8GA 1J21A 2E89A 1JIIA 2A7XA 3H9CA 3H97A 3IVCA 1QJCA 1T9GS 1MAUA 3CVYA 1V8FA 1WY5A 5DEOA 1GTSA 3Q12A 5K0SA 3IOEA 2DXIA 2ZUEA 1U7XA 1B6TA 2GOYA 3H9BA 4ZCTA 4PY2A 1IH8A 2Z08A 3OTWA 3TZLA 3X1MA 1H3NA 4G5FA 1O94D 2YWBA 3NBKA 2CT8A 1VLHA 3DPIA 1HYBA 2QJFA 1WZ2A 4Q93A 1N2JA 4OUDB 5BNZA 3ZJTA 1JILA 1EUYA 4MW7A 5J59A 3C8ZA 1COZA 1RQGA 1EFPB 1Q19A 3IOBA 4QREA 3FIUA 2OV4A 1U3CA 1LI5A 3IUBA 3U1VA 1OBCA 1XNGA 3ND5A 4ARIA 3IDFA 1JECA 5FO1A 1WXHA 4ZT5A 1JMVA 2Z09A 4MUHA 2QUKA 3N05A 4BWVA 2CYCA 4DJAA 2A1TS 1KORA 1KP2A 5EKDA 4DDMA 3UC5A 2X3FA 4MLPA 1O97D 4S1OA 4MW6A 1KH3A 1K4KA 4MUKA 1TFUA 2JANA 2X1LA 2VXOA 3RHSA 3G5AA 1PG0A 1QQTA 2A86A 5DASA 4NAUA 3CLUD 3RJZA 4MW2A 3VRHA 4JXXA 4UZEA 3IUEA 1M8JA 1NZJA 1LI7A 1EFVB 1ZH6A 1FFYA 3E27A 3FOCA 2A4MA 3FNRA 1NYLA 4YP7A 4ND6A 2JA2A 4DNXA 2RE8A 2J5BA 3UK2A 3FH0A 1OWPA 1J70A 1K92A 1R6XA 4HPWA 4R2MA 3S3TA 3AG5A 4YP6A 3IVGA 4EG3A 3HMQA 2DERA 3ELBA 4ZT7A 4KPUB 1U0BB 2J07A 4YMIA 2B7LA 2V0CA 4CDMA 1EE1A 4ZT2A 1WQ4A 3G6KA 4EG6A 3SZ3A 1GPMA 5LFAA 2V0GA 1NP7A 2CYAA 4MQ6A 4MUJA 1J20A 3CVUA 3AIIA 3FY4A 1O96B 2YWCA 3CA8A 3MLBA 1MC1A 1Y42X 1D2RA 3CVVA 4ND7A 3SP1A 3P0JA 1J1UA 2PZ8A 1IQUA 2CV2A 1H3EA 1ZJWA 2IP1A 2R5WA 3A05A 4ZCPA 4HJXA 3UOWA 3KT0A 4F4HA 3PNYA 1T9GR 1G59A 1OWOA 4EGAA 4MVYA 3L93A 2ZUFA 5J5AA 1Q77A 3QE4A 1GLNA 1M8KA 4OUDA 1NUQA 4F3RA 1X8XA 1V47A 2QUJA 1O0CA 3GLVA 3PXUA 1OD6A 1EFPA 1R6UA 2TS1A 3IOCA 4EG1A 2YY5A 2CYBA 2QJOA 3RK1A 3ND7A 1G8HA 4OJMX 2XRZA 3G59A 3K9WA 3ZUGA 1KH2A 1JEEA 3GUZA 4RPIA 1M1ZA 4I6GA 1IQRA 3X1JA 2ZP1A 1G8FA 1PFVA 4KR7A 3TNJA 4PBTA 3KT8A 4HK4A 1LW7A 1N2BA 4QBTA 2CFOA 1JZQA 2QUIA 4GRIA 4EG5A 3KT3A 2G36A 1N2OA 2A88A 2GM3A 1EFVA 1O95D 2JAXA 5TS2A 4CDNA 2C5SA 2NSYA 4I6JA 2PFSA 3ZGZA 2PIDA 2CSXA 1JGTA 3FG9A 1QU2A 5JBNA 3ZJVA 3SEQA 1J09A 3TQOA 1OWNA 1T6YA 2A1UA 1QRSA 3PNVA 1YI8A 2VTBB 4EFKA 3COVA 3MUEA 4KPUA 4AS1A 1WXIA 4MUEA 3JXEA 1MBZA 2O8VA 4ZT3A 4R0NA 3GMIA 3AG6A 3RBAA 3CLRC 1NUTA 3N8HA 3DO8A 1N2IA 4UZFA 1ULHA 2EL7A 3BL5A 4J75A 1F7VA 3UY4A 1O96A 5FO0A 1KKUA 3HL4A 3K32A 1U7DA 1IQ0A 1YUMA 4WSOA 4U7JA 4ZT6A 1NSYA 1TYCA 2D54A 3IMCA 1KP3A 1FYDA 1Q15A 2PG3A 3HFJA 3ISJA 4MVCA 4L2IB 5TEWA 4NDAA 3IVXA 3AL0C 1QTQA 4FZJA 1PFWA 2NZ2A 1I6MA 3P52A 2AZXA 2QJTA 3OP1A 3TZEA 1NUSA 2CV1A 5HUHA 1DNPA 4EG4A 3KFLA 5TEVA 5LLTA 4Q16A 5DB4A 1VBNA 3DV2A 3LOQA 4MW5A 3SYTA 3CR8A 2DPLA 5HUJA 3IH5A 2HGZA 1M8GA 5DK4A 1N3LA 4A91A 3N9IA 3AKZA 4ZT4A 1F4LA 1TYBE 1K4MA 1VBKA 2YXNA 1VBMA 2IELA 2PXHA 3H99A 4YBRA 3CVXA 3MMXA 3TQIA 3L92A 3INNA 1N1DA 2AKEA 3SDBA 1IFXA 4MW1A 1U3DA 1OBHA 3SEZA 1NUUA 3ILVA 4AQ7A 1PFUA 3I05A 1O0BA 3FHJA 1I6LA 1BS2A 1WOYA 2EJCA 4YP5A 1T6ZA 2GKSA 1S4MA 3ZJUA 2J08A 3CLUC 3FETA 4ZCQA 1KQOA 1YIAA 4KKVA 1IVSA 1ZUNA 1KQPA 3N2YA 3ZXIA 3FWKA 1MB9A 4PBRA 4U63A 2DLCX 4GU5A 1QRUA 2VTBA 2HZ7A 2DUMA 1KAMA 4G5YA 4I6EA 1IRXA 1O6BA 3HGMA 3M5WA 2H29A 4K03A 3IMGA 3VGJA 4MUFA 3Q10A 1NURA 1J1ZA 4ARCA 4QRDA 4HJRA 3CLRD 4JFAA 1OWLA 1WQ3A 2PZAA 1JHDA 1N75A 4P2BA 1QU3A 1ZH0A 2D13A 3H05A 2WQ7A 2XRYA 2CUZA 3LE8A 4MVXA 2DEUA 1EJ2A 1Q11A 1R6TA 3QTBA 4JXZA 3P0IA 3QTTA 1WJGA 4MUIA 3RK0A 5H7XA 1OWMA 2AG6A 4NZPA 4TS1A 4L2IA 1MB2A 2A1TR 1KQNA 4JYZA 4XFDA 1WXEA 3COYA 4MW9A 4NX2A 3CLTC 3F3MA 3ND6A 1H1TA 3FI0A 2QTNA 1QRTA 1JIKA 1N78A 3MLAA 3PNBA 4MW0A 1A8HA 2PZBA 5LM3A 3CLSC 3AFHA 3ZIUA 1KH1A 1GAXA 5KCMA 4J76A 1I2DA 1MRZA 3D6VA 3P0HA 3PRHA 4H3SA 2DR2A 1N2EA 4NATA 5HG0A 4DE5A 1SURA 2H2AA 2X0KA 4U8HA 1M8PA 1F9AA 1M83A 5F23A 3TS1A 4E1AA 4XSVA 1QNFA 2WB2A 1UFVA 3IODA 3COWA 2OQ2A 3MXTA 1PFYA 1XNHA 1EUQA 1X6VA 3FDXA 4EF6A 1GTRA 5TGTA 1ILEA 2E0IA 1MJHA 1T6XA 2J4DA 1H3FA 2D5BA 4PBSA 1N2GA 5K0TA 4DDHA 1JIJA 3UMVA 5IHXA 3NBAA 1PG2A 4MWDA 3A04A 4MUGA 1MAWA 1O94C 1VL2A 1MOPA 3NV7A 4G6ZA 1GZUA 4K0RA 4R2LA 5KHAA 3SZGA 1N77A 2E18A 4ZCRA 1EXDA 4KR6A 3ZXSA 2RD2A 4ZCSA 1KR2A 1N2HA 1O95C 2O5RA 2WQ6A 4MW4A 3A4IA 3D6UA 5H16A 1NUPA 4X0EA 2DETA 2QTMA 1TYAE 1JZSA 3Q4GA 1M8FA 4MWCA 4MULA 1CT9A 1I6KA 2IJGX 4JZYA 2HMAA 3X1KA 2A1UB 5J58A 1KAQA 4EG8A 3IMEA 2BTEA 1WXFA 5AHWA 1YULA 2J09A 3RFFA 4MVWA 5FNZA 1XNJA 4MWBA 2A84A 2BYTA 1TEZA 4MUNA 1WKBA
chains in the Genus database with same CATH superfamily
1GAWA 2C2HA 3WZLA 1LLDA 1UP4A 4FVTA 3Q0TA 3UAWA 4TSKA 1Q0HA 4JU9A 4YFYA 5MN5A 1SKYE 3ZWVA 1X8KA 2G08A 2UZ1B 1TLTA 3V1UA 2NP7A 1C41A 1Y48E 2Z3VA 1KAEA 4URZR 1ZI6A 1W88A 1MENA 4RQAA 2Q7DA 3RREA 1X7XB 2MIIA 4CG1A 3KX2A 1IY2A 1QE0A 3UFXB 3ZIDA 4HNQA 3IOYA 3DWGA 5F21A 5IASA 4BO4A 3B78A 3QV1A 3ROZA 3HP4A 3UHAA 3TM4A 1ECGA 4FYWA 2WYOA 2CV0A 3ZWPA 4O0MA 2XAUA 3RABA 3FMOB 1G8AA 3AEUB 3BA1A 1LJUA 3BTSA 4G2TA 4BCBA 1CQIA 1X1QA 3KB1A 3ZU6A 1CC1S 1HG0A 2GWHA 4MMXB 3ZI4A 1DHTA 2HMTA 1DV1A 4M4SA 3P2IA 1AMUA 2ID8A 3KQPA 3PLNA 3IEMA 4B6OA 5AJUA 3O2JA 4UCXA 3F90A 1FFEA 3I2HA 2NP6A 2J5RA 2WLTA 1GN9A 3Q7RA 2DHEA 5GOZA 1U0LA 1JIIA 3WFJA 1XNRB 1TJNA 3KO8A 1MAUA 1UPUA 2EP8A 3I6BA 4RABA 2ALJA 5HJ2A 1UPBA 1JDTA 4BZZA 5L6MB 1U5BB 3D2CA 1VOTA 3OLVA 5BQPA 4Z7QB 4RNDB 2P40A 1CVIA 3GZJA 3RTAA 1I7DA 5FUQA 1UJ4A 3VNBA 1A04A 2HF7A 4MCAA 1B6TA 2AEMA 3BDIA 2W6JA 1OH5A 2RGEA 1Y9EA 2WVJA 3KKZA 1YD7A 1PJSA 1WDLA 4LG1A 4NJMA 2XUOA 2PKWA 4N54A 1NOKA 2XCOA 3LL4A 3UH1A 4CIWA 5B4VA 4KN8A 1NF8A 2C54A 2BGTA 4HKTA 3B51X 3OMXA 2WUWE 1LBQA 3I8SA 4R5HA 4UU8A 1XQ9A 2H4XA 2P79A 4Q6BA 4HFNA 1C30B 4YRCA 3U26A 4CIDA 2J87A 2HMUA 2FVXA 2EFCB 1RZRD 3BMOA 4ZYYA 2NSDA 1G2QA 1U3TA 4JEHA 2OV4A 1YZNA 1ZGAA 3HBFA 3F7NA 3H1TA 3M1YA 4YAGA 3RCBA 1VYTA 5K4HA 2II6A 2VP5A 2YWHA 2ZSJA 1ZUHA 3IUBA 4GYJA 4UTRA 3QVSA 4GO1A 1VA5A 5CT6A 1VHTA 2JKYA 3FHCB 2BEWA 5KINB 4YMVA 4I1SA 3LO8A 3TLAA 4JENA 2B4AA 1I10A 1ZD4A 2Z5GA 4KFUA 3IDFA 1FIUA 2I34A 1AHIA 1QZ3A 3AVYA 1P2DA 3KPJA 4MUHA 3L6UA 5C7YA 3FDZA 3MJSA 3RFTA 1DJPA 2BDEA 2OVFA 3FW1A 3MJCA 5EKDA 5LB4A 3BYZA 1W4AA 4H7DA 3BWYA 4MLPA 3L84A 1U3FA 4OLAA 3ONNA 4IFTA 4LJ4A 3TQSA 4LCJA 4KXUA 2DKFA 2WKQA 2VZ0A 1LRKA 2J33A 2JAWA 2KLHA 2Z57A 3C3BA 1AY0A 3FAKA 5DASA 3E5NA 3IIEA 2CJWB 1B1AA 1RXSA 4DWOA 5KNCD 4X1YB 4CL2A 3V4PB 1Z8NA 4G37A 3GK3A 4BJ1A 1SKBA 3BS4A 3PQ6A 2ZR0A 5AW4A 3ZTWA 2KI5A 2A4MA 1PDWA 3FNRA 1WEKA 4M9RA 2CBXA 2ZCUA 3QOYA 2PR7A 1E9SA 4D96A 4G0QA 3FKJA 2EXXA 1GRQA 3PUVA 4LY0A 4C4ZA 3ER8A 3FDJA 1WP4A 5EIOA 2EX4A 4V1CI 5KNLA 1ESEA 4ZC8A 1LQ2A 4ZT7A 4LJRA 2ECKA 3VDNB 1L7MA 3UXEA 1G0OA 5FBVB 2F2TA 4PW0A 3PPXA 2O7VA 3MOGA 4EW2A 5BYBA 1RIIA 2VTDA 4QBKA 4YH1A 4BQRA 4ACBA 4YN3A 5NLLA 3VNRA 4CKYA 1WQ4A 5KDDA 1SBZA 1T36B 2GCOA 1GYPA 2NPFA 3SYRA 1C0PA 2E3JA 3M5CA 1HY3A 1GJRA 1VRVA 3EB9A 4L8GA 4ROSA 3VZCA 4AUMA 1JS1X 5I4IA 5KEIA 3HCEA 3H5VA 2GMWA 5IJ0B 3GNLA 1CJKC 3E9YA 1X39A 3N2KB 2B78A 1UOQA 5DISB 1MC1A 1GWNA 4CI9A 3WWPA 1DP4A 2VA9A 2FG5A 1GT6A 2NV2B 3PVSA 5T4BA 1P17A 3CRMA 3O1HB 5I48A 5KBYA 4PZEA 1NRWA 4RKWA 1J0EA 1DMSA 1NJGA 1T9ZA 2C4TA 2AK3A 1YSCA 2IU4A 1DRJA 3NM6B 2QRNA 1KJZA 3A1TA 3R5KA 1C3JA 1C4OA 1U2QA 5FORA 4EMBA 4ZHQB 1X0XA 1SU7A 3W2TA 1V11A 5EUQB 3WRXA 3ESQA 3KT0A 4J7UA 4EHNA 1C9YA 1KNQA 3WJ7A 3NJ8A 5ADHA 4GVXA 3QE4A 2OPHA 1Z2DA 4QUBA 4IWYA 2O20A 1ML4A 1Q91A 5C18A 2JI6A 3V1LA 4FYMA 2GVNA 1OV6A 5FOWA 4RVCA 3ID6C 1KFEB 3TX6A 2OFWA 4IEEA 1T3SA 1CF4A 3VOAA 1U9JA 1E9BA 2C5EA 2FFJA 3LDHA 4ZQFA 5CXUA 2HA4A 2C5GA 4U3JB 2H31A 1NXWA 1PL7A 2JLSA 4OQEA 4LQCA 3V7FA 4JL5A 5JDCA 3WAGA 4C0XA 3QQPA 5CT5A 2BMAA 1UC4B 2AD1A 4CL3A 2Z6QA 2C8VA 1W8DA 2FPOA 1S89A 4HXYA 3GUZA 2AF4C 5DKFA 3GDGA 3SSOA 2IPXA 2KHZA 2P0AA 1XKLA 3RRBA 3NGLA 3Q9SA 2XGSA 3HCNA 4O8CA 2QTVA 3DO5A 4JIGA 4IV0A 4IXTA 3GLGE 5DO9A 2O6LA 1ITZA 4AJOA 3ILHA 3K0CA 4D9IA 3GZTB 3CZ9A 4TKLA 3QBJA 4P36A 1LF5A 1Z37A 4UAJA 2VHWA 3HADA 5ES4B 3IGFA 4B7UA 4D9BA 4UC0A 2PUHA 4XLLA 1ZM2A 1Q1AA 3BIXA 2ZSEA 5FV4A 5TS2A 1WPGA 3GO4A 3QE9Y 3OZVA 3X2FA 4ENRA 1D6NA 4ESEA 1YNSA 5JVDB 3FNGA 2FQ1A 1OTXA 1G3RA 3TQOA 3NDRA 2Z8YM 5JC1A 1AU9A 3WL8A 3ICQB 2Q21A 1SB9A 3THWB 1CNFA 1XSEA 3R5FA 3MWLA 4ZANA 4R01A 1G21E 4EH1A 1E4EA 5I7OA 3OZAA 4X66B 1FUEA 3AOEC 3E1GA 2J3HA 3A10A 4G0YA 5EWLA 5FI1B 5HFJA 2I4RA 3V2IA 4ENSA 2Z5VA 2HADA 1COWA 4J8PA 5FHQA 2G1KA 3EGEA 1JQBA 4R0NA 3QOWA 5J2UA 1R0ZA 5JARA 1C9KA 3ANNA 1HLFA 3C3EA 3N8HA 5IWCA 3QMWA 4DV2B 4MJLA 3EVCA 3DO8A 3I2KA 1T9HA 1QO0D 5KIAA 2CXRA 4PG6A 2IVFA 2ACEA 2FPIA 2A0YA 5HS4A 2OGUA 2Z5LA 1NXVA 1FS4A 2WZBA 4AS2A 3UT0A 4U7JA 3AUAA 2XX3A 1ZN7A 2HCTA 1FTQA 3LYLA 4Q4AB 2O57A 1YTLA 2AVNA 5DN9A 3GMSA 3ROMA 1DC5A 5KYTA 1TC1A 1L7VC 5J2TB 4HDNA 1Q57A 1RM5A 3Q7EA 2IV3A 1CNMA 4H7JA 4BC1A 4YMHA 3THXB 4ARBA 1PZHA 2BISA 2VC2B 2F1IA 3D2BA 3NOXA 4ZO9A 2WEKA 3JATB 4ZQEA 4R9VA 3BK7A 3OIWA 3ZNNA 5BW8A 2R0QC 4KIUA 1JEOA 4H7EA 4L8LA 2JFFA 4IW3B 4LMBA 5ARCA 1XZPA 3IBSA 3V8VA 2Q4RA 1FTSA 3DDOA 3MMSA 1REQB 2IYXA 4QIHA 5JAPA 3K4HA 2MMGA 4J2HA 1PGPA 1SO8A 3H2SA 4TKVB 4D79A 3KDPA 3SY8A 3LP8A 3PDHA 3DV2A 1CJMA 5AH0A 4JUDX 4QDXA 5LA6B 1Z0JA 4AO7A 2UZ4A 2YIJA 5IXJA 1FJXA 4H9GA 1KTVA 1DINA 3GQBA 3Q7QA 1XHLA 4TOIA 4MIYA 1FVHA 5SZHB 3RVDA 1X94A 4QYTA 3ZCTA 3UJHA 5EHNA 3QVGA 5CGQB 1BGVA 1VBKA 1VJTA 1CXZA 3H99A 1QHIA 3N3AC 3BWMA 5JS1A 3E1KA 4GH5A 4UCWA 4BMNA 1V9CA 1JXQA 3UXMA 1ODCA 3V8RA 1NVEA 3KB8A 4RWZA 1TVEA 3EODA 5JLAA 1VE1A 2PKQO 3LFTA 2REBA 4URVR 1FMFA 4QFDA 1F2TA 3GOQA 2F55A 2P4QA 2B0CA 4M9SA 1JHVA 2GA9A 4OQYA 1HDEA 2FEKA 4JQCA 4WZZA 4CIVA 2JK0A 1AKYA 5DMXA 1R2QA 4XGIA 3SDZA 4U6NA 4CM8A 3MUNA 4RGYA 5KPJA 4H6XA 1J2JA 3KJEA 4IDQA 1FFXA 3FNFA 2RBKA 1Q12A 3O47A 4FJ1A 1D5CA 3EBOA 2OFPA 5FB3A 4X84A 5ALZA 1GGFA 2V6JA 1Z4KA 1KQPA 1ZM9A 2B1JA 1EHCA 1XN1A 2IUFA 2RONA 5DT2A 1KRXA 3RUDA 3LOPA 4HGYA 5LNK6 2HCRA 1EK0A 2UVPA 4PBRA 1ZM7A 2IXAA 1KDPA 2C84A 4QLAA 4CCYB 2VTBA 3ZGVA 1AKVA 1X80B 3LSTA 4E4YA 3KTAB 1YGYA 4ID9A 4OXRA 4WPGA 1O9BA 4N9QA 4RHTA 3TL6A 2IE0A 3C3WA 4NEGA 5KX5B 2IY7A 3CURA 1QHHB 2UV8A 4YEDA 1SHTX 2AXQA 4JC8A 1HT3A 2OV2A 4BVHA 2HY7A 5IUNC 4ARCA 4YYZA 3W8DA 2UXBB 1CP2A 4JVMA 3TZHA 1K86A 2V7VA 3H9GA 1YDMA 1CULC 4KL8S 1GZ3A 2J0UA 4L7VA 1P1FA 1R4NB 1MNQA 2H9IA 3U4IA 3WNZA 2RE8A 1E3WA 2YVKA 3RWBA 1E6UA 4TWZA 1RJGA 2VF7A 3U17A 2OENG 2BLNA 2C99A 2PQ6A 4RXTA 2P0YA 4C5CA 5I7SA 4ZYLA 3KXDA 3VKUA 1XX6A 1T5LA 5A1JA 3SHFA 1PQ4A 4X71A 2YQ4A 4KLAA 5ENDA 4MRSA 4DN6A 4MGEA 1QIFA 1WPQA 4RZIA 1MO5A 4NOMA 2HQRA 3GJYA 3MTDA 4C2TA 2ONKA 1T4CA 3P7MA 3RS4A 3RSCA 1GZDA 4XQ9A 4M8LA 3UK6A 3EXHB 4Q3DA 1UXJA 1Z6QA 4OGFA 1VLJA 4B73A 4YRBA 2QTNA 1YDFA 2R48A 1MT3A 4BATA 1QVWA 2HXSA 4NMWA 1HEUA 2E55A 2EF0A 2ZVJA 4LZJA 1NX6A 2ODAA 4H7IA 2XCLA 3RKRA 2GB4A 1QIHA 3DKIA 2CC2A 1R37A 3WAKA 1KH1A 3UJAA 1S02A 2BFFB 5AVUA 1EBUA 2XOXA 2ZJ7A 1ADCA 2O1EA 3PRHA 4M54A 1YO6A 4QNMA 2GEKA 3KHUA 1SURA 1MEEA 2IHYA 4Q12A 1ZLXA 4KNVA 4YCDA 4TZ0A 1GUBA 1M83A 3I9MA 2ZYRA 4ZYUA 1EFCA 1ZX1A 3KLNA 4E2FA 3TS1A 2PVSA 3A6DA 1GKLA 1HEIA 3Q9NA 3NM5A 5CLJA 2EV9A 4YP0A 3MAGA 1ZVKA 3LCMA 1IXZA 3M6LA 1ZY2A 2P9YA 3NRBA 4FHZA 4RGQA 3CZPA 4TWRA 3OPYI 4GI2A 5DE3A 3D7MA 3H11B 5BPFA 4GLJA 4LAFA 4DMLA 2GK3A 3CX3A 2VWQA 4B17A 4CKBB 5EJ6A 4BX0A 3NHAA 3ZD7A 2V3VA 4G1EB 4JJGA 3OIGA 4US1R 3TPCA 3PXGA 5IWAB 1HSOA 1UDCA 3JSAA 5JBQA 1PWHA 2PGNA 2QD1A 1VKZA 2IBMA 1FDRA 3DBHA 2R2GA 3DNPA 4GGPA 4AN1A 5AUNB 5I7FA 1GR1A 5KWIA 2CXNA 2FGKA 3T5MA 4ZI7A 2ZSDA 5CH3A 3G5MA 1JWAB 4G9BA 4JB2A 4PZCA 3S7TA 1SCAA 1YJXA 1KFCB 3SK0A 3W90A 2FU5C 2VBGA 1MHPA 3A4IA 2W90A 4K7JA 4TTSA 5AW6A 4ARAA 2O3JA 4EJMA 5F3WB 1VYUA 1MC5A 5EAIA 5HQ3B 2GLXA 1S6YA 5JY6A 4Y9DA 2AYZA 1BA3A 1FQOA 4A16A 4LNAA 4MWCA 4HADA 4OEHA 2JGDB 3U1BA 1NMYA 3GUHA 2FPMA 5CB0A 4DYHA 1T2FA 1W0JA 4RHYA 3V48A 3HDJA 2WTAA 3N0XA 2O5CA 4IDGA 2B92A 3IMEA 1TZ2A 1E62A 5AVOA 5BSWA 4KREA 4U2DA 3D8BA 3KHKA 4PC2A 5HWSA 2G6BA 121PA 3CW8X 1TEZA 2JEYA 3OPMA 1SPXA 1WKBA 4EA7A 3AI1A 4ZVSA 2JLAA 2VPYA 2B6HA 3COZA 1KI2A 2X42A 2LBPA 5IAKA 3UMRA 1RPTA 4QRIA 4W6QA 2X76A 3D6MA 4RPJA 1ZJZA 3IUNA 1VKHA 1X7YA 3VPGA 3B52X 3ICCA 3K8YA 4MPPA 4W8HA 4WINA 1FRZA 1FZTA 1LC3A 5F2EA 1LLUA 1SCDA 2C2MA 2ODPA 4QWWA 2AN1A 2Q3DA 3G0DA 2GKGA 2F3TA 3LKDA 3PEVA 3HO6A 1B74A 3K72B 4WZBB 4CT4B 5BV7A 4TXLA 2YYZA 1E2LA 3QLVA 1XMXA 2P2ZA 2QTRA 3RU2A 3MAJA 5DLEA 4DV3B 4G24A 3R3HA 5JFTA 3QPUA 3AVUA 3ZN2A 3K9BA 4ZQHA 1C7EA 4WA7A 1IJKA 1S3IA 3ZZTA 1IJEA 3CLSD 1DKLA 1V2GA 1Y1KE 2ADOA 2NQ2C 2ODEA 3DR5A 3EPPA 3G23A 3M2TA 3H8WA 4EMUA 3K70C 3VSAA 2XTMA 2ZE6A 3PXEA 4FCWA 2CNWA 4GWLA 2AJCA 4GNKA 1U7HA 1KVQA 2YL2A 3M9LA 3A58B 5TVKA 5EZQA 1AO3A 1QIDA 4FMPA 2HRQA 1ZEMA 2XADA 5DYNA 1WUHS 1C4KA 1L1QA 2IVZA 1SIOA 1G8KA 3L8GA 4HWSA 2ZRGA 5G4KB 3N5CA 1DMRA 2GHTA 4JI7B 1AHHA 5CT4A 3LWBA 4MWTA 3R3UA 1A9YA 1PWZA 2P2YA 4B40A 1QFZA 2XUKA 4H0CA 3ES9A 2JRCA 4YONB 1MO3A 3O82A 1OGIA 3W8RA 8OHMA 1RP7A 4XQCA 1VJ1A 3AGQA 2A57A 1UWLA 2P6UA 1JL3A 4JYAB 4BECA 2WICA 4HLDA 3LKBA 4G8JA 3VJKA 4ABYA 3PP8A 5C8XA 1DDGA 2GZMA 1UKEA 2WJGA 5JNRA 1IJFA 2WHXA 1QCZA 4BU1A 2G5CA 2B4QA 4KO8A 1DL5A 2R7MA 4O2BB 3SJZA 1Q19A 2NO9A 5KYUA 4QREA 4CETA 3AR4A 5LNK1 1D1SA 1TTTA 4IG4A 2PU5A 2O7SA 1NKSA 1EZ1A 1L5SA 1O03A 3WGGA 2VRCA 4IVPA 5BQFA 1WUTA 4JN6B 1VHDA 4DYDA 4F84A 2R86A 4IOKA 3VR5H 4N41A 1CERA 4Y6QA 1E0JA 3HKEB 1P1HA 4UARA 3TIVA 3Q15C 2NNWB 1WXQA 4K5QA 4KQHA 5FO1A 4QO8A 4TV9B 4Y1RB 4BE7B 3Q5DA 3JWIA 5F3RA 3AFMA 1OLSB 1KORA 4LGYA 3NBYC 1DKMA 2IQ5A 1PE0A 4ZIRB 1EP9A 4K3VA 4NG5A 4WOPA 4AN4A 4AZ0A 3E23A 2PT9A 1TFUA 1PT9A 4LQLA 2XAAA 2GRJA 4NZZA 5EIHA 1PSZA 4ND3A 3AYZB 4M0KA 4BNMA 4DSAA 2QXYA 4ZVKA 3SIXA 2M6SA 4YROA 4CV0A 3K6JA 4NQRA 5DTJA 4M0MA 3PEUA 1PAUA 4K46A 1BFUA 4G4IA 1RABA 1BJRE 2K87A 5EUCA 2PH5A 2FN7A 1P1CA 3GBSA 3NOOA 1EFVB 2A94A 4NBTA 2HU2A 3FOCA 1ST2A 1W4LA 3DV0B 4N0EA 4IIEA 1SKYB 2FOIA 3UK2A 1GLVA 4A2WA 2ZBUA 1CJBA 2H65A 2DQ4A 1ZK2A 3P2YA 4M49A 5ESRA 4DFDA 5BOSA 5EXDA 4V0QA 4IUDS 3S3TA 1U9IC 4RENA 3AKCA 1EINA 3ESBA 4WUTA 3I6MA 2V0CA 2JC3A 2ZOSA 3ILYA 3MWEA 3VPHA 5TDHA 5LDDC 4MQUA 4V0ME 5KQPA 1QVVA 1R1DA 1BVYF 2N47A 1V6AA 4O3FA 1JVSA 5L3RA 1L7XA 3PSHA 2Z6AA 3E9ZA 2MSEB 4D3SA 1GAQA 1LW6E 1G66A 2YJ5A 2HD4A 2NQTA 1XGKA 2FWMX 2AYYA 5AKGA 4FGZA 2EFDB 1BWSA 3SICE 5K9ZA 1F8UA 3MLBA 4C7XA 1WUKS 3QXCA 1BMDA 3SP1A 3EFOB 1RI2A 3OX2A 5FTLA 3JQ9A 4X64B 1SXJC 4ESHA 4J0IA 4PV7A 4KTTE 5CBPA 1ZJWA 1Z39A 4N12A 1X2BA 4LHYA 3OHMA 2W4QA 3HNRA 3IS3A 3RJTA 3W7BA 5JFOA 5K6AC 2FKAA 4DR1B 2H9AA 3RB8A 1T9GR 4ZOCA 5F1YA 2XE4A 1XVVA 5E4YA 1QGUA 1Z7YA 4MDFA 3MSCA 1C81A 1PTJC 2WU8A 2WE8A 3ZHUA 4NECA 4WLFA 2G6TA 2ZJ4A 2V6FA 4YGXB 3WVNA 2WTMA 4B32A 1V35A 2G40A 3A11A 4GKKB 3V8QA 2MYNA 2CF6A 1CRQA 1CZRA 5JCXA 4HAWA 1WSBA 1X9HA 4JGIA 3KEGA 2NVOA 4AI6A 5CFZA 1Z07A 2ATIA 2PRIA 4W7HA 3INGA 1HT2E 1JHUA 4QUAA 3NM4A 4C22A 4D4IA 4EKDA 5BUCA 5HF6A 3RKUA 3GHYA 4YHHB 3Q8WA 1RYDA 4OXKA 3F9RA 1L7QA 4EUFA 1LTKA 1YS1X 2ZI7A 3AHFA 4KQFA 5CVTA 3NHMA 2CGEA 2BZSA 3ZUGA 3V5NA 1V6CA 3GJ5A 4DPMA 3JZFA 3TXYA 1BMFA 1IN5A 2YHSA 5BN3A 3BIWA 3PKZA 3CKLA 3JTMA 4JMPA 4PPQA 4RMNA 4R1NA 3CT6A 4NU5A 1ZC4A 4ZXFA 3HDQA 4OYRA 3WMGA 1DU4A 3TSYA 3A7DA 4AQDA 2BEJA 4A5OA 1EXVA 4KR7A 1XUOA 3RS8A 3PWTA 2ZRJA 1JHPA 1N5KA 3O8OB 4YJ2B 4DC9A 2Q4OA 2ZI3A 3DEKA 1T0JB 2MSLA 3KT8A 4D74A 2Q5HA 1CRZA 4XWTA 3T3NA 2YZMA 3WKCA 2ZROA 3R7AA 5AJZA 4IH9A 2VDWB 3BD8A 3FOBA 1YB4A 5JPDA 1R0BA 2WUDA 1CK4A 4LMPA 4EG5A 5FLKA 2Y6UA 3A4NA 3WWOA 3ZPXA 2PT6A 2QYTA 2GUGA 4I3GA 4P7BA 5AUPB 2QQ0A 4R9RA 3UJPA 1LZLA 2C57A 3FPEA 4C7KA 4OK5A 1U9ZA 1AZLA 1K4YA 2QVBA 3JZDA 3Q8LA 3AM3A 3VTKA 2NUAB 4KFSA 4DCJA 5MN6A 4QHYA 1H8EA 5C7IO 5KTRA 5LKRA 1RWOA 5AKZA 1PS0A 4B80A 2HJVA 1U7UA 1TJ5A 1NVBA 4A2PA 1N77A 3FLEA 3EC2A 2QSUA 2R25B 4R3WA 5SY9A 4DGSA 4QNNA 4MYDA 3D4IA 3DTVD 1PUXA 2XUJA 4YI3A 4D4LA 3OJWA 5F77A 4ZEOA 3ADKA 3KYJB 2XVYA 4GOXA 1NW3A 1XQWA 4KE8A 3UMCA 3ZC3A 1L5YA 2YFQA 2PK3A 3HHPA 1HLPA 5FTJA 2PRYA 1R4MB 3NAMA 3X1XA 1FYXA 1V41E 4CKEB 4QTUB 5IYZB 5H8WA 4WVFA 3RE1A 3DOFA 5C8VA 1Z83A 2IZZA 3RHFA 2QJRA 2VJYA 3A7EA 1E7MA 1P72A 4LXTA 721PA 4H1VA 1DO8A 1YS4A 2VATA 4N0DA 2Q5QA 2JLRA 3OMLA 4GXRA 1AKNA 2WG0A 3IMCA 1KK3A 1TJ4A 4L0CA 4DY4A 2W8BA 5GJCA 1Y5IA 4NG4A 1Q15A 4ZJYA 1PWXA 3ISJA 4KBYA 4J0KA 4PTYA 4D9KA 5K2OA 4RD1A 5KYYA 4JJIA 3V32A 1R0YA 2GPTA 3IP3A 5FEUA 5LZ4A 1TC2A 3FPCA 3L18A 4Q5IA 2RJNA 5A62A 1I2CA 5T6MA 3UATA 1C1XB 1QTQA 2FMHA 1I6MA 3FPGA 1E5VA 4DNPA 3TZEA 3UAOA 1H4TA 4Y6RA 3FTNA 1A9PA 3HN2A 1U8YA 2DRIA 4CU5A 4IMPA 2O0JA 1E8NA 4IO0A 1X87A 3B6EA 3LOQA 3G0BA 4AW9A 2Z2ZA 3ZHTA 2EFEB 2HIGA 4C08A 1QORA 1KJ9A 2CNBA 2GF0A 3GGSA 3F4BA 5EIEA 1T0BA 2DQZA 3K2BA 1V9SA 2EJWA 2O8EA 2QRJA 5BXYA 1T4MA 4QM6A 4EPWA 4UD2A 4PAQA 3O4VA 1G4UR 4HEHA 2PXHA 3SG0A 1XCBA 3VZSA 1DT5A 2GNOA 1MO2A 4Z53A 3IELA 4F1WA 1RQRA 4YPOA 1B0UA 1MFZA 3U3DA 5AW0A 3FMVA 3NR2A 3BTVA 1N5OX 1Z13A 2K7FA 3F73A 2CB0A 2ZRDA 2OQVA 4AQ7A 3KTFA 1MB3A 2BMFA 2JIOA 4QGAA 5F52A 2NUTB 3KHSA 3VJMA 3VAYA 1B3RA 3DEAA 3E9DA 4QULA 1N4AA 2VAXA 3ICWA 3TIGA 2X4LA 4Y6OA 3ZZ1A 3S55A 1LPAB 3TL2A 1WOYA 4BKMA 1PFQA 3H6KA 3LCCA 1J33A 3G7SA 3PI6A 3PQ8A 1B26A 2JL1A 3QPDA 4MGYR 4PLPA 4A9AA 1KXZA 4B6QA 1E2JA 2YWFA 4MQFA 4BX9A 1U9YA 1VG8A 3GLGB 3SR4A 3FUTA 2D1RA 1UEIA 2GXQA 4CRWB 4NR0A 2OCIA 4YDHB 5A6VA 4C6HA 3QFCA 4FS3A 3FF4A 2WFAA 4QGHA 5ILGA 3V8EA 5JTUA 2HWUA 3SBOA 2BKLA 2JH8A 2AI3A 2PUJA 2RDMA 3EVNA 5JFGA 5JMOA 1XCJA 1NV8A 3T3GA 1MAAA 1TPZA 2OO7A 2WAYA 1C3EA 4U9UA 4ZOAA 2WWIA 1T34A 5CFQA 4LV6A 2R1UA 2G9NA 1T43A 3DF7A 3GT7A 1Q1BA 2G28A 3OPNA 3KEQA 3S2GA 5L40A 2OV3A 3BG5A 2TSYB 2I0FA 3QKRB 4IILA 3IV6A 5JZMA 3M7IA 5I01A 2P8SA 2XUFA 3A4VA 1QCYA 3KQLA 4PYLA 4R6XA 1WB5A 3WP0A 2JCGA 3ETLA 3TRKA 4H0FA 1G21B 2WQ7A 3LE8A 3ZVKA 4I4IA 1KBOA 3QXSA 1CUUA 3L7OA 5IAEA 3RK0A 1JHQA 1FC0A 1MN6A 3BMNB 3HJRA 1V7PC 3PKIA 2WJVA 1C4WA 1KY5A 1UBGA 4JA2A 2YV3A 4WKBA 4EF5A 4FGUA 1ENPA 1XZJA 1Z0DA 3I9KA 3L6RA 4XD2A 5G4LA 4RTSA 4HUJA 1ZW1A 4LSWA 2G1PA 1CS0A 3F3MA 4NX2A 4KZPA 3FI0A 4GPTA 1YZKA 4Z1OA 2A9KA 3TTWA 4BMXA 4DJJA 4OQDA 3SLKA 4F97A 4IDDA 4P84A 3K96A 5IBQA 3RV4A 3SC2A 4E6EA 5I7VA 1LPBB 4I46A 5AK4A 421PA 4WBNA 2IUEA 4IH1A 5LM3A 5HW0A 2X7JA 4K88A 4HLQB 4WK2B 3SR0A 4ZJPA 5DBGA 4UEJA 4NYIQ 3N86A 3IT2A 1MRZA 1D5WA 1TRHA 2VK8A 4ROTA 5HJ7A 2PTGA 4JI0B 3OLYA 2O50A 1IHYA 4XZ3A 5TV2A 3NIBA 4L85A 4YRZA 3FCYA 4L07A 1EAMA 1XP5A 4WOKA 1TCVA 1XKXA 1O87A 4RETA 4JJFA 4MRMB 4WCFA 3OESA 2WTBA 3PFCA 5KNCA 4MVJD 5KTTA 2GZHA 3UWPA 5KHLB 3Q5GA 2OZPA 3ESAA 5B6IA 1U6KA 1V45E 3F5SA 4S2UA 1PNRA 4R8KA 3B1JA 2GHQA 3CCBA 3CUTA 3FPSA 2XEXA 1PFYA 2WHYA 3C8DA 1XWFA 1KI8A 3GVXA 3LQ1A 2ZE8A 4ZALA 3RSHA 5IFLA 1X42A 3V4ZA 4RJ2A 1FTGA 1UH5A 3OQOA 1T8SA 3B2QA 4ZVMA 2GNAA 4LK2A 1OXSC 1BXGB 1KXJA 4N7BA 3X1ZA 1KK1A 1VL8A 2XODA 3J7TA 3UMVA 3REGA 3GJXC 1RE0A 4BQIA 1A8PA 1OLXB 1MAWA 3BZBA 4MARA 4QJIA 5EPUA 1CB7A 3GZNA 4FSHA 4LJKA 4J3JA 4R54A 5JJCA 1JMYA 4CNQA 3DCYA 2RKWA 3QW2A 1ZSNA 1O95C 3USES 4MQMA 3UT5A 4HRYA 1WY7A 1NNLA 1PTKA 3HKBB 3NH6A 1X13A 2XKAA 4ZTUB 3QFHA 2QP9X 4KLZA 5I9LA 3KG2A 1ZI9A 1TQ4A 1CZUA 4PHHA 3JALA 3CONA 1FUYB 1C8LA 2GYUA 2AW3A 2QB5A 2Y76A 4QDTA 2M6RA 2C1XA 1KF0A 1HLDA 4BBJA 4CKXA 5C52B 1ZCBA 3K92A 2ZI5A 1NT2A 3I45A 2YJZA 4URWR 3VPDA 4PO3X 3UPDA 4LSGA 1ABFA 4QXMA 4FFVA 4BQEA 1JALA 3T35A 2AN4A 1SXQA 5FUWA 2FZKA 1F14A 4ZOEA 3F4LA 5BNFA 4S05A 2XXBA 2GAOA 3VR4D 1TVKA 3NTVA 4AY3A 4N01A 2O1SA 3NBQA 4LWOA 4MUNA 4FPXA 2BFOA 2IWHA 1H2WA 1OASA 3ZW7A 1GPNA 5PGMA 4HDSB 5IH3A 5J2UF 2R00C 3DGEC 3MF4A 1ZRMA 4BFCA 1G291 4OBWA 1RI5A 5KKAA 1QBGA 5KWVA 4N47A 1ORHA 1H9CA 5LCXA 4CR7A 4A8HA 4V0NA 2YXDA 1P44A 3UTDA 1ZL2A 3FF1A 4RD6A 4EB0A 2XNCA 2FRDC 2G72A 2BFCB 1C9DB 1ZSVA 2RMKA 1QIKA 2GZ2A 2XYPA 3A2NA 3JYNA 1I7NA 4EF4A 5D7BA 1SZJG 3CIOA 3K1TA 3QYFA 1NJSA 5FYDA 3N3BC 5FPKA 2WUFA 3GLTA 4MS3A 1IEQA 2Z9DA 3U40A 4QSHA 1C0KA 2FETA 2ODWA 3QVKA 4B9EA 2WTUA 3INYA 1T1EA 2D0PB 4KPGA 4BMPB 4I5IA 3UMMA 2IPNA 2QV0A 2KW5A 4MV9A 4R40A 1N36B 5CB4A 4OVKA 4EY8A 2JI9A 2IP2A 3WTBA 3A31A 5C5IA 1MA0A 3W5HA 1BA2A 1PS8A 1JQJC 4I1YA 1GPH1 3H1PA 2QRZA 1I4TD 3CJQA 2CVFA 3FMPB 4MA4A 5DI9A 1K88A 1LJLA 3H1EA 3TW8A 3GT3A 1L5WA 4C14A 1ODKA 5LXTA 1J5PA 2XMGA 3F74A 1F5SA 4IIXA 1QJCA 2EGHA 1OFGA 3ESZA 1EQ2A 4IFBA 5HDQA 2EW8A 2YN0A 1YI1A 5LBIA 2CLCX 1QIJA 2GK4A 4MKZA 3DKVA 3OFND 5FOTA 3NFYA 1TT7A 1AOXA 2G9RA 2H4FA 2VXYA 3FZYA 2ORVA 5FQOA 4AWAA 1KMHA 3RYCB 2HSWA 2AFHA 2WAMA 4UE3S 1Q7CA 1DBWA 1KVSA 4PY2A 3EH1A 4R9NA 1BFDA 3VPBA 2Z08A 1EP1B 1T2AA 1BGXT 2WRZA 4J0FA 4MRNA 1T15A 3TZLA 4F11A 2H54A 3PGLA 5L51A 2HMVA 5LP6B 4FR2A 3HLYA 3ZY4A 4HLUC 1BWQA 4EVQA 4DC0A 3TCXB 4G5FA 3O4FA 1M2VB 3SKVA 5CAEA 2IEIA 2CT8A 3GAAA 3D8UA 4R9SA 2QJFA 2Z56A 4FBMA 4RE6A 4LE1A 1M0TA 3QITA 4CEIA 5F73A 4GX1A 2WUGA 3NVMB 1Z68A 3MBOA 4BBPA 2VP9A 4EWLA 1AKTA 2ZJ2A 2CHEA 4K9OA 5JCOA 4JMLA 1VMAA 4X61A 1QO0A 4MW7A 4CMEC 2B83A 4BRZA 1HDCA 2VHVA 4MIEA 3PC7A 4Y6GB 4P53A 3N2ZB 2YV4A 1U2SA 3SNHA 3T7AA 1E59A 4C2BA 1FRNA 1LI5A 2RHMA 3C2QA 4WGFA 1E2FA 2HU5A 3SS7X 2JJYA 5I8PA 2QP4A 3OLQA 3IILA 4D42A 3AF2A 2UVDA 3EIEA 1Q83A 4ZVOA 2IH2A 3N0RA 1UBFA 2C8JA 1PK8A 1RD4A 3ICVA 4MNTA 5E6RA 4DRXB 2HPHA 1JG4A 4JOQA 4JEIA 5CEJA 4FDTA 4M9XA 4GR9A 4V0RA 3FPBA 1FUUA 2QUKA 4YWJA 5JE8A 2ZBEA 2XE8A 4G0ZA 1UKBA 3OEHD 5HHTA 2VIIA 3VKFA 3LX8A 2DSTA 2GNPA 2HDHA 1YVRA 2FWRA 3AUJB 4S1OA 3U7JA 3U19A 3JQDA 2NU6A 1K4KA 1W0KD 2IPOA 1VL6A 2KWIA 4C0BA 4M1MA 4FJ2A 2A86A 3EXEA 1S2LA 3HBNA 5AXBA 5AVWA 3PE3A 2EWMA 1YMQA 3GBVA 3PXAA 2WIFA 4H7KA 2Y6VA 5K4AA 3LW7A 3LXXA 4AZTA 2BGKA 4HGOA 2O3RA 1YT5A 1Y4DE 3IKLA 2DPYA 2IEDA 3I8OA 1ONSA 5A9SA 4D2IA 4DANA 1JJFA 2OB2A 5DIZA 3FA2A 4KSYA 1R6XA 1XQ6A 2IOFA 2ZG6A 4GI3A 1Q5PA 4HAVA 4XPIB 2W2LA 3T9FA 4D0SA 2XJ9A 1EM8A 3AG5A 3N0WA 2AVDA 1C9NA 2C5LA 3TKYA 1FNSA 4DEXA 4OY3A 3PUHA 5CVVA 1KI4A 1R6VA 1ZJ4A 2F67A 1H2ZA 3PGMA 4JNCA 5IXYA 2R1VA 1U0BB 4YMIA 5HK8A 3QFFA 2XVMA 3L0BA 3EIQA 1TD1A 1GPMA 3D0KA 4U2CA 4AYXA 2R4UA 2YBEA 2RHRA 4PFKA 4B8ZA 3X1WA 5LL6P 3WB0A 2V0GA 3GRVA 3G82C 2I9PA 3CNOA 1L7EA 1NBIA 3N2LA 4U2GA 1JG7A 3ZBUA 3IRUA 4KQWA 4JLWA 3FY4A 1THTA 2DOKA 1SBCA 1D2RA 3AU9A 3C8HA 2UZ3A 2WJ6A 3ULKA 1EBFA 3VO1A 1CRPA 1KY2A 4CFZA 3AILA 5KMGB 3DZIA 1Q84A 3T9AA 2DKNA 2QPLA 1XZNA 2IP1A 2PFGA 3KOOA 1DADA 1BRMA 4G1MB 1ADGA 1N0UA 3R20A 4CKZA 3K5IA 1FP7A 1DRUA 1T13A 2N75A 5AUOB 4YMSA 4JYBA 3FCUB 1L7RA 2NMVA 2ZIVB 4WUVA 1SY7A 1T0IA 3ZG6A 1WABA 4FFOA 2JFXA 4XH9B 5LMUB 1E3IA 2ACWA 3HDVA 2XKKA 1OJ7A 3WJ1A 1E9VA 1YRHA 4EG1A 2HR1A 4RHEA 3BGOS 2CYBA 4ZI7F 4Q7KA 2KQUA 4N5HX 1YBMA 1P61B 1H5NA 2C0PA 5C8YA 2IX9A 2Q27A 4R2WA 3D02A 2PZJA 4FFLA 4O33A 2PMBA 3AM5A 5B1EA 4OKIA 1MOZA 4OH7A 1DQRA 3CQ9A 3N2GA 2QN9A 4GQIA 5EWJB 2J3MA 2V6BA 3GQVA 3OTQA 4FKMA 4YJ3A 1II0A 3R4VA 4RPIA 2GPWA 2X5OA 3BWCA 3U3ZA 3CR3C 3KJIA 4H1UA 1QV9A 1PW7A 1U0GA 4YQYA 2FN9A 4F2WA 2JHAA 4ZOLB 5K6TA 1KWGA 2QUAA 5IDVA 4TMVA 4HB3A 3L43A 1Y5LA 4UFNA 3RD5A 3B1KA 2VKTA 3MUFA 2PT7A 1YZ3A 3C6QA 3MERA 1IWPB 1QBKC 3QKIA 3R0QA 4P5PA 2X6TA 2Q3CA 1RVDA 4KI0A 1LW7A 2H1LA 3NRJA 3A9VA 1KYZA 1UMCA 1XA0A 2M2IA 3BFPA 4QU9A 3J81A 2NXJA 4RY2A 3U7GA 5DOZA 3RT9A 1BMTA 4RKQA 1RCTE 5L4SA 4Z3DA 1TMGE 1JDUA 1AF7A 1R0WA 2GM3A 2QLBA 3PC2A 4M1TA 5B2EA 1Z6PA 1P3Y1 3SE0A 1LK0A 1TM1E 1TB4A 2EU8A 2Z4SA 3K5HA 4HDCA 4QASA 2PIDA 1T9KA 1Y98A 1N2CA 2XOEA 5BR4A 3SYMA 4K1XA 3ZJVA 2FE1A 1TK9A 2M32A 4FC7A 4TS4A 5CYPA 1PJAA 1W9MA 4TMTA 3WWZA 3U7FB 2FW7A 1Q0QA 2AQHA 2X4IA 2Q1WA 3MRXA 5H0IA 3MRVA 3RV3A 3E82A 2IGTA 4MV8A 5H81A 2VNKA 1DRWA 4M1YA 1KRWA 2YC2C 1M72A 4J3FA 4PQEA 1TF7A 5JS8A 4RZHA 2WKSA 3ML1A 1SXPA 3U3XA 3LTNC 3HM9A 5G0UA 4Z8YA 3DDWA 1KZ7B 3NNDA 3CW9A 4Q7MB 1BXZA 1OLUA 3GCDA 4U9HS 4JI2B 4HFRA 4GX0A 4LZAA 5AHXA 1XCPA 2YZ2A 2QGNA 5HZKA 2H08A 3B36A 1KKUA 5ALXA 1ZW6A 2PKRA 3K32A 3ROGA 2CK3D 3HUUA 4QECA 4B31A 4B7XA 4UBNA 3GDFA 2FLVA 4DYVA 1P77A 3TSCA 3IKVA 3IB3A 1VLLA 1VE9A 3F67A 2GZDA 4UEQA 5AHRA 4EX7A 1PGOA 2DWQA 1VDZA 2WP0A 5TEWA 1M6YA 4OIMA 3PQ5A 5BUSA 1OI3A 3DFZA 2FSVA 5BURA 1G7CA 2A92A 4YECA 4P86A 4DDTA 4JB3A 4XEUA 1O3YA 2HK8A 1EQAA 3B1WA 4S12A 1NUSA 4KIWA 4PS1A 2PH3A 3S2FA 1XXHB 3JX9A 4YRFA 4DDVA 1DNPA 5FKJA 2YFHA 1UBMS 4M6WB 3QEMA 4HDKA 2YWDA 2K2QB 1HE8B 2V4UA 4FYJA 2F3PA 4RV4A 1PZEA 4UBJA 1PFKA 2H1VA 4HTFA 3WLKX 4B0PA 3O83A 2XT6A 4NZNA 3SSAA 2KBEA 1AA9A 1X7WB 2QTZA 3P9IA 3I5XA 4Z4QA 1PK9A 2D2EA 3PIDA 2QTCA 2QF7A 4CUKA 4KWEA 5EXTA 3QWBA 3IE0A 1XZQA 4OGGA 5ICGA 3ASVA 3AYXB 3UB3A 4EB3A 4MKFA 5AR1A 5J47A 3TGPA 2I2DA 1ONPA 1GEGA 1VKJA 3JTEA 5HM8A 2AQ8A 2HA6A 5BN4A 1N1MA 3W79A 4AECA 1CY6A 2Z5FA 5IJ9A 3HJCA 2Z43A 1DOHA 2BEUA 2J0VA 1J8YF 4XLTA 5GM1A 1YB1A 2QVLA 2ES4A 3LUFA 3QWFA 1POWA 1IFXA 1FXWF 5FADA 4HZIA 3KL2A 2JIZD 2ACKA 2WF7A 5FH9A 3U0BA 2LVBA 1DKOA 2WZQA 4G4JA 3WBFA 3DVLA 3OM8A 4D26A 1W94A 3PHIA 3VR6H 1R5NA 1VMIA 2NZUG 4WVLA 2B99A 2XGOA 3S5UA 4BNWA 4D6XA 2BSAA 2G4CA 1CYDA 5G0VA 4RFLA 4RTLA 1YMUA 2BGIA 4PO8A 3QIVA 4HYQA 3DAHA 3OE7D 4G9EA 5BQXA 3H1FA 1Y4AE 3DXXA 3DNFA 3H5TA 2OB1A 2P3LA 3QLUC 4I50B 4X20A 5EFZA 1SXJE 3OD1A 1AUOA 4ZVNA 9LDTA 1JR4A 1NSTA 1JEJA 4DBZA 3QK7A 2OC9A 4B8YA 2QX8A 2PKYX 3N8GA 5F2KA 4ECAA 2V3CC 1TUEA 1NKTA 2HT6A 3L8YA 1WPXA 2HDNB 3NTXA 3PFNA 4NMMA 3R7LA 3VAZA 1MQAA 5KJ1A 4TYQA 3WK5A 2E87A 1JV2B 4FCCA 3VGJA 1NURA 1L5QA 3JSXA 5IG2A 3VOSA 3G8BA 4PPYA 4HFJA 4AC9A 2W37A 2IYNA 3FUCA 5AW5A 3HWRA 1ZOIA 4N3GA 3FDFA 3QNMA 2EZ9A 1RBMA 1Z15A 2RGCA 2ZWMA 3G1TA 1JI3A 3UKDA 5HTOA 4DKJA 3NT2A 4G1VA 3AY0A 1O2DA 2F59A 2X7HA 3C3YA 4MVXA 4BNTA 1EJ2A 1BE0A 1M0SA 1W30A 1RXYA 4LXQA 2R47A 5H70A 3W2EA 6REQB 1IBKB 2QRUA 1WBDA 1AMOA 4BWGA 4M1WA 4II7A 3HMKA 4CTJA 1GQ2A 1M6NA 4L2IA 1Y1TA 4CM4A 3H65A 1DT3A 3PLAE 1J0DA 5CLIA 4NBNA 1C8BA 3CLTC 1DKUA 1ZKMA 1AK1A 1U7OA 2HU7A 3DL0A 3JD0A 4OJYA 5E6SB 4EPXA 2C03A 4Z2AA 3T5BA 5I7RA 1AH2A 4K8OA 1TK3A 1J7JA 1YCFA 1RM4A 2NTJA 2AUNA 1Z6TA 3SJ7A 2JGEA 1U0RA 3K2IA 1KE1A 3SNKA 2IV7A 4KGVA 4DXAA 4MCJA 1VL1A 3AJAA 4DZTA 3VR3D 2ZYGA 1QH8A 3GNQA 3K53A 4J9VA 2V7BA 4QXRA 2ZIXB 3WK4A 1GYRA 1DC6A 5JWRA 3BMQA 2IH4A 2WYIA 3AF6A 1NN0A 5I47A 1VPLA 1JQ3A 1E2UA 2X0KA 3MUOA 5B2FA 2I4OA 5K09A 1QYXA 3LT1A 1GCAA 5DYTA 3QWIA 3RFVA 2OEPA 3CT4A 3RT7A 1G41A 3DOCA 3MFYA 3NP9A 3LT5A 4Y9RA 4D7AA 1KO4A 2LIPA 5E3IA 4OGLA 4XIJA 3I4CA 4E1AA 1UBCA 2HFKA 3BJZA 4FZVA 5P21A 4UHKA 2ZATA 3QVTA 4K9LA 4MV6A 1BEZA 4XJVA 4CF5A 2DH6A 4M8KA 4EUHA 4NQZA 3NKFA 5AK3A 2C3UA 3O1JC 4RZXA 2QT9A 3DR3A 3L8EA 1EU1A 3NATA 1T1RA 4M0LA 3WQQA 4B48A 2W2NA 2F62A 3LY7A 1GP2A 3SZLA 1DHRA 2YXBA 2HQSA 3UCXA 5DHTA 4HYYA 5A6SB 3IPXA 4O4HA 1I80A 1PQUA 1KYTA 2YUTA 3MTQA 1IUPA 4H35A 1N0WA 5F64A 3AI2A 2GVZC 4FILA 3ZWWA 4C87A 1I3LA 1FRQA 1JIJA 5HP4A 1TKCA 2DC1A 2IS6A 5AKIA 4MO2A 2YHIB 5MFPA 1CCWA 1UJCA 1ZIYA 2I7CA 3R5SA 2YRWA 4NMLA 3UWKA 1GZUA 1K9VF 1Z6AA 2HLDD 3LGSA 4XYBA 3ZNOA 1RYEA 1TAHA 4JL8A 4C4AA 2I6SA 4RANA 2VNSA 1W29A 3AKEA 4PAOA 5JWHA 1D0VA 2HOQA 2H06A 3CZAA 3EEBA 2O5RA 3PC8A 4L5YA 4D3ZA 4E22A 1PL6A 4M1QA 4Y9UA 3AJEA 2E85A 1ZGCA 3X1DA 3CUEF 1IB6A 5JI2E 4IDNA 4MIKA 4AICA 4X62B 3O74A 2QU8A 3ETEA 5DHUA 2ZR8A 2GESA 4TN5A 1WZEA 2A1IA 2DUNA 3OTHA 3MLEA 2GJKA 2EFYA 5LYYA 3WLSA 1QDUA 1Z63A 2GBGA 4MULA 3H17A 3G2IA 4IPTA 4KXVA 1KJIA 4KGXA 4BFXA 1I2ZA 5J58A 3O9VA 1JU9A 4F2DA 3GARA 3VPCA 3OQJA 3UFBA 2WFZA 2GYWA 3MJDA 1SWWA 3LLVA 1KFKB 4KUEA 4MKXA 2VEOA 1QB8A 4I1IA 3VO2A 5JAHA 2QIOA 2CLMB 2GHIA 1ZWLA 1A4RA 1LLCA 1PGNA 2PMFA 1PT6A 4IHKA 4PRZA 4PTLA 2KE5A 1JLMA 2AOTB 4M9UA 3T0GA 3W5IA 4BCDA 4OJKA 4PSCA 4TXMA 1O5TA 4DAOA 2CZCA 4FMDB 2OG1A 4PZDA 1F4PA 2IDJA 1XALA 5AW1A 5JYBA 2MR5A 1JEDA 2REOA 3U60B 1FW8A 4G9GA 2I4MA 3GN2A 1K97A 4DEVA 2HHAA 3MJFA 1N5JA 1Q7BA 1IHOA 2X1MA 2Y2UA 4IJVA 4KK3A 5FWDA 3U1TA 3O1IC 2V5AA 1UBLS 4J2OA 3GL9A 4RLQA 5CM8B 3I9NA 1GSIA 2MDTA 3RLIA 5K0ZA 1KY4A 5B5SA 3THWA 3K1AA 3WDLA 1H94A 3IQXA 1KSHA 2NYVA 3AR5A 1UMBA 2E6UX 3MPOA 3RRYA 1A5TA 1B6GA 1X70A 1Y3FE 3ZE0B 4AP5A 5IAOA 1RAEA 3ELUA 5CLHA 4KKXB 1PVVA 2ZTMA 3D3EA 4GSLA 1C8VB 2CZQA 4LZLA 2I3BA 4K6FA 2JD0A 1XJ0A 4RHXA 1YZTA 3R5HA 5J1SB 3I52A 3EVAA 3NAQA 4ZV4A 1H4QA 2Y4OA 3KQHA 4HNSA 1UT8A 1XMVA 3H1AA 3USCS 2OOSA 2GAAA 1Y7TA 1ZU5A 2QQGA 3UICA 1HQCA 1OQAA 1TGYA 1U11A 2IYSA 2VQDA 2A30A 2FK7A 3OZDA 3ZDYB 2O1WA 5DJ5A 4ALNA 5BSVA 5TT0A 1SU4A 1RYHA 2A7XA 3IBCA 3H9CA 5F12A 2QD5A 4G1BA 4HMQA 3H5OA 3GF4A 2EZUA 5FOUA 4QZVA 4FFDA 4OSOA 4IDBA 2HCBA 4FBLA 4OBBA 3SI7A 5KC8A 3IOEA 3MOSA 3R5TA 1CZOA 2ZSUA 4KMSA 5FV7A 2JHCA 1VHQA 2BMVA 3LQFA 2ZKIA 4E03A 5AM3A 1Y82A 3QGMA 4OKSA 4TTAA 1V8ZA 5KVQA 5LKAA 5DN6D 1ML3A 4YQEA 2XBMA 4RTJA 2UUAB 4LTMA 4BVJA 5A7FA 2H3EA 1VRCA 3C6KA 1EFHA 2HM7A 4BLWA 4RM3A 4B6SA 3DTVA 1W1IA 1Z6GA 2B35A 3FIJA 1VLHA 3FWYA 4GMFA 4ZJUA 1Y6FA 2PSSA 1UDXA 2WTXA 3EE6A 2DY1A 3T1TA 3RYFA 2OV1A 1N32B 4BC0A 1CBUA 4GM0A 1ZVVA 3B5EA 3F2IA 4LGCA 3B1VA 1DIAA 2FJUA 3UXYA 1LBHA 4KTVE 3BH6A 1U3CA 1KFJB 1TMOA 3AB7A 4JQYA 4E5SA 1FBNA 1P1IA 1E6KA 2I7XA 2R1ZA 4M37A 2OMKA 4KYUA 1DZ3A 1B0ZA 1XNGA 1JKXA 4PYOA 2HIAA 3WK9A 1WF3A 2XCUA 1RLJA 3FOAA 3C7DB 3VYWA 1AT1A 3H5IA 4NESA 4P3OA 2GZRA 3AEZA 1LPNA 4Q7JB 2Z09A 1DKPA 2W8ZA 3ZIAA 1GU0A 3SMVA 3FNEA 4Z9YA 4MO9A 4U00A 1KP2A 3S2UA 4KIFA 3UBMA 5GADl 4Z51A 1II8A 3IFSA 4YAWA 4F8JA 3CEMA 3CV3A 3HP1A 1KH3A 3E7DA 5C5EA 3KSDO 2P6MA 3ACBA 5LD2C 2FFQA 4OSEA 4XXHA 2R9VA 3KZVA 4S3MA 3B7GA 1PG0A 3A1FA 1N2ZA 1VC2A 2O7RA 2ZE7A 5EZYA 1M1YE 2DFVA 5BN5B 3R41A 1U7WA 4TWBA 2WAAA 2VPXA 3AF5A 4CE6A 4KXWA 4YLGA 1CJSA 2CD9A 1UXOA 1FFYA 3PXDA 5B1DA 1NYLA 3UJBA 4LRTB 3W4IA 1LLQA 1U0HC 1G5HA 4KC0A 1KVTA 1M6HA 1T1GA 1T2UA 1T91A 1R74A 3L7NA 4O0LA 5DZSA 5JAIA 1EDOA 2O8BA 3HR4A 3C39A 4DTIA 4F9FA 1HT1E 5C51B 1SCBA 1B14A 3OOYA 4H3KB 1T5HX 4HAUA 4K6KA 4C21A 4CEJB 3WGKA 4WECA 4EG3A 1YL7A 5K8CA 4HI0E 2HSGA 4LF4B 3DQPA 3RYIB 2PMWB 4MR9B 4ICIA 4D9GA 1ABBA 4MINA 4EGFA 4O08A 5T41A 3HRIA 4WBNF 4QJBA 5SZKB 1F12A 5AT1A 1RJFA 3MQ4A 1Q0ZA 4CLRB 4W8OA 4FQ7A 5FUXA 2BFPA 1OAKA 2WIJA 1N6IA 2C78A 3CNQS 1ULZA 5TARA 2AR7A 2O2CA 3GJ0A 4DM7A 3ZWAA 5FI5A 1V96A 1WWKA 3BIOA 2ZEJA 4P32A 3AIIA 1XZHA 4CG2A 5A5EA 5BQ3A 3WIOA 4D9EA 2JCYA 5I5EA 4LBVA 1M7HA 2ZI9A 1RNLA 3P0JA 3WV5A 1XLWA 2G82A 3LKZA 1BQEA 4Q7EA 4UMEA 2CV2A 2LE0A 3F8TA 1G6KA 4X6UA 3LCRA 3B3JA 5EJGA 3RVQA 1L7PA 2XMSA 3T7SA 2DFPA 3U80A 2OZVA 2GAFA 3UOWA 2XBLA 2AT1A 3IR7A 5TJ9A 3REFA 1KOJA 3DXZA 3PNYA 5G1NA 3T52A 3NDBB 1S2OA 2EP5A 2QX9A 4QQFA 3MS7A 2WJYA 1QF9A 2B20A 3RC3A 1JKJA 4MJXA 1ESNA 1Z29A 2P9ZA 3RRJA 3AZOA 4EITA 5LQAA 4TS9A 3VA7A 4MS4B 4OUDA 4NXNB 1N6PA 2L17A 3PT9A 2QUJA 2BUAA 2FR8C 3R0VA 3BFVA 4MQ4A 3GLSA 3TUJC 1QP0A 3INRA 3MT9A 4JQSA 4F38A 3KPYA 3N87A 4XCXA 2ZU0C 3VKHA 5TGZA 3EVBA 5G0WA 3Q6NA 2Q8NA 1PCXA 1QQBA 3DBRB 4AY2A 2IYVA 2B4RO 3VJLA 1PVOA 2FHPA 4OJMX 1MQ8B 4OA5A 3AFGA 4UBLA 4FCVA 1OPRA 2XRZA 4UW9A 1GARA 3AR6A 2BD0A 2A58A 2H5IA 1NR5A 5IM4A 4IJUA 4UDXX 3B2NA 1B43A 4QPJC 4DB4A 3OJCA 2G76A 2Q1XA 3IULA 2GM5A 1ABEA 1NG1A 4LW8A 2POCA 1DUSA 2I2WA 3SPXA 5C5CA 2JGMA 1UJBA 1A72A 4PXYA 5AIAA 2NUPA 5AKLA 3STXA 3UJNA 4MS1B 3MINA 3PDJA 5LQNA 4B3RB 1ULTA 3JD2A 1QC5B 4BB5A 4FGSA 1VIDA 2GEDA 4AY5A 3KFVA 3DLCA 4F4UA 5LZ9A 1S5PA 3CO5A 3K09A 4K6CA 1V1RB 5A3QA 3FR7A 1D1PA 3O9MA 5CXXA 1S8AA 2C4MA 1WA5A 3AF0A 4ND1A 3NZEA 4F1JA 2JGLA 1F0NA 1FB5A 1U2GC 1ZC3A 2OXTA 3AUUA 1T3HA 1RMQA 3RIXA 4BAGA 4NCHA 2CLKB 4HZUA 4KWIA 4CKCA 3E3MA 3WL4A 2ZK7A 5BV1A 1EX1A 3K94A 4YJHB 1USIA 1VCOA 2PXCA 1QX3A 1G60A 2H8KA 4OLJA 4RZ2A 5FI3A 2AOUB 3WE7A 4B74A 2ZB4A 3RYHB 4IZHA 5AIBA 1ZJ5A 1T8RA 4P3NA 3R40A 1UXIA 4PSVA 2O8DA 4OFBA 4QYMA 2QN3A 1NTRA 3VDMA 4BGUA 1Z2CA 1O1YA 3MN1A 1NW8A 2EYQA 3HU1A 3NKLA 2H9YA 3CBGA 4WQMA 3SJAA 1Z25A 4HV4A 2QRVA 1FF9A 4EELA 3P2OA 2EKDA 3GUVA 4N49A 4XJXA 2QTBA 3BFJA 2QI9F 1G5QA 3CF4G 1U2DC 3KU4A 3QH4A 1EXMA 5CB4F 1ULHA 2QRQA 1GQYA 1TTPB 4OM8A 4EG0A 2FFAA 4WH0A 2CXTA 4MHOA 5ABPA 3IALA 4QG7A 2GCNA 3EDCA 3VKVA 4RQBA 1MO6A 4Q47A 5ALKA 5LXTF 2QX6A 1TYCA 3WGUA 2H1HA 3AHCA 4FBGA 3CN7A 1ZOPA 4WFIA 2BBTA 5HZMA 1DQZA 1K7SN 2PQ2A 3H2JA 4G0XA 3SVLA 8MHTA 2HHLA 1R0CA 4FLFA 5REQA 4B75A 5KNDA 2BP7A 2XE7A 2GZAA 3IVXA 1E3LA 3NEJA 2ASEA 5BRNA 5CX1B 2GKOA 4ZEWA 1UIRA 2CMDA 1IEWA 2OHGA 5EIWA 1XZGA 4RPHA 3UA4A 3ZHOA 1TO2E 3BWDD 3K5WA 5GP1A 3TSOA 2Q41A 1Y9AA 2P1ZA 2B4TO 2QJTA 4J0HA 4E31A 1EAYA 1FSSA 1JKFA 1KI6B 1LS6A 1PEDA 2X2EA 3JQ7B 3RTDA 3LWDA 3ZVLA 3R8CA 2F4VB 2IZOA 1YCDA 2O0MA 3EMBA 1FK8A 4Q1VA 5LLTA 4GOJA 1X3SA 2FPGB 2IEBA 1V71A 1Z3CA 3PD7A 3SYTA 5HOQA 1JPUA 4A73A 2IPLA 5FLYA 1SG0A 4H4CA 2N1BA 1YZLA 3HUFA 3KLPX 4TGLA 4ZAYA 2Y3IA 1XLVA 5EMJA 5TPWB 4B76A 3FOFC 1M8GA 3FSJX 4G0PA 2DBZA 2DFDA 2G4VA 2QORA 2R8EA 1A9TA 1UK9A 3HCAA 3FCOA 4UHFA 3RW9A 2YOGA 1WSAA 2VJPA 5EHZA 1ULSA 1Z08A 1DJQA 1P0MA 2JJMA 5IAGA 4QC2A 2TYSB 3TQIA 3EY9A 4DG8A 1ENOA 3RG8A 4NBWA 1A27A 3FWHA 1XDWA 1XYVA 4P4LA 2AE1A 4N65A 4JR0A 5I7HA 2AV6A 2E1RA 2H6EA 3G9XA 4JB0A 4AJ2A 3KPWA 1Y8CA 2XDQB 4MRPA 2IHNA 1D8AA 4D4KA 4ZDWA 4RACA 2QXUA 4NZ9A 1VA4A 3TLGA 3A25A 3FHJA 2WVGA 4IG9A 1YQTA 3IEXA 4YACA 5DGHA 3IPLA 2FFRA 5CTJA 1H2XA 3FBWA 2EJCA 1RWBA 3K70B 4JVSB 3R09A 3DLBA 2BR3A 1CDEA 3FRJA 1H9BA 3FYUC 5L4LA 1I5EA 3QMPA 3U7QB 4ZCQA 3PICA 2D2VA 1ZUNA 2DYKA 1BCSB 3F1KA 1NNI1 3MXOA 4X92A 2NO0A 4AS3A 1I0LA 1TIPA 2WK1A 2XYHA 2ZDHA 3EAQA 4TM7A 5M29A 1PQPA 3OFNA 1IBCA 1NSFA 2J1LA 3BB1A 3WLQA 2PYIA 1KO1A 2R8ZA 3HU3A 4RCVA 3SLGA 3ETCA 4YBZA 3MIZA 4WJZA 5ADWA 1I3CA 1QRAA 1TYZA 3GW8A 3QW4B 4ZI3A 3OE1A 1F5NA 4MP8A 3RHTA 4RO0A 3CH6A 4RTOA 1OWLA 4WT7A 2VT7A 4RCZA 4CF6A 1GKIA 1PNVA 2HQ1A 1W75A 5DNDA 3RRXA 2OMEA 2P4EA 2VQSA 2ZYWX 2DEUA 5A4AA 4GDMA 1Q22A 2WP8J 1GILA 2RCYA 4Q39A 4RAOA 4A0GA 5BQOA 2C4WA 5EJEA 5CLLA 1R12A 3WKBA 5A5DA 5GV7A 1N3YA 3CIFA 1UZNA 3REQA 1N92A 4NZPA 3SFZA 3PPWA 4D9NA 4QT0A 2ZSFA 3OEED 5JECA 3BGDA 3GAFA 2FWBA 2FP4B 1IIRA 3ZE9A 2XLCA 1BU5A 4ANFA 3SLRA 1ETUA 1KEKA 2BBSA 4TUYA 2G5TA 4OXNA 3TBKA 4E5VA 1FFDA 1HORA 1UOEA 3GT4A 3PFBA 4UHEA 2BH2A 3EH2A 3MOIA 4HVLA 2QLTA 1DKRA 1MU0A 4CU2A 1TK2A 3VYVA 2CCKA 1MG5A 3OEYA 5HE9A 2BI7A 2ATCA 3M83A 5JWOA 5JTTA 3IOMA 4TTIA 2ZYSA 3DBLB 4X1IB 4U7HA 5ETJA 3ZIUA 2RGDA 4UFPA 4DXHA 4QRHA 2GCEA 1IY8A 3ZEIA 4E32A 2IX3A 3AQIA 2VSQA 4ALIA 3GXBA 3PKJA 4X63A 4CV1A 1OXUA 1UZAA 3LVQE 3CR7A 4JP5A 1UAGA 3ABRB 1SELA 1EXWA 2OAQ1 3CF0A 2R11A 3WLJA 1SRQA 1Y7PA 4JLUA 2WKWA 5A9RA 4G5RA 1C80A 2J3DA 1E6LA 2PBLA 2XUGA 3HB4X 2IUYA 4N40A 2P2SA 2F4NA 3ZHVA 5C8YF 4BNDB 2LNDA 1SEVA 3PDUA 4LJ7A 2AC4A 2EZTA 4F06A 1XZBA 1R0RE 4GD3Q 4WCDA 1XZMA 1Q6ZA 1RRKA 3I2YX 1X6VA 4QSMA 5E1MA 3T3MB 3ZVNA 1EZ4A 1XZFA 1O8CA 3WGZA 3II6X 3IDZA 4IKOA 4R8MA 1R15A 3FJYA 2J4DA 4YJ3F 1GVHA 3BRWD 5FNVA 3EVZA 1P5JA 2NW6A 1L5FA 3AR8A 1VTKA 2PRZA 1N5DA 3IPYA 1CUDA 4J91A 2Q6OA 2V9CA 2Z4RA 1X14A 2R8RA 1W47A 3GUCA 3QU4A 1RKVA 5AM5A 1XTSA 2C7QA 3TBHA 2IYAA 3EEQA 4R2LA 3NV7A 2WA1A 2ZKLA 3B85A 4YPFA 3CRNA 2WLSA 4DXDA 4DUYB 1CD5A 4BGEA 1U81A 4KR6A 4ND4A 3RBZA 4ZCSA 1CG6A 1G63A 2EJTA 2I5PO 3L7IA 1WV0A 1SVKA 3KD2A 3GJ7A 4NK5A 1YONA 3C6YA 3OT1B 4ISBA 4L5BA 3D6UA 4WKOA 3T61A 1T9BA 5DNEA 1UADA 5A3SA 3AUFA 1L5HA 3UUEA 5YASA 2W4MA 3ZV7A 3C5HA 4CG0A 5AI0A 2AX3A 3ZCXA 2ID7A 1O08A 3N7UA 1EZZA 1Z18A 3GJ8A 1SQSA 4LDRA 5TQ0B 2WSBA 3UJ7A 4XEHA 5B30A 1LVHA 1UK6A 3W34A 4WKCA 2A1UB 1U2EA 4JUIA 3HVJA 5EA2A 1EVQA 5AXDA 3UNXA 1M5TA 4Z4GA 1U99A 4COOA 1SXJB 2VLIA 5DSTA 4A5SA 1FDUA 1TECE 2Q2NA 2DZDA 4EQ6A 2OUKA 4MB0A 1X7ZA 3CX4A 4L5CA 5KSYA 2FMIA 3AEQB 5BVGA 3NI2A 3V6LA 1XT6A 1CS4C 4OTZA 1VP3A 3X1YA 2QZPA 1GUYA 3CSSA 3VPSA 1NR7A 4LECA 4RK1A 2WWHA 3K9HA 3JVDA 1MC8A 2X9QA 1D2MA 1WOMA 2NVUA 2WFMA 4DG9A 1JAZA 4UCQA 3LZCA 4CF7A 5D51S 3WI7A 1OKKA 1WMSA 4MQEB 5KKNB 3FPFA 2J6CA 1GGNA 4HH4A 4HRXA 4EARA 1XJQA 4NYMR 2PLFA 4TTTS 5DF1A 5KOJB 1Z0KA 3ABSB 1JQLB 1L3IA 3EIHA 1LRLA 2I1LA 3DXYA 4Y2VA 1JR6A 3E9QA 4M99A 2VUHB 4CXMA 2ZIZA 3ZOKA 1IN1A 1LBSA 1TA0A 2ZRNA 1JQDA 5C32A 2GI4A 3ZDRA 3D6AA 3BSFA 4I8DA 4HNTA 1NUAA 1QPBA 2PMDA 3WNBA 1ZZGA 1W25A 4WV3A 3NDIA 1I14A 3ZWBA 1Y8QA 2OBLA 4Q3BA 4JBNA 3WKAA 2NU7B 5AK0A 3ENKA 1JJ7A 2O3TA 1CF2O 3SF8B 1NVTA 2DCMA 4KIJA 2XDYA 1D6SA 2JFNA 4PQFA 1ZAKA 2WR8A 3W9UA 4DLZA 4LCBA 5E4TA 5IBCA 4L3VA 2OD2A 3C7CB 4HQKA 3CW2A 3L8HA 4G4SP 4Y7CA 2O19A 4NDZA 3BMCB 2H7CA 4PX5A 4A0HA 3ZHQA 2Q4BA 2E48A 3WNDA 2HMYB 4ZCTA 5BSEA 2Q6KA 4OFXA 4ALMA 4IS3A 1T2EA 4E5DA 2H11A 4CJXA 2Q29A 2O2SA 3UANA 5ICMA 2HI0A 4Q3KA 1GCGA 2QT0A 3OICA 3FYTA 1IXSB 4NFSA 4BQPA 1ZGJA 1RRVA 1QWSA 1U98A 2CKMA 1OSNA 3F4KA 1IYZA 2HRDA 2Z8XA 1ZM3A 2WABA 3P2EA 1XBTA 4P4SB 4PQYA 3TJRA 5JJLA 1L3BA 3KPUA 2X0FA 2PWAA 1JB1A 1EFTA 5DGIA 2ZRCA 3K8OE 3ET5A 5AVKA 2DG2A 4D3XA 1R27A 3KZOA 1KY3A 5J59A 4F60A 4DTCA 3JQAB 1VE5A 4O4IB 4XX1A 2ZI6A 3ORYA 4U0KA 3AZQA 3IVMA 1C7RA 4WLEA 3U4QB 3ZVRA 2CK3A 1TM2A 2VJCA 4U7GA 3ZWOA 4D41A 1W5SA 1DB3A 1UJMA 3P9CA 2X0JA 1DTSA 3FXAA 5EINA 2IDZA 3DE1X 1YK0A 3KQMA 3OSZA 1YC2A 4TPKA 1QIMA 2ZPUA 4MVJI 4ZT5A 3EW7A 4LHZA 3IA7A 3CTMA 4BWVA 3QOXA 3B89A 4M87A 4PZ0A 4EDFA 5BMVB 1ZD5A 5KJEA 4PONA 3DMPA 4UNPA 4IQGA 3BHJA 1ZR2A 2IXBA 2FX2A 2FWJA 4AUKA 2BFWA 2BGRA 3RIMA 1Y7IA 4AB1A 1Q0SA 1OZFA 1Y33E 2ON6A 3DO6A 2LCIA 3BREA 4D25A 2J9YB 4D9MA 2HPVA 4U2FA 1OIXA 2XIJA 3RJZA 4YJFA 4PSUA 5B4UA 3LKVA 2PL3A 2OUIA 4Y0NA 1XPRA 1PJQA 1FU7A 1CJTC 3KJHA 4R1UA 4OHKA 3L8DA 4RMGA 4RQUA 4B2IA 3SX2A 4X90A 1UMDB 5ITWA 3JRXA 3R7BA 5EJ5A 3H13A 3FFTA 2D2XA 4WEOA 6ABPA 2CDAA 3D81A 1TVCA 3KOZA 3L06A 1RJ9B 3TLMA 2QMEA 4TXJA 1JLLB 2BKUA 4I4TA 1ZYUA 1D2HA 3N70A 5F7JA 1IK6A 4IHJA 1HDIA 1NNUA 4MV1A 4ZU6X 4EEKA 1NW7A 4QYXA 1GGVA 4RNCA 2BTQB 5E0KB 2VPPA 4HDOB 4ZVPA 4B5KA 4BZQA 1RQXA 5KSPA 3LK6A 5DI3A 1LPPA 3U48A 2PKEA 4UM8B 5TQ2A 4LVUA 5B6PA 2GEFA 1E5XA 3G6KA 4HYEA 2GM4A 2O0KA 3Q6MA 2Q2OA 3RIGA 3QNWA 2BEVB 1V8BA 4K9NA 3T1QA 3ZGXA 3I30X 2VYVA 3BMNA 3LG2A 1SUIA 2G77B 4L75A 3W6OA 5CDUA 3O94A 2JAUA 3OE7A 4UNQA 1XKQA 2HA3A 3IRVA 3LHKA 1IDN1 4HY3A 3V4OA 3Q2OA 5GINE 1E7YA 3DEJA 2CJYA 3EVFA 5A7HA 2PVCA 5KTOA 3IP6A 3BAZA 2JK1A 5DTEA 3KEOA 2B8NA 3A05A 2X1VA 3KVNA 4BVEA 3DHYA 3D3WA 5SV2A 4ZAVA 3OCWA 4ZHQF 3BK1A 4RVDA 3RFUA 1E3EA 2PQMA 4H4DA 2GXSA 1NFRA 3EBPA 4HLCA 4ZZIA 3Q88A 2X9NA 5BQ5A 2C88A 1C1YA 4W5TA 1DGQA 3MTIA 1KK2A 1BCRB 1JBEA 1NUQA 1Q7TA 5GZ6A 1JT9A 1P75A 2PRSA 4BBZA 1PD1A 2DY0A 4Y2UA 1UAYA 4NONA 5ALVA 1AS3A 3IOCA 1UFRA 5AOBA 5KPDA 3L6OO 2JLUA 4KN6A 1XYGA 2Q1TA 3URMA 3ZQKA 1XL0A 1XK6A 1CW2B 1SQGA 2GD6A 2HK6A 2C98A 2B7BA 2EDAA 5TF4A 1RPNA 3QKTA 4BUZA 4Z4CA 3N2NA 2Z0MA 3R5JA 2IU0A 4OYHA 2PZMA 3PZRA 4TMFA 1MUUA 4AG3A 2BDTA 1YR7A 4UHHA 3OX4A 4I6GA 1G6Q1 2OC4A 3X1JA 2CXOA 1EFDN 3QHAA 3RS0A 3PQFA 3TDMA 2DPXA 3SKYA 4PWZA 3EIOA 1U2ZA 1OLXA 5JY1A 1QTIA 3CRW1 4WBXC 4RDCA 1DXQA 1R18A 1XTZA 2P5TB 3VR3A 4Q9KA 3STHA 1D1QA 5K0JA 3EGXA 1JZQA 5CVDA 2GD1O 2PYZA 3H75A 4FFSA 1DWOA 1M6VB 2WJJA 3RARA 2ZUUA 3X43A 5DSXA 3AP2A 3WO1A 4N5DA 3PC4A 4ZV7A 5GZ3A 3HQ4O 5D3MA 4FE4A 3ZGZA 5H82A 2E4AA 2R6DA 3PK0A 4D3DA 3HDTA 3WGJA 2PL9A 4JBGA 3QG5A 4R2IA 5CA0B 3C3JA 3EMVA 4CUZA 3PYMA 5IAJA 4F4IA 3PFGA 4CF3A 2VNAA 5A1TA 1M1YB 3MBKA 4BO9A 4DCCA 2JZOA 3WRXC 3B53X 3WTCA 4ZYZA 4UUAA 3V4VB 3HSYA 4X97A 4F8EA 2NM0A 4NXMB 2ZRFA 3AUYA 2BV3A 4QVGA 1V1JA 1DAHA 1UWCA 5LYJB 3OZRA 8GPBA 2ZUSA 2QTFA 2ZBGA 4IDFA 5E1DA 1A2KC 3B6MA 1LDEA 2WVAA 4HDSA 3RBAA 1V0JA 3E22B 4C6TA 3K6SA 3UG6A 5JXJA 4NJEB 5DYGA 1EWRA 1T24A 3S7ZA 4OXXA 2Y2VA 3WMXA 3T7RA 4AUEA 1U3UA 1UMKA 1GZ6A 2AEJA 2DUWA 5JDCC 1JR3E 1TPYA 3TFWA 4ZT6A 3C87A 5C53B 1S3SA 2HGSA 2JIQA 3ZW8A 1EGVB 1T5OA 3WLFA 2JKVA 1TCBA 3NEYA 4KR2A 5A4MS 1XWWA 3NWBA 4R3NA 2HSEA 4DM3A 4WKPA 3GWZA 1XTRA 2ZIAA 3LFUA 1UZUA 3K05A 4MGHA 2QRMA 3D7NA 1PG5A 3BBLA 3M1AA 3KL4A 4ZCLA 3W2FA 5C3MA 3GLIA 3D54D 3B20A 1IM5A 3V7NA 1ADJA 3UWSA 4JI8B 1BQ4A 4Q82A 3I9V6 4N6OA 4CDGA 4Q3CA 1LKZA 3EOAI 1ZIDA 5IAAA 3DAGA 4DA6A 4YO8A 4JLKA 4V0LA 3WHLA 1A76A 3AJ9A 1PS9A 1NBWB 1ATIA 1EFUA 2FAXA 3RU9A 1S9HA 2FPLA 2SNIE 4XX0B 5FTWA 1M2JA 1XQVA 2AZ4A 4BLSA 1NY5A 4EVIA 1RXVA 5G1PA 2RGRA 1QONA 2P7IA 5EI5A 1CY4A 3G1WA 4I5DA 3E8MA 5TC4A 1FVOA 5DK4A 1EWVA 1HOXA 4ZT4A 4LQDA 2HF2A 1DBPA 2GFQA 3IXLA 2ZJZA 2R1TA 4QXQA 2OKGA 2PR2A 3IO5A 2B8TA 1JAHA 4MA0A 1NPDA 3L92A 1JWLA 3IP7A 1FU4A 2Q0XA 2AKEA 4N82A 2P9EA 3AF4A 4M7RA 2GJAA 4Q02A 5IHPA 1SD2A 4OAOA 3AW8A 2JLZA 1HE5A 3AERB 3WLEA 1R0KA 4WADA 1P6QA 4QEZA 1XMSA 4DSTA 5JD5A 3PYXA 3GRUA 4HXFB 1Z45A 2DVMA 4LEIA 2FQQA 3KZNA 1U90A 3EQ6A 3NH9A 4YP5A 3SXUA 3W2GA 3VSEA 3W6UA 2FUG6 1I9GA 4ZO7A 4BV3A 1S8NA 5BSKA 5K0TA 3ZJUA 3SQXA 3RLFA 2EBWA 2EOAA 3GJTA 3KR9A 3KZ1E 4F6RA 1IN8A 1YFZA 2XDAA 5EZYF 5T8KC 3SMQA 2ZAOA 1OA0A 4OQQA 4KO4S 1IM8A 3L4SO 1QV7A 3U13A 3RR2A 3LL7A 1SUSA 4QOFA 2WBLC 3DNMA 1LSUA 3JR3A 3NV9A 3ZTTA 3AL3A 1IRXA 1WDWB 1P0PA 3HGMA 4RFSA 4WN9B 1VCMA 5AJVB 5DW0A 4XRGA 2XB9A 3LV8A