1J56A

Minimized average structure of beryllofluoride-activated ntrc receiver domain: model structure incorporating active site contacts
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
124
Chain Sequence
MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords NITROGEN REGULATION PROTEIN NR(I)
publication title High-Resolution Solution Structure of the Beryllofluoride-Activated NtrC Receiver Domain
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 34
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1j56A00
4MLCA 2WWVD 2F8TA 3C3WA 5KQMA 5JNTA 1Z2EA 2JBAA 2MYPA 3KYJB 4QICA 4EGSA 2LUOA 3RVMA 1F51E 3JPWA 4ETNA 5CNMA 1ZN2A 3GRCA 2PUGA 2MYUA 3GT7A 2E4VA 1BAPA 3QLVA 5KQGA 1U04A 3JS5A 2A9PA 1A04A 2J48A 4OLAA 1KMIY 4P1ZA 1C4WA 3KYIB 4Q6BA 3OO1A 1GCGA 2LIVA 3D02A 3CKMA 5ABPA 2QXYA 1SRRA 3MA0A 4TMYA 2PUDA 1FSPA 2FTKE 4NICA 1EWTA 2MYTA 4Z4FA 4HNQA 1OXBB 3DBIA 1P6UA 1U0SY 2R48A 3EQZA 4E7OA 1BA2A 2M98A 1Z26A 5TQ0B 2PMCA 3H5TA 1DC8A 1ZGGA 2HJ9A 4EUKA 4YRZA 5BRJA 3ROTA 4LZLA 3HV2A 2QV0A 4KRFA 5EWLB 4Z4GA 1L5YA 4RK5A 4RDCA 1VLZA 4MS4B 3JPYA 4W5QA 2VUIB 1AB6A 4MR7A 4N0QA 3OQOA 1NY5A 4E7PA 3HO1A 4RXTA 2E4ZA 4Z9BA 3BRSA 4XXHA 3RVNA 4FB4A 5JNSA 1RZRD 4ZMRA 3HDVA 3OQNA 2HQBA 4KPYA 1QP0A 3OMXA 5DGCA 3C3MA 5FWYA 1PNTA 2A9OA 4OTZA 4RK0A 5GQSA 4RXUA 4MQEB 3KTOA 3IP9A 2IOYA 2XDYA 1ABFA 2MYNA 3GYBA 2HQRA 2VUHB 1ZESA 4Q7EA 4WUTA 4LDAA 3RH0A 5IEJA 2PUBA 4MGEA 3K4HA 1GCAA 1VKRA 2OQRA 3H1FA 4MRMB 1D1QA 2R47A 1S8NA 4B09A 4YGXB 1NXPA 2LPMA 2PAFA 3DZDA 3NNDA 1QQBA 3DGFC 8ABPA 2FEKA 3H5OA 1QO0A 4OBBA 3GWGA 1DZ3A 1P8AA 4Z0NA 4Z9AA 3O1HB 2N9UA 1XWWA 1Z25A 1VRVA 4RU1A 4D74A 1Z18A 3A0RB 1FQWA 5IUJC 3T95A 1ZVVA 2GKGA 3CTPA 1JLKA 3H5VA 5C5EA 3GBPA 4XARA 4H3HB 4QPJC 4G0OA 3BBLA 4JB0A 4F11A 4JP1A 4WWHA 3GV0A 5T7BA 5TQ0A 3I09A 4FE7A 2PUEA 3QEMA 3CLKA 4KK4A 3D8UA 3HS3A 1ZH2A 2FXIA 1DJMA 1SXGA 3KG2A 2PKXA 1GUBA 4EYGA 1JYFA 3OQMA 2QSJA 2WJWA 3VNAA 1PNRA 3H6HA 2FKAA 1K66A 5CNIA 3GL9A 3C3KA 1MIHA 2B1JA 3O74A 3KSMA 4O1IA 5I4CA 4QYWA 4EVRA 1RNLA 2L2QA 3HXMA 3EGCA 1MAVA 4ML3A 4L85A 1TMYA 3Q41A 1Z16A 5EWMA 3TB6A 1U2PA 1IIBA 1B00A 1TLFA 4EYKA 3CHYA 4GPAA 2FQWA 4W5TA 5FBHA 1Z17A 1DP4A 1Z2DA 4LRQA 4ZJPA 2IDMA 4KVFA 4LE0A 4MYRA 5B3JA 4YCSA 4Z4CA 2E4UA 3P9YA 3CS3A 3UK0A 1M2FA 3N8IA 4MR9A 1JHZA 3N6VA 1EWVA 3OMWA 4YWHA 3S99A 1DRJA 1PEAA 2DRIA 2PL9A 4G0MA 4MQFA 5JNUA 5JS2A 5JS1A 1M5TA 3A0UA 5TPZA 1J56A 3OLVA 5FWXB 3A3KA 4KK3A 3QEKA 3BREA 3JTEA 2ID9A 4MS1A 3UUGA 3NNNA 3L6UA 1FFSA 1T34A 1JH9A 3QX8A 3SG0A 4N76A 3KKEA 1YS6A 3LUDA 2PE5A 1QMPA 2JVIA 4TLLB 1ZAYA 3HUUA 4MR8B 2VYCA 4DN6A 2M1ZA 5IULC 1YTUA 1R8JA 4JB2A 2JK1A 3SQNA 2F8SA 3FMVA 3CFYA 1NXXA 3TMYA 1K68A 2NT3A 2KYRA 2NZUG 2E4YA 1UDRA 3LUHA 5HSGA 5IC5A 1LJUA 3LUGA 4OLBA 2E4XA 1QO0D 1P2FA 3KHTA 2GBPA 4MPTA 4RY0A 1ABEA 2CHEA 4MS3B 4RY8A 4YP9A 2IPNA 3EJWA 2WJAA 4IMJB 2PLNA 1E6KA 2QVGA 4JOQA 4UHJA 5DTEA 3CNBA 4IMIB 2L17A 2NUBA 1P6QA 3SAJA 3R0JA 3E61A 1TM2A 4Y9TA 1USGA 3HSYA 4HNRA 2GWRA 1H9CA 2L19A 5TPWA 2GI4A 5TQ2A 2O20A 5IBQA 5IX8A 4XASA 1LBHA 1Z13A 1LK0A 3GBVA 1Z15A 3M9WA 4NV3A 1YMUA 4F12A 3QLVC 2P4UA 2FLWA 2BGGA 4XLTA 4OG2A 3IP5A 4KFCA 3RVOA 2HPHA 1EHCA 3E3MA 3H1GA 2PJUA 3LMKA 3MF4A 4YV7A 1QP4A 2CWDA 4KQCA 1U2QA 5FWXA 1ZHHA 1URPA 1GUDA 1Z12A 1JF8A 4Z4IA 3MQ4A 4F3TA 3OM0A 2WB4A 1ZH4A 5GOTA 1DBWA 4ZMSA 3N0RA 5BQ3A 1EFAA 2MSLA 1QNLA 1AB5A 2IPAB 2IPLA 4ETIA 1FFWA 1YK1A 2A9QA 4G0XA 4IGAA 3QELB 5CNJA 3O2SB 4L4UA 1NXSA 2JB9A 4KV7A 2VK2A 5JNVA 3T6KA 1NTRA 2JBAB 2FVYA 3M9XA 1RXEA 4G0PA 1NXTA 5EWLA 1NATA 1SD5A 4LDZA 4DADA 2TMYA 4PZ0A 4WXMA 2QR3A 2YHAA 3B2NA 3JVIA 4MS4A 3FFTA 2Q5CA 1TVMA 4RS3A 1SXHA 3OLYA 3T8YA 3MYYA 2FSPA 4XFKA 3NNSA 3LUAA 1W25A 5TPZD 2B4AA 2CHFA 1ZY2A 2HSGA 1Y1LA 2H0AA 1RXIA 2IPMA 2JVJA 3FDFA 5IEBA 4LX8A 1LBIA 3MIZA 3SNKA 4F8JA 5CHYA 4GNRA 4W5RA 1DCMA 4OATA 5FBKA 5TQJA 4MQEA 4RSMA 1A2OA 4P98A 1KRXA 2AYXA 3EAFA 2FLKA 3H5WA 4KNYA 3N53A 3HK2A 2FEPA 5DKFA 4N03A 5TE9A 2FN8A 1NXWA 5PNTA 4RV5A 4YR7A 1DBPA 5BRAA 1KGSA 3JVDA 3C97A 2QVCA 3IDOA 3RQIA 3O1JC 5KC9A 3EULA 1MVOA 2NZVG 5HKOA 4NCBA 4HYEA 4JASB 4PEVA 4S05A 2FMIA 4MRMA 3NHZA 3RVLA 4ZYLA 1USKA 4WT7A 2P9HA 1JYEA 3H5IA 3KJXA 4MR7B 3T38A 2CD7A 4DQDA 2FN9A 3H6GA 1YK0A 2HQOA 3W9SA 4EYOA 2FMHA 1MB3A 3ROFA 1YVUA 1DRKA 4XAQA 3KLNA 1USIA 1BVHA 5FWYB 1JFVA 3VNBA 3C6QA 3LOPA 5EWJB 2JRLA 3LUCA 1XHFA 4IF4A 4EYQA 4RY9A 3OLWA 2FW0A 3LKBA 4F06A 4LE1A 3NBMA 2W42A 3ILYA 3BRQA 3FFWA 3MMNA 3RVJA 3HVRA 2A9RA 3N0XA 1JFTA 3CG4A 1F4VA 3H1EA 1QP7A 3FGZA 5KQPA 3BILA 3RVRA 3SM9A 1D4ZA 3DLHA 3HCWA 3K9CA 9ABPA 2X7XA 4RZSA 7ABPA 3O21A 2AYZA 2PUCA 4Z4EA 1QPZA 5CNKA 3FFXA 1D5WA 1QQAA 2JCGA 3I45A 3O2QB 5DCLA 5JNWA 1JL3A 1RPJA 2LP4Y 3CG0A 1SXIA 4RXMA 3G85A 4N0PA 5HQJA 1NXOA 1EWKA 5DLEA 3OLZA 3RVPA 3IPCA 4KZKA 3F73A 3CU5A 4CBVA 3LUKA 3O1IC 1JWLA 4ZPJA 3LTEA 3QX9A 5T3YA 2JVKA 5B3JC 3N75A 2NT4A 1YS7A 2I6FA 4W5NA 1E6LA 1D1PA 2WY2D 3O75A 1C0EA 3QEMB 1APBA 1TJYA 2FMFA 3TX6A 1ISSA 3DGEC 1L5ZA 2ZAYA 3UKJA 2FEWB 3I42A 4D6XA 3CZ5A 4M88A 1E6MA 4Q6WA 3HZHA 4TLMB 4YO7A 5D2CA 3IP6A 1ISRA 1ZDMA 1BDIA 1ZGZA 5ED4A 2WMYA 1CHNA 1JX6A 4KMRA 3RVSA 3F7NA 3OLXA 4JA2A 3MM4A 4IRXA 5IUNC 3SY8A 3A10A 4G86A 1D2AA 4RK4A 2QU7A 4RKQA 4YS6A 5EWMB 5EWJA 3RVQA 1WETA 3EODA 3URMA 4ETMA 2IKSA 3OO0A 4H60A 4O1HA 1DCFA 3TO5A 6ABPA 1E2BA 4KQ9A 2ZWMA 5JNRA 2PUAA 1XHEA 5IUKC 3HM9A 1DC7A 1JDNA 1FFGA 1NXVA 4MR8A 4RWEA 2IYNA 4Z99A 3HJFA 2ID7A 3LUJA 4TN5A 5KI6A 3JY6A 1CYEA 5C5CA 1U8TA 4MR9B 4KREA 2RJNA 3KS9A 3QLUA 3HEBA 1M2EA 3TD9A 1M5UA 3L49A 2PL1A 4WZZA 3RVKA 2E4WA 2PUFA 2LBPA 4JAVC 4N47A 3QLTA 3NHMA 2R25B 4IILA 4MQFB 3ILHA 3GA5A 3Q7TA 1YMVA 4PICA 1LJLA 4FE4A 1JDPA 2WRZA 3CZCA 4MLDA 4RK7A 1RZRA 3IP7A 3F6PA 4S04A 2FMKA 1MB0A 3H5LA 3Q7RA 2H3HA 4MS3A 4MS1B 1A0OA 4PYRA 2QW1A 2GX6A 4UHKA 2V0NA 4WXEA 4G97A 4EY3A 3HUTA 1PEYA 3LUFA 1BDJA 3O2JA 3OM1A 1DG9A 2YHBA 4D6YA 4RKRA 1DCKA 2FQYA 4QYMA 2OENG 4EVQA 3HDGA 1PUXA 3IPAA 5E3JA 3N0WA 5TQ2B 3H75A 1GLGA 3Q15C 4G0QA 4HNSA 4MAAA 3LKVA 2FQXA 1EAYA 4YLEA 1ZITA 3EQ2A 4Z4HA 4RK6A 2R4QA 3KLOA 1BDHA 2MSWA 2RDMA 3EDCA 3I5AA 3M6MD 3LFTA 4G0YA 1JFSA 1HEYA 1OXKB 1DBQA 1JBEA 3KCNA 3F6CA 4LE2A 2QZJA 1QKKA 1VPWA 4G0ZA 3QK7A 3CRNA 2RJOA 5KC8A 6CHYA 3DLBA 4NCAA 1W9HA 5HM6A 4PE5B 3G1WA 4RK1A 5BR1A 1YIOA 4O5AA 5KWSA 2L18A 3Q7SA 4NQRA 1PHRA 4W5OA 3QLUC 1KRWA 1I3CA 3Q9SA 2MSKA 1CEYA 5F64A 2RGYA 4H3KB 5TPWB 4EVSA 4N41A 3QELA 5KQLA
chains in the Genus database with same CATH superfamily
2QT9A 3L4BC 4KTTE 2WM9B 2X0JA 3P2EA 4IIFA 4LCBA 5CA1F 5FBVB 1EDZA 2FWBA 3DDWA 2IHUA 2CL0X 5CVCA 5JQGF 5KYGA 4M1MA 4CKBA 2I4TA 1QK4A 4IXWA 3FCYA 1R0RE 4MV5A 1CUCA 1U5BA 5EAIA 1AOXA 1E4YA 1FDTA 4FSXA 4YDRA 1A2QA 1CUGA 3HVUA 4GLOA 4BVFA 4YAIA 3VPFA 2CHVA 1XMJA 3G2PA 1HETA 2QRMA 3QFHA 5EFOA 3RCBA 5JYCA 1NMSA 1QO7A 4Q48A 5DX1A 4BUZA 4XPIB 4I5EA 1WXQA 1PO7A 1VBKA 3HBLA 3DPSA 1XIVA 2PUDA 2Q1UA 3PQ7A 1DBRA 1VMIA 3BAFA 2WSLA 3V2IA 2EATA 2GT1A 3ZU6A 3DBIA 3B6ZA 3L0SA 4JQYA 1I3OA 1ZW1A 3M9LA 3GFOA 2P8SA 4JWTA 5FFFA 3E81A 4B2LA 4BJ3A 1OBCA 4WERA 4ZZ2A 3ECSA 1VHTA 3LU1A 5FH9A 4FNAA 2ZQYA 5JASA 1W76A 4TWZA 4C3VA 1DKLA 1JHMA 2NUAA 2FGKA 2PJDA 2ZYAA 4J0IA 5FT9A 4LJ6A 5FI1B 4F3YA 3JSAA 5JC1A 1CVRA 2O3TA 4IFIA 3RRZA 1JJVA 3DMGA 3CB4A 4PNZA 4XSVA 1N3IA 5TSDA 2I0FA 1R4NA 2CXQA 3I2FA 4NPAA 1SBYA 2QGZA 1U1GA 2OAP1 1R6DA 4EKYA 3KZNA 3LSYA 2MSEB 4UVDA 3C43A 3EEYA 4Q9NA 4V02A 2V1UA 2DERA 5IAAA 4FB4A 4OP1A 1HV8A 3HXLA 1V95A 2QX9A 4MKGA 2QMHA 3OZFA 1C0KA 5DSZA 1NBMA 1CE8A 1YBHA 2JIRA 1F2UB 3K70B 3F98A 3SBEA 3NBUA 1KS9A 5GQSA 2VA8A 4RXUA 3KETA 3V7NA 4AU1A 3FSJX 4I14A 2B2XA 1Z4NA 1UJ4A 3JD0A 2ZBDA 1O77A 3N2LA 3SS8A 4JVLA 1MQ9A 4YPVA 3T3NA 2EAUA 5FYDA 1Z5PA 3WRYA 5BN1A 1MGOA 1JHDA 5LIRA 3AP1A 1XMQB 4D45A 2VTDA 3DT8A 3M8KA 4W4TA 1G21E 1QONA 2WUFA 1E2HA 1O6CA 1U11A 2ZRBA 3DHVA 2D1QA 2CSUA 4K1XA 3NTLA 1HLDA 5ALQA 8ABPA 2FEKA 1YRYE 4CL3A 1ECGA 5JC8A 2FPIB 3RS8A 1A72A 4NHOA 3H9BA 1XKXA 4FHEA 2W9XA 4JY7A 4FYWA 3WGLA 2FEXA 4JYAB 4RU1A 2WNHA 4ZARA 8ADHA 5I7VA 3RB8A 1QLWA 4QT4A 4R2WA 3ZD6A 5L3SB 3GCZA 1NM5C 1NN1A 1OA0A 3FRIA 3CX7A 3D3KA 2YXEA 3OIFA 4HVTA 1GKUB 3OF3A 4QPJC 3W2TA 4PBSA 2XCUA 1U9YA 3IBSA 4NYMQ 2UAGA 5DNVA 4ZZ0A 1YQUA 1C81A 3DW3X 3DZ8A 4FE7A 4JLPA 1CRLA 4UXIA 3G9ZA 1PR1A 2QM3A 4Y2XA 1G20E 1E4OA 3ACBA 1KVQA 3O8NA 3OZWA 4YAOA 3Q8LA 1RKVA 4EZEA 2BTQA 1CR6A 2NZWA 1LXCA 4YY3B 5JFGA 1IATA 2XYHA 4NBLA 2VPPA 1N0HA 1IN7A 1Z3CA 3P19A 4PIVA 1VB5A 3QU5A 1VXRA 4AJ1A 4UATA 1H94A 4WX2B 3BQNB 5D6NA 4WASA 2PJRA 1TM3E 3M89A 4TS3A 3DBVO 3W4KA 1H23A 1YL5A 3LGSA 4KE8A 3NVKI 1T4GA 3ZG6A 1T5SA 2X2OA 3JQAD 4H1WA 4WVFA 1ORDA 2CLMB 3DMYA 2NVOA 3GLQA 4HH1A 4OOEA 3WB2A 5BR4A 4RLQA 5A62A 5H16A 3FMPB 5DM70 4DLZA 4I1YA 1SQ6A 5ALKA 5LWHA 5C53B 2F4VB 3BMOB 1L5WA 1ZC4A 2VCYA 2ZRCA 1IPFA 1BD3A 3IKJA 4WNCA 3N8IA 2FXVA 1JHZA 3U4AA 2QRPA 4AJLA 1NHWA 1OPXA 1PKEA 5GZ6A 1HKUA 4PCAA 2L69A 4C43A 3UIEA 4DTCA 4ARIA 4LQ4A 3G6WA 2ZI5A 4YUVA 1I7QB 3RIEA 5EJIA 4E5KA 4EG1A 2AZXA 1WPGA 4NE9A 2PU5A 1PJBA 4MGHA 3V46A 4CR8A 3GRUA 5GONF 1YA8A 1Q0PA 2DH5A 4ZI2A 3DHWC 5LA6F 2R751 2AE1A 3Q9NA 5AVZA 1OSNA 4ILKA 2D1RA 5NULA 2XGGA 4I4TB 2JGFA 1LB1B 5C18A 1BYUA 1NW5A 3KKEA 1JI3A 2PZAA 3ZW7A 5FAKA 4HZUA 2CY0A 3E03A 3HV0A 3DBOB 2OP1A 3FPHA 4JXJA 1CUDA 3IEMA 4LI3X 4AM8A 3WYNA 5BO5A 3U44A 4JJZA 3AKEA 4QPCA 3MT0A 4C6TA 4LJRA 5EVJA 2D4HA 5AIAA 2JZCA 4CLDA 4OGKA 3N7AA 2O8NA 4LSZA 4QOFA 2JIMA 4CLOB 2BFDA 5A5VA 2E1RA 2COEA 4YRRA 2NZUG 3FUVA 4XDYA 3T4UA 3BK7A 3JW8A 1T6BY 4KQWA 2ZCJA 1HR0B 4EKNB 1TLLA 3F5MA 4L8VA 2VWHA 2YJ3A 1VOTA 3BMXA 5ALTA 3UXMA 4HS4A 4L7VA 2QX8A 3SU8A 3EVDA 4MW2A 5DYWA 2DB3A 1E9BA 3F6EX 2V7QA 1PQUA 2QE7D 4NTZA 4N9WA 1T1SA 4QE3A 4KR3A 1C7JA 4JL6A 3BE8A 2PLFA 1VCIA 3HCPA 5T6MA 2DWQA 3Q40A 5DTEA 2ILTA 3REFA 3UJ7A 2XTMA 1R3DA 3RYFB 4RPCA 2CL6X 3A70A 1TU3A 1USGA 1BCRA 3UMCA 4MW7A 4NULA 3G9TA 4ZDKA 421PA 4FMBB 4JLBA 4M1KA 5IBQA 4J0HA 4UAUA 3RS9A 3M9WA 4AN4A 2O8BA 1OAOA 3PTLA 5THXA 4KODA 3OT1B 3K0FB 2EZ4A 2GHRA 3IT0A 5HRCA 1KJYA 1GZ7A 1QIIA 1XTQA 5AHXA 4E1VA 5IDYA 4KFCA 1IY1A 2B8WA 5J2TF 3DEZA 3DDSA 4UM9D 4WJLA 5JSQA 2VYVD 2WUDA 2PRZA 1TU0A 1YCDA 2F43A 4LF4B 2P9EA 1EP9A 1SG0A 3EXEA 3BS4A 3FKSA 4IH1A 4MZDA 4DANA 4ECAA 4MRNA 2IHTA 1DEKA 1ZNZA 1DKPA 5L51A 1AUPA 4RTSA 3WHKA 4V1CI 2X5XA 1FFWA 1RR6A 4QVKA 3UWDA 4HB4A 1DGQA 4O4IB 4TYQA 4NSNA 1AA6A 1E6WA 2R5NA 3LCVB 4BCCA 4DARA 2AFHE 4X0EA 4CKWB 4ER0A 2B92A 1K7YA 2H8GA 4HLCA 4M1QA 1Y3CE 3T6KA 3GGGA 3PITA 2PCLA 4FHCA 3BXGA 8OHMA 1W5FA 3IQFA 3LO8A 1B6TA 4GOND 2BEVB 4QDKA 4UNNA 1IJEA 2C98A 1N2CB 1QGDA 3L7KA 1OT5A 1RXCA 2VHQA 1RZVA 1QF7A 1MNAA 4ARBA 2J09A 4GR9A 3HDQA 2EG9A 1EUDA 1DQSA 1L4YA 2EP7A 2QTAA 2WC1A 3GFRA 4OD0A 3EGXA 4DCTA 2Q5CA 5CA1A 2RGAA 3OCWA 2JJ8A 5JQGA 1B0AA 1SC1A 2D0PB 3RGWS 1W25A 1WHTB 2DF8A 1FXWF 5EMNA 5IYZB 4GG1A 2J9YB 1YZQA 3R3UA 1I5OA 4JYZA 4YGYA 4IWYA 2X9QA 2OGSA 3DC2A 3EVEA 4L3OA 2QAGC 5CHYA 5EIBC 3AB3A 4J1TC 3U7RA 4AXBA 4LF9B 2J0VA 1Z6PA 1KVSA 1XTJA 2GM9A 1NW6A 2JLAA 2RG1A 2V8OA 3QFCA 4JODA 4MUHA 4S1OA 2WM8A 2D1YA 2BCEA 2X8LA 1JDVA 2ZSKA 4RY2A 5EXTA 2FWPA 3T1TA 1D6NA 2C94A 4W9NC 1L1RA 5FOQA 2CFRA 3DBLB 1LVGA 2DTDA 3UHFA 4BFTA 4DT1A 4J0GA 1QHEA 1DC6A 2ZBGA 2C0CA 3NYWA 1CXZA 2VBCA 4OSEA 1N2BA 1KFBB 2H31A 1M2NA 2JAHA 2R6CA 1I7LA 3FZQA 3SSOA 4AZVA 1PKXA 3Q1LA 4IZ6A 4O4JA 5HWSA 1E1YA 1TM5E 4S1VA 3BL8A 2XCIA 2B8TA 2IU6A 3NTQA 1JYEA 2WLTA 5K8IA 1FUEA 1IY8A 4WBSA 2CD7A 2FOIA 2ZT7A 4ZOBA 1PVOA 2FMHA 3O6VA 1L5NA 2NXNA 4X64B 3UKDA 1OYYA 1Q1BA 3LCMA 4XAQA 3M5CA 3UG7A 4ED9A 1XJ0A 1W0KD 3C7DB 3AJDA 4WEOA 2GARA 1OU0A 4FOLA 3TLZA 3OEWA 2J33A 1T0IA 3EC2A 1SKAA 4B9EA 3R9WA 3IULA 3ZVKA 4U7HA 5ALHA 2FCAA 2VRWA 3D3NA 5AHOA 4BBAA 5FDFA 1MFZA 4RIFA 3I6IA 3UBTA 4BPBA 1DO2A 1TVKA 3SR0A 1NX6A 1P7PA 2FRXA 3FFWA 1HSOA 1PR3A 3BFVA 1LX7A 4JP2A 5LQSA 4OHZA 5CFMA 5AJUA 1JP7A 3BX1A 3UNXA 5CB0A 3RNOA 5B7PA 3I61A 2TYSB 1A1VA 3S2YA 4QPPA 3ZWBA 1EM8A 2WIFA 5BN5A 1LH0A 1P0MA 1Q7CA 5HJ5A 3RIXA 1S02A 3P0FA 3I62A 3R9IA 5T64A 3BXFA 3LVBA 3DKRA 3K70C 2AI1A 4GKKB 1CS0A 3ZWDA 5ADHA 2BGJA 4CM9D 1XA0A 5E4FA 3QVWA 3PFIA 4BNFA 5A4JA 4DSNA 1PG5A 1MJGA 2QYSA 5JPIA 4BN4A 4RD4A 5KUTA 5EL0A 1BXRA 2GN0A 2NZ8A 3PUHA 1W1UA 4UBOA 4RYDA 2DX7A 4NZNA 2SECE 1SK8A 2Z56A 4R8VA 1XPUA 1Q6YA 2OHIA 4A8JB 3V8NA 4EHHA 4QUGA 2GBGA 1CR1A 1QH8A 4FFDA 3ZVRA 3OC0A 2V4MA 3T3HA 2V45A 4BVHA 5KNBA 2WIKA 4JB3A 1GNSA 1X8KA 3JQPA 2JCYA 4M8KA 5CDSA 4B35A 3A6PC 1E3DA 3TF5A 1IBSA 4CL0A 1SCNE 2QD2A 2IIBA 3D2LA 1WUTA 2DKFA 2FDRA 2PYDA 2QJRA 2W0SA 4TLMB 4YJ3B 3IP6A 5IDQA 1ISRA 1U3FA 1MAAA 2SKCA 2OXTA 4B46A 1F3LA 3PGVA 1H4VB 1T0HB 1T2DA 3AUSA 3H11A 1CX9B 1RVDA 2OKGA 1NMZA 2VF5X 2YQ4A 1S2DA 4J07A 4W5JA 4HLUA 1D07A 3H4VA 3DBRB 1PR2A 3CLHA 4BX9A 1CIVA 5KYTA 2WVAA 4RK4A 3ABSB 1DIBA 1JU3A 2IZ1A 1QVVA 3HFRA 3L0ZA 1PTJC 3TLGA 2EFJA 2LTAA 1PJ4A 2WU4A 3M6XA 4MWDA 2QEQA 3PRYA 2Q2WA 2RI6A 1WDTA 4KVZA 4XVCA 5HKKA 1L5QA 1NXVA 2QZZA 1YJCA 4LC1A 1F17A 3KX2A 3MBIA 4HP8A 2NO9A 4BECA 3K0EA 4UHBA 1IRXA 2D5LA 1K7CA 2BUAA 3KWLA 3VU0A 1BQEA 4OB6A 1SCKA 4UMEA 1O96B 5K2OA 3NHWA 2CMHA 4CMHA 2IY8A 2WFLA 3FDXA 4O3FA 5IVHA 2W4QA 5SYAA 3A3YA 2RMKA 4PGAA 3NM6B 4JBNA 5DVZA 3SC3A 3QQPA 2IY7A 3BIOA 3ILHA 1EK5A 3V8BA 2AV6A 2XQIA 4M0LA 4EECA 2VQFB 3B38A 4IP0A 3O94A 4GHWA 5KYUA 4JENA 2IDJA 4PNPA 2PQ2A 4AB1A 4RKYA 4I1RA 5F2EA 5IJ0B 5IBRA 1EZ4A 1HFWA 1HSZA 4KTVE 2ZYWX 4W8OA 4R9UC 1PEYA 5CCXA 2PKWA 5B2EA 2J0UB 1JG6A 4I8IA 2FQYA 1HBJA 1PYGA 2PSEA 3IB3A 3PXBA 3EWAA 4WXPA 2Z1MA 4JC0A 4AJ2A 1VDMA 4AN0A 5B2FA 5CIYA 1IBKB 1OWLA 1DUIA 1R0YA 5FPYA 5D3KA 1E1RA 3CCBA 3DZKA 2AB0A 2ALJA 1Z2NX 3FOWA 3T94A 4AAYA 5BMOA 1KJ8A 1ZMBA 4DLSA 1B14A 4LOAA 8GPBA 5LU8A 1P81A 2ZRJA 4URFA 2RB5A 3M6MD 3AZQA 4WH0A 4WDRA 3ZDDA 1CFZA 1EM6A 1SXJA 1KDPA 2XEDA 4RF3A 2IRWA 4P3OA 4K7JA 2IXEA 4GICA 4AZ0A 4EI2A 3V6LA 4AY5A 2QZJA 1QKKA 1VPWA 1KZ1A 5EEHA 3LT2A 5TGDA 4CFYA 1GPDG 3F96A 5JTTA 1KVRA 2C3UA 4F4HA 4IHQA 3CXRA 4BY9E 1H2ZA 2ZBVA 4PE5B 1RRFA 3CNQS 4ITRC 3TE6A 2PT9A 2EU8A 4MI6A 2F3RA 4RZ2A 3KSAC 1ZHOA 5CDUA 3T7IA 5HKBA 1EVZA 3DFMA 1PJ2A 4X92A 4DQKA 1UMBA 1PHRA 4C9BA 3IOBA 4KFSA 2QDKA 4NCNA 1CS4C 1MEEA 1W85B 3OFKA 4BO3A 1EFTA 1V48A 2B98A 4EVSA 2J67A 5BPHA 3DEAA 2I71A 4XFDA 1U2GC 4DR1B 2VJOA 1TO1E 2HO5A 3B5IA 3C3CA 1WUIS 1TW3A 4D3YA 5CG2A 3TOXA 3CCFA 4AYWA 2ZE8A 4YUXA 4NV1A 5GVSA 3KLMX 1JA0A 1ZN8A 2CYBA 1WZUA 1PZMA 3E84A 2WJ3A 3PQ8A 4C4ZA 3GFSA 4G1CA 5A5FA 1ZVMA 2Q2QA 4P4SB 1JVBA 4B79A 1J5XA 4RUKA 5KQGA 1E66A 4RVSA 3A1UA 5CFLA 3IMCA 4Z54A 2IV3A 1QFMA 4QREA 4GYJA 5E1BA 4B71A 1C4WA 3HY3A 1PBNA 1CUZA 4OK5A 5J2TA 1GGVA 5EUBA 3KAQA 2LIVA 1V37A 1M83A 5L3QB 1Z0DA 2WICA 3QXCA 1X1EA 5IAKA 2ZRFA 3LVQE 1ZH8A 4DLUA 3BWYA 5JBNA 3T5MA 1XGKA 1OXBB 5BRNA 1UPXA 3LBIA 4E7OA 2ZYSA 1JQJC 1T9AA 3B52X 1UPBA 5FOTA 1P5FA 1QH9A 1SGWA 1WQ4A 1KO8A 1V43A 1VHDA 1YQTA 2ONKA 4XPZA 4YMWA 4FU0A 5CHEA 1K8QA 3I2YX 2VS1A 3CEAA 2WT4A 3NDPA 1TD9A 2Q3LA 4X7BA 3TPCA 2EKLA 4RDCA 1DUSA 4JLSA 3RABA 3SF8B 5DK4A 4K6MA 4FGLA 4W99A 3VZBA 1A8PA 4EG3A 3AETB 4NDNE 3LWDA 2YH2A 3B3FA 4LMAA 5KNCD 1N7HA 1ZISA 3DEFA 3MPUA 4H08A 1QM5A 4Z9BA 3A9WA 3ZR4B 4X20A 1DUVG 2IHVA 2XNJA 3F3MA 3WHPA 3IALA 4DWOA 2B3TA 4CQLB 5TVKA 5FWYA 2A58A 4QBFA 1FBTA 1UZUA 3LKZA 3EVNA 1ZGHA 4N8EA 1KKUA 2I2BA 1FXWA 4J2OA 1AGYA 5H9WA 4F8EA 2IOYA 2OV2A 3GLIB 3JAWB 1YZGA 3K2BA 2OZPA 5HP4A 2PX3A 2AX3A 1X7YA 2OHVA 4I36A 4WUTA 2ZUCA 1OTXA 3O3OB 4IJUA 4KQXA 3HFJA 3KU4A 3N07A 2PUBA 2CHUA 4CIBA 3MVEA 3CUKA 1SKUA 3L5OA 1SIWA 3C2QA 3DV9A 3REOA 4E21A 5JAPA 1B73A 1J8VA 2R47A 3BKXA 1S8NA 2ONYA 4RA9B 2HL6A 4FQ8A 4IIUA 4P33A 1NF2A 5KNDA 2C9ZA 2R6DA 1I3KA 2VL7A 1QO0A 2OTCA 1FC0A 2H59A 1DZ3A 4Z0NA 1MPTA 2OZLA 1LW7A 1HG0A 4QJ3A 1AS2A 1WZNA 3TNFA 4BVBA 4UEOA 2PS3A 5JZ9A 2XNDA 3PQ2A 5D3MA 2GN9A 2EHJA 4JB8A 3H2KA 2WKWA 2RAFA 3KR2A 4I9GA 1L7EA 1T6XA 4H3HB 5SYNA 1TZKA 1R15A 1Y8AA 1AN9A 2Q5LA 1CUJA 2XKAA 1CKEA 4LPSA 4WA7A 4EMBA 2G9QA 5DNYB 3R41A 1JR2A 2V7WA 3NX4A 2Z2JA 4ESEA 1X15A 4MUAA 1LX6A 1FYEA 2F3TA 3K0CC 3ZJ4A 4H31A 3K9WA 1GQOA 1D2MA 2YHIB 4O2AF 2HU2A 3RHZA 3WWEA 5GZ1A 1MIOA 3G7SA 4WLUA 1PZXA 4OBXA 3KKOA 1EGMB 2WWFA 5T4EA 4DXAA 4EYGA 3R0ZA 2Z4SA 2YIMA 5A9SB 1B43A 2P9TA 1RLJA 2PZKA 1YHYA 2H1HA 3D5EA 3KEQA 4WLFA 1TQ6A 1UFKA 1I14A 2VP3A 4KQ6A 2FKAA 4X60A 5D85A 4FGKA 1KWGA 4I1PA 3T41A 1YIAA 1XF9A 5P21A 5C8VA 3GMTA 4N3BA 3O74A 4UQPA 2AT1A 4E33A 5DNCA 2E5FA 3SIWA 3KJZA 4G81A 2ZLBA 4DIKA 1MAVA 2HEGA 3K9FC 3HDJA 4JI0B 3IKVA 3SDBA 5EY5B 1Z5GA 3ZIDA 1G0OA 1ZM4A 4GPAA 3EVFA 3M33A 1DU4A 1J9ZA 1FBNA 4GKBA 1YB7A 1FQKA 1AU9A 1JHPA 3QHQA 2VTBB 1OFUX 4W9MC 5LMUB 3IEIA 3U81A 1F5NA 2QUJA 2B3DA 4JL8A 5B1YA 2R00A 3SXJA 4CGZA 3VR5A 3WWYA 3C4VA 4KE9A 2RGEA 4NHEA 3K5WA 1EDOA 1QYCA 2CHQA 3KOXA 4M4SA 4U02A 1QJCA 4E6EA 2VDQB 1C9KA 4MV6A 1CY0A 3S99A 5GM1A 2AN3A 1Q1EA 3WRXA 2Z9CA 5C8XA 3IELA 3IURA 4Q4JA 3BGDA 1Q12A 4YP7A 4MJ3A 4PO9A 1TYZA 5TPZA 4FGSA 5DPMA 3TZ6A 4WACA 4A3SA 3PDJA 4LF8B 3WLAA 5E7QA 5AH0A 3SZUA 4A8JC 4KMOA 5JADA 4CG1A 3L6UA 4KUEA 3H8VA 1T34A 2QN3A 4BU0A 1O0BA 3HDHA 4GW3A 5SZIA 3R5XA 1F20A 3KYCB 4M89A 4Z4QA 5C37A 1UWLA 3VVMA 5A6SA 4K9NA 2UXBB 1XLUA 3A31A 5CIQA 1XZAA 4L9SA 4HQFA 4PR3A 4F0JA 3N0VA 1KOLA 2BDEA 2QD4A 4KXUA 5AUNB 2IPOA 1NLFA 4JLJA 5IK2A 3KU1A 4FOTA 3HR8A 4MMYB 3VR6D 3RDPA 4JSYA 4DJ5X 4DCGA 3MCUA 4EJ6A 1UDXA 3MXOA 1OH5A 5K6RA 4QU0A 1OYOA 5AXAA 3WY9A 4EX7A 4G41A 3UEOA 3CNHA 3LOQA 2HUPA 2E4XA 3ZWCA 2OT3B 3UUEA 3N2KA 1JG3A 4QM6A 4IXTA 2R84A 1DQRA 2P78A 2Q3EA 3CR3C 4PIPA 5DN6A 3T5GA 3GXOA 4YROA 2RE8A 3PNPA 1E1KA 1P6XA 4UHJA 1VIMA 3HBMA 4LRTB 3SZOA 2QTHA 4KO2S 4L8WB 4GUAA 2Q0XA 2ADMA 3CKLA 4KXMA 4TXNA 5E2IA 1JXAA 3UYKA 4E07A 3LUPA 3AY0A 1JIKA 3BMQB 3DCNA 1EQ2A 3MLBA 4DLWA 4JOSA 1W4ZA 2F3UA 2WYOA 3UAGA 1KXJA 4N3AA 1CWUA 2RKBA 3DV0B 5DNAA 5HZKA 3NASA 1JQBA 4WCDA 2I80A 4O4LF 4ZWNA 1KDRA 2HWUA 3SHOA 2WR8A 4M36A 5SICE 4UM9B 2PZEA 3C6KA 1RU3A 1KI2A 2D4AA 2ZU0C 4X63A 4RM3A 1T5IA 3R5HA 2BTOA 1EHCA 4BGDA 3CV3A 3D4OA 4UD6A 5JH7B 4GDFA 1A97A 4RESA 2FDCA 3CH6A 1M0TA 4I4IA 1QCZA 3FFBA 4BMOB 4C0SA 5TEVA 4BLQA 1GAXA 1A5ZA 4R7ZA 5AQEA 1ZBQA 5C1BA 1E3SA 1ZD8A 3D6UA 1Q1ZA 3L01A 4Q3CA 3WFJA 2AUTA 4CV1A 2IPAB 2IZ7A 3HJCA 4G2NA 3KAPA 1KZGB 5IKMA 1GUFA 5CLFA 5B2ZA 2QQEA 4V1CB 3EIFA 3QELB 1L5RA 4RPIA 4Y0NA 1A8UA 3O2SB 3SZGA 2FEOA 2E21A 1RJGA 4BV2A 4F56A 2II6A 3RYHA 2KSQA 1CUBA 5FOUA 2H0QA 4TQAA 1PJ3A 2IY9A 3IESA 1OKKD 4A0FA 2XT0A 1X7XA 4I3FA 1SEPA 1SD5A 4HDKB 4PBTA 5CPFA 3YASA 2WOOA 4LXIA 1YONA 4P4LA 1KPHA 4JKIA 1H6CA 1AK9A 2VPQA 1I32A 4HMPA 3FFTA 1ZD9A 5BVGA 5KTTA 3HU3A 1BEEA 3MBOA 3AVQA 3HLKA 4KRYA 2YJ4A 4IUYA 5HPYB 1PDOA 2KQUA 2VDMB 1Z6GA 5ARCA 1KK3A 3EQ9A 1NYLA 4LX8A 3B85A 3SNKA 2N46A 1VL2A 4PPGA 1V9CA 3OE5A 2IJGX 3DZCA 3ZU3A 5JI3E 2HXSA 5ERGB 4Z3DA 5C32A 4JLUA 1VIVA 2Q1TA 2WFAA 2IHJA 1NQUA 1WUJS 2AYXA 4PQFA 4E14A 1KEWA 2FEPA 3FBTA 1L7BA 3KC2A 4OQLA 3R77A 3EGVA 4RV5A 1DBPA 1XRNA 2I6TA 2RAUA 4KITB 1BRMA 1PGOA 2C2KA 2VJMA 3G2OA 3IILA 1Y8RB 3RW9A 1N8KA 3DPIA 4MXDA 3EQ6A 1JIIA 2IXAA 2IHBA 4JJGA 4PEVA 2H1WA 2ECQA 4YRGA 4EELA 2GN8A 4MRMA 5IU6A 2O57A 3NHZA 3EY9A 4US0R 4I6JA 1U1IA 1AV6A 1RADA 3GJ6A 4DWWA 1UEXC 2ODQA 3BB1A 4OM8A 1F6BA 4F2DA 3JXEA 4B4DA 4UAJA 5CGZA 3ORSA 2IP1A 4C4PA 4UNIA 3LQKA 1FU8A 3KLNA 1SBZA 3BMNB 2OHXA 3F8TA 3RC3A 5KYYB 4GKAA 1KPIA 1XOIA 3RSHA 3VNBA 5KKCA 3AKZA 3B6JA 2VHVA 2GRJA 3MCAA 2VFAA 1U0BB 2TECE 3GGPA 4LHVA 1DDIA 1KQNA 1O89A 1RQGA 1S2IA 3A1EA 3H17A 2IQIA 1U7XA 4PPNA 4BUCA 2NN3C 4LOHA 5DHRA 1CBUA 1ULAA 2CJXA 1E5TA 2FFHA 3MT8A 4YCMA 3D43A 4LJYA 4RL6A 1AQJA 1J0EA 4NI5A 3NH9A 3N0XA 4JQCA 4ECEA 1LK5A 1XKLA 3RVRA 3SM9A 1LRKA 3MJHA 5BWBA 2FUCA 2OBBA 3K9CA 3O21A 1O94C 4NESA 2QQFA 4LVOA 2BY4A 1AZLA 1Q0SA 3BZBA 4BWVA 3J80A 2LP4Y 1VKOA 2JC3A 5DBGA 1UWCA 4HAIA 1YFKA 2D7CA 2V65A 2R8YA 1P2GA 3DDCA 4IQGA 4MEJA 2BEWB 4UMFA 5CCBA 3K1YA 4OF4A 1Q77A 3I0MA 5IZCC 2E89A 3S6JA 1THTA 3COPA 1TA9A 4E30A 1FXUA 4EY7A 4R41A 1E2MA 3V1LA 5BW5A 2DZDA 1HDCA 4GSLA 4IDOA 2HGZA 1M67A 1JKJB 2X1LA 1E4VA 4BIIA 3JWGA 4Z2AA 3RBVA 4HXGA 1K27A 5JD3A 3M4XA 3T3EA 3FYTA 3OHSX 3ZCRA 2V4UA 4FPXA 1E6UA 1NTOA 4LRUA 3ABQB 1DZIA 2XUZA 3PDCA 8ATCA 2VZEA 1GU1A 1NVKA 1Z5UA 3K53A 1AKVA 2VLBA 1WL8A 3I9LA 5EIHA 1RP1A 4JNCA 4PYOA 3UKJA 3TFOA 4DMFA 2H8KA 1V5FA 5L95A 1LKZA 2IUSA 2X3FA 3GFBA 1ZMRA 3V8RA 4BGVA 5KU1A 1AK2A 1MJFA 2CE7A 4I4CA 2X23A 1U99A 2JIBA 4B6JA 1ULSA 1H65A 2H1IA 2VRBA 2C4NA 4JA2A 5JVDA 1IN4A 4GOKA 5I7UA 5LXTA 3QA3E 1SHUX 4XB1A 2MMGA 1W8IA 5TR9A 3ZWOA 1K8ZB 2GEDA 4U2BA 2A3RA 2BKVA 2C7GA 1L7MA 2OLJA 2VDOB 3LECA 4RACA 3C1TA 3S1AA 3AG5A 1JKXA 4PVCA 1P29A 1ZSNA 2ZXUA 4PV7A 3CJQA 4TN5A 3QNMA 4HXFB 1ZONA 5KOJB 2ZVQX 1I1HA 1O6FA 3VAYA 1FLVA 5KBYA 1MDFA 2JLRA 3RU9A 3WWDA 2RJNA 3WLLA 2ERYA 1OWMA 3BMCA 2XD4A 2P4EA 1AC5A 4P92A 1M5UA 4G85A 5AI6A 2COKA 3G8DA 1V26A 2YRXA 1XO1A 4DLNA 1W4BA 1A96A 1HDZA 2PZMA 3G0IA 4LY9A 1R12A 1PLKA 3LXXA 1YBAA 2R87A 2ATEA 3PFHA 3EXG1 2C5BA 1GSAA 4DQVA 3ZLVA 1IUOA 2KS6A 3F6PA 5HG0A 4H16A 4ZQIA 4BVKA 4AY6A 4HN2A 1PE0A 1C8BA 3CPEA 3PA6A 3EXHC 3TXAA 1WSWA 1SUDA 4KP7A 4E2YA 1E2EA 3G8BA 3VH4A 4DB4A 3RF7A 2G9VA 2RFLA 2ZUSA 2ZK7A 4YQEA 4C20A 3PE3A 3E8MA 4ZRDA 3IPAA 1WMAA 4M9ZA 5TRTA 3C7KA 3F2VA 4K9RA 4XGQA 5G4KA 3AKDA 4OJKA 2OXFA 5DTMA 3IT3A 4RK6A 2ICAA 5A03A 4LBVA 3PIRA 3KSBC 3EH1A 5EPUA 3R0IA 3R5JA 5E2BA 3PXXA 1L4KA 1EXDA 3WK9A 2CEKA 1K6MA 3S1LA 4C7MA 4XTCS 1CDDA 4IHJB 1I4TD 2H6EA 2R68A 2ZBQA 5CEJA 2C8JA 2YFQA 3ILVA 1J00A 5BN4B 3FZYA 1TCAA 1ZNYA 2X76A 3VTZA 2FQ1A 3KQSA 3AOEC 2ISCA 3AVUA 1LF0A 2RJOA 1LVUA 1UMDB 3EHEA 4HC4A 1BEUB 5JTUA 2VDUE 3GEIA 1R0KA 3AR4A 3EVGA 5HM6A 1TFUA 4AY2A 1E8NA 1CERA 4I66A 3WJ7A 2QOEA 1ZOLA 3G1WA 1W2GA 2G06A 3AEQA 3LGXA 3O90A 1SBQA 5DF1A 1VDZA 1FFYA 2RHHA 3KQPA 4N5MA 3ND7A 5IC4A 5A0VA 3HQ4O 1DB3A 4RH1A 4NU0A 2JI9A 2OBLA 1P4AA 1SUEA 1G3IA 4IIVA 4J75A 3TXXA 3W5IA 5J4KA 5HNKA 5TPWB 3HCFA 4LJ8A 3VUEA 3SLGA 2M6SA 2GQ0A 5FFNA 3MS4A 1ODJA 4M8IA 4R84A 5AMXA 1VLLA 1A9ZA 2YWRA 1VPLA 3KXIA 2W4MA 4LG1A 4XRRA 1GFZA 1KEUA 2BN4A 3KOOA 4N3CA 4RX1A 4ISCA 3FZNA 4YRPA 3UK2A 2PSSA 5JRDS 3PHJA 4IUBS 3LHIA 3R0XA 4J0DA 3WJ1A 3R5SA 2J31A 3PNKA 4PFJA 3LDHA 5JXJA 4YT4A 4KW7A 3JQ8A 1X92A 2A9PA 2VO1A 2VDPB 4ILEA 3WNCA 3A3OA 4DV5B 1ENZA 1BVRA 1Y9JA 3QTTA 3KYIB 1X86B 4G9GA 4TUYB 1H2EA 3P9SA 3ZNNA 4UM7A 4CEHA 1HE8B 4KR7A 2EFYA 3FB4A 3QSGA 4DNFA 1FSPA 3LZCA 3U37A 1KYWA 5J47A 5BYJA 3AK4A 3OTGA 2MYTA 5DEIA 4MWGA 1EPUA 2C2HA 4D1YA 2QENA 1ZWLA 4QGSA 2PX8A 3EA0A 5L45A 4LRYA 3U4QB 2XY4A 3ACDA 4GR5A 5HDBB 1OB2A 5BRJA 3RVBA 3LLMA 3PQ3A 4C87A 3A1TA 3AFNA 1ESCA 2VG8A 5EWLB 3G1TA 3E35A 1RJFA 3MJCA 4MTCA 2O5CA 1L5YA 4Q18A 1VLZA 3AX6A 2PIAA 1W19A 3KYDB 4N1AA 3K9HA 4Q66C 2ZSBA 2JIDA 4MR7A 4N0QA 1UEIA 3OQOA 4EG5A 3AUXA 2AKEA 4FWIB 1QYVA 3R8XA 3JX9A 2Q4OA 3AEXA 4DEYA 1W87A 5EQFA 3GOQA 1BHSA 4NR0A 1Z0UA 3LY9A 1DEHA 4JOCA 2W98A 5F21A 2AJCA 1JLLB 1I5RA 2UUPA 2C4UA 3ZV5A 3DUFB 3F9CA 4MQEB 3T7DA 4EG8A 1G8GA 3QVSA 1SBCA 3RJ5A 1G5QA 4R2HA 1VQ1A 5KSYA 3AM1A 1ABFA 5JCJA 5DO9A 3ZKWA 1MOQA 3IE1A 2IHKA 4FZ3A 3BHNA 1I2CA 4DDWA 4QQ8A 1Q0QA 2O0LA 3PENA 1SIUA 4GX2A 4YMIA 4P34A 5CA0A 4BLOA 2DBRA 1V7PC 1Z0SA 4XB2A 3HXQA 3IDSA 1U3UA 4UHHA 1GXSB 4K2HA 3DZDA 4ADSG 4TVOA 1DIRA 1MF7A 3H86A 4N7RA 5ALWA 3I28A 2HO4A 3KLPX 2B78A 4LXXA 1FUKA 3ZE7A 4BDSA 3TWOA 1Z45A 5G1PA 2C78A 1WABA 2WSSA 2ZSHA 5EESA 4EJMA 2BHSA 5BV2P 1D8AA 1T2NA 1ZGAA 1AQ6A 4G84A 5EMLA 5H83A 2I6UA 4N82A 5GJVC 4QBIA 3V55A 4OKNA 3H9QA 3COVA 1UJ5A 1X8XA 2FSUA 4UASA 1SUAA 2NVBA 3I76A 4OHWA 3IOYA 4C7VA 5LWQA 2QNBA 4RMIA 2OOKA 2RH5A 4PXYA 1TKAA 5A4IS 4LFCB 1S3GA 1N7JA 1B8PA 4KK4A 1QSGA 2CZCA 4BFYA 3D8UA 3HY4A 2XEXA 2XOKA 1P18A 1MJGM 3FD8A 3KK0A 4D9BA 3UJ9A 2QZSA 1RRGA 5T6BA 3VO1A 1T13A 1N3LA 4HMOA 3I30X 5JZMA 2ODBA 1OLXB 3TW0A 1XAJA 4A5SA 1YACA 3NP7A 4TTRA 2J3IA 4DR5B 4TXJA 4DCMA 3OOSA 3ODPA 4YT5A 2WTUA 5IKXA 1C2YA 3N3BC 3JQEA 3MTDA 3ZE9A 5KOIA 3DZFA 4QYWA 2PX0A 3HMKA 3BZUA 2VOEA 2PL3A 2YVQA 3GZJA 4FXOA 2Q5EA 3AMVA 2QQ0A 3ZHRA 4BWGA 5I9TA 3LQ4A 3W79A 4BHTA 3RREA 5I8WA 5EMMA 4QNNA 5J40A 1FYFA 4ZGWA 1AGRA 3O4VA 1BDBA 4UNSA 4YMLA 1NQAO 2PU7A 1BE0A 1OFIA 5T67A 4LF5B 5E9WA 2XXBA 4EHBA 2QTZA 2QP3A 1V1MB 2VT2A 2V54A 4FMCB 4I4LA 2CLHB 4GT1A 5AVUA 2Z83A 4ZCLA 3P9YA 5AIBA 3A6JA 4CMIB 5BSMA 1QZXA 3IAEA 2AVDA 1UZNA 1Q95A 4MJXA 4V2IA 3D8NA 4LOIA 2K5UA 3HCRA 3B9RA 4HCJA 1VGRA 1S4MA 2I4MA 2QPOA 4DSZA 4LFAB 2FN4A 4TS9A 1XMIA 2YBEA 2E49A 3ZUGA 3GAAA 3LVFO 4CCYA 4UPEA 2OAQ1 3K9BA 3ZJ5A 4CODB 3FF4A 4XQ9A 4O2LA 4N0EA 4Y9UA 5E6SB 1D09A 2P2ZA 3C6BA 1Z7EA 3NDRA 4F92B 4MW1A 3JSXA 5JSKA 4QWMA 4R1LA 2HJWA 4N0MA 3TLXA 2WUVA 3N6XA 4NMMA 1EMDA 3PPXA 1IMOA 4RNDB 3RIGA 3JQ9C 4KUHA 3VR3D 2H2HA 4B0PA 4YDQA 2KLBA 3L77A 3UOWA 4IMPA 4DNQA 2JFPA 2PMFA 5DHTA 1FSGA 3HCBA 1IOWA 4YREA 2UYGA 2BI7A 2ANCA 1GGFA 1MO6A 3PKJA 4OXXA 2A0XA 3FDJA 2WD7A 4ZT2A 3ZQJA 2P6NA 3VJRA 3AV0B 3DDOA 5REQA 2WWXA 4YEDA 1Z88A 1Q0LA 2A94A 2XA2A 3K6JA 2NT3A 2POCA 4G25A 4YJHA 3WDSA 2AWOA 1H1LB 1SR8A 4R71A 5LFAA 2BFMA 3ZDAA 3F5QA 4ZYWA 5DB4A 2Q5IA 3EGDA 4J2HA 5COAA 5IC5A 4BO4A 2FQQA 1ID8A 4D3FA 3OJFA 3ICOA 3FYSA 4OB7A 1O5TA 2AOWA 2GBPA 1GOTA 5DEOA 3WV4A 3O3NB 1L4HA 1IOLA 1Y6GA 3WMFA 1RPTA 4GM1A 3A9VA 4NBNA 4HX9A 4HEQA 1ZMTA 3BGWA 4K9PA 2QJTA 2BKEA 3K2EA 3PX3A 4JOQA 1VJGA 2D7JA 1B4DA 5HXAA 1NASA 1A5TA 2DKNA 2L17A 2XVZA 3MQFA 3JD1A 3VR4D 3DCIA 1UM8A 3HA3A 5ESXA 3MGKA 2PR2A 1U2SA 3OEED 4HNRA 2HNBA 3OTQA 4NJEA 4MA4A 2E6KA 2OO3A 2IOQA 2POQX 3GCDA 1KL7A 2H3EA 3K20A 4JN6B 5HEKA 2V59A 3PJGA 4HNAA 3SJBA 4C3ZA 1OIXA 1YMUA 2QF7A 3HBJA 3G5UA 3I64A 5JMOA 4Q3OA 5K0LA 1Z8HA 4L5JA 1E2QA 2VLIA 4Q47A 2ID8A 3RVOA 5EGNA 1M1NB 2FSSA 2WTAA 1AXGA 2PJUA 2ZI6A 3H1GA 4MV3A 4UPVA 1ZQ1A 4BX8A 1JZSA 3UY4A 4TKVB 1ZKMA 4DRXB 1KMMA 5ENZA 2VNKA 5ULLA 1P2UA 2QSYA 3EPRA 3IUBA 3BGSA 3OQ1A 2X4DA 4IS3A 1KO7A 2Q3HA 1E3WB 2WB4A 4NQZA 1PWZA 5CLGA 4AZWA 2FOLA 3K72B 2QTTA 1TC1A 3DOJA 3F4BA 3G0GA 5F7ZA 4AL4A 4C4SA 4RHYA 2IEDA 4KO1S 3KNZA 4WNAA 3DMTA 4D8TA 4DKXA 3NM5A 2YZNA 3CF6R 1CNMA 3CIFA 5ALOA 1T5TA 4YAKA 5JOQA 1XRJA 1UQTA 3VSEA 4A7PA 2OVFA 3D6JA 2D13A 3N70A 3AHCA 4NAHA 5I7WA 2RGDA 3PIIA 1NXTA 3V4FA 5F9FA 2QIOA 2TMYA 4L16A 1OH8A 2PZFA 2Y93A 1QE3A 3P9ZA 3DE2X 4NF2A 4OFZA 4WXMA 1YQQA 3A1NA 4KX3A 1PDWA 1Y98A 3LHSA 2HRDA 3OFVA 4PZAA 1FSZA 1LPAB 1TCVA 3HKCB 1XTRA 2YV3A 3E9QA 4CIYA 3DVRX 5F1PA 1RAFA 5SYMA 4HX2A 4NG5A 2IYSA 5KYWA 3KJGA 1XCJA 1XA4A 2PX6A 1C50A 2AG1A 4GNRA 4U7JA 3ZQ4A 3EVTA 4ETWA 1XZKA 3NAZA 3M3HA 1W5EA 3KE9A 4QTXA 3FNBA 1WBDA 4Q34A 2G3YA 2NLOA 1NP3A 4B3RB 2GHTA 3H5WA 3LIPA 3MAJA 1CRWG 4B3TB 4UU7A 3LDAA 2C9DA 2GESA 1UKEA 4XUEA 3RROA 1NXWA 2R2GA 2G28A 2QTGA 4J0FA 1QG0A 3JVDA 4ZDJA 1NW4A 3QBEA 3DNFA 3SHFA 1T3ZA 2B7LA 5HKOA 2H63A 2RCNA 2WIBA 3ZQUA 5CP8A 1GNVA 5LZ7A 1USKA 3CUYA 2BFFA 3QW2A 5AKYA 1X19A 1KMCA 3H2GA 4A27A 3CVWA 1Y81A 1Q0ZA 1UXGA 3NOQA 3GNLA 4HQKA 4GBED 4JNKA 1OV4A 4EYOA 5AVRA 3OE4A 3F8SA 2FJPA 3RLIA 3ZWNA 1XELA 3DVSX 3E1SA 4LX0A 4M46A 2NPFA 3AILA 2R66A 3LX5A 1X3LA 1KQGA 4FZVA 2JI8A 5A3SA 2Z6QA 2YJ5A 4HUTA 3V4VB 4RMGA 4CFSA 2CC2A 2WJ6A 3UAZA 1L7RA 3PNBA 1IXSB 1ZI6A 3ZHUA 2QKYA 2JLQA 4MP3A 3T3IA 1CZLA 1O08A 1XXHA 1QPGA 2RHWA 3KKLA 4LDJA 4DIUA 4LYDA 4OEHA 4EAQA 1D2NA 4C6SA 2QN9A 5T8KC 3IIJA 4WKPA 2WJGA 1I24A 3GMIA 3RLFA 3DBHA 5J58A 3WBJA 3E7WA 2PLRA 2D1SA 2GDZA 4IGEA 3U6BA 1P45A 2RC6A 1ISPA 5ISMA 2FE4A 3OKAA 1G66A 1HZJA 4QATA 5FYQA 2D1TA 3K1JA 4A8HA 3RFCA 2QTBA 3CLUC 3WKCA 2HK6A 1E4EB 1T3HA 4RFSB 2WKRA 3MPOA 5U4XA 2YRFA 2VF8A 4HBZA 1WOYA 2WINI 1MB2A 1A98A 1CDEA 4QM7A 2YZ2A 3URMA 5CH3A 3RAPR 5EE0A 3F6BX 4YC7A 3PR1A 3TW4A 2LV8A 2V5VA 3ZX4A 4DRYA 2YINC 1KU0A 1JWLA 3HGQA 4XM1A 1GKKA 4WADA 5FUXA 3OPNA 5IVDA 2Y1DA 3DOUA 4R4JA 1E79A 4XEHA 1O5IA 2W48A 4UTRA 3FCAA 1MZPA 4TYNA 2YYYA 1FNCA 3PRJA 2B69A 2YMMA 3UJNA 3COWA 1QQ7A 3OZBA 4L4SA 1DKRA 1APBA 5AT1A 2CLIB 1VGQA 1PS9A 2GXSA 3R24A 1F8UA 4K9OA 3DGEC 4PONA 4XJXA 1FYVA 2WWGA 4G09A 4HFJA 4TL6A 4D6XA 4JYMA 4PQYA 5FUMA 4FQ7A 4L0QA 1QX3A 4G56A 4DCCA 4KSBA 3QWIA 3L4SO 3RI3A 2H65A 1IIRA 3BH0A 1DBIA 3AR7A 3QBDA 3MINA 5HYVA 1U3VA 2P6MA 5JU6A 3KP1A 3MD9A 3COYA 3MJSA 4GECA 1YZ3A 4KLZA 3RUPA 4RKWA 1ZD5A 3AR3A 1CHNA 2B1IA 2FLVA 4NCJA 2WG2A 3W3ZB 3RVSA 1QGUB 4MYHA 2XMZA 2I7DA 2WSYB 3F7NA 3F9IA 3GG9A 4TMVA 2DY1A 3R7FA 3WQHA 4D3ZA 2L42A 4TOIA 2W58A 3EDQA 4H7FA 5JCXA 3OUUA 3SX0A 1QR2A 1ICIA 4KDRA 5MGNA 3MILA 3LBFA 1U7TA 3QITA 1DCFA 4C4RA 1CD5A 3CBQA 1VFPA 4RPKA 1XHEA 1WX1A 4YRDA 4EWLA 1JE1A 2B4KA 2VZLA 4G37A 1TJ5A 1NLYA 1RYMA 4BZXA 4IGFA 5FPQA 3BXZA 3JY6A 3VJLA 3QYAA 2RH8A 3FVQA 4MR9B 3CINA 3PQDA 4X6YA 5SV2A 1Q1QA 4FSDA 4QXQA 4E13A 1HEIA 4IDDA 2GPNA 2C96A 4HSEA 1BWQA 2FW1A 3G9QA 4MW6A 1XBTA 4BNDB 2JGDB 2Z57A 4JD5A 3C8MA 1PSDA 1ZJZA 2PY6A 4E94A 4EPTA 1YVDA 3D9QX 1ZA2A 2J9FB 3ILXA 2HH9A 1KI3A 2NX2A 2UVQA 2WRZA 2IIPA 4FE4A 1XMOB 2CDCA 3IP7A 1MRZA 3TIGA 1GHTA 2JFUA 4E5PA 5AW1A 1EFVB 2PH3A 1M74A 1JTFA 2PKQO 2XKBA 5ECYA 4QJ5A 1YZUA 4CEJB 2MSCB 2Q1WA 2V9CA 3HWRA 5M5BA 1QOQB 2CXPA 2YIVX 4OREX 4J0JA 3GF4A 5LB4A 1DCKA 1XZCA 2RH9B 2VP9A 2YX1A 4MPJA 1E58A 2FA9A 1L7XA 3EB9A 3I8SA 2V5AA 5AKGA 2H5LA 4JBYA 3HYNA 3SD7A 3Q87B 3T7CA 3UUWA 2J46A 3BC1A 1P2VA 1Z36A 3NIGB 4Q1BA 1G2QA 4MYUA 5FF9A 2FFBA 4L5BA 5LOVB 1QRUA 1CHDA 4BEWA 1KBOA 5KQRA 3MSXA 2UVPA 4EB6A 4QJBA 3H16A 4RZQA 4WFQA 5HK8A 4I4TF 2YV5A 3ANMA 3T3GA 2WF8A 4HQNA 3PE4A 4LE2A 5TS3A 5COQA 2DXIA 1E64A 1KZ9A 2BKXA 4FS3A 3TCNA 4YLYA 1RFGE 3CVOA 1EFRA 4ZVUA 2F67A 2IHNA 1SBNE 2ZRNA 2B8JA 1T5DX 1MLDA 2GLUA 2N3ZA 1RW4A 4MUYA 3OETA 5DZSA 5AVJA 5IF9A 3PQ4A 4P3XA 1C1HA 1LPBB 4R98A 5B37A 1NZJA 2V7QD 4JBXA 2HY7A 1YOVA 2I1QA 3OQPA 3QLUC 5I7AA 4WSOA 3G1UA 4MRSA 2XW6A 1RWOA 2QX7A 5DHAA 1PAUA 4RADA 4OJYA 4W5HA 3VC1A 3FJOA 3W5VA 3IQWA 2IYVA 2J87A 2YRWA 4M8SA 3DD1A 1M75A 4I8DA 1EK1A 5J1SB 4GC5A 2PZ8A 4JJ8A 4M98A 1G5FA 2PXCA 3WWPA 5JS7A 1JHOA 1OI7A 4ZQHA 4I19A 2Q5QA 3OCCA 2NP6A 3PT5A 3WAJA 2ZUVA 1ZNXA 1TT5B 3I9JA 4EBBA 2I62A 1F51E 1EVEA 4CMCA 5D84A 3LXUX 3WX0A 2UUBB 3UV6A 5B36A 3ZLJA 2VNHA 3KOMA 1GAEO 1QHIA 1U8FO 2GD6A 2DLDA 2FSFA 2J08A 1GGEA 4HH3C 3Q0IA 4MQ6A 6LDHA 2IL1A 3P9XA 1SBHA 3I04M 3WLKX 1WXDA 3DWGA 3AKYA 4P1ZA 3JRNA 1KETA 4HQRA 4KV9A 4WN3A 5SZJA 1QNFA 5K0JA 3AOGA 4JX9A 4MLPA 2REOA 3TRFA 3CKMA 1ZPDA 3AR8A 1VSQA 3PQFA 2JF0A 5EE3A 1K97A 2C8VA 2YJTD 3OPYB 3QVUA 4NK4A 4NWIA 1SZDA 4I9UA 3AO0B 4O59O 4WINA 3WC4A 1JEEA 3WO0A 2VPYA 5CFZA 1AF7A 1QHNA 1JRLA 2NNLD 3NHKA 2FX2A 5KTNA 1DC8A 1L0BA 4IHKA 1EX6A 2Z2KA 2HA3A 1A7KA 4BB9A 3FCEA 1SPBS 5DFAA 4DLYA 4E15A 3PKIA 3A2KA 3B7WA 2A35A 2R60A 3P0EA 4KWEA 4YQZA 1U9IC 5AXCA 3PDUA 2GN6A 3GNSA 2C00A 4QPDA 4DCNA 3KIPA 3P1JA 4X1YB 5JATA 3ZWKA 3STTA 5MGBA 3UJ6A 1PUIA 2IODA 3UMSA 4L4RA 4O4IF 1H1TA 2ZI9A 5CR9A 2PWZA 2MHCA 5TMBA 1BD4A 2CKDA 2JFZA 2B5OA 2Q9BA 3BRSA 3NWOA 4EY5A 1O3YA 2VEOA 3HP4A 4NBSA 4OVKA 2IV7A 3WLRA 2ZJ5A 2O8EB 5HRUA 1AURA 4ZC1A 4OTZA 1ORVA 1DMSA 1HOTA 2XWBF 1P3Y1 1PJQA 1FTQA 2FPKA 3IP9A 1QFXA 3RTCA 1WV1A 3FAKA 7YASA 4H0FA 5JSZA 2P9GA 4MUMA 3IQIX 4E1AA 4EI9A 2OBNA 3AB7A 2ZRQA 2XTJA 5IYZF 3U4GA 2WUWE 5I51A 2C2GA 3TW8A 3PWKA 2D0OB 2J3EA 3RO7A 4J16A 4IIGA 1VRCA 6NULA 1NLZA 2E82A 1JA1A 1F1JA 3MCVA 4RGBA 3U09A 4P83A 4YAGA 1XNGA 2Q8PA 3DGFC 3FVVA 4MULA 2I2AA 4R51A 4P6VF 4BJ1A 4ESVA 1F38A 2J9XB 4C22A 4DAEA 4EF6A 4BE7B 1V9SA 2E9SA 4KJZA 4XD2A 2V6GA 2VJLA 3U26A 4WZBA 3INRA 4QGGA 3ZI4A 3I9V1 1FQWA 2YNMA 4IXMA 3TOCA 2GKGA 4ACAA 3BF8A 3QE3A 1ZVVA 4F3TA 2HZBA 4JH0A 1HNZB 4LN1A 2YW2A 1XAGA 1IHDA 1LTKA 2HLDD 4G0OA 5EJ4A 2FG5A 2IZ5A 2CK3D 2C29D 3EQ8A 5T7BA 3N86A 1WWKA 2VSXA 5ALIA 4NE7A 3N2IA 2ZP1A 4CM7A 2P91A 5KX5A 5EJ7A 3AHEA 2HM7A 2FXIA 3D4BA 3EFOB 1XU9A 2EDAA 3HS3A 3L1KA 2AJBA 5D1NA 5JDCC 4EO9A 3K9QO 2YWEA 2X5OA 3D3WB 3L6DA 1I4DD 4G4GA 3EGEA 5DIFA 4DY6A 1SC9A 1PK9A 3K0AB 4QRIA 3TD2A 1CLUA 4CG0A 3DS8A 2JCSA 4QX6A 4RVNA 5TEWA 3OTHA 5LQAA 1CUIA 3MRTA 4U9IS 4L74A 3S2IA 1W59A 5I4CA 2ZB4A 3O95A 2L2QA 3IERA 4D9JA 2PS0A 2EGGA 3OQBA 4MJ7A 5EWMA 3RKUA 4QSHA 4NCHA 1TYEB 1X7ZB 2OV8A 3FPGA 4WGFA 4DN6A 2R0QC 1RJ9B 1C30B 1ISHA 1E6CA 1QCYA 3BK1A 1JQKA 2Y71A 1FQOA 2H7CA 1H2AS 3DKPA 3PGJA 1TA0A 2Q4DA 4ABYA 4EJFA 3RK4A 2V6FA 3AW9A 4BNXA 1N9GB 5L6LB 3E0XA 4HLDA 2RKOA 3WO1A 2E4UA 5FFMA 3VH3A 1A7AA 3UK0A 2HU8A 2JW5A 3GD5A 4XQ0A 3R7WA 5JMWA 3I5XA 1EWVA 1U65A 1M5RA 3BICA 4UUPA 3PF9A 4ZA2A 3B1JA 1KO1A 3IPLA 1M8GA 4LBYA 4MWCA 4P3YA 1HLFA 1V7CA 1JHYA 2QTVB 3DC7A 3HFGA 4MIYA 4UHEA 3T1QA 2ENWA 1GZUA 1QG6A 4F5ZA 5J4YA 3O8OA 1T5BA 2IGTA 5JUWA 2N1BA 1Y0BA 1CUWA 2H2GA 5FWXB 2CWWA 3P97A 4TYYA 1VE7A 1Y5RA 2BFCB 1IY0A 2LD4A 4LWPA 2HLNA 2IYEA 4V0SA 3NNNA 4PYKA 1R5OA 1AKTA 1CQXA 4NARA 4WRRA 1X77A 3TNYA 4D3DA 3V5NA 1V8FA 4AJPA 4B48A 1B3RA 1VG0B 4XDHA 3E9ZA 2IUYA 3F90A 3I0NA 4I50F 1E2NA 1L7AA 1U0RA 1E8DA 1WHSB 3MAAC 3I9MA 1XE3A 3AFIA 2MOKA 3OZSA 2VDWA 4HGNA 1HFEL 2F2TA 1JV2B 4L9RA 1GG5A 2XH8A 1T8UA 2PD6A 4ZVLA 3GQBA 1GKYA 5C8YB 3C5HA 5F98A 3O31A 1FSSA 1LRLA 4R1OA 3W78A 4BBJA 5HF8A 4U7FA 3NHFA 2FRDA 4UREA 3RBAA 1C5KA 4R9RA 1AS0A 3TQCA 3UOAB 4DYVA 1L5VA 1E3LA 1LDMA 2C57A 1SN7A 3EYAA 4UTZA 1NI4B 1JFFB 1ZX1A 3UTDA 3QYJA 4U6QA 3RNLA 1M7BA 2EW1A 2FPPB 3EJWA 5CK4A 1ZJYA 3C6XA 1OC4A 3ANSA 1Q2UA 4NAUA 2D7DA 1F8FA 4XCVA 5IM4F 5ICMA 3KUCA 4C5CA 1NUTA 1V47A 2JLZA 1L3IA 1U9CA 2NUBA 1U94A 1P6QA 2OILA 2P65A 3BPSA 3UFXB 4JVNA 2QT0A 1XKTA 2C4WA 1MG0A 2JGNA 1T2VA 2NXJA 3NTVA 3VU8A 1T2EA 1WSDA 2PRSA 4GRIA 4B2IA 5JY6A 4PYQA 1TMKA 4D9HA 4CG2A 3IDZA 3FZGA 5M29A 4JJFA 1T5LA 2CMGA 1M9NA 1SJ9A 2P4UA 1ESDA 4IWXA 3IR6A 4JVSB 1KI6B 1P19A 2YY6A 2GS9A 4JR1A 2W2OA 5EUMA 3ZY6A 3WNZA 4A8TA 4AP6A 3A9TA 3WGIA 4N48A 4IG4A 2JZNA 3C3JA 4HYQA 5EYPB 1A9XB 1SXJD 1CR4A 4NYMR 3HH8A 4E2FA 5JXWA 1XHLA 1I7NA 1ZHHA 4EFKA 1XC7A 3GARA 1GQQA 1CIJA 1EFKA 3A1DA 4P08A 5AJTA 1C0LA 4UDOA 3SBXA 5A2GA 1HYEA 3A6DA 2O59A 4Q05A 2BUCA 4YP1A 3TOZA 2IPLA 1QIFA 4GEGA 4DBLC 2I1WA 1EHIA 1UM9B 1OBVA 1RKBA 4B5LA 2JAQA 5FWDA 1O1YA 2Y1OA 1ZW6A 4ZVOA 5CB4B 1ULZA 1JHAA 1E3EA 1ZL2A 4GWKA 2I76A 4Y0VA 2GZ1A 3SHTA 3AF4A 2FN3A 1QCCA 3LHFA 3WL6A 2H17A 2Q5OA 5T41A 3WS7A 1YQDA 1C80A 1LBSA 3BWBA 3TKYA 3I9FA 2B1GA 3MUEA 4G0PA 4RLFA 3BHJA 4CKBB 4MYDA 1ITZA 4ROSA 3UCFA 1U5BB 4NAVA 3SEFA 1YJQA 5FLEX 2A4MA 3I6YA 2XB4A 3K15A 3OKCA 3U7FB 4J43A 3L7OA 5AJVB 3SS7X 1A9PA 2ODEA 4HZGA 4DF3A 4IZHA 4CIAA 3PHLA 2ZJFA 4RVCA 2GHQA 2O9JA 1H0SA 2J3HA 3RUDA 1WXXA 2DY0A 3QJ5A 1WMEA 4B73A 2ORVA 2OCAA 5D5HA 2F1HA 3PNSA 4QXOA 5LU9A 1DCMA 4YJFA 2B6NA 2QPAA 3S44A 5BSKA 4S1PA 4TXLA 4MHTA 1OE0A 2ORED 4FEAA 3JAKA 4ENPA 5KTPA 1KI1A 5HF6A 5JBQA 5A05A 3JQQA 1MDBA 2IU4A 5BUZA 3L6EA 1JFSA 1DINA 1W5BA 4PSCA 3QZUA 3WGQA 4EEXA 2NUAB 3NWBA 3N2EA 4F2PA 2YMLA 2XT6A 5CPBA 3QYPA 1FNBA 3D0KA 5C1IA 3M2TA 3RFVA 4R6WA 4AWXA 2QG4A 1V0JA 1R4NB 2FMIA 4XQCA 4TTJA 2F1OA 1X7GA 5A9TA 5U4QA 2XLCA 1ZIOA 2QB5A 3NBFA 4KUGA 2FN9A 2BH2A 1ST3A 3HB4X 2ZREA 3B1YA 2ISSD 3OY2A 5CX4A 1RCUA 4LRSB 1N36B 2JI7A 1CE8B 2IHZA 5B30A 5F2OA 2RB4A 1WVIA 4BNGA 2BD0A 2NU6A 1ZSYA 1NN3A 3N8GA 1JIJA 4XWTA 4F4DA 5FADA 3H42B 5GV7A 1KH1A 3I8XA 1GFWA 5ALLA 5JR3A 1S4QA 1S7GA 3TAHA 3BIFA 2FSGA 3AY3A 2FV8A 4LE1A 3ZZNA 2W42A 2BBSA 3ELBA 3CUTA 3VZDA 3RVJA 3WIUA 3CT6A 1D2CA 4U9HS 2XGJA 2A9RA 2BC9A 3GFPA 3U49A 1CUSA 2OWEA 1F4VA 2ZJ6A 1JG1A 4GP7A 5HFJA 3VR2D 3EPJA 3PJRA 3W6PA 5DGHA 1T3LA 4P5PA 2NAFA 4WFKA 4DCVA 1ADGA 4RQBA 1EWQA 4AJEA 1D5WA 4KE7A 4BNYA 2I78A 1L6RA 4YCBA 4B3HA 3ROQA 4M9CA 4ZIRA 2AMLA 2FSVA 3HRIA 5A7GA 3CH4B 3IVMA 3VKVA 5IYZA 4F7DA 2OK8A 3IUSA 3C8ZA 3OBBA 5KNDD 4H59A 3IPCA 3IE2A 9ATCA 4CE6A 1IVNA 4OIFA 3O1IC 1Y5LA 1D6JA 1HFKA 3UPDA 5HUJA 3NT5A 1PUJA 3GEMA 1YUMA 3KZOA 4V38A 2XRMA 2XMBA 3LQFA 1RHKA 4PU0A 1V4BA 4CF5A 4OUDA 3FW1A 3KTFA 1E6LA 4D42A 4DJDC 4EA7A 2GPJA 4ZXPA 5LQNA 1T4BA 5G3YA 1XCBA 1JILA 1K2VN 2QMOA 3QENA 5IH7A 4IQFA 2BTQB 2ZAYA 1NV8A 3D6AA 4HB0A 4IYRA 3I42A 4K86A 1WP4A 1K92A 5FQNA 2W2NA 3TK1A 1E6MA 5A3JA 1OIWA 1P2DA 1U0OC 1QOPB 3F97A 3G2QA 3K0CA 4QNMA 5J63A 5AW5A 4UFOA 4C88A 1NKTA 3UC9A 5I9MA 4FZ5A 1U2RA 4P3KA 4BJ5A 4ATNA 1P9RA 4EQ6B 2VYFA 2R1VA 3G2IA 5EKSA 1TEVA 3ZGVA 2JK0A 1KEVA 3TVYA 1T26A 4HOYA 1KARA 4NOJA 1EXWA 1DEXA 3T54A 3KQUA 3DL7A 4OQXA 1EFCA 5DCYA 3UAXA 2PUCA 1KY5A 2QU7A 1RBYA 4AWBA 3OESA 4K26A 2BBOA 1DJNA 2ON6A 4KRXA 4G36A 5AKKA 2NU8A 1QV7A 2B83A 1DMRA 1W4LA 1L9KA 2XKJE 4MVJA 1YJBA 1XZDA 2A6PA 5FUYA 2ZWMA 4KH1A 2ADFA 4PG6A 5IUKC 5MN4A 3EZGA 3R0VA 2WQ6A 3HM9A 1KY2A 1P5JA 2OLKA 2QVLA 3X1YA 2ID7A 2WAAA 1J99A 3UANA 2HFJA 2FEMA 2QUAA 2J5KA 3CKYA 3DTVD 2WIGA 1UPTA 4PFSA 3ZXSA 3PEEA 3D4LA 1A76A 1NOKA 3DHEA 4II7A 3HPQA 3D1LA 1T10A 2VPTA 1RWVA 3GRPA 3L49A 3S8YA 2CLKB 2GK4A 1LSSA 4BRWA 5CURA 2AXNA 4N47A 4DLLA 1GQSA 4YDSA 2XUHA 3G82C 3TLYA 2Z5VA 3SXPA 4ERNA 1SUWA 1FTYA 2I4OA 3B1XA 3NGXA 5KVSA 3D3JA 4GXQA 4UCXA 3NTXA 3HGTA 2ZB7A 1Q17A 1QO9A 3NHUA 1TAQA 4MS3A 3IC5A 4PYRA 5G53C 2CMKA 1DAFA 1I2DA 4H6VA 5SY9A 4HPJB 1IZYA 2OXEA 2ZPAA 3FWPA 1P9NA 1YR9A 4HZUB 1BHO1 1NSFA 2WD9A 3DDNA 3I58A 3M6WA 4MW0A 4PZYA 4WCFC 1E5VA 3IIMA 1NPTO 5FR1A 2QV7A 3AQ4A 2BBWA 3K1AB 4Z9XA 3U44B 1R6XA 1GZVA 2ACVA 2XJ4A 5LUBA 3SBDA 2NW6A 4C6TB 4Q39A 2BZGA 5EKXA 1PJTA 4IZIA 2EVWX 4GO1A 4JIMA 1JJAA 3LLVA 2BFDB 3VH1A 3TRHA 2P35A 4E70A 5GADl 3EDCA 4I50A 3B82A 4P2BA 3L4JA 2DBQA 2A0FA 3N7UA 3ROMA 3Q0TA 1RAHA 1WZCA 1BWSA 4MCHA 4OHBA 2JFNA 2CV1A 1XQ6A 5JALA 1AHIA 3HUDA 1NURA 2JDIA 5JJ5A 1AKYA 1DKMA 1VA5A 3DJYA 2O7VA 3JQCA 3ZI0A 3IBTA 4W1RA 4EF4A 2ZDGA 2RAVA 3LUBA 3DLBA 3RKSA 4YO8A 1K7EB 4BRUA 2WZBA 3NLLA 1E9FA 4TLDA 2I67A 4B4VA 2RSLA 3VYSB 4F04A 1EZ1A 2C9YA 3MJEA 5J5CA 1N0WA 2EKZA 3WR5A 2C3YA 1M0WA 2KW5A 2IX9A 2QDXA 2ESRA 3N58A 1UZLA 1BCRB 1KRHA 4ANFA 4A6EA 2RGYA 2A1UA 1DO8A 3QH4A 2QMUA 3QBVA 13PKA 4NYJR 1E2GA 2IZ0A 1M34A 5FBQB 1CW2B 4DVGA 5HVNA 2O8BB 3IXQA 3RG2A 1I1NA 1YB6A 2EKPA 6AT1A 2QJWA 3LHKA 4QICA 4EGSA 1H05A 2JAUA 3L8ZA 5JNLA 1V71A 2AFRA 5FUWA 3FDIA 3JASA 2WM2A 3CRQA 3RFUA 2G09A 2V3CC 5AOVA 3WMGA 1A9RA 4BYMA 2F43B 2GJSA 2X9LA 4B7AA 2D2XA 4Y9SA 4F5WA 1WXIA 5IXJA 1LPSA 3IEKA 2DWUA 2ZJ8A 3ESAA 3LNTA 3JS5A 3NRJA 4QULA 3RIYA 3L7LA 3WLTA 5GIPE 1JLSA 2DQSA 2AZDA 3EZXA 4TT8A 2Z5GA 1UKVY 5DP1A 4D4KA 4XB6B 5IJWA 1GCGA 1XCPA 4QNRA 4XYGA 2EF0A 5ABPA 1RAGA 4FGUA 5JHGB 1LGYA 3Q7EA 3DJFA 4KWCA 3DT9A 3A1SA 3FLEA 5DHSA 4CF4A 4EQZA 1SCDA 4DC9A 3ENQA 2G8NA 3D6HA 2INGX 3AXTA 1MOSA 5FL7A 4G26A 4AICA 1IMJA 1NBWB 1S9DA 3CE9A 1WM1A 2V7UA 4KSCA 5AUQA 4PC6A 3QKWA 3Q7IA 1L1FA 5KJCA 4KRFA 5AJWA 3ZVLA 3EIOA 4CQMD 2GK3A 1EUDB 1U5AA 5CA1B 5EHZA 121PA 3EGXB 3JPYA 2CDAA 1UAGA 2DUMA 5BV8A 4Y6PA 1P72A 3PUWA 3Q98A 3IVCA 4LOJA 1YZYA 1CQIA 1RE0A 5GGXA 3I23A 3KUUA 4GQIA 3ZOZA 1ZRNA 3K96A 3F1LA 3OZCA 4X54A 2VDNB 1D03A 3I2GA 3OMXA 3UVEA 3LP5A 1J6UA 1UPUA 1E94E 2A9OA 4LKOA 4RK0A 3FWYA 3HXOA 2YV2A 2G9UA 4DA6A 5C4MA 3ET4A 1TK2A 1QQ6A 2DFVA 1HDGO 4F97A 2OZKA 3PEUA 1Q1AA 4A9AA 3DB2A 4DT1B 4MCIA 3KLBA 2W6JA 1VP9A 2F64A 1NF3A 2CVFA 4Y7DA 3U40A 1ZKDA 2AHOA 1ESZA 1CP3A 4RDIA 3PTAA 2XE6A 1TT7A 4JA0A 4OOFA 4O4JB 4KVGA 5DLPA 1QYXA 5LP6C 4XUDA 4ZQCB 4UPDA 4YGXB 5B7QA 3X1XA 5AVTA 2X14A 2ZKLA 3RTAA 4WOBA 5AKLA 4E6PA 1UF9A 3D6MA 3KOWA 2OCYC 1Y5IA 1XWWA 1Z25A 1V5GA 1BMQA 5BSUA 4D74A 3R9XA 2H1LA 5HA5A 2GILA 3BBPA 4BQIA 2AN1A 4ZC8A 3ZDZB 1N7GA 2W6NA 4R3UC 4DOMA 1QYRA 2Z98A 3U80A 3OCJA 1RBMA 4CUKA 4MA0A 2CFIA 3AR6A 1DTSA 3V97A 4Q12A 4P5DA 1TIBA 1XVLA 4G24A 2GCGA 5E1OA 3BH7A 1TVKB 2EZTA 1K8YB 1IYZA 3QUTA 1XR3A 3IIIA 2VBIA 2NZ2A 3RJTA 4YJ2A 4J0CA 5ALMA 5TT0A 4BNZA 4EY4A 5KINB 1WBJB 1ORIA 2Y1XA 3CSSA 3I6ZA 3IKTA 3LW7A 1U1DA 5BN5B 4F9FA 1EM8B 3RC2A 1L5OA 2VDJA 2GUGA 3GJ3A 4EHAA 5LMZA 4IW3B 4B31A 4YIKA 4RF5A 3AGPA 1LBEA 1E1NA 3TLJA 4B44A 2YJ6A 2VVTA 1CS0B 4RTPA 1O94A 5EMJA 4NBUA 2WP0A 3IX7A 3U13A 4B6SA 3IOEA 3ZK8A 3LA8A 4FC7A 4DDMA 4ZQEA 5DXAA 4KL8S 1YA6A 1L5MA 1QF6A 1AE1A 4KWTA 2XHZA 1BXRB 2YC2C 4FLFA 3HSSA 1C4OA 3Q41A 3U7EB 5JFTA 3AVOA 1GTRA 3ZDCA 1B00A 2H18A 1RABA 2HCBA 4IICA 4LDQA 4W5TA 1GAQA 3HA2A 4Y8VA 3O8RA 4ITUA 3GLIA 2EQ5A 1QH8B 4G5HA 3X1MA 3FX2A 2IDMA 1G1MA 3F5FA 4LE0A 4CTMA 5ERXA 1R74A 3TSCA 1MTOA 4RVFA 1Z8NA 1C14A 1XV5A 4D80A 2P62A 1OTHA 1MV8A 2VKQA 3COJA 1LU9A 4QUAA 4OYYA 2CVOA 3A4MA 4KBGA 4MROA 4OU4A 2I7TA 5HCIA 4R5MA 1YHZA 3E9EA 4O2BF 4BVGA 1IQ0A 2PWAA 3A36A 2OFPA 3H11B 4ZO9A 1HH4A 4EZIA 2NOAA 5B57C 3VNQA 4EIWA 3SC2A 1RACA 3E9NA 3EGIA 2XUQA 3DYVA 1HG1A 2G72A 3TL2A 2JLYA 3TLGB 3WWZA 2ZEJA 4LA4A 4MCJA 2EQBA 4MZXA 4FJ1A 5HMLA 4TLCA 5C31A 4JT9A 3P0RA 2D62A 3OM9A 5B1HA 4X7RA 1TZJA 1YS6A 3M6LA 2VF7A 2JVIA 1SC3A 3W5CA 1RWQA 1ZAYA 5IULC 1W36B 3PTZA 4JB2A 1WBBA 4XQGA 4M1EA 1T15A 2Q9UA 2WYWA 1VGVA 4L22A 1T9CA 3I05A 4PCLA 4ZQGA 4RZIA 2F8SA 2QA5A 4H3SA 2DQ4A 5F7XA 3U1BA 1ORWA 3PYLA 4KAJA 4FUQA 3NB0A 2WFLB 4I7EA 4IDHA 3TEFA 1V6SA 4KDFA 3P32A 2E4YA 3TGLA 3RRBA 2GASA 2AFIA 2Z8XA 4AJIA 4XRGA 2J30A 5SZKB 3AJAA 4OLBA 1T0UA 2W2VA 2C20A 4TTVA 4OQFA 2LWIA 1ABEA 4MIEA 2ARKA 1PQWA 1OZ0A 5F51A 2LCIA 1Y9DA 1T1JA 4N7JA 4F3KA 5TJ9A 4GDMA 4MVYA 3M5DA 4N5LA 1SG9A 3FNEA 4YJDA 3ZE1B 3EXHA 3A3PA 2WOJA 1G98A 1A77A 1SUSA 4MWEA 3SAJA 4JBWA 1GEGA 4XA8A 3D8RA 3EN0A 3E9DA 3Q4GA 4LZAA 3WYAA 1K7XB 1TDJA 4UZSA 3OTIA 1YO6A 4DUPA 4F6RB 4P7KA 1SVIA 1P7ZA 5FTJA 2Z2YA 3GBVA 3PJFA 3Q3JB 1E32A 4ZK2A 3PC3A 5JD6A 2X1HA 1SXJB 2WAOA 5K3SA 2P79A 2XCRB 1V5WA 2Q4EA