4HX5A

Crystal structure of 11 beta-hsd1 in complex with sar184841
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
261
structure length
261
Chain Sequence
EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Discovery of SAR184841, a potent and long-lasting inhibitor of 11beta-hydroxysteroid dehydrogenase type 1, active in a physiopathological animal model of T2D
pubmed doi rcsb
source organism Homo sapiens
total genus 101
structure length 261
sequence length 261
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4hx5A00
2Y66A 3WFIA 1U9JA 3VVCA 3W4JA 5A06A 1B26A 2WYVA 2NVBA 3GUCA 4O6VA 4TVOA 4XQGA 3IC5A 4ILKA 3G1TA 1U3VA 2CSUA 4BKRA 3BIOA 4AJOA 4JJFA 1LLDA 1ZCJA 5B37A 4BGVA 4QUKA 2PLAA 3GQVA 3QVOA 4NFYA 3PEFA 3WTBA 4ZICA 1OC2A 1IUKA 3QVTA 3FN4A 4D0SA 4PLHA 3WQQA 3HE3A 3NUGA 3ZZNA 4NZ9A 5AXCA 3BMCB 3TZKA 3F6YA 1ZZEA 2IEDA 3W6UA 4BNGA 1M6WA 2IODA 5COAA 3ULKA 2VOJA 3DZHA 3PWZA 4F3YA 4ND5A 4WJZA 3VPXA 3S2EA 3BMQB 1DRVA 3DHEA 2PFGA 1HE5A 3MJ4A 4NJMB 3ZNQA 2BI8A 1E6UA 4ZQFA 3U09A 5J23A 3AOEA 1MC5A 2PD6A 1JA9A 1Y81A 4GAEA 3T7EA 4BO0A 2C7VA 2QYSA 4I5FA 3EAGA 1KVQA 1FJHA 2ZIZA 4EDFA 2AA3A 2O7QA 4UULA 4XIJA 3RQSA 1SMKA 4PG7A 2HK7A 3RC9A 1CJCA 4DBZA 4IMRA 2FZEA 1F8GA 1ZW1A 1PL7A 2X5JO 2GO1A 4NJOA 3DMYA 1P1FA 1X15A 3I9OA 1A9ZA 2NTNA 4ONEA 3WFJA 4OM8A 4IZHA 1JW9B 4RVFA 4WOJA 3RBVA 2EG9A 1PSDA 1WZIA 3LU1A 4YJGB 2BRUA 5JE8A 3JQDA 4M54A 3VPGA 5BSHA 1X14A 3PZBA 4CM3A 2AEFA 4IGEA 4K28A 1DDOA 2Y1EA 1R4MA 4IY1A 1YS4A 1G6KA 1CERA 1BMDA 2EKPA 4L75A 4R68A 3EVTA 5DN9A 3W8EA 4EJ6A 3DZKA 7ADHA 3DL2A 3GHYA 4QTZA 4I1IA 5CEFA 1EK5A 3DMTC 2OZPA 3AU8A 4CQMA 1H6AA 4XGNA 2Y0DA 1I3KA 3GNSA 4RZHA 3O26A 5ADHA 5T6BA 4QO8A 3ZH2A 3I52A 1TVEA 3KV3O 3L6OO 1X1TA 1E3WB 2WWRA 1EDOA 4UUNA 3MJTA 5IDYA 1G0NA 5DZSA 1VL6A 2HDHA 1ARZA 3VDQA 4E2YA 4EUHA 3RC7A 2DPGA 2NQTA 4PFJA 3WJ7A 2GF2A 2ZJ1A 3ZWCA 5JDCA 4FDAA 3E1KA 4BNXA 3KLMX 1IULA 3AI2A 2HMSA 2G82A 1V3TA 3WWYA 1AE1A 1ONOA 1ZK2A 3HN7A 4D3DA 2BH9A 4IQ8A 4WLUA 5KTKA 1ZIDA 3KTDA 3RC2A 5L9AA 2CY0A 3E6AA 5CHEA 1FDUA 1Z45A 4PLZA 3RROA 1JLLA 4R54A 4R1UA 4DTIA 2CVQA 2GR9A 4U5QA 1Y6JA 2I3AA 5CDTA 3VC7A 4B4WA 3JQGB 5ILOA 5COBA 2NQ8A 4BNFA 2HK8A 1PZEA 3RUAA 2Y67A 4ZHSA 5TC4A 1SC6A 2F1KA 3ADPA 3F5SA 4H16A 1PZGA 2WE8A 1U7HA 4GKBA 3VDRA 4ZQBA 1RM0A 3MCVA 4R1SA 4RGBA 3Q11A 3OQ1A 1DRWA 2C29D 4BMNA 3DOOA 1VRWA 2H63A 1YO6A 3M2PA 4NK4A 1H9BA 3GZ4A 3TPCA 4PG6A 4J9VA 4J2HA 4ZA2A 1ZEMA 3IJRA 4E2XA 2CD9A 3PYMA 4K9DA 4N54A 1VPDA 2VOEA 4ND2A 3PIDA 2PKRA 3PHIA 3DTYA 4JP3A 5JDIA 3BHIA 3PRJA 2AQKA 1YE3A 1ZXBA 2PA3A 2V6FA 3QW2A 1K5HA 1ZUD1 3OICA 3TWOA 1H6BA 3FR8A 1XA0A 3K9QO 1PZFA 3KUXA 4FFPA 4RJTA 3NGLA 1VJ1A 1KY4A 4FOOA 3HG7A 1VM6A 1YL6A 1GQYA 1YBVA 3U0BA 1UP6A 4D79A 2BI7A 1LSSA 1H93A 3ZWPA 1EUZA 3LZ6A 3F47A 4R9SA 4MP3A 3MWEB 1P74A 3NTOA 3DXFA 2FR0A 1PGQA 4FJ1A 1MGOA 2XAAA 3FWZA 3GFGA 1V35A 1Z7BA 4D46A 2DTEA 4NFSA 1ZH8A 3VTFA 5B12A 4BHTA 1HYHA 4RF2A 5KVCA 2EP5A 3RFTA 3BTSA 5C7LO 1PWXA 1K89A 3ONDA 2VNAA 2QX7A 3C1TA 1Z75A 3H65A 1TT7A 3L6EA 1KETA 1SEPA 1GUYA 3JQBC 3VZQA 1K2WA 5BQFA 5C3MA 3U5TA 3BTOA 4R4JA 5CG2A 5HM8A 3IAHA 3LVFO 3DAPA 2PR2A 4H15A 5T5QA 1LC3A 3RIHA 3VTZA 1P1KA 3AY6A 4XYGA 4D44A 2B4QA 1B8PA 2VUTA 1O6ZA 1R12A 3F46A 1B3BA 2Q1UA 4AJ1A 4NBRA 2C5EA 1ZSYA 1C0LA 5JLAA 2YY7A 4Z9FA 5IN5A 4DUPA 4BO8A 2VYVA 4J4BA 5FFFA 4MVJI 1Z82A 2Q49A 3FNHA 5DF1A 4EZBA 1LDEA 1GU7A 1VKNA 5K0ZA 1D8AA 3JQFA 3RUCA 3DZBA 1TLTA 2IYPA 4M49A 1KC3A 4BV8A 4J1SA 2FOIA 2VQ3A 5EJ2A 1UXKA 5TQVA 1XLTA 2LDBA 1T4DA 3KETA 3GMSA 4RCVA 1JVBA 1E1MA 3U4DA 3JQ7B 4O59O 1JKIA 1JAXA 5TGDA 4L76A 5MGBA 4MVJF 1NAIA 2J3KA 2JD0A 3AOGA 2OL4A 4KUEA 4A7PA 2A92A 3GT0A 3FNGA 1U4SA 3ZGYA 4D41A 5C7IO 3ENKA 3GRKA 3LK7A 1DIRA 4TROA 1F8FA 2BMAA 1Y8QA 3ZDFA 4GBJA 2GN6A 2VWPA 5GZ1A 4PLWA 5THQA 4E30A 5JMWA 5G4LA 3AM3A 4A73A 2D4AA 2R00A 2UAGA 4G65A 3G0OA 1HT0A 1W8DA 3ONEA 3CIFA 4YAKA 2PKQO 5EPOA 5DCUA 4B3HA 4CM6A 1GD1O 3TZQA 3QWAA 1QV6A 1HLDA 1PEDA 2Q50A 4X54A 2YFHA 1UDAA 2JHGA 3DZIA 3JD3A 4FN4A 1BG6A 1R4NB 3PLRA 3PYLA 2VRBA 1BDBA 2C59A 1RKXA 2ZB8A 4RZIA 4C4OA 3NYWA 3K2EA 4CJXA 4CLRA 3JQAB 1ULSA 1ISGA 4CLEA 4BNHA 4BL5A 1VL0A 3OEWA 5KJFA 1ADBA 1P31A 4CL8A 3TZ6A 2O4UX 4XR9A 2Y0EA 3OM9A 2ZJ0A 1EVZA 2HQ1A 4YCAA 5JFOA 2X0NA 1J0XO 4HWKA 3I5MA 2E37A 3ICPA 1QYDA 4ALIA 1YL5A 1YOVB 4BUCA 1N7GA 2Z1MA 3U62A 3GAZA 3UCEA 2DBZA 5L40A 4R1NA 3Q2IA 2HMTA 3G3EA 2WMDA 2W2KA 2CDBA 1R0SA 3INRA 1E77A 5JNLA 2NVUA 5ER9A 1CQIA 4A03A 4BB6A 3DZGA 2VYVD 4B8WA 3VAZA 3IJPA 5JBIA 4NDNE 4WNIA 2YDXA 2C0CA 3DEYX 5T8KA 2EJVA 1GCUA 3QA9A 3GUYA 4ND1A 2YHIB 5F1KA 1CEQA 3UUWA 3ZV4A 4CR6A 4DL9A 1VL8A 3HADA 4GI2A 3M6IA 4XZ3A 3DAFA 3W1VA 1ISHA 4PN3A 1LSOA 4IUYA 1C0PA 4E5KA 4GGPA 2Z5LA 2JL1A 3BMOB 2C07A 3KYCA 4GWKA 4HX5A 2TMGA 4KZPA 1M76A 3ROKA 3FBGA 5A3VA 1JDJA 2ZB3A 1BTOA 1LUAA 2C5AA 2GASA 2AE1A 5BSFA 3AI1A 5F3RA 3AU9A 3A1NA 3LT4A 5COQA 2E6UX 1YQGA 2AHRA 2EGGA 2GGSA 2NSDA 3WX0A 1N8KA 1LRLA 3E8XA 4UEKA 1TB4A 3GDOA 3MTJA 3EMKA 2RH4A 1BXKA 1U1IA 3DR3A 1KEUA 4FW8A 1T1SA 2TMDA 4PVCA 1N92A 2YQ4A 5I7EA 4N5LA 2JJYA 5IDWA 2YJZA 5I9LA 4GX5A 4HNGA 3QSGA 4XKJA 5I7SA 4RDHA 3NAQA 1QKIA 2ZKLA 4NBWA 5GZ3A 1GEEA 5IJZA 3JQ9C 4JBHA 3EY4A 3FPCA 3UH1A 5CAEA 3PTZA 4IQ0A 5JO0A 4LSMA 3PHLA 2YUTA 3OA2A 2NWQA 1QG6A 3DWFA 2B69A 4BB5A 4KWIA 4CM9A 3M2TA 5FEUA 4CM4A 2YV2A 3NX4A 3JTMA 3KO8A 4I9UA 4HUJA 5CEEA 4TQGA 3ZU4A 4YPOA 1KEWA 3GN2A 4J1TA 1M75A 1NX6A 1YVEI 4NMHA 1Y5MA 3Q9UA 3IP3A 4PCVA 2I5PO 4XQ9A 4F46A 4CMIB 4MKXA 1TT5B 4BV9A 5JCJA 1QR6A 1HDOA 2PGJA 5IAAA 4AJLA 5KWEA 3JYQA 4BNNA 1KERA 1UZLA 1WWKA 2PZLA 2NU9A 3H2ZA 1KVSA 3IUSA 3D4PA 1HETA 1I8TA 4W82A 1YXMA 3NDIA 5IZCC 3PXXA 2VYNA 5A9TA 2FMUA 4LW8A 1DHTA 3GZNB 3H9QA 4CQLA 5TLSA 2CNBA 1DC4A 1TI7A 2HJRA 4R5MA 4YDRA 5MDHA 2HLPA 3G79A 2AQHA 3GH3A 5ES3A 3VPHA 1D1TA 4MVJH 1HE4A 2PY6A 2ZTVA 1SOWA 4YYZA 5BNFA 3WBBA 3AFNA 4MPDA 1P1JA 2PV7A 4R41A 2H9IA 2Q2VA 3V2UA 4B8ZA 2G17A 3GA0A 5DNAA 1L1FA 3RASA 2NACA 1V3UA 3V2HA 3FD8A 1CRWG 4ALJA 3A28A 3LT1A 4BNKA 3DHNA 4ZVVA 1KBZA 4IM7A 3G17A 4WEQA 4CLDA 3OMLA 1UH5A 1EFLA 1FF9A 4H7PA 4BKPA 1OFGA 2BFPA 1A72A 2VCYA 2PNFA 1IHXA 4DLAA 1T2EA 3MOGA 5A1TA 1SB8A 2NADA 4J1NA 1X7GA 5JAQA 2ZTUA 5CFZA 3JCZA 4NPCA 2I66A 4G2NA 2VTDA 1Y8RB 4WCFB 3PPIA 2PD4A 4ROSA 2Y05A 3PGJA 1MG0A 4N5NA 3Q0EA 3ZW9A 1PJ3A 1V0JA 3WICA 4BQPA 4CM9D 4A10A 1GUFA 3KB6A 5IN4A 3GG9A 3L4BA 1X0VA 1IOLA 2J3HA 2VHYA 3DTTA 3KHUA 4NH4A 4P4GA 3BA1A 3H5NA 3V8BA 2B83A 2AQIA 2WE7A 2G0TA 2VUSA 5L7WA 4WLOA 5I7FA 2O50A 3G1UA 1FMCA 1O95A 4U0JA 4UAGA 1HE3A 3PQDA 3HDJA 3ZWWA 4Q3NA 4L73A 3KSUA 5JCJD 1PIWA 3QWBA 1E7QA 1NVTA 2RHCA 4CV0A 3NEPX 3PWKA 3BAZA 1H2HA 1MUUA 5DT9A 3GMDA 3GGGA 2P9CA 3FHLA 1WMBA 2VYND 3DZFA 1LEHA 1GDHA 1VSVA 3PDUA 4ITUA 1UZMA 3UN1A 1R37A 3OH8A 5G0VA 1ZNQO 2Q1TA 4WEOA 1GTMA 3PJFA 2Q1WA 3VPSA 1ZSNA 1E6EA 3RJ5A 1T4BA 4FQ8A 2AG8A 4J7CA 3C3XA 4IJWA 2O3JA 5IFLA 1LI4A 2V6GA 1AXGA 1PR3A 2JHFA 3LC2O 1JWAB 1A7KA 2GPTA 1LLUA 4URFA 4H3VA 4AVYA 3K31A 3IIEA 2EP7A 2IZZA 4DWVA 4DPMA 4UREA 3PHJA 5B4VA 3T4XA 1OAAA 2EW2A 3GOHA 3ZNPA 1SZJG 3ANNA 5IG2A 3E9QA 3RUHA 4DIOA 4LMPA 4XB1A 2IDZA 4NU6A 4CMCA 1AHHA 1WMAA 3WIDA 4RLHA 2E82A 3AM5A 2B4RO 5F1OA 1RYEA 5C7OO 3E03A 1NQAO 2C7GA 4OKNA 4XGIA 4ZD6A 4CMJA 1PU2A 4OAQA 5B4TA 3GVXA 2Q99A 3I3OA 4K6FA 3P19A 3UOGA 1R15A 2RHRA 4FPXA 3NGXA 4YRBA 3QLJA 5CPBA 1J5PA 5TX7A 1H6CA 1SEVA 2DUUA 2V6MA 4EGFA 3JYLA 3R0IA 4AFNA 2OBNA 3GVPA 4WPGA 5TRTA 1NASA 4U7WA 1FDWA 1BW9B 3B1FA 3DO5A 3SJUA 3ZHYA 2XF8A 3TNLA 1YB4A 2I3GA 2R6JA 3LT2A 4ZRMA 2PZMA 3WTCA 2XOXA 1FXSA 2EWMA 2WEKA 1XR3A 4J91A 1HXHA 1HWYA 4KQWA 2QZ9A 2PZKA 3BTVA 1S7CA 3RBZA 4GVXA 1E0DA 4RDIA 2VT3A 2HSDA 3CSDA 5DOVA 3PDJA 4BKQA 5EQFA 5DCWA 3JQAA 1XYGA 4BS9A 1RM5A 4P8RA 3B1JA 4PLFA 4J4TA 1E1KA 1HDZA 2IZ1A 5AVOA 5EESA 3KM0A 5I8ZA 2UDPA 4LGVA 4NU5A 4WCFC 1A4IA 3PLNA 4J3FA 5JY1A 2DM6A 4OSPA 1V8BA 2J3JA 3I4CA 4YB8A 2FRDA 1NWHA 1B15A 3PK0A 4TRRA 4IS3A 2E49A 5K6AC 2BKAA 3KYDA 3HFGA 4Z0TA 2ILTA 3WGOA 1KVUA 3MZ0A 3L4SO 5EMHA 3PGXA 4E12A 1A9YA 2NTVA 4R3NA 1YJ8A 2DAPA 2GRAA 1NQ5A 4FGWA 4J4HA 2VRCA 4R16A 1GYRA 4ND3A 5L3ZA 3UHAA 1OOEA 4CUZA 5B1YA 1IPEA 1GEGA 1HDXA 2NLOA 1H5QA 4W99A 3AUUA 4R01A 2HAEA 3JSAA 4YVFA 5TT1A 4DMLA 1H0KA 2C2YA 5FI3A 1ISMA 2YHIA 3CXRA 3I6QA 4UUPA 4J2OA 4Y98A 1I10A 4FJ2A 1NVMB 5CG1A 1P3DA 4IDEA 4FFNA 1U8XX 4HV4A 4J90A 1CDOA 4AJKA 3Q2KA 5JCXA 4OKIA 1WP4A 3I6IA 1E5LA 1EK6A 1XEAA 2ZTLA 1DAPA 3SBOA 2YYYA 2RBEA 1C0IA 1XKQA 2IE0A 3AW9A 3M1AA 2GN8A 3BMOA 4JN6B 2YFQA 3KEOA 3NV9A 1GUZA 1QYWA 3SLGA 4FFRA 3V2GA 3FF4A 4GX0A 1WDKA 4PLVA 1MC4A 4EBFA 2W4QA 3CUKA 4A26A 3GHHA 3I9KA 4HFNA 3E5MA 2DTDA 2Y1OA 4KDFA 5AXDA 5CDSA 4WECA 3W4KA 3WOHA 5B4UA 1IY8A 3LDHA 4EW6A 4AJEA 3RUEA 3ZV6A 3AUSA 4XDYA 1Q1NA 1YKFA 4PRKA 2PK3A 3ZW8A 4IDCA 3OIDA 2RIRA 5F5LA 2V7PA 4U0KA 3JQAD 2X86A 1WLYA 1RWBA 3O8QA 4F6LA 1EZ4A 4ALMA 4YEDA 4QFCA 3JV7A 1VSUA 4YACA 1GZ4A 4XX0A 5JY6A 4MO2A 1PQPA 4M86A 2R00C 4L4XA 4E13A 4YBZA 2DU8A 2VHVA 2J5KA 4YJHB 3JQ8B 4OIMA 5K9ZA 1LX6A 3IUPA 2QW8A 4IBOA 5IDQA 3VKVA 5L4SA 3QVSA 3AJRA 1Z73A 3MTGA 1E3JA 4EJMA 1ZO8A 2GNAA 3L9WA 2Z1NA 3ZWMA 4NR0A 5KKAA 2VRCD 1FDVA 2Q45A 1BSVA 1B2LA 3F4BA 4D43A 2X8LA 3GDGA 2W8ZA 4ALNA 3KSZO 3H9EO 3NT4A 2AXQA 4EJ0A 3R6DA 1E7SA 4XR4A 5G0TA 1ENYA 1YBMA 4RPHA 3UGKA 4UVEA 4NBTA 5JC8A 3EC7A 4RVDA 1JAYA 4CM8A 4NNJA 2ZYAA 3ZWAA 3H3FA 4BMSA 1SAYA 3ZWXA 1A7AA 1UDCA 3KOUA 3ZU2A 2X4GA 2YW9A 3C7CB 1U5CA 4LRTB 1OI7A 3OJOA 1I32A 2I9PA 1T24A 4Z9XA 1A5ZA 4IPTA 3ZCXA 4QEDA 4RF4A 1UP7A 1PJTA 2LDXA 4XQEA 5U9CA 1P9LA 2WD7A 1E7YA 3HSKA 2WYWA 3TQHA 4HFRA 3PHGA 4DPLA 4ZU3A 1HL3A 2A9FA 1GY8A 1W73A 2DBVO 3IS3A 3D4NA 2OOSA 1H9AA 1NPYA 4G81A 2W98A 5ENDA 4HY3A 5A3JA 1NYTA 4DYVA 3DFUA 4JXKA 3VZPA 3E5RA 2D0IA 3QWHA 1NFQA 3PQFA 4GLLA 4YTEA 5JSFA 2Y1DA 3PHHA 1KIFA 1MV8A 4CMEC 3UICA 5DCYA 1EMDA 3ORFA 3RFXA 2OP0A 4YJFB 4HADA 1YB5A 4RL6A 3GEMA 3A9WA 3RUDA 4INAA 3O03A 4TRNA 4MVJM 1DPGA 3OJLA 1IYZA 1UUFA 1W4ZA 5L4NA 4RPGA 2E48A 5HTOA 2OXIA 1DO8A 1N9GA 3U49A 1UZNA 5G4KA 4BNMA 3WNQA 4PIVA 1LU9A 4XRGA 3PFFA 4RVSA 1EEHA 3STHA 3ASUA 5HWSA 4ID9A 3HDQA 1SOVA 4TZKA 3EDMA 4W7HA 2DQ4A 4KDEA 3F5QA 5A5FA 1ULUA 3MWDB 3I9MA 2G1UA 4W9NC 4LSWA 2O3SA 1GQQA 1ZBQA 3FTNA 2Q2WA 3ADOA 1SCUA 4N7RA 4KP7A 4WGGA 3WR5A 4E32A 4EI2A 2QRJA 1U4OA 4CV1A 3GFBA 3HUDA 4DIFA 2D59A 2J5QA 3ZU3A 4XEHA 2CF6A 3LC7O 4NBUA 4KOAA 1U28A 1KS9A 3D5QA 1DIGA 1XQ6A 4OGWA 3PWSA 1Q0LA 3WQRA 3JYOA 2O4CA 5HRUA 4IGFA 5DP2A 2DBRA 3WMWA 1Y7TA 4HP8A 3E82A 2VWQA 3QIVA 3S2IA 4FFMA 3U3XA 4DC1A 1DC5A 1KVTA 1RM3A 1UP4A 4GSLA 3WS7A 3O38A 1CETA 3FRJA 2QYTA 4MP8A 2DVMA 4RLSA 3WG9A 1AHIA 3WIEA 4B3JA 3H4VA 2O7SA 1EDZA 4CPDA 1NPDA 1C1XA 1M66A 1B3RA 1L7EA 4IJKA 4BO1A 2P5YA 5KNLA 4BNLA 2X9VA 3U9LA 3KVOA 3OIGA 2P4QA 4R69A 1X13A 2DFDA 2GZ3A 2X0RA 3AK4A 2DT5A 1QMGA 3FR7A 1UDBA 3DMTA 1LDYA 2EIHA 1E7MA 4J1QA 5LDGA 2ZYGA 5HS6A 1I01A 2AG5A 1EQUA 4I5GA 4DRYA 1BXGA 5A03A 5JAMA 1QRRA 1DIHA 1K3TA 1MFPA 5TIIA 2IRWA 3DBHA 4GMGA 4BO4A 3NDJA 3I9LA 3GVHA 3V1TC 3GC6A 2BGLA 2HK9A 3H9GA 1BWSA 3H2SA 3CH6A 1P0CA 4PLTA 3VH2A 4HXYA 4NHEA 3E48A 5KJEA 3FI9A 1T25A 3EHEA 3D3WA 3DONA 3FNFA 3DOCA 1YQDA 4OL9A 4J7XA 3ONFA 3RU9A 5A05A 2HRZA 4DVJA 3RWBA 4Y6PA 5DOZA 1VE9A 4I5EA 5TF4A 2I65A 5FI5A 4CM7A 3L4BC 3MJSA 3W6ZA 4OXNA 2CDAA 1E7RA 1EVIA 1ZKMA 3RVDA 4ESOA 4B4UA 2EJWA 3AUAA 1K6IA 1DIBA 4PGFA 5BT9A 5CDGA 4IQGA 1V9LA 1E3LA 2NM0A 2FZWA 4BNZA 3WXBA 4FGSA 5GMOA 2DUWA 5GY7A 1ZJZA 4AJ4A 5T57A 4FJ0A 3X2EA 1NR1A 4WASA 1BDMA 3Q3CA 3QWIA 5I9MA 4DPKA 1T1RA 2PTGA 3TL3A 1QORA 5H81A 1U8FO 4TMFA 1H6DA 2VWHA 1ML3A 1PGJA 3PIIA 3WQSB 3V5NA 1KEPA 5I8WA 1DB3A 1ZK0A 1PJBA 3BMCA 1KYQA 1Z74A 3IL2A 2I99A 4WLVA 1EQ2A 4MVJD 3RJ9A 4MIEA 3MOIA 1DIAA 4KUGA 4KTTE 3ZWBA 4TZTA 3TL2A 2H1SA 4CV2A 1SO8A 4XRRA 3BMQA 2J8ZA 4NJMA 2E4AA 3AM4A 3C8MA 3RUFA 4GGOA 1GFSA 3OSUA 3MJVA 1LJ8A 3INTA 4LCJA 1OMOA 4YA6A 2X5OA 4YAEA 1VKOA 4II3A 1DFGA 1T26A 2VNSA 3HB4X 4PLYA 1N1GA 4PG5A 3UVEA 1R4MB 1ID1A 5KVQA 3QQPA 3JQBA 2OGUA 1ADGA 3PJEA 3PZRA 1MLDA 2X9GA 3RC1A 1I5RA 3R3JA 4R51A 3K96A 4TKLA 1ORRA 2Y99A 1IL0A 4FFLA 4CQMB 2Y1FA 3HDYA 1LDBA 1PWZA 5LCXA 3WWZA 1JWBB 3OHSX 4EYEA 4GKVA 4ZQEA 2QG4A 3HN2A 4JQCA 4OQYA 1EUDA 2JD2A 4YJGA 3ZV5A 4RVGA 5KOIA 2O3QA 1LQTA 3DFZA 3IKVA 1D4FA 2JCYA 3COSA 1VJ0A 1ZK3A 1E1LA 3VOSA 3JD4A 5ILGA 4DQUA 1RM4A 5L7YA 4PZEA 3CINA 4GMFA 4FC6A 3OP4A 2Q2QA 1E7WA 1U7TA 2B5VA 1WPQA 2QQ5A 3H9UA 3Q1LA 3KLPX 1QSGA 3Q9NA 3ANLA 2B37A 3SX2A 1Y9EA 4E3ZA 4BNJA 2X58A 3VKUA 1DFIA 1MB4A 1E3WA 5L53A 3GG2A 1BGVA 4GWGA 4YQYA 4YRDA 2P2SA 1DLIA 4CMHA 3ZHBA 1P77A 4GX1A 2GCGA 3C24A 1F12A 4N5MA 3GY0A 3C1AA 3DAGA 4P22A 2V6BA 3QY9A 4I5DA 4CR8A 3QRWA 5IZ4A 4M8SA 3QVXA 2FY8A 4BMVA 2RCYA 3LQFA 1I24A 1ZVMA 3UXYA 2VHXA 1YH3A 1O0SA 4Y6SA 3WGQA 1ISFA 2UVDA 3ZWVA 3C1OA 4U6SA 3AUTA 4AJJA 4LK3A 4PG4A 3SJ7A 2OO5A 2PKQP 5CDYA 3JQGA 4C7KA 1P44A 3P2YA 1F17A 2EHDA 4FCCA 1NWCA 3VPFA 2FHSA 1JU9A 2I6TA 3OECA 2WYUA 4J9UE 1LXCA 3SLKA 3K8ZA 2SCUA 1RPNA 2ZATA 5BNTA 1ZXLA 4YT5A 3U4HA 3D1LA 5EN4A 2ZTMA 5TJHA 3OFSA 3GVIA 4GX2A 1TEHA 4M1QA 3TN7A 3D3EA 1NFFA 3UCFA 4FB5A 3E9NA 1PL8A 3AY7A 3DB2A 4J0FA 3AOEC 1E3EA 3H7AA 2NV6A 3GLQA 1G0OA 4UVHA 2HKIA 4QO7A 4A5OA 1ISJA 4PZCA 1BXZA 1WW8A 2OORA 1OBFO 3UFXA 1QP8A 4P38A 4A2CA 4RF5A 3QHAA 1Y9AA 5GZ6A 5T67A 3ZU5A 1LSUA 5TJ9A 4O1MA 5AOVA 3EVNA 5BR7A 2R2GA 1DC6A 1J4AA 1K6JA 2GZ1A 4Q3EA 3DOJA 2X1HA 4BO5A 3DDNA 2ZB4A 2VN8A 1B0AA 3I23A 4UVIA 5A4DA 4KMSA 3IMFA 2X7HA 3BHJA 2EV9A 5L45A 1GYQA 4PVDA 1Y1PA 2AE2A 4XGKA 3GDFA 2XXJA 4P4LA 1J6UA 1QXSA 1E92A 4EUEA 2J3IA 8ADHA 3LC1O 4WCDA 3GR6A 4R3WA 4OMUA 4O0LA 4JK3A 2WM3A 2V65A 3TDKA 2GSDA 1WAMA 3K2BA 1PJSA 1GR0A 1JVSA 4PG8A 1YGYA 4OOEA 4S1VA 4Y9DA 2ZQYA 2X23A 3NTQA 4N18A 3OETA 1HDRA 2ZYDA 3UAGA 1VLLA 3MJEA 1JQBA 2W2LD 3V1YA 1V6AA 5JC1A 2X0JA 3CZMA 1B16A 3BTUA 2FR8A 5ICMA 3W8DA 4QXMA 3KYBA 2CVOA 2J5RA 1D3AA 1KOLA 5H83A 3B20A 3IDSA 1WDLA 3H3JA 1CWUA 4BNYA 5AQ1A 1PJQA 4Z0PA 2G76A 5JDCC 2PH3A 3NJ8A 3NDRA 4WNCA 1UXGA 4EEZA 4MOWA 4WOKA 1WDMA 1MFZA 1UJMA 2PGDA 1I3MA 4XJTA 5CPFA 5L4LA 1O89A 1L7DA 4TWRA 1Y8QB 4FBGA 1C0KA 3FWNA 4XYLA 1OC4A 1GCOA 2H5LA 5A02A 4IMPA 1E3IA 3CEAA 4AJHA 3TOXA 3WBFA 3ETDA 2WSBA 4Z6KA 4AJ2A 1R0LA 3JQ9A 5EL0A 7MDHA 3JQ7A 2AEJA 3OQ6A 4FR5A 4NQZA 3TZCA 3HFSA 4XIYA 4WUVA 2JD1A 3CPSA 2O2SA 3DQPA 1VI2A 4OHUA 2BGMA 2Q4EA 3P2OA 3ZI0A 4CLRB 2XXBA 4HFJA 3FBTA 1EBUA 3OBBA 1T2DA 3NJ4A 3RSHA 3L77A 5HS4A 2C2XA 1HZZA 3WNVA 1O94A 3WSWA 4YXFA 5I7VA 3GNTA 2G5CA 1SPXA 2NVWA 1JKJA 1EFKA 2I67A 2W90A 3B1KA 2Z95A 1QYXA 3GF4A 4IDAA 4Q39A 4B3IA 2HMVA 3SVTA 4DLLA 3RKUA 1R4NA 1P0FA 5JDIC 4B4VA 3M1LA 2DTXA 3GVCA 1GV1A 2W2KB 1I3LA 3VZRA 3ZN2A 5F1PA 1GQ2A 1HZJA 2NVUB 2ET6A 2GLXA 2O3RA 4YAJA 1EVJA 4BGIA 2X0IA 4YT8A 2JAHA 4WLFA 4CMAA 3HHPA 3C85A 4L4RA 2XPCA 4XDZA 1A27A 5TNXA 5G0SA 5F5NA 5T64A 4RPKA 1YOVA 4DYDA 2VHWA 3UF0A 2FR1A 3KRTA 1GYPA 1N1EA 2HJSA 5JO9A 3VH1A 4CLOB 4IS2A 3QV1A 3K73O 4I9NA 4MINA 4D45A 2HMWA 4K1LA 1C1DB 4RQUA 3OF2A 1HDCA 1ENZA 4YRAA 5IDXA 2QZZA 2QRLA 1DLJA 4HNHA 1LRKA 5DBGA 3RD5A 3ZNOA 3RCBA 3KYCB 3NT2A 4XCVA 3WGGA 1O9BA 1HYGA 1Q7CA 2A94A 1WVGA 1ONPA 1YBAA 4Q3BA 4IXTA 3PQEA 4AL4A 3VVBA 5IXYA 4YAIA 1TA4A 2YQ5A 4Q3CA 4NFHA 1K6XA 4GSKA 1XCBA 2D5AA 3AFMA 2B0JA 1I36A 2FPPA 1MXHA 3T4EA 4R1TA 1IB6A 1P33A 1PS0A 1CQJA 1E1NA 1XSEA 4CL3A 2EW8A 2FPGA 4CMBA 4GQAA 4E2ZA 3JQFC 4BKUA 3BYZA 4KTVE 3JD1A 4ZQGA 3X2FA 1R16A 3EW7A 4IDFA 4CLXA 4A0SA 3WGZA 4EITA 4KWHA 1R6DA 1RYDA 4D3FA 3ITKA 4JX8A 2CZCA 1W0CA 1ZSVA 2O2YA 2VWGA 2CFCA 3BXXA 5G0UA 4HKTA 1PS9A 2X22A 1I2BA 3L0DA 4GH5A 5L51A 1R0KA 2IXAA 3OJ0A 3EK2A 1SNYA 1Y5RA 3OIFA 1XIVA 4CM1A 1AXEA 3EZLA 5KCZA 3EZYA 3TOZA 4CM4B 3EGOA 4CR7A 3HZZA 4NI5A 2HRBA 1DHRA 3JYNA 1QYCA 4Q3DA 1S6YA 4OSOA 5THKA 3WMXA 4D0RA 2X9NA 2AQ8A 3FPLA 1LLCA 3WGYA 3ZNNA 1C14A 1NXQA 4PZDA 5EQDA 3K30A 4RO0A 3SC6A 1ZJYA 4FD3A 3I9JA 1O5IA 4IJVA 4QFDA 3R3SA 4OH1A 1W6UA 3AWDA 3LF2A 2UYYA 3OEYA 5H82A 4AJIA 3QJ5A 2H6EA 4F45A 1CF2O 4CQLB 1M67A 4E5PA 1HE2A 4Y6RA 4OO3A 4IXWA 4UEJA 4JGBA 4NBVA 3HB5X 1FK8A 2YHUA 4CMIA 5ER6A 1TT5A 5HA5A 3JD0A 3MJCA 3I4FA 5C37A 2P5UA 2FSVA 3WSVA 4OXKA 5AXAA 2EERA 4DGSA 3QP9A 4B79A 3KBOA 2NTJA 5JAZA 2C20A 5IXSA 1LDNA 3PFWO 4WK6A 3GZNA 3ROMA 3RBXA 1JTVA 4C7JA 4XYEA 2D2IA 1T2AA 1E3SA 4HFMA 5DULA 4MP6A 4OJNA 5BSEA 3BMNB 5A9SB 5T8KC 4TVBA 4RPJA 4E6PA 1XQ1A 5ICSA 4DMMA 4JJIA 4GPD1 4MDHA 4YQZA 4E2WA 4XD2A 3H5RA 1I2CA 2VZ8A 1WXDA 1F14A 1YDWA 3DBLB 4AG3A 3EYWA 2YDYA 3D4OA 2Y68A 1KVRA 4DXHA 1OZAA 4MIYA 3ROQA 2DPHA 1GPJA 1X7DA 3A06A 3H5AA 5LDHA 2NU6A 3Q6IA 1TXGA 1EBFA 1NQTA 1HKUA 1HTBA 1SB9A 2FWMX 2X5KO 4RORA 2UUPA 2B5WA 2P91A 1XHLA 2ZB7A 4BKOA 4DQXA 5AXBA 1GV0A 3ZWNA 2GD1O 2P4HX 4E0BA 4A27A 1GZ6A 1ISIA 1HDYA 3V1UA 4ALLA 1IZ9A 3F1KA 1Y8RA 3RKRA 4WCFA 3ASVA 4WKGA 2HUNA 1GADO 2QHXA 3R1IA 1HRDA 4QT0A 4CQMD 3ENNA 4ZGWA 4B7UA 1NPTO 1Q7BA 5DBFA 1XU9A 3H6KA 4OXYA 1F06A 4EEXA 3F4LA 5K6AA 5BNIA 4IDDA 3JQ6A 2VUUA 4P4NA 1U2GA 4XYBA 5FWNA 2OUIA 3CKYA 3CE6A 4BIIA 1XWFA 3VHRA 3TSCA 3WYBA 1PJ2A 2YV3A 1BHSA 3PVZA 3GN1A 2O23A 3DBRB 4BNUA 4GL4A 5ITVA 4Z0HO 1XU7A 1LA2A 2IXBA 1CYDA 1K0UA 1Z6ZA 1LC0A 3WYCA 4FOSA 3WDSA 4JJGA 4CUJA 2FSSA 2P9EA 3CZRA 4CUKA 3GEGA 4CMGA 3I9NA 3S2FA 1LDMA 4FS3A 3P7MA 4LMRA 3ICCA 1AGNA 5BSGA 1T2FA 4FFOA 4OOFA 4RF3A 1V3VA 2FP4A 1BVRA 4JBGA 1YB1A 2C54A 2Q46A 2IYOA 1GZ3A 5TS3A 4LN1A 2BD0A 4L9RA 2Q4BA 4LRSB 4L8VA 4Y8VA 4LVCA 3S2GA 3IKTA 3GAFA 1EVYA 2GN4A 1KC1A 1XDWA 2VHZA 1E6WA 3E18A 3DZJA 1X0XA 4R5HA 2EKQA 5KVVA 4MJLA 3I83A 1H2BA 4MVJA 3BHMA 2PD3A 1MG5A 1NTOA 2D3TA 5G2OA 5JS6A 2NU7A 3NKLA 4DIBA 1PX0A 2A35A 1B8VA 4YT4A 2EEZA 2NU8A 4PLGA 3D7LA 1LSJA 4KQXA 1U5AA 1ZEJA 4HBGA 1UAYA 1HLPA 1QLHA 4LISA 2YV1A 3PP8A 4ZN6A 2BFAA 4YWJA 3WLEA 1VJTA 4IINA 3TZHA 4MVJE 4ZRNA 1F0YA 3UCXA 4RQTA 3FSRA 3ROPA 2VZ0A 2RH8A 4PRLA 4UVDA 3OA0A 4EUFA 2JFGA 3LLVA 3F3SA 2Y1CA 1P45A 1BVUA 4G5HA 4QSMA 3TF5A 5JYEA 1YDEA 1ENOA 1HF3A 1PQUA 3HJAA 2POQX 1XGKA 1IZ0A 2BGKA 5KIAA 1H94A 3K92A 1BW9A 5JW6A 3UKOA 4MVJP 4MIOA 1NHGA 3AY3A 3JD2A 5HBRA 4JLWA 4YJDA 4MVJG 2Y93A 3L9XA 5DP1A 2J6IA 1LTHR 1NP3A 3WGIA 5JMPA 5AYVA 1N5DA 2D5CA 3WGHA 4J43A 1ZMOA 2WTBA 1GPDG 3IQDB 4FC7A 1I3NA 4I8XA 1LBEA 3N7UA 3PI7A 4TRMA 4BO3A 3PJGA 4U8GA 4RVHA 2PWZA 4E5MA 4D7AA 4WLNA 3KYDB 3U4CA 3OJFA 1R66A 1NVGA 4M87A 4DC0A 5TT0A 2GDZA 5EIOA 4XYMA 2VT2A 1I30A 2BF7A 5A5EA 1NNUA 3HNPA 3OJEA 1IE3A 1AUPA 4JBIA 3FNEA 2UUOA 4I9HA 2Y1GA 2DLDA 4L0QA 5EINA 1U2DA 2EKLA 3ITDA 1ONNA 3GEDA 2F00A 3D64A 3K5PA 3CMMA 4BO9A 1Q0QA 1Q2XA 3GNQA 4CLOA 4D3SA 3ON5A 4E31A 6LDHA 3ANMA 1QLJA 5A9RA 1U3UA 1C1DA 3N58A 1NFRA 1QYVA 1MXFA 2P68A 3MEQA 1EUCA 2AEMA 4JCOA 1N2SA 1NAHA 2BFMA 4MKZA 5JPIA 2JFFA 3ZWYA 4CMEA 3D5TA 4M55A 3L6DA 3A14A 3SC4A 3G49A 1VC2A 4JP2A 4JNKA 4BO7A 4CODB 1I0ZA 1NQOA 2D8AA 1PL6A 3RUIA 5IF3A 2CF5A 1HSOA 3S8MA 4ZQHA 1FDSA 1PR9A 4PLPA 5C5IA 1X1EA 2PH5A 1DJNA 4UUOA 2DFVA 3O8QB 1DJQA 1DAOA 5KJ1A 3GK3A 3TJRA 4II2A 2PGLA 1NHWA 5ENVA 3UW3A 4BVAA 3W4IA 4BO2A 3OQBA 3HWRA 2HCTA 1JN0A 3GPIA 9LDTA 1N7HA 4CV3A 3LSYA 1LRJA 1Q0HA 4CM5A 4YR9A 1BRMA 3B70A 3VH3A 4E5NA 3U4IA 3QE3A 4W9NA 2IEBA 3PYXA 4U6QA 3JQCA 3KEQA 1YWGO 1ZMTA 4BQRA 1DXYA 5U1PA 3S55A 3F1LA 5TSDA 2O3UA 3NTRA 1P1HA 1YQXA 2FN7A 2ZK7A 4NK5A 3I1JA 2OFPA 4E33A 1U3WA 1ZK4A 4DA9A 1UXJA 4XQCA 1PS8A 4YJHA 3JQ8A 2JFHA 2Q1SA 2Q3EA 1DRUA 1ENPA 2CVZA 3NT5A 3A4VA 2WDZA 1JKFA 1IHYA 3E9MA 2GUGA 4IDBA 2EF1A 3KSDO 4Q9NA 1XELA 4CM8B 2GYYA 4Q3AA 2PZJA 3GRPA 4F6CA 1DBVO 1Q7GA 2YZ7A 4UEOA 4D42A 1B14A 1GAEO 4W4TA 3VH4A 3TRIA 3HDHA 3AI3A 5JAIA 2RAFA 5KKCA 1DEHA 4KUHA 1AN9A 2DBQA 2ZCVA 4W7IA 4QX6A 2W2LA 4XJSA 1YJQA 2EGHA 4ND4A 1D1SA 3RAJA 3IP1A 4BNIA 1LLQA 2OBYA 2AW5A 2OMEA 3CTMA 4FIZA 1YRLA 3F9IA 5L95A 2WD7B 1PQWA 4L74A 4LVUA 4NG5A 1MA0A 4WLEA 3DC2A 3H8VA 3ABIA 3K6JA 4PLCA 4XWYA 1YL7A 2HMUA 2GN9A 5EERA 4OQZA 2X6TA 4AJPA 5KVSA 2O3TA 1PGNA 4J6FA 1ADCA 2B36A 2BELA 3W8FA 5DBIA 4O63O 3WYEA 3ETGA 1I33A 1HSZA 1SBYA 1QV7A 4XA8A 5L7TA 3JYPA 1B7GO 2FPIA 3PJDA 3BMNA 2NNLD 5A9SA 5CDUA 1YONA 1E5QA 2VZ9A 4L4SA 4B7XA 1U3TA 3ZV3A 2B35A 1T2CA 1I2ZA 6ADHA 3WJAA 4IDGA 3T7CA 4B4OA 4ZJUA 1LDGA 2JCXA 3LLSA 1M2WA 4QQRA 4UUMA 4B7CA 3DBLA 3WGTA 4ALKA 4IJUA 2O48X 3QWFA 2JKVA 1PTJA 4JROA 1DFHA 4RV9A 4BGEA 3WLFA 3RU7A 1EE2A 8LDHA 4LCEA 2OHXA 2CMDA 1N9GB 1B8UA 3B6ZA 4FSHA 5G4KB 3LT0A 4AJNA 1LNQA 3QVWA 5KJCA 4TRJA 4BNWA 1P1IA 4M89A 4Z9YA 3TFOA 3JQEA 1XG5A 4GLOA 5CEJA 1A4UA 4YJFA 5ITWA 2QRKA 1HYEA 2DKNA 1KEVA 2P9GA 4CLHA 2CUKA 2JCVA 1NBOA 3CMCO 1WZEA 4DLBA 4QECA 5FYDA 4J7UA 3C7AA 2Y0CA 4JIGA 4BGUA 1LQUA 1NR7A 3INGA 2QIOA 3HQ4O 4IIVA 5FF9A 1DOHA 1KY5A 5KJ6A 4IIUA 4UVGA 1EE9A 1HEUA 1P1RA 5JYDA 1Z7EA 4GVLA 3TFQA 3ST7A 1CIVA 2JAPA 5I9NA 3FCOA 1IPFA 3H9JA 5LC1A 2IZ0A 4XB2A 4AICA 4IZIA 4DQVA 3RI3A 1UR5A 4Z3KA 3DBRA 1DSSG 1PGOA 4TSKA 1UXHA 4RVUA 2GERA 3L07A 2CDCA 5U4QA 3ETEA 3P5SA 2NUAA 1G1AA 2DC1A 3GGPA 4J0EA 1GL3A 2WD8A 2A4KA 1J49A 4I08A 1C1XB 4TKMA 2C82A 3WB9A 3SXPA 1O8CA 4YT2A 4J16A 1PJ4A 3BZUA 3KXDA 1DC3A 3FTPA 3IOYA 3N74A 3LF1A 1C3VA 1MP0A 4K26A 3ZHXA 3DHYA 4YAGA 1BXGB 2HU2A 3C7DB 4RPLA 3GGOA 4DREA 1FDTA 2WJPA 4E5YA 2BFOA 4WE3A 2ZQZA 2ZCUA 4J49A 5DDIP 3SEFA 4BNTA 3LYLA 3DBHB 1A71A 4BNVA 3D0OA 4CMKA 9LDBA 4O5OA 4BOYA 1PZHA 1UXIA 3NRCA 4OYRA 3RFVA 3S1LA 2B4TO 1UAGA 4E21A 4NIMA 1ADFA 4S3MA 4E4YA 5IZCA 4W6ZA 4Y67A 3ZHZA 1WNTA 3ZWOA 3EUWA 1NM5A 4K6CA 3VZSA 2EXXA 1ZK1A 3D3WB 5G0WA 1X7HA 2BLLA 2BHLA 1ZFNA 2D1YA 2I76A 3O9ZA 4R9RA 1PGPA 1PJLA 2AMFA 1RJWA 3DBVO 3KZVA 5CP8A 5F21A 2VTEA 4BO6A 4DBVO 5JXWA 4MKRA 1M6HA 1HDGO 4Z3DA 2UV8A 3O4RA 2GZ2A 3GPDG 1D7OA 5A04A 1PJCA 2OP1A 2HO5A 1MX3A
chains in the Genus database with same CATH superfamily
1ABFA 2FDCA 3K0CC 4CNBA 4WZAA 5HK8A 1B26A 4DDHA 4XQGA 1RQPA 2B4YA 2V3WA 2R6AA 4O6VA 1CYEA 2X2EA 5JXGA 4FT2A 1I5EA 4QDZA 4OGLA 1OREA 1SK8A 1CHNA 3BXEA 3TEMA 3CRZA 3KT6A 2HPVA 3Q5DA 4W5WA 5D5QA 5FO0A 3UG7A 2E4WA 1GP2A 1G5RA 5JAPA 5B53A 2IH5A 4NFYA 3AESA 1JIJA 2PTHA 2DUMA 4NRDA 1RWMA 1A8QA 2ID9A 3N0WA 3B6JA 4CW7A 2JJ2A 2Z09A 3WQQA 4DT1B 3HE3A 3I37X 1SCIA 3QIAA 3H04A 4I99A 3ZZNA 5AXCA 4PGAA 3PFGA 3LIPA 1WMFA 4UBMA 3F6YA 5BW6B 1FXUA 5FUBA 2I2WA 5KSYA 4C20A 5CTAA 3HVUA 1M6WA 1BS9A 2IODA 5COAA 1GXSB 1XP5A 2G6BA 2VOJA 3IAM6 3O94A 4WJZA 4FHDA 3S2EA 3QFRA 1NJ5A 3OEHD 3V7WA 7ABPA 2PFGA 3MJ4A 5FUMA 2FQYA 4GYKA 3SIPA 3HJGA 1Z25A 1IPHA 4IVNA 3KKOA 5B6PA 1TVCA 2J4FA 4X7MA 1PI3A 1IZYA 1MC5A 3G68A 3T7EA 2QXUA 2C7VA 1WB4A 2QYSA 4QULA 3RS2A 1KVQA 2H06A 3CVVA 4RMGA 2W11A 1QFXA 4H08A 4DA8A 2DJIA 5AW5A 3V4PB 2H59A 4XIJA 3O1JC 4LRWA 4QGHA 1VHWA 5FUWA 3RHSA 1R8SA 4PG7A 4FWTA 2P1DA 2HK7A 3FTDA 3RC9A 5FBHA 2HSEA 4IMRA 4N8SA 3H0KA 4NJOA 2N3ZA 2A5YB 1QVWA 3AY0A 1J33A 3DMYA 3I58A 5FTLA 3ER9A 1XMPA 4JT2A 3WXMA 1Q0TA 1P5JA 5KMGB 3WNBA 1A9ZA 5FA8A 4ONEA 4ZGBA 1QFYA 3PUVA 1Z4QA 2BCEA 1XZLA 4WOJA 1DE0A 4B83A 2EG9A 1PSDA 3FRIA 5GV7A 2BRUA 5JE8A 4A0RA 1FP2A 3BQ9A 1RP1A 3MJDA 1E4OA 2QTVA 4KG7A 3Q40A 5BQ5A 4F97A 5BSHA 2WFLB 1X14A 1CG6A 3BILA 4CM3A 2AEFA 3LOUA 4IGEA 5HKBA 1JX6A 4WADA 1KI4A 2XUHA 2OBFA 5IEJA 5DN9A 4BPBA 3SNKA 3EIEA 4Q9LA 3VISA 3GHYA 2WJ3A 1ESNA 4I1IA 5IJAA 1EK5A 1RAEA 5CEFA 4N3CA 1NXVA 2NTEA 2OZPA 4Z8YA 4CQMA 1C30B 3D2BA 2JH3A 1OE0A 4RS4A 2KW5A 1JXMA 2QUZA 1I6KA 2W6ID 2KPOA 4XE5A 1TVEA 5TQ0A 3TQRA 2C7BA 2F8TA 2FWPA 2VEOA 1MEJA 2XYPA 4DIMA 2KHZA 2DG2A 2DCMA 2WWRA 3FHOA 4TV8F 3TNDA 3MJTA 5B6IA 3I39X 5DZSA 2BHTA 1ARZA 2MT9A 1YR3A 3C3WA 3DMGA 4FZ3A 3P9XA 3RC7A 4E2YA 5L3SA 1K5GA 3CN9A 2NT4A 2NQTA 5FULA 4PFJA 3RRXA 2ZJ1A 4XW2A 1TCAA 1GKYA 4OQEA 1FYEA 1UFOA 3AI2A 2HMSA 2HDNB 4GOLD 5F78A 3AEXA 2ZSAA 1AE1A 1KH3A 1MA3A 1ATIA 3K9LA 3K8OE 2TECE 4O4IB 3HXOA 3NIWA 1QVAA 2JGNA 2KX7A 3G2PA 4XVCA 3R8CA 1Z45A 4PLZA 4Z3OA 1TZBA 2QRZA 4R54A 4DTIA 4TM8A 2GF0A 5JVDA 1EM8A 3EOZA 5CB6A 4G37A 4RTKA 1ECLA 3HUTA 1XB2A 4F4UA 4BB9A 3VC7A 4B4WA 5A4JA 2D00A 2CT8A 1DARA 2B7CA 1FJXA 3X1JA 4BNFA 2AMLA 1PZEA 3NBAA 3RUAA 4ZMBA 5CNMA 5C18A 3GLIB 1HGXA 2F1KA 5BN4A 2ZKIA 1G6Q1 3K0HA 5LUBA 1U7HA 2QDKA 1W44A 5G41A 3SXJA 1EI9A 3VDRA 4ZQBA 5M29A 3QF4A 4FP9A 2DHEA 3MCVA 4KQ2A 3T1VA 4A4DA 4F86A 5AM4A 2O07A 2WIJA 5TQ2B 4BMNA 2WOOA 4DV3B 2FDRA 1TGYA 1YO6A 2P35A 3M2PA 3TKYA 3GZ4A 1R9MA 2QMQA 3STVA 4EY3A 5JXJA 3EVFA 2YXBA 1Z62A 5EMNA 5KZMB 2HBQA 4BZPA 2AN9A 2CD9A 1E1YA 3PYMA 3HDVA 3QJYA 1VPDA 2ABWA 2QP9X 2OM6A 4H4DA 5LJIA 5HX7A 4Y1RA 3PHIA 5J40A 4JP3A 5GVRA 5CBPB 5JDIA 1YE3A 2WIGA 2WTXA 3KD3A 4BCBA 5KC8A 2EJTA 1XOIA 3D43A 5KTOA 1H6BA 1XA0A 1UOEA 4PZPA 5AVKA 2RH5A 3DWIA 4K5QA 3FM9A 4BFTA 4FOOA 1VDMA 1E4VA 4D80A 1J8FA 4QYWA 3KK0A 1MW8X 4WVLA 1GGEA 1YBVA 3WLMA 3QM1A 4JA2A 2C9YA 2M98A 3TLKA 5HHTA 1H93A 1NDUA 1RLTA 2Y2VA 1N8NA 3ZX4A 3O2SB 1VLHA 4HZGA 2CK3A 4N76A 4HVTA 2GAIA 4R9SA 1N1DA 5KSZA 2GPSA 1P74A 2C2MA 1O3YA 3HCCA 1PGQA 4BE7B 2XAAA 2ZRNA 1OAOC 2PBFA 3V8RA 1Z7BA 4KQEA 3HEAA 4M83A 5KOYA 2WKPA 3BN3A 1ZH8A 3VTFA 4A6PA 3FOAA 5B12A 2ZETA 1DC8A 2EP5A 5CK4A 5CRIA 2ZAOA 4LHEA 3QMWA 3S68A 1G21E 4PN7A 2GBGA 3AERB 1KJYA 4OKSA 1K89A 3ONDA 5EHIA 1H65A 5C7LO 1EG2A 3OE7A 1VZ3A 1UM9B 2B2XA 1J8VA 2D1SA 1N2HA 1W4BA 3D3KA 4N8EA 2Q3LA 2XYRA 3OCUA 1O57A 3U5TA 5C3MA 1VJCA 1BU8A 1SKUA 2GZHA 3BTOA 2EC5A 4AIRA 1KORA 2IGTA 4O2BF 4RM2A 4RU1A 1WSDA 2HNBA 2RI6A 1WB6A 2UVPA 2EZTA 3VI4B 2BMJA 1SHUX 1XAHA 2H1FA 3L41A 2J6HA 1N2EA 1JQ5A 5K99A 2CNNA 2CJFA 1YK1A 2B94A 2YNMD 3GJ6A 1B8PA 3P0FA 1O6ZA 2WOJA 5DHSA 2LNDA 4N01A 3SBDA 3HH8A 3IOCA 4FYWA 4AZ0A 4Z9FA 5IN5A 5HZMA 4N1AA 4F9TA 2CJWA 2FWAA 4Q7MB 1R6AA 1XRQA 5IM4A 1ESDA 1GCGA 4YI5A 3SKXA 2REQA 1O0CA 3ZCRA 4MVJI 3SR3A 4TWZA 2D8MA 3L0CA 1NURA 4I50B 1VKNA 2ZJ5A 4BYGA 4EG5A 3DLHA 3MINA 1TLTA 3WRYC 5AQEA 1L4UA 1NW6A 5SY9A 4ZVOA 4GR4A 2O2IA 1A9OA 1Z4NA 2PG3A 3ZHOA 2VYCA 3WJ1A 1RQRA 2CNOA 4O3FA 1N2OA 4KXFB 4YPOA 5C8YF 3S7TA 1ZVKA 1FFYA 1XLTA 4FYIA 2RGWA 4LWQA 2IPOA 2UYHA 1WHTA 1JVBA 4R2HA 2R87A 4RWZA 1YDMA 4O59O 3H2KA 2E1PA 3BXHA 3U4DA 3WWOA 1JAXA 4EI9A 3AB8A 1Z2PX 5MGBA 1CS0A 3ZWQA 4XVUA 2VAVA 2YINC 2HWWA 3A58B 3GT0A 3VRHA 1DWOA 1FC0A 1N0WA 1V96A 4X64B 2IY9A 1DIRA 4TROA 1F8FA 4PE5B 1Y8QA 3KKPA 4HNQA 1VG1A 5GZ1A 4XD7A 1VBKA 4HGQA 3FBWA 3LOPA 4Q47A 2QVGA 3AF5A 4R8SA 2UAGA 3MTEA 5BV0A 1W8DA 3SKVA 3ZBUA 1Y7IA 3W2TA 4AP9A 4QG3A 4CM6A 4FUQA 4DC9A 1FSGA 4LHYA 3SDSA 5BXYA 1H2FA 1HLDA 2PL5A 4MV3A 1AD2A 421PA 5FTKA 3EF1A 3QU9A 4R0VA 5DASA 2JHGA 3DZIA 2XUPA 3JD3A 1BG6A 1R4NB 2H1LA 2E6KA 2HCJB 1BDBA 2YX1A 3KXIA 3HKEA 3NYWA 3CE9A 4D9FA 4CLRA 1XDDA 1ULSA 1LCIA 4Q4HB 3T8YA 4LF4B 1VL0A 2ODBA 5JNRA 1IOWA 1Q1QA 5FBKA 4DEVA 2PUCA 1ADBA 3BXZA 1VMDA 3G0IA 4FMCB 1P31A 2H31A 4DG9A 4G5YA 2Y0EA 2ZJ0A 3QBTA 2HQ1A 2P9FA 1TPZA 1BD4A 2BPOA 1IJBA 3OZUA 5LL6P 4HWKA 3E4CA 4PSAA 1XA3A 3H42B 1A9QA 1ZGHA 4EO9A 3RKSA 4KHPB 3HHEA 4BUCA 1CEYA 4PC6A 2Z1MA 2XCIA 2B0CA 1R5NA 2R60A 4LJAA 3UJAA 5BQXA 3ORQA 4R1NA 5EJ5A 3Q2IA 5KOJA 4CG1A 1ZA1A 1ZYUA 2WMDA 2WVAA 1WPGA 2C2KA 2CDBA 3BXPA 1R0SA 1R6BX 1Y42X 1ZMXA 1GRQA 3H0EA 5ER9A 5FWYB 4A03A 4RAQA 1C8BA 4IKOA 4ZOLF 3PI6A 3GQBB 4X6YA 1SXQA 4G25A 4PGGA 4PC3A 3AB7A 4M46A 1XBTA 2IYEA 3HABA 4XSGA 3TUIC 5JBIA 3KSBC 3DEAA 1QO7A 2OLJA 4IMIB 2BTQA 5AOAA 2CGEA 3MRSA 3NM4A 4US1R 5REQB 1TCBA 4DILA 1U80A 2F43B 3RIYA 3GUYA 1PEYA 3S2ZA 4CR6A 3ZV4A 4B81A 2ZRGA 3A27A 1VL8A 2A3RA 4I14A 3X0DA 4LNUA 4B34A 4OK3A 4GI2A 4AN4A 3IOMA 2A57A 4HDKA 5BUZA 4N12A 3PFHA 1EA7A 1KI8A 4XZ3A 3UKDA 4BZXA 2O54A 3C4QA 1IIBA 4WZ6A 2KM1A 3CNEA 1IIRA 1FLVA 3G5MA 4GSYA 4IXDA 3VC1A 4DSAA 4ID3A 2VK8A 2FPPB 2FEOA 1VB5A 2Y77A 5CT5A 4YAUA 3E05A 4EW2A 1JQDA 4D74A 3GLSA 5DX1A 1CQJB 1NQWA 1QIKA 4YP9A 3JASA 3BMOB 2ZJ2A 4INOA 2BOVA 2CZQA 3PDHA 4Y2TA 2C07A 2H51A 1AQ6A 2WFMA 5K3EA 4HX5A 3F2IA 2MYUA 4DG5A 3CHYA 2ZSFA 2GDJA 4EQ6A 2LGJA 3D6NB 3RS4A 4OY3A 5A3VA 3BK1A 3PVCA 4UTZA 4E5VA 1DJPA 1C3OA 2RK3A 3P0JA 1HNZB 5BSFA 3VPDA 3WB2A 2WWTA 2E1RA 1A5TA 1HTWA 3AU9A 2E6UX 2HTEA 2AHRA 3LWNA 4O4HB 3WKDA 1GXSA 5IARA 1N8KA 1D0VA 3QKSA 4BMZA 5EJEA 3D6AA 4CKWB 4DV4B 3GDOA 3RIGA 5ALFA 2CUTA 4KJZA 2GHTA 5BR8B 2Y71A 2WUDA 1BXKA 3DR3A 1JWLA 1NI5A 1T1SA 1HOTA 2FMFA 2YICA 2QI9C 1RZRD 4N5LA 2JJYA 1FB5A 5IDWA 4UMEA 2F64A 4QTYA 1PT9A 3QU5A 4JIMA 1IDOA 4HNGA 2SHKA 4TTVA 3W2EA 4ZHQB 4DADA 5I7SA 1UBLS 2IYUA 4NBWA 4QPJC 2C7OA 1WXWA 3WLIA 2IOHA 1C3EA 1P91A 3FPCA 3QMVA 1MBZA 4JBHA 4UMDA 5CAEA 1H4QA 3K1JA 5JO0A 1U3GA 5KSWB 2BP7B 1KDRA 4M99A 1MB9A 2EQAA 5EIBD 5BWCA 4QXQA 4R6XA 4ZAZA 4A16A 10MHA 3DWFA 1NY5A 2IHKA 4DABA 1NOKA 3UMRA 1K8YB 2CHEA 5I7OA 1FCJA 1C1HA 3K5WA 2WSMA 3AFHA 5FEUA 4FX2A 1UC4B 1XZAA 3JTMA 3KO8A 4HMQA 4JQOA 4Y2HA 5HQJA 1GTSA 4I9UA 1DUVG 2IYYA 4EG8A 1MJGA 5HF9A 4ENSA 4MS1A 4L8GA 4DIKA 5CEEA 1QE5A 3TRIA 4J1TA 1M75A 1YVEI 2QAGA 2PUHA 3DVLA 3IDOA 4KLNA 3T9AA 1VB3A 4KWTA 4PCVA 3MS4A 4YPVA 3DQZA 5A4FS 1U3DA 2GFHA 2I5PO 3LNCA 4QHSA 2W6PA 4BV9A 3HBJA 4C6SA 2DE0X 1UPTA 1XKXA 5IDVA 3SZOA 2EOAA 4BMPB 4Q7EA 4FGLA 4POAA 1IY9A 4BNNA 5AVXA 4I7EA 1CZNA 3CVWA 3BL8A 2XMZA 3MOSA 2VYNA 5D51S 3AR7A 3WB0A 3PD7A 1DHTA 4PGMA 2WYIA 5DM70 3C8UA 3P2EA 2GX6A 3N2LA 3ZS9A 3GW8A 1RPZA 2OT3B 3UWPA 1PNTA 2VDJA 3WDLA 4YDRA 3EDRA 3U4GA 3CW2A 5C3UA 4M7WA 1KKUA 3PHCA 1FMLA 1ZIPA 2AL7A 2ZB2A 5ES3A 2YWBA 1FL9A 1HE4A 4MVJH 4NSNA 1R8XA 4PPNA 2ZTVA 2OQ2A 5AK0A 3RTBA 3WGLA 3HP1A 2VXYA 4HX9A 1X1BA 2VYQA 4MI1A 1CZUA 2AK3A 1T9GR 2FZ4A 5DX0A 4C2AA 3UMJA 1IBMB 4KR7A 1S3SA 4LQDA 5ALYA 2PV7A 4YJ2F 4KE9A 1ZXXA 3QPVA 2G17A 4ON9A 3GA0A 2OD7A 4QPCA 1WZNA 1RAGA 2IEZA 4QVGA 4TMWA 5EHQA 2MJLA 2OAEA 4D92A 3A28A 1YR7A 2I8CA 3DHNA 1F0PA 3P2MA 4R05A 2XYVA 3U7EB 4C0WA 5BWLA 4QZVA 2H7YA 1KBZA 2ODEA 2G9NA 2GPYA 4CIWA 1JNXX 1EFLA 4H7PA 1NSYA 1M73E 1NXSA 1OFGA 1A72A 4PZZA 3LPDA 4K05A 4C4PA 5ALIA 2J0UB 4BCCA 1A1VA 1J9ZA 3IEIA 4KQMA 5J2TB 4UEWA 5A1TA 2YJ5A 4OVKA 5JRDS 3BQMB 1RRGA 2PUBA 2HIGA 4KIJA 4ZXPA 4J1NA 1K2VN 4OHYA 1YRBA 4NPCA 4FTWA 1Q16A 1PFVA 2I66A 5CVEA 4G2NA 1O97D 2VTDA 1Y8RB 5C31A 1W5EA 5B3KA 5IVPA 3PPIA 4ROSA 4RY9A 4MW7A 2XBUA 1UPFA 3THSA 3WICA 3S44A 4I66A 1NBMA 6YASA 1D4ZA 2BDTA 2H5EA 3KB6A 3GLUA 4N0MA 5CVDA 3L4BA 3TOCA 2W42A 2Z3WA 1X0VA 1IOLA 2J3HA 4WXYB 3V8BA 3AETA 4N3NA 3BA1A 1K86A 1UK8A 2AQIA 3UJCA 2I03A 2WE7A 3CVOA 4DR3B 4DA6A 3GLGB 3F4KA 1R1DA 4WLOA 5L7WA 1JXAA 1G2IA 3G1UA 1JKMA 1HLGA 4U0JA 3WMGA 4UAGA 1SXJD 3CG4A 4JUIA 4QDXA 4QTUB 4BJ5A 4EHHA 3ZD8A 5CW1A 2QW0X 4KQ6A 5JCJD 3KSUA 4JY7A 3QWBA 2RHCA 4LHXA 4MEBA 3FNBA 1SHLA 2WWFA 4CV0A 1Y3AA 1H2HA 3GZJA 1P4HA 1U2TA 1RHUA 3R2JA 4BN5A 3FHLA 5AKLA 1WMBA 1GNRA 1M2OA 3LHSA 4TV9B 4OLJA 4I1VA 3FB1A 4HQ6A 3W90A 4BLUA 1VSVA 3STWA 5E6UA 4CIAA 5DKFA 3D0QA 4ITUA 2UUAB 3WLQA 1R37A 2I91A 1Z8FA 2LCIA 3V8MA 1AV6A 3S1AA 2AI1A 2JGRA 4J0KA 1GTMA 1I9CA 3OZIA 4GKAA 3ROFA 3DDUA 3VPSA 2ZI5A 1ZSNA 4JKIA 1U8UA 4OAPA 3CJQA 4JEHA 1KIAA 4HEA1 2P62A 3HEBA 3IX7A 1NOJA 3K9HA 1T4BA 4HB0A 2RB5A 1VJDA 4M1OA 5EZQA 2FP4B 1T9CA 3C3XA 4K88A 4YLGA 5IFLA 1LI4A 2FJ0A 3OIVA 4NCAA 4G5SA 5JNWA 1JWAB 3QU4A 4R2XA 3IR5A 4URFA 3JZDA 1P4AA 1XFAA 1NRIA 5KNBH 1PVOA 3HKDB 4NMWA 2I0FA 1R0WA 2IZZA 1P7PA 3IILA 3LLUA 5AESA 3ADBA 1ZRMA 4MYTA 4P7BA 4UREA 4LQ4A 5MN6A 5B4VA 3K4QA 3HA2A 1E2DA 1FYWA 1G3QA 3V48A 4P4UA 2J3EA 3AIIA 1THGA 1W94A 2QE6A 3MN1A 2C2BA 2HX1A 3KVRA 1VHLA 4LMPA 3VKFA 4KITB 4NU6A 1CR0A 2P3OA 4LTMA 1GA1A 1OYYA 5DTRA 1SCKA 3PPYA 3OIYA 4JOCA 4RD0A 4EL5A 1KFJB 5F1OA 4RE6A 3ZDXB 1RYEA 3UJ6A 3S3TA 2QZJA 2WPNA 5DYGA 3UOWA 4B6OA 4MW1A 1KAEA 4M38A 5DJ5A 5I01A 5BQPA 1IJEA 2RGEA 3BFJA 1N6PA 3UC9A 2JI8A 3IT0A 1QOZA 3NGXA 2XUIA 4JI1B 4KIGA 1QZTA 2VL7A 5G1PA 4Q16A 3PCRB 4MR7A 4V0MA 5ARCA 5MGNA 1GZ7A 4JI3B 4U2EA 4EGFA 1KP2A 1JA0A 1VHTA 3GEBA 3R0IA 3C6BA 2E4ZA 4QICA 4AFNA 4CKYA 4ZZ0A 1OX6A 2JCSA 1NASA 4U7WA 3QPDA 4JI0B 2AOXA 2ZT8A 3NR2A 3HU1A 3U7FB 5M3BA 1NN5A 1G5PA 1IQRA 2EG5A 3JQRA 4GXNA 3LBIA 4O2LA 4ZRMA 5FH9A 3WTCA 1LX7A 1FP1D 4PSCA 5M7EA 1QB7A 1L5MA 1CXZA 3NH9A 5LQMA 1V7PC 2BCJQ 2ONZA 2WVGA 2JFXA 3BWVA 3H16A 3PUZA 5K2MA 2H4YA 1E32A 2E4VA 1XMXA 2XVXA 3WJ2A 1RRFA 2IYFA 2PZKA 3BTVA 2FEPA 2X1LA 2C2OA 4ZI2A 3W9SA 1K7SN 1DEOA 4CKEA 1SKMA 4JI2B 4DR4B 3MLBA 1ECBA 1P7ZA 4Y1GA 1K7XB 3FCEA 3P9RA 4BS9A 2CNDA 4ZCRA 3B1JA 1CUCA 3EXIA 2L19A 4PQYA 4GZ3A 3N5KA 4J4TA 2HTFA 1YR2A 3ZK9A 2FWBA 5K3FB 1XLUA 2GHRA 1RMQA 2UDPA 1PE0A 3C97A 2ZUTA 4B47A 4O29A 3KDPA 3PE6A 2X0DA 3S27A 1A4IA 3AG5A 4J3FA 3TM4A 2BGUA 2J45A 4AWXA 1CPYA 3FG9A 2PDAA 1GTG1 4WZAE 3I4CA 4YB8A 1YR9A 4JKOA 5JCOA 1B15A 2PQMA 3M4XA 1GGFA 2BF4A 1CB7A 1YRAA 1WUTA 3PK0A 1NF3A 3MW8A 4HPXB 4IS3A 4KJXA 4R7GA 1M10A 4MQUA 3MGBA 4MXDA 1HK7A 1AA6A 4V0NA 4ATNA 4XVHA 4F04A 4CCYA 2AVNA 3OPQA 3NC0C 1AKTA 2IVZA 2VFAA 2VDQB 3QITA 4N7JA 1DTSA 1U2EA 3ZHVA 1PWYE 1QCCA 1P9OA 3HJBA 4FGWA 3GQBA 4I55A 4J4HA 1Z7WA 3HKBB 5CVJA 4L02A 2RHHA 4OPMA 2JIZD 2GBIA 3IOEA 4FKBA 2QSJA 4R01A 4YVFA 3WV5A 1Z12A 4DMLA 2HJWA 2R6GA 5AM5A 5FI3A 2D1FA 5TDHA 3C43A 4G36A 2ZRDA 3H1AA 4EUSA 1RCUA 4V1CB 4Y98A 4FJ2A 1NVMB 1EBBA 4M0EA 1NW7A 3NAMA 4IDEA 5DWVA 4FFNA 1U8XX 4HV4A 3CUVA 5BP7A 5AVVA 4M1YA 4P2BA 5JCXA 4KFTA 1WP4A 2J5XA 2QZPA 4NV1A 4OHCA 1VCMA 4P7JA 4XB6B 3DJYA 1EZZA 3PQ7A 1Z6XA 2IHUA 4JQYA 1XKQA 2IE0A 1B1AA 3MGKA 4M9RA 5KSPA 4B85A 3BMOA 3A04A 2GS9A 4D9MA 5EJFA 1D4AA 2ZWIA 4NZMA 2PL3A 3V33A 1GUZA 3EXHC 1QYWA 5KS2A 4ZCQA 3AB3A 3RRMA 1NXPA 2QJFA 3OZXA 1NE7A 1WDKA 3SOZA 5FADA 1IHDA 1U6JA 4PCLA 3CUKA 4A26A 4ER6A 2YWHA 4IJ5A 5JV5A 3EGXA 1QB8A 2DTDA 1S3FA 4HQ0A 3L0OA 4TYPA 2C3YA 3T06B 3LJKA 4HC4A 3RYFA 3X1WA 1USIA 3LDHA 4HDRA 4US0R 1CQWA 3I12A 4RKRA 3AUSA 3BD7A 2ZBEA 2XZPA 2JIRA 4XDYA 4EYOA 1XQ9A 4CT0A 4PRKA 2PK3A 4UZEA 2PV0A 3Q4GA 4IW3B 4A8TA 2I2BA 5F5LA 4CKWA 5A0TA 2V7PA 2ANBA 4U0KA 2FFQA 2ZEJA 4DYHA 5DISB 2Z8ZA 4LQLA 1RWBA 1P80A 2I6QA 5FUYA 4CKEB 4LJ7A 4F6LA 5DN6A 4LPKA 1JEOA 1WCIB 3DXZA 3EGWA 3NNSA 2COUA 4G09A 3JV7A 1VSUA 4MRAA 1GZ4A 1NGSA 4XX0A 4AD8A 4BVFA 3C4VA 2O8FB 1TJ3A 3IJEB 4MO2A 4BFZA 4M86A 1O1YA 3KQLA 4YBZA 4I3HA 2X0EA 4HRYA 4YJHB 3WLHA 2ZSKA 3JQ8B 2HQSA 4P08A 4Q37A 4D4IA 1UBHS 2IHZA 2VQFB 2PYZA 4NDAA 2WKWA 3IUPA 3MHPA 5L8VA 2FZVA 2A9RA 3MXTA 3DXXA 4TMVA 2QW8A 1N75A 16PKA 1O4VA 1YBHA 5L4SA 3AJRA 1SGWA 1Z73A 1V48A 3AL0C 1GAXA 4B87A 3ZCVA 4KLRA 3DT9A 2B6HA 3RU3A 4EABA 2GNAA 3Q8LA 2SECE 2B5OA 4H60A 4HEA6 4PX9A 4R1QA 1UWVA 4G8CA 4MWOA 5KKAA 3BRWA 1AGRA 2O0HA 3FB4A 4JDUA 1FDVA 3DDCA 3AF4A 4MB2A 4UOEA 4BN4A 4D43A 2PWYA 2X8LA 5C2JB 2HJHA 3F7OA 4ALNA 2V8BA 1XVUA 3VR6A 3H9EO 3NT4A 4B3CA 3TRJA 3N75A 3HS3A 2ZZKA 3N0TA 1M1YA 1ENYA 4JC8A 3L0ZA 4JJKA 4PHTA 4XCXA 1X1AA 4CWAA 4GP9A 3ETNA 1GRCA 1TM3E 4B82A 4GE3A 2XX3A 1JAZA 4OMFG 5EA2A 2H9YA 5DM0A 1JMKC 1XDBA 2GJAA 2V03A 4NNJA 1JZQA 2GAAA 3H3FA 5H3CA 4LJYA 5TF0A 4QOEA 4BMSA 1N6KA 4X8OA 3K0FB 3PV0A 1H69A 3O82A 3KOUA 5BYBA 3FYCA 5EWJB 3WBKA 4B17A 4F9EA 1RW4A 3G89A 4L4YA 3KT3A 3OJOA 1TUEA 2PSDA 3CX3A 1XZ8A 4YJKA 4KR9A 5J47A 1VMKA 3MHTA 4X63A 4FXOA 4Z9XA 2NNWB 1DKPA 1L4GA 1Z0KA 3BIWA 1E1RD 4K3VA 1RXYA 2R97A 4EVSA 3FGNA 4JI7B 2ZJ8A 1ZIYA 1YJCA 3G7NA 3A6EA 2WYWA 4HFRA 4RL4A 3T38A 3W5VA 1MD9A 3FYHA 3I32A 4TMTA 1HL3A 2B61A 1F6WA 2XNJA 1KH2A 1FFHA 2A9FA 3HUEA 3L8YA 3STXA 2OPBA 3UAZA 2Y1LA 3M82A 2EBFX 1EAMA 5KREA 4MCIA 2XHZA 1VBNA 3DVQX 1XTJA 1VL2A 3OQHA 2J4CA 4CI0B 1NPYA 5I7AA 4ISBA 1J20A 5A3JA 5JWOA 1THZA 4K9KA 3UB3A 1BE8A 3R6WA 3BBPA 3E5RA 3VZPA 4OLBA 4FQ5A 4KN5A 1K92A 5D6NA 1SXPA 2RKWA 2PKCA 5EUMA 3H19A 4ZMRA 2B25A 5EIHA 2UZ4A 1BA3A 4CMEC 4IUBS 3B3QA 4FYJA 3UICA 4FB4A 5IP5A 4NZZA 2GSWA 2G4LA 2QIPA 3AW8A 4OLHA 1BJRE 1QF7A 2G1AA 2BZ0A 4U7JA 1ZRHA 1F8UA 1AU9A 4NS4A 4RL6A 3VTAA 3A9WA 4G67A 5A6SA 5FO1A 3H11B 4EY7A 3O03A 2V59A 4MVJM 1DPGA 3FCCA 3NHUA 4QUGA 4ZDJA 2QL9A 5KTYA 1P2GA 4L15A 2F1IA 3F7TA 3N8KA 4ZARA 4HWOA 4H18A 4RPGA 3LGAA 1VFNA 4PO9A 1M2GA 1DO8A 2DHDA 3OG9A 4G07A 5IBPA 1UZNA 2BEVB 2FUEA 2ZWAA 3E3AA 4MI6A 5FOUA 4BNMA 4PIVA 5JLJA 4F3TA 3ZGOA 2IIVA 3TAHA 2P4SA 3MCWA 4RVSA 5LWHA 4JC5A 2H1CA 2NXNA 1KEKA 2OVBA 1T36B 3P4YA 4ID9A 1SQ6A 2GEBA 5JECA 5FPHA 3L6BA 4AP6A 1BFUA 1P2BA 1ZWKA 3F5QA 3NXSA 3MWDB 2R7NA 4ZOAA 3W04A 1LS6A 4XWWA 1TQHA 4OD0A 4FK8A 3Q8WA 4LSWA 2VJAA 3R3YA 1LLFA 2QL5A 1NN3A 1GQQA 4KQCA 4W6QA 1OF1A 2ISQA 2WHQA 1Y4DE 1ZBQA 2X6RA 3KC2A 4N7RA 3DOIA 3BSWA 1DAFA 4BFUA 1Q1ZA 1T8RA 2I4MA 4WGGA 4E32A 1RRKA 1SOMA 2JCGA 4RXMA 5IMBA 1U6IA 2XA1A 1OV6A 5K4HA 1I4WA 1TYBE 1CZRA 1IEWA 2AMJA 2VBFA 2OCPA 4MKGA 4C7VA 4CV1A 2XMSA 2JFWA 3HUDA 5GIPE 2SICE 2IS2A 3O9VA 2Y3IA 3IVGA 5JS2A 1YFZA 2WJAA 3EVAA 3MAGA 4JHXA 1DO2A 3WRWA 5CTJA 1DIGA 2P7HA 1EFUA 1I14A 4LDZA 3E9ZA 5HYVA 4AW9A 2VNKA 3MQ4A 5HRUA 2P9ZA 1B8OA 3MPOA 1Y8CA 2DBRA 4YUAA 4GBED 1IZ8A 3WMWA 4L5JA 5D3MB 3RAPR 1XZDA 3QE9Y 2AFVA 4FFMA 5IKOA 3MSCA 3U3XA 3I1FA 4EM6A 1RM3A 5A7GA 3FRJA 1TU3A 4B3JA 2ORYA 3WIEA 2JLQA 4HGPA 2IXFA 4RD1A 3HKDA 1EDZA 2EFYA 1HH4A 2ZUUA 2A7QA 3MTBA 5FHRA 4FOPA 1RRPA 2FP3A 1XV5A 1FFGA 5DNDA 1V43A 4RHEA 4C4AA 5HF5A 3F5MA 5EZYB 4BNLA 2X9VA 4NNPA 4X9XA 1LY1A 1M2EA 5AHXA 2VAWA 3T0FA 3AR9A 4LJ5A 4KVZA 3MS7A 3ZCSA 3WAGA 4BLSA 2XT6A 4AG6A 4C1NA 1BH6A 1QMGA 1WUJS 3KD2A 1V5FA 4OHBA 4K46A 4J1QA 5EE1A 5KYTA 2H9AA 4MAAA 3TZBA 3JY6A 3SIXA 5SICE 2GARA 2FW6A 2WD9A 4JDPA 2AG5A 3JR7A 4RIGA 2ZI9A 2HR1A 2IKSA 4DCPA 1P5HA 2EZ4A 1DIHA 3DO6A 4NESA 2ZDQA 2MMCA 5J4HA 4M1SA 1HG1A 2WNIA 3WI7A 4L1KA 1KI7A 4GMGA 2BKLA 3HVKA 3NDJA 5JPCA 3I9LA 4WCVA 4BB0A 4EA6A 3GC6A 4XGRA 4LTDA 3B36A 3H2SA 4PSDA 4QU5A 5K1ZA 4R0NA 5SZJA 3W3AD 4PLTA 2P27A 2CXHA 2WIAA 2NUPB 3AF1A 4ARSA 4IH1A 3BCSA 3A3YA 5LQKA 3K6SB 4MZXA 4L8FA 1YJBA 1YAHA 2B1RA 3CF6R 2O2ZA 3FNFA 3N7AA 3DOCA 4H27A 3VU8A 2FYTA 1Y33E 2RK4A 3OFKA 5FOXA 2LWIA 1HV8A 1IN7A 1XTQA 3OCWA 4H7FA 2Z8YM 5A05A 5HKOA 2YVLA 2OA0A 1X92A 4JLPA 4LV8B 3S0JA 3QENA 4JYPA 2UZAA 621PA 1G5FA 1C3LA 2ZIFA 2FN4A 3GFSA 3MJSA 1XE3A 5FI5A 4CM7A 2JRLA 4G0YA 3TXAA 2BDUA 1K06A 1T15A 1UKAA 3E5HA 3CY6A 4TLEA 2FG6C 1K6IA 5CDGA 2GEVA 2DUJA 3OUTA 3T7JA 2NM0A 1RYYA 2FQWA 2FZWA 4PC7A 4BNZA 3C8ZA 3FVVA 5GMOA 4QYXA 1I13A 1NVVQ 4KDRA 2DUWA 1M1ZA 3C39A 3FYUB 5GY7A 5A5VA 4H6XA 3E3NA 3GAMA 4RETA 5FLXA 4OL0A 1NR1A 3DV0A 3O74A 4WASA 1WNFA 2Q6KA 5I9MA 4MUBA 4CTOA 1L5RA 1F4LA 4HDOB 3MYYA 5AR1A 2QNIA 1NW3A 1OFUX 1QORA 1SVIA 4NYMQ 5ADUS 2YZMA 1J22A 5IVDA 3CZCA 1H6DA 2VWHA 4DJJA 1PGJA 4M1ZA 3BXFA 1KEPA 2HNKA 3B13B 4HXGA 5I8WA 1ZK0A 1PJBA 3F8SA 4GEKA 1RQLA 1W1UA 1YA8A 4M9QA 3OTWA 4WLVA 3OFND 3T99A 3IL2A 3MILA 3UY4A 2RGAA 5LYJA 1XXHA 3C5HA 4NOJA 4JEMA 1P2VA 1LBTA 3HKBA 4MTLA 4RQBA 3ZVKA 1JEYA 2WWIA 2H1SA 2LTAA 3SE0A 2C3MA 4DUGD 2RGYA 2V5UA 2FRXA 3PCXA 2J8ZA 2QTNA 2XUJA 5FLYA 2QAJA 4L7VA 3RVQA 1GSIA 5BSRA 1M3SA 4GGOA 3IEMA 3OSUA 5BYKA 5KNDA 3INTA 4F3RA 5ECDA 2WR8A 4YA6A 3BFXA 1KQNA 3IH5A 4GM4A 4YRCA 2XGOA 2P5SA 1U65A 2B20A 4G9BA 2CXOA 3DDZX 1WZ2A 1XZKA 1L6RA 1N1GA 3IKLA 2ZFUA 4L22A 4V0SA 4PO1A 3UVEA 4CTMA 1A3CA 2IYAA 4CG3A 2BUBA 3Q88A 1KU6A 1NF8A 2PLFA 4R1LA 4LJ4A 4F1JA 5DM2A 1CHDA 3EFEA 3LX6A 4JVOA 1FFSA 1VI5A 1OPRA 2H3HA 4HH0A 2ADMA 3R3JA 3K96A 2VP5A 4FFLA 5ES4B 1CNFA 3HVRA 3HDYA 5K0EA 1E9FA 4O8CA 1M5TA 3WLPA 1SBNE 2FMKA 4QBKA 5ELLA 2EW1A 3DF7A 3CBGA 1ULHA 3EPPA 4J76A 4RZUA 4YJGA 4ZQEA 4ZDKA 2IY7A 5B7NA 3LUFA 2O3QA 1LQTA 4C7MA 3NOQA 3FZEA 1C7ZA 1L5SA 1VJ0A 4PAQA 2DY1A 3AR8A 4XUCA 5FPQA 3T54A 1Q83A 1EXWA 5GPBA 3ZX5A 4NZOA 1G2QA 3OPYB 4ZCSA 4W5OA 4BKMA 2AZMA 5ILGA 3PDIA 3YASA 1DADA 2I7CA 1RM4A 4U3JB 4IHQA 5L7YA 5C5EA 2MSKA 3DE4X 4PZEA 4R8VA 2OSVA 3UT0A 3BOSA 3OCXA 4HQOA 3AHJA 4FC6A 4IRXA 1E7WA 3PUYA 3Q1LA 1U9ZA 2QLMA 1S2LA 4G97A 2PXCA 3KLPX 2EL7A 3Q9NA 1L0BA 2W6NA 4N40A 4NNOA 5T4HA 5ULLA 3CFYA 1J0EA 1LZLA 3K2QA 6NULA 1GQOA 1Q3HA 2O8FA 4BNJA 3K4PA 1SU6A 5AKXA 3GT7A 3GYGA 1MB4A 2OGTA 2VJOA 2BUCA 3NWEA 4GWGA 4M53A 4YRDA 2GXUA 1KFEB 2UYOA 3ZHBA 5P21A 1P77A 3Q3HA 1QP7A 2AI2A 1IXKA 4C0QC 4EI7A 4EG3A 1GN9A 3ZKAA 2ZTSA 3GY0A 2Q9CA 2ZROA 3RVMA 3TW6A 1KQ3A 4ZAGA 3QVKA 1W4LA 3QY9A 1HFEL 4Z7JA 1B41A 5IZ4A 1UEIA 3QVXA 2PX8A 2ZI3A 2CLCX 4ZU1X 3SXUB 1U98A 3HPQA 4DIUA 3G0BA 1H8HD 2C57A 1YH3A 1VJGA 2VHXA 1O0SA 3BB1A 2ECFA 3LCMA 5TPZD 1ZJ5A 3HBFA 3WL7A 1ORWA 4FN5A 1I1OA 2Q3FA 2P9YA 2CXPA 2QUBA 4QFMA 4AJJA 4LDNA 3CISA 1E9RA 2OO5A 3IE1A 1T5TA 3TBFA 4IIEA 4HQNA 3U4AA 5C8ZA 2V7QD 4WFKA 4WBNB 1NWCA 2PO5A 3PE3A 4RGVA 4D8VA 4MQFB 3EE6A 1NT2A 2PS9A 3AGPA 4MQ5A 3K1YA 3WZMA 4LVNA 3AMVA 2GVZC 2VJMB 5EI5A 1MRNA 1R6VA 3U3MA 4Y2YA 1E1CB 3K8ZA 1V16B 5GONB 2BMVA 1VLQA 4CIDA 3SQOA 1VBMA 5I51A 3VI3B 2CFRA 4YT5A 2NYRA 1BQ3A 3D1LA 3LBYA 4QYIB 1W0JD 4NMMA 3OZTA 1I6WA 4MGKR 2PJUA 3OFSA 5E1MA 1XMSA 2R48A 4QVKA 1E9VA 1DXHA 4GX2A 1IK4A 1E2JA 3UCFA 1OXSC 4FB5A 5FNVF 3W6OA 3ICQB 1L5QA 1NXWA 1NBHA 3NB0A 3CLSD 3E9NA 3RSFA 3FMGA 3NIDB 1VRCA 3AOEC 3QUQA 1MT0A 1E3EA 3H7AA 1G0OA 2XQJA 4HAUA 2PJRA 1OCEA 1V8ZA 1MJ5A 2VP3A 3T1QA 2K7FA 1WW8A 4YCNA 1WABA 2FOLA 1OBFO 5HFJA 1NBME 4HGYA 1XRJA 3UFXA 1QP8A 1SZDA 4NU0A 3HI4A 1KNQA 2O8EB 3UJBA 4D81A 4G1FA 1V6CA 1YA6A 1YR1A 3GJXC 3IP5A 1TC2A 4FSXA 4DCGA 1RWPA 2FXVA 3VNSA 2XZTA 4OBEA 4QFBA 1RYMA 4Q3EA 3DOJA 3MWEA 4S1OA 2N47A 2XVMA 1QO9A 2GYVA 3C4JA 4BO5A 1ZH6A 3I5XA 1B0AA 3RVKA 2I2AA 2PCJA 2JDID 3CPJB 3BHJA 1YI8A 1K75A 3CT6A 4MWDA 4RVOA 5EY5B 3LFTA 5HBGA 3PL5A 1KQFA 2AE2A 3IAFA 4I9FA 4PR0A 4XGKA 3FCXA 4AY3A 1EFVB 4CFSA 3S81A 3C14C 3CH7A 3GDFA 1Y0BA 4IIJB 2BTEA 1J6UA 3H5TA 2BJHA 4Y6LA 2J3IA 4WERA 3EFOA