4HX5A

Crystal structure of 11 beta-hsd1 in complex with sar184841
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
261
structure length
261
Chain Sequence
EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Discovery of SAR184841, a potent and long-lasting inhibitor of 11beta-hydroxysteroid dehydrogenase type 1, active in a physiopathological animal model of T2D
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 101
structure length 261
sequence length 261
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4hx5A00
3EDMA 5JYEA 1VL8A 1EFKA 4IPTA 1TEHA 1WMBA 3CEAA 4JXKA 5IF3A 1QYCA 2GERA 3BTUA 4YWJA 4GX2A 1SCUA 4XR9A 3U9LA 5KVQA 1LLCA 2V7PA 2PV7A 3LZ6A 3GG2A 1FDVA 4J6FA 3H8VA 1QYDA 1DHTA 4E0BA 2GF2A 4HFRA 4J43A 4PLHA 1IHXA 4YTEA 1OC4A 3KB6A 1HE2A 2AQIA 3RU9A 4CL8A 5DOVA 1QMGA 4UREA 3WICA 1AXGA 1MUUA 1ISIA 3AM4A 3FI9A 4CUKA 4E5MA 3VTFA 1YBAA 1V3VA 4ZU3A 3E9QA 5G4LA 1TA4A 4Z0PA 1EK6A 3HDYA 2QZ9A 4BO0A 3D4NA 2LDXA 3ETDA 2C7GA 4DMMA 2VUUA 3KYDB 3RVDA 3WWYA 5A3VA 1NXQA 1SPXA 3ZW9A 1NPYA 5AXCA 1LDYA 3JYNA 4J1QA 3RFVA 4IS2A 5LCXA 2CVQA 1J5PA 1UDBA 2IODA 2O4CA 1WDLA 4CV3A 4YQYA 5ILOA 1A7KA 1YRLA 2Q1SA 3JD2A 4YRDA 4ZQBA 3RCBA 3CH6A 3WSWA 1SB9A 5AQ1A 2JHFA 5G2OA 3ZWAA 1U4SA 4XZ3A 1CERA 1E7RA 4U0KA 3LVFO 1LI4A 3PI7A 3HB5X 2AHRA 3LU1A 1BXGA 4XQEA 1GPDG 2W90A 2AQKA 1F06A 1W0CA 4WASA 1P9LA 2D0IA 4H3VA 3BHJA 4JX8A 5BNTA 1R0KA 4ALMA 2ZIZA 2QRLA 4L4SA 1QYWA 1O6ZA 3H65A 2C20A 1YJ8A 2B83A 3AY6A 4L4RA 3I9OA 4J7XA 3PHIA 3EAGA 2ZB7A 3KBOA 5CEEA 2AA3A 1NVGA 5TJ9A 4CQLA 3TL3A 2Y05A 1HDXA 3WMXA 4TZTA 4RF5A 4BKQA 1SOVA 2D5AA 4OSPA 5L4SA 4OAQA 1AHIA 4I5DA 4CM3A 4WJZA 1HEUA 3QVOA 1N5DA 1O95A 1RM3A 4BNXA 1Q1NA 4GAEA 1I24A 1IPEA 1A27A 2NU6A 4XIJA 3FWZA 1VPDA 2VNSA 3DOJA 3EVNA 4GX5A 4UUNA 2PZJA 3DZGA 4UUOA 3Q6IA 2FP4A 4UEKA 1NVMB 4S3MA 3IC5A 4EEXA 4AG3A 4ESOA 2HK7A 2P9EA 4RQUA 2JD2A 4J1SA 4FFPA 1HSOA 4PG7A 1XQ6A 3ADPA 4QT0A 3LLSA 3GEGA 1JWBB 3PQEA 4EGFA 3F4BA 5JY1A 3WNVA 3ZGYA 2X6TA 1MP0A 3K92A 1F17A 3L0DA 4NZ9A 2VTDA 3AFNA 1D4FA 5GY7A 1WLYA 1A4UA 1BWSA 3V2UA 1OZAA 1EMDA 2DUUA 4RLSA 4NH4A 2EW2A 2JD1A 4EJ0A 2YJZA 4E3ZA 1C14A 1NVTA 5CAEA 1Q0HA 4Z3DA 3VH1A 2JFHA 1LLDA 5TT1A 2Y1DA 2BFPA 4XEHA 1I30A 2ZCUA 3JD0A 3RKUA 5COAA 3ZW8A 3EGOA 3CE6A 3NTRA 4XKJA 2B37A 5ICMA 3GLQA 1I8TA 1PTJA 1M67A 3W1VA 4AJNA 5BSEA 1LA2A 3AU9A 4BS9A 2H1SA 1ISGA 3H9EO 4U0JA 2R00A 3TOZA 1HZJA 3JQ9A 2O3TA 4M54A 3VDRA 1PGOA 4WNIA 4NJMB 4JQCA 4W7HA 5KKCA 3K73O 4BB5A 4GKBA 3MTGA 3JQAA 3P7MA 2EERA 4WCFB 4BNNA 4RPJA 3PWSA 4F3YA 3BXXA 1IOLA 5BSGA 1ZXLA 4UAGA 1ZZEA 3K8ZA 1NYTA 4KOAA 5DP2A 5IDQA 1BDBA 3MTJA 4XYBA 1FK8A 1C1XA 4F6LA 1QORA 5HS6A 3GRPA 2FZWA 2HCTA 1X0XA 5F1OA 4AJ2A 2X0RA 2R2GA 3F1LA 2O3QA 3JQDA 4OJNA 4BNHA 3KYCB 4UUPA 4BKRA 5L4LA 2WE8A 1IZ0A 4CM5A 1W73A 5EQFA 5B12A 2O23A 4IDCA 2PH5A 3RI3A 5TQVA 3FCOA 4BKOA 3PP8A 4R41A 5GZ3A 3E18A 4J7UA 5CEJA 1E3JA 4K9DA 4LISA 2H5LA 3FPLA 3VPSA 2FZEA 1GD1O 4L9RA 1SEVA 3ASUA 2VT3A 1X7GA 5TX7A 3E9MA 4QTZA 3QWIA 1ULUA 2ZQZA 4FS3A 4KWIA 4OMUA 3TWOA 2WE7A 1SZJG 4PLTA 5KJ6A 2JCYA 2QQ5A 5BSFA 1R66A 3ETEA 1OMOA 4LMRA 1QV7A 2VTEA 4QEDA 4IMRA 4XRRA 4RVUA 1Q7CA 3L6DA 3F3SA 4BNYA 1A5ZA 3DAGA 2YHIA 5IN5A 1E7SA 3D4OA 1KEPA 3G1TA 2E6UX 3IP1A 2R6JA 5EINA 1YWGO 1LUAA 2R00C 5DDIP 2IEDA 1F8FA 3FR8A 3PWZA 4LSWA 1M6HA 2HRBA 3LT0A 5BT9A 4B3IA 2X9NA 3F5QA 1NASA 5DCYA 1QLJA 3RFXA 3GF4A 3D1LA 3ZU2A 1Z82A 4BNGA 2FPPA 4Z6KA 2DBRA 3GFGA 3WIDA 4WEOA 4L75A 1K6XA 1MGOA 4BO1A 3GGGA 2X8LA 2E48A 2FR1A 3RC7A 2O2YA 1VSVA 2EG9A 3TQHA 2VHWA 2NM0A 4NK5A 1T2FA 3U3XA 3D5QA 2ZTMA 3IUSA 3SLKA 3ICPA 1J0XO 5ADHA 1DC4A 2W2KB 2I99A 1P0CA 4CUJA 3I9JA 4CMBA 1OFGA 2UYYA 4TRMA 3UW3A 6ADHA 1BW9B 5GMOA 1V0JA 4GMGA 4NFSA 5JNLA 1K89A 1EDZA 4E13A 2BH9A 1KVQA 3DDNA 3V1TC 1NM5A 3PGJA 1EEHA 4D0SA 1GU7A 1PZHA 4HFNA 1Q0LA 2GO1A 1LC0A 4R68A 4A7PA 5IXYA 1AGNA 1YOVA 2AE1A 3TZHA 3S2EA 4AJLA 2PR2A 1C0LA 4JBGA 3WJAA 5HWSA 1IPFA 2HUNA 1YJQA 3UN1A 2XF8A 3ZV3A 3ICCA 1H6DA 1S6YA 1QP8A 1YB5A 4DQUA 2YV3A 3DB2A 4GMFA 2DM6A 2VWQA 5DOZA 1TT5B 3MOIA 1DPGA 3ZV6A 5TLSA 3A28A 2DBZA 1LXCA 2DPHA 1ZSYA 3UCFA 5A02A 1MLDA 4TRNA 3DWFA 1U5AA 4Q3DA 4IUYA 1Z7BA 3VKVA 1DIHA 4INAA 3OQ6A 4WNCA 2NVUB 1LU9A 4NMHA 2HU2A 2X4GA 4NBUA 2VYVD 2BFOA 2X5KO 3ZDFA 1VJ0A 4IJVA 4PFJA 3RBZA 3PZBA 1I2BA 5CPFA 2CY0A 1GPJA 3PJFA 1PU2A 5BNIA 2X0JA 4FW8A 2EP7A 1FJHA 3H9QA 4H16A 1E3LA 2VT2A 2EKLA 4B8WA 1GL3A 4PZDA 1HDGO 3JYLA 1RYDA 4N54A 5HTOA 1A9ZA 1B2LA 1GFSA 3ZHYA 1MC5A 4RDHA 4K26A 1MG0A 2NU7A 5A5EA 4JIGA 3H2ZA 1G0OA 4RPGA 4QXMA 4J4BA 2BD0A 4Q3EA 3KYBA 3PTZA 2FMUA 1VRWA 4PRKA 4JJIA 1MFPA 1C0KA 4XIYA 3DBLB 4HWKA 3VVCA 4JJFA 4DC0A 2ZYAA 3MJTA 5KTKA 2QIOA 1E6WA 1MA0A 4NBTA 4G5HA 3RUIA 5LC1A 4E5KA 2Q1TA 4AICA 4AL4A 3HN2A 4GQAA 5MDHA 1ZIDA 2B4QA 3QVTA 4E12A 3ZWOA 1ENYA 1YBMA 3JD1A 2X9VA 3S2FA 2WD7A 2JFGA 1CETA 2CNBA 3OEYA 4HUJA 5JFOA 2HK9A 5F21A 4U6QA 4CLEA 3KXDA 3I9NA 1ONNA 1M75A 3C1TA 3JQGB 5KJ1A 1E77A 4J3FA 1H6BA 1AXEA 1MC4A 3BMCB 3JQ8B 4HFMA 4ZJUA 1ENZA 2O3JA 5ENDA 5L7YA 4BNIA 2C0CA 3SVTA 5IZCA 1CRWG 3RFTA 3WGIA 4RL6A 5ER6A 3OETA 5THQA 3ZNQA 1DFHA 5DT9A 4XJTA 1SMKA 4DXHA 3BA1A 3C7AA 3PWKA 3QY9A 4PG8A 4BNUA 4LK3A 4XRGA 5A4DA 2BGMA 5F1KA 3F1KA 2G5CA 2O7SA 5KIAA 3LF1A 4BO2A 4W99A 1BSVA 5HBRA 4FJ0A 4LRTB 2NTNA 3K6JA 4ND3A 4FD3A 4PLYA 5JMWA 5AXDA 4YT2A 1TI7A 4CQMB 1KEWA 4R1TA 4AJEA 1QRRA 3MCVA 4IJWA 1LSSA 2QRKA 3LC7O 2IEBA 2EKQA 5G0UA 3ZH2A 4ALKA 2IXBA 3PHGA 2AG8A 3R3SA 4B4VA 5K6AA 4PLVA 1HYGA 2JL1A 1GUYA 1E6EA 2Q99A 4RGBA 1GQ2A 1V9LA 4J4TA 5JLAA 3TZ6A 5C5IA 3ENNA 3AOGA 3H5NA 1UZLA 3ZWXA 1GYPA 3JQAD 1BDMA 1PJSA 4Y8VA 4DIFA 1QYXA 3ZU3A 1JKFA 3QVSA 4A03A 5KVSA 4ITUA 3AUSA 4IZIA 1T2AA 3M1AA 3STHA 3FNFA 4K6FA 4M49A 3JD4A 1EQ2A 3DFUA 1ZJZA 2NUAA 3KUXA 3OJ0A 1RM0A 1SB8A 2JCVA 2YZ7A 4AJOA 1ZK3A 2IYPA 4EDFA 4KP7A 3ZWNA 3VDQA 4D3DA 1BVUA 1DO8A 2A9FA 3FN4A 5FYDA 2GN8A 3Q0EA 5AXAA 4I1IA 4MIOA 3PRJA 3VZRA 4QX6A 1FF9A 1GZ3A 2ZCVA 2B5VA 4GLOA 4BGVA 1I32A 2YQ5A 4I9NA 4LCEA 4JBIA 3BMOB 5EL0A 1X1EA 1DIRA 3OF2A 1ZUD1 4ZA2A 5TSDA 4FGSA 1LJ8A 2GN6A 4HNGA 4UEOA 4IIUA 1IZ9A 4KUHA 5L7TA 1A71A 3K2EA 3Q9UA 3ITDA 1DC6A 3PVZA 4RF4A 3BMQA 5ITVA 3GGPA 4WLNA 1D1TA 1WPQA 1PJLA 2VRBA 3OEWA 2GUGA 3WMWA 1JVSA 4OOEA 2DBQA 1ADGA 1HL3A 1PL8A 3GAFA 2RAFA 3NT5A 1EE9A 3E5MA 4FFMA 3QWAA 1EE2A 1U3TA 1KIFA 2CFCA 4XDYA 4YAJA 2EGHA 4E6PA 4NU6A 4IJKA 1X14A 3NGLA 1WXDA 4B4OA 4J16A 5JBIA 2BKAA 2V6GA 3KOUA 1TT7A 2RHCA 3UFXA 2HO5A 5A03A 1NFQA 3SBOA 3HDQA 5AYVA 3QQPA 4MVJH 3C7CB 1XR3A 1N9GB 5ITWA 3L4BC 5ER9A 1B8VA 1FXSA 2UUPA 3TN7A 4IXTA 1MV8A 2GRAA 3VZQA 2NQ8A 4NNJA 2XAAA 4OL9A 4BKUA 1X7HA 3TFOA 4OH1A 1PR3A 4J1TA 1VJ1A 2D8AA 5JS6A 3DC2A 3PIIA 2D1YA 2I66A 1HYEA 4PLPA 3WJ7A 3GFBA 1H2HA 4ZD6A 5JDCA 1XYGA 3KRTA 3K30A 1P1FA 3A1NA 1QLHA 2PLAA 2X1HA 4YRAA 3U09A 2CDCA 2VHVA 3AI3A 4E2ZA 2FPGA 3BTVA 3NV9A 3BMNA 3NEPX 1V8BA 4J2OA 4U8GA 1KVTA 4D7AA 5THKA 4BNJA 3U49A 2AQ8A 4QFCA 2FHSA 3RC1A 5JE8A 4RVDA 2PZLA 1GZ4A 4WKGA 2QYSA 3K31A 4PLZA 1IE3A 3AUUA 2NADA 1DLJA 3EW7A 4CMIB 3Q2IA 2NV6A 1E7MA 2GGSA 1UDCA 4CM8B 4JCOA 2ZTUA 2ZB4A 4E5NA 1ZK0A 5L9AA 2IDZA 2EHDA 4NJOA 3Q11A 3VH2A 1H6AA 1ZO8A 1LRJA 4Q3BA 3I9LA 1FDUA 1K0UA 4JROA 2G1UA 1Q2XA 3ZNPA 3OA0A 1E7QA 4MP8A 4KUGA 3PFWO 2DQ4A 2OBYA 3PJDA 3ROQA 3TFQA 5I8WA 5JDIA 1EBFA 3EMKA 4M87A 1XWFA 3GNSA 3TDKA 5KWEA 3RC9A 3E9NA 1VJTA 3LF2A 3I1JA 5C7LO 1VKOA 2B35A 3QWBA 3DL2A 1NQ5A 1YL5A 2FOIA 5K0ZA 1WNTA 1ID1A 1O5IA 1NAIA 2E4AA 1BXKA 2RHRA 3D3EA 5KJEA 4EZBA 4R5MA 4CJXA 4Q39A 5K9ZA 1A7AA 3VH3A 3L9XA 5FEUA 1NPDA 2BHLA 4BL5A 2PGDA 3AUAA 4XDZA 2EJVA 2X23A 1HE4A 4ROSA 4Y9DA 1DFGA 2AMFA 2GZ3A 4BQRA 4ND1A 5T64A 3KV3O 1PQPA 2OP0A 1YB1A 2CMDA 1PIWA 1TB4A 3UICA 4ZQGA 4MP6A 4D79A 3OSUA 3BTSA 4PLCA 4J49A 4Y67A 2OMEA 2B0JA 1HDCA 4TKMA 3WGGA 3G17A 3W6UA 5L4NA 3JQ7B 4W4TA 3WR5A 1U3UA 1ISJA 1BXZA 2P9CA 4DLBA 2J5RA 1LTHR 3MJSA 1T4BA 1H5QA 5H83A 1QR6A 3ROKA 3RUFA 2ZJ1A 4Y6PA 5ICSA 3IL2A 2AEFA 2OL4A 5KJCA 4CODB 2UVDA 3UF0A 4CMEC 2O3UA 3ORFA 3WGQA 2Q2VA 1KVRA 3K5PA 2P4QA 3PQFA 1YDEA 1K6IA 5JY6A 1D3AA 1HXHA 2JAHA 3GOHA 3JYPA 4MDHA 2VRCA 4HV4A 3NJ4A 4BGUA 3LK7A 4B3JA 2HKIA 1N8KA 1M66A 1R37A 2PNFA 3JQFA 4PVDA 4J9VA 1XG5A 2QHXA 5I7FA 2EKPA 2Q3EA 4BV9A 3ZWMA 4DIBA 3GPDG 1I2CA 1GQQA 2OGUA 3ROPA 4AJPA 1UXKA 3DHEA 4NQZA 2A94A 3OQBA 3V8BA 2OORA 3RASA 3H3FA 3M2PA 3LDHA 5FFFA 2DTDA 3PDUA 3W4JA 1DRVA 2D3TA 4FOSA 5TT0A 1WZIA 3HNPA 2BGLA 3GN1A 4FN4A 1B3RA 1WVGA 1PJCA 1EFLA 3NGXA 4GKVA 4HP8A 4AJ1A 3WYCA 1UH5A 3BAZA 2DBVO 2O48X 2G0TA 3E8XA 2C7VA 3OMLA 1ADFA 2Y68A 3ZV5A 2AW5A 3WFJA 3DZHA 3QRWA 3UCEA 4LCJA 5FI3A 3OECA 4DL9A 3IQDB 5I9LA 4B4WA 1JAXA 3PHJA 1P3DA 3CKYA 3KETA 3ZHBA 1ZMOA 2UDPA 2V6FA 2VNAA 2NNLD 4NJMA 5KJFA 2CZCA 3PLRA 4FIZA 1N92A 3PXXA 5CDGA 4WCFA 4DQVA 5G4KB 1SOWA 1FDTA 4EUEA 2WYUA 1LSJA 1D7OA 1MB4A 4NFHA 2OXIA 4PN3A 4LVCA 3GDGA 4ALLA 3COSA 1GAEO 1VLLA 3PDJA 4BO6A 4DYDA 3RUEA 4URFA 2X58A 1YL7A 3N7UA 4NBVA 5JO9A 3VZSA 1YBVA 2V6MA 3AUTA 3F5SA 2D4AA 4ALJA 3KYCA 2DKNA 2GZ1A 4DC1A 1E0DA 4WPGA 3DZFA 4GBJA 2B36A 2EWMA 3AI1A 4LGVA 4YR9A 4NI5A 2VZ0A 1LQUA 3OA2A 3DFZA 5KNLA 4A10A 3E03A 3WLFA 2PGJA 1E5QA 4FQ8A 3TZKA 2NSDA 4OOFA 3V5NA 2AXQA 1U1IA 2BI7A 3NJ8A 1RWBA 2PD6A 4WUVA 1PZGA 1HWYA 4PIVA 3OQ1A 1KEUA 2YFQA 3U4IA 1SBYA 3GVPA 4ID9A 3OP4A 4FC6A 1DSSG 4IGEA 3L4SO 5CP8A 4OHUA 1YL6A 2CVZA 2GD1O 3DAFA 3PIDA 4M1QA 5EMHA 2B4RO 3RJ9A 3OICA 4I5GA 5IN4A 3RU7A 2O4UX 5JAZA 3AFMA 1B0AA 1GCUA 2B4TO 2RH8A 5BQFA 1HDRA 3O9ZA 2JAPA 2RCYA 4G81A 3B6ZA 5H81A 3WNQA 2VZ8A 3N58A 4YJGB 3DBVO 2OO5A 1E3SA 2J3KA 3D64A 3NTOA 4AVYA 1P1JA 4YB8A 1I3NA 3E82A 5FWNA 3RROA 3ONFA 4MP3A 1UJMA 3ZWYA 2DAPA 4J90A 5IDXA 5FF9A 2DU8A 3DO5A 3ZU4A 3O8QA 4BMVA 4WOKA 1Y8QA 1B15A 1NBOA 1GY8A 1KERA 3KO8A 4DWVA 4Z9FA 5BNFA 3AOEA 2BI8A 3VC7A 3IIEA 2W2LA 2IRWA 1QKIA 1U9JA 4O63O 2XXJA 3JQCA 3HHPA 1LSOA 1GV1A 1YQGA 4K6CA 2O3RA 3QE3A 3FNEA 1O9BA 4FOOA 2DLDA 3GUCA 4Z9YA 2CF6A 2W2KA 4M55A 3CMMA 4X54A 4BO4A 5JCJA 2BFMA 1R16A 3L6OO 1BW9A 3ULKA 2XXBA 5H82A 4AJHA 4B79A 1Z74A 3B1KA 3E6AA 2C29D 2FRDA 4CMGA 1AE1A 5EESA 4YYZA 1OOEA 4L74A 3JQ9C 3MZ0A 1B14A 4BMSA 3DEYX 5I8ZA 3TOXA 4LSMA 2PFGA 4MVJG 4DMLA 1B8PA 5CG1A 1AHHA 3OIGA 1HETA 2D2IA 4YA6A 2UAGA 3OJFA 2Z95A 4LRSB 4O1MA 4Z9XA 5A9SB 1C0IA 4U7WA 3DR3A 1ZNQO 4CR6A 3W4KA 1TT5A 1VSUA 3IP3A 3G79A 3GC6A 2A35A 4MIYA 3WQQA 1NQOA 4GVLA 2YHUA 3T4XA 1ZSVA 1IHYA 2GR9A 3EZLA 4NHEA 3I4FA 4L0QA 4NFYA 1DDOA 4Z0TA 1ZJYA 2EF1A 5G0TA 4OQZA 3KZVA 5A05A 1MG5A 4Q3CA 3GQVA 3ZNNA 4IM7A 2NVBA 3L9WA 1LSUA 4E2XA 3AOEC 3NRCA 1L7EA 4UVEA 1YB4A 2H6EA 2J6IA 1XKQA 2VQ3A 3QVWA 5DBIA 1WP4A 3ZV4A 3GVXA 3GNQA 4C7JA 1GUZA 3BTOA 3DTYA 4XQGA 1DB3A 3ONEA 2CUKA 4KZPA 3H3JA 5COBA 1OAAA 1H6CA 1E3WB 3OIDA 2O50A 5EIOA 4CM1A 1HSZA 3ST7A 3QV1A 3DQPA 3RKRA 1X0VA 4XWYA 5MGBA 1CQJA 4TROA 5GZ6A 4WCDA 1Y9AA 1WMAA 2YV1A 4GX0A 4BO3A 3JQ6A 4R1UA 3AY3A 4W6ZA 1GYQA 1GR0A 2OHXA 1PSDA 4FBGA 4DYVA 1B26A 2ZJ0A 4YJFA 3DBLA 4YRBA 1X15A 4ZICA 3A4VA 3ZWWA 1ONOA 1Q7BA 2Z1MA 4UVHA 3E48A 1U3WA 4YAEA 3BYZA 1ENPA 1CYDA 4D46A 2J3JA 1PQUA 4JP2A 1Y6JA 5JPIA 3OHSX 1W4ZA 3ANLA 3FSRA 2FR0A 1ISMA 1ZK2A 3CMCO 1X1TA 4JP3A 3ZHXA 2GCGA 3FF4A 4UEJA 5JAIA 4YAKA 5IDYA 4E2YA 5CPBA 3WB9A 1PJ4A 1DJQA 1HDOA 4KTVE 3ZNOA 1KETA 1ZFNA 2VRCD 2ZKLA 3VKUA 4A73A 4CV2A 5JAQA 3JQGA 4UULA 1HT0A 4A27A 3DMYA 3FHLA 3BMCA 4PG4A 4GVXA 3JQ8A 4QECA 2X5JO 2ZATA 4ZQFA 3ZU5A 3P5SA 6LDHA 1V35A 4RJTA 1OBFO 3CZMA 3Q9NA 5L95A 1HTBA 3ANNA 3QW2A 4MVJP 3P19A 2FN7A 1BHSA 4IDFA 2HMWA 4UUMA 3RUDA 4BGEA 1ORRA 2IYOA 4U6SA 1YKFA 2UUOA 3ROMA 4BNZA 1BMDA 3L07A 2Y99A 4UVIA 5JXWA 1P33A 4KTTE 4GI2A 3CZRA 4CQMA 1U2GA 3WOHA 5TS3A 4MVJA 4Z0HO 4AFNA 3SC4A 3LC2O 4IQ8A 1EVJA 4N5MA 2NQTA 1GEEA 3EYWA 3GGOA 3O4RA 5JC8A 4DVJA 2VUTA 4JGBA 3U4DA 4CLRB 3O26A 5T5QA 4GX1A 3WGHA 2YFHA 3OIFA 4BO7A 4YQZA 4WECA 2OP1A 3B70A 2C07A 3GEDA 3I3OA 3V2GA 4OKIA 4E4YA 2TMGA 5DCWA 4E21A 2WM3A 1VI2A 3CPSA 3Q3CA 2NVWA 1R0LA 2PKQP 3FBTA 4NG5A 1P44A 3HE3A 5DP1A 3FWNA 4J1NA 4ILKA 1U4OA 4G65A 3JD3A 3TPCA 3CIFA 3D7LA 4G2NA 1H93A 1H94A 1T24A 2JD0A 2FY8A 2DT5A 1G1AA 2AG5A 4CMAA 2EW8A 2P68A 1PX0A 1NX6A 3PFFA 1YVEI 2ZB3A 1PJQA 2Q49A 3K2BA 4OXNA 4BKPA 3V1YA 4MKXA 1UZMA 2WSBA 4KQWA 3BMOA 4F46A 3QWFA 3OH8A 2EV9A 4F45A 4MOWA 4OGWA 2VYNA 4BNKA 1LNQA 3OJLA 1DOHA 4YJHA 2CSUA 2GSDA 4AJ4A 7ADHA 4XD2A 1NQTA 2Y0CA 1RM4A 5DNAA 2C5AA 3WYEA 3WQSB 8ADHA 2IXAA 4J7CA 2Z5LA 3D3WB 4P8RA 1PWXA 4J0FA 2HQ1A 2O2SA 1YGYA 3A9WA 2D59A 2UV8A 2P4HX 1LDNA 4OIMA 1P1KA 3ZWPA 4OO3A 3CSDA 1UP6A 4YXFA 2GN4A 4LN1A 4D3FA 4P22A 4YVFA 4A2CA 2GLXA 2WD7B 3WFIA 1OC2A 3QLJA 1I10A 1Y8RB 3R0IA 3F9IA 1V3UA 4IDAA 1QYVA 1VM6A 1S7CA 2G17A 3PHLA 4PG6A 4XYMA 1NR1A 4BNFA 5IZCC 4FB5A 1KOLA 1XDWA 2AEJA 2JKVA 1U8XX 2NACA 3RJ5A 3C7DB 3WGZA 5T8KA 1K2WA 4D44A 5KVCA 5L7WA 1N9GA 1WW8A 5LDGA 5G0WA 1JQBA 4HBGA 3TJRA 2IE0A 2VCYA 3GDOA 3FTPA 1SO8A 1KVUA 4GSKA 1UR5A 4R01A 1GZ6A 3WX0A 2X9GA 4BHTA 5IAAA 1MX3A 1E1NA 3TZQA 1E7YA 3NDRA 4PGFA 5JCJD 1T25A 1LLUA 5DBGA 4ZN6A 4R1NA 4RZIA 3H4VA 1F0YA 4DLLA 2RIRA 1Y5MA 4O6VA 3ZN2A 4IINA 2X0NA 2OZPA 3TF5A 5K6AC 2H9IA 3LQFA 1X13A 3GH3A 5A5FA 1ML3A 5L45A 3TSCA 3GDFA 1R4NB 4CM6A 3F4LA 5EPOA 3JV7A 4I5EA 1NFFA 1Y7TA 4R54A 4CMIA 5I9NA 1V3TA 1H9AA 1YE3A 3GT0A 3DZKA 5GZ1A 1P77A 4CM8A 1AUPA 2DUWA 2HMSA 1ISFA 5IZ4A 4QSMA 1NP3A 1XHLA 3T7CA 4HXYA 2VN8A 2Y67A 3NT4A 3RUHA 4EUFA 2WJPA 4XB2A 4NPCA 4IIVA 1DEHA 1XCBA 3S2IA 3WXBA 3KSZO 2WDZA 1C1DB 2ZQYA 3VPXA 5CG2A 3OJOA 3KLPX 1WDKA 2BFAA 3QJ5A 4CPDA 2HMTA 3DTTA 3C3XA 4W9NA 2CF5A 3E1KA 1FMCA 1CEQA 4PZCA 1PEDA 3ITKA 3AJRA 2P5UA 4NR0A 1F14A 3WIEA 1N7GA 2F00A 3CUKA 2LDBA 3I5MA 1GEGA 1KS9A 2GASA 4B7CA 1DIBA 4BVAA 5EERA 3VPFA 4I08A 3WGYA 3GHHA 1HDYA 2EIHA 4YAIA 2NLOA 2GZ2A 3H9JA 5L53A 1HLPA 4K28A 1XEAA 2I6TA 3ZHZA 3W8DA 4YT4A 9LDBA 5KVVA 1N2SA 3DBHB 3TZCA 4EJMA 4YPOA 3UHAA 2EEZA 2J3IA 3EY4A 2OOSA 1KY5A 3RSHA 3IUPA 1BGVA 3C1AA 1P1HA 4Q3NA 3GNTA 4H7PA 1U5CA 3HDHA 4OYRA 4RF3A 1PS8A 1KC3A 3GEMA 2W8ZA 2P5YA 1HE5A 1PQWA 2C2YA 4BIIA 4M89A 4E31A 4LW8A 1DIGA 1UP7A 3UKOA 4Y6SA 4RDIA 3LYLA 1NNUA 1GDHA 1UXGA 3JQ7A 1R4MB 4CM4B 3JQBA 4CLOB 1C0PA 4GGOA 1U3VA 4J2HA 5JAMA 3KYDA 3WGTA 2HJSA 3LT1A 3PEFA 4CMHA 1M6WA 1XGKA 4XCVA 1GYRA 2D5CA 3I6QA 1T1SA 1PR9A 4WGGA 1U28A 1WWKA 3DAPA 3WBBA 3GHYA 1IB6A 3T4EA 4P38A 5B4VA 3PZRA 4IGFA 4NIMA 3N74A 5JDCC 3O03A 3NT2A 4W9NC 3FRJA 4E32A 5F3RA 2EGGA 2QG4A 2SCUA 4FGWA 3ADOA 3TRIA 3I52A 4WLUA 3NUGA 2ZTLA 5DF1A 5I7EA 4B8ZA 1LRLA 4CV1A 2VOEA 3AW9A 3PYXA 1JW9B 1XU7A 1JVBA 2G82A 3GG9A 2QX7A 1RKXA 2YYYA 2WMDA 1R12A 4ZQEA 1UUFA 1JWAB 2YUTA 5CDUA 2GYYA 3L77A 1DFIA 4CQMD 3UH1A 3R3JA 3IS3A 2Q1UA 4MVJD 1MXHA 2DPGA 5DZSA 1NQAO 4BOYA 4UVDA 1JAYA 2EP5A 3GZ4A 4R3NA 3IKVA 1U7TA 3RIHA 2FWMX 3GN2A 1XQ1A 1I5RA 1I36A 3AY7A 1E1LA 2W98A 1ZVMA 1DC3A 1WAMA 3B1JA 3H6KA 4Y98A 1R0SA 3QA9A 1YS4A 3DXFA 3WQRA 3HADA 5JDIC 1VKNA 4XYGA 3JQEA 3NX4A 4C4OA 2V6BA 1HF3A 5DBFA 4DBZA 3EUWA 4II3A 3DBRB 4CLHA 3GVIA 3AM3A 4O0LA 3JQBC 2Y93A 3EK2A 5CEFA 3GZNB 2YV2A 3X2EA 1DLIA 2I3GA 3ASVA 5IFLA 4QO8A 4RORA 4A5OA 1EDOA 3K96A 5FI5A 4F6CA 1P0FA 3UXYA 2FSSA 3KSUA 2C2XA 2RH4A 4ALIA 2X22A 3FBGA 5G4KA 3GAZA 1CWUA 4DTIA 3WS7A 3IKTA 3WTCA 2ET6A 3E5RA 3INTA 1IULA 1LDGA 2PY6A 4MJLA 3V1UA 2PGLA 4TWRA 4EUHA 3B20A 3KLMX 1BVRA 2VYVA 3AWDA 2X5OA 5CHEA 1Y5RA 2PKQO 2DTXA 2ZK7A 3KEOA 4XGKA 1B7GO 2VYND 3I6IA 3OBBA 5A06A 3RD5A 1RPNA 4DQXA 2I65A 3PLNA 5C37A 1N1EA 3MJ4A 1XLTA 3G49A 1O94A 1ZMTA 2DFDA 1YXMA 3EHEA 3KVOA 4K1LA 1C3VA 1T4DA 4BUCA 5KCZA 1KEVA 3UUWA 3I83A 3NKLA 3UGKA 1UAGA 1WDMA 1IUKA 4IXWA 4OSOA 3DMTA 1HRDA 1W8DA 4XYEA 5C7IO 1JLLA 2YY7A 1E5LA 3PGXA 5A9TA 4QUKA 3AU8A 2H63A 4KWHA 5L51A 1LBEA 3U4HA 2Q2WA 1CIVA 3D0OA 3QP9A 4WLOA 1GUFA 1F12A 3INRA 2DVMA 1V6AA 2Q46A 3C8MA 4FPXA 1NTOA 4MINA 4WK6A 1QV6A 1NR7A 4RF2A 4YJGA 4B4UA 4WEQA 4NK4A 4BO5A 4GLLA 2VWPA 2JHGA 3S8MA 4HKTA 1L1FA 2ZTVA 5CFZA 3QWHA 2Y1GA 1F8GA 4II2A 5AVOA 3V2HA 1PS9A 5A04A 3MWEB 1T2EA 3DZIA 4GH5A 4XQCA 3DOOA 4JJGA 4N7RA 1A9YA 1ZXBA 3JQFC 1BXGB 3WSVA 3HG7A 4C7KA 4CV0A 3HJAA 3H9UA 4M8SA 1LQTA 1QG6A 3I4CA 2OBNA 4YT5A 5ENVA 2VWGA 4CL3A 4ALNA 5KKAA 1EQUA 4RVSA 5B1YA 1HZZA 3GMSA 5AOVA 4CUZA 5JW6A 1PJBA 2VHXA 1DRUA 3BHIA 3SJUA 2Y0DA 3QVXA 4CQLB 5T57A 4GSLA 3HN7A 4DLAA 1DXYA 1EBUA 2Y1FA 2PWZA 4BNLA 3KSDO 1JKIA 3F47A 2BELA 2VWHA 4IDDA 5ILGA 1ULSA 4YBZA 1P45A 2FPIA 1E7WA 3H5AA 3NDIA 4RO0A 2Y66A 4KDFA 3DMTC 1P1IA 4YT8A 1EVIA 3LT4A 4E5PA 1G6KA 3OM9A 5JO0A 3U4CA 1LRKA 2HK8A 3SC6A 3ZWVA 3P2OA 3WLEA 2FR8A 2DTEA 4PLGA 2X7HA 2HMUA 5BR7A 3GRKA 4DPMA 4A26A 1NWHA 5JYDA 4OQYA 1ZCJA 1Z6ZA 4N18A 5I7VA 1NPTO 4WCFC 1MFZA 2VHYA 1T2DA 2PKRA 4RVGA 5A9SA 2PD4A 1YH3A 2GNAA 1ISHA 2C59A 1LDEA 4XGNA 3I9KA 1UXHA 2AQHA 4BGIA 3C85A 4BNMA 3VPGA 1CJCA 4J0EA 1EVYA 3F46A 3GY0A 4W7IA 3RQSA 4DGSA 4XJSA 5JCXA 4TQGA 4CM9A 1PGQA 2EXXA 5TJHA 4HX5A 1AN9A 1I33A 1PL6A 3FR7A 4ZRMA 5TNXA 2PZKA 2TMDA 1NWCA 4EW6A 4CM7A 2WD8A 4TZKA 3SJ7A 3IMFA 3KHUA 1PGPA 4EEZA 4RPLA 5DCUA 1ZBQA 1O0SA 4NBWA 4XR4A 4FSHA 4J4HA 1PL7A 2BRUA 2B69A 3BZUA 4I9UA 1E3WA 1UXIA 4ND2A 3HZZA 3EC7A 4MVJI 1ONPA 3INGA 4P4NA 2Y1CA 2Y0EA 1H9BA 4E30A 2P2SA 1YDWA 1Z75A 1TXGA 4NU5A 1DRWA 3JQAB 4IY1A 3M2TA 1K5HA 4XQ9A 1ADCA 2C82A 4JN6B 2J8ZA 4HNHA 3RUAA 2ILTA 2G76A 1PWZA 1ARZA 1C1XB 3WYBA 4OXYA 1E6UA 1FDWA 1HLDA 1PJ3A 1Y1PA 3AM5A 3M1LA 5F1PA 4EI2A 2Q1WA 4N5LA 3FNGA 1IL0A 5EQDA 3W8FA 5I9MA 2NVUA 1Q7GA 3OJEA 1UDAA 3ANMA 1R15A 2DC1A 1NAHA 3O8QB 1Y8QB 3QSGA 1IY8A 1XU9A 4N5NA 3ZZNA 1PGJA 1RM5A 3MJVA 3PK0A 2OFPA 3LC1O 3D5TA 4TMFA 3DHNA 2QZZA 4Y6RA 3UOGA 4ONEA 4FC7A 1XIVA 1I2ZA 3FPCA 1ZK1A 5EN4A 4BMNA 4DA9A 2GPTA 3UAGA 3VTZA 1NHGA 5JSFA 1XSEA 4QO7A 5F5NA 2YQ4A 4ZRNA 8LDHA 5G0SA 3NYWA 2OUIA 4QFDA 2HJRA 2JJYA 4R9RA 3R1IA 3KTDA 1EK5A 3ZWBA 4YAGA 4JLWA 2NTVA 2I67A 3K9QO 2O3SA 4IJUA 3H7AA 1U7HA 4R9SA 2YHIB 2E49A 4Z3KA 5J23A 4PVCA 3C24A 1ZSNA 3ENKA 3IJPA 4I9HA 4Q3AA 1UZNA 1B3BA 4TRRA 3WBFA 1W6UA 3PJGA 2CVOA 3DOCA 3G1UA 4IZHA 4U5QA 4D43A 1A72A 1DAOA 2ZB8A 1I3LA 2YDXA 4FDAA 5A3JA 4DPLA 1ZEJA 4FFOA 4B3HA 4TSKA 3RUCA 4CLRA 1I3KA 5T67A 1N1GA 4L76A 2Q50A 2FSVA 3GUYA 5COQA 4AJKA 4PLWA 2VZ9A 4PG5A 4IQ0A 4JNKA 3WWZA 4KDEA 1E92A 1PGNA 4R5HA 5TF4A 4RVFA 2QYTA 4WLEA 4TVBA 4ZQHA 2GN9A 4GPD1 1JTVA 1JN0A 2I3AA 5JMPA 3VZPA 4O5OA 5LDHA 2J5KA 3ABIA 3W4IA 4ZGWA 5JC1A 1VE9A 1U8FO 5C7OO 4YJDA 1T1RA 3ZWCA 1WZEA 1O8CA 3SXPA 1A4IA 3F6YA 5B37A 3WGOA 3CTMA 3I9MA 4I8XA 4WOJA 3I23A 5CDSA 1R6DA 5HRUA 4MO2A 5B4UA 3HDJA 1Q0QA 3VVBA 3SLGA 2HLPA 5ES3A 2YDYA 3JYOA 5IXSA 1KY4A 1YOVB 2HMVA 1U2DA 2J5QA 1DJNA 1I3MA 1JKJA 1JDJA 4IDGA 5IDWA 4A0SA 4TVOA 3VHRA 3HB4X 3JYQA 3SEFA 3HFGA 3UVEA 4DIOA 1K6JA 1Z73A 4KUEA 4D0RA 1GQYA 3GMDA 1CDOA 5TGDA 4RCVA 4RQTA 2XOXA 4P4GA 1LDBA 1GTMA 3JCZA 2JFFA 4E2WA 1EUDA 1ADBA 3EZYA 4YJFB 3D3WA 4J9UE 3RAJA 1Y9EA 1HDZA 1I01A 3C1OA 2E82A 4BV8A 2NU8A 1H0KA 2B5WA 4IBOA 3DZBA 1EZ4A 1T26A 2J3HA 2VOJA 4R4JA 2EJWA 1E1MA 1EUCA 4I5FA 4BNWA 1SC6A 4PCVA 2VHZA 5A9RA 3CXRA 4R1SA 3GVHA 4YACA 5IG2A 1ZK4A 1YO6A 1Y8RA 3ZI0A 1M2WA 4MPDA 3PYLA 3G0OA 1T2CA 3MJCA 3AI2A 4TRJA 3SX2A 5CDTA 4BO9A 3LSYA 4NBRA 4WE3A 4IDEA 5HA5A 2PTGA 4MVJF 3WTBA 1SEPA 1KYQA 4PRLA 1B16A 3RBXA 4AJIA 2F1KA 5HM8A 4CMCA 5U4QA 5AXBA 3NTQA 1QXSA 1KBZA 3ONDA 5B4TA 3MJEA 1PJ2A 2I9PA 3IDSA 2YW9A 4NDNE 5T6BA 5HS4A 4FFRA 4L4XA 4O59O 4RZHA 2ZYGA 4GL4A 1IYZA 2PH3A 1KC1A 1D1SA 1UP4A 4CMJA 4HFJA 2I76A 4E33A 4IMPA 4MKZA 1P74A 4D3SA 1VL0A 1J6UA 1HYHA 2JCXA 2PK3A 1ZKMA 1YQXA 1VL6A 4GWKA 4R3WA 1EUZA 3VOSA 4LMPA 1R4NA 3FTNA 4B7UA 3LLVA 1UXJA 4ZHSA 2HAEA 1DIAA 4R51A 3T7EA 2BMAA 3A14A 3FNHA 4DREA 9LDTA 2AEMA 4GWGA 4BNVA 3W6ZA 1N7HA 3DONA 1MXFA 3X2FA 4R69A 2VUSA 1K3TA 2BGKA 3PJEA 1HE3A 2W2LD 1TVEA 4BNTA 1BTOA 4XYLA 3GR6A 2BLLA 3IAHA 4DBVO 3QIVA 3HWRA 3VAZA 3L4BA 3AK4A 4DUPA 1ZH8A 4CM9D 4FR5A 3PHHA 4PZEA 3H2SA 1Z45A 1KVSA 1C1DA 2GDZA 4Q9NA 1ZW1A 3BIOA 3MEQA 4HY3A 3UCXA 1RYEA 5DN9A 1G0NA 3NAQA 1DHRA 4MKRA 4PLFA 3H9GA 1E3EA 1DBVO 2O7QA 2Q4EA 5U9CA 2WEKA 1CQIA 4JK3A 4CMKA 1OI7A 1LEHA 4M86A 3TL2A 4YJHB 1LLQA 1PS0A 2NWQA 3EVTA 3S55A 4BQPA 3U5TA 5I7SA 3WDSA 1J4AA 3RBVA 3GPIA 4OKNA 4QQRA 2NU9A 4XGIA 3ETGA 3PYMA 3KEQA 2CD9A 3HSKA 2PA3A 4IS3A 3OFSA 4B7XA 3A06A 3DBHA 2AE2A 4H15A 1P1RA 2E37A 4RV9A 1UAYA 3DHYA 2IZZA 4XA8A 1BRMA 1Z7EA 4IDBA 4OXKA 2C54A 2Y1EA 1VC2A 3QHAA 5L3ZA 5TIIA 1H2BA 4TKLA 3GA0A 5CDYA 3PPIA 1GV0A 4YDRA 1BG6A 3JSAA 2WYWA 4L73A 4MVJE 4RVHA 2X86A 3HUDA 3IJRA 4ND5A 4WLFA 4ZVVA 4D42A 1PZFA 1D8AA 4R16A 5IJZA 2V65A 4FCCA 2Q4BA 4MIEA 1R4MA 2RBEA 4CM4A 1P31A 1GADO 4RPKA 4CLOA 3WG9A 5T8KC 4KMSA 4D45A 2CDBA 5G0VA 1TLTA 1Y81A 3GVCA 4CR7A 2QRJA 3VPHA 3S1LA 5F5LA 2NTJA 2C5EA 2DFVA 3Q1LA 4W82A 3DZJA 3RC2A 4HADA 5TRTA 3ON5A 4IQGA 5C3MA 4OM8A 4D41A 2QW8A 7MDHA 2HSDA 1ZEMA 3VH4A 2Y1OA 3GK3A 1E1KA 2WWRA 3O38A 2HRZA 2PD3A 2HDHA 3RWBA 3BMQB 4L8VA 3ZCXA 1LDMA 2CDAA 4RPHA 3HFSA 1DAPA 1XELA 5KOIA 1J49A 1XA0A 2Q2QA 3S2GA 3H5RA 2WYVA 3U0BA 2PZMA 2Z1NA 1X7DA 2A92A 3R6DA 3PQDA 2POQX 5EJ2A 4CLDA 4E5YA 3M6IA 2I5PO 2WTBA 4FJ2A 4EITA 3KM0A 4KQXA 4J91A 3TNLA 1LX6A 1SAYA 4DPKA 3Q2KA 1DC5A 2A4KA 1M76A 2X0IA 2XPCA 4FFNA 4RLHA 1HKUA 1NHWA 2P91A 3B1FA 4YCAA 4CLXA 4EYEA 5TC4A 4JBHA 5DULA 3W8EA 2ZYDA 4BB6A 1I0ZA 1JA9A 3MOGA 4WLVA 3U62A 3NDJA 4EJ6A 1PZEA 4LVUA 3CINA 1LC3A 5BSHA 4P4LA 1L7DA 1QSGA 4CMEA 1EVZA 3L6EA 1YQDA 3LT2A 4AJJA 5L40A 1FDSA 2IZ1A 4FFLA 4XX0A 3DBRA 1ENOA 3MWDB 1B8UA 1GCOA 2IZ0A 4ND4A 1E3IA 3JTMA 1CF2O 3G3EA 3GZNA 4DRYA 3BHMA 2P9GA 4S1VA 2BF7A 3IOYA 1NFRA 2Q45A 3BMNB 3FD8A 3HQ4O 4YEDA 4CR8A 1YONA 1SNYA 5A1TA 4XB1A 2W4QA 4UVGA 1PJTA 1RJWA 1JU9A 3P2YA 5U1PA 4FJ1A 4MVJM 4BO8A 1O89A 3D4PA 4EBFA 4GGPA
chains in the Genus database with same CATH superfamily
3GWZA 2HR1A 4C6TB 3ECSA 3U3ZA 4XDHA 4IPTA 1AKQA 3B6KA 3CEAA 4G4JA 4PC7A 4JXKA 4Q4DA 4UHHA 4JI0B 1ZCFA 1Z83A 3HVJA 2GERA 2PZEA 4Y0VA 4YHBA 3K70B 4YWJA 4EARA 5MHTA 1SCUA 3U9LA 3AKZA 3W7VA 5KVQA 2R6HA 4R9NA 1LLCA 2V7PA 1YTUA 1XPRA 3FPGA 3PNLA 1FDVA 2ZRBA 1NF9A 4X7RA 4UM9B 2B8WA 3AVYA 3H8VA 1GZ5A 2V45A 1DHTA 4O2AF 5JXIA 5CYOA 4MYDA 4W6QA 4HFRA 4J43A 4Q4AB 5A71A 1BE6A 2EJCA 4WOPA 4DOMA 1IMJA 4JL6A 4B33A 4EOGA 1E9BA 3OQOA 1RC8A 2PWAA 2ATVA 1E64A 3T1TA 1RR6A 1ZDMA 1M1UA 3V7FA 5D7NA 1BS9A 3PC8C 4ZCIA 2GARA 1UZAA 1Z6TA 4CUKA 1SZCA 4Z2YA 3TL6A 1I94B 4LXYA 4HXEB 2TSYB 4F9FA 4BCBA 1SBTA 5G4LA 3CGGA 4KYUA 3ETDA 4O4IF 2J7PA 3PNKA 2C7GA 1EXMA 4JCCA 3NI2A 1MRZA 1T5SA 5A3VA 1SPXA 2DETA 2FX5A 3AR6A 4HAYA 2Q4TA 1NPYA 2AFVA 3JYNA 3KQTA 4J1QA 1VIYA 4WINA 4JEHA 3RFVA 1UBEA 4NENB 2CVQA 3WB0A 1MTOA 1SBZA 1MB0A 2I22A 2WM2A 4G97A 5ILOA 2Q1SA 3O21A 3JD2A 3SZRA 4ZQBA 3HEMA 5IJ9A 4GC5A 4TT3A 3JZAA 1EK1A 2GFQA 2ZJ4A 4MWOA 5EGSA 5DNCA 1U4SA 2PMCA 5CLIA 1HT2E 2EC5A 1HYBA 1H9CA 1E7RA 5DSXA 4P54A 4ZOEA 3SKVA 2JI6A 3T35A 3PI7A 2P2LA 4J0KA 1KDTA 1Q15A 3CKKA 3ZOKA 1EE1A 1R50A 4WASA 1JDTA 4XQEA 3A6JA 3CF0A 4I19A 4P3KA 1U98A 2QMEA 3KC2A 1GRRA 4AYWA 3TGPA 4KAJA 1VLVA 1GPLA 1TM2A 4C05A 2B1RA 3E7WA 5MGNA 3K0CA 3T3PB 2QRLA 3MLBA 4JLUA 5AJHA 1ZUIA 4Q1FA 1QYWA 3BXHA 3CUEF 2UU9B 2GHIA 1TU4A 4UW9A 5J4LA 3SFVA 3K7EA 4J7XA 4KGDA 3PHIA 3EFEA 4MMXB 1XHEA 3HR7A 3HYLA 2CGEA 1KRXA 4TKUB 1RYMA 3NHLA 1YB7A 3TL3A 5TLSA 3KSAC 2QQFA 2QTGA 4D81A 3IAS1 1FJXA 1GZ7A 2J6BA 2BR5A 3N3BC 1UOQA 1SC3A 4KI0A 1SOVA 3TIXB 2XOKD 3CW9A 4HRXA 3PTLA 3BQ9A 4R6WA 5AKHA 2NPFA 4WJZA 2WU4A 2E21A 2EG5A 1HEUA 1FFSA 2J3LA 3QVOA 4JC4A 3NOOA 4BNXA 1IXRC 5DW3A 3T9CA 2N1BA 1GXSB 1KO7A 1K3FA 5MN4A 1XJQA 1WBJB 2A59A 1KI6A 3ESXA 1CFJA 3BFPA 2VNSA 1G20B 4WXMA 2XKAA 4GX5A 4UUNA 4BC1A 2PZJA 1N2BA 1ZY2A 4LX0A 2H5EA 2FP4A 1KZYC 3UMFA 4EEXA 1RZRD 4ESOA 3U7IA 5CVTA 2O0JA 4UOEA 3EGXB 1CJKC 2XAUA 3DEAA 4PG7A 4QT0A 4RSRA 4V0NA 4EUNA 3PQEA 4JQYA 3W1EA 3ZHOA 3F4BA 4RX1A 5JY1A 3S8YA 3BD9A 3LXXA 4NZ9A 3K92A 1N3LA 3G8CA 5J2UF 2GYVA 2Q5FA 5I9TA 1D4FA 3H0KA 2QG6A 5GY7A 5AVKA 1Z3CA 5HG0A 1BWSA 3DUFB 2ZJ2A 2H4ZA 5ALXA 1DX9A 4I2VA 3LUPA 4WL0A 3V4ZA 2PSHA 4I36A 3HCWA 3LMKA 4ZV9A 2WF9A 3PXEA 5AIBA 4EJ0A 3DQQA 2CJWB 1RFLA 2JIQA 2YJZA 1NVTA 1XZJA 3G2KA 3GCWA 4L3OA 1XLTC 2BGRA 3A1CA 4YI5A 1LLDA 1PG2A 4DLXA 3X1XA 1Q21A 2BFPA 4F8EA 1GG9A 3RKUA 1L8QA 1XCPA 5COAA 1ZP6A 5FH9A 1COWA 1LZKA 1I7NA 1QJ4A 2FRVA 4M7WA 3NTRA 3SP1A 1XYYA 1I8TA 3NO4A 2XI4A 4NP6A 4U6NA 1M67A 3W1VA 4ZKDA 1R8XA 5ERYA 5ALNA 1TMYA 3AU9A 2H1SA 1KP2A 5JS2A 1ISGA 4U0JA 1BKYA 4HN2A 4BBAA 5B3LA 4C2UA 1HZJA 1Y5NA 2PWBA 4O5AA 2Z3WA 3VDRA 2CNNA 4NJMB 4JQCA 2PNJA 4CG1A 1NVKA 5KKCA 3QE0A 5LQUA 1B76A 3K73O 2OCPA 5BXYA 4DV0B 1E59A 3E9EA 2ORIA 3MTGA 2Q5EA 3TLZA 2YQZA 4BNNA 5BWOA 1XMXA 2IV7A 1IOLA 4YONB 4UAGA 4WY5A 3IQWA 3K8ZA 1D7AA 2O7RA 3BS4A 4XYBA 5AFSA 1Q3KA 4P98A 2Q9BA 2XXAB 3PE4A 4F6LA 3CPJB 3SIXA 4DDUA 3BGVA 3GRPA 4K9QA 2CMFA 5KNCH 1FMTA 2DLNA 4QUAA 5SZIA 3JRXA 4OJQA 1U2QA 4NAHA 4KLCA 1SKAA 2ZAIA 4OJNA 1V4NA 5C35A 1JVNA 3KYCB 3N2KB 2OFFA 4WVLA 2VYQA 2I2DA 5EWLB 5E7IA 3SM3A 5AESA 5EQFA 1M8JA 4IG4A 2A1IA 4KX3A 1TTQB 4NCBA 3WI7A 4R41A 4DV1B 1HI9A 3HRHA 3E18A 5EPUA 3RVSA 4K9DA 1I5EA 1R9NA 4RCYA 1JLMA 2FZEA 1ST3A 1Y1KE 1SEVA 2ECFA 2V8OA 2VT3A 2Z83A 2QVZX 3A70A 5EUMA 2TECE 5AI6A 5TX7A 4Q9KA 3OX3A 5F2NA 2O8CA 1QRAA 3DUWA 4PYJA 4PLTA 5HDBB 1L5GB 3D8RA 2QQ5A 5BSFA 3ZHTA 1RC0A 2BL4A 1E61A 2B3TA 3EDCA 3TR6A 4B32A 2KBEA 4AUNA 4QEDA 1DQRA 1EJ2A 4RVUA 2WB2A 3CLUC 1ZHOA 2ZG6A 1M7HA 2FVYA 5BN5A 1Q7TA 2ZYHA 3DAGA 4PN7A 4Z2AA 1W4BA 1GA1A 1UT5A 3D4OA 4EUSA 2CE2X 1M2KA 4C0SA 4D9BA 3RVPA 5FBRB 3K5WA 1QBKC 2O57A 1WU8A 3CLSC 2IEDA 1F8FA 2D1FA 1YVDA 1LPPA 3L40A 1M6HA 2JJQA 3NHKA 4GE0A 4TOIA 3TQCA 2HRBA 3HBFA 1HL7A 3LUKA 2BP7A 1ORTA 3R6TA 2WUWE 3ZU6A 4QBIA 3WNDA 2JLXA 3A4YA 3GF4A 3A9CA 2NOAA 3VVLA 4DNOA 2ZBVA 3QKSA 3VUFA 2DBRA 3GFGA 1G9TA 8ATCA 1YR8A 4L16A 4EJFA 2I1QA 3ETJA 1KWKA 1MGOA 1A5TA 5GM1A 4BO1A 3GGGA 3GBVA 4RM2A 2E48A 1YNSA 2CYAA 4UAVA 4BEVA 2MWMA 2VF5X 4X1KB 3LQ4A 2Q4DA 4GMKA 7REQA 4Q24A 1KO8A 1PJAA 3C3KA 3DMRA 4ZVKA 5EEGA 2NM0A 1J1ZA 5DM2A 4Z4QA 3NAZA 1BE0A 2IP2A 3ELWA 2ZTMA 1LPMA 3ICPA 4MPTA 1P0CA 2B30A 4MW0A 3I9JA 5KNBH 1WZCA 2UYYA 4GD3Q 1JYFA 3G0DA 4NLLA 4GMGA 4NFSA 2H51A 5JNLA 4R8MA 3ME5A 2B1IA 1BS2A 1WULS 2W37A 1PKXA 3HKCB 4NCXA 4P0QB 4XGQA 16PKA 1M8PA 3MB8A 2RC6A 3OZVA 4HFNA 1PZHA 4A7PA 1Q0LA 2GO1A 2GBCA 1AGNA 1USIA 3GLIA 4WD3A 2AE1A 1KA9H 1YBHA 1NI3A 1A0OA 1TFUA 5HDQA 2GFIA 1TRKA 4JBGA 3UK7A 3WJAA 1IRXA 4UATA 1UPAA 5F76A 3ZCVA 4Z4IA 4HDNB 1YJQA 3M9XA 3UN1A 1MEEA 2QMQA 2XF8A 4MS4A 3G8BA 3ICCA 3NAGA 3V3KA 3NPMA 1S89A 4KQJA 3HI6A 2AB0A 1M0EA 1YB5A 4F97A 4ZO7A 3FCSB 1AZTA 1B93A 2DM6A 2PIAA 5DOZA 1DPGA 4FYMA 5FR1A 2D7CA 4ZEOA 1FRFS 2F64A 2ZSHA 1D9XA 4KR9A 2ETVA 2VK2A 1IK6A 3KG2A 3W05A 2B21A 1HEIA 4TRNA 3OCXA 3HKBB 3SIRA 3CLTC 5KYXA 4IUYA 1L3IA 4INAA 2NQ2C 2Y1WA 4ZVLA 4B40A 1X7WB 2GVZC 3STVA 2P77A 2NVUB 1K4MA 5D5PA 3DWEX 1IBLB 4EW1A 1CJSA 3VO2A 2VYVD 4KBFA 1D1QA 5IBCA 3RF6A 5C2JB 4PFJA 5BSUA 3NBQA 3RBZA 1EVKA 3VNQA 2IH5A 2WKRA 3T1OA 2J9FA 3IXLA 4R2WA 5AI5A 4JB3A 4LGYA 3AQ4A 4C43A 4D3ZA 4NCIA 1FQOA 4TGLA 3TCKA 1CUDA 1ZMRA 2HMYB 3ZDRA 5KTRA 3CVUA 3ZLVA 4DA4A 1QRSA 1E3LA 1LD3A 4UHJA 5GJVC 2V7VA 4B8WA 3EGCA 4M1WA 5FXMA 1L8LA 1ULAA 1A9ZA 4ZHQF 1GFSA 2YTZA 1MC5A 2OA0A 2N0SA 3ZHYA 4JQOA 4HLUA 3FHTA 2G8LA 5K3FA 1MN6A 1Z0IA 3BL5A 4F2HA 1OZ0A 2KM1A 4HK4A 1JLKA 2HTEA 3EXAA 4UE3S 1N3YA 1TZBA 3HDGA 1ZESA 4J4BA 4QXMA 4QJ5A 2UXBB 3KYBA 4NMMA 2JJ8A 3WMRA 1MFPA 1D5CA 1C0KA 4KIJA 1RHJA 4N76A 1F9AA 2OHGA 3DBLB 4MS1B 1QVRA 3HJUA 3QOWA 2CLMB 2LVBA 3IEMA 3BSSA 4EF6A 5HKBA 5LQDA 4TYMA 5JHGB 4DYDA 1KK3A 3Q1KA 5KTKA 2H8KA 4M0CA 1ZM7A 3W3ZB 2HV9A 2UZ1B 4G5HA 4GZ5A 4R9UC 4C7OB 2PVPA 4JI8B 1SUPA 2Q1TA 2EBWA 1TVCA 2FX2A 1G7CA 4MXDA 5C52B 2HDOA 5MDHA 4FM9A 3BCSA 4E12A 1IUNA 4BLQA 1J2RA 2WD7A 2JFGA 1CETA 3OEYA 5JFOA 4PX3A 1JL3A 2HK9A 4E3WA 4WDRA 4C5BA 5IX8A 5L6LB 3C3EA 3JWIA 1M0TA 5EZYF 1U3CA 3KXDA 2WOJA 6AT1A 2O8VA 5KOJA 4WKNA 2L2QA 1M75A 2BMWA 5C53B 4V39A 5FWYB 4RUKA 1NW6A 1AXEA 1MC4A 3BMCB 4Z4EA 4MUGA 2Z8ZA 3VA7A 3IMEA 5ENDA 1Y1TA 1C4OA 2Z98A 1U2SA 2O1EA 3AFGA 2WQ7A 2AZDA 4IGIA 3SVTA 2RHJA 3HCEA 1YK0A 1O54A 2G3YA 3AVOA 3NHSA 3RFTA 1S8OA 2PYDA 4DEVA 4TMWA 5EWMB 4C0QC 1I3CA 4X61A 4YMLA 2V7TA 4YPFA 3K09A 4ZYLA 1L7BA 4XJTA 5BV2P 1FJGB 1XZDA 2UZ3A 3ZQ4A 3JAWA 4DXHA 5JZMA 1IOWA 1VMKA 1T91A 2QENA 3QY9A 1E6KA 4X3PA 3VO9A 5BV8A 4X85A 1Z4OA 3C3MA 1T0IA 4K9KA 4S2EA 4IVRA 3PGMA 2PYIA 3N2YA 4W99A 1OTXA 3OY7A 3TM5A 3N6XA 5ICGA 4L3VA 1NN5A 5DNWA 5AXDA 5FR2A 1WBDA 3U37A 1NDHA 3GLVA 4BXOA 2BJWA 4TTQA 1UPCA 4YP7A 3FYHA 1U0GA 3CU5A 4AJEA 2IU6A 3FKJA 1E3MA 4JOCA 4EO7A 1ACMA 2EKQA 2IEBA 4PFSA 4Q0MA 5G0UA 3SBXA 2IXBA 1REQA 4INJA 4B4VA 4UBMA 3R9IA 2ZE5A 4MWBA 2NYUA 4D4MA 1OSNA 1M6NA 1Y3IA 3GT3A 2Q99A 3ORHA 4DM7A 2C98A 1SH7A 3CLVA 5AM2A 2IA5A 3ENNA 2QSUA 2GD2A 5I5GA 3D1JA 3H5NA 3LIIA 1BFDA 3BE4A 4QJ4A 3ZLTA 4H17A 1P4JA 1PJSA 2PO7A 1RJDA 4Y8VA 1DCMA 1QYXA 2PANA 3KT3A 1JKFA 1Y8CA 1FU4A 3QVSA 3W3AA 4A03A 3AVUA 1UOPA 3D3KA 3OD5A 1W85B 4IZIA 4NOLA 5LVAA 4B3XA 1MO4A 1JHYA 3V1LA 3F73A 1C3EA 3RANA 4Y3UA 1EQ2A 2XHEA 3DFUA 3R5FA 4KN6A 5F64A 2E3JA 2IYYA 5L3SA 1H0HA 1RLMA 1U1FA 2ZSKA 1ZK3A 3DPUA 3BEDA 4P32A 3VDQA 3SYRA 4D3DA 3OZIA 4X94A 1QIEA 2V6IA 3LTEA 3VR6A 5F2EA 3Q0EA 1M8GA 4RKQA 4I1IA 2PL1A 1RI1A 1OLUA 3RRMA 1Q84A 1QQ7A 5HUQA 5JSHA 2QJRA 4Y30A 4ZAVA 3QVGA 4RD2A 4TTJA 1WCWA 1XK6A 2AI3A 2ZCVA 3IAS6 5I7OA 2JFVA 4M36A 4M0FA 1Z62A 1N2JA 5H68A 4BGVA 3MRXA 5AW1A 2N47A 3J7TA 1W5FA 3KR0A 1KOJA 3A2LA 4WA8A 5AHKA 4DQ0A 2WKSA 5EL0A 2PYZA 4JXXA 3OF2A 1P62B 3AUKA 3QF4B 1I2MA 2QMOA 2YVAA 5DYTA 1DV2A 2ZDGA 3QMPA 3FBWA 4A5SA 3ZD6A 3W5CA 5FLEX 4CIDA 1ZM2A 3IOCA 3KWLA 3FJOA 1IZ9A 1IOZA 3T3NA 3K2EA 2G7MC 4TN5A 3GGCA 4KFUA 3ZXYA 2GJ8A 2IS2A 3OX4A 4YRZA 1M6VA 1QK4A 4RF4A 4WXPA 3CUVA 4Y2HA 5DWVA 1KI1A 2YXBA 3TOCA 4D8VA 3GGPA 3M6FA 1WPQA 3IT2A 3OEWA 4IMJB 4YC7A 3U0VA 2QQEA 4GZLA 4RANA 3RFFA 4D5EA 1W25A 2DBQA 1PNOA 3G9ZA 3MBKA 1PL8A 4ZYUA 4WZ6A 3NT5A 4MKGA 1EE9A 1DXHA 3QWAA 4M99A 3R3YA 2VDMB 3AR8A 3DL7A 3GJRA 3KU4A 4A92A 1KIFA 2CFCA 2B8NA 2W0SA 2XMRA 2EGHA 1ZD5A 4YAJA 2F4NA 3TLKA 1UBSB 1YHYA 3FPJA 3R8CA 4HGOA 1WXDA 4MROA 3T7RA 3OQMA 1ISSA 4BN5A 5J4YA 2JANA 2IT1A 3G68A 4HWOA 4II7A 4LY3A 1CEEA 3TUJC 1MQ8B 4O2LA 1TT7A 1XTQA 1AF7A 1H2EA 3RJTA 2O8DA 1BWQA 3Q5EA 1DVRA 3SBOA 1XXHE 4QOSA 3VX3A 1XR3A 2ZBDA 4GVPA 3VOAA 3RSGA 5ITWA 4ECEA 5JS1A 1B8VA 4OB7A 3ZR4B 4GR5A 1Q3HA 1E4VA 3TN7A 3BF7A 2G25A 1SVUA 1LBSA 3UATA 5KWEA 3P32A 3FKSD 4NNJA 1N8SA 1N4DA 3EIXA 4NRDA 1YQUA 4EHAA 1A3CA 3O74A 3QKTA 3KQNA 4Z5XA 4Q4HA 3PIIA 1H65A 2I66A 2HUPA 1HYEA 4HB0A 1CZKA 1RMTA 3IMGA 4RZQA 3BF8A 4UMEA 5HIKA 2HT6A 4XARA 4C0BA 3MWDA 2ZUEA 1T9GS 1H2HA 1X6VA 1ZUNB 4AUMA 4BFUA 3EIFA 1XTSA 3FVRA 3LDFA 4A4DA 1KI2A 1QLHA 3G85A 3ESZA 4QAQA 3AI3A 1MMFB 4AO7A 3EAQA 3BTVA 5EMKA 5FT9A 2EKBA 3NEPX 3AF1A 3O1IC 5MF6A 1PT8A 4FYHA 4L22A 2QZJA 5E6SB 3JW8A 2A9QA 3WBKA 1JHDA 1FRNA 1Z2DA 3W8NA 2PO5A 2QTFA 3D6FA 1TCBA 5JE8A 1Z2EA 4B75A 2FG6C 4WKGA 3RS2A 1T0PA 4U7TB 2R1ZA 3KLNA 3ZUGA 1DAMA 2WIDA 1RQXA 1NJGA 2NADA 2O6LA 2V74B 5KMGB 2MHCA 2AMVA 2GGSA 1FFBA 2PEYA 2PWYA 2ZB4A 4MUYA 1ZK0A 1NXSA 4H0CA 2Y77A 5D87A 3F6BX 2EHDA 1GM5A 1QH9A 4HF7A 3W5VA 2D3WA 1CB7A 1FDUA 4D8WA 3K05A 4BAZA 1L1EA 2XCUA 4F5ZA 4DV5B 1E7QA 4MP8A 2H59A 5DFAA 3GLHA 1BQ3A 2OYCA 1II8B 4IOJA 4V0SA 2ODEA 2P6MA 1AHPA 4N3CA 3TDKA 4GO1A 1Y8ZA 1VJTA 3RWOA 1W0JD 1RPAA 5FNVB 3QWBA 5K0ZA 1WNTA 5C1BA 1ID1A 3UC9A 1O5IA 1NUHA 1WXQA 4YMIA 5HVNA 4IH9A 1NAIA 2E4AA 3OIVA 4RMGA 4IQ4A 5KJEA 1CUIA 3LHIA 2E87A 4KN9S 3EEIA 3LTNC 2YR0A 3L9XA 3VOTA 5FEUA 1C5KA 1YB6A 2BHLA 3B36A 3GGSA 4U39A 1TTPB 5BV0A 1NT2A 3IB6A 3J81A 1HE4A 1VE3A 2XGSA 3FCYA 3I2GA 3M70A 4ROSA 4U9UA 4F3RA 5DEIA 4I50B 1SKUA 5IKOA 3NKVA 2GZ3A 4N9QA 4QYMA 2C61A 4ZVRA 4QUGA 1YB1A 4MQFB 1QKKA 1PIWA 4E30A 1JHRA 3L3BA 4LJKA 2DH5A 2F6RA 3UICA 3GYGA 4AW9A 4MP6A 4HLQB 3IUBA 2JDIA 4Q1EA 1QRDA 3ZZ1A 1ST2A 2AX4A 1XNRB 3PDIA 5DV9A 4LBZA 5E9WA 4GECA 2I71A 3GEEA 1B73A 3FNIA 2OMEA 4IH1A 1ZHHA 2NUTA 2W2VA 2DJIA 3OCWA 3KQWA 2XE6A 1WE2A 3G17A 4LE1A 4QUBA 5B64A 3DMNA 3SF0A 3ZK9A 2DG2A 4W4TA 5K99A 3WR5A 1T10A 1SCKA 2JLSA 4NKRA 4DBLE 4L85A 5JXHA 4DLBA 1NUQA 5H1YA 2NO0A 2WPDA 3MJHA 2IIVA 4EI8A 5H83A 1GTVA 3DTVA 5LBUA 4Y6PA 5ICSA 2Z56A 5JJCA 2X9LA 3WHIA 4KC0A 3PQ8A 3ILHA 1G2IA 1VKZA 2GA9A 4CODB 4EKIA 5I3CA 2I6UA 3SFZA 3JATA 2JK1A 3ZDEA 3SLRA 3WGQA 4KQ2A 2Q2VA 2B8JA 4JHLA 4UE2A 4URYR 2WFLA 2I8LA 1DBQA 2FU5C 4PYLA 1J9GA 3CLKA 1K6IA 2ZBGA 2ZSEA 1BE1A 2VHEA 3QNMA 3WYGA 3ZY3A 3JYPA 3DE6X 3TJZA 1OREA 1Y3BE 1LZLA 1KI3A 3H6GA 3C0KA 3LK7A 4P81A 2AEEA 4QARA 5ALGA 2HKIA 2CV2A 2CLFB 4J07A 1IQ0A 4UHFA 3PUXA 4GT1A 4O4IB 1VCMA 3CHYA 1GR1A 1WZNA 2QHXA 4JSRA 2JARA 5EZSA 2PBFA 2QN9A 3ZWMA 3GPDG 4L8FA 3GAMA 3OLQA 4HNAA 1GQQA 4KOEC 1OGJA 1U0HC 4ZP1A 4AJPA 4CG2A 4DQKA 3D4BA 4EVIA 2XE8A 4R2LA 5JCZA 1XXLA 3IOEA 3A4TA 4N0MA 4JA0A 2CWDA 4A8JB 2IEAA 3LDHA 2PN1A 3H17A 3PC3A 1WW3A 5FFFA 3RS8A 1Y3AA 3PDUA 3CH5A 2BMFA 2D3TA 2O14A 2RG1A 3H19A 3IH5A 1M0WA 4E14A 1ZD1A 1DDGA 1U11A 3GN1A 4LWPA 4D6XA 3D54D 1Z4JA 1ZRMA 3PA8A 4P36A 4ZYTA 3DLTA 1C4XA 4PYQA 1ADFA 2HSJA 1SXGA 5AHOA 1BWRA 4DCNA 1KK2A 4MQEB 3QRWA 2D7DA 2WMYA 4JOSA 2NG1A 2V97A 2XADA 4DSAA 4QE3A 4DL9A 4GR4A 4FHDA 3A0UA 1V7PC 3EAFA 3REGA 2HL6A 1JAXA 4EVQA 4FU0A 3ND6A 1EAMA 1KQGA 1PEAA 3PHJA 1P3DA 1QO9A 3LQKA 1SCDA 4CF3A 4KXLA 4B71A 2Z6QA 1EEXB 4MUJA 3VO1A 2F7SA 3QIAA 4HYQA 2VYCA 1E66A 2IZ5A 3HR4A 2VNAA 2BSQA 1ZH2A 4LBVA 3AO0B 3ABOB 3EOZA 4TYYA 2RGRA 3R2JA 5DGDA 3IV6A 1RFGE 2HF9A 3INNA 3LVBA 2QT9A 1OUMA 2XF2A 5DN6D 1L4GA 2SECE 2C95A 3ANYB 3M6VA 5LMNB 3UBTA 2IKQA 5FBHA 1Z4IA 5HMLA 2I1VB 1D7OA 5I48A 2YS6A 3H2JA 3TUZC 1AB6A 4IDPA 4JQSA 4PWYA 3ABZA 1IG3A 1YL7A 2CK3D 2RJ3A 1XVAA 5JO9A 3VZSA 4HB2A 1YBVA 2V6MA 621PA 5EPEA 2GEVA 4E22A 4GBED 4IYRA 3QI2A 1J00A 3FPBA 1EP9A 1U0SY 4YUZA 4LGVA 1T3SA 4NI5A 4MYCA 4FYWA 4WZAA 4Q1AA 3DFZA 5KNLA 2QVGA 3K9BA 4EUKA 4YJ3F 1PR0A 3UNXA 5I7WA 2OZLB 2Q5IA 1NXTA 1D0SA 3P2MA 3Q15C 2A33A 2BI7A 2QRZA 3NJ8A 4EG0A 1C9YA 4BVEA 4AI6A 5J2UB 3RH0A 1HT3A 1HWYA 4PIVA 1KEUA 3U4IA 3U39A 3AL3A 2VJPA 4RS4A 2VHCA 3BM5A 1KJNA 1JBQA 2GAIA 1ZQ1A 3TTXA 4QHSA 4AQ7A 1RHQA 3PIDA 4JC8A 2GD1O 5F33A 3OX2A 5HE9A 3VR5A 2B4RO 3HACA 2YMLA 3OICA 4MULA 4AULA 3BT7A 5JAZA 1P72A 4BB9A 4JS0A 1B0AA 1GCUA 5BWNA 2RH8A 2WNIA 3F5DA 2AWOA 1KE1A 4B6OA 2MR6A 1QH8B 3SM9A 4OX9B 5LYJB 3B6ZA 1ADJA 1O95C 3HJCA 1Z7GA 2VZ8A 4I8IA 4NE9A 3DBVO 5H81A 3RK4A 4PAOA 5IJ0A 3BWEA 4ER6A 4QPCA 2Q6IA 5FUYA 2J3KA 5JNUA 5KC9A 3NTOA 5I4BA 1C0EA 1LW6E 3CB4A 2ZVJA 521PA 4EG8A 2RHDA 2GAOA 3RYHA 5LP6A 2Z9BA 1BAPA 2PT5A 4C2BA 5LLSA 3WRYC 5JNVA 4FDMA 3SHOA 1I4OA 4H4CA 4UC0A 4LYEA 3Q5GA 4BMVA 1P7ZA 1T0UA 3CUUA 4N8EA 4IIYA 3SE0A 4B2PA 3WGJA 4DWVA 3GJQA 3H2HA 3OQHA 1KQ3A 4RD6A 2R6AA 2LIPA 3VC3A 2IRWA 4L5AA 1A8QA 2I1LA 3UJ8A 2OHJA 1GV1A 3K0EA 4K9OA 1W47A 2JBWA 4JBLA 1QHHA 3WO1A 2Q5CA 1O9BA 4FOOA 3B9PA 3GUCA 1UQTA 4EKNB 2W2KA 4TV8A 1JPVA 4X54A 4B6EA 4ABYA 2IS4A 9MHTA 2KX7A 1UJ4A 2DPXA 1G3RA 1XF9A 1QOPB 4US0R 4NXNB 1RJEA 3MG9A 2FPIB 3S2YA 1W5BA 2ZANA 3VU8A 3WL3A 1V1MB 5LQAA 3KVYA 1VIVA 3GQBB 4H6PA 4NBSA 3QUTA 4JHXA 1AE1A 1ID8A 2PRJA 5K8UA 4HVCA 2PVSA 1Z5WA 3M4XA 1P2SA 3JQ9C 1KS2A 1DXOA 1OD6A 3BDIA 2VJAA 2Z8XA 4DCCA 3CRRA 3ESBA 3GRRA 4DMLA 3ZCUA 5KC8A 2PX2A 2ACKA 4KMOA 5KREA 1QH1A 2V3VA 3B7GA 3FM9A 5DYYA 2UAGA 2Z95A 3CZCA 2CDRA 4GOOD 4BX0A 1C0IA 4MW1A 3B1YA 1UPUA 1QHGA 1TX4B 2I54A 1ZNQO 1BEEA 1VG9B 2ADOA 3N2EA 5D6NA 1NW5A 3W4KA 4YUWA 1B0ZA 1TT5A 3VR2A 1AMOA 4ZVMA 3G79A 1UOOA 3RF7A 2DUJA 2FEOA 3GC6A 3N2NA 3HKEA 2RDMA 2XB8A 3OZTA 4MR8A 2C3OA 2YHUA 2WTAA 1RRGA 4PCUA 1FOEB 5I45A 4OHRA 2GKGA 1ZJYA 2C9ZA 2ZT5A 4OQZA 2IOQA 3LLCA 3E22B 5A05A 2YFKA 2AUTA 2B1JA 3GQVA 2PSEA 4ENSA 4QELA 1T8SA 3MOSA 1UFKA 1Z36A 3EVBA 2XQIA 3O83A 4RZXA 5CX1A 1L7EA 2W6NA 4UVEA 4IVNA 1WU7A 2H6EA 1J0BA 3ZVLA 4FMDB 2CL5A 1E2MA 2VQ3A 3QVWA 1RRCA 3GB9A 3GVXA 1LBHA 1T34A 3WK6A 1GUZA 3BTOA 1AQJA 4EPVA 1SQSA 3EEFA 1OIVA 1FS4A 3T95A 1QK3A 2R6R1 4YRRA 1DB3A 1QTRA 3GT7A 4I14A 3TX6A 1O57A 3HMQA 1MOZA 5EIOA 1S02A 2Z2YA 4ZIRB 2Z08A 3H0EA 5HRCA 1PT7A 1SA0A 1X0VA 1CDZA 1DO0A 4BJ5A 1DX4A 4JZKA 2O05A 2CVHA 4B2LA 1H4QA 5A62A 5ESXA 3MBOA 4L08A 1GN8A 3T52A 5DMXA 1RW4A 3B1ZA 4PSDA 4D8UA 5KNCD 1QOZA 2ECOA 2WWHA 3JQ6A 4W6ZA 3KT0A 2OHXA 4FBGA 1PSDA 3F74A 4TXLA 2UXDB 4XFKA 4HAOA 3GUZA 1AKUA 1B26A 2ZJ0A 1V1JA 4DYVA 5AJTA 4E1VA 4D9HA 1Q7BA 5ALVA 4UVHA 3E48A 1GKYA 3BYZA 4M22A 3HCOA 4D46A 3K1ZA 4NZOA 4YJKA 5HFNA 3GELA 1W4ZA 2QJOA 4J3JA 3FSRA 1D2NA 1WD5A 3OMWA 1XMJA 1C2YA 1O5TA 1QLWA 1ZK2A 3AHIA 4GPEA 5KHAA 1KPGA 4G1EB 5KYUB 3FE2A 2BFEB 3IEIA 1U8AA 2YXNA 4F5WA 4X8MA 4Y2RA 1IVNA 4Q3LA 1HLGA 1YULA 1OIXA 1DJQA 3FGZA 3ZNOA 4QTYA 2ZKLA 3E84A 3VKUA 4A73A 3VU0A 2VA8A 3FFWA 3TQQA 4X65B 1CVLA 3KZCA 3JQGA 5KB3A 2P67A 2GQ0A 4LEIA 5JSKA 4A27A 1PD1A 5CA1F 4BPBA 2QNIA 3FZQA 2X5JO 5DXJA 2F8LA 2I78A 3W5JA 1WHTB 4DLRA 3II6X 1BZYA 1OXMA 2C5LA 2HGZA 3OFKA 2H7YA 3P5SA 1V35A 6LDHA 1ELOA 5FLYA 1N2HA 4BVFA 5L95A 3KB1A 1I1OA 3QW2A 1BH2A 3SR4A 4RBNA 3RAGA 4AF8A 2IYVA 2IU0A 2P0AA 3LX8A 4C76A 3F7NA 4UUMA 2YYZA 3EQ2A 4WT7A 4CG0A 4DXAA 5ISMA 3CJTA 1RHUA 2A0YA 4BNZA 1WCXA 1AN0A 3CISA 4L8GA 4A6EA 3OU6A 4JWTA 4LJSA 5FA8A 3L8ZA 2WNSA 4ZOBA 3VKHA 4MYSA 3E05A 1IONA 3KPVA 1YOBA 2JJ1D 2YZGA 1Z25A 4KTTE 2H7VA 1W8IA 5A6SA 1MO3A 3CONA 2DFLA 2LP4Y 4GI2A 4CIYA 1U2GA 4PNPA 4Q1CA 1I51A 4QBTA 3WOHA 4GYJA 4HNTA 3S2UA 3DMDA 5LSAA 4Z0HO 4PS0A 3LC2O 1NYLA 4GQBA 1D2CA 4RVOA 4TYPA 5M3BA 4N5MA 4A1FA 3ZXUB 4DWJA 1AG9A 2QL7A 3E7PA 1VRCA 2WU3A 2XECA 1MD9A 4KEAA 4AUEA 1ECGA 3U4DA 3GBPA 3Q7TA 2P3SA 5T5QA 4YQZA 3AI7A 3IESA 4WECA 1AUQA 2ONKA 1VXOA 1WSDA 3KOXA 3B70A 5KQLA 1XKTA 3RM3A 1IU9A 2C07A 2HLNA 2WKQA 1ABEA 4OIFA 3OZWA 5KNBD 1UKAA 4RK5A 3OWHA 1HOXA 3ICEA 5AKGA 2TMGA 5DCWA 2H7XA 2P90A 2Q0XA 4YP9A 3SDBA 4AECA 3CPSA 1YQWA 1M1XB 3N5CA 3OT5A 1ZN2A 2D2EA 3EXHA 2WG0A 2FEKA 1M5TA 1MIOB 2YWEA 4D26A 5BRJA 4K6OA 4F8JA 4OA8A 3EQ7A 4QDZA 1J5XA 4HNUA 1CX9B 2ZSUA 3TS1A 4YLEA 2GUWA 1H93A 1H94A 3BSWA 3KJGA 2FY8A 3MT0A 3U3DA 2VJBA 4EW3A 5LLTA 4D80A 2AG5A 1V37A 3F6SA 2Z58A 2EW8A 3VKWA 1GNRA 3H11A 2P68A 2WSIA 5IW8A 5DM4A 2VDQB 5EZYB 1BCSB 2AFIA 1NX6A 2J46A 3HXKA 4L8LA 2ZB3A 4MV9A 3UT0A 4AAYA 1PFGA 2Q49A 3TIVA 3K2BA 4OXNA 2H1OA 1WM1A 4BKPA 5L3VA 3D6TB 3NM4A 1W1UA 3L0YA 4X8LA 2WSBA 4KQWA 3EASA 3TDNA 3MELA 4F46A 4N65A 4ETIA 1AUXA 1KDOA 3O92A 2HN9A 4F45A 3SCZA 4KI7A 2V7QA 2JIBA 2OCIA 3VSAA 1YZYA 1LNQA 4OSEA 1ONBA 3ZS8A 2CSUA 4KKXB 4G9BA 4KXWA 4LRWA 4YFVA 5EP4A 3TJMA 4B44A 3F6PA 4MUHA 1YIAA 1FFXB 1TF7A 4UHDA 1RM4A 3PSAA 1YA4A 3GLGB 2CCJA 2HFJA 1E79D 2WSSD 3CRNA 1YZVA 1NZFA 4RK0A 1SC9A 4TSRA 1FNMA 4QSHA 8ADHA 1RLIA 1V5EA 1AUVA 1MAWA 3WRXC 3X1WA 4UE6A 4P8RA 4FVTA 3HBMA 1JTEA 2GM3A 4BBPA 1YGYA 3CX8A 3HWSA 5FBLB 4CKCA 3UFBA 1K08A 1NONA 1LDNA 2P4HX 4OIMA 1OBOA 3PV0A 5E2IA 1JALA 2ZE7A 3ZWPA 5BVGB 3Q8MA 3KJXA 1GGNA 1MRNA 1VPVA 2BUBA 3CSDA 3JVVA 4QUIA 3U17A 1WXGA 5TGTA 4D3FA 4RTPA 3RGWS 4GXQA 5FOXA 5KU1A 4IX1A 4RQAA 2OD2A 2BFBA 2VT6A 2WVJA 1Y8RB 3HB9A 1JEYA 1XLWA 3OT1A 3C3YA 4IDAA 1GZVA 4UEQA 2H0QA 4TWZA 1VM6A 2ZJYA 3PCXA 3MMPA 4MB2A 4FE4A 4WBSA 3LI2A 4L9AA 3FOEC 1QE0A 1NYQA 4EJ2A 2C97A 4AP9A 1U8XX 1XK7A 2YNMD 3C7DB 1QIFA 5T8KA 3FZEA 1FW8A 1XD9A 1LBTA 2C4NA 4CTOA 5C4MA 5K8IA 1N9GA 1PZMA 5BOSB 2Z43A 1UANA 5G0WA 4HBGA 2FKNA 4DCUA 2VCYA 3QPVA 2PFSA 2VDPB 1EDBA 3FTPA 1U31A 2XE7A 4BHTA 2XQJA 3OQIA 2HWXA 4Q4LA 4X66B 2PPVA 2CYCA 1TYBE 4LZOA 1C29B 2XVAA 4XOIA 2P6RA 1SU6A 3PFGA 1EWVA 1RXSA 2QG9A 3UXMA 5BN3B 4RJIA 3GJ4A 5JCJD 1EJ6A 1RWQA 2LV8A 3G59A 3NVMB 4DR2B 4K9MA 3RWMB 5IVHA 5KYKA 2I6QA 1W4RA 2J67A 4OYLA 3LWZA 3MGBA 4PYKA 1M6EX 3S28A 3HHEA 1Y5MA 3R5XA 3ZN2A 5BP7A 1SXJB 2VQDA 1KO4A 3RC8A 1Y7IA 4I4CA 2UZ0A 5FP0A 2XKJE 4QWWA 1MNQA 3IIJA 4BEWA 1V48A 3EXEA 1X13A 5L45A 3VMMA 1WQ3A 1EIWA 1MW9X 4F4JA 5CFLA 2IIPA 4OI1A 5H3HA 4CM6A 3GFTA 4CTJA 2W6CX 3ROEA 2H54A 3F4LA 3QEOA 4L6CA 4JI4B 4NOKA 2QEQA 4JB2A 3BWMA 4R54A 1PG5A 4CMIA 1PVOA 2WWTA 2XHZA 1P77A 2QTLA 1JQ5A 3Q9SA 3S68A 1U0LA 4QSMA 5C31A 2W8BA 1XHLA 5FPTA 2EGUA 4V0RA 4HMQA 1TL7C 2NP7A 2FWIA 4HNVA 1BYUA 4IKOA 4EUFA 1OZHA 2IOYA 2V7XA 1W4AA 3K0AA 3NXSA 4FNAA 4FFWA 4TYQA 3A2MA 4UTZA 5JATA 4NPCA 1V5WA 1IPHA 1DEHA 2I80A 4UBIA 1K98A 2Z2KA 2ZQYA 1C1DB 4EL0A 5F98A 3DP9A 4OQPA 3OUTA 2R0QC 3KLPX 1WDKA 3CN7A 3LRXA 2F9LA 2HMTA 2JLRA 3EPHA 3C3XA 5D5QA 4W9NA 1JQEA 2W9XA 3EFBA 1CB0A 1X7XA 3K0FB 4BATA 2BEVB 4PZCA 4YI3A 3ITKA 2P5UA 4NR0A 1N7GA 2OQ2A 3R7WB 4P3YA 5KYYA 4JR2A 4KO8A 4EECA 3ASZA 3GCGA 3U16A 1T2UA 1HDYA 4F2DA 1OFUX 1UJNA 2WHRA 2C04A 3KELA 2GZ2A 4C5CA 3VR0A 3KJEA 1A8HA 4Y2UA 1HLPA 4P3NA 4KWTA 4R83A 3ZHZA 2HIHA 1Z22A 2PQ2A 5LBIA 1U2EA 3W8DA 4BC0A 4YT4A 9LDBA 3ZE1B 2B7BA 4ILEA 3GRAA 4EJMA 1IM8A 2Y0BA 4ZMSA 1EBBA 3ZHSA 5JXJA 1E2HA 1UKYA 2OOSA 1O6GA 3KQSA 3C1AA 2GD6A 3FYUC 4I3GA 2HWWA 1ZGJA 4OAPA 2R97A 3SF8B 5KQMA 1OWPA 1PW5A 2Q0HA 4EMBA 5HQ3B 2JZNA 3SFTA 2CHEA 4BIIA 3GRYA 4M89A 4LW8A 1DIGA 2VTKA 3UKOA 1GGFA 1X80A 1DV1A 2ZAYA 1NNUA 4KVAA 2PLNA 1GDHA 3GJSA 4F0JA 4PAWA 1R4MB 1JFTA 1G5IA 1EVQA 3CT6A 1KI9A 4AZ3A 3B1VA 4GGOA 3IKMB 4BE7B 1TEXA 4J2HA 5JAMA 1IJFA 1KMQA 3QJGA 4UNRA 2QSZA 2A0WA 2ZUDA 1M6WA 1D2EA 1L7MA 1NN3A 4RETA 1GYRA 3HH8A 2D5CA 2YN4A 3I6QA