5EL0A

Crystal structure of an oxidoreductase (short chain dehydrogenase/reductase family) from brucella ovis in complex with a partially ordered nad
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
239
structure length
223
Chain Sequence
b'ERKTLVLTGASRGIGHATVKRFSLAGWRVITCSRQDFSENCPWPAGPEDHIKVDLSDPEDIGKAIAEIRRRLEANGSKLHALVNNAGISPKAEGGRRMNSIETPMAVWRDVFQVNFMAPIMLARGLFKELEAAQGSVVNVTSIAGSRVHPFAGTAYATSKAALAALTREMASDFGPYGIRVNAIAPGEIDTAILGKTSEVAETIYFLCTETSSYVTGSEIHIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxidoreductase, short chain dehydrogenase/reductase family
molecule tags Oxidoreductase
source organism Brucella ovis (strain atcc 25840 / 63/290 / nctc 10512)
publication title Crystal structure of an Oxidoreductase (short chain dehydrogenase/reductase family) from Brucella ovis in complex with a partially ordered NAD
rcsb
total genus 79
structure length 223
sequence length 239
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5el0A00
4ND2A 4WNIA 3LU1A 2IEBA 2W4QA 3TZQA 1G6KA 1YDEA 4WASA 3WGYA 4R51A 4B7UA 4EJ6A 4RVDA 1KC3A 5EJ2A 2D5AA 3H6KA 4GAEA 4AJNA 2VYNA 1PS8A 2C7GA 4AJJA 4BS9A 1ONNA 5G0SA 4QFDA 2CUKA 3PQDA 4CR6A 2B69A 1PJLA 3CINA 2PTGA 3AOEC 3L77A 4DXHA 1F8GA 3UCEA 3K73O 2WSBA 2YFQA 4EEXA 1ULSA 5DCUA 5EN4A 2DTXA 2YW9A 1DC6A 1GPJA 2AEJA 2HAEA 5T5QA 3JQ7A 3NDIA 1M76A 4B8WA 3ZWWA 3OEWA 4NNJA 2VRCD 1RM0A 3FPCA 2EGGA 2IODA 1B8PA 1XU9A 1PGQA 2FZWA 3LC1O 4M87A 5JFOA 5HRUA 1X7GA 4UVIA 1YOVA 4UVHA 3S2FA 4BHTA 4DYVA 2V6BA 4DLBA 4FPXA 2QW8A 4DIOA 1LDNA 1GR0A 3L9WA 3O9ZA 3T4EA 3LT2A 1CJCA 4E4YA 3MOIA 5JNLA 1NM5A 4RVHA 4C7JA 3RI3A 4ZQBA 3D4PA 5JW6A 2IXBA 2NUAA 1ZO8A 1EVZA 5FI3A 1ZSNA 1QXSA 1RWBA 4XEHA 1YQXA 4Q3DA 8ADHA 2BHLA 4U6QA 3C7AA 2ZB3A 5A02A 4YJHB 2O4UX 3OEYA 5TRTA 5L4LA 4TMFA 3EC7A 2I5PO 4RVFA 4XGKA 5KJCA 3BTUA 5KVQA 3CKYA 3NT2A 3PEFA 3T7EA 3D5TA 2VWHA 3PJEA 4O5OA 4QSMA 4YT8A 5G4LA 3QRWA 4KTVE 4HNGA 1T25A 4DRYA 4ZQFA 1Z73A 2ZKLA 1R0LA 4A26A 4IINA 4PLCA 4EUHA 4PCVA 3AUSA 1KIFA 2O7SA 1U4OA 4CMJA 4J49A 3Q3CA 3TZCA 1R6DA 3JYQA 2FPIA 4Z0TA 4F6CA 1SB9A 1YBAA 1H2BA 2AE2A 2HJRA 5B1YA 4GGOA 1XELA 4HBGA 3UICA 3GHHA 4Z9XA 1Z75A 3IQDB 3KYCA 4GBJA 4M86A 4GSKA 3U09A 1T2EA 3D64A 4CMCA 1QYVA 3D5QA 3GG2A 1Q0QA 1YQGA 4CV0A 4QXMA 4AJ1A 4DLAA 4BNNA 2DBRA 4UEOA 1ISGA 2PFGA 1LJ8A 1PIWA 2QG4A 4RCVA 3FSRA 4FS3A 1N7GA 4MPDA 3VH4A 4ALJA 3IUSA 3PFWO 4WEQA 4J0FA 2I6TA 3HB4X 3QVOA 1K0UA 1E1NA 3H7AA 1UJMA 3PK0A 1DFHA 2IZ0A 3QWIA 1WAMA 4YVFA 2Q99A 3D3WB 1JWAB 2GNAA 4NU6A 5KTKA 3PWKA 4G2NA 4URFA 1YWGO 4HWKA 5GZ3A 3DC2A 2D59A 3STHA 4EJMA 1QRRA 4LSWA 5LDHA 1N5DA 4OOEA 5J23A 1N1EA 4M54A 3DOCA 3OECA 2Z1MA 2FHSA 4RPJA 4AJPA 3WGOA 5BSHA 1E0DA 1FJHA 4RF3A 4E2ZA 4R1TA 5LC1A 3WTCA 3DZBA 2PV7A 4WLNA 4IDDA 3CMMA 3W8DA 1KOLA 4FGSA 5HS6A 5B37A 1HDGO 3L6OO 3FCOA 3QHAA 5EPOA 2TMGA 3ZNPA 5F21A 1H9AA 4WECA 2OXIA 3U0BA 4GWKA 4N18A 1HEUA 2PGDA 1Y8QA 2I67A 1SO8A 5CP8A 1T26A 5HA5A 3Q6IA 3ZV6A 5A9SA 4DQVA 1P0FA 4BMVA 4XX0A 5L45A 1RYEA 3L0DA 1EK6A 4Z3KA 2VUTA 1BDBA 4ZRMA 4BO1A 4OL9A 4DQXA 2WD7B 3GOHA 5TNXA 1EUDA 1ZXBA 3VDRA 4BUCA 1M2WA 3B1JA 3SEFA 1GZ6A 4NK5A 3FNGA 4W99A 5DOVA 2QX7A 4MINA 1K5HA 2X5OA 3ZWYA 4D0SA 1V3UA 1H94A 3F1LA 1U28A 4FOSA 4YAGA 3BMQB 3EMKA 1M6WA 3H2ZA 1OC2A 4TROA 2IYOA 3ZWPA 4MKZA 4IDGA 3R0IA 2YHIA 3K2BA 5JPIA 3TPCA 3JQ6A 3P2OA 4PG7A 4W9NC 4AJLA 4XYMA 1GZ3A 1C0KA 2HJSA 1QP8A 3TWOA 4S3MA 1E92A 2JD0A 2H9IA 2JHGA 2B5WA 4LMPA 4OSOA 5COQA 4BQRA 5L40A 4TKMA 4DPKA 1DFGA 3AUTA 4GGPA 1ORRA 2DU8A 1CIVA 3E9MA 1YL7A 2DBVO 5BSGA 3QA9A 2BELA 3MJSA 2JFHA 3D4OA 2I65A 4CM8A 4BNFA 2J3IA 3ZWBA 5TIIA 1WDLA 1WPQA 3ZN2A 3GY0A 2WE7A 3KUXA 4B8ZA 4YQZA 4BKOA 3OH8A 2VWQA 4R1SA 3FD8A 4CUZA 2NVUA 1JLLA 5JAIA 4I8XA 5BSFA 1SOVA 2E37A 2VWGA 4KZPA 1H6CA 1CETA 2CD9A 3H5AA 3BXXA 2GZ3A 1UAYA 2PZJA 1NR1A 5CDUA 1MLDA 2D4AA 3K30A 1JU9A 4BO5A 4UUOA 1K6JA 3ZWXA 4DC0A 4Z6KA 4F46A 2Q4EA 1LEHA 3JQEA 3DBRA 4J1QA 3SLGA 2RH4A 4XIJA 4BNHA 4UEKA 3ZGYA 2QYTA 5A4DA 5EL0A 2WYVA 1P74A 3EW7A 4NJOA 4U6SA 4MKRA 3R3SA 4ZD6A 1YO6A 2Y99A 4G81A 1DRWA 1B8UA 2I9PA 1P1IA 4IMPA 3K9QO 3PZBA 4BNUA 4DYDA 4GL4A 1GU7A 1CERA 4NPCA 4LK3A 1Z82A 3G79A 1NHWA 4RPHA 4FW8A 4MVJP 3SLKA 4WGGA 5IZCC 3AI2A 3C1TA 3IS3A 3INTA 2PD6A 1R0KA 3INGA 2ZJ0A 1R37A 3GZNB 1QMGA 1VJ1A 4OMUA 5THQA 4Z0HO 4M8SA 1P1HA 3WGIA 2X1HA 4TKLA 4E2XA 2HMTA 1DAPA 1SMKA 3JSAA 1O94A 1ZFNA 5K6AA 4FR5A 4BMSA 3IOYA 1T1RA 2GLXA 4XYBA 1V6AA 1KBZA 2GSDA 2CVZA 4PLHA 1W8DA 1UH5A 1GTMA 3WGZA 2Q2VA 1UZNA 4E12A 3WGQA 1E1KA 2HMWA 1XA0A 1BGVA 1DHRA 1HT0A 2NTVA 2XOXA 3PWSA 3ZWMA 1VL8A 1M67A 4JBHA 1BW9A 1KEWA 2C59A 2EWMA 3CMCO 3JD1A 1HF3A 1SNYA 2GUGA 3DHEA 2P9EA 3OSUA 1P1RA 4ZA2A 5MDHA 5G4KA 3OF2A 1VRWA 3B6ZA 4YJHA 2Z5LA 3TQHA 4DMLA 2BGLA 4AJKA 4D3FA 3H5RA 4NDNE 5JMWA 1UP6A 5TGDA 1PJ2A 3ANNA 1J0XO 3W8FA 3I9OA 3JQFA 3AI1A 1TI7A 1WDMA 2R00A 3HDQA 1CWUA 4P38A 2OMEA 2HRBA 5L3ZA 1P1KA 1AXEA 4PVCA 3VZRA 4XB2A 2POQX 4X54A 4YXFA 3RC2A 4DLLA 4YAJA 5DZSA 5G0UA 3L6DA 4YAKA 1M66A 1IULA 3JQGB 1LRKA 4P22A 1X1TA 1LRJA 1DRUA 1Z45A 3JV7A 4UULA 4CMIA 2JCVA 4L8VA 5DT9A 2RH8A 3JQBC 4R5HA 3MTJA 1DO8A 4GX5A 3I5MA 4HX5A 4NBVA 4JX8A 2AA3A 4WNCA 5I8ZA 1W0CA 4UEJA 4DPLA 2JD1A 5KVSA 5H82A 3RASA 1E1MA 2G5CA 3CPSA 5JY1A 3I52A 4TRNA 5A9RA 3T7CA 5JCXA 3ANLA 3HN2A 3IUPA 4CM4A 3WGGA 1PL7A 4I5DA 1BHSA 3I9NA 2UV8A 4JJIA 1EUCA 2Q4BA 4JP2A 1AN9A 3MTGA 3LSYA 3WWZA 1DXYA 4BO2A 3ROMA 3GUCA 4RO0A 4J1TA 4CLEA 2ZTMA 2OO5A 1CQIA 3N74A 1DHTA 3MWDB 3F4BA 1K3TA 4ND1A 1TT7A 4JCOA 1PQPA 3GFBA 5H81A 5JE8A 2C5EA 1SBYA 3GRPA 4IMRA 1PR9A 2EKLA 4J4TA 4L76A 1KYQA 4JK3A 2UVDA 3E5MA 2GERA 2GGSA 4BKQA 4A2CA 1N2SA 1YL6A 3MCVA 1QLHA 1UP4A 1Z6ZA 2GN9A 4R1UA 2EF1A 4BGEA 4N5NA 4PG4A 4XCVA 2BKAA 1CQJA 2PZMA 1QYXA 2B4TO 1EE9A 1R4NA 4WCDA 3TNLA 2WTBA 5U1PA 1C0LA 4BB6A 5EQFA 4EDFA 2HQ1A 2O2SA 3RUCA 3DBRB 3ONDA 1BRMA 2Y1FA 4PVDA 3CZMA 1QR6A 3QWFA 3ULKA 4Y9DA 3KRTA 1N1GA 3UCFA 1NPYA 1D3AA 3GMDA 1LRLA 1QKIA 4TWRA 5JDIC 4LN1A 2J3JA 3EHEA 4IS3A 1I2BA 2JD2A 4L4XA 4CMKA 3RWBA 3JQ8B 2QZ9A 3DZJA 3GVCA 4BNIA 1TVEA 2WD7A 4O6VA 5H83A 4PGFA 3I23A 3ZU4A 4DUPA 2C07A 2V7PA 4MP6A 3RAJA 1WLYA 3I6QA 4MJLA 2ZCVA 3WSVA 3RJ5A 3KBOA 3EZYA 4GLLA 4KDEA 1GFSA 1GYPA 3LQFA 4KMSA 3WGTA 4BNZA 2NQ8A 2FSVA 2FR0A 2VTEA 3H4VA 2W98A 2W2KB 1ZW1A 4AICA 3COSA 3DXFA 2B4RO 1OMOA 1QV6A 4TRRA 5DCWA 1OC4A 3ZU2A 3DZHA 3W6ZA 1E7SA 1PS0A 3HUDA 3M2PA 3HDHA 2WDZA 2AQKA 3S2IA 4HV4A 5F1KA 3ZHBA 2FRDA 3E48A 3LC7O 3N58A 1TEHA 4R01A 2I76A 3P2YA 9LDTA 3VH1A 1ZZEA 1R4MB 3B1KA 5DBGA 4B3JA 5AYVA 2YQ5A 3FR8A 2G17A 2PH3A 1YRLA 3GRKA 3BMNA 4FFOA 1HYGA 5AXBA 2J6IA 3WYBA 2WWRA 3ZHZA 4D0RA 2CNBA 3VH2A 3U4CA 1HYHA 2O48X 3RUFA 3F47A 1M75A 5I7FA 3OQ1A 2D3TA 2RAFA 1XQ1A 3DOOA 5LDGA 1DIRA 2HMVA 2NTNA 4EW6A 3KSZO 4DC1A 1BW9B 3OBBA 4UVEA 2I66A 3ZWAA 1U9JA 5KVCA 4PG5A 2GO1A 1UZMA 4M1QA 4HXYA 3ZV3A 2H5LA 4ITUA 4MIEA 1RYDA 1Y1PA 4QEDA 4CV1A 1ZEJA 2Q1TA 3PDJA 1IZ0A 1J4AA 1Y9AA 4MVJA 2VRCA 1A7AA 1P31A 2XF8A 5TS3A 2HK8A 2QRKA 3F5SA 3PQEA 1FDTA 1E5QA 1RM5A 2P5UA 2ZYDA 3GDOA 3VVCA 1K6IA 4PLVA 3W4KA 4MVJI 2C2XA 1IYZA 3AOEA 3QQPA 4TRJA 3UKOA 3I6IA 3PJFA 4O1MA 1EDOA 1V0JA 3EDMA 4UUMA 5JS6A 4B3HA 1S7CA 2EW8A 3FRJA 4BNKA 4CV3A 1A72A 1ID1A 1HLPA 5I7SA 4U0KA 4YACA 1B14A 1U2GA 2QRLA 1HWYA 2EERA 1IHYA 1LXCA 2EEZA 2Q46A 3CIFA 2BFMA 3BMQA 3WMWA 1B3BA 1HDXA 1PTJA 4NJMA 3EAGA 2YV3A 4Y6SA 1F14A 1O5IA 4YB8A 3GPIA 4DTIA 1A71A 3ZI0A 5ES3A 4FDAA 1T24A 1L7EA 1EQ2A 4ND4A 2BGMA 1ADCA 1W4ZA 3TRIA 3IKVA 5IFLA 1AHHA 1WWKA 4FGWA 1ZVMA 3G49A 4FFPA 4LISA 4GMFA 4W9NA 4GX2A 1P1JA 2QIOA 3D3EA 3VAZA 4BNTA 3G1UA 2H63A 3QW2A 4OOFA 2VYVD 4MVJH 2WM3A 1SCUA 3BTOA 3KYDB 3ZW8A 2OP1A 4K6FA 5DP1A 1I3KA 3WJ7A 3ICPA 1YJ8A 3HE3A 1N9GB 2O2YA 2AHRA 1X15A 3HDJA 4QO7A 4CUJA 3OJEA 4J0EA 3KYCB 4UREA 4E2WA 5KCZA 1EVIA 5TJHA 2GN6A 2CZCA 3KEQA 3PPIA 3D7LA 5GMOA 2JFFA 3WS7A 4XD2A 3ANMA 4CLDA 1ZCJA 5TF4A 1L7DA 1H2HA 1H5QA 1MG0A 1Y9EA 2O50A 3V8BA 5JY6A 1WP4A 4EZBA 1ZUD1 3I3OA 5AVOA 2PZKA 1IOLA 3HFSA 2H6EA 4OHUA 4AJIA 2NWQA 5JCJA 3RUDA 4EUEA 4S1VA 2BD0A 3AWDA 5B4UA 4Y6PA 2RCYA 4YCAA 1PQWA 2PH5A 1NPTO 1ZNQO 2YDYA 4A73A 2EP5A 1I3MA 4AJ4A 2B36A 2IZZA 2HLPA 1NQOA 4A10A 4PZCA 1DSSG 7MDHA 4NHEA 4BO9A 5FWNA 1VLLA 4H16A 4YT5A 3VTFA 4CMGA 4DBZA 3PTZA 1CYDA 4WPGA 4NIMA 4LVCA 2CDBA 4I08A 2Z95A 3HJAA 3LLSA 2EGHA 3DFZA 4JIGA 4CM9A 1RPNA 2XXJA 1E3JA 3INRA 3RU7A 4BNXA 5JDCC 2WE8A 1BXGA 3I9MA 3OJ0A 5DCYA 2WMDA 1FDSA 3HN7A 3OFSA 4E13A 3DOJA 2NQTA 1E3IA 3O03A 3RUIA 4CLOA 1SC6A 5TT1A 6LDHA 5TJ9A 3Q11A 5TQVA 1G0OA 5IJZA 1HE3A 2P9GA 1WZIA 2Y0DA 2PKQO 3LDHA 3U3XA 3WICA 2OBNA 4NU5A 4RVGA 2NU6A 3D1LA 4R54A 3BMNB 1TXGA 3ZV4A 1E6EA 4IZIA 5ER6A 3V1TC 2VOEA 1UXHA 2BFOA 2UUPA 4IJWA 3I4FA 4WOJA 1T4DA 1ZMOA 5DP2A 5U4QA 3NT5A 2FSSA 3L6EA 2DFVA 3V1UA 2C5AA 2GD1O 3VOSA 1MC5A 2GZ2A 1QV7A 3GZ4A 4YJGB 4FCCA 1ISFA 2P4QA 4J3FA 3JQ9A 3HZZA 2X0JA 1VL0A 1A4IA 3KLPX 4KTTE 4CV2A 1Y8RA 4AJOA 1N7HA 2EKQA 1UXIA 3SX2A 5DULA 2Q3EA 4Q3NA 5EERA 4IQ0A 4LW8A 1RM3A 1HETA 3ZU3A 2R00C 3WDSA 2UUOA 3WMXA 1VC2A 3DDNA 1KVQA 1C1DB 3BHJA 2AG5A 2B83A 3ROPA 2HKIA 2Y1CA 1I2CA 3KLMX 4IXTA 1WZEA 4NBRA 3DWFA 3ENKA 2NU7A 4ZICA 1IL0A 5JAMA 3FF4A 4ZQGA 5AXDA 4B79A 3NYWA 2E4AA 1T2FA 1IPEA 2DBQA 4JLWA 2Y66A 1TLTA 1Q7GA 1ZJZA 2AEFA 1JTVA 1NASA 1AGNA 1HE2A 4CM3A 5CFZA 3JTMA 1PL6A 4C4OA 3GQVA 2NLOA 2IXAA 2ZB8A 3UF0A 1LDEA 3OHSX 3HFGA 3JQAD 4FBGA 3EK2A 1G1AA 4RQTA 4WJZA 5B12A 4IS2A 4D45A 2Q2WA 3DZIA 4AL4A 3BIOA 1SEPA 1RKXA 3LC2O 3NUGA 3UCXA 2YZ7A 1Q1NA 1PJCA 3X2EA 4XYGA 2O3QA 4N5LA 1GV0A 3AM4A 2DVMA 1GPDG 2F1KA 2VHYA 3GGPA 2G1UA 5I8WA 1O95A 3GH3A 4CLHA 1R15A 1GQQA 3E18A 4ROSA 3AU9A 1E6WA 3EZLA 3E82A 3W4IA 4CM1A 5KVVA 1JKJA 3WG9A 3IP1A 1ADGA 1PJ4A 2OOSA 3O8QA 3OETA 4NG5A 1EMDA 4TQGA 1T4BA 2LDXA 3TDKA 3CUKA 4F6LA 3AUAA 4RJTA 4J2OA 4BL5A 3KB6A 3B70A 3U4HA 1I5RA 1I10A 4G5HA 1I01A 4I5FA 4JQCA 2V65A 2VNSA 1U8FO 3B1FA 3H9EO 3ZHXA 4XRGA 2ET6A 3NDRA 4IDBA 2R6JA 1GEEA 4PLPA 5KWEA 1PZEA 5KJFA 1NBOA 2IZ1A 3PJDA 2VT2A 1B16A 2RIRA 1U3UA 4KOAA 1Q0HA 4HADA 1KS9A 3K5PA 1OFGA 1HSOA 4IDCA 5L9AA 3KSDO 3UH1A 1NQ5A 4NFHA 4LRSB 1V3VA 3EGOA 3H9QA 4RQUA 3VZQA 3G0OA 3GGGA 5L51A 3F6YA 3FBTA 5GY7A 2UAGA 4CQMB 1V35A 3PDUA 2NNLD 4FD3A 4LCJA 3LT4A 1IHXA 4Q3AA 1NVMB 4A7PA 2X4GA 2XAAA 1GUFA 4OGWA 3GNTA 4RF2A 5T57A 4CM9D 3NKLA 2B35A 2O23A 4BNLA 3WNQA 1I32A 1JAXA 4CQMD 1Z7EA 1I33A 5BT9A 4ONEA 4E33A 1EQUA 4N7RA 3RFTA 3JYOA 2OL4A 4RDIA 4I9HA 1BXZA 1P1FA 1PSDA 3ZV5A 3TL3A 5KOIA 3I9LA 3RU9A 3V1YA 3O38A 1XYGA 3TFQA 4RZHA 4FN4A 1U5CA 1ZK4A 2EJWA 2E82A 3BAZA 2DC1A 4ILKA 2PY6A 3GUYA 3AM5A 3RIHA 1C3VA 1GQYA 1NFQA 4W7HA 1LC3A 3JD0A 4BO4A 5I9NA 3HADA 3CZRA 4JBGA 3TZ6A 2GYYA 2CF6A 1WXDA 2J3HA 3IMFA 3JYNA 4KWIA 2PR2A 2X0IA 2HK7A 3RCBA 4YT2A 5A5EA 1PS9A 3C8MA 4YT4A 2NVUB 1LLCA 4XWYA 1P33A 1E7RA 2NVBA 2O3SA 2QHXA 1B2LA 4B3IA 3FI9A 3JD4A 4MIYA 4WCFA 1VPDA 1ISHA 4YRDA 5BSEA 1YB5A 3E9QA 2VHXA 5AOVA 5FI5A 5TX7A 4INAA 2EHDA 1YKFA 1FDWA 4II3A 4BKUA 4EJ0A 3P5SA 4JN6B 1N8KA 2OORA 4EBFA 1ZXLA 3A06A 5F3RA 5ILGA 1A5ZA 2PKQP 3QJ5A 4LCEA 4NZ9A 5FYDA 4XIYA 2I99A 4J9VA 1BXKA 4QT0A 5A03A 4TVOA 2FPPA 1VSVA 3NX4A 1YBVA 2G76A 2EIHA 1PZGA 4BNGA 3OICA 5JAZA 2YJZA 4H15A 4NBUA 3DZGA 3HB5X 4D43A 2CDCA 5IN5A 3U62A 4ZRNA 3PVZA 3QE3A 4AG3A 3DBHA 4PZDA 3EY4A 4R9SA 1UP7A 3I83A 5CDYA 2Y1GA 3RVDA 1JKFA 4B4UA 4BNMA 2UYYA 4PFJA 3DFUA 1DIHA 3MWEB 1ISMA 2HSDA 1PJTA 1UXJA 3NJ8A 4U8GA 4EUFA 4GX1A 4HKTA 4IJKA 2VZ9A 2VT3A 3JQFC 5L4NA 1GCOA 3KETA 3K8ZA 3N7UA 3PHHA 5G0VA 2X9NA 1VJ0A 5ENVA 3PQFA 1ENZA 3RBVA 3R6DA 1ENPA 2GR9A 2FWMX 1U3TA 1KEUA 4IPTA 3UW3A 1P3DA 3M2TA 4WUVA 1KEVA 3DONA 3DEYX 5GZ1A 2YV1A 3DZKA 3QP9A 3BTVA 4WK6A 4R9RA 1Z74A 3AFMA 3GVIA 1MG5A 1NFFA 4J16A 6ADHA 3DAPA 2WEKA 3Q2IA 4CM5A 3FTNA 3LZ6A 1NVTA 1D7OA 1XHLA 4TRMA 1LLUA 5TT0A 1U2DA 4D3SA 2OBYA 4PG6A 2W90A 1PJSA 4MVJE 3DO5A 5T8KA 1DC3A 1I0ZA 1P0CA 4R68A 1RM4A 1GYQA 1P44A 4XQEA 3K2EA 4ALLA 2TMDA 4CMAA 5A05A 4XR9A 2B0JA 2O3RA 3QVXA 3SC4A 1I2ZA 3PHGA 5L4SA 1E7WA 4CR8A 1ONPA 3JCZA 3IC5A 4XQCA 1HE4A 1Y8RB 2HCTA 3O26A 4K28A 4ZVVA 4RPGA 3GAZA 2NM0A 3S55A 3WLFA 3DL2A 3DTTA 1P45A 4Q3CA 1PU2A 3H9GA 1DB3A 3LT0A 2GDZA 4YBZA 2D2IA 2ZYAA 5C5IA 3RQSA 4U0JA 4B7CA 1DIBA 1XDWA 2HO5A 5EIOA 2Y93A 3C85A 4XRRA 1BWSA 1DIAA 2B37A 2NADA 2RBEA 1ZH8A 2DTEA 1NX6A 1YH3A 3W8EA 3DBLB 3HSKA 2AQHA 4CL8A 3SVTA 2WJPA 4Z9FA 2P9CA 3KYBA 3WQRA 4BMNA 4AFNA 4CQMA 1R12A 5CAEA 3KHUA 5K9ZA 1KC1A 4M55A 1KY4A 3H8VA 2R2GA 3WYCA 4CODB 2YFHA 3OJOA 5ITVA 4RF5A 1OI7A 4WE3A 4C7KA 1Y81A 3HWRA 3F1KA 3PLRA 4XDZA 1E3EA 4CLOB 5KJEA 4DQUA 1WVGA 1VE9A 1I3LA 3ORFA 5IF3A 4PRLA 1PR3A 4J91A 1GDHA 5T67A 4CUKA 4YAIA 2OUIA 3ITDA 3OIFA 4E31A 4XZ3A 4YYZA 5A9SB 4E2YA 4I9UA 3VTZA 3PYLA 2HUNA 4JP3A 2FR8A 4YJFB 5BNTA 3BTSA 4UAGA 5L53A 4HNHA 5IZ4A 5G2OA 4DIBA 2OHXA 3LF2A 4GH5A 1ZSVA 3A4VA 1WW8A 2G0TA 4BV8A 5IN4A 2D8AA 4B4OA 1IUKA 1PGPA 1U5AA 3IP3A 5KKAA 1EBFA 4ZU3A 4CMBA 4FJ0A 1F06A 3GPDG 4YTEA 4DL9A 1ARZA 4IDEA 3WBBA 2VUSA 4A0SA 3L07A 2V6MA 2FZEA 4R3NA 4Z0PA 1ZSYA 2IDZA 5JAQA 1LSSA 4RPKA 1SOWA 4E21A 1ZIDA 3KTDA 4UVGA 3RFVA 4CL3A 3VPXA 4MVJG 3ZHYA 1Z7BA 3RBXA 1RJWA 4EEZA 3ASVA 3WFIA 1TB4A 4JROA 3PGXA 1Y5MA 5JBIA 3AY6A 2W2LD 1YOVB 2AXQA 3LF1A 3MJTA 4BGVA 1LBEA 4XKJA 2FMUA 1O0SA 2Y1DA 3GEGA 3S2EA 1DJNA 3KYDA 1CF2O 3VHRA 1JKIA 4KQWA 2JCYA 5B4TA 4N5MA 2YYYA 5A9TA 3PGJA 2PKRA 1FDUA 1O89A 5DBFA 3RC1A 4YA6A 1GQ2A 2BGKA 2VTDA 4LRTB 1PL8A 1YDWA 4L0QA 3VDQA 1NHGA 4E5NA 4RGBA 1GL3A 2A94A 2YV2A 3BMCB 5DNAA 4EI2A 1E5LA 2PNFA 3DHNA 4CM8B 5EMHA 1O8CA 2X9VA 5JLAA 3S1LA 3Q0EA 4AVYA 2Y1OA 4HFNA 3ROKA 2CMDA 1EK5A 1D4FA 4J4HA 1EE2A 4FC6A 3VH3A 2X22A 2XPCA 3TFOA 4FOOA 2IEDA 4YAEA 5F1PA 5L7WA 1AXGA 1UDCA 2DFDA 1LQTA 3DAFA 2C7VA 3ZCXA 3KO8A 1LI4A 4BNWA 1NPDA 2CY0A 5ICSA 4ALMA 2E6UX 4MDHA 3PLNA 5AQ1A 1QLJA 3GN2A 2VCYA 4XGNA 4R69A 4R41A 2FR1A 4II2A 4H3VA 4GQAA 1SPXA 3JQDA 4BNJA 4E5PA 1B3RA 1VM6A 2FN7A 1CRWG 3C1AA 3OM9A 3QV1A 5CG2A 2X5JO 4K1LA 5KIAA 1DIGA 1F0YA 4MP8A 4J2HA 4L4RA 3WQQA 4IIUA 2EJVA 4HUJA 1H93A 1LTHR 1E7QA 2NV6A 3PIIA 3VPFA 3ZNNA 3RFXA 2OP0A 4RLSA 3L4BC 3RKUA 3ADOA 1ZKMA 3GDFA 4U5QA 5A06A 1YONA 4XJTA 3P7MA 4OJNA 3Q9UA 4MVJF 5IXSA 3E6AA 4HY3A 2JAPA 4OO3A 5EQDA 1DJQA 1HE5A 3FWZA 5HBRA 2PGLA 1B26A 2VZ8A 4IQGA 3WBFA 1PGNA 1LSOA 2ZTUA 3H3FA 3E5RA 1GADO 4OSPA 3LYLA 1J49A 5BQFA 1PGOA 3QSGA 1BXGB 2B5VA 2HMUA 1MV8A 2AQIA 4GWGA 5T6BA 3RROA 5F1OA 3VZSA 2AQ8A 4BO0A 9LDBA 3RJ9A 3UXYA 4YRAA 2PZLA 4IJVA 2GPTA 5CDGA 1DDOA 3PJGA 4NJMB 2AMFA 1LNQA 2HK9A 4ZGWA 4WLVA 3A9WA 1XCBA 2A9FA 4I5GA 1E1LA 1ENYA 2JAHA 1HSZA 4JJGA 1ZBQA 2JJYA 3GN1A 4KUHA 3EVTA 1ZEMA 3GHYA 4TZTA 5JDIA 3NAQA 4BVAA 4LGVA 1I3NA 2GCGA 1U1IA 5FF9A 4ZN6A 4NK4A 1VKOA 4PG8A 1YGYA 3EVNA 5IDWA 1TA4A 5G4KB 3ZH2A 2ZQYA 4YJDA 4IJUA 2X6TA 1BVUA 1PJ3A 3IDSA 2ZB4A 3KSUA 5AXCA 3OIGA 3KXDA 2A92A 4WCFB 2ZB7A 1T2AA 3OQBA 4GI2A 3WR5A 2ZCUA 4QECA 1U3VA 1LSUA 3KVOA 1HDOA 1EDZA 1PZHA 1MFZA 3GNSA 1LA2A 1LLQA 3DR3A 5ENDA 3GC6A 4FC7A 1DFIA 4B7XA 4Q3BA 7ADHA 3FPLA 4OM8A 3SC6A 4WOKA 1Y5RA 3CTMA 5BNFA 5G0TA 3BMOA 3BHIA 1BSVA 2BI8A 1HYEA 1K6XA 1B7GO 1UZLA 3G1TA 1DC4A 2CDAA 4PLWA 4HFRA 2V6FA 4A03A 1XGKA 4E0BA 4CMIB 1W6UA 1PZFA 2W2LA 1NQTA 4IIVA 2DQ4A 3EYWA 4WLUA 1EUZA 3RUAA 3TJRA 4NI5A 3ROQA 3WOHA 1E7MA 4KQXA 4NFYA 4XYLA 5JO0A 2C20A 1SB8A 2VRBA 2WYWA 2X58A 3AJRA 2YHIB 4BKPA 2PD3A 4FQ8A 2AEMA 1XR3A 3TL2A 3M1AA 4HP8A 1ADBA 4BNYA 1LDMA 2GASA 3H2SA 1MXHA 1XU7A 3NT4A 3VZPA 3GVPA 3WIDA 1MX3A 4YRBA 2X7HA 3GAFA 1XG5A 2A35A 3PWZA 1PWXA 5KJ6A 4GPD1 3MJ4A 5JC1A 2NACA 4P4LA 3CEAA 4OAQA 1NFRA 2Q1UA 3GVHA 1IE3A 2W8ZA 2EV9A 4OQZA 3QWBA 4ND5A 4K9DA 4R5MA 4EITA 1NTOA 4OH1A 2JKVA 1MA0A 1KVTA 1T2CA 2O3UA 4CQLB 4GKVA 3SXPA 3A14A 4BNVA 1U7HA 2JHFA 4CM6A 5HTOA 1KVRA 3VKUA 3PIDA 2PGJA 3DMTA 5TSDA 4J1NA 1ZK0A 4P4NA 4P4GA 1R0SA 5ITWA 3ZWOA 3C24A 5A3JA 3K6JA 5IXYA 1VJTA 1HL3A 3JQCA 4NBTA 3RC9A 1PWZA 3C3XA 2LDBA 3AM3A 4KP7A 3GDGA 1H6AA 3LVFO 1E3LA 5C7LO 2A4KA 1ZK2A 1UDAA 4MO2A 5IDYA 3AFNA 1KETA 4IUYA 2J5RA 1LLDA 2P5YA 1LX6A 2BF7A 1ISJA 1NVGA 2YUTA 4L74A 2VN8A 2ZJ1A 5C3MA 5A1TA 1U4SA 4KDFA 2QZZA 3V2HA 4L4SA 1JDJA 4CMEC 2Q1SA 4ZJUA 2DUUA 1FXSA 3ZW9A 4PN3A 1A9ZA 2NU8A 3ETEA 1V9LA 3DBLA 4G65A 1HTBA 5JCJD 3OQ6A 2GN4A 5HM8A 4TVBA 3LLVA 2NU9A 4IZHA 3RD5A 3W1VA 1MP0A 2I3AA 2BFAA 5CG1A 1T2DA 3V5NA 5KJ1A 1YB1A 4YEDA 4L73A 3QVWA 1LU9A 1Q7CA 5ICMA 4XGIA 3L9XA 2X5KO 1PEDA 3GK3A 4K26A 4XQ9A 1WMBA 4FFNA 1X13A 3PP8A 3A1NA 1EZ4A 1TT5A 2DLDA 2PK3A 3UAGA 4BKRA 4WLFA 5KKCA 2OGUA 2P4HX 1KVSA 5JMPA 1J6UA 5BNIA 1OZAA 4DIFA 3JQ7B 4RZIA 2BRUA 1R16A 1UXGA 4YWJA 4DVJA 3OIDA 5BR7A 3NJ4A 3E1KA 3E9NA 3GGOA 3G17A 2ZTLA 3CXRA 2VZ0A 1A27A 4Y6RA 4DREA 3WJAA 1LC0A 4IY1A 3NDJA 5COBA 2J3KA 5TC4A 4J7XA 2DM6A 4W6ZA 5C7OO 3HG7A 4PZEA 3ZNQA 3WB9A 2YDXA 3WGHA 4I5EA 4CQLA 3DBVO 1WNTA 1X0XA 1LSJA 4ESOA 1B8VA 2RHRA 4ZQHA 3PYMA 3ZDFA 4Z9YA 3H9UA 1HRDA 1HLDA 1YQDA 4NQZA 2Q49A 4BO7A 2BLLA 3VC7A 5U9CA 4MOWA 5L7YA 2BI7A 1R4NB 3FBGA 1GEGA 1MFPA 2HRZA 1O9BA 3HDYA 3O8QB 1LDBA 2C82A 1SZJG 2DAPA 3OJLA 2GRAA 4GX0A 4HFJA 3JQAA 3TN7A 1DAOA 4PLZA 3TOZA 3JQGA 4CMHA 1FF9A 3F9IA 1YBMA 5DOZA 5JDCA 2DBZA 3DZFA 5DDIP 3QIVA 5HS4A 1IPFA 4PRKA 3JYLA 2IRWA 1EEHA 1YL5A 4ALKA 3FR7A 1Y6JA 3IAHA 4RVSA 3SJ7A 1GZ4A 2X23A 1JAYA 1C1XB 3GG9A 3K31A 3OP4A 1D8AA 1HKUA 4FFMA 3U9LA 4BO6A 4QUKA 4E32A 1DOHA 2W2KA 3BMOB 4B4WA 3H5NA 3O4RA 2Q45A 3ONEA 1NAIA 2BMAA 1NR7A 3LT1A 4O63O 2Y0CA 3BMCA 4CM4B 1GUYA 5ER9A 4A5OA 3PYXA 1NQAO 3C7DB 1F17A 2V6GA 4J43A 1UUFA 1XQ6A 4Y67A 3GR6A 1L1FA 3WXBA 4D42A 4ND3A 3PXXA 2Y0EA 4JJFA 4N54A 2VUUA 2FPGA 4OQYA 4Y98A 4BB5A 4M49A 3AY3A 4FFRA 1HXHA 1N9GA 3V2UA 3PHJA 3JQBA 1GY8A 5C7IO 4WKGA 5FFFA 5DN9A 2GZ1A 2DT5A 3JQ9C 3AK4A 1NP3A 1TT5B 1BMDA 2ILTA 3NEPX 3PFFA 3U4DA 1JWBB 2Y1EA 1BTOA 2B4QA 3VVBA 4D41A 1LQUA 2E48A 4CR7A 2ZQZA 3NGXA 4GVLA 4PLYA 1CDOA 4BGIA 2FY8A 5DF1A 3TOXA 4TSKA 1D1SA 3UOGA 2C29D 4BGUA 4MVJM 1EVYA 4MKXA 3RBZA 3S8MA 1IB6A 1QG6A 1DLIA 1H6BA 3C1OA 4WEOA 3LK7A 3ZZNA 4J4BA 1P9LA 3BHMA 1ONOA 2SCUA 3GNQA 5CHEA 2E49A 4DPMA 1H9BA 3TZHA 3OA0A 3PZRA 1E3WA 3TZKA 1JN0A 2ZATA 2DTDA 3Q2KA 4Q9NA 1ADFA 1NAHA 1P77A 1YB4A 4MIOA 4BO8A 3GEMA 3GEDA 5LCXA 1NWCA 3RC7A 5I7VA 1HZZA 5IDQA 2QQ5A 5T8KC 1EFKA 4CLRA 3VPHA 1PX0A 4NH4A 3P19A 5THKA 5IDXA 4Z3DA 3IJPA 4RVUA 4CLXA 3QLJA 5G0WA 1K89A 2Q1WA 2CVOA 3AOGA 4GMGA 1DLJA 5CDTA 5I9LA 2DKNA 3DHYA 1I24A 1VL6A 3BZUA 1KY5A 4FFLA 5AXAA 5B4VA 5IG2A 3KOUA 3NV9A 4O0LA 3UN1A 3WSWA 1XIVA 3M6IA 3VKVA 3FWNA 4R4JA 1GAEO 2X86A 2X9GA 1OOEA 4GVXA 4NR0A 4IDFA 4UUNA 3SBOA 4CMEA 1LDYA 1C1DA 4RLHA 1X14A 2O7QA 5MGBA 4IGEA 4IDAA 4BQPA 3FNFA 3E8XA 3NTOA 3ON5A 3PRJA 1B0AA 3VPSA 5COAA 1U8XX 3TSCA 3OA2A 3UHAA 3QY9A 3DAGA 4XQGA 3ETDA 1HDRA 5JXWA 1DEHA 3C7CB 1I8TA 2PLAA 3BYZA 1C0IA 3F4LA 4I9NA 4JNKA 3H3JA 5JYDA 5I7EA 1PJBA 4CM7A 4OXNA 5L95A 1E7YA 3CSDA 1YE3A 4DBVO 1GCUA 2H1SA 4TZKA 3AUUA 3R1IA 3ADPA 4RPLA 4PIVA 5EESA 1OBFO 3F46A 2VHVA 4RL6A 4PLFA 2EXXA 3M1LA 2EP7A 1PQUA 2O3JA 4CPDA 4KWHA 1EBUA 4GKBA 2ZIZA 5I9MA 4E5YA 5A04A 1S6YA 3E03A 1F8FA 1D1TA 3G3EA 3QVTA 4DMMA 3KM0A 1Q2XA 3X2FA 2DPHA 2AW5A 4E6PA 4L75A 3IJRA 2J5QA 4J6FA 1Y7TA 2JL1A 2O3TA 3EUWA 1E3SA 3NTRA 5GZ6A 4B4VA 5JC8A 3NGLA 4NBWA 3R3JA 4LSMA 5F5NA 2P68A 3SJUA 3VPGA 5K6AC 1X0VA 1ZK3A 2NVWA 3JD2A 5DBIA 1VSUA 2C2YA 3JQAB 1I30A 1KEPA 5T64A 4RV9A 1B15A 3MOGA 4GLOA 3UVEA 5IZCA 1BVRA 3GZNA 3JD3A 4RORA 4FB5A 1C1XA 4E5MA 4YR9A 2VWPA 3PHIA 3U49A 3WIEA 1U7TA 4OXYA 1GD1O 1X7HA 1IY8A 4IXWA 2HMSA 3FHLA 2BH9A 1A9YA 1YVEI 1X7DA 1QYWA 5HWSA 2OFPA 4KUGA 3RKRA 4YPOA 2VQ3A 4AJEA 5A5FA 4L9RA 4BIIA 2DUWA 4OYRA 3IIEA 4Q3EA 4WCFC 3WYEA 5KNLA 1NWHA 2UDPA 1HDYA 1Q7BA 2Y05A 3DTYA 2WD8A 3NRCA 3D3WA 2Y68A 2JFGA 2ZYGA 3RUEA 4J7UA 3Q9NA 5CPFA 5ILOA 1YXMA 1WDKA 2AE1A 3HNPA 4XA8A 2VOJA 1UAGA 4OXKA 2DPGA 4M89A 3I4CA 1ZK1A 4DA9A 4OIMA 3CE6A 3DB2A 1XWFA 1N92A 4PLTA 3K96A 1XLTA 1H0KA 5F5LA 3MJCA 4LVUA 5JYEA 1FMCA 1BG6A 1UXKA 3UFXA 2GF2A 3HQ4O 1JVBA 1AHIA 1ZJYA 4EGFA 2CSUA 2RHCA 1QYCA 4IM7A 3ZWVA 4BO3A 4IQ8A 4RDHA 2YQ4A 1C0PA 4AJHA 2CF5A 4CLRB 1QYDA 1HDCA 3AI3A 2Q50A 2VHWA 3MEQA 1Y8QB 3PHLA 1QORA 4YJGA 1DBVO 3FNHA 3I9JA 3V2GA 4AJ2A 1E3WB 1NYTA 3GFGA 4JGBA 3T4XA 3IL2A 3ST7A 4IBOA 2PD4A 1ENOA 1W73A 2FOIA 1UR5A 1E6UA 4WLOA 4QTZA 1QSGA 4WLEA 5ADHA 4JXKA 1MGOA 3WQSB 4KUEA 1V3TA 2OZPA 4E5KA 2C54A 2YY7A 1T1SA 3ASUA 3MZ0A 4U7WA 5FEUA 2BFPA 3PI7A 4BOYA 2O4CA 4W82A 1MB4A 1LUAA 3GLQA 4YQYA 3QWAA 1DC5A 3ZU5A 3ZWCA 2FP4A 4ZHSA 2IYPA 3U4IA 4MVJD 3U5TA 3L4BA 4Y8VA 3GMSA 3F3SA 2EG9A 3AY7A 2GN8A 1VKNA 1BDMA 5CEFA 1PJQA 1R66A 5L7TA 2VYVA 1MXFA 1K2WA 2I3GA 2VNAA 4CJXA 4DWVA 1A4UA 2AG8A 2XXBA 3B20A 1EFLA 1LDGA 3MJVA 3WWYA 3KV3O 1C14A 2Y67A 4I1IA 4XDYA 3F5QA 3OJFA 5IAAA 3WX0A 1M6HA 4BV9A 1ZMTA 1J5PA 4R3WA 1AUPA 1EVJA 4P8RA 4XB1A 3WNVA 4D44A 4QFCA 4LMRA 4UVDA 4NFSA 3OMLA 4HFMA 4ZQEA 2D1YA 2VYND 1NNUA 5CPBA 4MP3A 2X8LA 2PA3A 3WLEA 3UGKA 2YHUA 3I9KA 2PWZA 1VI2A 3GVXA 4FJ1A 2VHZA 4NMHA 2Z1NA 3ZWNA 5CDSA 2EW2A 3L4SO 4RF4A 1XEAA 4YDRA 3ETGA 1I36A 4XR4A 4D3DA 4D46A 1KVUA 1KERA 3AU8A 1WMAA 2Q2QA 1YJQA 2NSDA 4OKNA 1U3WA 2HU2A 3DQPA 4W7IA 4J7CA 5JSFA 5C37A 2QYSA 3ENNA 3IKTA 4GSLA 3WFJA 4QQRA 4R16A 1JQBA 1OAAA 2F00A 3RUHA 1GYRA 4FJ2A 1SEVA 5EINA 3MJEA 3DBHB 1HDZA 3ICCA 4E30A 4DGSA 1G0NA 1AE1A 1JVSA 3FTPA 2NTJA 3ONFA 1O6ZA 4UUPA 3CH6A 3QVSA 2IE0A 4QO8A 5CEEA 2HDHA 3DMYA 4OKIA 4PLGA 3GT0A 3UUWA 3I1JA 3GA0A 3ITKA 2JCXA 1ML3A 3FN4A 1H6DA 1FDVA 2D5CA 1CEQA 2ZTVA 4H7PA 3W6UA 4D7AA 2G82A 2X0RA 4E3ZA 5TLSA 3JYPA 1NXQA 1XSEA 4EYEA 3JQ8A 3KZVA 4ALNA 1UDBA 3NTQA 3WTBA 2CFCA 3GF4A 3BA1A 3AW9A 2ZK7A 3ABIA 3FNEA 4XJSA 2QRJA 3D0OA 3H65A 1HZJA 1DRVA 1PGJA 2EKPA 4JBIA 4R1NA 1V8BA 3HHPA 2J8ZA 1GUZA 4O59O 4Q39A 4XYEA 2X0NA 5CEJA 2J5KA 1F12A 1DPGA 2P91A 4ALIA 4F45A 4FSHA 2C0CA 3D4NA 4K6CA 1XKQA 2CVQA 3Q1LA 3H9JA 4QX6A 2P2SA 4FIZA 1GV1A 1MUUA 1SAYA 3K92A 4F3YA 5A3VA 3ZNOA 4J9UE 3W4JA 3KEOA 1ISIA 1FK8A 4J90A 3TF5A 1MC4A 3DMTC 4J1SA 5JO9A 1X1EA 4IGFA 1IZ9A 1ULUA 1YS4A 8LDHA 5K0ZA 2D0IA 1R4MA 4ID9A 1Q0LA 3QWHA 3S2GA 4W4TA 3RSHA 1E77A 4D79A 4A27A 1A7KA 3A28A 1JA9A 4YJFA 2WYUA 1JW9B
chains in the Genus database with same CATH superfamily
4RIGA 3C6ZA 4WNIA 5JAHA 2D7CA 2WWFA 4X3OA 4MV3A 5FPTA 1UPFA 4I36A 2WVJA 1X86B 1VYTA 3LECA 1KC3A 3KUDA 5AQEA 2BEWA 2D5AA 4GAEA 4AJJA 5F51A 4AJNA 1TVCA 1J5EB 1OXTA 2VXOA 4QFDA 1IM5A 4ICIA 4CN8A 4WBNA 4IF4A 3VHXA 3SEAA 3JZIA 1A7JA 1Z5UA 3AOEC 3INYA 3DFFA 3C4VA 1XMOB 3PUIA 3ONWA 1U80A 1WU7A 1J06A 1WTAA 3K1YA 3NATA 3HSSA 5FOVA 1RAFA 4NEGA 4Q66C 2XZPA 4DKJA 4Z53A 5EN4A 2DTXA 2ZQ5A 3K0EA 1D6MA 1TQ4A 4CIYA 3OFNA 5T5QA 2JLZA 3PX7A 1YR2A 5FFMA 4Z3KA 4IAOA 3ZWWA 4Z4QA 3KOXA 1FUYB 4L57A 3EDYA 3KJIA 4Z51A 2A0XA 1LB1B 3A4MA 5IS2A 5LKAA 2RAPA 1FRNA 1VBKA 1XU9A 2H3EA 3DE7X 3LC1O 4AZSA 2SKCA 5JFOA 2CSXA 1YOVA 5JZOA 3S2FA 4BHTA 1KK3A 3OZVA 3CN9A 1NURA 3GEBA 2ZYSA 1GR0A 3HXKA 3NPAA 4J0HA 3AR5A 4TX1A 3T4EA 4B6PA 4BP3A 3U60B 3PRKE 4ME6A 3TH5A 1PEKE 4HX9A 2WNIA 2PSFA 3VO8A 5LQDA 5I9TA 4E4YA 1U3FA 1NM5A 3I72A 4DAEA 4D0LB 2B25A 4F5YA 4CIVA 1J8FA 2ZJ6A 3GP3A 4NZYA 2IXBA 5TQ2B 5FI3A 3KELA 1T34A 1OF1A 1RWBA 2PV0A 4M9UA 1OB5A 8ADHA 4FXPA 2VA9A 5F78A 3EEFA 3GX1A 1I6KA 5L4LA 3EXEA 4X65B 1PK9A 2B4AA 5EZYB 3T7EA 4O5OA 3HJBA 3QFSA 5K2OA 4KTVE 1A8HA 5D3QA 4BVKA 2VF8A 5KYXA 2BGJA 4N8SA 1PHRA 3QK7A 4WDRA 1PW7A 3RHTA 2ECPA 3JAWA 1VGQA 2ZKLA 2IGTA 1R0LA 3A04A 1RPTA 1XK6A 2E87A 5GGYA 4ETMA 3PE3A 1KI8A 4JUAA 4IINA 3S29A 3G7UA 4PCVA 4DRXA 3WGVA 3JQPA 1KIFA 4N39A 1EFPB 4CMJA 5FUBA 1N1DA 4J49A 1UKVY 4UQPA 2FMKA 2RB5A 2X8AA 3AV0B 3CNBA 1W36D 1W0JD 1MAAA 1I80A 1BHO1 2AE2A 2HJRA 2ZJZA 2WIAA 2IUUA 3TG2A 2BM0A 4GGOA 3ELWA 3HXPA 4IMJB 2FSVC 3QENA 1Q0PA 3WY9A 1W1WA 3IQDB 1XPOA 3CUWA 2XOKA 4PSDA 1F3OA 3I2KA 1A76A 5JVDB 4GBJA 4BMPB 1P7VA 2OCPA 4FCTA 2D0DA 1NNEA 4CWAA 3W9YA 3U09A 4TUYF 3K4QA 4JUIA 5IVPA 1MVNA 1MPXA 1MB3A 5KDDA 3UAXA 4DLAA 2DBRA 3KXPA 5F7JA 1L4EA 3EGVA 3II6X 4FTWA 3VQTA 2QG4A 3UMYA 3WISA 4PC1A 1DXQA 4EG6A 4JV5B 2YR0A 4MPDA 3G6KA 3QBJA 4V2IA 4DDWA 1A96A 1NE7A 1TAQA 2PT9A 3JSXA 3QVOA 4Y9TA 2JIZD 1ZL2A 2MINB 5FOQA 1YTUA 3PK0A 4TS1A 2I34A 4JYAB 3COVA 3ETHA 3QWIA 5C80A 4ZVRA 1UDXA 2C5GA 4YVFA 1GPUA 2XGMA 4Y2XA 3ZE8A 1RC8A 1JDSA 3R09A 5INTA 2MMGA 4EVRA 4XIFA 4DV5B 4ZPXA 1BFUA 4CEJA 4K0RA 5GZ3A 1YWGO 4LYGA 2D59A 2XOEA 4RMNA 3NG1A 1N5DA 1G7CA 3ZKWA 3DOCA 4BU1A 1CDEA 1T8PA 1YIDA 2E2WA 2Z1MA 5IWAB 4OAOA 4RPJA 3WGOA 4KXNA 4R1TA 5LC1A 4CHTA 1Y4ZA 3DZBA 3HA3A 2BCJQ 3CUYA 1AHPA 1CHNA 4IDQA 3SFVA 4CU2A 5ANRB 3W8DA 3B7GA 1QH9A 1WSAA 1DJOA 2LD4A 5A1JA 5B37A 5CA1F 3AC0A 4QL3A 1K66A 3G6WA 2W5UA 3L6OO 4TLLB 3ND9A 4ZVNA 1ONBA 3THWA 1P4GA 2HV9A 2D5IA 5AJTA 3UFXB 4D81A 1XXHE 1GTL1 2PGDA 2WZBA 2G0NA 1LK5A 4ETIA 4Q1CA 3ER6A 3HU1A 3OMWA 3EISA 4K8OA 4XQ0A 2A3RA 2FN9A 1TU3A 2XQFA 1T26A 3DDSA 2MSCB 4LXHA 4MB0A 4CKCB 3E7FA 5CJ2A 2ATVA 1DWQA 1DCKA 5FAKA 2AVDA 5KTOA 2LCQA 3VR6D 3JZFA 2H5EA 4XX0A 1CRQA 1RYEA 2AFIB 1NXVA 2I0FA 5ALHA 4GQBA 1Z68A 3UAZA 3ZWDA 4ZRMA 2ZFUA 4BO1A 4G0VA 5DI9A 3GRCA 2HU7A 2ZIUB 5TNXA 1EUDA 1ZXBA 2PS9A 2ZPAA 2NO7A 1II0A 2VVTA 3K15A 3W2TA 5JD5A 2H2WA 2WV9A 2CV1A 3SEFA 2GT1A 2IHNA 4NK5A 4OMCA 4G4SO 4IUBS 3WDMA 5K03A 3LUFA 3NYQA 3RVJA 1G38A 1EIWA 4LRUA 1P19A 4R98A 4D98A 2GHTA 4MINA 1K5HA 2X5OA 3RRJA 5KHLB 3BWBA 1Q7RA 3RC8A 2O2ZA 4K5QA 1RW4A 3PUXA 4IIYA 4OI1A 1IQ0A 3UHFA 1C3XA 3IDFA 2AJLI 2QLLA 4FOSA 4ZVSA 3R7FA 1K8XB 3EMKA 1PCXA 1M6WA 5EIAA 4IP0A 3L04A 1T5HX 1CY8A 1UC8A 4ZVPA 4MKZA 2OT3B 2YHIA 3B38A 3K2BA 2PPVA 1JQ5A 3NBMA 4OLFA 5DW0A 5LXTA 1WW3A 4ZAXA 2EZ9A 4YMSA 1CEEA 3QJGA 4XYMA 1GZ3A 5AVWA 1W2WB 3PDCA 2I87A 2DOKA 4S3MA 2H9IA 2JHGA 5MN4A 2GN0A 1NTRA 4FMDB 3KSAC 3B8EA 5H4GA 4FN5A 1Z8DA 3ZOZA 4X8LA 3USZA 4MCJA 4TKMA 2HQOA 4CF3A 4DPKA 3SM9A 2AOWA 3R4CA 4X85A 4EB8A 1UF9A 2CXHA 5ALRA 1CR2A 3NP7A 3SZUA 4IKEA 2PAFA 2P6PA 4L5JA 4NAUA 2NUAB 2QD4A 3EFHA 4Q03A 1M2EA 1H5UA 1N9ZA 3BMXA 4UDNA 5D8DA 5DTEA 3NAZA 2YINC 2H4YA 1USIA 2I2BA 4MRAA 3FNRA 4X90A 4NCAA 1C3OA 4TXJA 1EVEA 1GXSB 3DCJA 4CM8A 4FE4A 2J3IA 3ZWBA 1WPQA 5SY6A 3ZN2A 3ODPA 1L5MA 1KQOA 4Y0VA 2YKGA 5UKDA 3V4SA 5HP4A 5IUNC 1S3SA 4O0MA 2BDTA 2ZJAA 2YXPX 3OH8A 3P4XA 3TZBA 3FD8A 3UV7A 4BWGA 4LY6A 4CUZA 2BLNA 4KRFA 2MDTA 1PFVA 1SOVA 4JJ7A 2P1RA 4LFCB 5AVJA 4KZPA 2GTHA 1CETA 4PHHA 4YK7A 4E51A 2HPVA 4X45A 1RI4A 2WINI 2DH5A 5IK2D 3G0BA 3O74A 1QE5A 3PGVA 2I9KA 5DNDA 3NBKA 2IQIA 1WVIA 3GLUA 4R81A 4C87A 5CDUA 2WB4A 5LD2C 1G2OA 4OQQA 1MB9A 3K8QA 5IJ0B 3T5AA 2YZGA 3ZWQA 4EFLA 1TJ5A 3RIGA 1QVAA 1LEHA 4TL9A 4Y1RB 4J1QA 2RH4A 4XIJA 2Z2IA 3L8FA 2FQYA 4QJ3A 5K0LA 3HJHA 2IYAA 2YZNA 1E9VA 3OZFA 4M22A 4QFMA 4NJOA 5ALGA 4EPWA 2IVZA 2J5BA 4NBKA 1TEXA 4V0KA 2WIJA 4C6TB 1O3YA 1YO6A 3OOJA 2GLUA 1DRWA 1ODKA 1TGVA 1P2VA 1ZUIA 1JHMA 2I9PA 2ZI7A 2FDXA 1P1IA 4IMPA 3K9QO 5HQ3B 4B87A 4TMTA 4C43A 2XNCA 3DXYA 1IONA 1P7WA 3DEJA 5CNJA 3S2SA 4AY2A 1GU7A 3LPMA 3X0DA 4N7MA 4NPCA 3GOQA 4RPHA 5DBHX 1BNCA 1M3SA 1KP9A 1JT2A 5CRIA 5IZCC 3AI2A 2ZRPA 1NJ2A 3IP9A 2PD6A 4NOJA 1PDWA 1R0RE 1K6EA 5HR5A 4D57A 1P1HA 5JADA 2O2XA 4OB7A 4W5WA 1QIDA 2HMTA 3IPXA 1SMKA 1MW9X 4G26A 1Y6QA 3JSAA 4TZ0A 1T1RA 2JFPA 4OBXA 1APBA 4RLFA 2YICA 3QMVA 3MBOA 1V6SA 2V1XA 4HXEB 4LHYA 5BRAA 1YRQA 2HLHA 4KR7A 3Q0IA 4Y6QA 4W5OA 2MSLA 4D9HA 4PAGA 3WGZA 5JZ9A 1M2NA 4TQ9A 5LU9A 1WNFA 2BAGA 4JJ8A 1UZNA 3WI7A 3WGQA 4E12A 4Y1EA 3EIHA 2HMWA 2AL7A 2B98A 1DHRA 1HT0A 2GCEA 5CVVA 3UAOA 3PWSA 3G5UA 2IYRA 4D9KA 3GMTA 4RK6A 1BW9A 2ZXEA 3DWEX 1FYEA 1OE0A 1NF8A 5DTIA 2C59A 3GQBA 3D2LA 5KAMA 4ER6A 3LM8A 3ICWA 3P45A 4IFEA 4AMVA 5K05A 2ZSUA 1GSHA 1HF3A 4RSMA 4ZA2A 1K7CA 2P9EA 3SZRA 3V7FA 3DDUA 2RHHA 3Q8WA 3HCRA 2Z5LA 1NXOA 3FCEA 4C0XA 4NDNE 1IIRA 1VPTA 2OCLA 4DLRA 4NMMA 4JI8B 3WKEA 3ILYA 5C1IA 4NCHA 1S5PA 2HO4A 3LHKA 5CJJA 4HQFA 4YPFA 3I9OA 3ML1A 4BLVA 4LJ8A 1D7AA 3W9SA 1EE1A 2R00A 3HDQA 4WV3A 4EQ6B 2YWBA 4G5XA 2OMEA 4HDMB 2DGDA 3PR3A 5REQB 1P1KA 3AESA 1AXEA 4PVCA 5JD6A 5AW6A 2YFKA 1D2GA 4P84A 3G5LA 3L8YA 2H4WA 1E62A 5DE3A 4QPJC 1XMVA 3IE0A 1KZ6A 3L6DA 3QUQA 1GKKA 2EQAA 3IEVA 2ZWVA 3WK5A 2F43A 3OT1A 2RFLA 2VJLA 1V4VA 4ER0A 4JWTA 4X0EA 1H65A 1LRJA 4WVLA 1I2DA 2IF2A 1O96B 3JV7A 2ZSFA 3FHJA 3DQZA 4CMIA 3WWDA 3L7YA 1Q12A 3DV9A 4E3WA 1UM9A 4XVRA 1V8DA 3JQBC 4R5HA 3MTJA 3OVMA 4XLLA 4EGSA 1YGPA 2QPOA 2EFYA 1Q5PA 4HDKB 1R6XA 4NBVA 4JX8A 4MCAA 4AZ0A 3FYHA 2JVJA 4HYTA 1NF3A 1H4SA 3NEJA 3MXOA 3N2NA 5IJ9A 3B9RA 2BHSA 3T7CA 1DBRA 2ZDHA 4NAVA 3WGGA 1BHSA 2HLDD 3E22B 4IHJF 4WFKA 5TPZA 1ZD9A 5JD3A 1U0GA 4U7JA 2FVXA 3VR4A 4JP2A 1IM2A 3OZUA 1Y3FE 4ZOQI 3MTGA 4O29A 3S7ZA 4TLCA 3X43A 1DXYA 1O6CA 2CFSA 3GUCA 1KTIA 3A4YA 4H4DA 2ZRQA 1TA9A 2BBTA 2OD9A 3HBJA 3I2IA 3F96A 2ZJ2A 2VUHB 1TUGA 3F4BA 5CX1B 5EZYF 5K8UA 2JLUA 3PEUA 5KYXB 4JCOA 1VB5A 4BN5A 1PQPA 2WLTA 2WVHA 3GFBA 4LHZA 5JE8A 4BFLA 5EE5B 3TXXA 2UXCB 4GM4A 3GRPA 4QPZA 1Z5NA 3Q7IA 4OI0A 2NZUG 3PQ4A 4PIMA 1KKUA 2CC2A 1KYQA 4P81A 5KBYA 1J9EA 2YC4C 3CX7A 5LQCA 1KJWA 1U7UA 3KDPA 4FFSA 5KVAA 1JDPA 1IAVA 2VAXA 4PZ0A 3UJNA 4CTOA 2WQ6A 1QLHA 2GN9A 2JI9A 2QE6A 1OYOA 1I3CA 2AXNA 1MDFA 3BFPA 3F0TA 4JBXA 4N5NA 4XPIA 4KYUA 3TMYA 4BGEA 5A2QA 1PR4A 1J39A 2BKAA 1CQJA 1Z6XA 1YRHA 2C3YA 2C8JA 3RRZA 4AXXA 1OYVA 4WCDA 3SMVA 1ILWA 2BZ0A 2WTBA 4FKMA 3ET5A 3D6NB 1Z5VA 4QAJA 5EQFA 3RUCA 3VI4B 3L0ZA 3OD1A 1YS1X 3CZMA 1L5SA 3LKBA 1V4BA 3QWFA 4DFDA 3HO1A 3WA6A 3RREA 1I7LA 3UK6A 5AVQA 3WRXA 5CXQA 5JSHA 1OPXA 2O7RA 3GMDA 1LRLA 2XTZA 4BE9A 4QVIA 5CT4A 1QKIA 5JDIC 3FF1A 4LN1A 1V2HE 4MRSA 2AXPA 2C4KA 1VRCA 2MR6A 5DHRA 2ZP1A 3KOWA 4M60A 3UZUA 4CMKA 1E1YA 1I1OA 2QZ9A 3MJDA 4EI8A 3DFKA 1TVEA 1NVXQ 5DLYA 5I6DA 2QV0A 2IC5A 2Q2OA 2HSGA 2QK4A 3TSAA 4DEXA 3ZH9B 4O6VA 3BBLA 4NYIQ 4PGFA 3I23A 4DUPA 4B45A 3MMPA 3VYTB 5CIWA 4IIJF 4LHEA 2FQQA 1ZH6A 4JB2A 4RC9A 3RAJA 2GPAA 4MJLA 2ZCVA 1GLGA 1COZA 1ICEA 4HWTA 4F84A 3KBOA 4BNZA 3AEUB 4GC9A 2ORWA 3LQFA 4KMSA 3T94A 3VKFA 4CTKA 3VR2A 1MQ9A 1IJEA 1XMSA 3NI2A 2W98A 3KXIA 5E0KB 2G88A 2Z2KA 5EHNA 4U7DA 1DQPA 2VKTA 3UK1A 3BULA 4AICA 4O4HF 3OX1A 1CUXA 1OMOA 1QIIA 2OM6A 3E4DA 4FZVA 1U3GA 2PS1A 2FQXA 4TRRA 5DCWA 5MN6A 1HM5A 1OC4A 4FS8A 4B33A 5CCEA 1PS0A 1G3MA 3M2PA 1MZVA 1J97A 5E95A 2FFQA 1SXGA 5K3BA 3S2IA 3TB6A 3QKRB 1MOQA 1JBEA 3PNMA 4BZWA 4OXXA 3ZHBA 2QTLA 2RHLA 3CT6A 4PINA 1GPWB 3V46A 1UZUA 4R01A 4DDHA 1OX4A 1NXWA 1CVLA 3KKQA 2QX9A 4WW0A 1G42A 2R11A 5AYVA 3N8DA 1GFIA 3B9PA 1C2YA 2WAOA 1YS7A 3K72B 1BX3A 3C41J 2J6IA 3WYBA 1U9ZA 1X1RA 3U61B 4D0RA 2QTGA 2H2DA 5JG7A 1JR4A 8AT1A 2Z3VA 3ISVA 4JB0A 4G5SA 2QT1A 2O48X 5ECYA 4CKWA 3G13A 1M75A 2JLQA 4JC4A 2D3TA 3HUUA 3DOOA 2HMVA 1WKCA 2NTNA 5KKNB 1YAJA 5FLKA 5K0NA 4DC1A 4EZEA 4UVEA 3ZWAA 2I66A 1L9KA 1S8AA 1T8YA 2EBHX 1NVDA 2GO1A 4F6RB 1FLVA 3KOOA 3ZE2B 3ZV3A 2VHCA 4ITUA 2NAPA 3JALB 4K9QA 5JARA 5DNVA 1KFBB 1XMJA 1RYDA 2H0QA 1Z4PX 2JASA 2MTBA 4TUYB 5F35A 2Q1TA 3PDJA 2NZ8A 1IZ0A 3H2JA 1QR2A 3TX2A 1P31A 1O87A 1BRTA 4YC7A 2QRKA 4AF8A 1FDTA 3F5FA 1CUSA 4II7A 4JJ6A 2ZYDA 3VVCA 4C78A 4YRSA 2YWDA 3KQSA 4MVJI 4CIBA 3AOEA 4TRJA 2ZUUA 4M0UA 4M2LA 1KORA 4O1MA 3K9CA 1EDOA 4LYFA 2R68A 4UUMA 1D9ZA 2JGNA 2IV7A 3FUVA 1UKCA 4OEHA 3BRSA 3LYHA 5AW1A 3PUVA 3IXQA 2HT6A 4Y0NA 3TCXB 4EAQA 5K4GA 3OTGA 1ID1A 2ID7A 2R7KA 2EYUA 1JTFA 4DSNA 4ZZIA 5KYKA 4QDXA 1T9AA 5IKEA 1UMCB 3DNPA 5LJIA 5F9FA 1U2GA 2BDEA 2FPPB 4AX4A 4QRHA 2ID9A 3OIYA 3BMQA 4OP3A 4C6SA 3AGPA 4REQB 3GO4A 4D8TA 2BKEA 5JSKA 3T7RA 1KJNA 3DO6A 2Z1DA 2IYQA 3CCFA 2EFDB 1UFKA 1OI4A 4QOJA 2EQBA 3R5HA 1LCIA 4UBNA 2XRFA 1W4ZA 1W76A 1G63A 3IKVA 1UOQA 2A0UA 4PEVA 4C3VA 2O8NA 4P31A 5AM1A 1WWKA 2WNHA 1QMPA 1U02A 3MD9A 4FGWA 4PPNA 2VQEB 4LISA 4W9NA 4GMFA 2QD2A 2ZRNA 4JVOA 5JNSA 3G1UA 2H63A 4G0ZA 3GNLA 3H5LA 5CTJA 4BLPA 2VYVD 4B6RA 2WM3A 3GGJA 2H2IA 4GXNA 2OP1A 3CG0A 1Y5LA 3SQXA 1C8BA 1I3KA 4HNAB 1YJ8A 1TVMA 4TL8A 3WLKX 3I30X 4L0DA 2HREA 3B1XA 1A1SA 1G7SA 1YQEA 2O2YA 2VDWB 3IGFA 3OO0A 3JX9A 4WUTA 2H48A 3G1WA 5ICFA 2DP4E 3B6EA 4QO7A 2HXGA 2N42A 3CA8A 3KYCB 4UREA 2X1LA 3PT9A 1JXMA 1VL1A 2Q28A 3MSXA 4ZYLA 3HEBA 5GMOA 1E0JA 2Z2ZA 4CKEB 3K6SA 1ZCJA 4F4JA 4B3MB 4HNQA 4DUGA 2V03A 4TXMA 3CZ5A 2CDRA 2QTVB 1TIBA 4JB3A 5JY6A 4NCKA 1ZUD1 3I73A 2PZAA 1QGUB 3HFSA 3ZX4A 2ST1A 4AJIA 2P3SA 3RT7A 2B8WA 1A9SA 4ZMRA 3RUDA 1UFRA 3AERA 1FDOA 1BU8A 1WUYA 2CLIB 3EIQA 1XZ8A 4RX1A 2YN4A 1HE1C 1JHYA 1YA8A 4OHXA 5AJVB 4EG8A 2ETXA 4H59A 3FJ1A 2G28A 3KAPA 3LVQE 4HNSA 3T52A 5LUAA 5ADUS 1KHHA 1RAIA 1PT7A 1P4AA 3FMGA 2IZZA 1T6BY 2UYQA 4B48A 3AT1A 3HFRA 3SZOA 1MH1A 2Z57A 3PPXA 4PZCA 3TUZC 4NHEA 1KRXA 2WUWE 2CHQA 4DCTA 4MUFA 4ZZ2A 5K6RA 5FPPA 4DBZA 4IRMA 5FYQA 4R8LA 1B1CA 3R9KA 2WKPA 1SULA 3M9WA 1EJ2A 1EJ6A 4HB0A 2X42A 3ZE9A 2FTKE 1QP0A 4J8PA 5GV8A 4ZCSA 1T6NA 5ITZA 1DV2A 2CDBA 4I08A 4B44A 1TQDA 3HDTA 3UXHA 3QEAZ 4ZEXA 3K9WA 2Q3CA 4CM9A 5JH7B 1RPNA 4DJJA 4JLPA 1E3JA 2LKDA 4D80A 3I5XA 1UAAA 2EX0A 2H65A 3CZPA 1BXGA 5DCYA 4GOJA 3L8CA 1G21B 3FWYA 1D6SA 3R2JA 2RONA 4IUDS 2BMDA 5I5EA 2DCMA 3CLUC 3HCDA 3EPKA 3QBDA 7ABPA 5TT1A 6LDHA 1PNTA 4Z99A 3ZCSA 2XGOA 3LX8A 1F7VA 2ZI9A 4KQGA 3EBPA 1HE3A 3A6DA 1Y6ZA 3PIRA 4X7BA 5CA0B 1XVIA 2JLRA 2ATEA 5DB4A 5KZMB 2G63A 3WICA 5DI3A 4RU1A 1WTCA 4IV8A 5DXAA 1M1NB 1V47A 3IHKA 1QHGA 2IUYA 1RWMA 4O2BB 4WXEA 4B2LA 1ZD3A 4IZIA 5ER6A 5GINE 2A0FA 2DPLA 2VEOA 3V1TC 1VIDA 1EGMB 4IJWA 3UKOA 3VR5A 1ZMOA 5E8RA 3HXTA 2FSSA 3VU1A 1HMYA 1LZLA 2GZ2A 3FPBA 4PR0A 2XWPA 4LMAA 5LYJB 2I6FA 4O33A 4UTOA 2PUEA 4MRMA 3BKWA 3PR2B 2IPNA 3Q5EA 1VL0A 3IELA 2WPDA 1ZUNB 3IAFA 2VNHA 1FPMA 4WFJA 1Y8RA 3TX6A 3BIWA 2Q4TA 2QRGA 1RHKA 1NU8A 4NCBA 2P9BA 1FP2A 2WMOB 3SX2A 3UJHA 2VTBB 1E5XA 2IS4A 1TC2A 3PNPA 4IQ0A 4RKRA 2DUMA 3D6TB 4QDTA 4IQFA 1KK2A 1RI2A 4LW8A 4PGAA 4HH0A 3SQMA 2W4MA 2FPMA 4DNQA 3WDSA 1AQIA 1KVQA 1C1DB 1Z35A 1N2XA 2QTNA 2RHTA 2B83A 3WQBA 1G3RA 3ROPA 3PLAE 2XQIA 5EP3A 2PU7A 5CX1A 4IZOA 2H54A 3ENKA 2LIVA 1N5RA 2NU7A 1IL0A 4EY7A 3MIIA 4HDOB 3P9NA 2XNDA 1QJ4A 3NANA 3D6JA 4HEQA 2P9HA 5EJ7A 2R751 2MSEB 3B85A 1IPEA 1QONA 1R4ZA 3AKDA 2V58A 3L7AA 1BIFA 2DBQA 1JL3A 1JTVA 2QI9C 1HNXB 2C99A 1I6WA 1IY1A 1XTPA 4L3VA 1DX4A 4EF6A 5CFZA 3FFBA 1PL6A 4JB8A 5JALA 3I42A 3NP9A 4TKUB 2ZB8A 3UF0A 3FAZA 4ECEA 3EK2A 1QF6A 5K0SA 2Q3FA 4PCAA 4TLDA 1W0JA 1V39A 4AT1A 4UTVA 1ZMRA 4BPRA 4IVRA 3VI3B 3LC2O 3NUGA 3WK9A 2ABWA 2YZ7A 3W2HA 1JR3E 3U4QA 4DBLE 5CNIA 3V7YA 3X2EA 3UOWA 2O3QA 1GV0A 1ZC4A 3WGUA 3VNAA 3FETA 2GD0A 2VHYA 2ZZNA 2G1UA 3F97A 3R3WA 5I8WA 4KAXA 4YALA 4EYQA 4ROSA 1E6WA 3E15A 3E82A 2BEVB 1UT6A 3MMXA 4HCJA 4BVFA 5ITSA 1JMYA 4CM1A 4W1RA 1N6NA 1NSTA 3P4UA 4KBFA 1G9SA 2C0QA 2DUNA 1P9WA 2OFXA 4WXPA 2GLTA 3TBFA 1U7WA 4NICA 4CTMA 2Z5FA 1DCMA 4EECA 1CVIA 1ADGA 3U7GA 5EWJA 3OETA 2OBBA 4K6KA 3SHVA 3V8EA 1EMDA 2CMFA 1T4BA 2LDXA 4MS4A 4Q1VA 3TDKA 2JIZA 2O5CA 1K27A 4C03A 4TV8F 4RJKA 3WRWA 2WTMA 1I5RA 3C1UA 2WWXA 4NH0A 4G5HA 4KAFA 5IEBA 2AUTA 3WWPA 3AERB 4MQFA 3ZHXA 2X0FA 1EWYA 3FKQA 4ZT7A 1M2OA 2IE8A 2XE8A 4C0SA 4YJKA 3LY5A 4DIEA 1NBOA 1ZUHA 5KWEA 3LTNC 1QHIA 1U3UA 5LJLA 4L3WA 2G1KA 2CHEA 3K5PA 3EYAA 1RKVA 4OQLA 3A9UA 3ZJ4A 2WWYA 3GFSA 3L46A 3KSDO 1NQ5A 1UKZA 4A0HA 4NC9A 3H9QA 4RQUA 5C5DA 2H1OA 3DT9A 3G0OA 2FGJA 2GVNA 3F6YA 3FBTA 2JJ1D 4CQMB 5JR3A 3AHEA 3HSYA 2NNLD 3GAMA 3K09A 4BJHB 1IDOA 2HHCA 3B60A 3ZCVA 3LT4A 5I4CA 1E3QA 2JAXA 2NTEA 5T3YA 4B5KA 2OCDA 4MO9A 3RVPA 4I14A 1LQ2A 1TNDA 1ZD5A 3GJYA 4A7PA 3DTVB 3ZPXA 1FXWF 4YREA 3LSTA 3GNTA 3DEIA 3PR1A 2V7QA 2AI1A 2B35A 2WF6A 3NOOA 1E79D 2HD4A 2O23A 3TQOA 4JI3B 5JWHA 2PFKA 5CM8B 4PS0A 1I32A 1JAXA 1NBME 4BJ5A 2GVDC 1N2OA 2E18A 1AGXA 1EQUA 3G2PA 4IICA 1KK1A 1SURA 3VR6A 1OASA 3JYOA 4RDIA 5FX2A 2CXOA 1W75A 5C7YA 5SY9A 1Q3HA 3HA2A 1NLFA 2AMVA 1P5HA 5HJEA 3O38A 3E9DA 4L08A 5DLEA 3TS1A 1V1MB 1UIMA 2JJ2D 4Q1AA 3GLGE 4FN4A 1ZK4A 2CLDX 1JG1A 2DC1A 1C30A 3AFOA 3R7NA 5BVGB 3GUYA 3ICOA 5ETJA 2FW8A 2WHPA 4MR7B 1C3VA 2XRZA 1GQYA 2QLTA 3V8QA 1LC3A 3M4JA 4OHYA 1SHKA 4UNNA 3D8TA 5FOTA 2XVMA 2Q3LA 4HVTA 2FZKA 1DO0A 2GYYA 4G85A 4KMRA 1WXDA 4RESA 2WWGA 2WZCA 5KYUA 3HJUA 2HJWA 3TINA 3E9ZA 5JNVA 5EVJA 1EK2A 4JI1B 3FUCA 3IAS6 4YT4A 5G1NA 1LLCA 5A4JA 3AUKA 4MUXA 1P33A 2X2OA 2W70A 3T06B 4NSNA 4BZPA 1MTOA 2OQIA 3BHNA 3MERA 4IVQA 2OHJA 2QHXA 4X24A 6REQA 4B3IA 3I62A 4L8WB 5C4MA 1GN8A 5D1HA 2WTUA 3JD4A 4IIFA 4LBWA 4MIYA 1Q6ZA 1A8PA 1E8MA 2V74B 1UMBB 3LJKA 3P5BA 3ZQ4A 2IS1A 3WAKA 5FI5A 5TX7A 4QEKA 1YKFA 3KPYA 4II3A 4US1R 4JLOA 1HKHA 4UTNA 4WXMA 5M3BA 1OU0A 3AI7A 5EIXA 5LQAA 3M6LA 3X1KA 2FUG1 2ONKA 2QDKA 4CG1A 2LVBA 1ORDA 5GVRA 2PKQP 2H7CA 2G71A 2KLHA 2VJPA 4LCEA 4XIYA 4YJ3B 2C61A 2I99A 3SJZA 3UV6A 2QZJA 4A8PA 4AURA 3K94A 3AEZA 3F78A 4IFIA 4PYOA 4TVOA 2G76A 3UKJA 4BNGA 5JAZA 3AWIA 3EMDA 1NI3A 3W77A 3ZXIA 2Q4RA 1IXZA 1ULHA 5E6RA 1NOKA 3A9RA 2POCA 3IVAA 2I7CA 5HCIA 3JQQA 1XYYA 2ZSBA 2OHVA 3DBHA 4KKXB 3AZPA 1OXUA 4E1BA 5CDYA 2B78A 2C9MA 4H6XA 1J70A 2W6MA 3DB1A 4B4UA 2CV2A 5BN3A 2BEUA 4RZQA 3OCUA 2R85A 1T9ZA 2IQ5A 1J8QA 1JEQB 3IURA 4ZCTA 1G4HA 1JZQA 1UXJA 3NJ8A 2NYUA 3PHCA 4FDMA 4LOIA 4P2BA 4IJKA 4I6JA 5EZYA 1GCOA 2LTAA 3S27A 3RS4A 4K9PA 5C8VA 3PHHA 1AT1A 4P32A 1UT5A 3HEMA 4XSHA 1G21A 3DEZA 4JLVA 3RBVA 4WZBA 4YXWA 1ENPA 1RXCA 2GR9A 2ZBDA 3E1GA 4IPTA 2F2TA 2C58A 4CVNA 2XYHA 3M2TA 3A1SA 1QF7A 1R74A 3Q1KA 4TYMA 2GFHA 4WUVA 4UU0A 5BWNA 2IX9A 2PO5A 4ZOLA 4NCNA 2YV1A 3C8ZA 1MAVA 3EZFA 1W5SA 3GUHA 1TVKA 4HWOA 4D4MA 1W1UA 1B76A 3R5KA 3IL2A 1JAIA 2IPLA 4ZCLA 4BNDB 3ZY2A 2WEKA 1NBAA 4TRMA 1XHLA 4BRZA 2WJGA 1K8QA 1XTVA 4L27A 1NVKA 1U2DA 5C2JB 4PG6A 2VDWA 1PJSA 1QK4A 5B3AA 1JMKC 2K7ZA 3FDXA 4RHEA 1P0CA 2DRIA 2HMAA 3DULA 5ALVA 1RM4A 1T36A 4XQEA 4R05A 2E4YA 4I1YA 1JPNA 4TPKA 5CD1A 2PUAA 4IXNA 4XR9A 3TXAA 1G1MA 2WJHA 1SU7A 3G5AA 1Y37A 5HGXA 1NJ1A 1I2ZA 2WP0A 4GBMA 3DV0B 4YASA 1E7WA 4ZO6A 5A0VA 3JCZA 1J7JA 2WYOA 1Y8RB 3O26A 1PR1A 4FDUA 2Z0MA 3GAZA 2JH9A 4EJSB 3SMQA 1JDBC 1FNMA 1U7DA 4OHBA 3ANTA 2H59A 3QKWA 2ANBA 1CJTC 4KH1A 5GM2A 2BGGA 1E98A 3WHPA 4A2QA 1XNJA 9GPBA 3I2JA 3D1JA 1DIBA 2ZIXB 4EJ2A 5DM70 4X20A 4MA4A 5HKAA 2RAVA 2GZDA 1IY2A 1KI6A 2B37A 1IUOA 2HBYA 3EVFA 2DTEA 1YH3A 2J67A 3PC3A 3ROXA 4CKYA 3DBLB 5J4YA 1KZ4A 3SYRA 2WJPA 3HY4A 3V97A 3KYBA 1L4MA 3FBWA 2GA8A 3W5IA 4MQ5A 1WXWA 4H77A 4N41A 4AYXA 1FYDA 2FOLA 3FMFA 1KZ1A 3PD1A 3AVOA 4R2JA 3TAXA 3QBVA 4DJFC 3THYA 1U8EA 4CODB 3G82C 5ITVA 1MC8A 3U80A 1R8YA 2NXEA 1E96A 4WE3A 4C7KA 3T1TA 3HWRA 1K8ZB 1QO9A 1O6GA 4NU8X 2FUNB 1NJ6A 2NN3C 3LG2A 1GUAA 4XDZA 4ZEWA 4CLOB 1VE9A 3CX8A 3VMFA 3ORFA 3ENWA 4M0KA 5IF3A 1M33A 4EP1A 5KB3A 1HFEL 2G7ZA 3PDIB 4ZT5A 2OUIA 2XT6A 2AF4C 4QHSA 1JIKA 4E31A 4YYZA 1JLLB 1NC3A 1AMOA 3RYIB 1C3OB 1Z13A 2C95A 3DLAA 4POOA 4O4JA 1S89A 4MGEA 1JI3A 1RRGA 2XUAA 2PJUA 3I09A 3SYLA 1JFLA 1ESMA 5BNTA 3BTSA 1JEYA 4HNHA 2J9XB 1G20A 1JEJA 3RGGA 5IZ4A 5H1YA 2XQKA 1M34E 1OR8A 1XO1A 2NZYA 3AF5A 3P27A 4GH5A 1QBKC 2F3SA 1ZSVA 2XMCA 4HB3A 1ZGHA 2G0TA 2VRNA 4MMXB 1Y82A 2CXXA 2XMSA 4RPIA 2GK7A 3DF9A 3IP3A 4Z5XA 1W5TA 3F98A 5JS7A 1EBFA 4MARA 2YS7A 3VR4D 4EG4A 4YMVA 3MRXA 4KO3S 4JUCA 5E2AA 3FCAA 1V43A 3DDOA 3EMBA 4YTEA 4WXHA 1Q77A 4IDEA 1HL7A 3EEOA 3OPYA 5KS2A 3EWAA 4A0SA 3EVAA 5HF9A 2R1TA 5CGZA 1Z5GA 2BFNA 3FOWA 4QQFA 5BV1A 3L07A 3D7KA 3E81A 1SBCA 1TCUA 3CB2A 2WKSA 3QVJA 1RWPA 4GIBA 5AI0A 1V16B 3K5HA 1NMEA 2YJNA 4QM6A 2I6QA 4E21A 1AKEA 4Y2PA 4WK0B 4P53A 1H0RA 3B82A 3VSCA 2BIFA 3Q7RA 3SICE 1VYHA 3REQA 3VPXA 3O4GA 4N65A 3OPVA 3ZDAA 1UPUA 1X7YA 5GJWC 1C9MA 4J76A 4YRRA 5ECDA 3IHLA 1EBBA 3LF1A 3MJTA 3C6XA 3ZHCA 1SJ9A 2M6RA 1LBEA 1DC7A 2N3ZA 1ZAYA 2NMVA 1YRAA 4KN5A 4X63A 3WGMA 5IYZB 2V97A 3B2EA 1F5SA 1DJNA 3Q5GA 5HE9A 2Z8YA 3HA7A 5A3SA 2N9UA 1RWNA 1JKIA 3LY8A 2OV8A 2JCYA 4KQWA 4LV6A 1YMUA 4KPUA 2VH1A 1ANKA 4N5MA 4RFLA 2RBGA 4UCWA 2F64A 5DHFA 5IVIA 5A9TA 2OV1A 2H4ZA 4BEWA 5DBFA 1RBYA 4OQMA 3B89A 3SC3A 1EP3B 1NY6A 3C3MA 1GQ2A 2H2AA 1JIXA 1FP7A 2BGKA 3SI7A 4YX9A 3TEMA 4E5NA 1T35A 2JGJA 5TPZD 4DG5A 2QBYA 3GPCA 5D6NA 2WAYA 3DFIA 2XQVA 1NXPA 5HUQA 1IOWA 2A94A 1A98A 4J75A 4QU9A 4RK7A 3PTLA 4EKYA 3HNOA 2QQGA 3DHNA 4RENA 4DWJA 2JCBA 3PNLA 3BFJA 4HRVA 5HKKA 1O8CA 2E4ZA 2EBWA 1DTSA 1R0BA 2GBPA 4KEAA 3BL8A 3C7TA 2Y1OA 4AVYA 2CB9A 2XRMA 1T2VA 5K8VA 1QGED 4WKPA 2Y3IA 1KBQA 2CMDA 5JMTA 3DA8A 1RQXA 4FGZA 4FDLA 3IB6A 1OXMA 3MYYA 4TWIA 5AR1A 3KKZA 5BVGA 3COJA 3VNVA 4H1UA 3P94A 1CR1A 3HCAA 2WSSA 2GEDA 1PQ4A 2XPCA 1E66A 4FOOA 1MJ5A 4YAEA 5F1PA 4GICA 3ZE7A 1UDCA 4MB2A 3QPWA 1V8FA 4HQKA 1H1TA 2AVNA 4OLHA 4MGHA 3SKXA 2YC2C 4C2AA 1XZKA 1EQAA 1NRIA 2C7VA 2O0HA 4F3TA 2IYXA 1I5OA 4DUYB 2O2JA 2P67A 4MR8A 4U2KA 3UGTA 2D4HA 2FG5A 2XVAA 2C8LA 3H6HA 4MDHA 4PXYA 3TLBA 5BUCA 1USKA 2LGJA 5FV4A 1QLJA 5T7BA 1DCTA 3LDFA 3DWIA 1XZLA 4R69A 2P90A 4R41A 3H1PA 2RBKA 3DE4X 3OLZA 1SHZA 2PWBA 2O5RA 3AF1A 4II2A 3UJPA 4Z4GA 3JQDA 3C4JA 1RHRA 4BNJA 2Z6VA 1B3RA 1CE8B 2FN7A 2I8LA 3O90A 1YE5A 3C1AA 3QV1A 4GI5A 4P92A 3LXMA 5DPMA 3WAJA 4O4IB 3VISA 3BVPA 1RHUA 3UW1A 2QA5A 1DIGA 2L0XA 1CY7A 3CW9A 4J2HA 3ZK8A 3C5EA 3WQQA 2JFZA 4IIUA 2D0OB 2EJVA 2OFWA 2HOQA 1XAJA 3EJWA 1XLVA 1LTHR 1E7QA 2BGNA 2NV6A 1CUWA 4P7GA 4QEZA 3VPFA 1VE6A 2VJAA 3RFXA 4CETA 3QQ5A 4RA9B 2CFIA 5LLSA 2MSKA 4U5QA 2V0GA 4BJ6A 4YCLA 3I3SR 1NSFA 1N7IA 1DOZA 1CNFA 3Q9UA 1GAJA 1Q2UA 3E6AA 5IXSA 2JAPA 2OC9A 4OO3A 2YJ3A 5KQPA 4B6OA 1MO6A 1OIXA 1LTKA 1OZHA 2F62A 3JVDA 3P2EA 4JP8A 4IQGA 1G9XA 4N5DA 4JLMA 5DNUA 1YFKA 1QG4A 2IKQA 1LSOA 2ZTUA 3THYB 1A1VA 4IWNA 3CG4A 2VEDA 3FGZA 2DFNA 3LYLA 2FSPA 4OSPA 4PYMA 2ZIGA 2W2PA 5DX8A 3TIVA 3TSWA 3F3YA 3ZLUA 2MMCA 1MV8A 2JGEA 3M6WA 4MHOA 2HWYA 5F1OA 3RROA 4BO0A 3KPJA 3W7AA 4DWOA 2XB2A 3R0QA 4YRAA 2A2ZA 1T0JB 5L6MB 2W4IA 2BEUB 2H29A 2PZLA 3AHGA 3NM5A 4IJVA 1O94D 4P5DA 1PWEA 2BKLA 4GOLD 4EY4A 5AKIA 4PTZA 3A9WA 4QXRA 2NX2A 1H8ED 1E1LA 3K70B 3A6HA 3CPJB 2JJYA 1T3TA 4TZTA 3GHYA 1YD7A 4IJMA 4QXPA 5FAXA 2PMDA 3EXG2