5EL0A

Crystal structure of an oxidoreductase (short chain dehydrogenase/reductase family) from brucella ovis in complex with a partially ordered nad
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
239
structure length
223
Chain Sequence
ERKTLVLTGASRGIGHATVKRFSLAGWRVITCSRQDFSENCPWPAGPEDHIKVDLSDPEDIGKAIAEIRRRLEANGSKLHALVNNAGISPKAEGGRRMNSIETPMAVWRDVFQVNFMAPIMLARGLFKELEAAQGSVVNVTSIAGSRVHPFAGTAYATSKAALAALTREMASDFGPYGIRVNAIAPGEIDTAILGKTSEVAETIYFLCTETSSYVTGSEIHIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxidoreductase, short chain dehydrogenase/reductase family
publication title Crystal structure of an Oxidoreductase (short chain dehydrogenase/reductase family) from Brucella ovis in complex with a partially ordered NAD
rcsb
source organism Brucella ovis (strain atcc 25840 / 63/290 / nctc 10512)
molecule tags Oxidoreductase
total genus 79
structure length 223
sequence length 239
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5el0A00
3BTUA 3WOHA 1B3BA 3RIHA 2Y99A 1O9BA 4YAKA 5KJCA 1U3UA 5IXYA 3CEAA 3WQSB 3RFXA 4D41A 6ADHA 1SB9A 4NG5A 4BOYA 1PZEA 4K1LA 5KCZA 4NBRA 1B0AA 3AWDA 1QYXA 3OF2A 4I5GA 3D5QA 3WB9A 1EBFA 1XIVA 3EK2A 2I3AA 1MP0A 1WNTA 3F1KA 4D43A 4MINA 1GTMA 3RSHA 2NVWA 3KXDA 4L76A 1NPTO 3GT0A 4EUEA 4XYMA 3BXXA 4A5OA 3OP4A 4OQZA 1OBFO 3WBBA 1HLDA 4DYDA 4RZHA 2FMUA 3VPSA 1J0XO 1B26A 4OO3A 2W90A 4NZ9A 3QWFA 1LSUA 4MVJP 4CMEA 3DBRA 2FSSA 1JA9A 2HJRA 3HDYA 5GY7A 4HXYA 3UAGA 5EJ2A 2G1UA 4IQ8A 1O0SA 1Z7EA 1NASA 4HP8A 3CZRA 1BTOA 1KY5A 1N9GB 2ZTVA 4IMRA 3NTQA 1SZJG 2AG5A 4J2HA 5G0UA 1TEHA 1K6XA 4FN4A 1IPFA 2C82A 1EK6A 5DN9A 3DAFA 3ZHZA 2ZTMA 1PGNA 1QSGA 1YBAA 5JY1A 2DBRA 5EQDA 1LDBA 1HE2A 1TLTA 1FJHA 2VTEA 4ND1A 2ZATA 4YJGA 3BMOA 5B37A 4EJMA 4Z0TA 1R6DA 4BNIA 4CMJA 4Z9XA 3PLNA 1ADGA 5TSDA 4WPGA 3L6OO 1P45A 3H2ZA 4R51A 4L75A 1V3TA 2CD9A 3E9NA 1DSSG 3EAGA 4WLUA 3KB6A 4QEDA 4GPD1 3E5RA 4QT0A 1YKFA 5THQA 1GQ2A 1O6ZA 1E7YA 1M76A 1EVYA 1DRWA 3H9UA 1HYHA 4ALNA 3TZKA 4G5HA 4GBJA 4JX8A 5CPFA 4BMNA 5L4SA 4L73A 1Q0QA 4MDHA 2DPHA 2YQ5A 4WCFC 1PL6A 2YQ4A 5JDCC 2X0RA 3GRPA 2VTDA 1GCUA 2Q1WA 4Y9DA 3VHRA 2GDZA 2VZ8A 4OQYA 1ISHA 2X5JO 2B5VA 4MIOA 2OOSA 2RBEA 4CLHA 2NVBA 4JBIA 3ICCA 1WMAA 2G76A 3MJ4A 1T2AA 2C5EA 4IGFA 3VKUA 1VKOA 3BMCB 4NPCA 2UVDA 3PGJA 4MP8A 4RQUA 4W9NC 5IJZA 1R4NB 3K96A 1U28A 5B4UA 4XZ3A 2VRBA 4WOJA 3ZNOA 2X9NA 3AM4A 3OMLA 2NU8A 1QXSA 3BHJA 1DO8A 1CQIA 1LRKA 1LSOA 3C1TA 1ENPA 3JSAA 1M66A 2VWQA 3SEFA 4FPXA 4FFMA 1R0SA 1HZJA 1GUFA 3LC1O 1KERA 1PJLA 1BW9B 4RF5A 3ZCXA 1HRDA 4PGFA 5FFFA 4BKOA 3F46A 2YJZA 3JQ8B 3ANLA 5H82A 2OFPA 1B8VA 1ENZA 3RC1A 2LDXA 7MDHA 2EIHA 1FDTA 3DFUA 1DFHA 2NU7A 3NGXA 4IJVA 5TJ9A 2PV7A 2P5UA 2IDZA 1BWSA 3MJCA 5DCWA 1P1HA 3PHLA 4LRTB 1UDBA 3WMWA 3RKUA 3KBOA 4F6CA 2ZB8A 4ZQBA 4IMPA 5A4DA 2X7HA 2JCXA 2Z1NA 1QLHA 2IEDA 3E82A 4LRSB 3S55A 4AJ1A 2WWRA 3GH3A 4E5KA 1V35A 3RJ9A 1N7HA 1MFZA 3JQ7A 4YJHB 2EW2A 4MP6A 5LDGA 3UF0A 4XCVA 4BNTA 4LMPA 3VPGA 2EEZA 2JCYA 1Q1NA 4IY1A 3ROQA 3OH8A 3KTDA 3HFGA 4XR4A 3WLEA 5HRUA 1UZNA 3O9ZA 1PSDA 2Q46A 1XDWA 1IUKA 4YCAA 1Y9EA 2HRZA 1G0OA 3D4PA 3HJAA 1XYGA 3EZLA 4F3YA 1OC4A 1E7WA 5C37A 5A03A 3HUDA 3ZWNA 2B5WA 1EQUA 1PJ4A 3GLQA 1YBVA 5G0TA 3A14A 3E9QA 1DHTA 1GD1O 1T2FA 4UVDA 4BO8A 5F3RA 2TMDA 3DBLA 3OQBA 4R54A 4NBUA 3U4CA 5CDYA 4RJTA 5G2OA 3PWKA 2CDCA 4WNCA 2Q99A 3ZV4A 4BO5A 3GOHA 3WYCA 1DBVO 3ON5A 4E32A 4NU6A 3OA0A 2ZIZA 1NQAO 2P91A 3GHYA 2DTDA 1JKFA 2WE7A 2YY7A 4XIJA 1E3WB 3I9MA 3HB5X 1NWHA 1NHGA 2I9PA 1JAXA 3AOGA 3I3OA 4IZHA 4BGEA 3U3XA 1H6DA 3E6AA 4WCDA 3S2GA 4GGPA 3IMFA 4FR5A 4JROA 8ADHA 4MJLA 3P2OA 2V6MA 4NJOA 2XXBA 3OETA 4B3HA 4R1UA 4R41A 5F21A 4GKBA 4AL4A 4GGOA 2YFHA 3ZV6A 2Y0CA 3RD5A 2VYVA 5DNAA 1K0UA 2HJSA 3I9KA 3B1KA 1ZJYA 1E3IA 1TI7A 4NHEA 4YAJA 4EGFA 4E4YA 1LQUA 9LDTA 3ASVA 1GCOA 5JCXA 1GZ3A 1K3TA 1X1TA 3OJOA 2Q4BA 4N5NA 2NM0A 4FB5A 3DOCA 4UVGA 3T4XA 9LDBA 3TF5A 3DHEA 5THKA 2A35A 1Q7BA 5DZSA 3W6ZA 4O5OA 2D0IA 3ROMA 1M67A 4D44A 3O8QB 1WMBA 5DCUA 2AA3A 4GX2A 1MXHA 3SC6A 2X58A 1A4IA 4PG5A 4BVAA 4Y8VA 5KTKA 1E7RA 2E82A 5KVCA 3OICA 2ZB3A 2BFAA 2Z5LA 5EINA 3F5SA 1BHSA 3VDQA 1E6UA 4I9NA 4DWVA 1R0LA 4CLDA 2E37A 3QWBA 3Q2IA 1BSVA 3ZWXA 5CDGA 4UAGA 3KM0A 1MV8A 1NQOA 3GQVA 1GUZA 3PPIA 4OKNA 4BO6A 3ZWAA 2I66A 4D45A 3QHAA 1DXYA 3FPLA 4PLYA 2Y0DA 1RM3A 3BMQA 1SNYA 4P4GA 4B8ZA 2X86A 1V6AA 1ZW1A 3FCOA 5FI3A 1Z7BA 1NFFA 5A3VA 1VSUA 2PGDA 1L1FA 3WFIA 4XDYA 1P31A 1WDKA 4HNHA 3VTZA 4M54A 2H5LA 2B37A 4J0FA 1MA0A 1W4ZA 2D4AA 3JQFC 2POQX 2AEJA 4GX1A 2PWZA 1FXSA 2O2YA 5MGBA 1N1EA 1DC4A 1BG6A 4CUZA 2OP1A 1XWFA 3BMNA 1ONOA 2VYVD 3CTMA 1Z45A 4DPMA 4Z6KA 1B2LA 2GLXA 4CM6A 5JS6A 1ZXLA 5CG1A 3VPXA 3SXPA 3DZJA 2PY6A 1DC5A 4LW8A 3FWNA 2YUTA 2FR0A 1KETA 1RKXA 4YRDA 3WGZA 2OP0A 3JQDA 2W2KA 3GPIA 5K9ZA 5FYDA 4P4NA 4DA9A 4IINA 4II3A 5JO9A 5ILOA 1PX0A 1H2BA 2E4AA 1LLQA 3GVHA 5IG2A 4FCCA 2GF2A 1U7TA 4YTEA 1LDGA 1ZK2A 4J9UE 3V2HA 4D3SA 3QA9A 5CFZA 1XA0A 4DQVA 1GL3A 3DC2A 3DDNA 5AYVA 5IZCA 1UXKA 4N18A 3ZHYA 4BV9A 1ZNQO 4FFNA 3RUAA 2R2GA 5ENVA 2AEFA 5C5IA 3A9WA 3VH4A 1EZ4A 4J90A 1VKNA 2RH8A 3GNSA 1RM5A 3OIGA 1C1DB 4J4HA 1F14A 2IE0A 1SBYA 4DIFA 4ZGWA 5KVVA 4QTZA 3H5AA 2C0CA 4MKZA 4YJFB 5TX7A 3Q3CA 3ZWYA 1JAYA 4IGEA 4BS9A 3CPSA 4DLLA 4DPLA 4BO7A 3OM9A 1KVQA 4ZU3A 5JAQA 3ZU2A 5L4NA 4Z9YA 4BO9A 2RAFA 1LDNA 1ENOA 4J1NA 4EYEA 4L9RA 1GYQA 4JIGA 1AUPA 3KZVA 1DAOA 5ADHA 3AU9A 2GO1A 2BFOA 1HT0A 4FFLA 3ZN2A 1GFSA 4WCFA 2OUIA 3GDGA 3AI1A 4IDCA 2Q49A 1Y8RB 4JP3A 1S6YA 4PLVA 1JKIA 4DXHA 4GMFA 5JDCA 4EDFA 1NBOA 2H63A 4TKLA 1X7HA 4UEKA 3H5NA 3Q0EA 2GASA 5ILGA 4B7UA 4F6LA 4NBWA 1MG5A 1JW9B 2YZ7A 4TRMA 3ZU3A 3BYZA 2EKPA 4CR8A 3EY4A 5TQVA 4Q39A 5L7TA 1DEHA 1C1XB 2PLAA 1ZFNA 4RZIA 5IN5A 1NNUA 4BNXA 3I9OA 3C7AA 1GPJA 3A28A 3I23A 4RF3A 4TKMA 4NIMA 4UUOA 1C1XA 1T4BA 3GFBA 3V8BA 4D0RA 3LT4A 2PKQP 1JDJA 3SBOA 2HDHA 3MCVA 1MG0A 2J8ZA 2ZK7A 4XQCA 5B1YA 3AI2A 2OXIA 3T7EA 3KLPX 2BGKA 4DIOA 3JYPA 4U0JA 3KUXA 1E3SA 1LDMA 1UXIA 4XB2A 1O8CA 1SEVA 1AE1A 4MKRA 4CMBA 4JJFA 2IYPA 4WLVA 1E92A 3H8VA 4A26A 1V8BA 1EVJA 3PDUA 3JQGB 1D8AA 1E6EA 4DLBA 1BXGB 5AQ1A 4GVLA 1YS4A 4UVEA 2PZJA 3EW7A 5KOIA 4MP3A 4S3MA 1LXCA 3CH6A 1DIBA 1NVTA 1HETA 3GVIA 1YXMA 3WSVA 5MDHA 3E5MA 4URFA 3QLJA 4MIEA 5B4TA 1Y81A 4WLOA 4R1SA 2EHDA 1L7DA 1AXEA 1Z82A 3K31A 5TT1A 3B70A 4R69A 2RH4A 2PZMA 4W7HA 2WEKA 2Y1DA 3LT0A 4E6PA 5L40A 4U5QA 5GZ3A 1IZ9A 2B36A 3UVEA 4KWIA 2X5OA 3ZWOA 2NSDA 4Z3DA 2YHUA 1ZVMA 5DP2A 2BFPA 4Z0HO 3S8MA 4WEQA 4ZHSA 3G49A 3ONEA 4B8WA 4LK3A 4BKUA 2OHXA 3OBBA 2UUPA 5ER9A 5G0VA 1HXHA 2C29D 4CL3A 4BKQA 4YQYA 2D8AA 2ZJ0A 2J3JA 1YGYA 1ZSNA 5U1PA 1EBUA 2ZCUA 4ZVVA 5I9MA 3RVDA 1E5LA 1NQTA 1VLLA 5FF9A 1AXGA 4B4WA 4NK4A 4KMSA 1YQDA 2Y67A 1UZMA 4YB8A 4XEHA 4H7PA 1F12A 3ETEA 1PJSA 4J7XA 3WGQA 3RAJA 3D5TA 5C7IO 5JDIC 4TWRA 3SC4A 2VHXA 5TT0A 2GRAA 1FDUA 4CLRB 4FOSA 1PGJA 4Y98A 5K6AC 3NDJA 1DFIA 1ZSVA 1XLTA 3O4RA 3P19A 1R37A 1VE9A 3TFQA 1EFLA 3H3FA 4A0SA 1VSVA 1ZUD1 3SLKA 1XHLA 4B4OA 5JBIA 3QVXA 5JAMA 3SVTA 4XRRA 5T8KC 1WDLA 2EJVA 3GVXA 3DBHA 3KSDO 3QE3A 3PIDA 2JD0A 4RCVA 3TJRA 3ZWMA 2P68A 1LDYA 1GYRA 1H6CA 2BLLA 3A06A 3FNGA 4ROSA 3MTJA 3FR8A 3IUPA 4WJZA 5L95A 2XPCA 4I1IA 3HQ4O 1LNQA 4ONEA 1HLPA 1D4FA 3DOOA 1NM5A 3UHAA 4FFRA 3W4KA 4I08A 5DP1A 1QYVA 3H6KA 3HDHA 4R1NA 2NQ8A 4EEXA 3PI7A 1ZO8A 3ULKA 3ZNQA 4ZD6A 3KVOA 4L0QA 4BV8A 1U5AA 1NVGA 3W8EA 3EGOA 3ROPA 1WXDA 2IEBA 4A2CA 5L53A 1TT5B 3NAQA 2IXAA 1T26A 4NFHA 1OMOA 1TB4A 1I36A 3HE3A 5T57A 1Z74A 1D1TA 1WP4A 2A4KA 1BGVA 2P9CA 1XGKA 3RCBA 3TSCA 4CUKA 4NMHA 3FF4A 3OIFA 1V3UA 1BVRA 4K6CA 5A04A 1X7GA 4RPHA 1DFGA 3AJRA 1A5ZA 4RORA 3K30A 3WSWA 1LSJA 1ML3A 1NAHA 3JQ9C 4EZBA 3IUSA 2IXBA 2GN6A 2O3UA 1JU9A 4I5FA 1GEEA 4LGVA 1DLIA 4XJTA 5F1OA 1I3NA 2O3JA 4K26A 2GN4A 1B8PA 1NFRA 1GAEO 3BTVA 4YAGA 3DTTA 3L6EA 4YBZA 3WQQA 1PWXA 4PG8A 1T24A 2DVMA 2AEMA 1H93A 3B1JA 4J0EA 2JL1A 5JMPA 4Q3BA 4DUPA 3PFFA 3KYCB 1Z75A 2GUGA 3JTMA 1DDOA 3PYMA 2NV6A 5CDSA 5K0ZA 1LQTA 1O5IA 2VZ9A 2HLPA 4ZJUA 2GSDA 1OZAA 2DTXA 4ZRNA 3R3JA 3TPCA 2Q2WA 4TVOA 1E1MA 3U4DA 4KDFA 4RDIA 1LC3A 3AOEC 3C3XA 1RWBA 1U3TA 2X0JA 1E0DA 1N7GA 4NR0A 4W4TA 1H9BA 3H9JA 4RL6A 3EVTA 1VPDA 3UGKA 3D3WB 1ONNA 4XA8A 3E18A 4NH4A 2FSVA 1FDWA 4XD2A 3ADPA 3CINA 3O03A 4CV2A 1I2ZA 4BO1A 5F5NA 5DDIP 5AVOA 4D0SA 1JKJA 1O89A 4CQLB 1AHHA 1EDOA 3FTPA 4Q3EA 3D3WA 1T1RA 4CMKA 1HEUA 4BB6A 2PH3A 2QRJA 1VJ0A 3CMCO 1H5QA 3T7CA 1V3VA 3WS7A 1RJWA 1F0YA 5ICSA 2HMWA 3W6UA 1HYEA 4PLTA 1KIFA 4ZRMA 1XU7A 1PR9A 2NU9A 1Y6JA 3WXBA 4S1VA 1DHRA 4IJKA 1QKIA 3UKOA 4TROA 2VHVA 4YXFA 3PDJA 4YAIA 1YVEI 3PQDA 1XU9A 1P0CA 2V65A 4WOKA 4YT2A 3GK3A 1N9GA 1I24A 4U0KA 1YB4A 4QQRA 5A5FA 2ZTUA 3I1JA 2G17A 2O50A 3PWZA 5COBA 3IQDB 1WAMA 2E49A 4D3FA 3E8XA 4FJ2A 1DAPA 1YQGA 4BGUA 3C8MA 3I4FA 5KIAA 1MB4A 3PRJA 4YWJA 1P1IA 2Y05A 4CR6A 4E3ZA 2BRUA 1Q7CA 2O4UX 4R9RA 4DQUA 3ONDA 1I10A 5JYDA 2DTEA 1C0LA 2PGJA 2UYYA 1LRJA 1A71A 4NDNE 5AXBA 4DPKA 4NNJA 1CF2O 1EQ2A 4M49A 2Q1UA 2X23A 5U9CA 1QRRA 1J6UA 3LK7A 4P38A 1ZK1A 4D79A 3JQCA 1HE5A 1KC3A 1Y1PA 1ZMOA 4WLFA 4ZN6A 5FEUA 4J2OA 3VTFA 2GCGA 3DMTC 4HADA 1CIVA 4IS3A 2PK3A 4E2YA 4AVYA 1DIHA 4RV9A 2UDPA 2D3TA 2WTBA 4KZPA 5KKCA 3RUIA 3GZNB 2BD0A 4CMIB 1N5DA 3NT4A 1LLDA 1FMCA 3R3SA 3W1VA 1HL3A 4MVJH 4IIVA 3MJVA 3QW2A 5T6BA 5DCYA 1KEWA 4N5LA 4IM7A 2QRLA 2CDBA 4JK3A 3LU1A 4D7AA 1UDAA 4RPGA 4RLSA 5TLSA 1WLYA 1KBZA 1HDZA 1YDWA 5HM8A 2IODA 3NTRA 4BQPA 3AUUA 3WDSA 1IYZA 1F06A 1GQQA 2Q2QA 5AXAA 5KJFA 2GPTA 5T64A 1DIRA 3KETA 4OOFA 1YB1A 3GA0A 5BNFA 5EIOA 3DOJA 1D1SA 3VH2A 4N54A 1LEHA 5B12A 3UOGA 3BMCA 1NXQA 4CQMB 2NU6A 4XGKA 3DZGA 4CJXA 1R4NA 1ULUA 2NTJA 4WK6A 4L74A 2HRBA 1GZ4A 1AGNA 2Y1FA 4EI2A 1M75A 3PQEA 1MC4A 3K8ZA 1PJQA 2C7VA 3DHNA 4R4JA 2PGLA 1NPYA 4HY3A 1E7MA 2ZKLA 4GVXA 4OSPA 1BW9A 4B7CA 4JBGA 3F4BA 2P2SA 3R6DA 3ZW9A 2DPGA 4KTTE 4PG7A 1A9YA 3PWSA 3JQ8A 4PZDA 3KHUA 4Y6PA 1ZCJA 3CUKA 1DIGA 3I9JA 3INGA 2HUNA 3PYXA 2GD1O 3T4EA 3HNPA 2UAGA 4PG6A 1ZZEA 1EUZA 5ENDA 1UUFA 2ET6A 1QORA 3WX0A 3UCEA 2Q50A 1FK8A 5COAA 1NFQA 3NT5A 4CV3A 3G79A 5ITWA 4LCEA 2EGHA 1R0KA 2CVZA 4YJHA 3OJLA 3TL3A 4WNIA 3C7CB 3ZWBA 2I76A 1PQWA 5BSGA 2HQ1A 4BNJA 4DRYA 3P7MA 2V6GA 1SC6A 1W0CA 2WM3A 3I9NA 4XWYA 5JDIA 5LDHA 1LUAA 3A1NA 4BNUA 4Q3CA 1A72A 5G4LA 4E5MA 4J16A 3GF4A 1ZBQA 3DEYX 2VHWA 4ZQEA 1DJNA 4FFOA 1UXJA 1P74A 3L4BC 3Q9UA 3TWOA 4BNLA 3IKTA 1Y5MA 4ALKA 3I4CA 3OQ1A 2GZ1A 4YR9A 4JCOA 3GUCA 2Z1MA 3GGGA 4E2XA 3QQPA 2AE2A 4ND4A 4O6VA 3LYLA 4E2WA 3H7AA 2JFGA 4J4BA 1Q2XA 1LA2A 3COSA 4B4UA 2Y93A 3JYNA 3AUSA 4AJIA 2F1KA 2PD4A 1A7KA 2V7PA 4QUKA 3U0BA 3WTCA 5JC1A 3UFXA 3H4VA 3DQPA 2GERA 3UH1A 5L45A 1UZLA 1E3WA 4ZQHA 4X54A 4ALLA 2BI8A 5CHEA 5GZ1A 3IOYA 3QWAA 1ONPA 4BIIA 5A9RA 3WYBA 1LC0A 2VHYA 3KSZO 4K28A 4IDEA 4N7RA 4L4XA 5A9SB 4IPTA 1WDMA 3VZSA 2AQ8A 1U9JA 5IN4A 3LC2O 3ICPA 1LI4A 2H9IA 2QW8A 4AFNA 4HX5A 3AW9A 1KVUA 2FOIA 3TQHA 1I01A 5BR7A 3GG2A 2VWHA 4NBVA 2O3TA 2GZ2A 1ZH8A 3DZHA 2QYTA 3WTBA 4LSWA 1I32A 2BFMA 4ALIA 4IDBA 4YPOA 3JQ9A 4WE3A 3PGXA 3I6IA 2EERA 4AJOA 3DL2A 2HK8A 4A73A 3O8QA 4GWGA 4XKJA 4XQ9A 4ID9A 4NQZA 1HYGA 4D3DA 1U3WA 3DR3A 4JLWA 1UJMA 4GWKA 3E48A 4PLWA 4UVIA 4A7PA 2CFCA 5GZ6A 2J3IA 4GSLA 1E3LA 3WWZA 1M6WA 4RVDA 4D42A 3RU9A 5JMWA 1EUCA 4HFMA 4DREA 2BH9A 3QVTA 1P44A 1QV6A 2IRWA 3F1LA 1LDEA 1VL0A 1UP4A 4AJEA 4CM5A 1LLUA 2OGUA 5TF4A 1E7SA 4U7WA 5A5EA 2FP4A 2W8ZA 3VVCA 2B69A 1KYQA 2VZ0A 2O48X 3WBFA 3QWHA 3AOEA 3TDKA 5EESA 3NV9A 1I8TA 5TNXA 3RC2A 1EEHA 3I6QA 2WE8A 1KS9A 1LJ8A 4CM3A 4CM7A 4OMUA 5KWEA 8LDHA 1PZGA 2Y1GA 4P22A 2UV8A 5A05A 2J3HA 1SEPA 5BQFA 4FJ1A 5IAAA 1X7DA 1IE3A 4HFNA 3L9WA 4HKTA 3D3EA 4ESOA 1ZK3A 4YEDA 1YOVB 2QYSA 1T2CA 2PFGA 5L7YA 2JCVA 3VAZA 1GR0A 2Y1OA 2P9EA 3ZV5A 4OH1A 4OXYA 3BIOA 3M2TA 2VUTA 3GY0A 1K89A 2RCYA 3GVPA 2AXQA 3L07A 4CPDA 2WD8A 3PJEA 1LX6A 3PQFA 2FPGA 2Z95A 3QIVA 3QVOA 4IXWA 2QZ9A 3ITDA 4E13A 4AJ2A 4EUFA 2Q1TA 1W73A 3TN7A 2HU2A 4A27A 2ZQZA 2BI7A 3OECA 4U6SA 3GN2A 4G2NA 4DYVA 4EITA 3CKYA 1PL7A 1KVTA 3F9IA 3UUWA 4BB5A 1GDHA 4BQRA 5EMHA 3V5NA 5IF3A 2O23A 4BNNA 1DRUA 2IZ0A 4RVSA 1F17A 1HKUA 2EV9A 4HNGA 4M87A 3NRCA 3PYLA 3H65A 3S2EA 4XGNA 4R3NA 1E1NA 4C7JA 1XEAA 4OXKA 2PNFA 2GYYA 1H94A 3C7DB 2DBQA 1H6BA 2O3QA 2YV3A 3C85A 5A06A 5KJ1A 3TZQA 1NR7A 2CVQA 1C1DA 4QX6A 1VL8A 3GEDA 3PHGA 5JY6A 2TMGA 2VUSA 2XOXA 4J7UA 4YJFA 5IFLA 1KVSA 4ALJA 3ZU5A 5J23A 2I99A 4PN3A 5ER6A 4J3FA 4W7IA 3EHEA 1E6WA 3VH1A 1DC3A 2GN9A 1JTVA 4IBOA 4IJUA 1VJ1A 4IDAA 1C0IA 1UAYA 1I0ZA 3STHA 5L4LA 1YDEA 3Q2KA 1Y9AA 4PZEA 2VUUA 3G3EA 2AHRA 5KJ6A 1NYTA 4YJDA 4J4TA 1DLJA 5DBIA 5JCJA 3PK0A 3ASUA 4CODB 1RYDA 1R12A 1NR1A 1Y8RA 3B6ZA 1U2DA 4ZQGA 5HBRA 4WUVA 1SAYA 2OORA 5JPIA 2BHLA 3Q1LA 1AHIA 2FHSA 2NQTA 4KUEA 1Z73A 4R1TA 3OJ0A 3EDMA 4H16A 1QLJA 4IQGA 4W9NA 4RGBA 1MFPA 1Y8QB 3O38A 4J43A 4JJGA 4WLEA 3D1LA 1K6IA 1VM6A 4R5HA 2I67A 4BL5A 2B83A 3GDOA 4KWHA 2SCUA 4EEZA 4GLOA 1RYEA 4EBFA 5TRTA 3AUTA 2XF8A 2FY8A 5DBGA 1Y8QA 1P1KA 2VRCA 2FR8A 3ONFA 4O59O 1R66A 2F00A 3FN4A 3TZHA 2VCYA 4BO4A 4BNGA 3FI9A 1TA4A 2DBZA 5G4KB 1PGPA 1YE3A 1YBMA 5CEEA 4AJHA 3UXYA 5KKAA 3OIDA 2GR9A 3NX4A 2NTVA 1MC5A 1TT7A 2VWPA 3CIFA 1XQ1A 3GG9A 6LDHA 4DLAA 4I9UA 4ITUA 1H2HA 3BHIA 4KUGA 1ZIDA 3JQGA 4CM9A 4TRRA 1BXGA 4E5NA 3FRJA 3Q9NA 4BNWA 5A3JA 4CMCA 4OXNA 2O3RA 3JQ6A 1U4OA 1YJ8A 4MVJA 4M55A 1NHWA 5KVQA 2PH5A 5DOVA 4CM4B 5JE8A 3TL2A 4RVHA 3ROKA 4BGIA 3I83A 3ST7A 3IKVA 1NX6A 2HAEA 4BO0A 4CLOB 3LDHA 5JCJD 4PRLA 1BDMA 3L6DA 4DVJA 5L51A 2VOJA 3NDIA 4KQXA 1YL5A 4R9SA 3ORFA 3CSDA 5DT9A 3FD8A 3C1OA 3ENNA 2W2LA 3DZIA 3VZPA 2HSDA 5BSEA 2CDAA 4CV1A 1CEQA 1M6HA 3UCFA 1ORRA 4O0LA 3DONA 2GN8A 3DBVO 3DZFA 5F1PA 3RC7A 3JQBC 1LBEA 3P5SA 3PXXA 4TMFA 4DC0A 2VRCD 3LF2A 1PJ2A 4WASA 3GRKA 4MIYA 1WWKA 2BF7A 3HZZA 2YV1A 4B3JA 4MOWA 4K9DA 4M1QA 4Y6RA 2J5RA 4BKRA 2R00C 3TRIA 2HKIA 3PLRA 1VL6A 1LLCA 3V2UA 1I5RA 2GZ3A 5I7VA 3FNHA 1I30A 4NK5A 1IOLA 4AJJA 4E12A 1PEDA 5JXWA 5JW6A 4R68A 3DB2A 4JN6B 2B4TO 1DJQA 2NLOA 4CLRA 2ZTLA 4CM8B 3H5RA 4O63O 4CM9D 1KEUA 4CM1A 3NTOA 2CSUA 3TZ6A 4IXTA 2D5AA 2DAPA 4PIVA 3AY6A 4YT4A 3OSUA 2B4QA 2X4GA 4JQCA 4MO2A 4MVJD 2W98A 1NAIA 4BNFA 3ZHBA 3KO8A 1GZ6A 1EVZA 4UVHA 1OOEA 5B4VA 4RLHA 4KTVE 1EE9A 1PJCA 1UP6A 4Y6SA 5JO0A 1G6KA 1EK5A 3PHIA 1JLLA 4GL4A 1YL7A 3X2FA 4I5DA 2J5KA 1Q0HA 3GDFA 3NT2A 5DF1A 1CRWG 2O7SA 4AJ4A 1F8GA 1E1LA 2YW9A 3KV3O 3WWYA 4BO3A 2C54A 3KLMX 3AU8A 4TSKA 3HB4X 1T4DA 2W2LD 2PTGA 1ULSA 3IJRA 5I7FA 4XR9A 2H1SA 4OYRA 3RFVA 2A94A 3M1AA 1PS9A 1QYWA 4FBGA 4HUJA 5A02A 1PS0A 4OSOA 3DXFA 3HHPA 1U4SA 2QHXA 4B3IA 4JBHA 2VT3A 1CYDA 5JSFA 1TT5A 2EWMA 2Y1EA 2DLDA 3EZYA 3F4LA 1IY8A 2JFHA 4JJIA 4ALMA 4ND3A 2R6JA 1LRLA 4Z3KA 3RASA 1YO6A 3IAHA 4PFJA 1JWAB 2OO5A 2P5YA 1SCUA 4M89A 1HDRA 2HMSA 1NVMB 2P4QA 1YH3A 5T67A 3OEWA 2G0TA 1P0FA 2VT2A 1PR3A 3OJEA 1XG5A 3FBGA 1GUYA 4FGSA 1K2WA 3HSKA 2JAPA 3JQFA 3Q11A 1R16A 1W6UA 3JYLA 4F45A 1ISJA 2OBYA 3KYDB 4KOAA 4XYGA 3I9LA 4WECA 4LMRA 2Y68A 2XXJA 1XELA 1IZ0A 2EKLA 4W6ZA 4GI2A 1IPEA 1CDOA 4BNYA 1S7CA 3KYCA 3MWDB 5LC1A 3U09A 4TZTA 4FW8A 1GPDG 4GLLA 3ANMA 4BHTA 1A4UA 3VZRA 1B3RA 2AW5A 2AQKA 3LZ6A 4DL9A 4CR7A 3JYOA 1ZK4A 1IULA 1XQ6A 4PCVA 3L4SO 4QFCA 2VNSA 5G0SA 3F5QA 1RPNA 3OEYA 2RIRA 3BTSA 5CEFA 5IDWA 1SPXA 2AQIA 2FZEA 2I65A 2CVOA 4E0BA 3TOXA 1BXZA 3B20A 3FPCA 4K6FA 2BMAA 2A9FA 3AUAA 4PRKA 3JD0A 3IC5A 1ADBA 1E7QA 5BNIA 3F6YA 4PLPA 4PZCA 4B4VA 3QV1A 3DAGA 3JD3A 1P1FA 4YT5A 3PZBA 1J4AA 4CQLA 2PZKA 5IDXA 2WSBA 4WEOA 4E5PA 3IDSA 1XKQA 3JD4A 1V0JA 3DBRB 3ITKA 3ZHXA 3E9MA 1B15A 3W4JA 5HTOA 5AXDA 3G17A 5CP8A 4EJ6A 4Y67A 1RM4A 2I5PO 3NJ4A 3IP1A 2QX7A 4OHUA 4RF2A 1X0VA 4E33A 2W4QA 1HDCA 1SB8A 4UEOA 5TJHA 3WGIA 3K73O 4GAEA 1JQBA 5JC8A 1MGOA 3L9XA 4UREA 2VYNA 3EVNA 4QECA 3VZQA 5I7EA 3SX2A 3U62A 5FWNA 3E03A 1U8XX 3ZGYA 4BNHA 2WD7B 4PLGA 1QP8A 4WKGA 1E3JA 2WYVA 4DIBA 3ZWWA 4TVBA 5GMOA 3IS3A 1VRWA 4HV4A 4YJGB 4IS2A 3BMOB 3LLSA 5KVSA 1MX3A 3AM3A 2J3KA 5IZCC 4DMLA 3ZI0A 4J1QA 3D0OA 2WD7A 5BT9A 3TFOA 1O94A 3DFZA 5L3ZA 2EG9A 1N1GA 2C7GA 4NBTA 4XYEA 3F47A 3H9QA 4I5EA 2ZB7A 3GZ4A 1NQ5A 4FD3A 3GMDA 5TC4A 3W4IA 1E3EA 4XQGA 4BO2A 5AOVA 3H3JA 5DULA 3KOUA 1HWYA 4IDFA 5EQFA 1NTOA 3IP3A 1ZMTA 2WMDA 3ZWVA 3ZNNA 3FSRA 2Y66A 4QXMA 1DPGA 4MVJI 1KC1A 1J5PA 2X9VA 3GZNA 4CMIA 1YRLA 1MLDA 3PP8A 2FZWA 4Q3NA 3GNQA 4HBGA 4RPLA 3ETGA 2WJPA 4Z0PA 3PVZA 4F46A 1DRVA 1XCBA 2YDYA 1HDYA 3U4HA 4AJNA 2UUOA 3RBXA 3IJPA 1B8UA 5LCXA 3D4NA 3PJFA 4XDZA 3GEMA 1R15A 1YWGO 2OL4A 3RC9A 5BNTA 5DOZA 3WNQA 3H9GA 3GAFA 3LF1A 2FPPA 1XR3A 5HA5A 1GADO 2D5CA 3QSGA 3WGTA 3MWEB 3ZW8A 1B14A 3PHHA 4NJMB 3UW3A 3PEFA 4QO7A 4OIMA 1HSOA 2O4CA 2HO5A 3DAPA 1DOHA 2VYND 4FGWA 4CV0A 3K6JA 4ZICA 4CQMA 4IJWA 4R16A 4BNVA 4WLNA 2VN8A 3L77A 3CXRA 1HTBA 4NJMA 1E1KA 1Z6ZA 3MJSA 1IHXA 2OZPA 4IDDA 5BSHA 2EXXA 3K9QO 3ZNPA 2C20A 1G1AA 2P4HX 3R0IA 5C3MA 5TIIA 3OJFA 3Q6IA 1BMDA 5I8ZA 1LTHR 2NTNA 1T1SA 1PJ3A 5H83A 4DC1A 1JVBA 1AN9A 2FR1A 2J5QA 1KY4A 1QR6A 4Z9FA 1VC2A 2DBVO 2PR2A 5CDUA 2Q3EA 1KEPA 3C1AA 3B1FA 5U4QA 2PA3A 3JQ7B 4OGWA 3SLGA 3WLFA 1C0PA 2AMFA 3PZRA 3UICA 4P4LA 1N2SA 3WG9A 1YL6A 3JQBA 1CERA 4UEJA 3GGPA 1UDCA 1KOLA 2FWMX 5KJEA 4L4RA 3PHJA 2DM6A 3RFTA 3OQ6A 2O3SA 4II2A 1ZXBA 3PJGA 1C14A 2HMVA 3IIEA 3U5TA 2Q1SA 4MPDA 2R00A 1HDOA 3DWFA 3KEQA 5BSFA 4Q9NA 3KEOA 1HE4A 1BDBA 1T2DA 3HN2A 5K6AA 4UUMA 1OAAA 2CUKA 3EUWA 5TGDA 3QVSA 4GH5A 3JD1A 3N58A 1ADFA 3NYWA 4YDRA 5JFOA 1BRMA 4YA6A 3ADOA 1ARZA 3GC6A 4IDGA 1GEGA 5CPBA 4J49A 1RM0A 3K2EA 3AY7A 3DBLB 4FC7A 3ZV3A 3JQEA 2V6FA 5T8KA 3ZDFA 1BVUA 4GX5A 3WR5A 4IZIA 4OOEA 4CQMD 1EFKA 2B4RO 4CMAA 1E77A 3R1IA 4CLXA 1YB5A 3NGLA 2BELA 4CMHA 3JQAB 4M86A 2JD1A 3H2SA 5JLAA 4GQAA 1PU2A 4PG4A 1X13A 5CAEA 4NU5A 2WDZA 4LVUA 3O26A 1PWZA 3MOGA 1FDSA 4IUYA 1X14A 3JQAA 4U6QA 4IIUA 1UP7A 1U1IA 2E48A 3FNFA 3WNVA 1X1EA 4EW6A 4J1TA 3MJEA 2VHZA 4JXKA 5FI5A 3INRA 1OC2A 5I9NA 2EW8A 1UAGA 2DUWA 1PS8A 2B0JA 3ANNA 3RKRA 5A9SA 3GHHA 4D46A 4J1SA 2DUUA 4BMVA 4WGGA 3I5MA 1K5HA 1P3DA 4GX0A 3EMKA 2X8LA 3D4OA 1PZFA 5CG2A 1TVEA 2Q2VA 3BZUA 1GQYA 1QG6A 2JHFA 1F8FA 4ND5A 1U5CA 2LDBA 1KVRA 3RWBA 3VC7A 1GV1A 1Q0LA 1ZSYA 5EL0A 4EUHA 3AFMA 5ICMA 3OA2A 4E5YA 3RBZA 3DZBA 2EJWA 5EERA 5T5QA 4LCJA 5A9TA 2EF1A 4DGSA 4A10A 3AI3A 1CWUA 1WPQA 1IB6A 3M2PA 3UN1A 1PGQA 4JP2A 1WW8A 3M6IA 1E5QA 4DMMA 4FDAA 4AJLA 4R01A 3PJDA 1H9AA 4KUHA 1QYCA 1N92A 4DBZA 4RO0A 1U8FO 3BTOA 4XRGA 4PVCA 4LISA 1M2WA 2QQ5A 1PTJA 4LSMA 3A4VA 5I8WA 2ZCVA 3WJ7A 4AJPA 2JD2A 4GKVA 1C0KA 3LVFO 4FC6A 2EGGA 2QG4A 3FHLA 3LC7O 3BMQB 4AJKA 2JHGA 1OFGA 1NWCA 2VOEA 2WYUA 1YQXA 3DO5A 3NUGA 3WGOA 1B7GO 1K6JA 3ENKA 1U7HA 2NADA 5I9LA 3WGHA 5F5LA 3JQAD 3PTZA 4R3WA 3FNEA 1GU7A 1GV0A 3SJUA 3TNLA 1PQPA 4YYZA 2EP5A 4KDEA 1T2EA 3ABIA 4BGVA 3VOSA 3H9EO 1QYDA 4H3VA 4O1MA 3BMNB 3GNTA 4YVFA 1YOVA 4H15A 4G65A 4YQZA 5G0WA 2YFQA 3GN1A 1A27A 1J49A 3RUFA 3AY3A 4FIZA 2CNBA 1DIAA 1O95A 3NJ8A 2W2KB 3HG7A 3VKVA 2CF6A 3BHMA 3JD2A 3S1LA 1I2CA 4U8GA 3HDJA 4ZQFA 3RBVA 2DQ4A 1PJTA 1Y7TA 1PQUA 4RQTA 3RUCA 2NNLD 1HF3A 2E6UX 5TS3A 1JWBB 2AG8A 1HZZA 3AK4A 1I3KA 2PKRA 2JAHA 5CDTA 2C2YA 3DMYA 2X5KO 3LLVA 5ITVA 5HS4A 2X0NA 4QO8A 2ZYDA 4XQEA 1SMKA 4ZA2A 4FQ8A 2FN7A 1P9LA 3V1UA 4OL9A 3GEGA 3OFSA 3QY9A 4BKPA 2J6IA 3QWIA 3U49A 4AICA 4CMEC 1HDXA 1IHYA 3C24A 3GAZA 4N5MA 2B35A 1WZEA 4RF4A 4G81A 3DMTA 3QVWA 2C59A 3U4IA 4R5MA 1VI2A 2OMEA 2ZYGA 3SJ7A 4B7XA 4TRNA 2NACA 3CMMA 2ILTA 4JNKA 1ZKMA 2CZCA 2DC1A 3WGYA 5HS6A 4PLCA 1ZK0A 2FPIA 3L0DA 4E31A 5L7WA 1ZJZA 3D7LA 3FR7A 1L7EA 1ID1A 4WCFB 3LT1A 3RI3A 1WZIA 5C7LO 4HWKA 1CQJA 3F3SA 1P1JA 1ISFA 1EMDA 3KSUA 2Y1CA 2YHIB 1D3AA 1PJBA 2H6EA 2ZQYA 3KRTA 1PL8A 4J91A 3G0OA 3GR6A 3QRWA 4I8XA 4J9VA 4LVCA 1IL0A 3RUHA 3ZH2A 1PIWA 3W8DA 3RUDA 5EN4A 7ADHA 1PGOA 2YHIA 3DTYA 2QZZA 2C2XA 1KEVA 1I2BA 5DBFA 5ES3A 1NPDA 2GGSA 2HMTA 2Y0EA 4KP7A 4P8RA 2O2SA 5L9AA 3K2BA 3ZWCA 2D59A 4YAEA 4BNZA 4UULA 3MTGA 2Q45A 4A03A 4FSHA 2IYOA 3RJ5A 3AM5A 3U9LA 2YDXA 2NUAA 4FOOA 4LN1A 3HFSA 4XX0A 4OAQA 4E30A 1HDGO 2C5AA 4YACA 5AXCA 4AG3A 4E2ZA 4Q3DA 3WMXA 3WYEA 4M8SA 4MVJF 5G4KA 3TOZA 4C7KA 1FF9A 1I3MA 1P1RA 3HADA 4W99A 5CEJA 1A9ZA 3WGGA 3X2EA 2ZJ1A 4L8VA 2QIOA 4C4OA 2DFDA 2X6TA 3PFWO 4RVGA 2DU8A 1U2GA 1Y5RA 3EC7A 4ILKA 3CE6A 2NWQA 4DQXA 1UXGA 2IZ1A 4L4SA 3LQFA 3FBTA 2PD3A 4RVUA 5IDYA 2DFVA 3V1TC 1X15A 2P9GA 2DT5A 4QSMA 2C07A 5A1TA 1OI7A 4J7CA 3E1KA 3JCZA 1H6AA 3WIDA 2YV2A 4CM4A 1DB3A 5IZ4A 1GY8A 1P33A 1UR5A 5F1KA 1MXFA 4Q3AA 1LU9A 1WVGA 3HDQA 2O7QA 4W82A 3KYBA 1VJTA 2VWGA 3WICA 4CLOA 3N7UA 2VNAA 4XYBA 1GYPA 4UUPA 1JVSA 4QFDA 4FFPA 4FJ0A 3AFNA 1TXGA 3L4BA 1XSEA 1YONA 4RPJA 1YJQA 2BGLA 2HK9A 2WYWA 3LT2A 3NDRA 3S2IA 1W8DA 2ZYAA 1HSZA 1ZEJA 2EKQA 3GMSA 4CLEA 4RDHA 4RVFA 3V2GA 2BKAA 2X1HA 3INTA 4OKIA 3FWZA 2XAAA 3ETDA 3GUYA 2ZB4A 4MVJE 5IXSA 3MOIA 1V9LA 4CUJA 4YRAA 2HK7A 3P2YA 3VDRA 2YYYA 5HWSA 1HE3A 1A7AA 3S2FA 4JGBA 4DBVO 3HN7A 2OBNA 5I7SA 2HCTA 5IDQA 2RHCA 1QMGA 3CZMA 4OM8A 2CMDA 2G5CA 3K92A 5JYEA 3WIEA 4PLHA 4E21A 1X0XA 3LSYA 4BNMA 4YT8A 1D7OA 1P77A 1SOWA 1MUUA 3BAZA 3MEQA 4OJNA 1ENYA 4CM8A 1R4MB 1ISIA 1UH5A 2RHRA 4XIYA 3FTNA 3MZ0A 3PIIA 3DBHB 5EPOA 1JN0A 3RU7A 3OHSX 4DTIA 2FRDA 3JYQA 5KNLA 3ZZNA 3ZWPA 1ISMA 1UXHA 2I3GA 3UCXA 3NEPX 3DHYA 1R4MA 2BGMA 1CETA 4HFJA 3VPFA 2GNAA 3GFGA 4GSKA 2AE1A 4BMSA 4PLZA 2PZLA 4I9HA 4BUCA 2PD6A 1B16A 4MKXA 4YRBA 3G1TA 5JNLA 2PKQO 3IL2A 3QP9A 1CJCA 3D64A 3NKLA 4TZKA 4CL8A 3RROA 3MJTA 4MVJM 1C3VA 3HWRA 2NVUB 3N74A 4XJSA 2D1YA 3DZKA 1I33A 5H81A 2A92A 3GGOA 2CF5A 4NFSA 4TRJA 2Q4EA 4ND2A 5JAZA 3VVBA 1QV7A 1ISGA 3ZU4A 4KQWA 3JV7A 1DC6A 5C7OO 1NP3A 2NVUA 1EUDA 1SO8A 4PLFA 2JFFA 4UUNA 4EJ0A 4NI5A 4XYLA 5JAIA 1Q7GA 4FS3A 3EYWA 4PVDA 4TQGA 4NFYA 4J6FA 1H0KA 3WQRA 3K5PA 1T25A 2G82A 4XB1A 5COQA 1N8KA 1PZHA 3G1UA 2QRKA 4B79A 1I3LA 4INAA 4CMGA 2VQ3A 2X9GA 3BA1A 2EP7A 1ZEMA 3VPHA 2AQHA 3V1YA 4RPKA 3I52A 3WJAA 1LSSA 4MVJG 1BXKA 3W8FA 1EE2A 2D2IA 1SOVA 2DKNA 4HFRA 3M1LA 2CY0A 3KYDA 4BNKA 3RUEA 2V6BA 3RQSA 4XGIA 3GVCA 1ADCA 3VH3A 3GPDG 1EDZA 1G0NA 2X0IA 1FDVA 2IZZA 4GMGA 2JJYA 2X22A 2HMUA 1EVIA 1U3VA 3WFJA 3TZCA 2JKVA 2I6TA 3QJ5A 4IQ0A
chains in the Genus database with same CATH superfamily
3BTUA 2E7ZA 1B3BA 3FVWA 4ZVMA 3WOHA 4DSUA 5B5SA 2H52A 1O9BA 2MT9A 3OZBA 5IXYA 1LCIA 4R98A 2O8VA 3RFXA 5EFZA 1WXFA 1SB9A 2VK4A 5FPSA 1N2CA 3L7MA 3SF8B 1H2FA 3WK5A 1DADA 3D8TA 1PZEA 2FKAA 2IYQA 1N0WA 3UYLA 3VBCA 4HUTA 1QU3A 2QN2A 4NBRA 5KCZA 4O5AA 1XJCA 3AWDA 3PF8A 3WB9A 1E6MA 1T5OA 4CDNA 3PFKA 1PCXA 4D9HA 2QX4A 2I3AA 1OYYA 2VPYA 3NBAA 3N0WA 3PVSA 5ALIA 2JLQA 1SHTX 4D43A 1QQ5A 3TRFA 1ECLA 1YF3A 3UMSA 4G0XA 4L76A 4EUEA 4XYMA 2O7NA 2C1ZA 3MPOA 4DARA 2HHJA 1OBFO 2ZIVB 4OQZA 1V1JA 3OX4A 1B73A 1UOOA 1KAGA 1RP7A 5C4GB 3SJZA 1KA9H 4OO3A 2DPYA 4V0SA 3W04A 3RRMA 1WL8A 4CMEA 3DBRA 4G9EA 2BSQA 1JA9A 4B40A 4R0MA 1TJ5A 3ND8A 5GY7A 1W0KA 5CFOA 5EJ2A 1O0SA 4LNHA 3RPEA 2ZTVA 4FYYA 1SZJG 2AG5A 4HTFB 1TEHA 5GQSA 1K6XA 3DZDA 1AO3A 4JCCA 3ZY4A 3DEKA 4M9QA 5DN9A 4GP6A 4L5BA 4HZGA 2A3RA 3HGTA 2VQEB 3JWJA 5ALNA 1HE2A 1FJHA 4ND1A 1V48A 5TR9A 2XVMA 3LZDA 3BE5A 4H08A 1EP1B 1IRXA 4TV8F 4MW0A 1CUAA 4Z0TA 4KDRA 4BNIA 4CMJA 2LGJA 3PLNA 4N0MA 1ADGA 4BB9A 3TBKA 3IOCA 1LPBB 2WPNA 3H2ZA 4EPRA 1MZPA 1V9SA 1LBSA 1V3TA 4GMKA 3E9NA 1DSSG 4R3UC 1JIUA 1EWQA 4YAOA 2FDXA 1TCVA 4TXJA 5THQA 1KP2A 1TKRA 1W88B 3AEXA 1E7YA 4DW8A 1EK2A 2JGNA 3ML1A 1HPLA 4KX3A 1G60A 3D8RA 4IMJB 4MCHA 1EVYA 3H1BA 3RFUA 5FYQA 4CE6A 1R2QA 3Q41A 1C7FA 3GA7A 2V9PA 2VPPA 4F8EA 2D62A 4YRCA 3TBFA 5CEFA 5L4SA 4M99A 3K35A 1E5DA 4L73A 2BZSA 2ZLBA 4F3KA 4TOIA 4ZDIA 2HGSA 1EX9A 4AZ0A 1NRWA 2YQ5A 3PNOA 4HL6A 3CWZA 3DM5A 4QDOA 3KXKA 3D0QA 2OWDA 3GRPA 3KQNA 2QTGA 4UM9D 2HWWA 2VZ8A 4OQYA 2AZTA 1QNLA 5KINB 1SIOA 2C5SA 1MORA 3HB7A 3OHMA 1UC5B 2XB9A 1H4TA 4CLHA 5EP1A 3KAQA 4F5ZA 3GJTA 2XGOA 3H9BA 4GZ6A 1C29B 2HHHB 2JFWA 3IPXA 5AHKA 4WN9B 2G76A 3MJ4A 2C7BA 1I7PA 1CQIB 3VKUA 1KY2A 2HIHA 3PR1A 3JYHA 4RSMA 4UBOA 3SZ3A 5JG7A 4C43A 1P19A 5K3DA 1CF9A 3BBPA 3CVWA 3TTSA 1Z5VA 5AW6A 3K96A 4H6WA 4KR9A 5B4UA 5KNBH 1KJIA 1Y3HA 2EU8A 2QN9A 2WT8A 4L7QA 4ZIRB 2X9NA 5KNCA 3BHJA 4WESA 5A7GA 1LRKA 2J1LA 1U8TA 1ZN7A 1G7CA 2EZ8A 1PFGA 3BAFA 4TWIA 1JMYA 3P96A 4WXYB 2YMPA 4KN5A 1R0SA 2I87A 3GFSA 1KERA 1PJLA 1DKOA 1VA5A 4DY4A 1D04A 4KN9S 5JCPA 1YK0A 4R8RA 5B2ZA 1XXLA 1DGQA 5HJ7A 1TQHA 3NHFA 2AMYA 2HK6A 3JQ8B 1TRHA 2H7VA 3MBOA 3F3MA 4PHFA 1B8VA 3U37A 1NKVA 4UM7A 4OHVA 4O1HA 7MDHA 1YMUA 2GK7A 3NGXA 4IJVA 4Z7QB 1MEEA 7REQA 1T15A 3UHFA 2LIVA 3MJCA 1TQ8A 1P1HA 3RM3A 5AOBA 1IG0A 2BMVA 2ZB8A 5FPYA 5A4DA 4K87A 4G5XA 3AVYA 2JCXA 2Z1NA 2IEDA 3S55A 1GLGA 2ZYUX 1Y9JA 4AJ1A 1N7JA 2WWRA 2CBZA 2QT0A 3EVDA 3HXPA 4H18A 1ML4A 1E96A 2VK8A 4HLDA 1YR3A 2XB8A 2ZR9A 5ECGC 2BBWA 4BLVA 1XI2A 3SZLA 3G8BA 3LMKA 2QMQA 2EEZA 2ZVQX 1WZUA 3CISA 4EMSA 5MN6A 3C3DA 2BFEB 3SR3A 3HA3A 4IHAA 5HG0A 2FE4A 2WT4A 5BN4A 1EVLA 3OAAD 5FWXA 5LP6C 3WLEA 1FBNA 1KJJA 1IBRA 1Z36A 2P6MA 1YS2X 3E2PA 3O9ZA 9GPBA 1PV4A 1AM4D 1Z6XA 4AC9A 3GBVA 3C41J 5LIRA 4DA6A 1G21B 3EB9A 4QYTA 3VBEA 2GYUA 4YP6A 5IJWA 4Y2PA 5BVGB 1C2TA 3QJGA 8AT1A 4IYJA 4EJFA 4IYRA 5CMLA 3ZWNA 1PZMA 1V26A 3EXG1 4RK0A 3A26A 3MXTA 1Z8DA 2Q6KA 4XQ0A 3G8DA 1NC3A 3MQ2A 5ADWA 2CHQA 5DSTA 1KAEA 1E2EA 3A14A 4TWAA 4UVDA 5FWAA 1APBA 1A98A 1VP9A 3A0RB 2OMKA 2JRLA 1RQLA 5ALRA 4UD6A 2HXSA 2WJZB 3DBLA 4R54A 2XDQA 3OQBA 5CDYA 1MENA 5HKOA 5G2OA 3TLZA 4MV1A 1W0JA 2Q99A 2Q5LA 5K99A 4XPIB 3GOHA 5DKFA 4BO5A 4BYGA 5E8JA 3W5AA 5J47A 1XF9A 3M6WA 2REBA 3PX7A 1DBVO 2RIPA 3KEMA 3L7YA 3R5XA 4RXTA 5HK9A 3G68A 1JDSA 2L0XA 1UMKA 1IEVA 5D86A 3OA0A 4LXYA 1PJRA 3EGIA 4TMVA 1WPGA 3IQZA 3GHYA 3QBTA 2DTDA 4TV9F 4IG4A 3UMYA 3T6KA 3FI0A 3DKIA 4BVFA 3I9MA 3PNMA 3HB5X 5PNTA 3I3OA 1IUOA 1JAXA 1L7NA 3FOCA 1EAYA 1TVKA 1XNGA 1V8FA 2H7XA 4K3UA 3C7TA 4P82A 4ZC1A 3V4FA 1KRHA 3AUYA 3IMFA 3NC4A 5TMEA 4D6PA 3ZDAA 4MJLA 4NJOA 6CHYA 1Y4UA 3OETA 4R1UA 1TEXA 2Q5IA 2WIKA 2YJ6A 3IOEA 4R41A 4XLZA 4AL4A 2HF9A 3HVHA 3D5EA 3VR4H 2QLLA 3HZRA 2PE5A 2BH2A 4CDMA 2F3RA 1GJRA 3I9KA 2RGNC 3H8WA 1TI7A 4YAJA 5IH7A 3Q7RA 4YP7A 4E4YA 2QRPA 3IEXA 5DISB 2ILVA 9LDTA 3IDAA 1GZ3A 5WRFA 1GZ5A 4F97A 1SXIA 3K7EA 4A6DA 3UC9A 4N7MA 3C0KA 1RYFA 4M9RA 3PD7A 1N8NA 1QANA 3FWHA 4LJ9A 3T0GA 4HEA6 4EELA 4U1RA 1RNLA 5ICCA 5KQSA 4G0WA 5DEOA 3LY8A 5JEDA 1M67A 3MWYW 3RG8A 5DCUA 5M7EA 1JEEA 1Q1QA 3LGSA 3R0ZA 2YFKA 4TKZA 1Z2PX 2IPMA 1DI0A 3GGDA 3NBFA 5BORA 5DLPA 5KTKA 3ZDCA 1E7RA 3GEIA 4LPKA 3W3ZB 5HSGA 2R0QC 2HWKA 4QA9A 5F2NA 3TW0A 1M2NA 2BFAA 2JH9A 2Z5LA 3L8MA 1BHSA 5AKEA 1E6UA 4I9NA 5EINA 5A3SA 3TB4A 3W5UA 1JHVA 1R0LA 2YJTD 5BSTA 4EUSA 3QWBA 5EIXA 1MJGA 5P8WA 2O8FB 1HEYA 4YMLA 1T8WA 1CQXA 3PNQA 5C8YA 3GQVA 4U7HA 2I2AA 2I66A 5K3BA 2EQ5A 4WXHA 1JI3A 1VCOA 1ZX1A 3HC7A 1J9ZA 4LVOA 2WDPA 2Q1XA 1K9VF 3FHJA 4MGYR 4PLYA 3GLGB 3DVQX 5EWMB 4C1NA 4P4GA 5HGJA 1A4XA 2X86A 4LYGA 1N5JA 1T9HA 5A3VA 3QOYA 2X4IA 1N6LA 3EA5A 5HBGA 2AVNA 2I2WA 1NXPA 2JG3A 3WA6A 4F3CA 4ZK6A 2EKZA 3JWEA 4HRXA 4F85A 5CBKA 2FA9A 2G5TA 2W2OA 1Y4SA 2QUIA 4J07A 3ICEA 2B37A 1JEOA 1N2EA 1MA0A 4H7HA 1YVUA 3ZDEA 1W4ZA 4L8WB 5KQMA 2POQX 4UDXX 4GX1A 1FXSA 3ZXYA 4H31A 1V5IA 1DC4A 4EVIA 2NXCA 5M04A 1VDMA 4KVAA 4HQNA 4X84A 2R1ZA 2UZ4A 4KRFA 1V11B 3BXZA 4Z6KA 4FE3A 3HVIA 4KV9A 2FPGB 5FA8A 3ZXUB 2DFLA 2KM1A 2KB0A 2ZAMA 4K9NA 1OJ7A 1RAGA 3G23A 4ZOLA 4LW8A 5AMXA 2WQ7A 2FR0A 1T1JA 5CT4A 5E4FA 3WJ2A 1NU8A 3M9WA 5TARA 2W2KA 4F0JA 4PPQA 2EIXA 4II3A 3WFZA 1RCUA 3E7PA 5LQRA 4KGVA 1GTRA 1E9RA 1E2LA 1YZKA 4MV3A 2E4AA 1LLQA 2ZSFA 4DCMA 2Q3CA 2GCPA 1OVGA 3MIIA 1IAVA 5TEWA 3VAAA 3V2HA 2CNWA 2WPDD 1IXKA 5CFZA 1RHRA 1XMPA 4M1YA 2YZKA 3BXPA 3DC2A 3H5OA 2FJ0A 4N40A 5FBHA 4DR1B 2J3MA 1WXWA 4JOBA 3RK0A 2NTYC 3ZHYA 3IKMB 1XVVA 1ZNQO 2R2GA 5ENVA 2UZ0A 2AEFA 3L5OA 3EGCA 2I91A 3FAZA 3HNRA 2B82A 2CN1A 2H85A 2M1XA 2RH8A 1CIPA 1DRKA 1RM5A 1MH1A 3OIGA 1C1DB 5KYVA 2RGWA 5KYWA 3JAMA 3QX3A 5KVVA 2F3PA 1T0BA 1L5OA 5AVQA 5EIWA 4YJFB 5LZ8A 1AKNA 1G3MA 2IUYA 2R44A 1BWQA 1E62A 1FLDA 4EATA 4YALA 6REQA 3OZFA 1IRIA 2UKDA 4HDKB 1JAYA 4IGEA 4L3WA 5MF6A 3CPSA 1UXOA 4HGOA 1H2AS 5KNCH 3SHVA 4BO7A 4ZU3A 1P8JA 4YASA 1SVWA 1AKMA 1WPXA 1XJ0A 4Z9YA 1A2QA 5E9AA 2C1EA 5BV1A 4F5WA 4MS1B 1ENOA 1F6WA 4EYEA 4L9RA 3RWOA 5A4IS 3KZVA 3ZY3A 1DAOA 5GIPE 2P5SA 2WIAA 2N1MA 4RZ3A 1KJNA 3TE7A 1HT0A 4FFLA 3HB1A 4WCFA 4OM7A 1J7JA 4CW7A 1C8VB 3L43A 2PLRA 3A27A 4PLVA 4DXHA 4ZYXA 5JDCA 3FOAA 3AL2A 3C87A 3MS2A 4GEKA 1ACJA 4U2BA 2VP2A 1NBOA 4URWR 4HGNA 4AWAA 1MJHA 3FW1A 3ODPA 3HNOA 4NATA 4UEKA 5SY4A 2AF4C 4CCAA 3H5NA 3NVKI 5CH5A 1PQYA 4B7UA 4QXPA 3Q3VA 1JW9B 3TZLA 4XGQA 4IWYA 2RHDA 4BJHB 1CCWA 5L7TA 2W71A 2RHJA 1SBQA 2JDIA 4TYQA 3H1GA 4ER5A 1RE1A 3L6UA 4XXHA 4LHZA 5B7GA 4RZIA 2BM9A 2G67A 4CIYA 1KH3A 1FFXB 1WA5A 1GPJA 3GUUA 3O82A 4NIMA 5FNVF 2BISA 4LX0A 1C1XA 3WGMA 5A7HA 4LF5B 3GFBA 4YP0A 3V8BA 3TG8A 3AUKA 3LT4A 2PKQP 4RS4A 4WNAA 3SBOA 2HDHA 2R4QA 3K9CA 3EQ9A 3MCVA 4PWYA 1CUYA 4XQCA 5J5VA 4QU0A 1VJRA 2JFPA 1UFVA 2VJYA 2BGKA 4C22A 4HZUB 5CT8A 2HBRA 4CF3A 3G7SA 3KUXA 4WCVA 2V55B 4X7BA 1UXIA 1Z0IA 3O2NA 2GCOA 1YNSA 2FETA 3ROZA 4BJ3A 4IL5A 1XKXA 3RWMB 2VJDA 3PNBA 4WLVA 5GONA 3I04A 3H8VA 5INTA 2HYDA 3KOMA 3SKYA 4HB4A 4EG4A 3PDUA 2KYRA 1JQEA 3JQGB 1VMIA 4DLBA 3AKCA 3ADDA 4KJXA 5AQ1A 1A69A 3DFKA 2IYLD 3VSBA 3NM5A 4RIEA 4WKPA 3RYFA 3L8FA 1N5MA 3IIJA 3O9MA 5LQMA 1T9KA 3C3BA 4KQ1A 5JQWA 2QY9A 4WOPA 1PYGA 2WA2A 1DIBA 4N3GA 2VK2A 1BMFA 3PJRA 2HT1A 2B1JA 1ZJ4A 3F90A 2Q41A 5C7YA 3WNDA 4LC1A 1EWRA 4BEVA 5J43A 4WLOA 3KTFA 1R5OA 4GXTA 3WVNA 4RKRA 3K31A 4DADA 1JG1A 3AFOA 3CGWA 4M8NE 1T3GA 1SZCA 5IRCD 3DVLA 2RH4A 2GPWA 4WOBA 4JNCA 1V1MA 3TQIA 4N6GA 1XTVA 2IEIA 4W1PA 4OB6A 2FEWB 2I7XA 2W6JD 1V7PC 2FZVA 4MUGA 1SQGA 3EF0A 1UC8A 5DGCA 4Z3DA 5DP2A 3VC1A 2IA5A 3ZBTA 3GAMA 4ZHSA 2PKYX 1ABBA 1HFKA 4K7JA 2J3LA 1QAQA 4KV7A 2NO9A 3B3JA 4XARA 3RRXA 2OHXA 4QGGA 4RHUA 3GRYA 4CL3A 2QTZA 1PAUA 4W5RA 2AJ8A 4HJRA 4YQYA 1X7WA 2C57A 2ZJ0A 3AHFA 2BFWA 2VO1A 1ZSNA 3E3MA 2OSVA 1FFCA 1RRFA 1EGAA 2I34A 4Y2HA 4ZVVA 2JCSA 4LJ7A 3I6ZA 3QA3E 4TZ0A 4M21A 4C06A 3CW8X 1E5LA 1NQTA 3QBEA 2CK3A 4WI1A 3HDVA 4N0PA 2ZANA 2FOXA 2Y67A 3AEQA 1F12A 3H4IA 4UE2A 3EGXB 1PJSA 3ANTA 3DMFA 4CG0A 3RAJA 5DGDA 4EQZA 1ZKDA 3K9BA 1U7OA 4I55B 2RE8A 3URKA 4FEYA 3EQ6A 3JR3A 4J16C 5JRZA 2C7PA 5A2GA 5JT1A 1RLIA 2YVUA 3K0FB 4CLRB 4QM6A 2IYWA 3CBGA 4TT3A 2XNKA 4R83A 5K6AC 3VR1A 2VS1A 4NCIA 3NDJA 2FZGA 1XDDA 1XLTA 4C2TA 3GLKA 1SXQA 1DXHA 1VE9A 4HATA 2IU4A 2IIQA 3ESXA 4EY6A 4CT5A 3H3FA 4A0SA 1YHNA 5D5PA 1ZUD1 3EDRA 4XAQA 1XHLA 5FOTA 2FPSA 2H1WA 5JAMA 5P21A 3SVTA 4UDYX 4WADA 1ZITA 2G09A 1SC1A 1PG2A 1NMEA 3TMYA 5KTPA 3KJFA 1NN0A 1B00A 1CS0B 3QEMB 4RX1A 4DE5A 2JD0A 3RVOA 3CEMA 1O5TA 3EDQA 2R7MA 5EIBD 1LDYA 1G291 1H6CA 2BLLA 3N2GB 2PT6A 4DHWA 2VAPA 2XE8A 3AEKB 3FR8A 3OZ7A 4TVSA 1AUVA 1W4AA 3GDWA 1Q21A 1MVLA 4FMCF 4RCYA 2OEPA 2ALJA 3HQ4O 5DHSA 4ZKEA 5F7OA 1LNQA 4ONEA 2RHMA 4FDMA 3J80A 3DOOA 4I36A 2YNMC 1MA3A 2CHGA 3UHAA 4L28A 4DB4A 1MU0A 1H8EA 4C0JA 1U3FA 2VJKA 4JLOA 4Z2AA 3COPA 5EXDA 4BBJA 5B2FA 5BV0A 5CLQA 5A0VA 4BV8A 1J2EA 1R4ZA 1L2TA 2CUZA 5J59A 3W8EA 2OXCA 3K0AB 1ZY2A 4WZ6A 4ND6A 5MFZA 4KYIB 3MT0A 2CFSA 2UVQA 1T26A 3PUWA 2ID8A 3C6QA 1PVOA 1L8LA 1OMOA 2P9TA 3GQBA 4AN1A 1D1TA 1T2VA 5EGNA 2VF8A 4QQNA 1BGVA 1MCZA 1XGKA 1X42A 3EOAI 1O58A 1W25A 4Y1RB 3WDLA 3WIUA 4J03A 1QF9A 5DLDA 5A04A 4XJVA 4AZTA 5EZYF 5FBZA 9ATCA 3ABQB 1FFEA 4RORA 3UMRA 1ML3A 3TECE 1EJ6A 1UBKS 3K53A 4MYHA 4D99A 4KG7A 2O3UA 3AF4A 5E2BA 1ZL2A 2MYPA 3FLMA 3QK7A 5F1OA 2A59A 1TEZA 3FA2A 3L41A 3TQFA 2O3JA 2XUDA 1WSBA 3GFOA 4G8DA 3WKEA 2HA2A 2DPMA 1NFRA 1JJIA 2N0SA 1YQ9A 3Q9SA 4LJYA 4EAQA 5FORA 4PTLA 2JHPA 4PWZA 5HGXA 4KPYA 1PWXA 3K05A 3Q1KA 5JH7F 1T24A 3B1JA 1H93A 3LPLA 3UOAB 3EXAA 1MJNA 3EF3A 5K0CA 3UXHA 3PFFA 2VDMB 3VNBA 1Z75A 2JLRA 4OAPA 1MO5A 4PZZA 1OROA 1RD4A 3QUTA 1EWKA 2G5GX 5KWVA 1YVDA 4OQLA 1LQTA 3NBZC 1H2WA 3BGVA 2HLPA 4JLDA 3TQQA 4DMFA 4ZJUA 1N4DA 3RC8A 1OZAA 3TPCA 3R3JA 2Q2WA 1PTJC 1RKUA 4TVOA 1E1MA 4UXJA 4ETIA 1MD9A 1N1DA 2FSGA 3AOEC 5DHTA 5G3ZA 1U3TA 2X0JA 7YASA 1GSAA 1E0DA 4WXMA 3T3GA 3FTCA 3K0BA 5IHXA 2C4KA 4KQHA 5IYZA 5H02A 5IVDA 2CEKA 4LRWA 3TW8B 1JFVA 1H9BA 3C3KA 3T1VA 3EVTA 2WKRA 1NT4A 3UJ3X 4FGKA 2IQIA 4E7OA 4QRHA 3RS5A 2PS1A 1SG9A 1DTEA 5H0IA 5KTOA 5LLDA 4LGMA 4NH4A 4CYMA 3DVAB 3HKBA 2YQZA 1VHLA 1TFUA 3MILA 4CV2A 4QUIA 2AV6A 2V4MA 5DDIP 5AVOA 1XROA 2AJTA 2ES4A 4N5HX 3KU4A 4CQLB 2G83A 1EDOA 1X1QA 5T41A 1AKUA 2H1IA 4OHRA 5K3AA 3QEAZ 4TUYB 1T1RA 1HEUA 3NS7A 4JJZA 2WUDA 2PH3A 3OQPA 4BCDA 2PLWA 2EJTA 3T7CA 2ZWMA 3GLFE 3E0QA 1J2RA 1G8GA 2J3QA 2W37A 2Z30A 4BXOB 2GWRA 1Y9DA 2HMWA 4MYRA 4RJLA 4RAQA 5TGTA 5BSKA 5BP7A 2G40A 3B2QA 4KGXA 3UUEA 4Q5IA 4ZK2A 4QXQA 5H3HA 3SP1A 1QZTA 1DHRA 2BEUB 4HLNA 1QKIA 2QZ4A 1ZD3A 1UKYA 4ZO6A 2VHVA 5EUMA 1XTIA 4YAIA 4BMOB 3T5AA 1X1AA 5HP4A 3ZPXA 3LTEA 2V65A 1TK2A 3FETA 3NW9A 3R2JA 4ME6A 4WOKA 4YT2A 1DJLA 3GK3A 5KQGA 4Y2SA 3TSWA 1XO1A 3HP1A 3G5LA 5A1JA 1JB9A 5JJLA 4UHJA 5E2IA 2DLCX 3TOVA 1PFQA 1MAAA 3PWZA 1CKEA 3LQKA 5COBA 2BBOA 1KDVA 4D3FA 3U6KA 2D6FA 3E8XA 1GAXA 3F49S 4PSUA 2JASA 2H51A 3C8MA 3I4FA 3QLUC 3RS9A 1Z7GA 3PRJA 3V1NA 4AY4A 1HDIA 4PTYA 1OLSB 2ZTHA 2H29A 1KE1A 1TM2A 2AJDA 3KQWA 4R9RA 5FEMA 4X64B 3OURA 1L5VA 2YXDA 1C0LA 2ODTX 1VCHA 2UYYA 4KN8A 2PV0A 4KE9A 3ZCTA 4DABA 4URXR 3VYWA 1KYWA 4I9GA 5BMVF 1F5SA 4QYXA 5EWJA 1AQJA 3G85A 3GJSA 3ZI4A 3K9LA 4KLRA 4IW3B 5GGXA 4M49A 1ZOOA 4DRXB 5BY2A 2X23A 5U9CA 2X6RA 2G6BA 1J6UA 1STOA 3F0TA 4KLZA 2PSHA 4N0EA 5ALVA 2A14A 2OAEA 1ZD8A 4ZQIA 4G1EB 1Y1PA 3E3OA 2E4UA 2G0NA 1H23A 2V3VA 4WLFA 4ZN6A 5FEUA 2FMTA 1W88A 3KAJA 1QTQA 4IS3A 4E2YA 3UJPA 4AVYA 2NZVG 4NOMA 1GG8A 2WTBA 4A1FA 4E1AA 4MUEA 2AI3A 2JAWA 3GZNB 2DX7A 1P7CA 1JR3E 1SA0B 2NO5A 2OZLB 3PXCX 4IIVA 3MJVA 4OLHA 2V0GA 1C4XA 1CDZA 2V4UA 3L3BA 1T43A 4KXYA 5DCYA 5T6BA 5BN3B 4HNTA 1Z8HA 4KIJA 3KL2A 1G9TA 5MDHA 3LU1A 1LPAB 3PKJA 3H2BA 1GL7A 4H1UA 1WLYA 3P9XA 2FPLA 4Q4AA 1KBZA 2BP7B 1YCGA 1OXBB 1T5IA 3I2FA 3THOA 2P1ZA 3QKUA 3ICQB 1KK3A 1U9IA 4BQPA 4G86A 3AUUA 3WDSA 3SGLA 2LRHA 1GQQA 3THYB 3DEZA 5AXAA 2AL7A 1YCDA 3ESAA 3VXKA 3U80A 1E2GA 5T64A 1DIRA 2QTWB 4OOFA 3GA0A 1EFVB 1GNSA 1TX4B 2HFJA 2R79A 3ETJA 4II7A 5C1IA 4LEIA 1D1SA 1EFRD 3B78A 4H0CA 4P7FA 3AQ4A 3N8NA 1GDDA 1C9YA 1O9GA 3UOGA 3GEEA 1NXQA 5ERGB 4CQMB 2IWRA 3T94A 4CJXA 2FU5C 2HSJA 3FPGA 3VR3D 2IBMA 4B6QA 1QRSA 1WD5A 3WGJA 2NSYA 4H3KB 1THTA 1ULUA 4LXTA 4BDTA 2RGAA 2GPYA 2BWJA 1KFEB 2Y1FA 3K0CA 4DMHA 4ZIRA 1N2GA 4GXNA 3CVUA 4EP1A 4E5VA 1QG4A 1PJQA 2V9CA 2C7VA 3DHNA 3ORHA 1Z0KA 4R4JA 2PGLA 2Y3IA 3EFOB 3HU2A 2FHPA 1XRQA 3CO5A 2CLDX 3IP7A 4HY3A 4GVXA 4R1PA 5HCUA 3T61A 3WGUA 1N5LA 1J8VA 3ZW9A 4KTTE 1A9YA 4JENA 4WFQA 2FFJA 3JQ8A 4OHWA 4PZDA 3FHTA 3CPJB 1LBHA 2EFGA 2NVOA 2R9VA 3FSEA 5TV2A 3CUKA 4ENVA 1J42A 3INGA 2GYWA 2HH9A 3ZEAA 2GD1O 3NHAA 1V8ZA 4PG6A 1ZONA 2F17A 2QSJA 1R74A 1MB2A 4ZHQB 1GPMA 2XVYA 2XZDA 1UUFA 3DT6A 3RSSA 3RHFA 2O7RA 2RGBA 4HNVA 1Z39A 5CVCA 5C31A 1ZOLA 1JEAA 3IA2A 1WZNA 1R0KA 3VNAA 3GFQA 3KJZA 5E9JA 4F11A 5IMBA 3OPXA 1G98A 4C7XA 5BUCA 4IKEA 5C8DA 2HX1A 1THZA 4DUZB 2BFEA 5FPTA 4EI9A 3IJ5A 1ZL0A 2I76A 4M0KA 1M33A 1PQWA 4AUMA 2C2OA 2NZYA 1QYIA 2HQ1A 2XYGA 4D3YA 4DRYA 1SC6A 5JDIA 2B98A 4G09A 1HT1E 1LUAA 3A1NA 3WQBA 2B2NA 4Q3CA 5G4LA 2ZJ2A 1G21A 3OZGA 3MMXA 4BE7B 2H4XA 4ID3A 4PV7A 2VHWA 2VJBA 1QOZA 4JIMA 3V3TA 5AM1A 3MT9A 4AP6A 1OLXB 1QIMA 1RAEA 1FQOA 2QVGA 3Q9UA 3ZE2B 1C7RA 2QN8A 3LSTA 3WB0A 1HL7A 1MV5A 1M54A 5HRAA 3IE0A 2F43B 3RG2A 5M29A 1PT9A 2BUCA 3Q7IA 5ALHA 2PX4A 2G8NA 4MJXA 2P2CA 3OIYA 1W2WB 2A5FA 1A96A 3FKSA 1SU4A 2GKSA 1RRPA 3BH0A 3IQHX 2XTZA 4E2XA 3UFXB 3VAYA 2FFBA 4CN9A 1L1QA 4G63A 4NV0A 1POWA 4RTJA 5HNKA 3G9XA 1OREA 4XPIA 4B73A 1J1UA 4E2WA 3H7AA 1R7RA 1KMHB 1Q2XA 2YWCA 5SY6A 3FLBA 3JYNA 3AUSA 2F1KA 2PD4A 4L2IB 3U0BA 1EHYA 4KKVA 1MNQA 2Z5VA 1ORIA 2GJKA 1CZUA 1MKYA 4Y0NA 2FPUA 1LFDB 5DX0A 3RSLA 4ZCMA 2XLCA 3FZGA 2GERA 2JBWA 3KKQA 5TGDA 5L45A 3QVSA 5F76A 3HXOA 1KJZA 2Y2VA 2ZZNA 4MMYB 3IOYA 4KITB 4BIIA 3AWIA 5HCNA 5A9RA 1IQ0A 1Y34E 2PRSA 3M89A 4A92A 4UU0A 5LQDA 4K28A 4N7RA 5IX8A 4NONA 5JUWA 2H0QA 2P90A 4UM5A 1WDMA 2NSLA 4JLBA 3RBAA 1SH7A 3AG6A 3AI7A 5IN4A 4XFJA 4C5CA 3LC2O 1KJ8A 3ICPA 2H9IA 1NMXA 4HGRA 4HX5A 1QO0A 4AFNA 2FOIA 3N2ZB 1I01A 3KG2A 4YMIA 5BR7A 4MI3A 3GG2A 3VJKA 2UXDB 4RDCA 5AVJA 5B3KA 1F1BA 5EJ7A 2XKKA 2QYTA 4WY2A 4JASB 3R4VA 3U6BA 1CW2B 1X1SA 1FCJA 2CCGA 2QD3A 4HH3C 5DW3A 3NLLA 5HX7A 5FTWA 1USKA 4ALIA 2FWAA 3A6FA 3DO6A 3EXHC 1M0WA 4JVOA 4BFSA 5C35A 1Q57A 3JY6A 3PGXA 4CKEA 3AHEA 2EERA 2P3QA 1NXWA 3DL2A 1XE3A 1YIOA 4LJKA 4DCJA 4ZEXA 4EW1A 3FPFA 3G2LA 3GRUA 1NF8A 1Q5PA 5GINE 1I3OA 1Z5UA 1FP1D 2XA2A 4RZQA 4C4SA 3BE6A 1SCJA 3DR3A 5DW0A 5FBLB 3GLIB 1EWVA 4LZNA 3DMRA 4GWKA 3I5XA 1P4GA 4LV5B 4CG3A 1NE7A 5J63A 4L9WA 4A7PA 5GZ6A 2Q21A 2WM8A 2J3IA 3L7IA 1FUIA 3G2JA 3EEIA 1OV6A 3EQ7A 4RVDA 4PINA 4J29A 3SZRA 5JMWA 2P9ZA 4HFMA 4IF4A 4LI0A 4DREA 4P58A 5ITSA 3EAFA 3AIIA 5CW1A 3FY4A 2P2GA 1JBEA 2O8FA 1WBBA 1RQRA 3H84A 4L8GA 3F1LA 4H1VA 1LDEA 4KPUB 2OA0A 4CM5A 4EDHA 2OGUA 1E7SA 2QSYA 3NWEA 4U7WA 4BCCA 3HWSA 4HZIA 4JOCA 2B69A 2DYKA 2DG2A 5D3ZA 1I7DA 2AUNA 3QWHA 3GFRA 3G2KA 4BY9E 4GRIA 5BWNA 4Y2QA 3GLGA 1G6OA 3P52A 3BN3A 5EWMA 5KPDA 5HILA 1Q83A 1WVIA 2D13A 1VMDA 1W48A 3B5IA 1POXA 1Z62A 3M6AA 4IIJB 2Y1GA 1AC5A 2IVFA 4JBWA 4O4JB 1KR2A 1N3BA 4K46A 5IEBA 2J3HA 2QTRA 1JH9A 1FJGB 3OFVA 1IN5A 3M6VA 3X1DA 1YOVB 3NH9A 5E9QA 2QYSA 5F9HA 1G4UR 1GIAA 1MB3A 3W5JA 4B3RB 2JIZA 3NIBA 3PITA 5FUMA 2IP4A 1ZESA 2OV3A 1TQ6A 2WTMA 4MQ6A 3WBKA 3DFFA 4HEA1 4NXNB 4RXMA 3LUGA 4EBBA 4HQRA 2D4HA 1X8JA 2WG1A 4LSZA 4OXYA 1PG0A 4C9BA 3LPDA 1K89A 1V11A 2RCYA 3L07A 3P9SA 4NYJQ 1WOYA 3OKCA 2FSIA 4P84A 2FPGA 2QL9A 2Z95A 1PDOA 3ENWA 1SK9A 3ITDA 4AJ2A 2F9LA 2IC5A 2Q1TA 1HFJA 2G8LA 3SXJA 2IY7A 2BI7A 1RJFA 5H80A 1NV8A 4MPJA 3V8NA 4DDHA 3GN2A 2Y0BA 1FFBA 1JS1X 2RB5A 4QHTA 1UPAA 4F96A 1KVTA 3O2JA 3F9IA 5ADVA 3UUWA 2ZIXB 4BQRA 3EIHA 4QEKA 5IF3A 4O3MA 3NZEA 4MEAA 4OHCA 1FSSA 1YSCA 5AVYA 5JAOA 4RVSA 3X0DA 4HNGA 4C89A 2EV9A 3FX2A 1PSZA 4FTWA 1J99A 3WB1A 2FN9A 1CSEE 2J6BA 1L7MA 1RZVA 1P2SA 1W52X 3AHDA 1GPH1 4LQLA 1FMTA 3ZTYA 4B6JA 1I94B 1U7ZA 121PA 1CNEA 2GYYA 2I4MA 3SEQA 3QGMA 4V03A 5JATA 4CIAA 1H94A 1C8KA 1H6BA 2OXFA 2NXJA 1W87A 1AGXA 2JCGA 2VSQA 2QMEA 1DCFA 5CA1F 4BATA 4BWVA 2UYHA 4RK7A 2AOTA 1C1DA 1VL8A 3GEDA 3I0ZA 4DMRA 4RK4A 3PHGA 4NCBA 1RHUA 2FZLA 3HXLA 4IOKA 3EHDA 2IEGA 1WUTA 4J7UA 4KAJA 2V1XA 1CDEA 4MR9A 3TIFA 4YJFA 4FFWA 1ECFA 2G08A 4O2BA 5IFLA 3N3AC 1KMQA 1Y6ZA 3ZU5A 3FSGA 2OKCA 3N2LA 5J23A 1IUPA 5ER6A 1BQ4A 2JHCA 2H4HA 3GEPA 4OK5A 1W30A 4D4JA 1ZD4A 2C77A 1WTCA 3CH5A 3CX4A 3F2VA 4X45A 4EO9A 1JTVA 4IBOA 5DM2A 3K9FC 2FEAA 1QP4A 1GUBA 4IDAA 2HHLA 3R5SA 1C0IA 4MS1A 4X6UA 1COZA 5CH3A 1E0JA 4OAOA 3EZ2A 4KE7A 3STHA 2HR1A 1Y9AA 4PZEA 2VUUA 4D82A 1XZIA 1NYTA 1II9A 1R9MA 1KNQA 3O9VA 2I2DA 2JGJA 3PK0A 3EVGA 1W44A 2AI2A 3LD9A 3DE0X 3R74A 1QM5A 1EXNA 1USWA 2QZJA 3MM4A 4JLAA 4DIMA 5HBRA 2ZT6A 3TRHA 1Z0AA 2OORA 3LYUA 5BV2P 4NJEB 4ZXPA 1AHIA 2YRXA 4KUEA 2C4MA 5LBIA 4DSAA 3EDMA 3ET5A 1QLJA 4IQGA 4RGBA 2CFTA 1NY6A 1MFPA 2OB2A 4YREA 3NYRA 4WLEA 3RIGA 3RJMA 2WB2A 4QYIA 3EC2A 3G7UA 3IVRA 1K6IA 3E5HA 4C2BA 1S5PA 3FMOB 3D3JA 1AKVA 3LUCA 3OM1A 3QH4A 3QU2A 4R5HA 2FWNA 2Z98A 3KJGA 4Q1FA 3RAEC 4EBFA 5HM6A 4MHOA 1FFXA 1VXRA 3ZCQA 4EPYA 4YMVA 2VRCA 4OHYA 3ZE6A 4NBNA 2CJXA 2FCAA 2XJ4A 3KBBA 3NOXA 4OQEA 4I1UA 4TSFD 5CLIA 5CCXA 4B3TB 3K1AB 4R2IA 4AY2A 1R66A 7MHTA 2VCYA 4BO4A 4EF4A 2OM6A 3VSDA 1RHJA 2ZUTA 2ZWVA 1KU0A 5I4KA 3CNEA 3N86A 4HZUA 2GEKA 4KL8S 4LV6A 4OKSA 3SZOA 5CEEA 2XTNA 2VPTA 3L18A 4GPIB 2CZQA 2D2XA 2ZRNA 4YCCA 3BFPA 1XZPA 1TT7A 2QAIA 2VWPA 3OKAA 4KFTA 1JQLB 3ORYA 4BAGA 1XQ1A 5C46F 1D5WA 3MWJA 3WLLA 3DDZX 4DLAA 4Z4HA 1W5BA 5M5BA 1NBMD 3BHIA 3WDMA 2XCOA 5B6PA 5FXMA 1LI7A 1ZIDA 3JQGA 2DCUA 4U7FA 3K0KA 4JU8A 4DDKA 3Q9NA 5IVHA 2O0LA 1BE8A 2C0QA 2VHTA 4CMCA 1OIVA 1G2QA 3ZK9A 1G8MA 5AHXA 5DGXA 3D31A 1U4OA 3V4PB 5TVGA 4P36A 5AVSA 4RD2A 1NJ8A 3OCCA 5JZBA 3TL2A 2BJWA 1DKQA 2MINB 5ETJA 3VPCA 4BGIA 3FUCA 1J9GA 3I83A 3FH0A 3D8HA 1A1VA 1QIIA 1A9PA 2IEZA 4BO0A 5JCJD 3HL0A 4LNAA 1BDMA 4BB0A 5L51A 2HPVA 1B2RA 1ORWA 1YVRA 3GUHA 4HWTA 3ORFA 3CSDA 5KYKA 1ZIYA 3DPSA 4IIHA 3TGWA 2W6IA 3CJTA 3AB3A 2W2LA 2HQSA 2VAVA 3DZIA 2HSDA 3RVBA 5BSEA 4HCJA 4YP9A 3EVAA 5IBCA 4L8YA 4TQ9A 4CV1A 2I7TA 4TTQA 4B3FX 1Z6GA 2Q0SA 3N8KA 5B1IA 3QKWA 2LZ0A 4NESA 3UCFA 4W1SA 1IHDA 5IHPA 1MC1A 1SZPA 2GN8A 4JUFA 3O8LA 5LQKA 4PS0A 3WB2A 1EHIA 4D98A 5BPFA 2YFYA 1RXUA 4YI3A 3JQBC 4TMFA 1ZGGA 2DKOA 3ISVA 4E07A 1CY8A 3IUMA 4IDQA 3ZQKA 2SKEA 3EXG2 3TTWA 1VIYA 4IWXA 4MIYA 1WWKA 3HZZA 4GOXA 5AKXA 4UJ3A 4B3JA 5D3QA 2F1HA 4M1QA 2X2PA 3EGVA 2BKXA 2R00C 4BFXA 3PLRA 2CDNA 3EGXA 1X9GA 2O52A 2Z6QA 4L7VA 1BH2A 2GZ3A 2VHJA 1UM9B 5EIFA 3UIEA 4AJJA 4I55A 3PSHA 1OFTA 1T36B 4R68A 3WKCA 3DB2A 2R65A 3LPCA 4GS5A 5DHQA 2B4TO 3K0FA 2NLOA 4CLRA 2ZTLA 2GVZC 4G01B 5G1PA 4R1MA 2XNDA 3DMPA 3LGXA 4CGZA 1CJKC 2O6HA 2ZXUA 3X44A 2QA5A 3B51X 4JL6A 4CM1A 2CSUA 4OVKA 3TZ6A 5LMNB 1E2KA 3WGKA 4R1QA 3WO0A 1J06A 3AY6A 5DLEA 2B4QA 1OBHA 3MAJA 4ZARA 1WULS 4GM4A 4LMAA 1OGIA 4X7RA 3PSAA 1ZNXA 2XDAA 4LTMA 1CY4A 3TLMA 3ZHBA 4OL0A 4D56A 1GZ6A 3W6NA 1CR1A 2NO1A 5B4VA 1KO1A 4LV8B 3QEMA 4BLQA 3OE7A 3W2GA 5JNRA 2VIIA 3D2CA 1G6KA 4RBNA 1NG1A 4C01A 1YL7A 3X2FA 2X40A 3S68A 3N28A 3CHYA 1Q0HA 5DF1A 1SKYB 2E0IA 3N2GA 3N5CA 2C78A 3TD9A 3AEKA 3FCUB 3G2MA 3NASA 3U1TA 1KDZA 3KPJA 4ENSA 1F8GA 1O87A 3WWYA 2VL7A 3I2KA 1T4CB 4R2LA 5FR1A 4UTVA 3ROGA 2VDNB 3AU8A 3V48A 1T4DA 2G1KA 3IJRA 4Y30A 3EEYA 3R7AA 2JGDB 5I7FA 5D7NA 1XA3A 3RFVA 4F4JA 2QQGA 4JLVA 1H2YA 3EDCA 2OHGA 4KMRA 3OPNA 4HUJA 1DG9A 1PS0A 4WRRA 2NO6A 4UU1A 2QN6A