5EL0A

Crystal structure of an oxidoreductase (short chain dehydrogenase/reductase family) from brucella ovis in complex with a partially ordered nad
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
239
structure length
223
Chain Sequence
ERKTLVLTGASRGIGHATVKRFSLAGWRVITCSRQDFSENCPWPAGPEDHIKVDLSDPEDIGKAIAEIRRRLEANGSKLHALVNNAGISPKAEGGRRMNSIETPMAVWRDVFQVNFMAPIMLARGLFKELEAAQGSVVNVTSIAGSRVHPFAGTAYATSKAALAALTREMASDFGPYGIRVNAIAPGEIDTAILGKTSEVAETIYFLCTETSSYVTGSEIHIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Oxidoreductase, short chain dehydrogenase/reductase family
publication title Crystal structure of an Oxidoreductase (short chain dehydrogenase/reductase family) from Brucella ovis in complex with a partially ordered NAD
rcsb
source organism Brucella ovis (strain atcc 25840 / 63/290 / nctc 10512)
total genus 79
structure length 223
sequence length 239
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5el0A00
2X86A 5A05A 4B3HA 1P9LA 1SOVA 5L7TA 2Y66A 2E82A 1DXYA 1I3NA 1EE2A 1K89A 4GBJA 3OICA 3O38A 1G1AA 4E3ZA 4ESOA 2X5OA 3RUHA 3ZU5A 4TMFA 2VT3A 5ENDA 4OYRA 1QLJA 3U4CA 3VDRA 2BI8A 4D41A 3DBRB 4CMEA 2C7GA 3ZV6A 3DTTA 2DBRA 2I66A 5JO9A 2NQ8A 2RHCA 4CL8A 3RC2A 4WEOA 3JQGA 4OXNA 1HE3A 1JVSA 2O3SA 1HE2A 3BMQB 4FSHA 5TS3A 5FI3A 3JSAA 1XWFA 3CKYA 2YQ4A 4UVGA 4RPGA 4EUEA 2SCUA 4PVDA 2PV7A 1E1NA 3AY6A 1GPJA 1X13A 3IAHA 1HZJA 4KUEA 1LJ8A 3CIFA 1CERA 1LC3A 3K5PA 4K1LA 3CZMA 5B12A 1O8CA 3Q3CA 4UEJA 4DBVO 5AXCA 1GZ4A 3O03A 2FSSA 3QW2A 2NVUB 2DAPA 3PGJA 3H5AA 4ZA2A 2QYTA 1ZSYA 2WYWA 4XYBA 2GERA 3FR7A 1DAOA 3AUSA 1RPNA 2C29D 2UVDA 3IDSA 1ENPA 3MOGA 3NV9A 2PZJA 1YJ8A 3PYLA 3WLEA 3ZZNA 3IQDB 4B3IA 1W6UA 2AQIA 2IYPA 4BKQA 1TT7A 2HUNA 1B0AA 3E1KA 4GI2A 4GX5A 4J90A 1B3BA 1LX6A 1LSJA 3KVOA 3NDJA 5EINA 4F6CA 1IPEA 4B4OA 4KMSA 4BO9A 3NRCA 4YJGA 8ADHA 4OHUA 3A1NA 1GAEO 2O2YA 4TRMA 1Y8RB 4KOAA 2E6UX 2Q1WA 3DB2A 3IMFA 3Q2IA 4UAGA 3V5NA 4LGVA 3S2IA 2GZ3A 5I9MA 1PS9A 4XEHA 3W1VA 1LBEA 3H9EO 4MVJH 4Q39A 1R0LA 2AE2A 4AFNA 2A35A 2BF7A 3DBHA 5CDYA 4Z3KA 3R1IA 3DL2A 4JGBA 4JBIA 1Z7BA 2Y93A 2FR0A 3E6AA 2EHDA 4NBUA 3AM3A 4XGNA 1XYGA 2PZKA 2WD8A 4D46A 4AJJA 4IINA 1T2AA 5B4TA 5CG2A 3V2GA 4P4LA 1EBFA 4II3A 4BKPA 1ZKMA 3GOHA 2X9NA 1C3VA 1AHIA 5GY7A 4XYEA 4CQMB 1ULUA 2NLOA 1GR0A 3RC7A 2OORA 4Y9DA 4J1SA 1MFPA 5DOZA 5HA5A 4YAIA 3E5RA 4L4XA 1HTBA 3EK2A 1YBMA 4Q3AA 1PZFA 3WTBA 3ZHXA 4CMAA 1IUKA 2G1UA 2Y1OA 5A5EA 5B1YA 4I08A 3GGGA 5JDCC 4UUMA 4AL4A 4OM8A 3AK4A 5JSFA 4DMMA 2RCYA 3JQ6A 2VYVD 4WPGA 3MTGA 1ZH8A 2PWZA 3L07A 4TRNA 2VRCD 3JQFA 2HMVA 4LK3A 1RJWA 4FBGA 3LT4A 1HYEA 3P7MA 4A73A 3DXFA 3ANMA 3GMDA 1VC2A 2J6IA 4GPD1 4LVUA 2NVUA 2ZYDA 1J49A 3DMTC 3VPSA 2XXJA 3QSGA 4XA8A 1GV1A 1JKIA 1OZAA 4FW8A 1C1DA 4I8XA 3GVHA 4WGGA 4ZRNA 4BV9A 3WSVA 5AXBA 4J91A 4FR5A 1VJTA 1X14A 5H82A 4BQPA 1NNUA 4KQWA 3GZNA 4ROSA 4MVJF 4F3YA 4OOEA 4R41A 3GVCA 3GAZA 1R16A 2Q50A 5L4SA 1U7HA 3L6EA 4NFYA 4AJIA 1F12A 4YAGA 1UDCA 4PRLA 4YDRA 5T64A 3EW7A 2E37A 1R12A 3PWKA 4CLOB 3D4PA 1ADFA 1UH5A 2CVOA 1KIFA 2PR2A 4HP8A 3RAJA 1E7MA 4PLTA 3VZQA 3JQ8B 4NBRA 5A02A 1NQTA 1AE1A 4XB2A 3PJDA 1CRWG 3CH6A 3U3XA 1YGYA 1JW9B 3MJVA 4IJVA 3B1FA 1NAIA 5KJFA 2EW8A 4HV4A 2P9EA 2FZEA 2YFHA 4ZU3A 4RDHA 5TRTA 5A5FA 4WCFB 3WGYA 4EJ6A 1BXKA 1N1EA 2FP4A 2VOEA 4LVCA 3MJEA 3I1JA 3KLMX 2RIRA 1BWSA 3L4BA 2OXIA 4WLVA 3Q0EA 2WE7A 3GA0A 4HWKA 2CF5A 3F46A 2ZB4A 3FPCA 1GCUA 5EN4A 1CYDA 1Z82A 3WJ7A 5MDHA 4NFSA 1XIVA 1YBVA 4TRJA 4W9NA 4XB1A 3E5MA 3HN2A 1BXZA 3GFBA 4NU5A 1U2DA 3NEPX 3I83A 3DBLA 2EXXA 5DOVA 4EJMA 5CAEA 2LDXA 4OXKA 1GU7A 1EQUA 3SLGA 4B8ZA 4R3WA 3DZIA 1NR7A 2CDBA 3H5NA 3PK0A 3O8QB 1ZVMA 3A28A 2Q45A 3EYWA 3VOSA 1F06A 4I9UA 1KERA 2ZB8A 5L45A 3L6DA 3E9NA 4ZN6A 2NUAA 3B1KA 1JKFA 4H3VA 3N7UA 4QX6A 1A27A 1C1XB 1OOEA 2HKIA 2YY7A 4IZHA 1PJ4A 4DQXA 1LSOA 3KRTA 4LRSB 4FB5A 2A94A 2XOXA 3FTNA 3FF4A 1ISMA 3VZRA 1V6AA 3F4LA 3H9QA 2J5RA 3RD5A 5JFOA 2HU2A 1FXSA 3EZYA 4CLRB 1K6JA 5F1KA 1SO8A 4BNIA 4DYDA 2X23A 4I1IA 2POQX 2X58A 4FN4A 3ZV3A 4XDYA 4YT8A 1EK6A 3CSDA 4JJIA 3RASA 2GD1O 3V1TC 1WVGA 2Y0CA 5DCYA 3CEAA 2AG8A 3D0OA 1YQDA 2HK7A 7MDHA 1GUYA 1IL0A 1CETA 3JQ8A 4J7UA 2G0TA 4MPDA 3DHYA 3HJAA 4DPKA 5L4NA 4W7IA 3H6KA 2CMDA 3ZW9A 1JA9A 4BO6A 4UVEA 5TJHA 3I9MA 3L6OO 3BIOA 1Z7EA 4O5OA 3GEDA 4YTEA 1MXHA 1CEQA 2Y05A 4IBOA 4D3DA 5G0UA 1PJBA 2IEDA 2X1HA 1ZUD1 2B36A 4Z0PA 3VH1A 2YHUA 1Y8QB 4UVDA 2WD7A 1K0UA 4RCVA 5AYVA 4RLSA 3A4VA 4NBTA 1MXFA 1NPYA 1OC2A 5ENVA 2UAGA 5KNLA 3LT0A 5KVCA 4GMFA 4BGUA 5I9NA 5F5NA 1LDGA 2W2KA 4IDAA 5DCWA 4EUFA 4A03A 3TFQA 4A0SA 1IHYA 1WLYA 2YJZA 5I8ZA 3PZRA 4JQCA 1ZMTA 3NT2A 1KVTA 4IDDA 3T7EA 1HLPA 4JJGA 3ZU3A 1E3JA 4CQMD 2YUTA 3WGOA 4D7AA 2IYOA 1BSVA 3EMKA 3FNFA 4KZPA 3ZU4A 4BO4A 5BR7A 1MG5A 1YWGO 2RBEA 3W6ZA 4L8VA 4DIOA 2LDBA 1AN9A 1YB5A 4PLZA 2I6TA 4ITUA 3AM5A 4BNUA 3TPCA 3O8QA 1XA0A 4CUKA 4AVYA 4PLYA 3LVFO 1VKOA 1C0LA 4CPDA 1GYQA 3ITDA 1EUZA 1GADO 4L76A 4ZJUA 2CD9A 4GWKA 3L77A 5G0VA 3UXYA 2GZ1A 3GT0A 1CF2O 4IDCA 4BV8A 1PJSA 4A26A 4YAJA 1PJLA 1DPGA 2V6MA 4XIYA 5FYDA 3C3XA 3E82A 4B79A 4R1TA 2P5YA 1UXJA 1N9GB 4WLEA 3D3EA 4UEOA 1Q0HA 5THKA 3GDOA 1ZJYA 3INGA 2EERA 3GY0A 1WDLA 3ONEA 4CM9D 2A92A 1PGOA 2FPGA 3UH1A 1CQIA 3HFGA 5J23A 5CDSA 3ZWOA 5I7SA 4FOSA 3Q9NA 4N18A 5HM8A 2JCYA 2IZZA 4YRAA 1PL7A 4K26A 3P2OA 3ON5A 2GN6A 4IS2A 3FRJA 5I8WA 4G5HA 3QLJA 1N2SA 1LA2A 1Z73A 3WGIA 1X1EA 2Q4EA 3AUTA 2VUSA 3B20A 4KWIA 1H6CA 1DB3A 2JCXA 3KTDA 3MJTA 4Y6RA 1Y8QA 2JFGA 4S3MA 3NT5A 1ISGA 4E6PA 3DMTA 1YB4A 4J9VA 1T2DA 3RJ5A 4NBVA 3DZFA 4IDFA 4YB8A 3WFJA 2DBQA 5JCJD 3K73O 3GGPA 2YFQA 4LSMA 3TRIA 2I3GA 3ZWNA 3DONA 5IDXA 4U6QA 4IJUA 5JYEA 4RV9A 1P45A 2DLDA 4OL9A 5F1OA 4PRKA 4OIMA 3UUWA 4NJOA 1W4ZA 3DHEA 2I76A 3PI7A 4N7RA 1P1IA 1HEUA 2O3QA 2DTXA 5L7YA 5CP8A 4UUNA 1GYPA 4HKTA 3ZNPA 3ICPA 3UFXA 1HDOA 1VL8A 1YO6A 2QG4A 1GQ2A 4LMPA 4CLHA 4TZTA 3JYQA 4WLOA 3JCZA 2TMDA 2DPHA 2VHYA 3S2EA 3WXBA 2C07A 1R4NA 3RUFA 1L7DA 4A10A 1IHXA 4Y6SA 2Q2QA 2C7VA 4MP3A 1T24A 3S55A 4RZHA 3HDQA 3RC1A 4FFMA 4K28A 4UEKA 4R54A 1Q0QA 2RH4A 5JY6A 1QV7A 2QQ5A 3GRPA 1CIVA 4MKZA 1ID1A 2DU8A 2X4GA 3FCOA 3HSKA 3JQAB 4TVBA 2VWHA 1ONPA 1NVMB 1PQUA 3LF1A 3L0DA 2JFHA 4YJFB 1M2WA 3H5RA 4IDGA 3KYCA 5T67A 4MJLA 4OGWA 1P1JA 5KVQA 1YONA 2ILTA 3TZKA 5FFFA 4QO8A 3OIDA 3C7CB 4E0BA 1XGKA 1OMOA 1XELA 1YVEI 5A3JA 3OQ1A 4WE3A 3LC7O 1NBOA 5BSFA 1KYQA 3ZI0A 4BNGA 2G5CA 2WSBA 1B8VA 2W98A 4XIJA 3OH8A 5I7VA 5CFZA 3WIDA 4L0QA 3MOIA 1H9BA 1LTHR 4IGEA 3RFXA 2O2SA 4RVHA 1L7EA 3UW3A 1DHTA 3GH3A 1C0PA 3GEMA 1ZEJA 2OP0A 5KJEA 3FHLA 3T4XA 1R0SA 3TDKA 1FF9A 2D2IA 5T57A 4BGVA 2DUUA 3W8EA 1FMCA 4J43A 4W82A 4XX0A 4DGSA 1GY8A 3T4EA 3IJPA 4DMLA 4GLLA 4CQLB 3O9ZA 3PWZA 3PHJA 5JAIA 1D3AA 3QA9A 1P33A 4TQGA 4I9NA 1NHGA 1XKQA 4JN6B 3PJFA 2OP1A 5DP2A 3ZWYA 4R1UA 1EBUA 2HMWA 4BMVA 5KIAA 1U5CA 3P2YA 5JXWA 1LDNA 1PSDA 2P2SA 1GEGA 4GKVA 5BNTA 1D1TA 4W7HA 4DLBA 3TWOA 1UDAA 2PK3A 1E7WA 2QRKA 4FC7A 2Q99A 2DKNA 9LDBA 4WNIA 5EERA 2JJYA 1RM0A 3AU8A 3FBGA 4IJKA 1X0XA 2IE0A 2OO5A 1DIBA 3LLVA 3GUYA 4PLFA 5B4UA 4XKJA 2HJSA 2A4KA 2VCYA 4HFJA 4MVJA 2YDXA 3VH4A 4BHTA 4P4NA 1KVSA 3TOZA 1E1LA 3ORFA 3QIVA 2X8LA 3ZV5A 4BKUA 3U62A 2NNLD 2PY6A 3JQAA 1NPTO 1QYCA 2GCGA 3JQGB 4A2CA 4GSKA 3PQDA 4JBHA 4S1VA 4YJFA 1YL5A 5CEJA 1PS8A 1EUDA 4JNKA 3IUSA 1GZ6A 1KY4A 2EF1A 4RPKA 1H6DA 3EVTA 3OM9A 4J2HA 4R1SA 1X7DA 1BDMA 2AHRA 4ALIA 2D8AA 2H1SA 2PGJA 3DTYA 2P91A 3HWRA 4LW8A 4Z9XA 4IM7A 1ZZEA 3UN1A 3NJ8A 4IQ8A 2E4AA 5A9TA 3OFSA 4AJNA 3RKRA 3NX4A 4FPXA 3OEYA 4I9HA 4J0EA 3LDHA 3FN4A 1KY5A 1NXQA 4PGFA 3VPGA 5C37A 1E92A 2C0CA 3GHYA 3KLPX 3RFVA 3W8FA 3UICA 5KVSA 1YXMA 1D7OA 4GKBA 5IZCC 3I23A 4IMRA 2QRJA 4D3SA 3COSA 4YR9A 1E7SA 2VHWA 3V2HA 3DWFA 4CQLA 1KVQA 1E3EA 1PR3A 4YJGB 1T4BA 2Y68A 1T25A 4CV2A 1E7QA 1JKJA 4YQYA 1EDZA 3TQHA 1RM4A 1N8KA 3PIIA 5JE8A 3DBHB 4RPJA 2R2GA 1T2FA 5DULA 1TT5A 3JQDA 2VWPA 3AFNA 3QWHA 1DIAA 1EVIA 5L53A 1SC6A 2RHRA 4J3FA 1MC5A 2GLXA 5DNAA 3V2UA 4RF2A 4R9SA 2I67A 2J3IA 4J49A 4LISA 1Q2XA 3RSHA 5JYDA 1NQ5A 1ZNQO 4DTIA 1H94A 4XZ3A 3KSDO 1E7RA 1Q7CA 3IIEA 3TL2A 2ZTUA 4UVIA 2ZIZA 5JS6A 1EFKA 3WMWA 3UGKA 2OUIA 3HN7A 3DDNA 4UULA 4XD2A 4IUYA 1MP0A 1R4MB 5HBRA 5C7LO 1OBFO 5KOIA 1LLCA 4Q3EA 1Q1NA 3D64A 3H7AA 3KYDB 2JAHA 1VM6A 4UREA 3UF0A 3WYCA 1T2EA 4MOWA 4E2ZA 3LK7A 4YBZA 4W99A 4XQCA 4CM1A 3EVNA 1H6BA 2B4RO 2JFFA 2EEZA 3ZHBA 3ZWWA 2HAEA 4BNYA 2CVQA 2VYVA 1PS0A 5TT0A 4F6LA 2IODA 1WXDA 2I3AA 3JQBC 1C1DB 1P1KA 5JDIC 1ZBQA 5DN9A 1ENZA 1LUAA 1JN0A 5H81A 3BMNB 4HNGA 1YQGA 2TMGA 4OMUA 2BFAA 3WX0A 3V1YA 5K6AC 3GZNB 4WASA 5BSGA 1R6DA 4MKRA 4E13A 5BSHA 1NTOA 3DZJA 2PKRA 1PWZA 3K92A 4WCFC 2Q4BA 4B7CA 1HETA 5EPOA 3OIFA 1Q7BA 1WZEA 2AEJA 3JQ9A 3WQQA 3U4HA 3F5QA 3JD0A 4E2WA 2O3RA 5U1PA 3DFZA 2XAAA 3PLNA 1FJHA 4BQRA 4BO2A 5ILOA 4KTVE 1KS9A 2QZ9A 2H63A 5KTKA 2AMFA 3ICCA 4E5YA 2O3JA 5BSEA 3UCXA 1PQPA 4YT4A 3AY7A 4YJHB 5K9ZA 1XEAA 1TVEA 1HDGO 4IZIA 4G2NA 3TL3A 4AJPA 2EW2A 2CDCA 4QQRA 1O5IA 1JVBA 3GQVA 4HADA 4PG8A 2BFMA 4IQGA 4PLWA 1ULSA 3GC6A 1HE5A 2BI7A 2QZZA 3OHSX 4Q3NA 5TF4A 2EKPA 3JTMA 3G49A 4RVGA 1TA4A 2Z95A 3ETEA 3NGLA 5G4LA 5AXDA 1F0YA 3VVBA 1T4DA 2CVZA 4JJFA 2Y1CA 4CJXA 3PXXA 4M1QA 2HMUA 2V6FA 5KCZA 3C1TA 4BMNA 2YYYA 4RVUA 3IL2A 4R3NA 3FD8A 3MZ0A 1G0NA 1ZK2A 5G0SA 4J16A 1R4MA 3I9OA 1ISJA 3BMOA 3FNGA 3DBVO 1QV6A 3DBLB 1Y9AA 3TN7A 3ANNA 3KYDA 4PN3A 2BD0A 2VNSA 3KO8A 1MV8A 3GRKA 2I99A 4JBGA 4E5KA 4J2OA 1O0SA 4BO8A 1GQQA 3K96A 2O23A 1TB4A 1LXCA 3OBBA 4N5LA 1SAYA 4GX1A 3BAZA 4F45A 4ZQEA 2O7SA 2DTEA 3PHIA 1A5ZA 4F46A 4GGOA 1LLUA 2FZWA 3BMNA 4P4GA 3R3JA 1WMAA 4M49A 4MP6A 3QP9A 4WJZA 3ROMA 3F4BA 4J7XA 1W8DA 1M67A 5T8KA 3MJ4A 3RROA 2BGMA 4N5MA 3KZVA 1XCBA 3C8MA 1WWKA 2EIHA 3FWZA 4CV0A 1CDOA 4WK6A 2PFGA 4HXYA 2AXQA 1T1RA 2P9GA 4U0KA 1QYXA 5DZSA 3HHPA 3QE3A 4O0LA 4DREA 3GN1A 2VUUA 1WDMA 4OQZA 3EHEA 3GPDG 1LC0A 4RJTA 5IZ4A 1G0OA 1PX0A 3G1TA 1J5PA 4R68A 2F1KA 4AJ4A 4CR7A 2ZTMA 1U4SA 4JX8A 4ZGWA 3UAGA 8LDHA 4YJHA 2AEMA 2YV1A 1LDYA 2C59A 1L1FA 4BNTA 2ET6A 1DRWA 1E1MA 3FSRA 4LSWA 3L9WA 1DC6A 3PIDA 3GMSA 3NUGA 1LDEA 1S6YA 2ZATA 1ONOA 2NACA 1AGNA 5FF9A 3JYPA 2Q3EA 1KEPA 1ISHA 3H8VA 2WD7B 4CR6A 1LEHA 3QWIA 1N92A 4E21A 3D5TA 1I2ZA 3DEYX 1J6UA 2GR9A 3G0OA 1BVRA 1LSUA 4BB5A 2W2KB 2OZPA 5GZ1A 5A04A 1R15A 1U3VA 3BMCA 1B7GO 1EUCA 3SLKA 2PKQP 5G2OA 2PNFA 4UUPA 1RM5A 3ULKA 1B3RA 5TGDA 5HTOA 2BGLA 1BRMA 3OJOA 5GZ6A 4RORA 4RVSA 5A06A 1R37A 2W2LD 3LSYA 3OQBA 1XLTA 1E3WA 2RAFA 4GLOA 1DFHA 5BT9A 2YQ5A 3I6IA 3U0BA 1YH3A 1FDVA 1DIGA 2Y1GA 5AXAA 1GUZA 5A03A 2BFPA 2IRWA 1PGJA 3OMLA 1WW8A 4RGBA 1XU7A 4BNFA 5CDGA 2JKVA 4FFNA 4PG5A 3BTSA 4HFNA 3ZWAA 4BNHA 2P5UA 4DLLA 1B15A 3G17A 4BKOA 3DO5A 3H3JA 1E5QA 4LN1A 2YDYA 1PTJA 2NQTA 1ORRA 4BMSA 2NU9A 1Z75A 5HS4A 2GDZA 4IIUA 3TZQA 3Q11A 3NKLA 4HFMA 3PYXA 3SX2A 1A9YA 4MVJP 1XQ6A 4B4UA 2AQKA 1WPQA 1K2WA 2AEFA 4RL6A 4Z6KA 3JYNA 2IEBA 3ZNQA 4CR8A 1AUPA 1UXKA 3WMXA 2BHLA 3OETA 3RVDA 4CUJA 1HKUA 3WGHA 3GG2A 4FJ1A 1DRUA 2C20A 1MX3A 2J3JA 3H2SA 4OJNA 1YKFA 1ZIDA 3WGQA 2R00C 3TFOA 1PL6A 3ETDA 3OP4A 3DOJA 4CUZA 1YRLA 1BMDA 4HFRA 4A5OA 5ADHA 2QYSA 2ZYGA 3GFGA 5DBIA 5KWEA 1E1KA 4DIBA 4ZQFA 3QWFA 5TSDA 4D42A 1MLDA 3ZNOA 5EQDA 5GMOA 3ZW8A 1HWYA 4IQ0A 4R01A 3GNSA 4UVHA 2P68A 4CLEA 5IF3A 3OSUA 2C5EA 5IFLA 3ENNA 1V3UA 4DXHA 4JXKA 1OC4A 1DEHA 5K6AA 3ONFA 1YQXA 2OOSA 2EKQA 2IXBA 3VH3A 3AOEC 5L3ZA 2OGUA 1WZIA 2H9IA 5FWNA 2I65A 1HDYA 1XG5A 3NT4A 1UAYA 5JC1A 2VWQA 2IDZA 1PU2A 4R51A 3D7LA 3JD4A 5JAQA 3NJ4A 3NAQA 4ONEA 4CMCA 1PJ3A 4E31A 1GV0A 5EL0A 2FRDA 5IDQA 2DTDA 3I9JA 1IOLA 4O59O 3B6ZA 1SPXA 1YDEA 1O6ZA 1R4NB 2VHXA 3OA0A 1GL3A 1NHWA 5ICSA 1DFGA 3ROQA 4R5MA 3L4SO 1ZCJA 2V6GA 1ZSNA 3QJ5A 4NHEA 4XWYA 1ZXBA 3K6JA 2EKLA 4HY3A 2UUPA 4Y67A 4J0FA 1GD1O 1N7GA 4NZ9A 5IJZA 3BHJA 3CMCO 5COQA 4D45A 1Q0LA 1U8FO 3WFIA 2J5QA 4IJWA 2OMEA 2VT2A 1JDJA 5AVOA 2PD3A 4RO0A 3S1LA 4TWRA 3RI3A 1BG6A 1S7CA 1ZFNA 3I9NA 1YDWA 3TJRA 4IDBA 4TZKA 5FEUA 3KYCB 4BNJA 5T6BA 1U3UA 3WJAA 1Y1PA 4HNHA 3W4JA 1B16A 3ZHYA 1K6IA 1PZGA 3NDRA 1DAPA 3D4NA 5H83A 1U8XX 5JDCA 2BLLA 1I3MA 2DC1A 4DA9A 1U4OA 1BHSA 5DP1A 3WGTA 5KJ1A 1VL0A 4AJLA 1GEEA 2VYNA 4GX0A 4GWGA 1R0KA 3AI3A 3CUKA 1NYTA 3RBXA 1XDWA 1V3TA 1UP4A 2HRZA 1W73A 3NDIA 4FS3A 3VKVA 3UKOA 3BHMA 5EQFA 4FFLA 3AJRA 4FGWA 3NTOA 4XJSA 1KVRA 1MC4A 4Y8VA 3SC6A 3CINA 4DC1A 3TF5A 4D0RA 4R5HA 4E32A 3HDHA 5I9LA 2J8ZA 4BOYA 5G4KB 4CMIA 2YV3A 4ALLA 1UR5A 2X0IA 3EDMA 2VZ8A 2O3TA 1NM5A 4CMEC 5BNIA 4CM8A 3H9GA 4FC6A 2ZKLA 2FMUA 5KVVA 4HBGA 4ZD6A 2Y1EA 1LNQA 5BQFA 5I7FA 4NNJA 2B5VA 4IMPA 4MIOA 2YHIB 4RPLA 4AJHA 2QW8A 4BNXA 4Y6PA 4YRDA 1P74A 3PPIA 1VSVA 3BTOA 4ALJA 1KETA 2O50A 3HQ4O 4KDEA 3JYLA 2NU7A 1ADBA 2GGSA 2VOJA 4MDHA 3GN2A 2Y0EA 1JWAB 2YV2A 1UZNA 3ZHZA 2PTGA 4I5FA 4L74A 2HK9A 3TZCA 1QP8A 1WMBA 3KSUA 2JD1A 3QVWA 1AXEA 3T7CA 1NFQA 4E30A 1I36A 1DJNA 4YAKA 5L9AA 3H3FA 3K8ZA 1QSGA 2B4TO 4XDZA 1EEHA 4EGFA 5KKAA 2GO1A 3AU9A 2HQ1A 3WS7A 2EJWA 4CM7A 1GCOA 1VRWA 3FWNA 3I4FA 1CJCA 4Z9YA 2UYYA 3PQFA 5IN5A 4D79A 1MA0A 2YW9A 3QV1A 2Q2WA 4XQEA 4DL9A 2UUOA 2E48A 2ZTVA 3AWDA 3RKUA 3E48A 4PCVA 2FN7A 3SEFA 3SXPA 3HB4X 4AJOA 3E9QA 1WAMA 4WKGA 5JLAA 1DIRA 4W6ZA 2FPPA 4B4VA 4BS9A 3QWAA 5DCUA 3M2TA 1C14A 2DT5A 4M55A 4E12A 4DC0A 4IGFA 3O4RA 4J9UE 4QSMA 4M54A 3E8XA 3UCFA 3LQFA 5C7OO 5JAZA 1M6HA 1UP6A 2C2XA 3LU1A 5JBIA 5MGBA 1VKNA 1D1SA 2P4QA 3DAFA 1GDHA 3VPFA 3Q1LA 3PHGA 5DT9A 3ASUA 1IZ9A 3LT2A 4GGPA 4J1TA 2BKAA 3MTJA 5JCXA 5G4KA 3IUPA 4L9RA 4K9DA 1O95A 1QR6A 4GX2A 4DBZA 3PP8A 3WYBA 3GNQA 2X0RA 3DOOA 1SB8A 1O89A 3HG7A 2PD6A 2NVBA 4BNNA 3HNPA 5GZ3A 3KYBA 1CWUA 2W8ZA 2XF8A 2BGKA 1TT5B 4RPHA 2C5AA 2DBVO 4TSKA 3TNLA 2YHIA 3WTCA 4DLAA 5IG2A 5JW6A 3A14A 4YAEA 1ZK0A 6LDHA 4GVXA 5G0WA 2BH9A 1UZMA 2JD0A 3RJ9A 1FDWA 2R00A 2UDPA 2WM3A 1SEPA 2HCTA 2Q2VA 4D3FA 3JQFC 3N74A 5L40A 4WOJA 4N54A 4C7KA 2O7QA 1E6EA 4ND5A 5KJCA 2X6TA 4TROA 4CLXA 1GZ3A 3RWBA 3JD3A 4CMGA 4L4RA 3VDQA 1JQBA 3DR3A 2X7HA 1DO8A 3KV3O 4RLHA 4YYZA 3WBBA 2PKQO 1SBYA 2NADA 3LF2A 5TT1A 1VJ0A 1IPFA 1LDBA 1LRLA 1NWHA 3KB6A 5AQ1A 1LRJA 5F21A 2NSDA 5U4QA 1E5LA 3ZWMA 1V9LA 1VPDA 1GUFA 2EV9A 2D5CA 3QVXA 4Z9FA 1JAYA 1NQOA 4FCCA 3RUCA 2B37A 3AOEA 3E18A 1KEWA 4MO2A 1YB1A 3TZHA 3U49A 3GZ4A 1HL3A 4H7PA 3OIGA 1IYZA 1E77A 5LCXA 3JD2A 4XJTA 3INTA 2W4QA 2NTVA 4ND4A 3AOGA 5A3VA 1UZLA 2C54A 3D3WA 3GLQA 3N58A 4Z3DA 1OAAA 4P22A 3SC4A 1U2GA 4E4YA 1KOLA 4OKNA 1HRDA 2DVMA 1ML3A 3FBTA 4ZQBA 3D4OA 3W8DA 4MVJM 1QG6A 1PR9A 4EYEA 1DFIA 4ZHSA 1A71A 5T5QA 3Q9UA 2XPCA 1E3SA 3K31A 4FFRA 1CQJA 3I9LA 4RVDA 4CODB 2VQ3A 3OJEA 1BXGB 2ZK7A 1DDOA 2EGGA 3F47A 1YOVA 3ABIA 4YT2A 1ZK1A 3EY4A 3I9KA 4Q3DA 2PA3A 4ND1A 4WECA 4NI5A 4DWVA 4CV3A 3PJEA 1HDZA 4AJEA 4YVFA 1MG0A 3P5SA 4PZCA 3GR6A 4J4TA 2I5PO 4ND2A 4W9NC 4YJDA 1Z74A 1ZMOA 3OECA 4TRRA 3LLSA 1JLLA 2HSDA 1VLLA 1K3TA 3NTRA 2C82A 3WOHA 3ZWVA 3KSZO 4WLUA 3CZRA 1XHLA 2HJRA 4FIZA 3PJGA 4C4OA 4WLFA 3HUDA 3OF2A 3GUCA 3Q2KA 1KC3A 1TEHA 4DPLA 3DFUA 3X2FA 1ISFA 1IULA 3LC2O 3LC1O 1MGOA 2DM6A 4NIMA 4FOOA 1QMGA 2Z1MA 2ZQZA 1SNYA 2BELA 3F1KA 2PH3A 4GQAA 1U3TA 2D0IA 2DBZA 2V65A 5TQVA 3LT1A 3D1LA 4FQ8A 4MVJD 4GH5A 1VL6A 3E9MA 3BMOB 1NAHA 2Y1FA 1Y5MA 2WEKA 4BIIA 3OQ6A 1ZXLA 4GVLA 1U1IA 2EP7A 2Y99A 4XR4A 3KHUA 3JQCA 1PJQA 1SEVA 1TXGA 3FI9A 3JQAD 1KBZA 5TNXA 3VPXA 1GFSA 1G6KA 4HUJA 5F1PA 4BVAA 2ZTLA 4MVJI 4LCJA 3EAGA 2CUKA 1U3WA 2O4CA 3QRWA 2IXAA 4RQUA 5ER9A 4E2XA 1EZ4A 1JTVA 2NVWA 3GDGA 3OEWA 2VRCA 2QIOA 1BW9B 3KETA 5CEEA 1H0KA 1IY8A 4TKMA 1R66A 4EUHA 1UP7A 2VN8A 1RKXA 4OSOA 4X54A 1EVJA 2ZQYA 3C1AA 5TJ9A 2HMTA 4NMHA 4AJ2A 5KJ6A 1FDTA 4PG7A 5JPIA 1IE3A 4BO1A 2F00A 4B8WA 4ALKA 5IDWA 1VSUA 1EQ2A 1HDCA 2DPGA 2X5KO 2Y1DA 2OL4A 1ZSVA 4K6CA 3F6YA 3FTPA 4A7PA 1ZO8A 1BXGA 2WE8A 3UHAA 5C5IA 1C0KA 3GNTA 3STHA 1MB4A 4L4SA 3WGGA 3ROPA 1HZZA 4RF5A 3GF4A 1D8AA 2GRAA 4IDEA 2HRBA 3ST7A 4RQTA 1ZK3A 1I01A 3P19A 1M76A 3WLFA 4YXFA 1H2HA 1I8TA 4NK5A 4RVFA 4MKXA 4NK4A 1V35A 1HYHA 2Z1NA 3QWBA 1DLIA 1SZJG 3EZLA 4B3JA 1DBVO 4RDIA 4EZBA 4FGSA 2VHZA 1NVTA 2C2YA 4OKIA 7ADHA 5ICMA 2WMDA 4ZRMA 3PYMA 3DC2A 4CMKA 1E3LA 5L95A 5I7EA 4NBWA 1HYGA 3FR8A 1KC1A 3M1LA 4CM5A 1UUFA 3DZGA 1WNTA 4TKLA 4WCDA 5ITWA 3SJ7A 1E0DA 2J3HA 3BMCB 1QYDA 1YJQA 4R4JA 4OOFA 3MWDB 1GTMA 2FHSA 4BNLA 5EIOA 3TZ6A 3PDJA 4YEDA 1DHRA 3EC7A 1XQ1A 4CLDA 4ZQGA 3CTMA 1HF3A 4U6SA 2NM0A 4Z0TA 4ZVVA 3SJUA 1PJ2A 1IB6A 4ALMA 3U4DA 3AUUA 4PVCA 3F3SA 1E3WB 3DOCA 3IJRA 4M86A 3LZ6A 4EEZA 4E5PA 3WIEA 1PZHA 2FR1A 1I0ZA 3DBRA 5CDTA 3ZDFA 3PZBA 2W2LA 1PGNA 4JIGA 4OXYA 4QFCA 2CZCA 4ID9A 1RYDA 1X0VA 3F9IA 1T1SA 4R69A 4EW6A 1BW9A 1DC3A 3BMQA 1YL6A 4BO5A 4AG3A 1XSEA 2CY0A 3W4KA 3ZH2A 2X0NA 4GSLA 5C7IO 5B37A 3JD1A 2ZB7A 1F14A 4QECA 3ZNNA 3BA1A 3KXDA 4JLWA 3TOXA 2O48X 1ISIA 1UXIA 1ZEMA 2GN4A 2PGLA 3WGZA 4XGKA 4DVJA 1ZK4A 2BMAA 3H2ZA 3WWZA 5A9SB 5A9RA 3M1AA 1EVYA 1X1TA 4PG6A 3WG9A 4KUHA 3C85A 3RC9A 2P4HX 4JROA 3MCVA 3PWSA 4BNMA 2FWMX 1M75A 1NPDA 3L9XA 1PZEA 4E5NA 1DC5A 1QYVA 1WDKA 3HE3A 4NJMB 5L4LA 1J4AA 2G82A 2JCVA 1F17A 2WDZA 4EBFA 4C7JA 2PZMA 4BB6A 4OSPA 3AFMA 4D44A 2ZYAA 3HZZA 3ENKA 3V1UA 1D4FA 1O9BA 3BXXA 1E6WA 2AG5A 3GHHA 4NFHA 3RUIA 1N1GA 1PJTA 4FJ0A 2H5LA 4PLHA 4BGEA 3B70A 3GDFA 1PGQA 1Y8RA 3PLRA 2B69A 4KP7A 3W6UA 1FK8A 3INRA 2B35A 2DQ4A 4R1NA 4PIVA 2D3TA 1P31A 1Y81A 1JWBB 5LC1A 2BRUA 4FFOA 1U9JA 1VI2A 4YACA 2IZ1A 4CMJA 5JC8A 2FR8A 4TVOA 3WDSA 1X7GA 4LRTB 1PWXA 3KEOA 4E2YA 4E5MA 1P1HA 1XR3A 2GASA 4FDAA 3BHIA 3MEQA 2JL1A 1UAGA 4MIEA 3WNQA 3DZHA 3O26A 3B1JA 4UUOA 3X2EA 5IZCA 2B4QA 3IP1A 1HT0A 5K0ZA 1B14A 1J0XO 2VNAA 4KUGA 4CQMA 4DPMA 2EWMA 3CE6A 4XRRA 3VHRA 4P38A 3IKTA 4BO3A 2X5JO 3WSWA 4Q3CA 3V8BA 3HDJA 3VTFA 1RM3A 1N5DA 4QFDA 4Y98A 5JY1A 4NQZA 2GPTA 2PGDA 3U4IA 4XR9A 4YA6A 4CMHA 1A7AA 3F1LA 3GVXA 4PZEA 3R6DA 3ROKA 1NQAO 1SB9A 4I5DA 1PEDA 4NDNE 1I24A 1GYRA 3MJCA 3CMMA 1SOWA 2VWGA 1ENYA 1I2BA 5TLSA 1T2CA 5CG1A 4QEDA 3HFSA 1KVUA 2Q1SA 4Z0HO 4M89A 3FNHA 1A4IA 5A9SA 1P0CA 3H4VA 3DMYA 2CSUA 6ADHA 3OA2A 3OJ0A 1BTOA 2VHVA 3PQEA 3QHAA 1EE9A 1H93A 3QVOA 3ZCXA 1U5AA 1DIHA 2AQHA 3GGOA 3NGXA 3QVTA 4M8SA 1MFZA 4O63O 9LDTA 1UJMA 3EGOA 3CPSA 4NR0A 4NJMA 4CM9A 1V3VA 1FDSA 3ZGYA 5KKCA 3H9JA 4BNVA 3OJFA 2GN8A 1P3DA 5U9CA 2AQ8A 4FD3A 1PGPA 1BVUA 3GPIA 5DBGA 4XYMA 3SBOA 4CMBA 4OAQA 2Y0DA 4DQUA 4NG5A 1IZ0A 4CLOA 4M87A 5COBA 5CEFA 1NWCA 4O1MA 3RBVA 4BL5A 4II2A 5IXSA 4GMGA 2AA3A 3CXRA 4CL3A 1NFRA 4DQVA 3JQBA 1H6AA 5JDIA 1EK5A 4LCEA 2V6BA 1LI4A 4MP8A 4K6FA 1EMDA 2CNBA 3PFFA 5B4VA 4JP2A 3ADOA 4BKRA 3ONDA 4PLCA 3C24A 2Q49A 4J4HA 2GYYA 3AUAA 4CMIB 1BDBA 2R6JA 3JYOA 5JCJA 5C3MA 4WCFA 3DQPA 4YWJA 3GEGA 3VAZA 5F5LA 2NU8A 4CM8B 1Y6JA 3VVCA 2Q1UA 4P8RA 1PJCA 2IZ0A 4D43A 1ZJZA 1DLJA 4BUCA 4ILKA 3RCBA 5F3RA 3WB9A 2FY8A 5TX7A 3C7AA 4KDFA 4CM3A 4AICA 2GUGA 5AOVA 1B8PA 2EP5A 2DFDA 4B7XA 3RU9A 1B2LA 3W4IA 3NTQA 2RH8A 3SVTA 4HX5A 1YE3A 5HS6A 3HADA 4B7UA 4W4TA 2GZ2A 4URFA 4A27A 3UCEA 5JAMA 2Q1TA 2D59A 4DRYA 3Q6IA 1H2BA 3K30A 2AE1A 1C0IA 1MUUA 5EJ2A 2YZ7A 1HSZA 4N5NA 1HXHA 2VTDA 1B26A 1U7TA 2EG9A 3DHNA 1SCUA 2Q46A 4J1NA 4H16A 3VZPA 3UVEA 4XQGA 3ZWXA 1LLDA 2WJPA 2VZ9A 1UXHA 1C1XA 1QRRA 2HLPA 2D1YA 1E3IA 1LRKA 1LU9A 1A72A 2OFPA 5CPBA 1P44A 4KTTE 3VPHA 4JK3A 3AI2A 1HSOA 4Q3BA 3G3EA 1I32A 4CLRA 1BGVA 2O4UX 1PIWA 2X22A 4BO7A 2QHXA 5EESA 1HE4A 2WYVA 3S2GA 2GNAA 4MINA 4OQYA 1O94A 2HO5A 1KEVA 3F5SA 1ADGA 3WQSB 1AHHA 4U8GA 2FSVA 1ADCA 3VZSA 5IN4A 2UV8A 4MIYA 1YS4A 4LMRA 1U28A 3M2PA 3K2EA 2Y67A 4YT5A 4I5EA 4ALNA 3E03A 3WQRA 1M6WA 4PLPA 2G17A 1I3KA 5TC4A 1OI7A 1H9AA 1I30A 2P9CA 3WR5A 2A9FA 2FPIA 2GN9A 4YRBA 4EDFA 3DAGA 2WTBA 1N7HA 2H6EA 1JAXA 1WP4A 1JU9A 1F8GA 1UDBA 4CM4B 2O3UA 1QYWA 4FFPA 4I5GA 1I10A 3MWEB 3PHLA 2GF2A 5DBFA 3WWYA 1EVZA 3DZBA 3LYLA 3PGXA 3G1UA 1P77A 4D0SA 2PLAA 2WWRA 4DIFA 1NVGA 3WBFA 3PTZA 5IAAA 3HB5X 5HWSA 2GSDA 4NH4A 3MJSA 4XYGA 4XQ9A 4YPOA 1K6XA 3GVPA 5ITVA 4QTZA 2V7PA 3FPLA 3BTUA 2CF6A 2VUTA 3JV7A 2W90A 3KUXA 2PH5A 1A9ZA 3ZV4A 4BNZA 2EGHA 4JP3A 3UOGA 2EJVA 1QORA 3S2FA 4GL4A 1V8BA 2QX7A 4KWHA 4JCOA 1HDRA 2JHGA 1DOHA 3ITKA 3ZWPA 2BFOA 4J4BA 4U5QA 5ER6A 1PL8A 3U5TA 1LLQA 1QXSA 4G65A 4EITA 3RQSA 1I3LA 2B5WA 4YCAA 4OO3A 2WYUA 3JQ9C 4IIVA 4NPCA 4DYVA 3C1OA 3OJLA 2OBNA 1ZW1A 1OFGA 1Y9EA 5DF1A 4QUKA 1N9GA 3IP3A 4R9RA 4WEQA 4PZDA 3RFTA 5L7WA 3DAPA 1ONNA 4EEXA 3PHHA 3RBZA 4R16A 4IXWA 1QKIA 3U09A 5IXYA 1DJQA 1NX6A 4ZQHA 3D3WB 3C7DB 1VE9A 3GG9A 4L75A 2VYND 2FOIA 3I4CA 4AJ1A 4CM6A 2ZCVA 4WLNA 3PVZA 1F8FA 2HK8A 2NV6A 3PFWO 4RZIA 4DUPA 4FJ2A 4U7WA 3JQEA 3S8MA 3A06A 1E7YA 2CDAA 1A7KA 2NTJA 2X9VA 3RUDA 3I52A 3JQ7B 1ARZA 1YOVB 2PZLA 4J1QA 2VRBA 5DDIP 5JNLA 2NU6A 3ZU2A 1KEUA 4GAEA 3AM4A 4CV1A 4XYLA 4WOKA 4IS3A 1NR1A 4EJ0A 4J6FA 3ANLA 2J5KA 1V0JA 4IPTA 3GVIA 4CM4A 1GPDG 5COAA 3WNVA 1Z45A 2VTEA 1HLDA 4B4WA 4ZICA 3I5MA 2E49A 3AI1A 4OH1A 1LQUA 1NFFA 2DUWA 1TI7A 5ES3A 5LDGA 4O6VA 1FDUA 4MVJG 4Q9NA 3RUEA 2OHXA 2VZ0A 5JMWA 2B0JA 4YQZA 4PFJA 1HDXA 1DSSG 1NP3A 3ADPA 4QO7A 4BO0A 4J7CA 2JAPA 4H15A 5THQA 2ZCUA 3K9QO 4XRGA 3QVSA 3QY9A 1PQWA 3RU7A 1YL7A 3ZN2A 2B83A 4IXTA 5T8KC 3HDYA 2AW5A 5LDHA 1Q7GA 2J3KA 1ENOA 3AY3A 4PLVA 3TSCA 4U0JA 4BNWA 2D5AA 3KM0A 5CHEA 4RF3A 5CPFA 1I33A 1M66A 3R0IA 2ZB3A 4BNKA 4XCVA 1Y5RA 2HMSA 4WUVA 3H9UA 5L51A 3G79A 4EI2A 5A4DA 1DC4A 5JMPA 1EFLA 3WICA 3RUAA 5HRUA 2ZJ0A 2CFCA 1K5HA 3IOYA 1AXGA 3GK3A 5A1TA 4NU6A 1LQTA 2ZJ1A 1P1FA 3I6QA 2G76A 3NYWA 1Z6ZA 3VKUA 5FI5A 3KBOA 1UXGA 3IKVA 4INAA 3ZWCA 1NASA 1LDMA 1EDOA 1DRVA 1XU9A 3VC7A 3KEQA 2I9PA 3PRJA 4PLGA 5TIIA 1P1RA 1H5QA 4RF4A 2NTNA 4XGIA 3FNEA 4L73A 3AW9A 1YBAA 3QQPA 3L4BC 5JO0A 3JQ7A 3BZUA 5BNFA 1I2CA 3BYZA 3EUWA 4E33A 5EMHA 3ZWBA 3RIHA 2X0JA 1B8UA 1RYEA 1A4UA 4KQXA 3M6IA 3I3OA 1RWBA 4IY1A 1VJ1A 2HDHA 2JD2A 2X9GA 1T26A 2NWQA 1SMKA 3A9WA 3K2BA 1GQYA 1LSSA 3R3SA 3H65A 3IC5A 1I5RA 3D5QA 3PEFA 4QXMA 2DFVA 1X15A 4G81A 3VTZA 1P0FA 2XXBA 3DZKA 3GAFA 1TLTA 4PG4A 1QLHA 1X7HA 3IS3A 5ILGA 2QRLA 3BTVA 5G0TA 3VH2A 2JHFA 1E6UA 2PD4A 3WYEA 2OBYA 4ND3A 4AJKA 4QT0A 3U9LA 4MVJE 3KOUA 3ASVA 1W0CA 3PDUA 4WNCA 2Z5LA 5IDYA 2D4AA 3ETGA 1Y7TA 4BGIA 5CDUA
chains in the Genus database with same CATH superfamily
1YC2A 3BE5A 4ZVOA 1AQIA 2EJTA 5AJUA 2WPNA 4B3HA 1T1EA 4ROTA 1FLNA 3A2NA 1PTJC 4BLWA 2Y66A 1V1JA 1DXYA 1SJ9A 1T9KA 3UMYA 1I3NA 4KQMA 3HBNA 2FNAA 1G3RA 4OXQA 1U9IC 2NO1A 1WW2A 2WV9A 4ESOA 2BUBA 2JB9A 3ZU5A 1AQYA 5ENDA 1X6VA 1M2JA 2AS0A 3KE9A 2ETXA 5EUMA 2OUKA 2V55B 4DRZA 4Q16A 3D0KA 2REQB 1KI3A 1S96A 2WA1A 4Z7JA 5DU2A 3SSOA 3ZV6A 2DBRA 2QVBA 3MD9A 4FDLA 4OF4A 4IIJB 4RHCA 1RLUA 2P2CA 1ZICA 4NBNA 4G5YA 3JQGA 4J76A 1HE3A 2CD7A 2O3SA 4CDRA 3BMQB 5M29A 5J4KA 1KSGA 3QNWA 5BUSA 2QVCA 1XK6A 4HH0A 4RPGA 2B3DA 3TDMA 1QIDA 5EQTA 3QPDA 3IAHA 3D7SA 1HZJA 3DZDA 4HQOA 2C5FA 5JT1A 1FNCA 1CUHA 2Z30A 4K1LA 5BSUA 1QH1B 2DWQA 1UBOS 1A77A 1GG9A 2GRJA 1SUPA 3CZMA 5KTPA 1G291 1Z8FA 4FHCA 5DNYB 3Q3CA 4DBVO 3PGA1 4X92A 2IV7A 2FSSA 1QGZA 4UAUA 3NWOA 1T29A 1UWKA 2QYTA 1ZS9A 1BNCA 3A9RA 2OAQ1 5B36A 5EJ6A 4L7VA 5J3JA 1ND6A 5EUCA 5KOYA 1SXHA 3I6MA 2Y2UA 4RJ2A 2GERA 4K7JA 2FZKA 3VR6A 2WWXA 1MC1A 2C29D 4FLEA 3W8RA 1ENPA 3VV3A 2PZJA 1IWPB 1YZHA 1LCIA 5EYPB 1W6UA 4B87A 3LC0A 1K8XB 3Q9SA 4O3MA 2ZR0A 2HUNA 1B0AA 1XVIA 3E1KA 4GI2A 4GX5A 4I4TA 2O8BA 4GQIA 2IF0A 1Z17A 1LX6A 4H7JA 4A2PA 3KVOA 5C7YA 3K70D 3QNUA 3C39A 3ZJ5A 1JB1A 2ZUWA 3QIAA 1SHUX 1GGMA 4FYWA 4WADA 4YJGA 8ADHA 1CY0A 1F2TA 4LBYA 2O8VA 4I36A 4RE5A 4TVSA 1N2BA 2QLBA 3QI7A 3DB2A 4KOAA 4QOFA 4BRSA 4QM6A 2QUZA 4UAGA 1GCAA 3A6GA 2V1XA 1EM8A 4NFLA 1PS9A 4FR2A 3EXEB 4PQGA 4XSGA 2PT9A 2W22A 1LBEA 3H9EO 4D4IA 2C5BA 3HFJA 1R0LA 1W4LA 2NIPA 4G37A 4KXLA 3MINA 2A35A 4PX3A 4WACA 4AFNA 5KYUB 4M9CA 3OEHD 1IXRC 1KFBB 1T8YA 2VRWA 3NXKA 4JGBA 4Z3KA 4ZZIA 1O96B 1OAOA 2REXB 5DNVA 3N0RA 5JS8A 2K6GA 2EHDA 4NBUA 3LFUA 3GP8A 4ARIA 2X2OA 1XYGA 2CZGA 4DJFC 3GUHA 3SNKA 4FP9A 4AJJA 2DWUA 5CG2A 2BFEA 3M0EA 3V2GA 3COPA 3U7QA 1TQDA 3TW0A 3O8CA 1C3VA 2DERA 4M4SA 2XQKA 3M82A 4YCDA 1GR0A 2OORA 1JDNA 1MFPA 2JIDA 4QJIA 5M04A 4B73A 1CUJA 4YAIA 3CLRD 4OJQA 5LOVB 4DNPA 1YBMA 4FZ5A 4NE2A 5C31A 1ATIA 1H2FA 1OUMA 2AN4A 2J3LA 3D81A 4XEUA 3V4ZA 3WTBA 1OF1A 2QLJA 2HBZA 3T7AA 2BW0A 1Z7GA 4EA6A 3QEOA 4UUMA 5LIRA 2XUFA 4Q37A 4RTRA 1S2DA 1L4BA 1OHHD 1BE8A 4EECA 3QVJA 2JHPA 2RCYA 5DRYA 5HJ5A 1W48A 3MTGA 1ODFA 1EDDA 3G7NA 3JVIA 3FXAA 4JJ6A 4DXAA 4TRNA 2I2AA 2VRCD 2O2IA 2HMVA 2P7HA 3KQYA 4NOMA 4DSZA 3W6PA 2E4ZA 4A73A 1R6AA 3DXFA 2EBUA 3ANMA 1VC2A 2OY0A 1LX7A 5EE5B 4F38A 1VG0B 2NVUA 1Z4KA 3DMTC 3HB0A 3CLKA 2XXJA 4GDMA 1T3LA 2WG1A 1H8HD 1GV1A 1MX1A 1Y98A 3QSGA 4O33A 1DE0A 4WGGA 2I33A 5BQXA 2G70A 4TYPA 4B3DA 1GDTA 3HKEA 5AXBA 2XQFA 3ZIAA 4ZI7B 5H82A 2H51A 4DRXA 2ECFA 5AKYA 4PR3A 2EFHB 2KMLA 5EP4A 2GK4A 1HFEL 5SV2A 3G5TA 5F9FA 1IHDA 1KF0A 4I1UA 5HRCA 4OOEA 1ZGJA 1NUAA 2XTMA 1TYEB 1V5WA 1V8OA 3PPVA 3ASYA 5L4SA 1F12A 2GCOB 3KU1A 4QWMA 5JXGA 4C7VA 2IDJA 4QPJC 3RYCA 2FYTA 2H5JA 3B13B 3HBLA 3PWKA 4JLSA 2RGNC 4PO9A 2CVOA 4FM9A 1W1UA 1YNSA 4Y9TA 1JHPA 3KCNA 4ZVTA 3RAJA 2Q9CA 2O7RA 3VZQA 3JQ8B 5DE3A 1OSNA 1JKMA 1M5TA 5IP5A 4UM9D 4JBYA 3E23A 5A02A 3GEPA 1T34A 1UJCA 3QMVA 1CRWG 2N46A 4MV6A 3P8ZA 1JW9B 1JMVA 4E88A 3V97A 2YMPA 2DSNA 3OOSA 1O77A 4IIDA 4Q01A 2LKDA 1L4FA 4REOA 1OPXA 4RXUA 4NZYA 4V0LA 5DM1A 4OLAA 3QHQA 1J90A 1YAHA 1RZ3A 1U8TA 2QTVA 4OB6A 4MS3B 2DOKA 4KGZA 1WIWA 1Y9ZA 2MMCA 1J0DA 3BXFA 5TRTA 3SLRA 4EO7A 2CSXA 1SU7A 4M83A 3AL0C 1FRNA 1KQOA 2H7VA 5ESWA 4Z7OB 3MCZA 4F4JA 1T5DX 2VOEA 2R8RA 2FUCA 4I14A 3ICVA 3MJEA 3C2QA 3OLWA 3FRIA 4NJEA 3L4BA 1AS0A 2Q3CA 7GPBA 3CY6A 2EDAA 4HHEA 4LYYA 4QNNA 4KLZA 4UQOA 3TXXA 3EGDA 3N59A 2OAP1 3BGDA 1HM5A 2ZB4A 3F46A 2VUHB 1BYIA 3THWB 2JAOA 5J4VA 1TMYA 2L2QA 1ADJA 2YMQA 1K9SA 1OXSC 5EE1A 2Q7OE 2XCRB 5EN4A 5EWLB 5JJLA 5ELLA 1M7GA 2XEDA 2VO1A 2H06A 3I2YX 2PS1A 5KNBD 4NU5A 4G4GA 2LR0A 1SUDA 3DBLA 4A3SA 5CLQA 2EXXA 5AJVB 4W82A 3H11A 4G0ZA 4Q1FA 3FCYA 3LQYA 2JLQA 1I4LD 5CUQA 1RXEA 3A28A 1PDWA 1HE8B 4NU0A 3VOSA 3CLSD 4Y2UA 1KERA 4DABA 1XT6A 2FX5A 1T6BY 1NP7A 1P0QA 3ESQA 1SCUB 3CVJA 4GKKB 2QLTA 3UMJA 2NUAA 3B1KA 2PWPA 1A27A 1Z0KA 3PUIA 1K2VN 1RAAA 1SUFA 3NBMA 1G8KA 3LGXA 4FMCF 2P6MA 2DPMA 3KTAA 3RU2A 1DKOA 2IU0A 3ZE1B 4QBFA 5M34A 4HB2A 3HYTA 1GFZA 1KO7A 1TO2E 1V6AA 3H9QA 5CH8A 4OKSA 4YRLA 3U2QA 3X1DA 5JFOA 3HUFA 1CTQA 1FXSA 3AB8A 1ILWA 1IDN1 1G3QA 1XJ5A 3R3ZA 4R8LA 5DYIA 4ZYTA 1SO8A 2H00A 1OILA 3HSSA 2POQX 4B4DA 1RI4A 3WY9A 5C8XA 4FSXA 1A8IA 4J0HA 4AG5A 4B2YA 2H4WA 2A0WA 1EK6A 3NVAA 3DVSX 4NDAA 3V1TC 3GA7A 3URMA 1SCAA 4ETNA 3P52A 4H2DA 2FN8A 1RHKA 3CEAA 3PIRA 4KFSA 5DCYA 1J0BA 5LWQA 5EZ5A 3CLTC 4LRWA 2JFWA 2WC1A 3HJAA 5L4NA 1CY6A 3RO7A 2GX6A 4WFKA 3H6KA 2N1MA 1WF6A 1ULZA 3EXG2 1JA9A 2OO5C 1CT9A 2VBCA 3K0BA 4YC7A 5C8YA 4JYCA 4BO6A 1YQ9A 3I9MA 3L6OO 1XZAA 4X64B 1SKBA 2G6BA 3BIOA 2W6JD 1WR8A 3BHNA 1PCXA 1Z7EA 4GKAA 4O5OA 5EHGA 4DCSA 4ENTA 3N2GB 2NZVG 4YTEA 4E14A 1D0VA 4IBOA 4LXQA 3UK0A 5CXQA 3MCTA 3PQ3A 4Z0PA 3F67A 1RADA 5AKHA 1K0UA 3GRVA 4B3CA 1XD8A 1Z68A 2H11A 3A4VA 2E4YA 1OZFA 3USES 2MYPA 1QNLA 1LY1A 2BFCA 4JVLA 1VL5A 3SGLA 3TTYA 3SHQA 1M1YA 5F23A 3H86A 4Q9IA 2OCLA 1GQSA 2J09A 2W2KA 4EUFA 2B82A 1WLYA 4RK4A 1T9GS 1J23A 4DR1B 4X8MA 3K94A 3PZRA 4NZNA 2AFIB 1HTWA 1ZUWA 4JQCA 4LYAA 4F97A 3ANXA 3V3KA 4IWXA 2YUTA 2K7ZA 2BTQA 5FNVF 2IYOA 4BO4A 5BN1A 2JBAB 3LXUX 3ZU4A 2IKSA 3GDWA 4GNKA 4B40A 1ICEA 1NW4A 4Z2YA 3EGWA 3W6ZA 3MFYA 3P4XA 5KYWA 4R2JA 1ESEA 3UTDA 3AM5A 3K6SA 3KUUA 5B58T 3PRKE 2CJPA 5IAJA 4MEAA 1SD2A 2SHKA 3O8BA 3LUFA 3VHXA 1MX9A 1R4AA 1K4YA 3ITDA 2GEDA 3IXLA 3Q0TA 1XA3A 4HDMB 3AHEA 3BGOS 4M46A 2CD9A 1ZI9A 1ZHHA 4UHCA 2VSQA 3AR3A 3LL4A 1G1MA 2V3CC 3UPTA 1SKAA 3GT0A 5CFQA 4F56A 3AY0A 1E89A 1QFXA 3LGAA 4P7FA 3C3XA 3E82A 2BZGA 4HEHA 3Q3VA 1Y7IA 3FVRA 1N36B 1M0SA 1BKSB 1G6Q1 2XWJI 3D3JA 2ZE8A 3STUA 3DVQX 5C4IA 3ZD6A 2P5YA 4A8JB 4XOIA 2I87A 4LI3X 2UZ1B 2NUPA 2PH1A 3D3EA 1Q0HA 5E6RB 5THKA 3GDOA 2XB4A 1ZJYA 1J20A 3I5UA 2EERA 2A92A 2VXCA 3GLKA 1XXHE 3PGVA 5BN4A 1PGOA 2GBGA 5H9VA 3FTQA 3VR2D 1TNDA 1Q7TA 3GPBA 3IDAA 4FOSA 4RY0A 5IKXA 1JR3D 1PV2A 4XB6B 2A33A 1G6HA 2EWVA 3S1SA 1CVLA 2OLEA 4G5HA 1KJWA 1N2SA 3OCJA 2WQ7A 1Z73A 1X1EA 2PAFA 2ODAA 3RVRA 4JDPA 4I9GA 1OZ0A 3HP4A 2VLBA 1TK3A 2COEA 2MYUA 3AUTA 4OFXA 1L8XA 1Y7HA 2PBRA 3PUHA 1SUEA 3L8CA 4KWIA 3TIXB 1AF7A 1FFCA 1H6CA 1DB3A 3KTDA 3EDCA 1W19A 4Y6RA 1LV8A 1FTGA 1SBCA 1BRTA 1G21B 3M4XA 4Q7JB 4S3MA 3NT5A 4HVAA 4MWCA 4TTVA 1MHTA 2ZUBA 3AZQA 1FTSA 3C97A 2X0KA 3KR1A 4J9VA 2PMWB 5AI8A 1T2DA 5JYCA 3RJ5A 5K7SA 1GPMA 4NBVA 3DZFA 2HA7A 3WFJA 2DBQA 4EY3A 3QU2A 3K73O 4WZBA 3C6MA 4MARA 1K4KA 1IN8A 2D7CA 4H6XA 1YFJA 2FTKE 4EY7A 3ZWNA 3FIUA 5IDXA 4QREA 1CPYA 1JPNA 5K3FB 2OKCA 3RS8A 5JYEA 1P45A 2DLDA 3DKIA 1W2HA 3QXHA 2HZ7A 2VP5A 1E9BA 1MW9X 4QEZA 2IYLD 5IBRA 4P36A 2NUTA 4PGHA 1RCFA 3U56A 4ZT5A 3O3CA 1FLVA 5EKTA 3PI7A 4N7RA 4DQLA 5DNDA 2PAAA 1IONA 1SC3A 2FW0A 1DTWA 5I4BA 2XTZA 3V8MA 2HJVA 1T5OA 4ITVA 5CP8A 4YALA 3RKSA 3GD7A 2H48A 3ICPA 4BZWA 3UFXA 2IYXA 2CZQA 3UQZA 3FZEA 1GQFA 3I76A 1L4UA 2C7RA 4KNWA 4LMPA 2EJBA 2QN9A 4TZTA 4WLOA 2C9YA 2TMDA 3EA4A 3H2JA 4KRGA 4HF7A 4I6JA 3EIWA 3WXBA 1QONA 4WJLA 1L7DA 1RXYA 3HDVA 2PXAA 5I7UA 1G5RA 4OK3A 2Q2QA 2C7VA 1A4RA 3CHYA 4MV7A 5DIFA 2GPSA 4RZHA 3VPDA 5CBPA 5CFNA 3H42B 3OFNA 3R5JA 2HTFA 1TKBA 2OVFA 1DQZA 3DFFA 3R20A 3O6VA 1L5HB 1TF7A 1QV7A 3GRPA 1HZZC 1R9GA 4JD5A 3D02A 1B42A 1EGHA 3NIDB 1CIVA 1GITA 2WAYA 3ORRA 1ID1A 3FCOA 4URWR 4DA8A 5HVNA 3SM9A 3ANSA 2BEKA 1T8RA 4XDHA 3IPCA 3U9SA 3O5AA 1AURA 3LQRA 4ZGBA 3AVPA 5AUNB 5HCNA 4IDGA 5T67A 4HRVA 4UMVA 1P1JA 5KVQA 3QLUA 2P69A 3BRSA 1Q21A 4GR5A 4GZMA 3SF0A 1VSBA 1VXRA 3Q41A 1XGKA 3HYNA 1OMOA 5FX2A 1FFBA 3HJGA 1GSAA 3OQ1A 1P0MA 4FQ7A 4MNTA 4WE3A 5DM0A 5M3BA 1U7UA 4U6NA 1RPZA 2JLUA 5C0OE 1KYQA 1NI4A 4OGFA 3TSOA 1BOFA 1AKWA 1AC5A 1CY2A 1DCMA 5BVHB 3RSQA 4WZBE 1ZH0A 4Q4AA 2DH5A 2Q5FA 3QF4B 4G0OA 4MYTA 3QG5A 5GINE 1V5GA 2VF7A 4JC8A 4JUFA 3REGA 5KBYA 4HWRA 1QE3A 1LTHR 1NDHA 3U4QB 2WMNB 3NOXA 4KGVA 4RVHA 3SR0A 3UW3A 3DP7A 3GH3A 3GEMA 4ARZA 4DF3A 2JK0A 2NSHA 3GDHA 1AK9A 1ECCA 1HOXA 4O5AA 3H5WA 4WBNF 1M2EA 2ZRJA 4BY9E 5DV9A 4ISCA 3FOEC 1J24A 1R0SA 1JECA 3TDKA 1ZL2A 1FF9A 2JGFA 3TKAA 1Q3HA 2BEUA 2ZPAA 4BGVA 3NHSA 2FOXA 4IEFB 2Y0BA 3K0SA 1JSXA 1QGED 3ELBA 3RRXA 2IS2A 5ALTA 4PBSA 5IBQA 4BLPA 2EFYA 5LQAA 6REQB 1N1DA 1XMQB 1CLEA 1EPUA 3QA9A 3EZGA 3OZEA 1FTNA 3LYHA 4J8PA 1UMDB 1ZIXA 1WXIA 5K3BA 4RULA 2YHBA 3HNRA 4ZAZA 4EPRA 1YRWA 2VHTA 5DP2A 1K7YA 1QFMA 2OP1A 1JG3A 3PJFA 3QI2A 4MK4A 5JMTA 1EBUA 2IGTA 2WUVA 2XBLA 4FWIB 4MJ3A 3T3GA 1EB8A 4BMVA 1U5CA 4D9GA 1EB9A 3KDAA 1PSDA 5BNTA 1GEGA 4W7HA 4DLBA 4HUQA 2A30A 3TWOA 2PK3A 1PNQA 3MIIA 2VJMB 4UNSA 1T8WA 2QRKA 2I29A 2DKNA 6AT1A 1CJUC 2OCXA 4NG4A 2JJYA 1RM0A 2VDLB 3AU8A 1YMVA 1YVUA 3H17A 4FMCB 4ZVNA 1E9AA 1M73E 2C2ZA 4WXRA 3LLVA 5JHGB 5B4UA 1JWLA 3ZLVA 1FU4A 3PRHA 4XKJA 4Z4HA 3O83A 3M6VA 4L3OA 2VCYA 3EEBA 4HFJA 4MVJA 3UT5B 1G5TA 2G0NA 4L0DA 4BMPB 1O7JA 2M1XA 3CONA 3WP0A 3V32A 5HF6A 1SG0A 2HM7A 3HHEA 2ISSD 3G2LA 3KQWA 1V95A 4E5DA 3U62A 4TOIA 1DVRA 1Z7WA 2QD5A 3DPIA 4OP2A 2PY6A 2NT4A 1W4CA 3JQAA 4FSDA 4PYLA 4RMNA 1NPTO 1ECPA 1GWNA 1XP5A 4GSKA 1VPTA 2YX1A 3CLUD 1OWOA 2ZDGA 5CEJA 1MTZA 3M89A 4TXJA 1EUDA 3BSSA 4JNKA 4ZI3A 5KTTA 2OCGA 1KY4A 4H3HB 3FPAA 2ORVA 1M2FA 4RPKA 3EVTA 1E61A 3WLSA 4R1SA 5GONA 2XOEA 4RJIA 1RJEA 1X7DA 4ZCRA 1CQPA 4UNNA 2WHXA 2ZS7A 5CGQB 1Z16A 3D6NB 4H7EA 3AEXA 2D8AA 2H1SA 3R5KA 5CX1A 2QY6A 4UD2A 1K5DA 4ALIA 2P91A 2JLAA 4K9SA 5K0GA 2A5FA 2A58A 4CKEA 4IM7A 1ZZEA 2I22A 3K1AB 3L01A 4G5OA 4RTSA 1SUWA 5FOSA 1Y4UA 1AB6A 5HHTA 4C29A 2EKZA 2XYGA 1O87A 2IZ5A 4G97A 4IQ8A 4QTXA 3O9VA 1DI0A 3DMPA 5A9TA 3NIFB 4RTPA 1HNNA 1L7BA 1NT2A 3AC0A 3NX4A 3DLIA 4OJKA 3RKRA 4EB6B 3OEYA 3S8EA 4GYKA 3PNOA 4YRNA 4I9HA 3IE1A 2ZYUX 1RNLA 3LDHA 1OASA 3PUZA 1KY5A 2PMBA 3VPGA 2OWEA 1E92A 4UEWA 5LUBA 2B1QA 4GG1A 1XRRA 3GHYA 4MWGA 2GMWA 1NW6A 1N4AA 5KVSA 5JNRA 3HFRA 5T4HA 1D7OA 1X7WB 3U4GA 5IZCC 5TF0A 3I23A 3N0WA 4NZPA 2ZS8A 2DUNA 4ENUA 2NZWA 1UBJS 1YE5A 1MNAA 3A4TA 2XUZA 3PL1A 4OGLA 4D3SA 4EHLA 1E7SA 2OQIA 4PYNA 3DWFA 3D7RA 3ID6C 5FNVB 1E3EA 4R7GA 5PNTA 2L69A 1T4BA 2WUWE 3HR8A 3VDNB 2R62A 1M8GA 1TZMA 1BDJA 3B48A 1BO6A 4YQYA 2M32A 1REQB 2J5BA 4U9IS 1E58A 5CCEA 2PMKA 2OCBA 5IVPA 2AB0A 3PIIA 1H65A 1TX4B 4ESHA 1B23P 5IUKC 3DBHB 4RPJA 5DULA 1KYTA 2L0XA 3JQDA 2Y3IA 3AFNA 1NXVA 3BGVA 4IKPA 2RCNA 4YROA 3L7JA 2RHRA 2DEUA 4J3FA 2GLXA 5DNAA 1NI5A 3UAOA 3C15C 2NO7A 2I67A 1V3QE 1ABFA 2J3IA 1U8CB 3EXFA 4J49A 1N3IA 3OEHA 4ND7A 4RA9B 3Q3EA 2BP7A 4XAQA 5L3VA 5IU6A 1KJQA 1FIUA 4B17A 1P6UA 2D7JA 4XZ3A 3KSDO 2PR7A 1RHRA 1U02A 4MKIA 1GTZA 2W00A 2ZIZA 1I7DA 3VNRA 2XMCA 1EFKA 1G9TA 2I4IA 5BSWA 4C04A 1JIXA 1RJDA 1UMKA 4S12A 1UJBA 1ZITA 3DT9A 1U81A 4DXDA 3DDNA 2HHLA 3MUFA 4XD2A 3H5OA 3TL6A 1R4MB 5HBRA 5JG7A 1JFRA 1GRRA 1KJ9A 3R8CA 1LLCA 5C2JB 5ED4A 4Q3EA 2XIJA 3HDGA 2JAHA 1VM6A 2VUIB 3UF0A 3WYCA 1T2EA 5LMUB 4MOWA 4AF7A 1GSHA 3S2YA 4PWYA 5F2NA 2FPSA 4YUAA 1ZM9A 3BH7A 4YBZA 5EZSA 4REQA 2ORYA 4CM1A 4EIWA 1EG2A 2JFFA 1RLMA 4RUKA 2HGZA 4JFRA 4TT8A 4L9WA 3A9SA 2KSQA 1DELA 2R8YA 3NFYA 1IAQA 3F74A 1DT3A 2MSDB 2J9YB 1WXDA 1C7JA 1E9EA 2EW1A 1C1DB 1AY0A 2V0CA 3I2FA 3MXTA 5DN9A 1ENZA 1M8FA 4HDRB 2QJOA 5FBWB 5SY6A 3SIWA 5B30A 4EENA 1FX0A 3BMNB 4BLOA 2Q2NA 4IWNA 1YQGA 2VH2A 2BFAA 5U4XA 3ABZA 3GARA 3GZNB 4EJSB 4UU7A 1CUAA 2Q0HA 2CV2A 2VDQB 1MJNA 4MXDA 2NAFA 1FNSA 4E13A 5D8DA 5BSHA 4FDTA 3AHFA 4ZC1A 4DWWA 3AERA 2DUJA 4YUVA 3GIWA 5CB8A 2Q4BA 3CH7A 2IOFK 4G23A 3T3NA 3EWIA 1Y5IA 1Q7BA 1WZEA 2AEJA 3OOJA 3WQQA 1JHAA 3JD0A 3C3DA 1E60A 1AIPA 1ONSA 2FG5A 3PLNA 4E6EA 1S2NA 3ZOZA 1DX4A 1XP8A 3VISA 3ESDA 1KL7A 4KTVE 2VNKA 4TL6A 1XRPA 2FV8A 1Z4JA 2H63A 4QXQA 3ICCA 5BRNA 1XZMA 2IW3A 2O3JA 2WPDD 2QKYA 3IP9A 4NVRA 2ZR8A 5K2MA 3DOUA 1IEQA 2BBWA 4MVCA 5K4AA 1PQPA 3UCXA 4YJHB 2Z5VA 1DKLA 5E7QA 4UM7A 1E69A 5HKLA 2MMGA 5DM70 4IZIA 4AZ0B 4X97A 4D8TA 1IK6A 3T9DA 1HV8A 5BYBA 1GCIA 3TBHA 1DINA 3PDWA 2QJWA 3GQVA 5EIXA 2G08A 4PLWA 1ULSA 3P9SA 2FG6C 1PI3A 2BI7A 1XJCA 4Q3NA 4B0OA 2EKPA 1KMIY 1N9KA 2DKOA 1UFRA 2QP4A 4W6QA 1GGFA 4AN4A 2RGRA 1TA4A 4EF5A 2YBDA 1IM8A 1E0KA 1ETHA 1JMKC 1OE0A 3RS9A 4W5TA 5AXDA 2PFSA 4J0GA 4EDHA 5JS2A 2YINC 1B6RA 4JJFA 4MWZA 4YREA 2Y1CA 4ZI2A 3QVVA 1D2MA 3SFZA 4TLBA 1FMLA 4IOKA 1OJLA 2V6FA 4ABYA 1K6EA 2ZSEA 4IDQA 2XKJE 4NAVA 5EE9A 4JT8A 5EWJB 3H1EA 2YYYA 3PNSA 3WK4A 4FMDF 3IL2A 4R3NA 1PW7A 1YR8A 2MHCA 3FD8A 3L1UA 4N5IX 3EDOA 4NONA 4PS1A 1YA4A 3BILA 3QK7A 4J16A 4BU1A 3VC2A 2HIHA 5EJIA 1SCDA 3FNGA 3TN7A 1Y9AA 3S28A 3ANNA 5CLFA 4MS1A 4OHPA 1WQ3A 1E79A 5NLLA 1HRKA 4OGKA 4UTXA 5ALLA 2VNSA 3U37A 5KNBA 5KYTA 4EX6A 3KO8A 2OHVA 2AC2A 5DLPA 4EB0A 3IMGA 4JBGA 5KYXA 3ESXA 3V42A 2V1UA 4J2OA 2DB3A 2BL4A 1IUPA 5GADl 4GOOD 1WUKS 2H08A 2O23A 4DE5A 1PJAA 1SAYA 5DN6A 3T5GA 4CYMA 4ZQEA 2FMIA 3GB9A 3PHIA 2OMKA 3LWDA 1QFSA 1Y3HA 2YVUA 1KKUA 1CQWA 2HWXA 5HILA 4JI5B 2DPXA 2YWDA 3N7AA 2B2XA 3R3JA 5D3QA 4HN4B 2I4MA 2WWGA 1S02A 2JLCA 4BCDA 4WBNB 5KX5F 1W8DA 2A5DA 1M2NA 1ACJA 2QRPA 4QG7A 2NU9B 2WJ4A 3B82A 1D9ZA 3FWZA 2PT5A 5GIOE 1CDOA 3GFOA 1R6BX 4WK6A 4HXYA 1T1RA 4GI1A 5DHTA 5AD1A 1QYXA 1Z2OX 1Z6PA 3HHPA 2QUBA 4O0LA 5DZSA 4F5WA 4NQRA 4F4UA 4LE2A 1PV4A 4JXZA 1N32B 3KLBA 5DM2A 3B2QA 3C43A 4FEEA 4D97A 1JFFB 4GU5A 1E6CA 2F1KA 1XD9A 4H9GA 1MIOB 2MU1A 3B12A 3DL7A 5D3MA 4B2PA 2ZTMA 3PNPA 1RPAA 1U4SA 4JX8A 1J22A 3UAGA 9MHTA 1R3DA 1CJSA 2AEMA 2YV1A 4ER6A 2C59A 3VSEA 3CV3A 3C8UA 3OVMA 2ET6A 1GPWB 3DEFA 4H27A 2XSZD 3CB2A 3OZ7A 3CBQA 3PIDA 4WGFA 3U44B 4CNQA 1S6YA 1VIYA 4YYEA 1XZEA 4U2KA 5FF9A 1DAHA 1I2AA 1PRYA 1QGUA 3JYPA 4EO4A 1KEPA 1HORA 2O8CA 1OWNA 3ZYZA 4HQKA 3H8VA 4HEA1 4C5AA 1LEHA 3QWIA 1N92A 1M7BA 4RZUA 2IF2A 3IILA 4IMJB 5ALSA 3KKEA 1ESDA 1DTSA 1RWQA 4NE7A 1GZDA 2B2CA 3G0OA 4JSRA 4QELA 2WJ3A 3RS7A 5EIHA 4ZIRA 3KQNA 1M7HA 3N7TA 1FFEA 1VCMA 3BD9A 1Y1TA 1ECLA 3OE7A 4OTZA 4P4TA 1R15A 1X94A 5CVJA 4CU2A 2X4IA 2YZMA 5GZ1A 3GIDA 3BMCA 4UUQA 4LRQA 1XRQA 3BGSA 4JL5A 1S8NA 2WJGA 3R0QA 4UOQA 5B2FA 3AQIA 3N39C 2DXIA 2GBLA 2H3EA 3ULKA 4D5EA 1KQPA 1ZJ4A 1NC3A 2FPOA 4V02A 3HU1A 3ND5A 4KE8A 2AFHB 2CL0X 5HIKA 1KU6A 2FSPA 2Z2XA 2QJTA 3SVZA 5GZ6A 4C5BA 4RVSA 5A06A 3FUVA 4ZT6A 1QDLB 4GLOA 5K05A 5BT9A 3IAEA 2G9QA 5AVRA 3LL7A 3B5EA 2Y1GA 4ZARA 5AK3A 5A03A 2IRWA 4BMCA 1I6LA 1M10A 1JIJA 2WOJA 3B5IA 1XU7A 4OVKA 1JU4A 5CDGA 2IWHA 4R8VA 3KAJA 4MW4A 4UW9A 5H02A 4ERXA 3BTSA 5EXEA 4KVGA 4OD0A 4WERA 5C35A 1B15A 2ZRLA 4FXOA 4BKOA 1UWCA 3GNLA 5CLHA 4HNSA 4LN1A 1PTJA 1AVTA 3K5HA 1JHZA 3I01A 4NRDA 4IIUA 4JP1A 2FPWA 3FI0A 1B74A 1LPBB 1O6CA 3MWKA 3R5SA 4Q21A 4RK0A 3F96A 1U9IA 5C4MA 5AJYA 5A9RA 2XWBF 4MVJP 4DCTA 5C5DA 1M6VA 2RHWA 4AURA 2PS0A 1KJNA 1GU1A 4Z6KA 5BXYA 3EPRA 4ZTUB 4PC2A 3A9CA 1B1CA 4F5DA 3D4BA 4IZ6A 4AC9A 4US0R 5FFMA 2R6GA 2WT4A 4ANFA 3A25A 2A5GA 1E1CB 2YN2A 2ODTX 1Z0JA 2VCEA 3H2SA 3EGEA 4DSOA 5K8LA 1QH0A 1YKFA 3LI2A 1ZIDA 3EVGA 1YUNA 2ZBPA 3LKZA 4P5DA 1CS0A 3LOPA 3RRBA 4M9ZA 4CUZA 1C9JA 1EUYA 1X80A 1E3MA 2H57A 2VS1A 3QMPA 3TJMA 1OXKB 5DBIA 4NV0A 4NCHA 1IBRA 4EVSA 4EKEA 1OJ7A 3HYRA 4AMBA 2VDRB 3IIKA 3QWFA 4D42A 1GT6A 2J85A 1MLDA 3Q0IA 4UKDA 3S2UA 2J9FA 5GMOA 1SULA 2W11A 1O6BA 4BPRA 1PBTA 3OZGA 3E05A 5IWAB 4F4HA 1E1QA 3O4GA 3Q7IA 4JSYA 4X90A 4UVHA 2ILVA 2JASA 2QRNA 2J59A 2ZBRA 2Z1DA 5KNBH 3M5DA 1KOGA 1MKYA 1V3UA 4WFQA 1TPYA 2GD2A 1IJKA 1DEHA 3R7AA 3ONFA 2B1RA 4W5HA 2G9NA 5KMGA 3OWXA 5IM4A 1TCBA 3E2MA 2H9IA 1CFJA 4JAVC 5FWNA 2I65A 1XMVA 1ZNXA 3A36A 5F2KA 2IH4A 2O14A 5EHQA 3AEKA 4DY4A 1JXMA 1XEFA 1N6RA 4Q6WA 1USWA 5KNDD 3PKZA 4NZZA 3CFYA 1JXQA 2AI1A 1FSSA 1XMSA 2J9XB 3D7LA 2D3WA 3C87A 3VAYA 3JD4A 3QPAA 4ZOLF 4JMLA 3UJ6A 3QTLA 3VKGA 1W7AA 1MDFA 3VU0A 2D0OB 3NUQA 3EZ9A 3OQVA 1C29B 3REQA 5IDQA 3GELA 2EL9A 1IJEA 2Z8XA 4WY5A 4A6EA 4AN1A 4IDPA 1R4NB 1J2UA 2PKXA 1DFGA 1QFJA 2XLBA 4M1ZA 3E7PA 1GNPA 3QJ5A 5ILQA 4MSUA 1W4BA 4XWYA 2WYHA 2PJZA 4BB0A 4QQ8A 4Y67A 3QBTA 5BUZA 5JZMA 1W0JD 1QGOA 5COQA 1U8FO 2VHQA 2IPXA 2VKQA 3NOVA 3AIOA 3D43A 4C0AC 1JDJA 3EPJA 3ZZ0A 1RJ9A 4R2WA 5B7QA 4TWRA 1X42A 3MJHA 3RI3A 3M3DA 1OIVA 2VHJA 4F86A 4YRRA 3T3DA 3TLXA 3ZVNA 1BHO1 1YDWA 1OXBB 1ESNA 2FFJA 5IKEA 4WN9A 5FL7D 4TZKA 5SYAA 3KYCB 1BD3A 1PR4A 1LQ2A 3O1LA 4PYOA 3WYFA 1U3UA 3WJAA 4QOEA 5FI1B 5KOHB 5ANRB 1TYBE 1YBFA 3KZOA 3KQKA 3D4NA 3LNCA 5H83A 1MMFB 3IOMA 1QTNA 3GGCA 1DIOB 1Q6ZA 3AL2A 5DP1A 3WGTA 2QLFA 1IZYA 1V16B 4FNAA 4UE3S 2OCPA 3T4UA 2ALJA 4GX0A 3UAVA 2G28A 2I71A 3AI3A 3RBXA 1XDWA 4URUR 4YCCA 1XTRA 2R6R1 4CIVA 4MVWA 3M70A 3U61B 5KQMA 4MRPA 4WA7A 3E5NA 1W73A 3MHTA 2CFSA 3KXLA 4ZPJA 5TPWA 3UO8B 2J0QA 1V1RA 2HH9A 2WF9A 2P90A 3QYPA 3MA0A 5JNVA 4F9FA 4BBJA 1ZA1A 2FFHA 4EZIA 4FFLA 1FUYB 1KZ9A 2JAWA 3LT5A 4C06A 3SPXA 3AJRA 3T9CA 1VJCA 3NTOA 4G5GA 2C94A 1KVRA 5KHLB 4IZOA 4F72A 3CINA 3PA6A 4DC1A 4DLRA 5EIEA 4FMDB 1O6GA 2KW5A 3AF3A 4LV5B 4DNXA 5I9LA 3W9SA 3EPLA 2XBUA 1P8AA 2BY4A 4BOYA 1RI1A 2X7JA 4CMIA 4FT4A 2VG8A 1XVVA 2XUKA 2YV3A 3Q88A 3EDMA 5B2ZA 5KNCD 2OFOA 2O3TA 2VZ8A 4CIDA 5BNIA 1TUEA 5BW8A 1TF5A 4CM8A 5A5VA 1NI3A 4FC6A 1NOJA 5E7IA 3STYA 3I9FA 4QYTA 5AVWA 5KVVA 2WNSA 1XKLA 2RGNA 3AB7A 3FSGA 4JR1A 4PC3A 4WFJA 1YAJA 5DTRA 4ZD6A 3BRQA 4MRMA 3T94A 2IYNA 2QX8A 4MIOA 2HZBA 2YHIB 2QZJA 1MTOA 4PZUA 2PN1A 1OD6A 4GM1A 4HB3A 1E1YA 1NRJB 4PPQA 4Q4JB 6GPBA 3ZJ4A 4AY4A 1KETA 1EFVA 1MPTA 1ZD3A 3RVPA 2HSGA 4E1BA 1VYHA 1K8QA 2GGSA 2YHSA 4WKOA 2Y0EA 5KX5B 4GP7A 5HIMA 1RCUA 5CNIA 4G1BA 3FY4A 4H31A 4I5FA 2AFRA 2GLUA 5LP6F 4R7ZA 2X2EA 1THMA 2P1RA 3SKXA 2UZ4A 2JD1A 5F3DA 1P9WA 2O1EA 4NF2A 2YY6A 2PLWA 3A10A 3AJ8A 1AXEA 1K7SN 3QVWA 4HSEA 4MUBA 4G56A 4RKFA 4JVMA 7MDHA 1KMNA 1KZYC 4UTNA 5FTWA 4D82A 3AVQA 1QSGA 1UC8A 2CBXA 2B4TO 3UATA 1EEHA 1XF1A 3CXUA 1HNXB 2GO1A 3D0RA 2HQ1A 2C8LA 4NBLA 1J09A 3UY4A 1A88A 1U0TA 3VU1A 4AUKA 1WMFA 4QYXA 1FU8A 4CM7A 2QTTA 3FWNA 4X7MA 1CJCA 3FG9A 2IWRA 5KB3A 3W5BA 5IN5A 1I1HA 1UDXA 2YW9A 1L9XA 3QV1A 4OQFA 3O21A 1WY7A 2FPMA 4R8MA 5LB2A 5E2BA 3ROEA 1U3GA 2VK8A 2ZTVA 1BMTA 3AWDA 2OV1A 4PCVA 4RSHA 2QY9A 4YLGA 3HB4X 3SEFA 5I9IA 4B6EA 5CXXA 3E9QA 1ZCBA 2C31A 1ST2A 1DIRA 4B4VA 1FA9A 1UMBA 4D46A 1TYDE 2IC5A 3QBDA 1SVWA 5E1DA 1CVRA 3M2TA 1KJ8A 3JAWB 4E12A 2JGJA 2PZFA 5IJ9A 3E8XA 1NYQA 4R2MA 1E2EA 2XMQA 3FNQA 3LQFA 4O2RA 4FX2A 4CF4A 1NVVR 1UP6A 1YU6A 5JAZA 4KPEC 3P94A 2G7ZA 4OHXA 5MGBA 1VKNA 4GFDA 3W5UA 3L7LA 3KAQA 3VPFA 2C8KA 3WKBA 3Q1LA 5SYNA 1SHJA 3PHGA 3BSFA 2CXRA 1NBMA 3E9YA 4GOXA 1H2ZA 4PR0A 5DT9A 1DUSA 4HD8A 4C4TA 3O31A 2P2LA 4IIXA 1DKUA 1ULAA 3MTJA 3AHHA 4LS3A 1MDBA 1HFJA 1OKKA 3Q4GA 1WXGA 1R5OA 1SIWA 4L6AA 2R8EA 3V7UA 5FLEX 1E1RA 3QKWA 1IWBB 3W1EA 3GH1A 4GX2A 3PP8A 2WHPB 2PT6A 1JBQA 3ZG6A 3EA5A 1JBEA 2C3UA 2OV8A 3CUVA 4RCYA 3SU8A 4R9NA 2NVBA 1K5GA 5FWDA 5AK5A 3K05A 1CWUA 3GJRA 2ZJBA 3OT4A 3TCNA 1RRPA 1QFYA 2CJWB 2DBVO 2QDXA 3JATB 3COJA 1JHOA 4IH4A 5IUNC 4FYXA 3MWJA 6LDHA 2ACWA 3M83A 4GVXA 4J0JA 3SZOA 2JD0A 4GRIA 4KR6A 4EKGA 3GBPA 1UIMA 1VP9A 1FDWA 3HZOA 2UDPA 2WM3A 1SEPA 2NXEA 2Q2VA 2XYQA 2Z3WA 4FFSA 3OCYA 4M8LA 2XT0A 2ZDHA 2O5RA 1N6NA 1ZHOA 5EP1A 1V45E 1SD1A 3C98A 4J0QA 1T6NA 2BKEA 3N0XA 1BKDR 1UOQA 4J29A 1NYLA 3AUXA 2ZBDA 1GHTA 3TNFA 3TGPA 5L3SA 4Z4EA 2X6TA 2Z08A 3KQUA 4A15A 3RWBA 1KI1A 1E9DA 1K8ZB 1Z9BA 1RHJA 3VDQA 3LHIA 3CRW1 4ZK6A 4EBBA 1DO8A 2MOKA 4RLHA 2DP4E 1QRSA 4FFBA 4YYZA 2W42A 3WBBA 2H4YA 2AZXA 4DCPA 1DCKA 3NALA 4EJSC 4IEEA 3EEYA 3FCXA 3HEAA 5AH0A 1IPFA 1LDBA 3R3HA 1FFDA 1EUQA 4MQFA 1NWHA 4HAYA 3OT1B 2ON6A 5IBCA 5F21A 2NSDA 4NYJQ 1E5LA 2QQFA 3ZWMA 5FCDA 1PT8A 3GQBA 4LGCA 2EV9A 2D5CA 1EESA 1EX7A 1Z4MA 3FOCA 3DGFC 5E38A 1Z15A 2B37A 3BOSA 1KEWA 3AKCA 3EMBA 4MO2A 3ZBQA 2FFBA 3HYCA 4B76A 3OPYB 3PCXA 4C6TA 1HL3A 1W5EA 4KO8A 4H7PA 2NVOA