5EL0A

Crystal structure of an oxidoreductase (short chain dehydrogenase/reductase family) from brucella ovis in complex with a partially ordered nad
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
239
structure length
223
Chain Sequence
ERKTLVLTGASRGIGHATVKRFSLAGWRVITCSRQDFSENCPWPAGPEDHIKVDLSDPEDIGKAIAEIRRRLEANGSKLHALVNNAGISPKAEGGRRMNSIETPMAVWRDVFQVNFMAPIMLARGLFKELEAAQGSVVNVTSIAGSRVHPFAGTAYATSKAALAALTREMASDFGPYGIRVNAIAPGEIDTAILGKTSEVAETIYFLCTETSSYVTGSEIHIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an Oxidoreductase (short chain dehydrogenase/reductase family) from Brucella ovis in complex with a partially ordered NAD
rcsb
source organism Brucella ovis (strain atcc 25840 / 63/290 / nctc 10512)
molecule tags Oxidoreductase
molecule keywords Oxidoreductase, short chain dehydrogenase/reductase family
total genus 79
structure length 223
sequence length 239
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5el0A00
3EK2A 5CDTA 2DM6A 5A03A 3RVDA 1NVMB 5IXYA 4FC6A 3KETA 4KUHA 3ONEA 3D1LA 1HDOA 1B8PA 4R16A 4CQLB 4PGFA 1H94A 3ZI0A 5JDCC 4LCEA 2VUUA 3LK7A 2V65A 1YJ8A 3TZCA 1VPDA 4DIBA 4XB2A 3EGOA 3VDRA 3EZLA 3PZRA 1JW9B 3KOUA 3Q0EA 1DJNA 3KB6A 3C1AA 1KYQA 1LDGA 4Y8VA 1A9YA 1KVRA 4U0KA 4UVDA 5FF9A 2P4HX 3V2UA 4DUPA 9LDBA 3HDJA 1D1SA 1MB4A 1PJ2A 1E0DA 3AUUA 4IS2A 2PZMA 2EHDA 5DOZA 3FWZA 2G0TA 2A4KA 1LEHA 3PHJA 4ZHSA 4IM7A 6LDHA 1LDYA 2YY7A 4TRMA 1BVRA 4IDAA 3RBXA 4ZD6A 1Z7BA 3IQDB 3VDQA 1P1JA 1J6UA 2IXAA 4N5NA 5HA5A 1Y9EA 3ZW9A 4P22A 1LDEA 3DTYA 4RPKA 1NAHA 4XEHA 2DFVA 4GX0A 3Q9NA 3RUEA 4BNNA 2GPTA 2EW8A 4I9UA 1UDAA 4B8WA 3BHIA 4E12A 1WLYA 3R6DA 2X0NA 4ND5A 1ZSYA 4RZHA 3W4KA 4DPMA 4EDFA 4L9RA 4RZIA 1UUFA 1N7GA 2LDBA 1ZKMA 3HDYA 3WLEA 4YAJA 4E30A 4WASA 3DQPA 3TQHA 2Q3EA 1Z82A 1U7HA 4GGOA 3TSCA 2EP5A 4BNJA 1LLQA 4JIGA 2GN4A 4BO6A 1OFGA 2Y93A 3TPCA 5GZ1A 3OIDA 4WEQA 4GVLA 2J3JA 4FFRA 1XR3A 5DCYA 1PGOA 1HLPA 1DPGA 1LRKA 1MXHA 1P45A 1T2EA 1ZW1A 3RUHA 2AQKA 2BELA 1KVSA 4NFSA 2A92A 3E9NA 2WJPA 1GZ4A 2H5LA 4GLOA 1P0CA 2ZIZA 1YB5A 4K6CA 1F12A 2O23A 3RJ9A 3BMNA 3WJ7A 1LA2A 1GL3A 5KWEA 1TI7A 3PP8A 1E3SA 1NAIA 2EJWA 4IDDA 4WECA 1XEAA 4D0RA 3PGXA 4J4HA 4J49A 3E9MA 4KDFA 4JP2A 2JD1A 1GUFA 3D4PA 2C20A 3L9XA 4IIUA 2TMGA 4M86A 2B0JA 4YEDA 5T64A 1TA4A 2GNAA 1T4DA 4JBGA 5F1KA 2X5KO 3DFUA 4EJ6A 4U8GA 2I5PO 4A10A 1ZK1A 4AJHA 4ZQFA 1NTOA 3D64A 1UJMA 3WYCA 3KO8A 2JAHA 3F5QA 2DBRA 4FB5A 1NQ5A 1Q7GA 1T2DA 2BRUA 3SJ7A 4A0SA 1ZUD1 1X0XA 1ZJZA 1WZEA 3HDHA 1DAPA 3QWHA 3GQVA 3CEAA 1CQJA 1OC2A 5JYEA 2I6TA 4X54A 3L4SO 5JCJA 1OAAA 2X22A 1LSJA 1Y8QA 4NFYA 3WGZA 4NJMB 4I5FA 2F00A 4NU5A 2QG4A 4ZQBA 2DTXA 2EJVA 1KY4A 2DVMA 2J5QA 3EAGA 4G65A 1B14A 3C7CB 1YL5A 3W8FA 3VPSA 5TIIA 4AJPA 1ISFA 4UREA 1A4UA 2H1SA 2C5AA 4DLAA 2J5RA 5U4QA 3SLKA 1FDSA 3Q2KA 1EEHA 2P9GA 1C0LA 3DBVO 3L4BC 1LTHR 3G0OA 2QYSA 4NHEA 1GV0A 3QY9A 3R3JA 2VWPA 4B7CA 3NDJA 2Y1OA 2CVOA 1CEQA 4D45A 4GX5A 7MDHA 4NBTA 1WZIA 3OQ1A 1PJBA 1QYWA 3JQBA 1X7GA 1X14A 1BDMA 3KZVA 4AJOA 4CM8B 2HMVA 4QSMA 5I7FA 4YBZA 3BMOB 1E7YA 1AGNA 1RWBA 4I5EA 4YT5A 4AICA 4E2YA 5CDGA 1GTMA 2ZB7A 3K92A 2JD2A 4NBRA 3ZV5A 4QTZA 2EGHA 1GUYA 2Y1EA 3S2FA 3S2GA 4OXNA 3FWNA 4ND3A 3H2SA 2BD0A 3TZKA 4FC7A 1TB4A 5A9SA 4MIOA 3KSZO 4P4LA 4PLPA 2IXBA 1Q0LA 3VVBA 2NVWA 1ADFA 4EUHA 1KS9A 1D1TA 2ILTA 4FQ8A 1GQ2A 4H16A 3PDJA 4HP8A 4MPDA 4PCVA 4XJTA 1Z74A 2R6JA 1H6CA 3UH1A 3H9UA 4OO3A 4W7HA 4JP3A 2D4AA 4OIMA 1AHHA 3NYWA 2VRCA 4D42A 3ETDA 2IZ0A 2Y1GA 4PG8A 3FNEA 4Z0HO 2O3RA 4BKUA 2FPGA 3HNPA 5IZ4A 2VOJA 4WE3A 3GVHA 1GQYA 3WSWA 3DWFA 4PVCA 3PLNA 1U3UA 1YB1A 1MLDA 1H5QA 4IZHA 5DN9A 3UGKA 1VL0A 2QX7A 1VL6A 4DIOA 5KOIA 3ZWNA 4FR5A 1UAGA 3PJEA 1UP6A 3K31A 1NQTA 3KSUA 1KY5A 2HRZA 3JYPA 3ZWYA 1GR0A 1Y8RA 4MVJE 4B7XA 3WMXA 2X0RA 3I9LA 5T5QA 1WDLA 4IDFA 3PYMA 1EE9A 3FBTA 2ZATA 4B3IA 2DU8A 2OBNA 3K9QO 1P33A 3TL2A 3ZGYA 3QLJA 2UAGA 5GY7A 2I66A 2PGLA 3VH3A 3HSKA 3AI2A 2GYYA 1KETA 3G17A 4E32A 3GFBA 4NU6A 2NUAA 3IP3A 1EFLA 3VC7A 4MDHA 4II2A 4O6VA 4CR7A 4A5OA 2X58A 5F1OA 5I9LA 3HE3A 5JO9A 1DEHA 4BNZA 3F1LA 2JCXA 3ANNA 3WBBA 3I4FA 3ROQA 1PX0A 1O6ZA 3HADA 5L53A 4A26A 2XOXA 3DBLA 5F5NA 1SPXA 1C0KA 1LDMA 3OA2A 4WCFB 3BTVA 3CUKA 1ISJA 1PSDA 1C14A 4A03A 2Y1DA 2IEBA 4ZGWA 3ZU2A 1ENZA 3OP4A 3VZQA 3LDHA 3V2HA 3GT0A 2Y0CA 1UXHA 2EKPA 3Q6IA 1IPFA 3BMNB 3WXBA 4EBFA 3I9OA 3DOOA 3TF5A 3WNVA 2PY6A 5K0ZA 1QSGA 5FFFA 2A94A 3HB4X 3ZW8A 1EVZA 1NVGA 3EYWA 1XDWA 3UICA 5AOVA 4E3ZA 1UR5A 4XGKA 2AE2A 1NR7A 2NVUA 3CZRA 4ZJUA 4ND4A 4XWYA 2ZB4A 3OECA 2HMUA 2YFHA 2O48X 1LC3A 4HFRA 4JX8A 5T67A 3UKOA 1PEDA 1PS0A 3LT2A 4ID9A 1DRVA 4CL8A 1E7QA 3ZCXA 4WKGA 2O2SA 3DB2A 4EZBA 4AG3A 3I9KA 1YKFA 3WNQA 5B37A 5IDXA 2D1YA 5JAQA 5JCXA 3WWZA 2D5CA 4NH4A 3DAPA 4LCJA 2G76A 3MJEA 1GEEA 3AFNA 5L7WA 3RWBA 3MCVA 3V1YA 1GUZA 1MX3A 2NTJA 3P19A 1U8FO 3QQPA 4CMCA 4YT4A 4IXTA 1ZFNA 1HDRA 4WUVA 4DA9A 1D8AA 1WWKA 2G17A 3AW9A 5BT9A 3F46A 3FR8A 5IDQA 1PJSA 4OOFA 4ZVVA 5EMHA 5JC8A 4DMMA 4F45A 4KUEA 2YV3A 2ZTVA 4BNIA 1ZJYA 4IXWA 4K6FA 1YL6A 2I3GA 3I3OA 2DBQA 3JQ8A 4M55A 3QIVA 4J9VA 2FZEA 5EIOA 5CPBA 2O4CA 3O03A 2ZTLA 2JHGA 5EINA 3FD8A 3RFXA 1RM5A 4RL6A 1GZ6A 4IMPA 1EFKA 1DSSG 1WXDA 5IFLA 2Z5LA 2VHVA 1HEUA 3QJ5A 8ADHA 1XG5A 3HQ4O 4N5LA 3TN7A 1HYGA 3AI3A 4TVOA 2JAPA 5CP8A 1P1IA 4R1TA 3MZ0A 1MP0A 3KEOA 3AU9A 1KEUA 2CNBA 4PZDA 3H9JA 5I7EA 1UXGA 5C7LO 3A9WA 2SCUA 2PFGA 1V8BA 4L4SA 2RIRA 1XCBA 4BL5A 5KIAA 4XYLA 4GQAA 3AY6A 3K96A 1BXKA 3DHNA 4G2NA 4BO4A 1PWXA 4ND2A 4M87A 1DIRA 3GG2A 5AXAA 1QYXA 3D3EA 2AEMA 3B6ZA 4M89A 1ZSNA 4ALJA 4DQVA 3RROA 1OC4A 1C0PA 1UXJA 3L0DA 1JWAB 2R2GA 3PI7A 4DRYA 1Y6JA 4RF2A 5U1PA 4M8SA 3CPSA 1IY8A 5CFZA 3GRKA 1I32A 3Q1LA 4JBIA 4Q3BA 1K3TA 2CSUA 3NT2A 3U4DA 5ENDA 5T8KA 3FNGA 1PJQA 2VUTA 4GAEA 3WFJA 2O4UX 1PGQA 3Q3CA 5EQFA 1CIVA 2WYUA 5GZ6A 2ZYGA 3DHEA 3ASUA 4D41A 5A5EA 1FDTA 3LQFA 4M49A 1IZ9A 4I5DA 4ALIA 1HDYA 1SC6A 4JCOA 1ZK0A 3OIFA 4UVHA 1HE4A 4XQGA 3U4HA 5TRTA 4IJKA 2Y0DA 3JQFC 4RORA 1VL8A 4DMLA 1H2BA 2Q1UA 4XB1A 4BNKA 3NKLA 3FNFA 1LDNA 1LRLA 1YGYA 3ENNA 3HN7A 2Q2QA 1DRUA 2VQ3A 5AYVA 3ONFA 4RQUA 5BR7A 1GY8A 3C85A 3ZWXA 3KUXA 3ZU3A 1BGVA 3O8QB 4GLLA 1PL7A 4OYRA 1DLJA 2O50A 1ISIA 2VUSA 3JYLA 4YCAA 3VVCA 1X7DA 4JBHA 1ONOA 5F5LA 1LRJA 2B36A 3GFGA 3GA0A 3AUAA 4G5HA 4ZQEA 5I8ZA 4AJ4A 4GVXA 3ZWBA 4PLGA 1RKXA 2WTBA 3PHHA 3K8ZA 1V3UA 4D46A 2EP7A 5EJ2A 3GRPA 3FTNA 3Q2IA 4YB8A 4QO7A 1PR9A 5A06A 3W8EA 4P4NA 5A05A 4NR0A 3SXPA 5L7TA 1Y8QB 4R9SA 3PZBA 4FFPA 4ZA2A 2PZLA 2W2LA 4P8RA 3FF4A 1PJCA 2EKQA 2YYYA 1TT5A 2C07A 4EJMA 5FWNA 3ZNQA 4JLWA 4A7PA 4DQUA 1A71A 1P1KA 1SB9A 4CLHA 1PJ4A 4CM8A 2C2XA 5JE8A 1PS9A 1QG6A 3HZZA 3GH3A 3NAQA 2P4QA 3UF0A 2BI7A 1EVYA 1S7CA 1ONPA 1I5RA 2CDAA 1I01A 1K2WA 3SBOA 1YWGO 5ADHA 4I1IA 2AXQA 3HB5X 3QHAA 5CHEA 1Q0QA 3DAGA 4NJOA 3ROKA 4R1NA 4WLVA 3W1VA 4BKRA 1PQPA 1BW9A 4Q39A 4XDYA 3ZHBA 3H3FA 3U4IA 4BVAA 1K6XA 3BMOA 1X1TA 1GYRA 4P38A 2OO5A 4BOYA 2ZYAA 4HUJA 2PV7A 1RM0A 1P9LA 4OSOA 3JQ7B 1NFFA 3ZV6A 1R12A 2ZB8A 3GDGA 1W0CA 4RQTA 4CLXA 4K9DA 1Z45A 2VN8A 3DZJA 4N54A 5CEFA 1F06A 4ALMA 3GLQA 3MTJA 3OHSX 2Q45A 3IUSA 1U7TA 3QW2A 3GMSA 1DJQA 3D5TA 1UZMA 3NGXA 3RI3A 4LW8A 3WSVA 3LF2A 3MEQA 4A2CA 4EGFA 1PTJA 4BNMA 4BGEA 1H6BA 2DTEA 3W4JA 5KVCA 5EQDA 4CMIA 1B8VA 1UP7A 5L95A 1HYHA 3PPIA 1JA9A 5T6BA 1EVJA 1HE3A 4BNHA 1XIVA 2GSDA 4TWRA 3M1AA 4RPHA 1BMDA 1JVBA 2AG5A 3DHYA 2QW8A 3WGTA 4MKRA 1U5CA 5IAAA 3JD4A 3D3WA 4YJGB 2W8ZA 4YJHA 1VRWA 3LLSA 4E2ZA 1JKJA 2Z1NA 1SOVA 4UEKA 5L4LA 3MJCA 2NQTA 3ZU5A 2JKVA 3JQ6A 4Z9FA 3WYEA 4L74A 1Y5MA 3DZBA 2FP4A 4CQLA 3T7EA 2E82A 3AFMA 4L8VA 3PFWO 1UXIA 4NJMA 4J7UA 2Q2WA 4GWGA 4CLRB 4O1MA 3I4CA 5C7OO 2AA3A 3INGA 3QVTA 4YJFB 4E5NA 4E4YA 5ER9A 4GI2A 3RC7A 2BI8A 3HWRA 3JQ9A 1LU9A 1F14A 1W4ZA 3IJPA 2Q2VA 4RLHA 3U09A 4ZU3A 4XR9A 4Q3DA 5JNLA 1N2SA 3VH2A 4TVBA 2NVBA 5T8KC 1NX6A 1MG5A 1DIAA 2Q49A 2HO5A 3DL2A 4J2OA 4OMUA 1YBAA 3G3EA 5J23A 1GFSA 2G82A 3MJVA 4UULA 1SZJG 3KTDA 1Y7TA 4E33A 4FFOA 1E5LA 4XRRA 5IF3A 2YJZA 3OJOA 2EIHA 2HK7A 3KYBA 2NLOA 5LDHA 4QEDA 2JL1A 2D5AA 3RFVA 5KVVA 3PHLA 5BNIA 1M2WA 2FOIA 4XCVA 4OL9A 2X9NA 3TOXA 3ZZNA 4GL4A 2DQ4A 3PTZA 2Y67A 1T2AA 4J7XA 1BXZA 1LLUA 4EYEA 3ZV4A 3JD3A 4INAA 4BNYA 3M1LA 2NU9A 3H9GA 3BTUA 5TJ9A 5ER6A 4BO9A 2BFOA 4L75A 2V6BA 5TT0A 3ZWMA 3PQDA 4IDCA 4GKBA 3FCOA 1AXEA 3QE3A 2VZ0A 3ROMA 2X9GA 3BIOA 1GPDG 3GMDA 5JMPA 3S2IA 4BO3A 4PN3A 1MFZA 2QRLA 4NI5A 3PGJA 2O3UA 2AEFA 2PKQP 4R68A 3U62A 1PR3A 1IHYA 4JXKA 4Z0TA 3GN1A 4HFMA 3F9IA 4YRDA 3EZYA 3AM4A 5CEJA 2NADA 4J43A 1I36A 3QSGA 3RC2A 3AWDA 1SO8A 1GEGA 4ESOA 1DC6A 5THKA 5TGDA 1VLLA 5IDWA 2FR1A 3RAJA 1JTVA 4FOOA 4C7JA 1MC4A 3H65A 4CODB 3INRA 3FNHA 4JNKA 1I0ZA 1D3AA 3DBHB 3QVOA 4XQ9A 5A9TA 1CERA 1DIGA 1LSUA 1ADCA 2AHRA 2W2KA 3LC1O 5A1TA 3LVFO 4FFMA 2O3QA 2GGSA 1NASA 4ZRNA 5I9NA 5DDIP 3IC5A 4RLSA 3GUYA 1H6DA 4E5PA 4EUFA 4YT8A 4D0SA 3VPXA 3NDRA 4RPGA 1ZVMA 3P5SA 3RD5A 1YE3A 3UXYA 3HG7A 1A4IA 2UVDA 3F4LA 2EXXA 2JHFA 3LSYA 4R51A 4CM1A 1XU9A 2ZQYA 4PVDA 1L1FA 3B20A 3OJLA 1XHLA 3D0OA 1V3TA 3STHA 1EK5A 1DXYA 3VKVA 1KEVA 2E4AA 4DVJA 1CQIA 3VOSA 4E0BA 1UH5A 3ZNPA 1M67A 5C3MA 1G0OA 4H7PA 1MC5A 2EG9A 4J1TA 1IOLA 1YDEA 4WCFA 3FPLA 1SMKA 1Y5RA 4RVDA 1BW9B 4LGVA 3F1KA 2ZTMA 4U6SA 4XD2A 5DT9A 4R3NA 1SOWA 3GK3A 5HWSA 1NPYA 2CFCA 2BF7A 1J49A 2QZ9A 1VM6A 1RM4A 4IJUA 4M1QA 5JO0A 3EVTA 4PIVA 3MJTA 5JS6A 1TLTA 2YV1A 1ISHA 3TWOA 1I33A 2H63A 1H6AA 3AM5A 3GEDA 1JDJA 2VHYA 1BXGB 4EW6A 1XQ6A 5EERA 1A5ZA 3UVEA 4RVFA 4TSKA 4HADA 4R9RA 2C0CA 2HMWA 4P4GA 2VZ8A 5G0WA 4B79A 5BSHA 1O89A 5BQFA 1TT5B 4XIJA 5TNXA 4FPXA 4PLFA 2WYVA 3JYNA 1GAEO 1RPNA 4RPJA 2W90A 4CLOB 1ULUA 3L9WA 4E5MA 3PWSA 4UEJA 4LSWA 1JAYA 5JAMA 3LLVA 4B4OA 1CETA 5JXWA 4MVJG 3ZHXA 1F8FA 1JLLA 4RVUA 2J3IA 4YYZA 3EY4A 1SCUA 1U2DA 5DBIA 1LSSA 4O63O 2UUOA 2WDZA 1GDHA 1XA0A 1I2CA 3ZHZA 5H82A 3F47A 1R0KA 1Z75A 1C1XA 1GZ3A 4YJHB 5LC1A 4BO2A 4JGBA 3W6ZA 3KLPX 2EF1A 1NQAO 5CEEA 3DR3A 3RBVA 4CMEA 1GCOA 2J5KA 1ORRA 3GZNB 1N9GB 1T1RA 1ZMOA 4KDEA 2YDYA 3TZ6A 4DYVA 4DWVA 4EEZA 3WYBA 1E7RA 1QR6A 3OJEA 1P1HA 4LRSB 4RVGA 4CLRA 5ENVA 2GZ1A 1N1EA 1M6HA 1T26A 1QORA 1T4BA 3E82A 1HZJA 1TVEA 1NYTA 2I9PA 4LISA 3G1TA 3Q11A 1IPEA 1P77A 1QMGA 2VYVA 1BHSA 3L07A 2ZCUA 4KTVE 4IS3A 2VNAA 3I52A 4CMAA 1LJ8A 1P44A 3ADPA 3ICCA 4FOSA 2OP1A 3ITDA 5DOVA 1TXGA 4QT0A 1MFPA 5IZCC 2ZJ1A 3JQ9C 1ZBQA 1KBZA 4BO8A 1X13A 1R66A 2X5OA 2XPCA 4FDAA 2O3SA 4QX6A 3W4IA 4PG6A 4FCCA 1E7MA 1JVSA 1Y8RB 1PGPA 4W9NC 3BAZA 1PQWA 2QRJA 5F21A 2YQ5A 4TROA 1N5DA 4FIZA 2GERA 5DCUA 4L76A 5IZCA 4D43A 1HKUA 3IP1A 4Q3EA 3U3XA 3L77A 4WLOA 3MWDB 4E21A 2OUIA 3NJ4A 1VSVA 2RH4A 3OF2A 4AJEA 4GX2A 2X8LA 4CM4A 4YR9A 4YDRA 4GMFA 4RDIA 1B3RA 2PK3A 1J4AA 1EUZA 1L7DA 3S55A 3WIDA 2GD1O 3SLGA 2C5EA 3HHPA 2X7HA 4KTTE 5EN4A 2VNSA 4KMSA 4CMBA 2WYWA 3OM9A 5I8WA 3TFOA 4TRJA 4IUYA 1K6JA 3G79A 2IYPA 3JQBC 1P31A 2PD3A 3NTOA 2AQ8A 3KYCA 1NHWA 1LQTA 3PQFA 2Y99A 3AY3A 2Z1MA 3QA9A 1NPTO 1EBUA 1FDVA 5G4LA 3TJRA 4JJFA 5I7VA 1MGOA 4PZCA 2EW2A 2VYND 4MVJI 4O5OA 3WICA 1HL3A 3DOCA 4FSHA 4XYGA 5A4DA 3K30A 1CRWG 3M2TA 3RUFA 2J8ZA 3PJDA 4II3A 2PGDA 1V35A 2WEKA 5HBRA 4MVJF 5B4TA 4K28A 1WW8A 2W2KB 1DFIA 3DMTC 1U4SA 1T2FA 2RH8A 3GVPA 5KJFA 2OP0A 3A4VA 3O4RA 4UEOA 1W6UA 2XXJA 3UCXA 1NP3A 2OORA 5JCJD 1UDBA 4IJVA 5JY1A 4XQEA 2ET6A 5TT1A 5A3JA 4FJ2A 4GSLA 1I24A 3E9QA 5DCWA 4R01A 2D2IA 5CAEA 4ONEA 4J16A 3WGGA 3IKVA 1V6AA 3IS3A 3GDOA 5IJZA 3DDNA 1C1XB 4KWIA 4ZN6A 3AOGA 4M54A 4J6FA 2EKLA 1PIWA 2B83A 2RCYA 1IHXA 4AJNA 4ALKA 4BQPA 3S1LA 4AL4A 1LC0A 1YBVA 2CD9A 3C24A 2HU2A 2PZJA 3QRWA 1XYGA 4UUNA 5JMWA 3BHJA 5G4KB 4WLNA 5JFOA 1X15A 1ENOA 2POQX 3N74A 4OKIA 1E77A 1PGNA 3OJFA 2YHIA 1R37A 4RPLA 2E48A 4B4VA 3PRJA 4KQXA 3U9LA 3PWZA 3L6DA 3NTQA 1YBMA 1PJLA 4L73A 3TFQA 3TZHA 3D4NA 3RJ5A 3IIEA 2ZYDA 4NIMA 5BSGA 4GSKA 4YRAA 3VZRA 1R16A 4NPCA 5BSEA 5HTOA 2HSDA 1C1DA 4J1NA 3RUIA 2JD0A 3JD0A 5CDSA 1H9AA 3LYLA 5A3VA 2ZQZA 5TLSA 1YO6A 2H9IA 3WX0A 2PTGA 4N7RA 2PH3A 2C7VA 4XRGA 4YQZA 2DFDA 4CM4B 3KYDA 1T24A 5KKCA 4KWHA 1LSOA 1XU7A 4Y6RA 1NR1A 3IDSA 4NBUA 2O3JA 3DTTA 2GRAA 1DC5A 4ITUA 3E18A 4XZ3A 2NWQA 1FK8A 1RJWA 1QYCA 2GN9A 4OGWA 5KTKA 1JKFA 1J5PA 1XKQA 2HAEA 3JQGA 3U5TA 1B15A 3F3SA 2P5YA 3I9MA 1ADBA 2Q1TA 3H2ZA 5IN5A 4XKJA 3DBLB 2PZKA 1YH3A 5AQ1A 2JCVA 2HQ1A 1Q7CA 1IULA 2QYTA 1ENYA 3I9JA 3HUDA 4JQCA 4W82A 1U28A 4CMJA 2ZB3A 5KJ1A 4C7KA 4OXYA 1BVUA 2DT5A 2VWQA 3JD1A 2JFHA 4D79A 3V1TC 2X5JO 2X1HA 4J1SA 4XQCA 4RV9A 3EUWA 1SEVA 5COBA 5TJHA 2DTDA 1B7GO 5JAIA 4QUKA 4DYDA 4OOEA 4QQRA 2FMUA 4YVFA 4PFJA 2VYNA 4E31A 5KJ6A 2D3TA 3DONA 1EUDA 2ZCVA 2X4GA 1OI7A 3TNLA 3WR5A 5JW6A 1LNQA 2I67A 3HFGA 4BKPA 5C37A 4FJ1A 2GO1A 2X6TA 5KVSA 2AW5A 4YXFA 3PXXA 3B1JA 3QVSA 4BNTA 2Q99A 5G0UA 3BHMA 3ZN2A 1ZXLA 2ZK7A 4H15A 4CR6A 1DBVO 1KC1A 3OQ6A 3SVTA 3N7UA 3K5PA 2GN8A 5EESA 1QYDA 3Q9UA 4YAEA 3LF1A 3ON5A 3UCEA 2B4RO 1CJCA 3M6IA 4URFA 1VE9A 4U0JA 1DIHA 1QP8A 2OBYA 3GVXA 4HFJA 4Z3KA 3QWAA 1YQDA 2RHCA 4OHUA 4YPOA 1YQXA 1YXMA 3FSRA 4GMGA 1WMBA 1HXHA 1E3LA 3GGPA 4ZQHA 1W8DA 4ZRMA 5AVOA 4E6PA 1PZHA 4Q9NA 2GR9A 4W99A 4WOKA 2R00C 3ANMA 4R5MA 1VJ0A 3HN2A 3O9ZA 4NK5A 4XYMA 2JFFA 4XJSA 3UOGA 2UDPA 9LDTA 4IDEA 2B69A 1KEWA 2FSVA 1GU7A 2PKQO 3DEYX 1D4FA 2BKAA 4D7AA 2YHIB 3T7CA 3H9QA 3WG9A 3VKUA 3CKYA 1NHGA 3DZHA 1PZGA 3JQAA 3DAFA 2FWMX 5TS3A 4CUZA 4MP3A 3OMLA 3RBZA 5G2OA 2CDBA 1E3WA 1HZZA 3NT5A 1E6EA 4DIFA 5HS4A 1R15A 2O7SA 1E1NA 4KOAA 2FY8A 3P7MA 3ASVA 1O5IA 5KJEA 2YZ7A 2PD4A 1UAYA 1UZLA 3HFSA 2J3HA 1HRDA 2P68A 3H6KA 3CH6A 1UP4A 5ICMA 3R3SA 4FFLA 3WGYA 3CIFA 3GNTA 3PJGA 5FI3A 4BB5A 3AY7A 6ADHA 3KBOA 3GNSA 4Z9XA 5BNFA 3JYOA 3KV3O 3DBRB 1L7EA 1F8GA 3T4XA 2VOEA 4JK3A 5L51A 5EPOA 2NU7A 3AOEA 4Y98A 4DLBA 3UFXA 2XF8A 4PLZA 3V5NA 4EI2A 4BO5A 1R4NB 4CM3A 2FR0A 4W4TA 1XSEA 2GDZA 3CMCO 1IYZA 4J0FA 4AFNA 4ND1A 5U9CA 5A5FA 4XYEA 1V9LA 4Y9DA 1NXQA 1KVTA 2Y1CA 1H9BA 4MP6A 4DGSA 4YAGA 4LRTB 1PGJA 2YV2A 4DTIA 2YQ4A 2V6GA 4GH5A 2DAPA 1DHTA 4CM5A 3ZWCA 4Q3NA 2I76A 1HF3A 1OBFO 3PLRA 4D3SA 3QVWA 4RO0A 4RVHA 3TZQA 1LBEA 2Q46A 5AXBA 1I3NA 4Q3AA 4BNUA 1UZNA 4BV8A 4AVYA 3VZPA 4JJGA 3JQEA 3EC7A 3BXXA 4J90A 2CY0A 4EJ0A 1P3DA 2CF6A 2BGMA 3PHGA 2HJSA 2QQ5A 3PYLA 3IKTA 1B2LA 3UCFA 4PLVA 1I30A 1BRMA 1ZH8A 2BGKA 5TQVA 2H6EA 4R69A 4GWKA 1Y9AA 4RF3A 1IZ0A 4CR8A 4IDBA 2VHWA 4J0EA 3TDKA 4CLDA 4BKOA 1I10A 2QHXA 1ZNQO 2EWMA 2HKIA 2CUKA 1PS8A 2YFQA 4E2WA 3VPFA 3KVOA 2AG8A 3VPHA 1Z7EA 5ICSA 1H93A 2FR8A 1GCUA 1PWZA 2IZZA 1ENPA 3ANLA 4KP7A 4L4XA 5ITVA 4JJIA 1FXSA 2G1UA 4HNGA 1LX6A 2GN6A 2IEDA 4IIVA 4ROSA 4WEOA 5IN4A 4CQMA 2EV9A 3PFFA 3JQ8B 8LDHA 3C7AA 3WTCA 3PK0A 1FDWA 4FS3A 3OQBA 5ILGA 5GZ3A 1KIFA 3OETA 3KYDB 2P9CA 4F46A 3GR6A 3IAHA 3I83A 1G1AA 3U49A 1IL0A 2J6IA 2DPGA 2QIOA 3GC6A 2BMAA 5JDIC 1E5QA 4N5MA 3F5SA 3SEFA 4BO0A 1GYPA 2OHXA 3CINA 5HRUA 1B3BA 4FGSA 1E7WA 3JQDA 1M76A 1NPDA 5A9SB 4J4BA 3GF4A 2IZ1A 3PEFA 3E5RA 3WGIA 2X0IA 1DAOA 1XELA 2AEJA 2VT2A 3WQQA 4YAKA 2I3AA 4MJLA 1RYEA 3WDSA 2Q4BA 1T1SA 3K2EA 1FF9A 4L4RA 4BO1A 2P2SA 2Y68A 3AM3A 1O95A 3WQRA 4BKQA 4YWJA 2UUPA 2Q1SA 1YOVB 3C8MA 1Z73A 4TRNA 2B4QA 1JAXA 1U8XX 3KLMX 1KOLA 3X2EA 3UAGA 4WPGA 2PWZA 2DUUA 3DZFA 3JD2A 1O0SA 3WMWA 3C1OA 1BDBA 1MXFA 3EVNA 4DLLA 4WLEA 2IDZA 2VTDA 3AJRA 3DO5A 4XIYA 1YVEI 4FBGA 4OH1A 2GCGA 3MOIA 4U7WA 1PJ3A 3JV7A 4IQ0A 3QVXA 5AXCA 3LU1A 2CVZA 2FRDA 4R54A 3SC6A 4RJTA 2WWRA 2GASA 1OMOA 2Q1WA 3PIIA 2V7PA 1M66A 4R41A 4XX0A 5TF4A 2FN7A 4R5HA 4KUGA 3UN1A 1DIBA 1OZAA 1WP4A 1P1FA 1U5AA 1MG0A 3NDIA 2RBEA 1YQGA 1PL8A 3WB9A 1HE5A 1JQBA 2NTVA 1B26A 5C7IO 3GPDG 4BV9A 5I9MA 1VSUA 4CLEA 4E13A 1T25A 1HE2A 3D3WB 4YJGA 3RC9A 2PA3A 3ZWPA 2IE0A 3DMYA 1WPQA 1P1RA 5TX7A 2HLPA 4Z6KA 3I23A 2PLAA 2NSDA 4J3FA 4GGPA 3JYQA 3ST7A 4RCVA 1LDBA 2Y05A 4S1VA 4CMKA 5MGBA 3OSUA 4XGIA 1IE3A 3LT0A 2D59A 3JQFA 4JROA 2E6UX 4QFCA 4LSMA 3FI9A 2VWHA 4I9NA 3GEMA 1K89A 1ULSA 3EW7A 5JLAA 2OFPA 2VZ9A 3RSHA 5G4KA 4I5GA 3PHIA 2G5CA 3I6QA 4YJFA 2OL4A 3F6YA 1VKOA 2Q4EA 5FEUA 3LZ6A 1ZK2A 4I8XA 3SX2A 4TZKA 1HT0A 4NK4A 4IINA 4AJLA 1B16A 5ES3A 5DF1A 5TSDA 2ZTUA 1B8UA 2X9VA 2B5WA 3PYXA 1DO8A 1LUAA 3FRJA 5CG1A 3GGGA 1C1DB 1X1EA 2X0JA 2XAAA 4NMHA 4GBJA 4XGNA 2WM3A 2HRBA 3ZHYA 4OM8A 4BQRA 3E1KA 3IL2A 4MINA 3GEGA 3CE6A 5DZSA 1R6DA 1CF2O 1U3VA 2FPIA 5K6AC 3BMCA 3RU7A 4WCDA 3NT4A 2NTNA 1M6WA 1W73A 3QV1A 5G0VA 5MDHA 2Y66A 3ZNOA 5DBGA 1X7HA 2NQ8A 2DPHA 4L0QA 4MVJA 5DULA 3NX4A 1YS4A 3OJ0A 4UUMA 1Q7BA 1R0LA 1HDCA 4NBWA 2I99A 5IDYA 5FI5A 3JQAD 4YA6A 3GUCA 4PG4A 4RF5A 3RQSA 3NTRA 2IRWA 4BMNA 1I2ZA 1YONA 4GPD1 4EEXA 4D3DA 1P74A 1N92A 3GOHA 4DC1A 1I8TA 2WMDA 1ML3A 1EBFA 4UAGA 1I3LA 2UYYA 5TC4A 3H5RA 4W7IA 4ALNA 4BNLA 1AUPA 1MV8A 1VJTA 5JDIA 3BTOA 4TRRA 2VTEA 5KCZA 3V1UA 4TQGA 4B4UA 1MUUA 3CTMA 4E2XA 3NUGA 2HMSA 3AUSA 5HM8A 1E3EA 3AUTA 4YAIA 2ZKLA 5G0TA 1VC2A 1LI4A 1QYVA 4FGWA 3DOJA 3IOYA 3BTSA 3P2OA 2B35A 3DFZA 3H8VA 4AJ1A 4CQMB 5IG2A 4QFDA 2O2YA 3I1JA 4OAQA 4CMIB 2BGLA 2P91A 1VJ1A 4LK3A 4B3JA 5T57A 4TZTA 5JYDA 1DRWA 1HDXA 1EZ4A 2GF2A 2YDXA 3ZU4A 4BNWA 4S3MA 3A28A 4J91A 3GPIA 4WJZA 2OGUA 4BO7A 5LDGA 5JSFA 1ID1A 5DBFA 4CQMD 1F0YA 2E49A 4OQZA 1E3JA 1HSOA 1BG6A 3QP9A 3BZUA 3WOHA 4D44A 1M75A 2W98A 2D8AA 1YL7A 3RFTA 1VKNA 1K5HA 1EQ2A 1ONNA 2VT3A 4YQYA 1LQUA 4A73A 1A27A 2HMTA 3OEYA 1QKIA 1TT7A 4RDHA 4H3VA 4BUCA 5K6AA 4OXKA 1KVQA 1S6YA 2P9EA 1E6WA 1I3MA 1R0SA 2JJYA 3ICPA 2X23A 1HTBA 2A35A 2YW9A 1V3VA 1XGKA 3FR7A 4WK6A 1EVIA 1R4NA 1SNYA 2FZWA 4Z3DA 4Y67A 4PRKA 3DZGA 3JSAA 4YACA 3BMCB 3V8BA 2C59A 1EK6A 3KHUA 3MTGA 4BGUA 5L3ZA 4QECA 3VHRA 2CDCA 3LC7O 3OICA 4PLYA 1E3WB 4B3HA 5LCXA 3ENKA 1BXGA 5KNLA 3ZH2A 3AI1A 3INTA 2PKRA 1UXKA 5C5IA 3DMTA 1U3WA 1ZXBA 1DHRA 3A1NA 1JU9A 3HJAA 2BHLA 4CUKA 2F1KA 3GVIA 4IQ8A 4HV4A 1SAYA 1PZEA 2AQHA 2JCYA 2NV6A 3MOGA 3ADOA 1HETA 1HSZA 3EDMA 1HDGO 1FDUA 1JKIA 3DC2A 3ZV3A 3A14A 2W2LD 1XLTA 5JY6A 3R0IA 4XDZA 1E3IA 2D0IA 1XQ1A 4BGIA 2CVQA 1HWYA 2VHZA 4PZEA 1HLDA 4DQXA 3RUCA 3QWBA 4O59O 3WQSB 4B4WA 3S8MA 2UV8A 2PH5A 2IODA 3E6AA 3O8QA 4BMSA 3I5MA 2CF5A 3BMQB 1B0AA 1DOHA 4KZPA 4FD3A 1MA0A 1N9GA 3NV9A 5B1YA 4F3YA 1K0UA 1HDZA 3C1TA 3NJ8A 2PGJA 3I6IA 3VAZA 1ADGA 1J0XO 2VHXA 3GGOA 4NDNE 2JFGA 4AJKA 4UUOA 5JC1A 1H2HA 3GDFA 2HJRA 3L6OO 1GYQA 4J4TA 3UW3A 3ZDFA 1DFGA 2Y1FA 3RC1A 3G1UA 1N7HA 4OJNA 4O0LA 1BSVA 3MJSA 3BYZA 4FN4A 2VWGA 5CPFA 1G6KA 4MO2A 4ZQGA 1NVTA 2B5VA 1U9JA 1U1IA 3DBHA 3JQCA 4HXYA 4YJDA 3RCBA 4IPTA 4HFNA 1ZK4A 4PRLA 4RGBA 5THQA 5GMOA 4BMVA 1Z6ZA 3ETEA 4WLFA 1YB4A 1A7KA 4FJ0A 3E48A 3GAZA 5EL0A 3FPCA 2QZZA 4UVIA 2FHSA 3PQEA 1JN0A 3TRIA 4RF4A 2C82A 1KVUA 1Q0HA 4J1QA 4MP8A 4I08A 4R1UA 3WGOA 3CSDA 3WS7A 3G49A 2DBZA 5JAZA 1E1MA 1C0IA 2WD7B 1D7OA 3GY0A 5L4SA 3B70A 4R4JA 4LN1A 1EDZA 4DBZA 1EDOA 4UUPA 3QWIA 4PG7A 5KVQA 3OH8A 4WGGA 1DC4A 5HS6A 3ULKA 4D3FA 5COQA 1KC3A 3O38A 4MVJD 1ZEJA 1X0VA 2EGGA 2HCTA 3KSDO 4MIEA 1VI2A 1UDCA 4NG5A 1BWSA 3DZKA 3AOEC 1Y1PA 3GNQA 4IBOA 5DP2A 1YOVA 3H3JA 4CUJA 2BFAA 2HUNA 1ZMTA 1LLCA 4G81A 2B4TO 1IUKA 4QXMA 4YTEA 1GV1A 4RVSA 4DXHA 3FHLA 3CMMA 3N58A 4BNXA 3O26A 1EMDA 4ZICA 3GG9A 5DP1A 4KQWA 4DL9A 3TL3A 4W6ZA 1LXCA 2HDHA 3L4BA 1K6IA 2Z95A 1IB6A 4XYBA 4BNVA 1AHIA 2IYOA 4Y6SA 4BB6A 2YHUA 4U6QA 3H5NA 3PDUA 3AU8A 4Z9YA 3KEQA 4IGFA 2OXIA 1DB3A 3RUAA 5KJCA 3NEPX 2EEZA 4MVJM 3DZIA 4IZIA 1A9ZA 2VRCD 3ABIA 1ISMA 2B37A 2OMEA 1E7SA 4J9UE 3WTBA 2WE7A 3RKUA 5A04A 1WDKA 1QV7A 4WNIA 1SEPA 1WVGA 1ARZA 1OOEA 1R4MB 5F1PA 1A7AA 3P2YA 3U0BA 2J3KA 1N8KA 2RAFA 4K26A 3VH4A 4AJIA 3C3XA 4FW8A 4R1SA 1Q2XA 1ZZEA 7ADHA 3R1IA 2NU8A 1RM3A 1C3VA 3GVCA 2X86A 3D5QA 4HWKA 4WCFC 1NBOA 3ZWWA 1QXSA 5I7SA 5JBIA 2QRKA 1TEHA 4XR4A 1RYDA 3GHYA 3OEWA 4TKMA 4ILKA 5B4VA 1I3KA 1SB8A 1PQUA 3A06A 2PD6A 2AE1A 4CV0A 5JDCA 3KXDA 4BIIA 3UUWA 1E6UA 2GZ2A 3SC4A 4C4OA 4CV1A 1FMCA 3RIHA 1EE2A 4EITA 1GD1O 2DBVO 1GADO 3JTMA 2V6FA 3VZSA 5K9ZA 5A9RA 3I9NA 4I9HA 2AMFA 3ZWVA 4ALLA 2YUTA 3IUPA 1Y81A 4Z0PA 3JQAB 4AJJA 4W9NA 4DBVO 5L7YA 1V0JA 1GQQA 2AQIA 4DREA 2O7QA 5FYDA 3ZNNA 1Q1NA 3E5MA 1U2GA 3W6UA 3AK4A 3COSA 4CPDA 1NM5A 3PIDA 3B1KA 3E03A 4F6CA 1AXGA 1GPJA 3GAFA 2RHRA 1EQUA 4MVJH 3WJAA 3GHHA 2WD7A 2NU6A 3U4CA 3CZMA 3OBBA 4MIYA 4NFHA 3B1FA 5L4NA 5B12A 1P0FA 4F6LA 2A9FA 3DBRA 3HDQA 2VCYA 1DDOA 1I2BA 4BS9A 4DC0A 1NWHA 2NACA 4NZ9A 2C29D 4PLWA 4NNJA 1U4OA 4QO8A 1AN9A 3K6JA 5L45A 2LDXA 4CM7A 1DC3A 2R00A 3WGQA 1O94A 3ITKA 5BSFA 5KKAA 4MVJP 5ILOA 3H4VA 3K2BA 3FBGA 4R3WA 3K73O 1ZIDA 4IQGA 3LC2O 4MKZA 1BTOA 2E37A 2PR2A 4AJ2A 5B4UA 3TOZA 3W8DA 5ITWA 4B8ZA 3IMFA 2O3TA 2NVUB 3NGLA 1WDMA 1PL6A 3WLFA 2CMDA 4CLOA 2DLDA 4E5YA 4UVEA 1NFRA 4K1LA 4YRBA 1WAMA 1CYDA 3E8XA 1ZK3A 4FFNA 4LVCA 1XWFA 1HYEA 1DLIA 4BHTA 4IJWA 4NBVA 5JPIA 1PU2A 2I65A 2Q50A 3BMQA 5COAA 1E1LA 4LMRA 2GZ3A 4CM9A 4YT2A 4XA8A 5L40A 4HY3A 4DPKA 3PJFA 3GZ4A 3JCZA 3VTFA 4GX1A 4CMEC 4CM6A 2FSSA 3OIGA 3ZWOA 2C7GA 1E92A 1T2CA 3FTPA 4U5QA 3F4BA 3H9EO 5BNTA 3WFIA 4B7UA 1U3TA 2DUWA 3EHEA 4WNCA 1DFHA 2PNFA 3PWKA 4HKTA 5DNAA 3UHAA 1QRRA 1SBYA 4CMHA 3H5AA 2NNLD 4MKXA 3D7LA 1O9BA 1LLDA 3NRCA 4JN6B 1NFQA 3IJRA 4CL3A 4BNFA 4UVGA 4EUEA 2BFMA 3C7DB 4HNHA 5CDYA 2CZCA 2C54A 4J7CA 3VTZA 1CWUA 2HK9A 3QWFA 2WD8A 3X2FA 1FJHA 5L9AA 2FPPA 3ORFA 4CJXA 3SJUA 4WLUA 3ROPA 3L6EA 4MOWA 3VPGA 4WOJA 4HX5A 2C2YA 3FN4A 4Q3CA 1YJQA 3RASA 2ZJ0A 3ONDA 4TMFA 3WBFA 1QV6A 2BLLA 4J2HA 1AE1A 1NNUA 4N18A 2GLXA 3WGHA 1H0KA 3OA0A 4A27A 1G0NA 1NWCA 3MWEB 4PG5A 1WNTA 1WMAA 3VH1A 2BH9A 2EERA 2WSBA 3T4EA 2DC1A 1ZO8A 1PZFA 3JQGB 5F3RA 4DPLA 5CDUA 5CG2A 3RU9A 2DKNA 4CM9D 1CDOA 4HBGA 5H83A 2XXBA 5G0SA 4Y6PA 5IXSA 4PLCA 4BGVA 4LVUA 4PLTA 1QLHA 3OFSA 4TKLA 3LT4A 4CMGA 2GUGA 3JQ7A 3WWYA 1E1KA 1ZEMA 2VYVD 3EMKA 3ETGA 1R4MA 2P5UA 2VRBA 3H7AA 3MJ4A 1YDWA 3GZNA 4LMPA 4BNGA 1F17A 4IY1A 1ISGA 2NM0A 4IMRA 5A02A 3RUDA 4IDGA 3WIEA 1PJTA 4CV3A 1NQOA 4GKVA 1ZSVA 1EUCA 1A72A 3BA1A 2WE8A 2Y0EA 3KRTA 4IGEA 4OSPA 3PVZA 3KYCB 4OQYA 3LT1A 1ZCJA 2TMDA 2BFPA 3S2EA 2W4QA 1JWBB 2HK8A 3DXFA 2OOSA 4PLHA 4CV2A 1N1GA 1QLJA 3GN2A 5H81A 4E5KA 1KERA 2OZPA 3CXRA 3KM0A 1O8CA 4OKNA 4NQZA 3RKRA 3ZWAA 3M2PA 5AXDA 2V6MA 3V2GA 1KEPA 3D4OA 1YRLA
chains in the Genus database with same CATH superfamily
1YJBA 3EK2A 3PFCA 4KLAA 3VFDA 3C8UA 2DM6A 2ISSD 3ZW7A 1W49A 3SU8A 1H2AS 4KR9A 1NVMB 1Z68A 3EIOA 3OZIA 3RVDA 4K9SA 3ONEA 1H2EA 4KUHA 4PQRA 1PVOA 4FGJA 1HDOA 3OTGA 4I1OA 3I3SR 4M2LA 4CQLB 2IYNA 4PGFA 1PYDA 4DR6B 1L8QA 5JDCC 3ZI0A 3ZGVA 2V7QA 1Z47A 1NV8A 4LV8B 2D2XA 2V65A 3TX6A 3TZCA 3U80A 3HLYA 4CG0A 4XB2A 3ZTYA 1JG6A 1ZCBA 1JW9B 1AZWA 3I9V1 2FP3A 4CWAA 4DRXB 3C1AA 4DS3A 4MR8A 4U0KA 1CR6A 2SNIE 4N5IX 4WWHA 4AWXA 1U9IA 1M6VA 1SK8A 3V2UA 9LDBA 2OQRA 4OU5A 4KO8A 5EZYB 5TMEA 4JD5A 1MB4A 2D7CA 2HD4A 3O8DA 4EMUA 5KYTA 1D03A 1LGYA 1VBKA 1VG1A 1W0KA 3N28A 1NONA 2R84A 4ZO6A 3ZIAD 1YZ3A 2EHDA 4C5CA 2G0TA 3R7NA 5CA1B 4J6EA 1I0LA 2J6BA 1TTHA 3PHJA 4RPIA 5SZHB 2WTXA 1N8SA 4ZHSA 3WNBA 6LDHA 4I3HA 1WXHA 3PTAA 1YI0A 1BVRA 3DLHA 1NYRA 1ESMA 1EIWA 3U44A 4JC4A 1P1JA 5HA5A 2RGUA 3Q6NA 4FHCA 4IV0A 1E2FA 1E6KA 5HF8A 2QRGA 1QK5A 4GGMX 2C4WA 1F5NA 2B20A 4KWEA 4W5JA 3WV5A 4BNNA 2R8OA 3BHIA 3WA7A 2X0NA 3F7TA 4ND5A 5CXXA 2R1UA 3ECSA 1MTOA 3FSEA 2IH2A 4Q1VA 4RZIA 3EZ6A 1BU8A 2PO7A 3ICEA 4GI1A 3O83A 1YAJA 2FOXA 4JP8A 4C30A 2RHTA 3TQHA 2PU5A 2V1XA 5LBIA 4I55F 4URHA 5DSZA 3N8HA 3L8ZA 3WLLA 2RG7A 2JZCA 1DJOA 4EB0A 4BNJA 4UBNA 1CJTC 3SSNA 3WBKA 5GADl 4Z4QA 3TIIA 2JGEA 4DBLC 2BHRA 1T3LA 3LUKA 1OFGA 2LCIA 4B80A 5AW0A 4GR5A 4B74A 4UHFA 3BGDA 1KMIY 3H97A 4WEQA 2CEKA 4WUTA 3EVGA 3TGLA 2QN2A 1P6UA 3DMGA 1RAIA 3QI2A 4IIHA 1VQ1A 2I54A 2J45A 5EJGA 4C0HA 1PR2A 1P45A 1QUEA 1Z36A 2VP3A 2PWYA 3A2NA 3MWJA 3R4VA 4S12A 1KVSA 4D8XA 1GZ4A 2O7RA 4LF5B 3AKDA 2FPLA 1JFRA 1P0CA 3UMSA 2WU1A 1C2YA 3KUDA 4JOQA 4OUDA 3UOWA 2F8MA 1LA2A 5KWEA 3FMVA 1TI7A 3OZEA 5EJMA 4MR7B 1Y9ZA 2DSNA 2EJWA 2BGGA 3LV8A 4LRUA 3FCAA 5BN5A 2PT6A 2JLYA 2AHOA 3PGXA 4YCMA 2GMWA 2A0KA 3VSEA 3ENQA 4MDEA 4IILA 3UGTA 1L4GA 1JLSA 3NNSA 3SJAA 2C20A 1UJ4A 4M86A 1JAIA 2OHOA 4ARCA 2M2IA 3HDGA 4OK6A 3UJHA 1NTRA 3N07A 4JBGA 1JHMA 3CNEA 1W4LA 4YRKA 1V6SA 2JAUA 4U8GA 2DGDA 1OLUA 3D64A 1OQAA 4W5RA 1UJMA 1JA1A 4O1IA 4BFUA 3CZCA 4V1CI 3OC0A 1NQ5A 4L50A 2ST1A 3ROFA 3UPTA 2FQWA 1ZUD1 2WQZA 1X0XA 1ZJZA 1WZEA 3AWIA 1WKVA 4YJ2F 3QWHA 4H08A 2HWYA 2IZOA 3CEAA 1CQJA 1OC2A 3FRIA 3HKCA 4GPZA 4X54A 3L4SO 3TAHA 2X22A 1PFGA 4NFYA 4P86A 4DABA 1FNDA 2NW6A 3CUEF 1WUKS 2IXEA 1UK7A 4I5FA 2F00A 4Z1OA 4R98A 3C3BA 4DSOA 1GAQA 3MTAA 2O9JA 5LZ4A 5LZ9A 3QXGA 2EJVA 2XVMA 4KE9A 2J5QA 2V7XA 1KA9H 2HFKA 2V4UA 4KI0A 1KYTA 1JAZA 2J3MA 3D8TA 5C51B 3VPSA 5K4GA 3TW0A 4TKVA 5JYBA 1GDDA 4AJPA 2FQQA 2IX9A 3G8CA 3SIXA 2P6RA 1SUCA 4PHFA 2J5RA 1A9PA 5E6SB 5B58T 2Z1DA 5U4QA 3C4JA 3WI7A 2EZ4A 4C0BA 3EPKA 2ALJA 1VMDA 2H52A 2JA2A 2XW6A 3L4BC 3G0OA 4NHEA 2QYSA 1XNQB 1RFGE 3WGKA 4UTZA 4RTOA 1JDSA 1Q95A 2WPDD 2J5XA 3H0CA 3I09A 3SEAA 1KXZA 2CD7A 1JAHA 4CU2A 5AM0A 1CEQA 1H69A 1RBQA 1VGQA 2PCLA 3H1TA 4XQ0A 5THXA 4AB1A 1OH6A 3EA4A 4KHPB 3IXMA 4NBTA 4DLNA 5JD3A 1PJBA 4JUFA 4AKEA 1L7PA 1BDMA 4CM8B 2HMVA 4QSMA 1F4PA 2DQKA 5FHRA 3RFFA 4D6YA 3BMOB 3P0HA 4MIKA 2YNMD 2BCEA 4YT5A 4E2YA 2BFEB 4UW9A 2ZB7A 4NBRA 1S5PA 4Q4AA 5EI5A 4M3NA 3RTEA 2O8FA 3VX3A 4V0NA 1J1UA 1CJMA 3FWNA 4ND3A 5DI3B 2E0IA 1XT6A 3N8IA 4QGAA 4YJ2B 2GCIA 4MIOA 3VOAA 5EEGA 2PL5A 3CLTC 4L8WB 3Q41A 4GP9A 4HPWA 5BW6B 1WSDA 2IXBA 2YBEA 3COVA 3HJUA 5HUJA 1SU4A 2ES4A 3DFKA 4HEA1 521PA 1ADFA 1C4KA 1W85A 4EUHA 1UMCA 3EW9A 3OZAA 4HL6A 1BIFA 4E94A 3NBAA 5AIBA 5KB3A 1DXQA 4DXDA 4FQ8A 4HWTA 1GQ2A 2K7ZA 1N5JA 2WVJA 1RI2A 3BE6A 1LPNA 4MH0R 3GLFB 1H6CA 1UK9A 1UZUA 2W58A 5CXSA 1OFUA 1Z56C 2OWDA 1XBTA 1DUIA 3IULA 4OG2A 4OIMA 3WIVA 3KSBC 1RXVA 2GDJA 2CNKA 2ON6A 4Q9AA 4D42A 4RYDA 2J87A 1TVKB 3L4EA 3P20A 4K6GA 1Y37A 2V0GA 1B6SA 1J06A 1L5OA 2ZVQX 2ZYRA 4ZV4A 4LWPA 2G8NA 3G2KA 3M49A 1DG9A 2YV4A 4Q4CA 3HZOA 3B2NA 3RT1A 1N5OX 3TM4A 1SOAA 3CM0A 4O4HA 4F3CA 2AJCA 3GVHA 3PLNA 3RT7A 1YB1A 1CP2A 1TUBB 1FXWF 1I14A 4RKQA 1L8LA 4BXOB 4EQZA 2NPIA 2HM7A 2GPNA 2Y1XA 4BX9A 4UHKA 4AYTA 3RREA 1TYZA 4QATA 1SBIA 2RH9B 2XNHA 4QDOA 3DSRA 2P3OA 2QN7A 3JWHA 3JYPA 5ECYA 1Y8RA 3GLRA 4CEHA 2X0RA 4LQLA 3W04A 3HM2A 3AG5A 1Z6PA 3MK31 3Q3VA 4FMCF 1VSQA 2HLNA 2EYUA 2IV7A 3BGIA 5F7JA 1FLAA 5KWJA 4WINA 2DU8A 3TL2A 1XF1A 5IABA 5KI6A 3A9UA 4M1ZA 3SZGA 3M5CA 4PPQA 4F4UA 3OF5A 1ECFA 1BO6A 1EFDN 4MQLA 5J1TB 4D9IA 2FPPB 4LXQA 3G17A 1OX4A 4KU4A 1KJQA 4JQSA 5G1OA 1NVVR 1F0KA 2AI3A 2Z8YA 4EVQA 5C1DA 4OHYA 4MDHA 4DDTA 1R8SA 2GFHA 2X58A 1CNFA 3DYBA 4TUYA 5H9VA 5I9LA 4C5AA 2IEAA 1VKRA 3O3MB 1CHNA 1KQ3A 2WFLA 2WJYA 3GJSA 4IICA 4D3ZA 4BFZA 3CWZA 3LVQE 4OXRA 1ORTA 3V4SA 3KVNA 1KAQA 1OWPA 2XMSA 2QV7A 2DFPA 2BISA 4JLNA 2CXNA 3DL0A 4K9PA 5L53A 5KO2A 1LS1A 2XOXA 3DBLA 4X6LA 5AI4A 5FOSA 2LIPA 3KJGA 2DP4E 2I6UA 4WCFB 3BTVA 3WRXA 1ISJA 1O9HA 1PSDA 3M4JA 4LOJA 4ZO9A 3S2YA 1TYCA 3QVJA 5CD1A 3VZQA 3IX7A 5J59A 3SSMA 5KTRA 3V2HA 3BEDA 3X2SA 2NVOA 2O8FB 4S1NA 3KOMA 3QEAZ 5DXAA 1IPFA 2HJGA 3DOOA 3TF5A 3U6BA 1HL7A 1TKAA 2OBBA 1GGMA 2IVFA 2X9LA 1KYZA 4U9HS 5IFKA 1R88A 3D2BA 2A94A 3H8JA 3WK7A 5CH3A 3C3EA 2B1RA 3UICA 3R6GA 4E3ZA 5HIAA 1Z4NA 2P4SA 5BN1A 5IBQA 1MA3A 1YB2A 2NVUA 1XRSB 3CR3C 2X4LA 3MLAA 4Z8YA 4ZJUA 3N2KB 4JEMA 2Z98A 2ZB4A 3OECA 2WWYA 2O48X 1RWWA 1JALA 1LC3A 2V3WA 4DJFC 4MW9A 5IT0A 2G9ZA 3LOQA 2ZJ8A 4XE5A 1XMJA 1Z5NA 2MYNA 4ID9A 4JB8A 1N5IA 1Z2EA 3IVCA 2O2SA 3O9MA 1J2UA 1W75A 3OJCA 4F85A 1O0CA 3K70B 2ATCA 3ZG6A 5JAQA 4E51A 3W90A 2D5CA 2XA9A 2YTZA 4IHJB 3W1EA 5IDVA 3W9YA 1ES9A 2WNSA 3MJEA 1V8PA 4KGDA 4YMWA 4EABA 4F7WA 4DCSA 1EAMA 4HN4B 2ZSFA 3K0AA 4FHZA 1MX3A 1ODKA 1A2KC 3EXHA 3KIPA 1RWKA 3OZSA 3QPVA 5GM1A 4CMCA 2OG2A 3HP1A 1GPWB 1Z29A 2YX1A 4WOCA 2BUAA 4KQ2A 3KS9A 4QD3A 4V03A 2QSYA 1E6LA 1UOEA 4OGFA 4GOOD 1OTXA 1ST2A 2CXXA 5AJXA 3WRYC 4BJ1A 4JJ7A 1HI9A 5C52B 3OEED 3F46A 5DYGA 5D3ZA 1JHPA 1RC1A 4OOFA 1U2TA 4IUCS 1Z4LA 5JC8A 1XZIA 1N3YA 5AJZA 3RVMA 4DMMA 3OPXA 4YRZA 2BMFA 3OPYA 1F5SA 4M55A 1P2TA 5T41A 2WF8A 3TQQA 2XIQA 2O4CA 4JT9A 4ND8A 4UBIA 2WKRA 3LWZA 2ZJFA 4QLAA 4UU8A 6PFKA 5HJ7A 2XXAA 5AWFC 1J2RA 2IFTA 4ZODA 5HTKA 5BR4A 4UNPA 4MI9A 3WKAA 1WKCA 4GPAA 4RL6A 1TEXA 4L57A 4CT5A 2RKWA 4D99A 5I45A 1SHTX 1WXDA 2QN1A 2VH1A 3TJZA 2IS1A 5HCUA 1YRHA 2FK7A 3DUWA 4N5LA 4X0EA 3JASA 3TN7A 1BD3A 1HYGA 1RI1A 2ILVA 4D3XA 1YZGA 2A84A 3IB6A 3ND5A 1P1IA 1NN5A 4WVLA 3KKQA 2ADFA 3CG0A 3KEOA 1XYYA 3DXXA 3VU3A 3H1AA 1Z5UA 3EE6A 4TMZA 4EG6A 2HMAA 1ZUNB 4AQYB 1ABFA 3ES9A 2I4OA 4KLRA 2F64A 5L8VA 2RJNA 4RX1A 1D2HA 4DWJA 3KT6A 4Y2PA 1QFSA 1QIJA 4CHGA 1EXDA 2NTYC 2A5GA 3HKBB 1CQJB 5BNWA 3GJ3A 3WHIA 5DM60 3PD7A 3T9AA 3E1GA 1XCBA 4BL5A 5EJIA 4O4LF 4HDSB 4GQAA 2XNKA 4LXXA 3VJMA 3F6EX 5JSZA 5CX4A 2B8NA 2RK6A 5AW7A 3FFTA 3RFCA 1S2NA 3NQ41 4ND2A 4M87A 4Q1BA 3ITEA 2P9HA 1DIRA 4F2WA 4I7EA 4FNOA 3PVSA 3ZU6A 2C84A 3R3HA 5SY9A 3U7FB 3BDVA 5JXIA 2Q9AA 2VP2A 1VE1A 1GR1A 1UXJA 1YRYE 3KB1A 1G5IA 3LHIA 4Y2UA 5EWJA 1R9GA 1A8SA 5K3SA 2R2GA 1M2OA 4REMA 3PI7A 5TQ2A 4DRYA 2G5GX 5U1PA 1ZLXA 2YZMA 3SSAA 1YQ9A 5AVSA 2KSQA 1IY8A 1FX1A 1AUQA 1GXSA 3CPSA 4GXTA 4H4DA 2F4NA 2QDKA 4HEQA 4JBIA 3DW1X 5LKAA 1K3TA 5DN6D 2EJUA 3HJHA 2ZUTA 2W7TA 4AZSA 2OM6A 4R2MA 3AW8A 4C78A 2BSAA 1TPYA 2AXEA 2O4UX 4G6ZA 4YUWA 1DXHA 5BN4A 1PGQA 3SQXA 1CIVA 2NPOA 2CXTA 4TWIA 3DHEA 4A0HA 5EWLB 2ZR7A 4D4HA 1XVVA 3J81k 3MT9A 1QO9A 1XQ9A 1PRYA 4I5DA 3FGOA 4YAFA 5C46F 3ZJVA 2HA0A 3OIFA 4QZVA 3K4PA 4FNGA 3DDSA 1MW8X 1S2IA 4P81A 1C9YA 1CUSA 4RORA 2A9VA 4TTIA 3RAEC 1G1MA 2OXCA 1QH1A 1F7VA 5H9WA 1IAVA 3QA3E 1BCSB 1YGYA 2W6IA 1ZH0A 3IBGA 3IOMA 5CLLA 2D2VA 5AYVA 4FEAA 1P17A 5BR7A 4EY6A 4YMGA 5AUNB 8GPBA 4A23A 3O91A 2Q5IA 4B3DA 4XOUA 1BGVA 2VSQA 3IT3A 3O8QB 4F93B 3TCNA 3EZGA 1DLJA 2O50A 1ISIA 5BOVA 5AVVA 1TAQA 1COZA 2HADA 2BBTA 3OLCX 4HDMB 1GA4A 2VL7A 3K1YA 4RD1A 3TQRA 2PHZA 1FP1D 1ONOA 2OVFA 2NUPB 3B89A 3DEKA 3H1FA 1ZM9A 5H16A 1ZM3A 2VHEA 3AUAA 4G5HA 4EG3A 1JL3A 4LF9B 3BL5A 1KOFA 4URYR 3WAJA 1UEIA 1Z2NX 5F5XA 2I33A 3E7DA 1Q6ZA 4EKYA 5JANA 3ADDA 4TN5A 2EP7A 2WAOA 3NEAA 4ENUA 4QXAA 2UYHA 4P4NA 1DIOB 3BSWA 3ZIDA 3SXPA 1JA0A 1CP3A 2OK7A 4G26A 4MCAA 4R9SA 5CMLA 1GL6A 4ZU1X 5L7TA 5EP4A 4ZA2A 5J5AA 4FKBA 3VU8A 1EKXA 5HJ5A 2R1TA 4MA5A 3RIGA 1VJGA 3FF4A 2YYYA 5J3JA 4EHAA 1TT5A 3IIKA 5I01A 2VSNA 3ORHA 3R4CA 4EJMA 4UU7A 1ZUNA 3IQXA 2QYHA 3NONA 4HB3A 2E4VA 2FFRA 2BV3A 1XVLA 3TAXA 3ZNQA 1UOOA 2H16A 2A59A 2WUVA 3AP3A 4A7PA 4JOBA 4D5EA 1F2UA 4DQUA 5HX7A 1A71A 1T9HA 1P1KA 4CLHA 3W5AA 4F38A 2W43A 4ENPA 3CLSD 3LX8A 1D2CA 3HZZA 3GPCA 3VU0A 5L3SB 2GA8A 1CUEA 4BU0A 5JNTA 1NYLA 5E95A 5J2UB 2FXVA 1JECA 1SGWA 4JU8A 4ZYYA 1BZYA 1L8AA 2QJFA 2QBYB 2CDAA 1K2WA 3L04A 3OOWA 5C9ZA 5LOVB 4HJXA 1US8B 3FZNA 3QTTA 4I1IA 1WUTA 3QHAA 5CHEA 3DAGA 4BKRA 1P3Y1 2BT4A 1J23A 1PQPA 1BW9A 3PV0A 4EGQA 3H3FA 8AT1A 2FQ1A 3ESQA 2QM8A 3I4LA 3U4IA 3QKWA 4X7RA 5HRCA 2I91A 2CHFA 2G72A 4UM5A 5FPKA 5BUCA 1REQB 4M0UA 2HXYA 3JQ7B 1NFFA 4G5FA 1BQ3A 3N7TA 3O4GA 4Y2SA 2CHEA 2AI1A 1R12A 3GU3A 4YJ3F 3UJ6A 5LQMA 1OIXA 1QG2A 3GFSA 1ZUHA 3LYHA 4JJZA 2XWPA 4RELA 4G1CA 4Q4JA 1DQRA 1F06A 2PGNA 3A7EA 3LPDA 4AECA 1N2GA 2YASA 2Q45A 2IUYA 3IUSA 2B98A 2QTCA 3UWPA 3WJ1A 4ZK6A 2PJRA 3C3CA 1U7TA 2I34A 1GGVA 2H8GA 3K8QA 4D81A 1WXIA 3D5TA 2WV7A 2NXWA 4JXJA 4A8JB 4U2KA 2IUUA 4QVGA 3RI3A 2FVXA 1I13A 3MEQA 2KI5A 3V4PB 2XEXA 4HEHA 3E7PA 1U7WA 3QVKA 4ZVQA 2VS1A 3BILA 1XZJA 3V80A 1ONBA 5EQDA 1UP7A 4PNHA 4AUEA 2B5OA 1JDVA 3C70A 4KKXB 4WFQA 2W2OA 4GI7A 3E8MA 4TWRA 3GO4A 1Z2CA 1XD2B 4CRWB 4KR2A 2ACEA 3OCUA 3G59A 3V9AA 2I2AA 4MV7A 1F0PA 5ICEA 4K9MA 1MZVA 5CH5A 2F55A 3LLSA 4E2ZA 5EJ9A 2WVGA 3GZTB 1TF5A 2E7ZA 2NQTA 2H2GA 3WK4A 2ZBRA 3JQ6A 3WL7A 4LHEA 4BMYA 4G0WA 2XX3A 4JOSA 4AU1A 4HI0E 2HA2A 2OXEA 2QTFA 4MV1A 4NJMA 5C7OO 1M1UA 4CLRB 1NQWA 4O1MA 1DCFA 1LBIA 1M1XB 1XL0A 1ZM2A 3I4CA 4OQPA 4EPVA 2QVBA 2FF7A 1XTBA 3UT5A 4WHMA 4E5NA 2O8BA 5BRAA 4R1PA 3INYA 1GTJ1 3TQIA 4BFYA 4N40A 2QRZA 1M8FA 3G2LA 3K9NA 4QDTA 3EXHB 1JTFA 3TSYA 4AZ0B 2BI8A 3HWRA 4G37A 1IN6A 3P2IA 4H7IA 1NLFA 1C9EA 1QHXA 1RQNA 2GEVA 2GK7A 2XBUA 3EARA 3IJPA 2Q2VA 1F2DA 1SKUA 2MSCB 4FI3F 3U09A 1DX4A 3TLCA 2CVPA 3EEQA 5BUZA 4U1RA 1NXSA 2F9FA 3FZQA 2EFYA 4LECA 4TVBA 1K6EA 1KTVA 1UMKA 4ZXPA 3I8SA 4KJXA 4ROTA 4RM2A 1NX6A 1M34B 3R8XA 2ZVJA 3HCEA 2NP7A 3RB8A 2L19A 5D3MB 4PYJA 5L3SA 2NG1A 2G82A 2GESA 1H2XA 2QGNA 1HQYE 1G2IA 1MX5A 3FUUA 2GBFA 3AEYA 1XPOA 1DELA 3TLGA 3WYAA 2XXAB 2C4NA 2X77A 3KKKA 4PXYA 4XRRA 3KQKA 2WJHA 1YFKA 3PCTA 1E4VA 1E99A 2EIHA 1Z35A 1BXRB 1O4VA 3KYBA 3ZHVA 1P4JA 1VHTA 4QUEA 4ETWA 1G21B 4ARZA 1QCDA 5KVVA 3E58A 4A15A 4E1BA 1M2WA 2XIJA 3TOXA 3L1UA 3C5WP 5FOTA 2XUHA 3KOYA 5EVJA 2QSZA 5CJ2A 1LLUA 2FSUA 3B1VA 3ZY5A 2PXCA 4ZT7A 5L6LB 2Z58A 4YRCA 2RH5A 4INAA 5E2BA 5JCZA 3ESZA 1PTKA 4M99A 4RANA 5FOWA 1VTKA 4F4FA 4D26A 2YC4C 4LZNA 2WQ6A 5AOBA 3ZWMA 3PQDA 1YK0A 1EG2A 2IL1A 3DEFA 4IIJB 4HAYA 3ROMA 4LK2A 4DAEA 1Z0IA 4MCHA 4PN3A 3BJRA 2QRLA 4NI5A 4CF3A 3MT0A 4MYTA 3PEUA 3SNHA 3WP0A 4B9EA 2P11A 4UOQA 2ENWA 1PR3A 3TH5A 3QMVA 4JXKA 2Q9CA 4IDOA 3SQOA 1UJCA 3QU2A 5FTMA 4HH3C 1P5ZB 4J43A 1I36A 4KLZA 3K70D 3T1VA 5ECGC 2KQUA 1ZRNA 4P31A 1GEGA 4WBNA 2CB0A 3KWMA 1NNEA 5THKA 4O4HF 5TGDA 1KDPA 5KSPA 1MC8A 2FR1A 3RAJA 1V9SA 1D7AA 5FLYA 4C7JA 4CODB 3RV3A 1EI9A 1PFKA 4UPEA 1D3AA 1KNXA 1AS0A 1T15A 2DHRA 4XQ9A 2P7IA 2RB5A 3BQNB 5D2CA 2HNKA 4UMVA 4I6EA 3PGLA 4M7OA 3EXG2 1BOOA 1NVFA 2UYGA 1G6HA 4TTQA 4ER5A 5DEOA 3CEJA 3IELA 5DDIP 1AF7A 1LVHA 4KXVA 2XKKA 5EFOA 4FCWA 1J42A 3LBAA 5B58C 1H6DA 1YC2A 4YT8A 4D0SA 5I7UA 3E9EA 3LTNC 2UZ1B 4HAOA 2GN2A 3RD5A 3UXYA 4QPZA 2CHUA 4DLZA 3LSYA 1DQZA 2EXXA 2JHFA 4D3YA 1VSTA 1FRVA 3N2IA 3TI7A 4EPXA 3U2QA 1WD5A 4WA8A 5IP5A 4KDCA 3ZWDA 3O8OB 5LXTF 1XDGA 4M76B 1YZYA 3VHXB 2TSYB 1QR2A 2E4AA 2GS9A 1FXUA 4ZPJA 1CQIA 4CN8A 5BW4A 5AI9A 4EECA 4PF1A 4PZPA 1KIMA 3TO5A 4A8TA 2EG9A 1W87A 4CNBA 1D09A 1IOLA 2CLSA 3FPLA 1PV4A 2V74B 3C43A 4LGVA 4D4GA 4XD2A 4MMXB 1AB6A 3T3NA 5I7OA 3GK3A 5HWSA 2CFCA 4PFQA 2OUKA 3R41A 4UTXA 1E69A 2QZ9A 2H9AA 2IV2X 1EZZA 1SQSA 4IIJF 4FW9A 1G7TA 2AJTA 3EVTA 4NBNA 3FTDA 4X65B 5C1PA 4FWIB 1H8EA 3IMEA 2CLDX 2G25A 1GG8A 2GF9A 1ISHA 2R7LA 2N3ZA 2YV1A 4JJ8A 4UHJA 2F3PA 3X1XA 1WUJS 2FOLA 1V1JA 3GLKA 3W2EA 2WWTA 4WFIA 1BXGB 1TMOA 3UK1A 1UFVA 2YOHA 2JJ2D 5IJAA 1E1RD 4TLEA 3ETCA 4MUNA 4P3PA 4B79A 1J5EB 5BSHA 4RFLA 4KO4S 5TNXA 2P77A 2WYVA 3JYNA 1GAEO 1IY9A 2W90A 4ENRA 5BW8A 4CLOB 4ARAA 1Q15A 4M7PA 2NZUG 3W3AD 1JAYA 1CJBA 1YTLA 3Q7SA 3D7RA 1NW8A 1ULBA 1RFLA 2WIAA 5G3ZA 3CCBA 1DAMA 4AIIA 1ZD9A 3EPHA 2P30A 4PAGA 1X1SA 3ZHXA 4LZZA 1GM5A 2LPMA 3MQ2A 4FOLA 5ALFA 3R0QA 4JI8B 1UJNA 4A6PA 7ABPA 2A5JA 3BAFA 3QXHA 1VLHA 3EBLA 2PUAA 2CXRA 1YR1A 1Q7TA 3DP9A 1UPTA 1Y3FE 3MPUA 4ZPXA 4YPVA 5BXYA 1RQPA 2XB2A 1T0BA 2IUFA 5IMBA 1WHSB 1I2CA 2JFNA 1Q0RA 3OTQA 1Z75A 4YJHB 1C1XA 1GZ3A 4HZUA 4BO2A 4TYQA 4JGBA 3L02A 3KLPX 3W6ZA 1M2OB 1WZUA 3KLBA 4P2GA 4L8VA 1A8IA 2FPKA 5T7BA 2B1IA 1N9GB 1Y1RA 1ZMOA 5BYJA 5BV7A 4RV5A 3IHTA 3KJFA 1LF5A 4N39A 4XWTA 3FKQA 4DYVA 4DWVA 1QR6A 4LRSB 4RVGA 1P1HA 2REXB 3IBYA 1VHJA 4EIWA 3R75A 3IFSA 1BS9A 5ENVA 3V6MA 4ZIRA 1MPXA 3KKZA 4HQKA 4JJ4A 1QTQA 4XUDA 4CN9A 1UM8A 4HR7A 3EGVA 5CDHA 1RMTA 2I22A 1NYTA 2I9PA 4B33A 1VGVA 4EYQA 3C45A 5EHNA 3ZHSA 2OCDA 1IPEA 1QMGA 1SG6A 1U2EA 2O8VA 1BHSA 3IPCA 4MS4A 3VPAA 3PRHA 2ZCUA 4KTVE 5JQGA 2VNAA 3I52A 2QMQA 1LJ8A 1J25A 3JWEA 2ZSEA 3SVLA 3ITDA 4QOHA 2JLWA 3H5LA 2C5FA 2E2WA 1RMYA 3LTEA 1KYXA 1EJBA 2RI1A 3RAFC 1I4LD 2JS7A 1MT3A 4A3SA 1T36A 2FWIA 3JZIA 3O21A 4AZTA 4DA7A 1X13A 4REQA 1R66A 2XPCA 4LJAA 3ZHRA 2C4UA 3IAM1 4DZRA 2YWDA 4PE5B 3G5UA 2GBCA 4PG6A 5JLJA 4N8DA 4YCLA 5FQOA 1E7MA 4R31A 3PE4A 1Y8RB 2I6FA 4V2UA 5E7QA 1NXPA 3DDUA 4W9NC 3JZAA 2QRJA 5F21A 1WIWA 3KJQA 2YQ5A 4HGNA 1UF9A 2RGAA 4HDSA 1BFDA 1RTKA 2I7CA 2BYTA 2GERA 5DCUA 3QYAA 2BDTA 3OIWA 2W0MA 1EHCA 4QGFA 4DJAA 4F5YA 1E9AA 1FFGA 3EGXA 4L5AA 4UOZA 4CM3A 2YFKA 3L77A 3DH0A 3OQNA 2FI1A 4Z1MA 5F7XA 3OESA 3NRBA 1RRGA 4P7FA 1RZUA 5CURA 4GX2A 4CM4A 1R3UA 1GGFA 3QG1A 2KM1A 2VTVA 1B3RA 4RDIA 1T5SA 1T8YA 1GPUA 3FAZA 1KDYA 4N48A 3CLRD 2IHZA 3HHPA 1N4AA 3OMWA 1WXQA 1YVDA 4KMSA 4UD6A 3ZQJA 5G40A 1WJGA 2DCMA 2IIBA 1E4EA 1FTGA 2WYWA 3A9SA 1SBQA 3R40A 4ZYUA 4KV7A 4TRJA 4IUYA 5FORA 4AUMA 5LIRA 2JHAA 1FU7A 3G79A 4FSDA 4F1WA 1P31A 2AQ8A 5ALYA 2V98A 1LI7A 3KBBA 1NF8A 3JQQA 4CKCA 3PQFA 5IVKA 1J21A 1FNCA 1M5UA 2FUNB 2ZI7A 3ZXYA 2V0CA 4OHZA 3VOTA 3TJRA 1FDVA 3O31A 3VZCA 3KUKA 1WB9A 1EHIA 1CLEA 1MGOA 2BBOA 2JJQA 1NVUQ 2HJWA 1J8VA 2VYND 3KQTA 3WICA 5BVHB 3AP2A 3DLCA 2FW9A 4FSHA 4G5XA 5A4DA 2O19A 2JJ2A 4OI1A 5K0BA 2JARA 5FUVA 3UK6A 1RPJA 1PFQA 3ZZTA 3P4XA 1YASA 3ZGZA 3TTTA 1I7SB 1FUIA 1NVDA 5B4TA 2IQ5A 1D6JA 2CXUA 2I2FA 5F3WB 5AW9A 2W2KB 1YRQA 1V8ZA 1FE8A 2RH8A 3GVPA 4CEJB 4WTOA 4DMFA 2P67A 1JSLA 4F2DA 1U3GA 1W6UA 4ZI7A 4QQFA 3I05A 3NWPA 3VR4D 3FFBA 1LZKA 5JY1A 4MPRA 2AT1A 1L3IA 2DQSA 4NDAA 4M36A 1UEJA 1G9XA 3ZZ1A 5ALEA 1YR9A 2FSVC 3KJEA 3CZ4A 4MAFA 4IIYA 3SYRA 2CV1A 5EMMA 1U2GC 3IA7A 3BGWA 1J0BA 5HKBA 1BAPA 4I0WB 2HR1A 4Y6OA 3WK5A 3PS9A 1JEJA 1OWOA 3C2QA 2F90A 2EKLA 5JTUA 1E1CA 1E1DA 1IHXA 2WYIA 2XUOA 4Y1EA 3S1LA 1RZRD 2QXUA 1YBVA 4Q9LA 1YBHA 2CD9A 3C24A 2PZJA 5DHPA 3UK0A 3LL7A 3ESDA 1Q3KA 4PU0A 4WDQA 3TTYA 3ZUPA 3BHJA 4Q4LA 2C1XA 1FJ2A 2VDNB 1QMPA 1EFPA 2AVNA 2VP0A 2YHIA 3L6BA 3OJFA 3OE1A 4RHEA 1U98A 2W6JA 4RPLA 5C8DA 5J9FA 2EFGA 1VHLA 1B74A 3VYSB 4RMIA 5LQCA 4DV3B 2LCFA 3FKJA 4KLNA 2HL6A 4R0NA 3LXRA 4EI8A 4Z5XA 3NTQA 1PJLA 1UKVY 2X0EA 3RJ5A 4YRRA 1U8ZA 4NIMA 5JH7F 5BSGA 1YTUA 3A6KA 1WVMA 1R16A 4B32A 5LMNB 4LXIA 4NZNA 3RUIA 3LX4A 1PDOA 5CDSA 4Y2JA 5ES4B 4TMYA 2O8NA 3UMJA 3N76A 3R7FA 2PWBA 2CBGA 4EFKA 3FA2A 4GECA 3MLBA 3BK2A 3TUJC 1X7WA 1PR0A 1QF9A 3EXG1 2DFDA 4KBGA 4ZOQI 1KQPA 1SOMA 1X7YA 4Y6RA 4LYDA 3KWLA 1UINA 2GN1A 4DWWA 4L9AA 1TAUA 2X40A 3E53A 4PCUA 4K88A 1ZR4A 3DTTA 3F8WA 1DC5A 3PPVA 3E18A 3HA7A 4MWSA 1U0RA 2BFNA 1AZTA 2NWQA 3ZS8A 4PSAA 1KY3A 4H1VA 3G2OA 1GG2A 2CE7A 2QAGB 5KTKA 2GN9A 3PXDA 2VAPA 4L8YA 1J5PA 2HDWA 3IP5A 3WWOA 1G17A 4RWEA 1GRRA 1B15A 3AVXA 1I9GA 1OILA 3OZDA 1MBZA 2P5YA 4R9UC 3UANA 3R0ZA 2IU3A 5EKTA 4CKCB 2HTEA 1AJEA 1ADBA 2Q1TA 3QOWA 4JLSA 2ZCJA 4BEVA 1EG7A 1W36C 4BP8A 5DM0A 1UC5B 3T12A 4UEQA 1FYVA 4TYWA 4PHCA 2HQ1A 4Q34A 4D57A 4DOMA 2QYTA 1ENYA 4JQCA 2IZ6A 1T5IA 4IRUB 4W82A 3VR0A 1U28A 3IDFA 2CFRA 2RGEA 3CS3A 2H4HA 4UFNA 4MA0A 3KQVA 4ZGGA 5H4GA 1O7JA 2QUKA 2XZPA 2VWQA 4OXYA 4QYIA 1I3OA 1C29B 2X1HA 1KR2A 4XQCA 4ZYLA 1TW2A 4RV9A 3J7AC 3ZVRA 2BM1A 1YOBA 4ECEA 5KNCD 1RAAA 2N47A 2YWBA 3L8FA 4JZYA 1D9ZA 4J8PA 4DW8A 1Z4KA 4F72A 4KGZA 1O9GA 1SHLA 3LG2A 2XCSB 2C7OA 4MCIA 4QQRA 2FMUA 5K3FB 5REQB 4DB2A 1L5HB 4MYUA 3THSA 3ODGA 1KU0A 5JARA 3COYA 1VPEA 1CUYA 4GHWA 5FLEX 1RPAA 5JQWA 2DWCA 3N5KA 2H48A 4O4LB 3WR5A 4AX4A 1QX4A 2W6JD 4MYSA 4LA4A 2I1WA 1SU8A 3TW6A 3O2JA 4FJ1A 3FOFC 2GO1A 2X6TA 4BWGA 1AUVA 4DLWA 2AW5A 4EENA 1JKXA 5KVSA 3QVSA 4MGKR 4WCVA 1KJYA 4DLYA 1N5KA 5BMVA 1C0EA 2IHKA 1DBVO 4NDZA 4CR6A 1K8YB 1CRLA 3A1TA 3N7UA 2QPTA 4Y1RB 3SVTA 1TIBA 4IHJA 3FHJA 3TIVA 2Q6KA 2VG8A 2QUZA 1R4ZA 3NC0C 3WL8A 2GN8A 1OWNA 2G36A 3N7AA 1LPBB 3DA8A 4H7KA 2ZJ7A 5JSHA 3LF1A 3UCEA 1E9RA 2B4RO 4EF5A 3F8SA 2HA4A 1QDLB 3M6IA 1VE9A 1C1YA 3V8QA 4BBPA 4WBNB 2V5AA 1DIHA 4DRZA 3O8RA 4ABTA 4Q05A 1HKHA 1YCDA 3GVXA 4HFJA 1SCBA 1RRMA 3EIXA 1YQDA 3G8YA 3L7CA 4XM1A 2O1WA 3T4UA 3SC2A 3FGPA 1YXMA 4YPOA 3L7LA 1RR6A 3MCUA 2DWUA 1XP5A 1IUNA 5F4BA 3GGPA 1E3LA 4ZQHA 1H3EA 1W8DA 5AVOA 4QWMA 5B53A 4Q9NA 1TQDA 1QLWA 1TZBA 5K8LA 1WE2A 2JJMA 1NNSA 3ANMA 3DDHA 3P1JA 4IQ4A 3O9ZA 2MHCA 4QAJA 1FFHA 4EO4A 1YFJA 1QFMA 2D2FA 2B69A 1RAEA 4F1JA 2I8LA 3BIJA 3HO6A 2PUVA 3VHXA 2NSLA 3NJRA 3M5DA 1C7QA 1PQ4A 4FFBB 2GM3A 4JUDX 1D4FA 2BKAA 1WCIA 4OYHA 3RAPR 1D1QA 3T7CA 3WG9A 1FIUA 1E5DA 1OX4B 4UU1A 1TM4E 2C9DA 2WTAA 1H8HD 2D3WA 4D8TA 2HJVA 1NHGA 2FG7C 3IHWA 1KQGA 3HI4A 4YUVA 3VO8A 2DHDA 3UTCA 3NIWA 4LRXA 4MP3A 5E0OA 2XUQA 4HDOB 5HR5A 1PK9A 5KNDD 1CS0A 1QU2A 4NECA 5G2OA 3FKSD 2XVAA 5HS4A 4OLBA 3PCRB 5D01A 1E1NA 2GHRA 2FY8A 3AHJA 1ZGCA 4G8BA 5GWXA 5KJEA 1RKUA 5K01A 1UPUA 3M81A 3OU6A 1KJZA 4ECAA 1UAYA 1ZH2A 3BERA 2HEGA 2J3HA 3QOYA 5JYCA 3CH6A 4C4PA 2GNPA 3T35A 2ZBVA 3GNTA 3LHKA 2YWCA 4KAAA 4D0LB 3AY7A 1AGYA 2B3DA 2QTAA 2XITA 3GNSA 3KUCA 2CLLB 2G0AA 3KV3O 3DBRB 1Z6GA 1L7EA 3A4IA 2VOEA 1O3YA 3VDXA 4BP3A 4FB4A 4YMTA 5L51A 2SKEA 4Y98A 1QQ6A 4XGQA 4ZOLF 4N9WA 2IYEA 2IX3A 3AF0A 5KQMA 1NW5A 4J0HA 3HV0A 4TKVB 4CL2A 1WEHA 3MSCA 1DEOA 5FL3A 1F8YA 3G82C 4HGOA 1KK0A 4I1RA 5A5FA 2C9YA 3FDZA 4FK8A 3AIIA 1NXQA 1E1QD 5GGXA 1T0IA 2MJLA 3KXKA 1ZINA 1GILA 1XMVA 3E23A 2YV2A 4DTIA 1KFEB 5GINE 2YQ4A 2V6GA 3CLTD 2XE4A 4GH5A 2OYCA 5A7GA 3EIQA 1Y6GA 1L7BA 1KORA 3AZOA 1U3FA 1ZUIA 3KR2A 1NRJB 1ESNA 4X41A 4JVSB 2QX9A 3QVWA 3SPXA 4RVHA 4Q3AA 2ZSKA 1UZNA 4M1MA 2ASEA 3BGVA 4NV0A 1A2QA 4OV6B 3WXMA 2WR8A 2JH8A 2VPYA 4BQNA 1THGA 4U63A 4KE8A 4B6GA 2O5EA 3JQEA 2PXAA 1QH8B 2WIGA 3LCRA 1QP0A 4DMHA 3W3ZB 4EKEA 4ZCPA 1RT9A 1IVNA 3PR1A 4J90A 2CJFA 4XASA 5LMZA 3NDPA 2CY0A 2DSTA 4HH1A 4NZMA 4RSGA 2IOHA 4TM7A 1XU4A 1SK9A 1ZG3A 3I1FA 1WB5A 2XCIA 2PCJA 5DGXA 2PXXA 3V97A 3IAAA 3IR6A 4C06A 1MHTA 4ZEOA 3U1TA 1I30A 1YZUA 4OBWA 2BGKA 3E9DA 3S81A 4YC7A 1QE0A 4GWKA 5AW1A 2V5UA 4RK0A 1HE1C 1M1ZA 3ZX5A 2HY7A 4DR5B 4J0EA 2JI9A 2M32A 2VJPA 3RDPA 2X2OA 3UXHA 2BR4A 4CLDA 1OGYA 3OFJA 4DQLA 4H18A 1I10A 2EWMA 2HKIA 5IM5A 1CRPA 2WFAA 3RVKA 3DEIA 5LP6F 2MYTA 2POCA 2YFQA 2DOKA 4UNQA 3SI7A 3VPFA 2AG8A 2Y1WA 2I4LA 2QNIA 2FE1A 2ZRPA 4K46A 4RY8A 4BJHB 2J33A 5A3RA 2I3ZA 2XQKA 3ASZA 3U40A 4GFDA 2G1UA 2O2IA 3NHRA 4YECA 4AAYA 1CCWA 1DZIA 3W5JA 1RS0A 4BEBA 1F6DA 1O0BA 1ND6A 1G4AE 4IIVA 1W2HA 1GRQA 3EIFA 2WUEA 3BRWD 5IN4A 5DNYB 2EV9A 1TD1A 1F3OA