1GQOA

Type ii dehydroquinase from bacillus subtilis
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
141
structure length
141
Chain Sequence
PHFLILNGPNVNRLGSREPEVFGRQTLTDIETDLFQFAEALHIQLTFFQSNHEGDLIDAIHEAEEQYSGIVLNPGALSHYSYAIRDAVSSISLPVVEVHLSNLYAREEFRHQSVIAPVAKGQIVGLGAEGYKLAVRYLLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords DEHYDROQUINASE
publication title Crystal Structure of the Type II Dehydroquinase from Bacillus Subtilis
rcsb
source organism Bacillus subtilis
total genus 49
structure length 141
sequence length 141
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, X, Y
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2001-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 1gqoA00
4B6PA 3N87A 2XDAA 4CIXA 2C57A 1H0RA 2C4VA 2BT4A 3LWZA 4V0SA 3N76A 3N86A 4CKXA 4KIJA 3N59A 4KIUA 4CIVA 5B6PA 4KIWA 4CKYA 2CJFA 1GU0A 2XB8A 4CKZA 2DHQA 3N7AA 4KI7A 3KIPA 4L8LA 1D0IA 2WKSA 4CKWA 2Y71A 4B6SA 4B6RA 4RC9A 2UYGA 4CL0A 4RHCA 1J2YA 4B6QA 1UQRA 3N8KA 2XD9A 2Y76A 1GU1A 1V1JA 1H0SA 3U80A 4CKWB 2Y77A 3N8NA 1GTZA 2C4WA 1H05A 4ZC1A 4CIWA 4CIYA 5WRFA 4B6OA 2XB9A 1GQOA
chains in the Genus database with same CATH superfamily
1TEXA 3F47A 1C3VA 4R8KA 4FGUA 1A4UA 5A3QA 2ZYAA 4DLKA 5BORA 5FOXA 4HDOB 3M3PA 2WAYA 4X66B 4PSCA 5I9BA 4RQUA 3SHOA 3M6IA 1CIPA 2CJFA 2FG6C 2X1MA 4GBGA 4BJ1A 5HKAA 1WKBA 4X44A 5D3MB 3RUEA 4GDFA 4IDNA 2X5JO 4C29A 4JJ4A 3AETB 4DIMA 3PJEA 4PZAA 3TH5A 2IPMA 3LUAA 8MHTA 4D56A 3RABA 1YS6A 4NQZA 3KDPA 3SS8A 2HO5A 2WT9A 1J0DA 1Z4LA 1QAMA 4JK3A 1KY5A 3LT5A 1VBNA 2FE1A 1I7NA 4UZFA 2BCJQ 4YWHA 3BGWA 2R8YA 1CUJA 2P7IA 1K8XB 4PLVA 4OCZA 5EESA 3ZWBA 2V1UA 4H08A 4NXMB 4EARA 3V8NA 1B15A 1BE8A 3WNBA 1NZDA 1Z0ZA 2Y6VA 1W4RA 1BE0A 2N1MA 3EVBA 3DZJA 4EELA 1HETA 1XTUA 2OGZA 3HO1A 4WESB 2E4WA 3AV3A 3F6PA 5EZ6B 2WJJA 4C1BA 5F7ZA 3T4EA 2PZEA 1QIGA 4JL8A 2CEKA 2EHDA 1MLDA 4E3ZA 3E7WA 1OROA 2R48A 3MB8A 2RKOA 1ESCA 2FP4B 3PC3A 3QHAA 4EX6A 4AZ3A 4Q3KA 3YASA 1V1JA 3VAAA 2QJOA 4KYUA 4X54A 2JFXA 4HQLA 3BQMB 5KU7A 3ZR4B 5IAOA 4LBYA 2XF2A 4ZAVA 3WGVA 4YAEA 9ATCA 1P9RA 1WZCA 1W36D 2PZLA 1BRMA 1NBMA 3AW8A 4UBNA 3LVBA 1MF7A 3WWEA 1OX4B 4QM6A 1KRWA 4ERNA 5FFFA 3I9KA 1FU7A 3WGGA 1QO9A 1E92A 1UXIA 4CF3A 2KQUA 4DV4B 4DREA 1RWOA 1EZ4A 3VNVA 2X9NA 2HCRA 5FUWA 5TR9A 4P84A 3R9KA 3GQVA 2H4ZA 2C8JA 3DL7A 4C06A 4QRHA 3BYZA 3ZD6A 4R3WA 1DIHA 2C7GA 1T8WA 3ORSA 3QFHA 4G56A 1QSGA 2NO1A 2GLTA 4GMXA 2KB0A 3FNFA 3KKEA 1U1GA 1KU0A 2VK1A 4ZGWA 3JATB 4KDFA 4TXLA 4Q7LA 3HDTA 2XZTA 4N5MA 4X62B 3I9V6 1WOMA 4Q12A 3KNZA 1AGXA 1SIWA 3OIUA 3KWMA 2WNHA 2H54A 2NTNA 1RPTA 2VHZA 2Z1DA 4RANA 3QQ5A 4J1QA 4P53A 4P2GA 3JY6A 5KHOC 3CZ9A 4KIWA 1YZQA 5T6MA 3ETLA 3UGTA 3AUJB 2DBZA 2XVMA 2RE8A 2CHFA 1WXHA 2CNKA 2PJUA 5ER6A 5TSDA 2UUPA 2WE8A 3F1KA 1QFYA 3VPCA 4U2FA 3PC4A 3E3AA 2ISSD 4R9NA 1U9IA 2NLOA 2Z6VA 3EGCA 1Z37A 1E1LA 4JCOA 4M6WB 1NHWA 3GQBB 1TE2A 2EEZA 2H4WA 2WM8A 3NBQA 4G0OA 4JC0A 1HH4A 3KUDA 4FKBA 2QVBA 2FW9A 1A0OA 2J9FA 2FEXA 1NJGA 3PIIA 3WGZA 2BISA 3PPYA 4Q1DA 3F96A 1H3EA 2EX0A 2R6AA 2HRCA 1DIGA 1W0KD 2BY4A 4GOXA 3LZDA 3WP0A 4JSTA 4AG6A 2P1DA 3RRNA 1I7PA 3I0ZA 3KQVA 2NSDA 2CHUA 3VPXA 2Z58A 4RK5A 3VI3B 3HA7A 2QRUA 4EA9A 4ER3A 1XPUA 3EGEA 1JLLA 2J8ZA 3W05A 4Z9FA 2J09A 1KYTA 3WHKA 3IMCA 3F6CA 5T5QA 1XTQA 3GRYA 3TGLA 4B7ZA 1TYDE 4YACA 5JSZB 4PNPA 4X7PA 5FXMA 4GGPA 3BWVA 4Q0MA 3UK6A 4C88A 4R8RA 2YJTD 3CO0S 3B2EA 1HSZA 4QUDA 5ECWA 2YYYA 4B7UA 5K03A 3NANA 4MWOA 3AVWA 3U1VA 1JKJA 3ND8A 2VNAA 3TEJA 5CPFA 3OZ7A 4QPPA 4Z3OA 1YGPA 1DT3A 4WUVA 5UKDA 2AYZA 3F7TA 3K31A 2AW5A 5U9CA 4J1TC 2DECA 1G3MA 2E89A 2RCYA 2FE4A 4V38A 2NU9B 4D3FA 5KTRA 2E6KA 3S1SA 2VKQA 2Y05A 5B1EA 5JYCA 1AU9A 2AI3A 3PBKA 2PX8A 4TTRA 5JCZA 1DO2A 3AWDA 4MWSA 2AC2A 5HIAA 3PENA 4DUGA 4M7WA 1RWPA 5JMWA 4C7VA 1V43A 5EWMB 1P1CA 2E3JA 1ZN8A 3WIUA 2ODEA 1Z39A 3PEYA 5CNJA 3LA8A 1X9IA 4EBBA 3KB6A 4L4UA 5K2OA 4LRUA 3HYTA 3K6RA 3EIWA 1JEYB 2YY6A 4GBMA 3V97A 4MKIA 1NUPA 1RPNA 3N53A 4E3WA 4ZZIA 4LJ8A 4B79A 5CAEB 2JLXA 1YZGA 2CWWA 1D2NA 4WCFB 3AHEA 5IDYA 1M8GA 1MTOA 1ZN7A 1RI5A 5BN4A 2PSSA 2UVPA 5JARA 2GT1A 3PXEA 5DPMA 2ODQA 2FWJA 3TR6A 3DKRA 3OCXA 1YZUA 5CMLA 3UAYA 3VHLB 4EM6A 3R7DA 1E3WA 5JPDA 3W1VA 4DMCA 3WXBA 1N9KA 3FUTA 4ZDKA 1MDFA 1RC0A 4DLPA 1USIA 2VYNA 2P2GA 3R0VA 4N18A 1XK6A 5L6MB 1BVYF 2G5GX 3KTOA 4HDSB 1P2VA 3IKTA 5DN6D 1EEXB 4YAOA 5AOCA 2WAAA 3SQMA 4DW8A 1JBKA 3MCVA 4RCVA 2OZKA 5ABPA 1JXMA 5GY7A 1OLSB 2QG6A 4R68A 1MC5A 5AHXA 5JZVA 3FPJA 2OUIA 3FGZA 2PUEA 3ZWYA 5CGQB 2ZP1A 1DC3A 1DKUA 3C98A 2DJIA 3IUNA 3E0QA 4IUBS 2P62A 3CZMA 4OQFA 4W8OA 1U8UA 3DZIA 4JB2A 1U2DC 2Z8YA 4LRQA 3IVXA 3VZSA 5EP4A 1YC5A 3NASA 4XWAA 1XDZA 2PIDA 4ZKEA 2C9DA 1FZTA 1ZS9A 4DSZA 3T7TA 1XMXA 1CIVA 3DH0A 4PSVA 4G1VA 5EKXA 1D5WA 3PVSA 5IKXA 1B43A 3TI7A 1OTHA 2A5YB 4TZ0A 1CXZA 2JKVA 2P40A 3E03A 2ECPA 3UJHA 3WYAA 1RI3A 4Z99A 5A05A 6GPBA 1H8ED 3AFMA 5EA2A 5J2UB 1P1BA 3PHLA 1D6JA 1IK6A 2HLDD 5LVAA 1GPWB 3OQ6A 1KMCA 4YJKA 4CCAA 3C3KA 3KTDA 2R8XA 1XQXA 2REBA 1CZRA 3DL4A 3NWBA 1SZPA 1TVCA 2CL0X 4WFKA 5AHWA 3JAKA 1R6XA 5REQA 5JBQA 1VG9B 3PTLA 1P60A 2BI8A 1NNI1 1NVWQ 3LX4A 3EZGA 1UJ2A 2VJQA 4I55F 1ONOA 1I4LD 4F0JA 2PX4A 1UT6A 4WY8A 1G20A 2B4RO 1ZHHA 3DP7A 3NHPA 3I9FA 2AL7A 3G0DA 1T2VA 2GBCA 3HYLA 3TRKA 1U7OA 2GUWA 1MENA 5CBPA 1AJEA 1JQBA 4YVFA 1OBFO 1GFIA 2XZOA 4WECA 3ROQA 2BF4A 2QM3A 1HSOA 5KNBH 1OYOA 1W4CA 4ROSA 4R7GA 3CTMA 2HPAA 3FLMA 3BRWA 3OQIB 4MQLA 4A0SA 3IMFA 1DQRA 1TM4E 1WWKA 4KJZA 3KKQA 1Y1LA 2PM8A 2Y68A 3PE6A 4HQOA 1XZEA 5C9ZA 1N9GA 2H31A 3CHYA 5HGXA 1WQ4A 2R7AA 1R64A 4H31A 3LC1O 3F3SA 4GW3A 5FPTA 3G9ZA 1VLQA 1GTJ1 3KYJB 5BR4A 2Y0BA 1ZPDA 4I36A 4WWHA 1G2QA 4AYWA 3FRHA 3MPUA 2Q0SA 5J5AA 2GFIA 1G8MA 3U0BA 1ZGJA 1NL3A 2K6GA 2TMGA 4DOMA 5HF5A 3RJMA 2BHLA 4OOFA 3LP6A 5FEMA 2FR1A 3V4PB 1WF6A 3AF4A 3N05A 2UYOA 2HJVA 3NVAA 3HLKA 3IRUA 4M89A 4EFMA 8ATCA 5LQJA 2CUTA 1SVIA 2IYFA 2NG1A 5PNTA 5AXAA 2IHNA 5ADWA 2ORVA 3N0RA 3OMLA 2C8VA 3MTJA 3UH0A 3A4YA 1Z08A 4UKDA 4CODB 4MITA 2FPRA 3B9BA 4G4JA 2CLOB 1DKRA 2HK9A 4W5JA 1OLXA 3N58A 4MLCA 3DFZA 4E2FA 1AB5A 4BMPB 4H0FA 1O94D 4CBVA 1NJ6A 1WNFA 4FYJA 1DB3A 3PHGA 3RYHA 2WFAA 1P4SA 3EARA 2MSLA 2QQEA 4FINA 2R6JA 4GWKA 3VC7A 4CM1A 1YR6A 3DKIA 3UATA 1G41A 1H2YA 2W83A 1NXSA 1NULA 3PFIA 5FTJA 3MJFA 1C9DB 2YX1A 2ZKIA 4Q4AB 3LHIA 4LNUA 2ZW9A 1W4AA 1XDBA 2CYAA 2QORA 4R8SA 3P9XA 1HDYA 1FUEA 4KWIA 3LLCA 4ND2A 3KJFA 1Z45A 1I2AA 4OAQA 3T7RA 1ZH8A 4MV1A 1G9TA 1TO6A 1L5NA 2BR3A 4LF7B 3L0ZA 4HB2A 2A0UA 3P4XA 4B71A 1W30A 4B73A 3GJ8A 4NZYA 2QN6A 5JVDB 1H9BA 4MHTA 1AKNA 2BHRA 2CFTA 1ABEA 4JBIA 3UENA 4DNXA 3EMKA 2YCLA 3BJMA 1UWVA 3S68A 1Y1SA 1BN7A 2JGDB 2I91A 2ILTA 3N1UA 1KYXA 3C6MA 3OY7A 4TWJA 3PFWO 4RK1A 2VT6A 4Z0PA 1GA4A 5HDQA 1ZOLA 4EMSA 1CYDA 1TJPB 2JFHA 1G60A 2OZLA 4JT2A 1DBIA 3KOXA 4RZIA 5J2TF 1JN0A 3LXMA 4UQLA 2GPTA 3PXGA 2IP1A 3HGMA 1UANA 3U4GA 4DM4A 2A1TR 1TCAA 2WLSA 3M8KA 4JT8A 2JGLA 1Z7BA 2OFFA 3LQKA 3VH2A 2UVDA 5E0KB 3UA3A 3PUZA 1NJ2A 1QCZA 4ZI7A 2XNKA 3TRHA 5TJHA 5IXYA 4AUNA 1VL5A 4E2WA 1LV8A 3MBOA 3O38A 4I9FA 3BTOA 1POWA 4RIGA 3TRFA 5IJ9A 4NYIR 1K5PA 4RWEA 2H1LA 2Z2JA 5EKTA 1P2SA 2QF7A 1I9GA 2O2CA 1UBRS 3IUPA 3QV2A 3OCCA 2RHMA 4LWPA 2E4XA 3VOSA 5ALNA 2QRHA 3OWOA 3KYDA 1IOWA 2QJTA 1PGPA 2HV8A 2P2ZA 3QU2A 3VGPA 4C3OB 2Q27A 2IL1A 3FOCA 2PX6A 3GMDA 2O2ZA 4IDOA 2QS9A 4GZ3A 1TTHA 2QLJA 2JASA 1EWKA 2PUHA 2RHHA 3C6ZA 3ESAA 5AVRA 1J2TA 1QVWA 2QVGA 2ZTSA 4I5IA 5FPHA 2NMVA 4D9FA 3NIBA 3AEYA 4X6LA 2EKPA 3RQIA 3SZ3A 1CS0A 2R7NA 2XMPA 4JEIA 1PIWA 4Y6GB 5FA6A 1QPBA 1XLUA 5CK4A 1S2LA 5DB4A 3HK2A 3ESCA 1S3FA 1NLFA 1GPJA 1KMHB 4QAJA 5IWAB 1W96A 1XPJA 3DMRA 4FXOA 4AK9A 3V4RA 4P3PA 4G0ZA 3UPDA 4CLDA 4I4NA 2PKEA 2BH2A 2H51A 3HCCA 3AY7A 3TCKA 5C3MA 1T3LA 1LPMA 1V0JA 1YZHA 1N8KA 2J87A 2O57A 2PRIA 4Z8YA 3W8RA 5KTYA 3RUCA 4I6JA 4X8OA 4B6OA 5IVDA 3B5IA 1TJ4A 3T3EA 3HKDA 3ABZA 2G5CA 3ZGXA 3OWXA 4KREA 3VC3A 5JNVA 1ZD4A 4K1LA 3DZHA 3QLVA 5AIBA 2VJLA 1NXQA 2YYZA 1S7CA 4YPOA 2GASA 1LVHA 1E94E 2KBEA 4AAYA 4U00A 2Q2NA 1PQYA 4F8JA 4YYZA 1G38A 4JLUA 5KCMA 4QUHA 1Y7LA 5G41A 5TPWA 1JIJA 1KI6A 2JIDA 2LPMA 3SZRA 4D99A 2MIIA 3AKCA 3I42A 3S2YA 4L2IB 4OQYA 3SX4A 2MTBA 4P7BA 5LQSA 4AKHA 1Z88A 1DTWA 2Q3CA 2SICE 3OTOB 3NAMA 4NE7A 3R23A 4B4KA 5JO0A 5DVZA 3RIHA 3W1EA 2W11A 5BRJA 3EA0A 3ZD8A 4BP8A 3WGMA 1ULAA 4BLRA 1UP4A 1K2WA 2G9UA 3O75A 4XD7D 2YKGA 1Q11A 2D2FA 5KNDD 3K70B 2G82A 2ZUBA 3HEMA 3TLZA 4FHEA 4IDGA 3VSEA 3MRSA 1PNRA 2P9HA 3S7ZA 2GEUA 4B3JA 2B0JA 1B93A 1KVTA 3PRJA 3ZX4A 1EESA 1RFGE 2ZRCA 2XOKD 1NIJA 4RUKA 5GGXA 1K4MA 3C3MA 4MIKA 1XZKA 1YIAA 1UOEA 4WLOA 3LBHA 3ZN2A 5LB4A 4OHOA 2ZSBA 5LMCA 1WQ1R 3GL9A 3TVTA 1YS9A 2V4ZA 4MUAA 3DE0X 1SHUX 5CPBA 3S55A 3KAPA 4KN8A 2W2XA 5U1PA 3SC2A 2Z3ZA 1C9YA 3AP1A 1QFXA 2JH8A 1NMQA 3ER6A 1TU4A 3B1FA 4PZ0A 2VQSA 4YK7A 3RO7A 3TOCA 1Q2UA 5DM1A 1N0VC 3OE7D 2FWIA 2PX3A 3FHLA 4L0QA 4U63A 4Y2GA 3RHFA 4OMFG 5HM6A 3O4HA 1SVKA 1UBEA 4UBKA 2F3UA 4I1YA 4KQIA 4NV0A 4YBRA 2TMDA 1KE1A 1KVSA 3HJUA 1CUFA 3CF4A 3CIFA 3MBIA 4KNVA 1YV9A 3SHQA 1YI8A 2DMRA 1ND6A 3KJHA 4DUPA 2YVKA 4F6RB 2NNWB 2WTMA 1EFRD 4NYMR 4D44A 2I3BA 3MJVA 3U3JA 2CZGA 5I9SA 5EJMA 1H5UA 4GP9A 4NBTA 1JR2A 3LH5A 4UREA 3AB7A 4Q02A 1O97C 4PLHA 4GI5A 1KKLA 1T8YA 1ZUHA 3NIDB 4IRMA 3QITA 5JBIA 1H9CA 2GF2A 2CJPA 5A4KA 4KAFA 4M7PA 4QEDA 2YINC 2IIQA 5B7GA 1VLMA 3WADA 2IFTA 1GKLA 3OLWA 4I55A 5EJ7A 3U56A 2VPTA 1LU9A 2AEMA 4F6CA 1ADJA 3RAJA 5MDHA 3GBVA 4WOKA 3RVLA 3IQIX 3T41A 1EUDB 1YFKA 3B20A 3KT8A 1KKMA 5BV7A 4QTTB 3E9DA 3VPBA 3R9XA 4GYYA 4XR9A 3H13A 4EF5A 4B4OA 5BN3B 4O2LA 1W48A 3IP6A 3M6VA 3Q6NA 521PA 4A4DA 2O1XA 2Y0CA 3BG5A 2QJFA 1N6KA 4WLEA 2CW5A 3V1TC 4NH4A 4KU4A 2NQ8A 1N2XA 2BEVB 2QU8A 1P17A 3BGIA 3HBMA 3OHMA 4FN5A 2ROQA 3KZMA 3FCSB 4OB6A 1CHDA 3HRKA 2DSTA 3Q8XB 3H8JA 1ATZA 3HA5A 3O03A 2HFKA 5CCBA 2UUCB 4DV3B 1AUVA 4KX5A 4CKBB 1RWMA 2FSVC 3NYWA 4JGGA 4NAUA 2XQVA 3EAQA 2V0NA 4LZOA 3V5NA 1WVGA 4CLEA 4R0MA 1JPJA 2OMKA 1Y9DA 4HRXA 3ODPA 4AU1A 4HEA6 2WUDA 3HZHA 1KDOA 5E3JA 3T5CA 4A82A 3NM6B 3S29A 1AN9A 1CRQA 1OYVA 4N5DA 2PUVA 4MQBA 4M0DA 4OSOA 3ZHSA 4EGSA 3RIGA 2C4HA 3UCEA 4AO6A 2GYWA 1DXQA 1GFSA 1FXSA 3EIQA 4M9XA 4R6XA 3OJXA 1DT5A 4QJ5A 1LQTA 3L0SA 3NWPA 1ZRSA 3PR2B 3WV5A 2XBLA 2PXAA 4JBYA 3DNFA 1ZVMA 4ENTA 4FEYA 4JJKA 3ZYZA 1F17A 4NMWA 3GUZA 2R79A 1ODIA 3RSCA 4ARCA 4WAUA 1ZICA 2REOA 3JQAA 2ZB3A 4P7FA 3HCDA 4Q9LA 4OFZA 4IOJA 4TMVA 5HS4A 1C14A 2WYUA 3MT0A 3QEKA 4DBLE 4BQOA 2AG1A 4UTPA 3WMRA 3WMWA 3CWQA 3H4VA 5IVKA 2QBYA 4G63A 1HNXB 3USCS 1RBYA 1GP2A 3T9DA 1S5PA 4CM7A 1R8YA 4RTKA 4KKXB 1Y1KE 3PLRA 3M1YA 4CFSA 2C8LA 3N8GA 2LCFA 3R7NA 2V9PA 3E8XA 3ZWWA 4B85A 5EHGA 1PP4A 3T1TA 1Z0SA 2E4AA 3ADKA 4FLFA 1JB1A 4LXQA 3WXMA 2GKOA 4DQLA 4RDXA 3CF4G 2ZK7A 3ET5A 3MMZA 4RCYA 4WEQA 1Z0UA 4TN1A 4AZ0B 3LDAA 2WSYB 1B0AA 5ED0A 4MUKA 3U09A 1I94B 2QYSA 1EE2A 4KXLA 4MLDA 4NZMA 3LT0A 1NRWA 2J5KA 3PVZA 4JR1A 4ALMA 4ZOQI 5JSFA 4U7DA 2JLBA 2NO0A 3TS1A 1C81A 5AUNB 2Z5VA 3TXAA 4PTLA 2RH4A 1YCHA 4MAMA 2JGIA 3N59A 4N54A 4UPEA 3OF5A 2XGGA 2QX9A 2YWJA 3O90A 1OFTA 4ZAYA 1OZAA 2R00A 2GZ2A 3KHSA 2RI6A 1G9XA 3AHHA 1F14A 3PXAA 1WRBA 2XKJE 4DARA 3FNBA 4Y18A 4YV7A 3AOEA 5J2TA 4CM8A 2Q5FA 3AQIA 1KDRA 4G97A 4EFNA 2QLTA 4HZIA 4WBNA 1UDAA 3L02A 4URWR 2VJAA 1SKAA 5HW0A 3PYXA 3VVLA 4B8YA 2PTHA 1J9GA 1Q22A 1HDXA 1L4NA 1UWLA 1U0EA 3T15A 1WPRA 4CUKA 4F71A 4C2UA 3OCVA 1EAYA 3KUUA 1VMKA 2G9VA 1PW5A 2WPDD 5IU6A 3IQDB 4XVHA 4F5WA 1NWCA 1MB2A 3LQ4A 4ZV7A 4BRWA 4HGNA 1DOHA 1JECA 3ZTYA 4C21A 5BN5A 1Y1TA 1QIHA 3DCJA 1E79D 4L78A 4DLZA 1MZVA 4IV8A 3ZVMA 1OAKA 3UA4A 3AYXB 1FFGA 1QF7A 1T5DX 3R0ZA 4GVPA 1U2GC 1ELOA 3U7EB 2BEUA 3Q98A 5D6NA 5BMOA 2YS6A 1S2MA 3GZTB 4FEAA 3SY8A 3ZCVA 4EI9A 2R7LA 1SVSA 4JLDA 1F7VA 5SICE 3SG0A 4LEIA 3RBZA 3JQ6A 1NURA 4E7PA 3L1IA 5DX1A 1Z4PX 3OF2A 1K68A 1VOTA 3DC7A 2TYSB 3L4SO 2XDQA 1TF7A 2Y1FA 2XUQA 2QAGC 5DU2A 2VHUA 3AZQA 2HSGA 3AFHA 4LKOA 721PA 5IXSA 4IXMA 4QREA 4NDAA 4BGVA 1K7XB 2RIRA 3VPAA 3GYGA 3H86A 1LBQA 4QPZA 2EZ8A 4KQGA 5BQXA 2LWIA 1KTIA 1KPGA 2ORED 3OZAA 821PA 4UUMA 3VR3D 3WOHA 3K9FC 1R0XA 1RLOA 4DR7B 4L9RA 4OSPA 3JZAA 1N4AA 3N2NA 1J39A 3HJTA 3PFGA 2RG7A 4J0IA 1WB5A 1Q1EA 3V34A 2FB9A 3WZLA 4GPAA 2QSYA 1PYGA 1U8TA 4IJUA 1NXVA 4JXZA 3HBJA 5L40A 1EJBA 4R1TA 1OFUA 1CB0A 3JZIA 3OETA 4R1NA 4YRDA 3GWGA 4OLHA 1K06A 3PNMA 4P3XA 2W6QA 4F3NA 1T15A 3PDCA 4E2XA 2BVNA 2OV2A 3AXSA 3MTEA 2WQ7A 1MO3A 3E5RA 4D9BA 2Z08A 1BW9A 1L7BA 3LCMA 1ZJ4A 2G0NA 4H1UA 4PCAA 5D3ZA 2B94A 3H5IA 2A0YA 5CXUA 4N41A 1OWNA 2F62A 5AVTA 2IGBA 2ZI5A 5E6RB 2HDNB 5TQ0A 1ULZA 3WL5A 2QG9A 2PH5A 1TECE 4ESOA 5KOJB 2F2TA 2X9QA 1RVV1 3IR7A 3FVWA 2Q5EA 5DE3A 4D81A 2PGXA 1JXQA 1PDOA 2FDRA 1MX3A 2HSZA 2LDXA 4A0QA 3W5DA 2X23A 4V0KA 1SXHA 2N47A 5K3AA 4EATA 2ZYTX 2B83A 1WMSA 3OJCA 3ZBPA 1BX1A 5IN4A 4E5DA 4Z4HA 1N6LA 3PR3A 2IEZA 1DXYA 1RJFA 3NYIA 1ZGHA 2OY0A 4CEHB 5C5EA 4QKQA 1GTSA 4CEJB 4F5DA 5IFKA 3LCUA 2Y71A 1PKXA 4GWGA 4RKWA 2OV3A 2ICAA 4XJSA 2CZCA 4N01A 2C7RA 1EG2A 2HCFA 4NBSA 5LMUB 2PSFA 3E22A 1JFRA 3OKAA 3U4IA 2A5JA 1H2BA 3DOIA 1XVVA 4NMMA 3TBFA 1DCMA 1VRCA 2J6CA 5FOSA 3R5KA 4ARZA 2J4FA 3G13A 3W6UA 1ZD5A 2HF9A 4JJGA 1W94A 4DHEA 1E5QA 2HA7A 3BHMA 3DKKA 4OBBA 5C18A 1V2HE 1QHHA 2ZIXB 1CKEA 3IODA 4I5GA 4P4LA 4LG1A 2EL9A 3CKMA 1H0HA 1T0IA 1JHQA 2IODA 1YBFA 5JQWA 4OF4A 3ZHUA 3DDSA 2HB6A 4WIAA 5AQEA 4I3HA 4PU0A 2YOHA 1CQJA 5E6UA 1OTXA 4E14A 1VCOA 5JAZA 3RVOA 4IOLA 4RVGA 1BVUA 4TKVA 1XMSA 1VHWA 2EFCB 4MW7A 1XTIA 4P36A 5AHKA 4WINA 1PU2A 3ZDAA 1MGPA 1Q1QA 2PH3A 3H83A 4L27A 5CG2A 4EPVA 1Z63A 3K1TA 5HFJA 2KLBA 3D8RA 4O8ZA 3SFVA 3U40A 3VISA 1CR0A 1ODCA 2WU0A 3OTHA 2EV9A 4F5ZA 2CDBA 4R31A 3VPFA 5HUHA 5ENZA 1NATA 1AKYA 4PE5B 4ZQHA 2WG1A 2AZ4A 2D7JA 3ZEIA 5KJFA 2O59A 2YUIA 3WV4A 1U28C 4HADA 4F2HA 1WXXA 4N12A 1QIKA 1FNCA 3COYA 3W2EA 2DPXA 1HT1E 4UC0A 4W5RA 4OD0A 4K1XA 3W6NA 1Z4QA 3BUSA 3IVGA 1OH6A 4XPZA 1YWGO 1U11A 4XYLA 4YUXA 3RV4A 3NGMA 1A9PA 1PKEA 2D2VA 4YRTA 3IULA 3ROZA 2VDMB 2Y1WA 4W6QA 3RFVA 5K20A 4QT0A 1M2KA 5EIWA 3TE7A 2PUBA 2PL5A 2I66A 1OREA 3PE3A 1T9KA 1G3QA 2PV0A 3B5EA 2W71A 3GAZA 4CI9A 2OXIA 1AUPA 2GJ4A 2VHQA 1Y9EA 3LIIA 4B32A 1NN1A 2VXOA 1XO1A 2A9RA 4G89A 3TIFA 1P4HA 3OZXA 3C14C 2ZRQA 4WOJA 5LZ9A 4TTPA 4L5AA 3BREA 2Q9CA 5GAJA 3F4KA 1DQYA 4LFAB 4YUYA 2FZLA 4HGRA 2FN8A 1MO2A 1W5FA 3R6WA 1IY9A 3IOYA 5FAXA 2PMBA 2TECE 1L4EA 4LC9A 2C3UA 4XM2A 3G0BA 2WUWE 5ICFA 4DY6A 4HLCA 4XB1A 3MBKA 2NAPA 1BQ3A 3RAFC 2QE7A 1PV2A 3G0OA 3OPYB 3M5DA 3T1VA 4D0GA 3BH6A 2KYRA 5J5VA 1R4AA 3QPCA 4HFRA 1Z8HA 5CT4A 1EEHA 2ZSUA 2NU8A 3TQFA 5I7RA 4FWBA 3HP1A 2QTZA 3D7NA 3N2GA 1I1OA 1R4MA 5CB4F 1UJ4A 3GG9A 3GIDA 2BRUA 1WTCA 4LVOA 1Z9BA 4YAFA 3QX3A 1ZQ1A 4R1OA 5G0TA 4BFZA 4AMYA 5AW4A 4GF5A 1JNYA 1Z5PA 3JYNA 5DLPA 2PLWA 3NAQA 4HX2A 4WN3A 5B58T 4BO3A 4CMJA 2ETVA 3UT5A 1JDVA 2ZRJA 3CPSA 3DBIA 2GBGA 2ZUWA 2QZPA 4IFIA 3CISA 3ZW7A 4C87A 2BI4A 3JQBC 4WACA 4UEQA 3PUVA 5E9WA 2C5HA 2ZI7A 4XWOA 4NATA 2PCLA 4ZRMA 3G2LA 2RBEA 2MR6A 3A0UA 2F17A 4CDMA 4HN9A 1M2NA 1CZLA 2OZLB 3LBIA 2OCAA 2AQKA 4EGCB 2ZDQA 2IPOA 3LBYA 1NMSA 3LM8A 3HN7A 4C7KA 4L51A 5SYNA 2FMXA 5JYBA 2VP6A 1MV5A 2IH4A 4OHMA 3G68A 3G0GA 1D6SA 3OKFA 4LQLA 1PR0A 4WZAA 3QELA 4O5OA 3VSBA 3PJRA 2PKRA 1DLIA 1I3OA 4BB0A 4EW6A 2AOUB 2BTQB 3PQCA 1NVKA 5J4YA 2HL6A 2XZLA 3PNKA 4NZPA 2X0FA 2HBZA 1AQJA 4EEXA 5DTEA 2ZWAA 1NR1A 1AA6A 1WP4A 4TLLB 3G85A 5D7BA 1M34A 1QK4A 3EVNA 5GGYA 1X15A 2H9YA 2GM9A 1VJDA 2BAGA 1LX7A 2NADA 3REGA 3QBEA 1ODKA 4PRLA 2JC3A 4AQDA 2X3UA 1NPTO 3THXA 2NXJA 5AXDA 2NO4A 1M73E 3QWHA 3QA3E 5AI5A 4R9SA 1O1YA 1GYRA 3AG5A 4B75A 3R3HA 5I9TA 1ZSVA 4BMYA 3W3AH 1SHZA 1XK7A 3D8UA 2Z95A 1KJZA 2HXSA 4PPQA 3BF7A 4DQUA 3PSAA 1ZN9A 3CCCA 4CV1A 1R8JA 1G5HA 1CS0B 1GGFA 1T1JA 1CE8B 3RHZA 3NWEA 4M83A 4E0BA 1K86A 1X8XA 3KZNA 2ZYIA 3HADA 5K99A 1ZUNA 2ADOA 2OPBA 3A6KA 1UK8A 5A04A 3T7SA 1ENOA 3GH1A 1X2BA 2FTKE 1HYHA 1O5OA 3P2KA 1V16A 3QTLA 3HBAA 4C7MA 1KK1A 3HDJA 4GSYA 4Z7QB 3V1MA 3ZGLA 4UE2A 2WD7B 3KRTA 2OD7A 4D25A 1ORTA 4HWTA 4XIGS 2ZULA 5G0SA 1FDWA 3C85A 5A7FA 1DV2A 1EIWA 1MH9A 3SYMA 2BH9A 2ZIUB 5KYYB 1LF0A 2KE5A 3ZHQA 1VZ2A 2OBYA 4JQYA 4U2CA 2XB4A 3W2IA 2BJWA 2OBBA 4L95C 1GUYA 5DULA 5CT8A 1MTZA 2FMFA 4ETNA 5AM0A 4DLWA 3V8RA 5I3ZA 2MSNA 2XNDA 4W63A 2AG5A 5JQGF 3HJBA 3LF2A 2VRBA 2DHDA 3DAYA 2YZ7A 3QJYA 2FEPA 1KVRA 2OQIA 3EY9A 3EXHC 4HNGA 1GL9B 3CNLA 3EC2A 5I4KA 1TUEA 5LU8A 4R2KA 4RACA 2DQ4A 1E9VA 4FQ8A 3EPHA 4N8EA 3QXXA 2P8SA 3JD2A 1XZFA 2REQB 3RU7A 2D2EA 3ZK8A 1BHSA 1FLVA 1ZAKA 1P0FA 2WSSD 3MSXA 2G9RA 2BGNA 1W0CA 4PG8A 1OYYA 2WJIA 5JBNA 4KE9A 1N8SA 5IJZA 2G7ZA 2YWDA 3IMEA 4HR7A 4C6HA 2D13A 4QASA 4LDQA 1OR8A 3ACDA 4C0LA 4YGXB 1JAHA 3CRVA 1L0BA 2RHBA 3ORQA 3WIBA 4JIGA 5EXDA 221PA 1AQIA 4MTLA 1PO7A 3AO0B 3H3JA 2O8CA 5BOSA 5U4QA 1DZ3A 2H1RA 3TR5A 2ZEJA 2X2PA 2J5BA 1EINA 3C8HA 3L01A 2IEGA 3P9RA 4BL5A 2XBMA 2CD9A 5DHFA 2FPPA 2O2IA 3DWFA 1T3SA 4FGLA 1VL2A 1LDBA 5DWVA 4HY3A 3LBFA 3K9LA 3QEJA 3HCAA 3N8DA 4HB3A 4G37A 1V5WA 1LRLA 5KDLA 2WNSA 2HPZA 5B3KA 1C4XA 2IUYA 4IH4A 1I4WA 5J23A 3K71B 3TW8B 1W5EA 4CIXA 4BX2A 3O4IA 2AJ8A 5EWLA 2J7KA 2WDPA 4BQIA 1QXSA 1SQFA 4S35A 4TMFA 3TJMA 1WMAA 2F7SA 3L6UA 4ECAA 3ABQB 2AJLI 2G71A 3DDZX 1XJCA 3KQSA 3DLIA 1EGVB 3PE4A 3PHCA 1RZ3A 1DO0A 1OZFA 4M8SA 4I3FA 1Y6FA 2J9GA 1JZQA 2VH1A 3CB4A 4RHCA 3FJOA 3E35A 3H2GA 4PCUA 1SU4A 2V3WA 2ZSDA 1L8AA 1OLOA 2DUUA 5BW4A 2A94A 3KEFA 1NVVQ 4XR4A 1N75A 2XVZA 4OA5A 4H3VA 1ZKMA 3P2MA 3C1UA 3IOCA 3GGCA 1FW8A 1ICIA 4ZANA 4JLSA 5AKJA 4HVTA 1AF7A 3OBIA 4G0MA 4NFYA 2B21A 1NRJB 1I6KA 4X20A 5L4NA 2JAOA 3MJHA 2P75A 4CIVA 4DWOA 2OZVA 3LUJA 1U2EA 1E9CA 2CEAA 4JP1A 1SCAA 1ONNA 3R7WA 2DHQA 5HQ3A 4HQNA 4J0GA 3RSGA 4B6RA 5C8ZA 1KJYA 4NYJQ 3BCSA 1C9JA 1YVDA 2GJAA 4ILEA 3ZHYA 1E2NA 3HL4A 3IXMA 3CUKA 1O8CA 1N0IA 3H97A 2MINA 1BDIA 5ALPA 4FYVA 4OGFA 4FFSA 2XE8A 4REOA 5EXEA 3ONVA 3ONEA 2X22A 1QRTA 3CE6A 3SR4A 2ANCA 4ETWA 5FWYA 5G2OA 2DC1A 4PG5A 2MYTA 3CR8A 2VJBA 3STUA 2WJ6A 1ZIOA 4ZVRA 5CDYA 1WSDA 4N49A 2QR3A 4ND8B 2PRJA 1VB3A 2W9XA 1JG7A 1G8FA 3QNUA 4WZZA 4GPEA 2FJPA 3KFXA 1VDZA 4TS9A 1GXSB 1YFJA 2NVBA 2FK7A 2ZS7A 1Z6XA 1L7AA 3ICWA 3UMGA 2FY8A 2LZ0A 3EZ2A 3QG1A 3KQNA 1UODA 1CVIA 4MJXA 1XU7A 1JU9A 4QYXA 1G8JA 2QZ9A 1QGZA 4NBVA 3R77A 4NBNA 1TKRA 1WBJB 2QVYX 3BAFA 2EERA 3I2FA 4L8VA 4XD7A 5CR9A 2BFBA 5E9AA 3QNWA 3D5EA 4QGFA 2BFCA 5C1OA 3BXFA 3AR2A 1PZNA 1SK8A 3A9WA 4PGGA 3DAPA 4GI1A 2V6JA 1ULUA 3E1GA 4AG3A 1NBME 1A8QA 2XOKA 3ABIA 2XVXA 3LUDA 1JWBB 1SBHA 4HNAB 1PUJA 3OJEA 1PSDA 1NVAA 3OZSA 4KO4S 4OMUA 3CJQA 1ZRMA 1N1EA 4ZQBA 2WW8A 2CCJA 1C8VB 2CY0A 3ADCA 1Y3HA 3PIDA 2I87A 4IW3B 4X1YB 1G7RA 2ZGVA 3NFYA 4Z3KA 1SB9A 1U5AA 4GWLA 3ZHCA 1CG6A 1O6ZA 4D8WA 3BSYA 1XHEA 1L4HA 3WLTA 5KQSA 2H7XA 4EY4A 2UZ1A 4O4LA 1KYYA 3FPAA 5K8VA 3BXPA 3OE7A 1N4DA 2HCTA 2XCLA 3FNGA 1LW7A 1FSGA 3H75A 1P91A 2WB2A 1U65A 3R7SA 5CB4A 2VPPA 3NM5A 1C0EA 4AI6A 4C3VA 1Z5UA 5ITZB 2NP7A 3OE5A 4DM7A 3JSXA 3VZPA 1OZHA 1EFRA 1JV2B 1YONA 3D0QA 3LJKA 1HDRA 3T3DA 3OZGA 3FWHA 4GX0A 1EFKA 3EEIA 3PGXA 3WIDA 4AN4A 1D0IA 2O4UX 4BNKA 4GECA 4AX4A 2CZQA 4M88A 4G65A 1PK9A 4FMDF 3GFVA 3VTZA 3A31A 3AI2A 4P3YA 3V1NA 3OPVA 5BYBA 1V4VA 1RPJA 5FWDA 2YWEA 4PYQA 4NULA 2DM6A 3BMXA 4JWKA 1T0BA 3A37A 3S2ZA 5J2TB 3UV3A 3OC0A 3LKZA 1K0FA 4O4JB 4MRVA 1CJTC 1UINA 3FFXA 4CPDA 1Z0DA 1EM8A 3BBLA 2GDZA 3V48A 4KHPB 1J2EA 2GWHA 4OH7A 4JC5A 4QQ8A 4FDLA 3LW8A 3C4VA 4YA6A 1LB1B 2LBPA 4YP9A 2RGWA 4A9AA 1R2QA 1YJ8A 1YT5A 2VRCA 4A0RA 1U9JA 2W2KB 2I33A 3EZXA 3HHPA 2WNIA 1PX2A 4WFJA 2NPFA 3UW3A 3JQGB 3W5UA 1W88A 1OXTA 4KKVA 3L1JA 4D9IA 1GU7A 1UWKA 1DFGA 4ESHA 1WPXA 4MEBA 1R0WA 3BFJA 4IY1A 3UJ3X 5ALFA 1LI4A 1E1KA 3CLRD 3U4HA 4DSTA 4DMGA 4ER7A 4D02A 2ZBGA 5FIUA 4Q39A 4F3YA 1P77A 1U7PA 1Z73A 3P0EA 5F5NA 3X1YA 3K0CA 7ADHA 5LKAA 3KQHA 3FI9A 3QKWA 4YJ3F 5LP6B 1RE1A 5J3JA 5BMVF 3Q41A 5HA5A 3PNVA 1YDEA 1N2OA 5GVSA 5HHTA 3I8OA 3HDQA 2COKA 3OO1A 3RS5A 4UUPA 4GE3A 4YLYA 1Z06A 4TQGA 4F86A 1KL7A 1D04A 1QANA 4GGOA 3AHCA 1BJKA 1EAMA 4OP1A 5EI5A 4ZV9A 2CJYA 1TEVA 3C5EA 3JVVA 5HUQA 4B09A 1G0NA 4XSVA 4X63A 4OHPA 5BSEA 5DSZA 3H11A 3RRBA 1QHIA 1QS0A 2VBCA 4BCDA 1W34A 4YMTA 1L4FA 1RVDA 3C70A 3A7DA 1OU0A 5ERYA 3CRW1 1NY6A 4DMHA 3FD8A 4XM1A 5KJEA 2ZCVA 4L8WB 3W78A 3RE1A 2C84A 3HZZA 3C1TA 3LNCA 5HBGA 3SSAA 3FDIA 3WISA 4ZV4A 1M74A 1WXWA 1ACLA 1II0A 1MNAA 3EVZA 3A3KA 4HNSA 4NC9A 4TYPA 9LDBA 4RTMA 1MW8X 2VDKB 1J21A 2BT4A 3A58B 3DE1X 3G5TA 3K8ZA 3R0IA 2QZSA 4BWVA 3SEQA 1MU0A 2FWNA 4Y2VA 3KXLA 4V0MA 3JR7A 1DRJA 2XUDA 3WJ2A 2CLLB 4ZVMA 2WMDA 2P4HX 2P2NA 4G0QA 1HLPA 3IILA 5B1DA 5ADUS 5FQOA 3A2LA 1LK5A 2WJZB 1QG4A 1KKUA 1COZA 3BMNA 5EJGA 5KAPA 3W5HA 2HQ1A 4L8FA 2RHTA 1BW9B 2X1HA 4G1UC 2KWIA 4YQZA 1ZM4A 3VMMA 3BJIC 1L1FA 1A2OA 1WCV1 2ZIGA 1JG2A 5JUWA 2F67A 1DI0A 1LSOA 2HWWA 2J0EA 3SM9A 3UHAA 2QTMA 2DPLA 2IHKA 5D7NA 4ES6A 4X93A 4HJRA 3O4JA 1GSOA 2OORC 4P4GA 5AI6A 4BQSA 3KKZA 2X58A 5FBVB 2ODBA 2MMCA 4EEZA 4HLUC 1V9LA 3QU5A 4HCJA 3OFND 2Q6IA 2MYNA 2NSYA 2YN0A 1IN7A 3BJZA 1OJLA 2M1ZA 4M1YA 2QSJA 4IHAA 1VLHA 1P9OA 3IUMA 3LXXA 5AYVA 4DUZB 4HDNB 2FR0A 3S2FA 1KH1A 3WKAA 1P2BA 3AHDA 2VHWA 4YRAA 4BO6A 4WKBA 4PF1A 3CX6A 3FTFA 4IJ6A 3G2NA 2EG9A 4KMRA 4QPJC 4LV8B 3UFBA 3C7TA 1RABA 3AF1A 4RA6B 5ALUA 1Z7EA 2VJMA 5EY5B 4ARZB 1E79A 1KU6A 1HZZA 3ICVA 4MV9A 3AJRA 3TIGA 3THWA 2OBLA 4P81A 3UWSA 1JJIA 3B2QA 4H7IA 4UHBA 3ID6C 5CX4A 4JI4B 4TMYA 3LOQA 3ENKA 3NORA 3BXGA 3N0WA 4MVJF 3VOAA 1GPUA 1T5OA 3AR3A 4GU5A 1QU3A 2HA4A 1IDOA 3OI7A 2H57A 1BE1A 3K6KA 3QEMB 3MK31 4RNCA 5GV7A 4BLUA 3ZBUA 1SOAA 4KV7A 2PCJA 4PS0A 3UPUA 4B7CA 1T6BY 3PQ4A 3BMQB 2A0WA 1TCCA 2XUJA 4ZCQA 1QE0A 3DHEA 3BD7A 4IOMA 1QF9A 1BZYA 2XMQA 1V47A 3GDOA 2C88A 3L1KA 4B46A 3PS9A 2GKSA 2ZVDA 2H29A 2YMQA 2COEA 3IDZA 3PDIA 1J22A 5IJWA 2M32A 4K3VA 4YMUA 1F6WA 1U1EA 4TLAA 4WY5A 3U39A 4H2DA 3GEPA 2Y1DA 4Q9AA 1GTG1 4LISA 4OH1A 3TM5A 2X0EA 1RWWA 1YRHA 4F2WA 5AW0A 1T1SA 3MTAA 2Q4OA 3B6ZA 1LV7A 5C3UA 1E9RA 3JALB 1PJSA 4ZQCB 2XYPA 4EFLA 4MPRA 1UIRA 3A1TA 4PZDA 1A71A 4O8CA 5I5GA 3ZJ5A 5JDIA 5CVEA 3OCWA 2H5EA 5ALLA 4QSHA 4Z9AA 4EYSA 4WW0A 2PBFA 3VOTA 3N5KA 1KNQA 3KPUA 4DR1B 1OBOA 3VNAA 1A7UA 3MCZA 3UICA 4GM1A 3D02A 3WVNA 1IY1A 4Y1RA 3O3OB 1DAGA 1YIDA 1G98A 3UJAA 3T1QA 4E94A 2P90A 2IXFA 1ECFA 2YN2A 4GI3A 1SUEA 1T5IA 4C01A 3QKSA 4D3DA 3I9LA 5GJCA 2Q8QA 4MKXA 1G8SA 2P9FA 3OQBA 4URHA 1GVNB 1W7AA 4BS9A 1CFJA 3P20A 2RFLA 4HAUA 2AK3A 4LNHA 4DQ0A 1DX4A 4IH9A 3W5BA 2P30A 1SZDA 3EXG2 3TIXB 4EAAA 3GFFA 4KWCA 3GVIA 4JLNA 3H5VA 5D01A 5J47A 1EX9A 3GVXA 4G8BA 4YTEA 1EBBA 2I7TA 3K9BA 5I7FA 1MC1A 4NHOA 2WBLC 2YNMC 4ZDJA 2HIAA 3GFGA 4C4PA 2GPYA 5F21A 5HS6A 4ALJA 4YT4A 3BHJA 3SYLA 4LPKA 3MLAA 1X1QA 3NHFA 3NHYA 2DKOA 3NNDA 2ANBA 3HYSA 4WQMA 2FPWA 2JS7A 1YDWA 3RSOA 3HDGA 3IKMB 3UT5B 3GJQA 4UE6A 2B78A 1PR5A 5ARBA 3EW7A 3RIEA 4NEHB 4ETIA 4MX8A 4RZQA 3C24A 1Z35A 2JFBA 1VP9A 4CRWB 2CBXA 1RJEA 2ZITA 3U7QB 4MQEB 3UOGA 5MN5A 3IBGA 4ZC8A 4L1KA 4XE5A 2D1FA 3U3MA 1FX0A 4BC0A 2ZIVB 1SXJA 4ANFA 1HEUA 1RPZA 2VHEA 1QH9A 2BSQA 3JZMA 3MMPA 5EFOA 5GQSA 3KJIA 4A1FA 3WGIA 1KS9A 1XVLA 2I4LA 2IYVA 4H4CA 4Q66C 4WKNA 5TXGA 3RVKA 3UIEA 5BUZA 2FW0A 2JI7A 4Q82A 1QE3A 4YCSA 1MAHA 2PUFA 5TX7A 1O9GA 2DWPA 4Y0NA 3AGPA 1M8JA 3PTAA 1SKYE 3OCJA 5HYVA 3UMCA 1KGDA 5MN4A 2I1LA 2J9RA 1A7AA 1R9GA 3NV9A 1XZLA 2YXNA 4H4EA 2WKSA 4TVBA 4AKIA 1WBDA 4KHZA 2CYCA 1OU4A 3M81A 5GOTA 3EIXA 1NPYA 1VPVA 2XE6A 1M1YA 1VXOA 2Q3LA 1JQ3A 3ET4A 3LQ2A 1OSNA 1AKTA 3O74A 2L2QA 1E8NA 1QWOA 4K9QA 4QL3A 1B16A 3MB5A 5I9MA 4BPRA 4F04A 5LLDA 4DJJA 1U9ZA 5BNTA 1J7KA 3FOZA 5GM1A 4DPMA 2Q3BA 3FGPA 4NABA 3MG9A 4N3GA 1PZXA 1ZIXA 3I5MA 4TXNA 1JHPA 1U0HC 2JD2A 4MARA 5COAA 5IX8A 2D6FA 1X8KA 3HN2A 1RHRA 4CFYA 1BFUA 1ZUNB 2QTAA 4UVGA 1DOAA 1N5DA 1PTJC 3DE2X 1NW7A 4GT1A 2YVQA 4MR9B 5EKDA 1NG9A 2LIPA 2P91A 4XCXA 5I48A 3G8CA 3SC6A 4PZLA 1JKIA 1QX3A 2G28A 2HHLA 4J0JA 2Z2KA 4DLLA 5KC9A 1V5IA 2NU7B 1DEXA 2GCOA 2IXAA 3F5QA 4PFKA 2P3OA 4YJ3A 4PM4A 4CZ2A 5CXQA 5IULC 3M82A 1IPHA 1J0CA 4RSRA 4DCGA 5BMVA 2P9YA 2XUZA 4F4HA 3USES 4CLOA 4CN9A 1SPXA 3THRA 4MVJI 2P9GA 1E3IA 2QR5A 1HR0B 1O5TA 2Q29A 1TW3A 3A3YA 3FSGD 1X7YB 4QDOA 2F48A 1FP2A 4DILA 3I05A 1G5PA 2NYUA 4BTVA 3V4OA 4OJTA 4UEWA 4F4IA 3E9MA 4X7BA 2BE9A 4X90A 5I47A 2RGNC 3N2EA 4Y7DA 1F1BA 3NUQA 1IHOA 3ADDA 3IEXA 2FN3A 2PWYA 4BP9A 1LQUA 4JAVC 2IYTA 3WLOA 5BV8A 4PLWA 5SYAA 5H81A 3N70A 1YHNA 3BPSA 2WHRA 5FBZA 2XCQA 3RAPR 4EF6A 3AZOA 4GOMD 4DAEA 5AVSA 5KCZA 4MRMB 4RCZA 4UAJA 5HF9A 2GDJA 3CT4A 2QXUA 3FYTA 3GUHA 3MJDA 4CMHA 5B7PA 1P1RA 1PWEA 5G3YA 3TINA 5FWNA 3KS9A 3BORA 1WW2A 5JANA 2J5QA 4B17A 1H6AA 4YJDA 1R18A 3BZBA 1HTWA 1RQLA 3B53X 2QQGA 3KKPA 4ALNA 1TLLA 5A4JA 1G4UR 5ULLA 2FPPB 2PSEA 5H82A 4BKOA 2Q3JA 4WCFC 4AJLA 4BO9A 1SUWA 4J6EA 2BP7A 2O2JA 4FMCB 2ZJ3A 1F9EA 2ZT7A 3VR5H 5SY6A 1I2ZA 2TRSB 1X1AA 2X5NA 1WD5A 4L08A 1H69A 2VHXA 4DA0A 1TYAE 1G8KA 1UAAA 4JB0A 5I4CA 4IYRA 3E15A 4ZTBA 3UMRA 3DLHA 2WWTA 4BXOB 3M6UA 2P1ZA 2PL3A 2AFIB 5AM4A 5ITSA 4MB0A 5G4KA 4G5HA 2FPGA 3UHJA 3OA0A 1YRQA 3EQ6A 2JK1A 4R9VA 2IV2X 3V4LA 1AQYA 2VQ3A 1PR9A 3G82C 1Q7EA 5BQOA 3NMUF 5FLXA 2JIZA 4PSAA 3FPSA 4MYUA 4H27A 2PUGA 1ZIYA 1IHXA 3G23A 2I29A 2ZCUA 4WNIA 1QZTA 4N8DA 4RORA 3DXFA 4MYDA 4OSEA 5BV0A 5I5EA 1Y3CE 2W6NA 3IPAA 1IZYA 3KAJA 4XA8A 3Q0EA 2ECKA 4ZQGA 3MWFA 4EO4A 1RADA 4QPDA 5CIWA 3V8PA 3EG5A 3Q8MA 1A2BA 4NYIQ 3RUHA 1ZGGA 1EB8A 1B14A 1WS6A 2IP4A 4I66A 5AOVA 1G9SA 2I2DA 3DCNA 3H9EO 3VKFA 4BFUA 4E07A 1IDN1 3DDWA 4JLMA 1SHTX 3IMKA 2GAIA 3OQOA 3FSRA 1SBIA 1W35A 5A02A 3UJ8A 2GLUA 1XNQB 3QJGA 1LKZA 4DG5A 1MVNA 2P5TB 5HQ3B 4WRRA 4AFNA 4MVJA 4Q9NA 4M0UA 2CLEB 2HU2A 2B3TA 3VYUB 5JZMA 4IHQA 3EVGA 3GGGA 1ODTC 4PGFA 1UMBA 3GCXA 2IYPA 2MINB 4MHOA 3ZBTA 1M66A 4BAZA 5A4FS 2IPXA 4JXKA 2C20A 1IVNA 5JYDA 2IVFA 4PR3A 4R40A 1PT9A 2G1UA 1GPMA 7GPBA 3JQ8A 5EEHA 4HDRB 2VTEA 5K5EA 1MG0A 3IRVA 5I45A 2D00A 2PKQO 4KTVE 4LTNA 4R7ZA 5FI3A 2CXTA 1BCRA 5AW2A 1VLZA 1SQ6A 3TQSA 1EVKA 1BN6A 2X1VA 4ZA2A 3W8EA 1YMUA 3ZXIA 3ZD9A 4IZIA 2CCGA 3J7TA 1PSWA 4J07A 2Q4TA 4J16A 4MV8A 1KDVA 5KKAA 3TSZA 3FYSA 4AUEA 1H1DA 4R54A 2O5EA 2WSSA 2CKDA 2VL7A 4AMUA 1GZSA 2ID9A 3ZW9A 2QMHA 4KPGA 2OV6A 4KUHA 5AI0A 3RSLA 3T7IA 2CL7X 3PNQA 4S1TA 3VDMA 4AWAA 4CLRA 2BE7A 2FWPA 3RVPA 1GNPA 1A8PA 4P98A 1PL6A 2D06A 2EGGA 2NYAA 4A23A 4RMIA 4TL7A 4ZMSA 2I8AA 4KI0A 1H2HA 1CUWA 4R2HA 1VE9A 4HLNA 2ETXA 3V32A 4JI0B 2F1KA 4W9MC 5JMPA 2X0NA 4HQ0A 2O6HA 2QD2A 1GG8A 4LVUA 3TEFA 4BV2A 1DBVO 3K5HA 3KU1A 1YA6A 4HRYA 1EQ2A 1QIMA 2DYKA 2IBMA 4FYPA 4HYEA 3T0FA 3MIZA 3M1AA 1M1ZA 2XUIA 3MJEA 4BKQA 1J4AA 2Y0PA 1U0RA 1SD5A 1OMOA 1P2DA 3COVA 3JARA 3MRXA 4OKIA 4EHJA 1RAIA 4WZAB 3COJA 1V3UA 3HCFA 1ZKDA 3ZV4A 4ZC1A 3BRSA 1S9DA 5HTKA 2UZ1B 1LPBB 3ABOB 3ORYA 4NCNA 4QDJA 3MGCA 3NYQA 2GBLC 2QRLA 1UAYA 4LW8A 4EENA 3LF1A 1JL3A 4DDTA 3T9AA 1D6MA 1CR6A 1U3TA 2Q5IA 1X3LA 3Q1LA 1D1SA 4DSOA 2YFKA 1PQUA 2DCMA 3LUKA 1P0MA 2XECA 1REQA 1DJQA 4KK3A 2AD1A 2GRJA 5G0VA 1UOPA 1BEZA 4IKEA 4Q93A 3FE2A 1GTVA 1E0AA 3D6MA 3PNSA 3IDFA 3O82A 4O3MA 3H4TA 1MJ5A 2VF4X 4K7JA 3O8CA 5JNRA 3IBCA 3KB2A 1DRUA 3P0RA 3FNRA 3I58A 1YZ3A 5F35A 2FJUA 3ZCTA 3EPLA 1JDBB 1P7ZA 2H1WA 4TSRA 2R66A 4IGFA 1YS2X 1XDSA 1LUAA 4UDYX 4D97A 5MFPA 4GZ5A 4MDEA 1II9A 1K6EA 1O3YA 1RBMA 1YUMA 1UBOS 3FLEA 3GT4A 2PXXA 3IAHA 4OQQA 5ARCA 3R7AA 2Q4EA 1W75A 1Q21A 4PS1A 4QTXA 5KWVA 4EY5A 2R7MA 2PLNA 2J4CA 1NVEA 3K72B 4NYMQ 3BL8A 2JZNA 2PQMA 5BV2P 2ZJ8A 4QHSA 4MVJG 4DG9A 2HJWA 2DPMA 2ZRIA 3SYNA 5JS1A 2QUJA 1CX9B 2QVXX 4TTIA 4YFVA 2VBIA 5DMHA 1RMTA 3EPPA 3EQ9A 4HH3C 4KH0A 4TSFD 3BWYA 3ZCRA 5H8WA 3E9QA 5KQGA 2YV4A 3SXJA 2V7PA 5H3CA 1GRNA 4Y2XA 4KWTA 4NL4H 3RYIA 1Y0BA 5HNKA 2G88A 3PXCX 2WTEA 2ATIA 5KQMA 4YNBA 4H59A 1BQ4A 5CCEA 3TSOA 5IH7A 4LZPA 3RHTA 5THXA 2D0IA 2B30A 2XUFA 3L06A 5AVQA 3BICA 3NBAA 4EABA 1ZX1A 2EF0A 4P54A 1K8QA 1XIVA 4HDMA 2DEUA 1T4MA 1CB7A 4AWXA 3HCWA 3OFVA 4ND4A 1HX7A 4XRRA 4CKWA 2Y1CA 3QOYA 4U2GA 2NW6A 3TZCA 2R87A 2X3YA 3EN0A 4FSHA 2AK2A 2ZSEA 4O02B 3UN1A 3DBRB 4MPTA 1RKVA 1ENPA 4MRPA 1NW4A 1WAMA 1XU4A 4K9RA 1XHFA 1RYMA 2EFHB 4A6EA 2EEPA 2QEQA 5KHAA 3DAFA 3NIWA 1N2HA 4QLAA 4DCNA 2JEOA 3EX7C 1UZMA 1ZJ5A 1AKRA 1XCGB 5KU1A 2OL4A 4UUQA 1AMOA 1QS0B 1CZKA 1TIBA 2FDXA 3LVQE 4FBGA 3EG9B 2UZ3A 3P52A 3R4VA 3TG8A 1GGKA 3RH0A 4JA2A 1QB7A 3QXHA 2VZ9A 3P9SA 3CVJA 3NTOA 3N8IA 1VG8A 5EHXA 1AUQA 1CJVC 1SQSA 1SUDA 5JQGB 4N0DA 2PBLA 4Q1BA 3EUAA 2JCYA 1J42A 1DG3A 3LUBA 3ZGZA 4G9BA 3ZNQA 1VYVA 2C78A 2HZBA 1G18A 2QW8A 2XX3A 3D7MA 3E8MA 3FGOA 3OF3A 4HL6A 4H3SA 4ZVQA 1VKOA 4QU8A 3OZFA 1DEAA 2HX1A 4DABA 5CDUA 4KYVA 4F9EA 4D4LA 2YXBA 1CBUA 2QHXA 2WJVA 3T7AA 4BRSA 3MJRA 3QBJA 4C04A 3KLOA 4MQFB 4YJFB 4W5OA 1XNGA 3FB1A 4CEHA 5FNVA 5KNBD 1EGAA 1Z16A 4YCNA 1YJXA 2XCOA 2B34A 3L79A 3H16A 3LY5A 2XMZA 4G41A 3T3MB 4MRSA 1D7AA 2GVNA 1SCNE 2Z5GA 4MV0A 3BHNA 5EPEA 3A32A 4B1FA 3AU8A 3ROTA 5D8DA 1K4KA 4LA4A 4RZHA 3UAXA 4AJIA 4NEGA 5CYOA 3NHJA 5K0JA 1YVPA 1Y4ZA 3DMTC 5CW2A 2ZAMA 1E6WA 3MCTA 4K8OA 1FMFA 1I3MA 1ZESA 3K70C 3DZ8A 3IDQA 2JH9A 4HTAA 4K9MA 3LL4A 4EHDA 3QF4B 5DEOA 3CLSD 4BAUA 1MAWA 3NPMA 1Q16A 4MIEA 1FMJA 3KUXA 5E2AA 1SUPA 5GWXA 1D7OA 3UFXA 3SJCA 1ML4A 1PWHA 1ORWA 2ZBQA 4MWGA 3T5AA 3L46A 5IABA 4XOIA 4F5YA 3OEWA 1EDBA 4EVRA 1SGWA 4M53A 1A8IA 3O1LA 1BMTA 2PFKA 4DJAA 5KVVA 1O77A 2C8KA 2ZB7A 1RP7A 1R6AA 1G2IA 2XT6A 2PS1A 3KE8A 1RYHA 4HAYA 3TZBA 1PLLA 2GK3A 4UEJA 5HR5A 1X9HA 2X8JA 4CT0A 1L7OA 4E4RA 1SUBA 4RAOA 4WXYB 2JIRA 3DTYA 2P8JA 1E5LA 4MV6A 1OGIA 1PVOA 4YV0A 3N0XA 2X0DA 5IG2A 1ZK4A 3NHZA 4FB4A 1K7YA 5IM5A 3LV8A 2HREA 1L5FA 5FX2A 4HO1X 1U2SA 2YVUA 1T9CA 5FPSA 1L6IA 2BFDB 2AW3A 4HS9A 2BZSA 5IAGA 3CVUA 1B6SA 2JAQA 2WD9A 3KB1A 4QARA 3LD9A 3AI1A 1GUFA 1ECGA 2O1WA 3RG2A 5C8YF 3OT4A 4IDBA 4L73A 3T5BA 1Y3FE 3E3OA 2IVZA 4ID9A 1UXOA 4TMKA 3DMNA 3W77A 4BEJA 1XZIA 4EA6A 1W29A 1CDDA 1HG1A 1X14A 2PAFA 2Q1XA 2Z5LA 2HJSA 4FKMA 4FYYA 3D8HA 1W5AA 3NPAA 3RUDA 4Z4CA 3NJRA 3C1AA 2WY2D 4D8XA 3UMFA 5IF3A 3RVNA 1DFIA 3SBEA 2BKVA 3MZ0A 3PUIA 3REFA 5TRTA 3ZDXB 5HJEA 1ISRA 3PEEA 1KZ6A 4TMZA 1Z3IX 3QYPA 4AJ4A 2G1PA 3E53A 3A1UA 3ZWDA 3I3SR 1RTTA 1NF9A 1SOWA 3CW8X 3MHTA 3PLAE 2N3ZA 4QOFA 3O91A 1D2EA 3P4YA 4WEOA 3DNMA 5LFAA 2GCGA 5H9VA 4M55A 3VHXB 1KMQA 4D8UA 4Y1RB 3RYFA 1XLWA 2VZ0A 2FN9A 2UUAB 5KS2A 2VDWB 3QKSB 3ULKA 4L0CA 1KF0A 3DV2A 4GKAA 3I01A 2QUAA 2QTGA 2YQ4A 3D81A 1ISMA 3PQ5A 4EMBA 4EI2A 4NAVA 4QQRA 3LCVB 2DHEA 3C5CA 4JFRA 3HM9A 4V39A 4K0RA 3BK7A 2PT5A 4FGWA 5KYUA 3SVZA 5A6SA 4H6PA 4JFAA 2VF5X 4JU9A 4Y2QA 3EZ9A 3ROGA 1DGQA 1O9BA 3R3UA 2ZAOA 3E84A 4RKQA 1AO3A 4AD8A 4WXEA 1W2WB 4XIJA 3KSUA 1J49A 2VTBB 4LJRA 1PRYA 3WYFA 2RAPA 3OQNA 1UDRA 1VBKA 2M6RA 2MSCB 1PNTA 1C1YA 1ZZGA 4JC4A 5D51S 4J9VA 3Q4GA 4DCCA 4QBTA 1TUBA 4AJ9A 5ICCA 2Z8XA 3E18A 2O0JA 2AG0A 3KSZO 5JJBA 3RYCA 4F1WA 5BT9A 1VHJA 4MUHA 1GN8A 4X8MA 1I4DD 3CE9A 4IX9A 1ZXBA 3FRIA 2B99A 4P4UA 1VC2A 1WZIA 5CA1F 1RLUA 4N7RA 3FPGA 1YKFA 1DBWA 2QTWB 2YDXA 4DC9A 1A5SB 3GOQA 2MSEB 3KVNA 5JEDA 3INRA 4H0CA 3C74A 1JQDA 3OEED 3DE6X 1DCKA 1FX0B 3EFOB 4GI7A 2EF1A 2RC6A 3AEUA 3R4CA 2QUIA 2XVAA 4MUBA 4NU8X 4YCDA 2BUBA 4NARA 1K2VN 5ETJA 5C7OO 1PSZA 4PYIA 3LT4A 3HSYA 3TN7A 5ENVA 9LDTA 4XEHA 3MPOA 3L7BA 2XXJA 4EG0A 4OKNA 3AB8A 2C2GA 5T4BA 1RXVA 4HK4A 1KO8A 4JWTA 4QEZA 2V8OA 3IKLA 4IH1A 4NCAA 3ITDA 1V71A 8LDHA 2OT3B 2RSLA 2PQ6A 1USWA 4TKUA 2H92A 3L41A 1MIHA 3C7KA 1M2EA 3DDOA 1NFFA 3DMHA 4BE7B 1HQKA 1SWWA 1U9IC 1QFSA 3E9YA 2PX5A 3IIIA 3MSCA 4G1BA 1M1YB 1VCHA 5JS6A 2XYQA 4P9NA 2P0EA 5AI9A 3NHLA 4FKZA 4JODA 4X91A 4GL2A 2L0XA 1T9AA 2AGVA 2EX4A 2HU5A 4YRKA 1ZL2A 1H3FA 1VJ1A 3WKBA 3SQLA 1M6WA 3SU8A 3U7RA 2G0TA 1N2SA 4NZOA 1IJFA 1CF9A 1F6DA 1NF2A 5ERXA 1HV8A 1ZXXA 2B61A 5JWHA 4EI7A 3BDVA 5AK4A 2UYCA 1R12A 1FTQA 1NV8A 1CUBA 1NT2A 1YDFA 1Y5RA 5M7EA 1CJCA 3SEAA 1RZRA 1C3OA 2YJ5A 4RK7A 1ZH2A 4H4DA 1U7ZA 5L3QB 1U0TA 1N33B 4FXPA 1K6MA 3GCZA 1NIPA 3ROXA 5BMVB 1AE1A 1XTRA 1JIIA 1H05A 1PEKE 1QHXA 3A1VA 3EB9A 4GGMX 5ALEA 3JAWA 4BGIA 1SHLA 1P7PA 3RIMA 4F12A 3OZIA 1RKQA 3GU3A 4JYBA 4A8HA 5IC5A 2IX9A 3RTCA 4HI0E 4PRYA 4H77A 3BOSA 2OYRA 3SIRA 3R24A 4GBED 1VSUA 3UOWA 2XQGA 3O84A 5GONB 2VQ6A 1CCWA 1A8HA 4DLYA 1NE2A 4KGDA 5BUQA 3L7JA 3GLTA 4LXYA 3OM0A 2PVCA 5J4LA 2XD9A 3O8NA 1ISFA 1JQEA 1NUHA 3KAKA 2ZSAA 5K7SA 1BXRB 2WQZA 4N82A 4E2YA 4BE4A 3VU8A 2YR0A 2V6MA 4R81A 1IK4A 4WN9B 4M0CA 2OAP1 5CVDA 4R2IA 5HJ2A 5INTA 5CLQA 4ABYA 1QTQA 2XDAA 2ZRMA 1CUCA 1L5SA 1NKTA 3TG2A 3TQHA 3AC0A 1BWSA 3H5OA 1T3GA 2Q1TA 1URPA 2ISQA 4IM7A 1XP5A 4C4OA 1T4BA 4I08A 2JJYA 2AG6A 3NIGB 4MDHA 2NO9A 3WYGA 1JSLA 2NUPB 5ILGA 1F9AA 1O95D 1WUYA 4H1TA 1KI4A 1WD7A 4YRCA 1MEOA 4W82A 3L4BC 4LY6A 1KQ3A 2KMLA 4KQKA 4LE1A 2PSDA 4AF6A 4BB5A 4WNAA 4BGEA 4YCLA 3HY3A 1IOZA 1ZY2A 1EFPA 1PL0A 3DA8A 2CMHA 3PC8C 4UVHA 4L07A 2FPLA 4LGCA 3H8WA 5G4KB 5JNSA 1ZM9A 2FPGB 3V55A 4UTNA 3CEHA 1UQUA 2P79A 4X1KB 2E55A 3K0KA 3ELWA 4DRXA 3BXXA 3K30A 3ZE7A 2HJHA 1GOTA 4BVJA 1Q7CA 4D8VA 1EVQA 4YHHB 5DNDA 2GB4A 1ODLA 1OILA 2RKWA 5C8XA 2JARA 5T3YA 2BEJA 2EJBA 3UF0A 1RQGA 1SCUB 3ANMA 2V7QD 4DA7A 3U1BA 4GQAA 4Q1AA 3T9BA 3PZRA 4ZEMA 2SNIE 2QGZA 3TVYA 5DLEA 2YIJA 2CUKA 3QEAZ 4TZ6A 2HMTA 1XA4A 1THTA 4RDHA 5AK5A 3DE3X 5ESXA 2AN9A 1NUQA 3L4EA 4RPKA 3HMQA 4KSCA 5T6BA 3VNRA 1WO8A 1CSEE 1ZLYA 1I3NA 3BE5A 3HV0A 3FTDA 4FGJA 2J33A 4XWTA 1UM8A 4BVAA 2I6TA 3NS7A 1XMVA 1NV9A 4TT3A 1RHUA 2YV1A 3A25A 3I5XA 1RXSA 1QP4A 3DBHB 2OCGA 3T1OA 1QZUA 2P35A 2A6PA 2QP3A 1X1CA 4MSUA 3NIFB 2XNSA 4UASA 4YRJA 5LB2A 1LI5A 3HCPA 4JGBA 2ST1A 4FE4A 4F97A 2I22A 1R4NA 1J8MF 4AJPA 1Y80A 5KREA 1AQLA 1YJCA 3C4JA 4RKEA 2WWIA 2X5KO 5BXQC 1KQFA 3OZDA 4AL4A 2A0KA 4Q3CA 1NI3A 1UPFA 1J1UA 5CITA 1QYRA 3FSGA 2FSVA 2XWJI 1X80B 1Z2OX 3HDYA 5C8YA 1H2AS 2G4LA 4JLBA 4RF3A 2ZUCA 4L8GA 3OUZA 3TDMA 4BO2A 1K9SA 3AQ4A 2GN6A 2LGJA 4MQUA 3SR3A 5KX5B 4RKFA 1JEQB 4URXR 5EMNA 3PHHA 3URKA 1JG4A 4IIVA 2SKDA 3C2QA 4LZLA 4UBIA 5LYJF 1QR6A 4N3CA 5C4MA 4UHDA 1TM7E 1X0VA 3S99A 3EVEA 1YZKA 2ZJYA 2FZEA 3CF6R 3CRQA 4FONA 4CLRB 1SKUA 2YVLA 3ZHVA 1JR3A 2GK4A 3DGEC 3P9YA 3GARA 2JHAA 4MS1A 1KAGA 4RMGA 3P5SA 3RFCA 1Z6ZA 4AXXA 3QXCA 4MB6A 4LX8A 4CM9D 2LP4Y 1XTTA 3PDWA 5FI0B 1SKMA 4PZUA 1KI7A 5AUPB 2X40A 3DWEX 3GCDA 2JFOA 2LCIA 4MCAA 2QP4A 4D6YA 1HFEL 2GN2A 5CEJA 3JQQA 1PZGA 1NBEA 1UXJA 3D0KA 1A9RA 1E62A 4RETA 4X41A 2ACKA 4F4UA 4ZYYA 3D3EA 1D09A 4WASA 1JFFB 1PJLA 1XAIA 2XRZA 1DC4A 1A95A 1MA0A 3JARB 3LCRA 2R97A 1QP0A 3GCWA 5ARDA 1N7IA 3B6MA 4Z9XA 4IEIA 4PHHA 4UW9A 4V3BA 3VVCA 2VBFA 3RF6A 4IZHA 2QY6A 1GCAA 4KSYA 3I2GA 4N1AA 4WZAE 2CK3D 3K9WA 1DHTA 1XZNA 3AONB 3Q8KA 2QD1A 2RGYA 4XFDA 1XRRA 2CL5A 2QVCA 5K3BA 1WDKA 1QFJA 4Y6QA 3ACBA 1Y3AA 3FKSD 1G66A 2VSNA 1XCJA 2OD9A 5KYNA 3E9NA 4BLSA 5J9FA 3ABSB 2W2LA 4AW9A 4CWAA 1US8A 2XUOA 1MC4A 4FOSA 4OEHA 3AWIA 1N5MA 2R8RA 2C9CA 1NYQA 3K0AB 3KLBA 2OLEA 2XEDA 4NG5A 5DCLA 3UMVA 3EZ6A 5CA1A 3G5UA 1ZQ9A 4CR7A 1LRJA 3AIMA 4O4HF 2WJ3A 1RAAA 1V35A 1Z2DA 1EDEA 2PXCA 2O0HA 3B48A 3BWXA 1Y8ZA 2I2CA 3EWNA 5M29A 1LW6E 2FSUA 3BIJA 1L5GB 3AF6A 2LCQA 3QU7A 5EZ5A 3LDFA 3UJ7A 1BXGA 2ACVA 2ZIZA 4YP6A 3OECA 4RGBA 4WXPA 5CYPA 5BYKA 1GAQA 2B7LA 3KR1A 1XA3A 3S1AA 3WSVA 2HMVA 1T9BA 3F8SA 2IT1A 3N07A 4JYPA 1JQAA 2EYQA 1RQPA 2FRXA 2VPWA 4UU7A 1ZBQA 3V8VA 3V6MA 4AWBA 4UMDA 5C4IA 2GFQA 5DJ5A 5CYGA 1Z17A 4O2AF 1KR5A 1O6BA 4UFOA 1V6SA 1XLVA 4D1YA 2JAXA 1XN1A 1E4VA 1JZTA 3QVXA 3EYWA 3REOA 2X76A 4Z0NA 2WIFA 3PNBA 4G1CA 3M7IA 4L02A 2O2XA 2YZKA 2ZRFA 4D9KA 1PNQA 1VI5A 1DG9A 3L1UA 4C76A 3IDAA 4H7DA 3RBXA 4RAQA 3ROFA 4B74A 3HPQA 5ALXA 4IBOA 2QAGA 2BWJA 1JFSA 5KPJA 1YULA 2C1XA 3LG2A 5E9QA 2FZ4A 5HQJA 2CLCX 1YJ5A 3PFHA 1TAGA 4KACA 1NQOA 4FR0A 1NBAA 4M3NA 1E99A 1GT6A 2QL9A 2ZRAA 2ZSKA 3FPKA 4OG2A 1EGHA 1EWYA 1RNLA 3FW1A 2O8BB 2VZ8A 2HQOA 2I65A 4TKZA 2E18A 1LJLA 4YN3A 3U4AA 5CH5A 3X43A 2OC9A 3HTXA 3QGMA 2HF2A 4NI5A 4J75A 4QC2A 4D80A 2HRDA 4LAFA 3KTAA 1JDTA 2QL5A 2FPSA 2H6EA 1PEDA 3TRJA 1CUXA 1E1QD 5BSUA 1BDMA 2DR3A 1PT6A 1JI3A 3EZYA 3H5LA 5IT9A 4W1SA 10MHA 1DNPA 5FQNA 1V8FA 1Z5OA 2D3WA 2N42A 4PIPA 2M6KA 3Q7EA 2BEWB 1SCDA 4C4SA 1J0EA 3WA6A 4CQLB 2PY6A 1L7QA 4Q9DA 3NVKI 2VATA 4FIDA 3TKAA 4UEKA 3DEKA 4C0AC 3QMWA 1ZGAA 4TQ9A 2ZM6B 4BQNA 4ON9A 2P6NA 5JLJA 4LOAA 4L16A 4J6FA 2R8OA 2K87A 3GXBA 1ZVVA 2ZRLA 1U8EA 3PRHA 1VE7A 4C9BA 5AT1A 1JWAB 2P6PA 1ZOPA 2PUCA 2G63A 3Q5DA 5EP3A 1QZXA 2NU6B 5TY0A 3TKYA 4JVOA 1UFRA 3T5PA 4NCJA 2H9IA 1HLGA 3O2JA 4MI3A 2SKCA 1CUHA 5I8PA 2AG8A 1E2MA 1FXWF 2EATA 2ZJZA 1F2DA 3HXPA 4WL0A 5DM70 1M6VA 3AUTA 2HQSA 3X2FA 3FI0A 1KFKB 5CX1A 2PU5A 3CJRA 1GITA 4WX2B 4DYVA 5K0ZA 1Z34A 4MZDA 3LWDA 5ILQA 3NVDA 3GRZA 5K05A 4N5LA 4CG0A 2H17A 2GA9A 4R2XA 1GZDA 2F00A 3ZIUA 1T91A 3PPWA 4XOUA 1TK2A 3GF4A 1NXWA 1LTQA 2B6HA 2QSZA 4O0MA 1NASA 3OLCX 1PLJA 1T2EA 2A3NA 2I2AA 4DPLA 2DPGA 2OO5C 5JW6A 2H7VA 1Y7HA 2BUAA 2X8JB 3C4QA 2WIAA 3KYCA 1HFKA 2GZSA 5JS8A 1E2UA 1LH0A 1XRQA 5HCUA 2EP8A 1CIJA 1QC5A 2CLDX 3EGIA 4J4HA 3TZEA 2VWQA 4GPBA 3EGXA 4WZBB 2IC5A 1RLTA 1G59A 2OG2A 4LE2A 1JI0A 1CJKC 1L4MA 3GGJA 4AY6A 3IT2A 4FCCA 4BFCA 4BNLA 5CD9A 2JVJA 5MHTA 1T36B 1F0KA 1WOYA 3A4TA 2ACWA 1F2VA 4DIOA 2PZ8A 3EZFA 1LLFA 4BNXA 1TGYA 3HSSA 1U28A 1GG9A 5KNDH 5IYZB 4KIFA 1GAJA 3N8NA 4XD2A 5JHGB 2RH5A 2C98A 4ZZ1A 2C5AA 4EJMA 2AJTA 2NV0A 3PHJA 6ADHA 3L0PA 1D4ZA 4G5SA 2B8EA 2D3TA 3HYNA 4N47A 2OKGA 3FIJA 2GF9A 2HWXA 1D2GA 4DT1A 1LS1A 3S28A 2C5FA 2H48A 3D6FA 4B5KA 2BF7A 3P2JA 4PVDA 3CPJB 3SN6A 5EZSA 4CIDA 1ZEMA 4LRXA 3EGWA 3DF9A 4GLJA 2PLRA 3RC1A 1SUAA 5AK3A 3DD1A 3UC9A 1K0UA 5IJ0A 5K8JB 3RC3A 3FLAA 1WZUA 5LYJA 4DV2B 1AD2A 5SY4A 4TSKA 2HLPA 3TAHA 4FNMA 4CW7A 1J06A 1ZMTA 2I71A 2Z8YM 3GO4A 3ZQJA 5HGJA 3MWJA 4EG3A 5KNBA 3HRIA 5HIKA 2Q62A 2R1VB 1ZP6A 1T4CB 1GTL1 2W6JD 5CB6A 3JWJA 3CKLA 3K9HA 4URYR 3DEZA 2WM3A 3LX5A 5FL7D 2XAAA 3GGPA 3PWTA 1F2TB 1HFJA 4DF3A 3QPBA 3DLTA 1ZXLA 4YJHB 1RWVA 5BVHA 5KYUB 1FC0A 1BX0A 3QW2A 1H8HD 1JFVA 1EXNA 2DT8A 2OYCA 5DCYA 3IAUA 4J7UA 3IO5A 1Q0UA 4QUJA 1NBIA 4H7HA 1YQ9A 4WK0B 2H9AA 4WPGA 1JYFA 3U1TA 1PR1A 3GT7A 3WNVA 4NWIA 4M9QA 4HXFB 3FM9A 4KPUB 4EVIA 5KQLA 4POOA 4ENVA 3TQCA 2Y2VA 1MB3A 3DFFA 1T5SA 3DT6A 2FJ0A 2O3TA 3DZFA 5SZHB 1Z36A 2MHCA 3KB8A 4MR7A 5AW5A 3LDGA 2HWKA 4AMZA 3U4QA 3PA8A 3NHRA 5KYXB 3R44A 1DX6A 1KZYC 4R83A 3F3MA 4ENPA 2CMFA 3O9VA 4BQFA 3LUGA 4U8GA 5C5IA 2Q3MA 1DMSA 1FFBA 4H16A 3AEUB 4BVGA 2QTLA 5L7WA 1M1NA 2G9QA 3QX9A 4P3KA 2VYVD 3CS3A 2E7ZA 4NF2A 1DARA 3QUSA 2BCEA 3QVGB 4MWBA 3SI7A 2ERCA 2C03A 3FYUB 3VZDA 3EK2A 3IPYA 1TOAA 2ZRKA 1FMTA 4IX1A 1SXJE 2ZYRA 5TF4A 3ZPXA 3CH4B 1IG3A 2YQ5A 2PEYA 1FNMA 3QENA 1MB9A 3EASA 4HXGA 2O0LA 1ZISA 3CZPA 3NBFA 3P97A 4OO3A 2IBTA 3KZXA 1YK1A 4TTTS 4UAUA 4YAKA 2BFOA 5HPYB 5C7LO 5TF0A 4EKNB 1T4DA 3ZWXA 2J3HA 2FZCA 1TI7A 2GYUA 4QXPA 4AB1A 1CUYA 4HD8A 3WAKA 3CPHA 5AR1A 4ZEWA 1SVNA 2XNHA 3IE0A 1IBLB 1CULC 1ZNXA 1ZD2P 2VJOA 2W2PA 5TMPA 4HDAA 2DG2A 2PSJA 2F3RA 1M1YE 2Q9AA 3C5HA 2OFWA 4YRPA 3QSYA 2XMBA 4P35A 4M1SA 3FBGA 4D0NA 5EFZA 4QDTA 4WBSA 4O2AA 4MIOA 3UTDA 3M9XA 2QM8A 4TTSA 2YWCA 3E1KA 1AS3A 3EQZA 3HGTA 4ZMRA 2ZUFA 4F56A 4XARA 5K4GA 4E7OA 1W1WA 4Y2JA 2JLQA 3E4CA 4RJJA 1W0JA 4A2WA 1GZ4A 4NPHA 1VBMA 1CDZA 5AQ1A 5HOQA 3KHUA 3GK3A 4N7MA 3V1LA 2DQZA 2WIKA 1WXIA 3QE0A 3HM2A 1WU8A 4CCYB 1FW6A 2X3FA 4D74A 2PA0A 3K0FB 1Q83A 4LIPD 2PT9A 1IWBB 4MLZA 4NZNA 2TSYB 4PC3A 3RI3A 3EXHA 4PHCA 3WZMA 5BNZA 1M7BA 1NW3A 3VDRA 4A10A 5E1MA 2IHVA 4IMJB 3D3WA 2OHIA 3Q9SA 1IH8A 4F2DA 3QPUA 4QYIB 4R8VA 3IIMA 3ZGYA 4GKJB 1ZOOA 5LP6C 1XL1A 4KQJA 4EW3A 1FRVA 4RIHA 3KV3O 4N6GA 5EJ4A 1W36C 1A04A 5IUNC 4NPCA 1XJ5A 2WD8A 1XXHB 3IAAA 1ZNQO 2AT1A 1U8ZA 2O48X 4QYSA 3R6DA 4KP7A 1EVJA 5LN1A 1EPUA 1P5JA 5C5DA 1A77A 1OI4A 2I8LA 4XQ0A 4PZZA 4Q3LA 1OY1A 1W9MA 1WHSA 4PZCA 2VDJA 1S8OA 4QD3A 3HNPA 1RYNA 1F38A 2HGZA 2XXAB 1MB4A 3WC4A 1JBQA 4D41A 1DDGA 4D82A 4FJ1A 4RV9A 4OOEA 1VG1A 2HRQA 4FC7A 2P5UA 5SZJA 3UZUA 3CX3A 5FR1A 3FPCA 2RMKA 4DLTA 4V1CI 3A04A 2FKNA 4I1OA 1H4VB 2WYVA 3KJQA 3Q2OA 3ZE6A 4OJQA 1GTZA 2EZ4A 1MMFB 1ORRA 2IZ1A 2ZSIA 1QGUB 1XJQA 3WNQA 5JNWA 1D4OA 3L7DA 4B40A 3EBLA 2CD7A 3VPHA 3NTVA 3GDFA 2GJ9A 3DLBA 1EFPB 1XRNA 5BSWA 1L1QA 3ETEA 2A5FA 5JCOC 2HBRA 3DB2A 4IEFB 1PJ8A 2B4YA 1XMQB 2AFHB 2HC9A 1R1DA 2NT4A 4XGNA 4ZIRA 1JFTA 1IN1A 2HMYB 3GDHA 3EDCA 4Z0TA 3RFUA 4FCVA 1WB9A 3EE6A 1QYWA 4I9UA 3NDIA 4CEIA 4K6OA 2J67A 3WKEA 1C4WA 2C96A 3DHNA 3QPDA 2VK2A 4MQ4A 7MHTA 1J0BA 3TTVA 3O8QB 4GRIA 3WLQA 3EWAA 2LKCA 3FTNA 4ZK2A 2ECFA 3LAWA 3CW2A 4FOLA 5AW6A 1VIYA 2YMMA 2ODPA 3DHYA 5F4BA 3CRNA 3DV0A 1FLDA 1KJJA 4GR4A 3E2MA 1QIJA 3R3JA 3OOEA 1HG0A 4TMTA 3BB3A 3RAGA 1D3AA 3TRIA 4C03A 1E3TA 3ROEA 2NTYC 3L1HA 5AHOA 3Q3JB 1G3RA 1FY2A 1Z5WA 1DINA 2Q99A 2YUTA 3CSSA 2VSFA 1O96B 3D4IA 4KH1A 4UQPA 4KX3A 3WDKA 1NQUA 1IZ8A 3UKJA 3B85A 4X65B 5AW8A 1O4VA 1DEHA 1YBHA 1IY0A 1GPBA 4P7JA 3JPYA 5CM9C 2IWRA 1NQTA 1G8YA 1TIPA 4GFDA 5JXIA 5K0GA 2DFTA 2FSHA 2RGEA 5F23A 1T43A 2JFVA 5DX8A 3IP5A 3AEQA 2XHEA 2IDMA 2A1TS 3AM4A 4MKZA 4O0LA 5FUQA 1XRLA 2G9ZA 5JHHB 3SOZA 1E2EA 2JI4A 3TD6A 2FK8A 1UJ5A 5J1SB 2WP8J 4FZRA 2CLMB 3K6SA 3DCIA 1PGQA 4BNIA 1WU7A 1ESNA 3CSDA 4G2NA 4WNYA 3C7AA 3KZCA 1AXGA 4FQ7A 3CVVA 2QTVB 3OLXA 4J94A 3R2JA 4XIFA 3AERA 1VSQA 4PIMA 1AQ6A 1KO4A 4R2MA 5KSOA 2ZUVA 4CMKA 1EFDN 1FDVA 3O8OA 4FHDA 2E4VA 4JB8A 5IAEA 1SJ9A 2IEYA 2SCUA 4Q3OA 4YDRA 1GL7A 4V1CA 1EVLA 2ZREA 4MS1B 1HLDA 4IQ8A 4UFPA 3PJFA 1ZA1A 1R74A 3R6TA 1XRSB 3G6WA 4ALIA 2HA3A 1RWKA 2QVLA 3PT5A 4KO8A 5DNAA 3ZXSA 4D9CA 5FH9A 5FPYA 4D5GA 1CLUA 2B7CA 2FXIA 1QO0D 5F64A 4BQRA