1GQOA

Type ii dehydroquinase from bacillus subtilis
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
141
structure length
141
Chain Sequence
PHFLILNGPNVNRLGSREPEVFGRQTLTDIETDLFQFAEALHIQLTFFQSNHEGDLIDAIHEAEEQYSGIVLNPGALSHYSYAIRDAVSSISLPVVEVHLSNLYAREEFRHQSVIAPVAKGQIVGLGAEGYKLAVRYLLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Type II Dehydroquinase from Bacillus Subtilis
rcsb
source organism Bacillus subtilis
molecule tags Lyase
molecule keywords DEHYDROQUINASE
total genus 49
structure length 141
sequence length 141
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, X, Y
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2001-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 1gqoA00
2BT4A 2Y77A 4CIYA 4CIVA 3N59A 3KIPA 4RC9A 4ZC1A 4V0SA 4KIWA 1GU0A 4L8LA 4KIJA 4CIXA 4RHCA 4B6PA 5B6PA 1GQOA 4CKWA 4B6OA 2UYGA 1UQRA 2XD9A 2CJFA 2XB8A 2Y71A 3N87A 3N8NA 2WKSA 2DHQA 3N86A 5WRFA 4CIWA 3LWZA 2Y76A 1J2YA 3N7AA 1V1JA 4CKWB 4CKZA 1D0IA 3N76A 3N8KA 2C57A 4CL0A 1H0RA 2XDAA 4B6QA 4CKYA 1GU1A 3U80A 4KIUA 1H05A 1H0SA 2XB9A 4KI7A 4B6SA 1GTZA 4CKXA 4B6RA 2C4VA 2C4WA
chains in the Genus database with same CATH superfamily
1PCXA 3NEAA 1FS4A 2CV0A 4TV8F 3ZC3A 3GGDA 1P77A 1Z26A 2JAXA 3M6VA 3I61A 2C9BA 2H2HA 4G5GA 4MEJA 3U6BA 2EG5A 2Z6AA 2XADA 1XJ5A 2CZGA 2Q3DA 4RVGA 3EMBA 2QX6A 1TFUA 3DKIA 4PGHA 4WNYA 4DE5A 5JO0A 1ZOSA 4DSUA 5BRJA 5J3JA 3RFUA 4RIFA 4Y2XA 3ICEA 2QRUA 1QK3A 2CGEA 3H7IA 4PAQA 5DJ5A 4EGCB 1JA9A 2C58A 2R4UA 3SQDA 3AEZA 1TW2A 1OB5A 1VIMA 4CEHB 5IVHA 1KEZA 1M6EX 4C0BA 2OZLA 4COOA 4CQMB 1OPRA 3U7QA 5LL6P 1QP8A 1Z9BA 2B1RA 3RTBA 3K92A 3OI7A 3OJCA 5CVJA 2P78A 5BVHB 4D6YA 1SCQA 4X93A 1FC0A 1QQAA 1WJGA 4OQMA 1QGYA 4L7QA 1I5EA 3K16A 1XQWA 3U7IA 2Z43A 4JJ8A 2VDOB 1YKFA 4JJ6A 3VYVA 1YB5A 3VKGA 1EX1A 3DBRB 5JECA 5IJXA 4BJ6A 4C3OB 3WP1B 2IEAA 1LV8A 4KSBA 4FT2A 4MV6A 1SXJC 3E0QA 3NHFA 3PRYA 5L7YA 4CF4A 4D1YA 2ATVA 5EXSA 4HSGA 1IEVA 2MTBA 1NTRA 3L7IA 2PL5A 3RS3A 4Y7DA 3UJAA 1T2NA 1F5SA 1VYTA 1YSCA 4MUYA 1ZGCA 4OH7A 2ADMA 3PPYA 4PZYA 1OV6A 5HR5A 2LBPA 1Y1SA 1QVRA 4JROA 1FF9A 2AJDA 3DZFA 3ELWA 1ZCZA 1LNSA 3OTIA 1OC4A 3GJYA 1ZA1A 1UOEA 4TXNA 3WK5A 1BCRA 2QTHA 3PBKA 4BE7B 4ZK2A 5DNUA 1BGWA 3CONA 3NHSA 2IPLA 2PH3A 2XMZA 3ZWWA 1IBSA 4LA4A 5TPWA 1KZ7B 4L72A 1XA4A 4QRHA 3D2AA 1U1EA 3JAWB 2XF2A 2PJUA 1W96A 1UPAA 2Z4RA 3BSYA 4B81A 1K06A 3QSYA 2PWAA 3AR3A 2Q29A 2FPPA 3RARA 1YA6A 3OQJA 1U1FA 3NHUA 1JXMA 4R1OA 4GL2A 2EFCB 3IOCA 3SGLA 4LJRA 1YDEA 2W98A 4EY3A 3NH6A 4J07A 2ZRMA 4ER7A 1KEKA 5L45A 2CNWD 2REQB 1PGJA 2C99A 3GT7A 3IUPA 3KFVA 1JJAA 3MCUA 3O9VA 2I6UA 1PEKE 1UK9A 3PC2A 4DHEA 4WCFC 5LZ7A 3HJUA 1THGA 5EKXA 1YOVB 4DLYA 1RRGA 2M6SA 2Q5JA 5HZKA 1T8RA 3FCOA 1CUDA 2PBRA 1TT5A 1XIVA 1YQQA 2EDAA 3LVBA 5EKTA 1QRTA 3QX3A 3VDNB 4MWTA 3AHJA 3IPYA 5L3SA 3O03A 3FPCA 1WHSB 9ABPA 5J63A 3W1WA 3T9AA 4Q19A 3VHXA 2OGWA 4OBXA 3ZE8A 1Y9ZA 2C3YA 2H5EA 3VR5H 5JFTA 4O02B 2X13A 2ODPA 3TNJA 3NVKI 3FUCA 4BQIA 1LI5A 3QXSA 3ESQA 1EK5A 3FKJA 2LCQA 2FR1A 3NVAA 1F8XA 3PIDA 4PZCA 3HXOA 3ZBPA 4OOEA 4YAUA 2MHCA 3HBNA 4HTFB 5JLJA 4JU8A 2JLZA 1ISIA 3PUZA 4QFDA 3UJ9A 3U3JA 3EIXA 3PGVA 5KSOA 5FLXA 4UBOA 1ZVQA 2FKNA 4D4IA 5IN5A 3LNCA 2O2YA 4B6PA 5B6PA 2ATXA 1RS0A 3KG2A 1DXOA 1NFQA 3OEHD 3WGOA 1VGRA 4NS1A 1CTQA 5DTIA 3RB8A 3HU5A 5AFSA 5IN4A 3FMIA 3R4VA 4S3MA 3SHQA 5L3SB 1C8BA 2B25A 4YQEA 3L9WA 3NP9A 4N3BA 2I2WA 3ETLA 1CK4A 4I1UA 2QAGC 2AQ8A 2A59A 3E8XA 5LQMA 3RT7A 2VZ9A 2ZG6A 4JR0A 1GA1A 1A88A 2QS9A 4DZZA 5JMOA 6ABPA 2IY7A 3SXUA 3DXZA 4OQPA 3SHWA 4FOLA 5IKMA 3KEMA 1FOEB 1F1BA 2C7VA 2JJYA 2P3QA 2VPYA 2DU8A 3BGOS 3ZEAA 3R5FA 2RDMA 4B85A 1Q0LA 5BRNA 3HCWA 1AGRA 1B2LA 1VRWA 3G0DA 3U3XA 3KT3A 3EOZA 3T12A 4EG6A 1TM2A 4Q15A 1GTMA 3HI4A 1FPQA 3U2QA 5C9ZA 1RQGA 5E9WA 3FPJA 3DVSX 4H6WA 4UEWA 4ACBA 1KVQA 1GFSA 3NJRA 3BGSA 4IGEA 1TC2A 4BRZA 4EHAA 2XBLA 4CIAA 2ID4A 2PSJA 4NQZA 2FEXA 2BR3A 3C70A 1Z2EA 3RU7A 4CMEA 1QRAA 3GOQA 1UKBA 3DKKA 2OSVA 3M33A 4HKTA 4LMPA 1YDWA 3R7WB 5JYEA 1VL6A 1U0FA 2WAMA 3WAKA 2VDPB 5C4MA 1YFLA 1R0CA 1K0UA 4TTTS 1K4YA 5DEIA 1E2EA 1TI7A 2HMYB 3DULA 3ENNA 3HEAA 3A1SA 5ULLA 3DTVA 4KQMA 1J2UA 4P4LA 2PD4A 2IWRA 2BGUA 4JP2A 3FMPB 4ZWNA 4WZBA 6REQB 3RV3A 1ACLA 3F0TA 3QFHA 5IAOA 2J07A 1C4KA 2HT1A 3N2ZB 2RGAA 1P62B 2VP5A 4LYJA 3DUFA 1U3TA 1NW5A 1XTUA 2XKBA 3IIIA 3IKJA 3PFHA 2C2OA 4PTYA 3VHLB 1HDOA 2I6TA 4E1VA 4A2CA 3CE6A 1P8JA 5EFOA 4H16A 5FUWA 2M32A 2BFDB 1NT2A 1U8YA 2B37A 1P3JA 5P8WA 5J2UF 2OYCA 3SHVA 5SY9A 1I5OA 1SUCA 1ECCA 2BFMA 5AJXA 4NBVA 3Q0EA 1IWOA 4OHCA 4DV6B 3PEYA 3BJEA 1XF9A 4KYUA 1DRUA 5FULA 2GK3A 3KL2A 3QJYA 3SEAA 2PYZA 3WIOA 2W0SA 3DP9A 1BJTA 2HBYA 3AY6A 4NK4A 5BSEA 2ZPAA 5CW1A 3SEFA 2QPAA 2GN1A 2GEFA 1V5WA 4JSTA 3I3SR 3P2EA 4YX9A 1QYRA 2FK8A 5CG1A 2JZCA 4X7BA 4NCJA 1CR4A 4BKUA 4EKNB 2Y66A 3DG9A 4HDRA 3RC7A 4LJ5A 1GFWA 4L2IA 5F12A 5FHQA 4KR9A 5LU8A 4TKVB 1JB9A 3M1IA 2HSDA 2NZJA 4YAJA 3FYHA 1JBQA 1V4VA 5K0LA 3EBOA 4WV3A 1P2UA 1GUDA 2ZUSA 5A1JA 4G9EA 4MLPA 1L7PA 5BQFA 3CUWA 3PYLA 1B14A 3EXIA 1J9EA 2R65A 3UT5B 1VJ1A 2KS6A 3N2NA 2K2QB 4PTZA 5K0CA 2YZMA 3QOWA 3LBFA 3V9AA 3SVLA 2IHVA 3HFSA 2D4AA 4M8IA 4MRPA 1OJLA 4UD6A 5ICFA 4C6TA 4U7GA 2WFLB 1M75A 1OAOA 5EZYA 1R8QA 3SC2B 1JVSA 4YAOA 4QTYA 4U8HA 5B55A 3ADBA 2FRDC 1VPDA 1JGTA 2QM0A 3JZFA 4TS9A 4X44A 3WL3A 1MHTA 3T3MB 2P5UA 2QD3A 1CPYA 3DV0A 5FEMA 2D5CA 4RESA 2OCBA 3KVNA 4Y7CA 3MINA 1UWLA 5TQ0B 4ZAXA 1I6MA 1SGWA 2JGLA 1O94D 1O95A 2WD9A 4DABA 2EW8A 2I7VA 2JKYA 3O83A 4UEQA 4BVLA 3C8UA 2Q2WA 2VHTA 4E5UA 3SJCA 3M1YA 4MYDA 1U7ZA 2VYNA 2GQ0A 5ALNA 4K9QA 1CZLA 4X85A 4UEOA 3O94A 2IF0A 2P41A 2ABWA 3QYFA 2ZQZA 3NYRA 3BTUA 4WKOA 1D6SA 3VR4D 4WBNA 4EKEA 5C1PA 2CVHA 1E63A 2Q3FA 3AV0B 5F2EA 4NMMA 3ORFA 1R9JA 2WUEA 5JH7B 3JQAA 1MA0A 2GAOA 2IDKA 4WY2A 4TLLB 3HEBA 4W1RA 4D6XA 4MA0A 2F1JA 4OQNA 1IZ7A 3S2UA 4MJ3A 1F8YA 2VPPA 1GCOA 2BE7A 3ABSB 2B4YA 4P80A 4ALMA 4E5VA 3E9CA 3E8MA 4DLPA 1RM4A 2XCLA 5A0FA 1F12A 1D2CA 1J56A 2L18A 2H51A 3DDWA 1EWRA 4Q5IA 2PD3A 5D3ZA 1AXGA 2CUNA 1Z17A 1PUIA 4N5MA 4P22A 5EP1A 2OPHA 2VHJA 5F9HA 4RMJA 5ESXA 5A9SB 1IXYA 4H2DA 1SBQA 2M1XA 1XZFA 5IBCA 5JBQA 1W581 2L0XA 2QMZA 1P80A 2WG0A 4RVOA 5HM6A 3PFNA 2FEKA 2YYSA 4RQUA 1QH1A 3B3QA 4CPDA 3BGIA 4IIHA 5DRYA 2P4HX 3UPTA 4BGEA 5AKEA 1HH4A 1K8ZB 1VI2A 5EYPA 4KJXA 1CULC 1DAOA 1VJCA 3DQZA 1YOBA 1EVLA 2D1RA 3LL4A 4RY9A 2HW8A 1NZFA 1WZCA 1WBBA 1OLXA 4XFDA 5AVQA 3NHRA 5LA6B 3WRWA 5DV9A 1XNGA 3DBIA 3N0WA 4M53A 5CURA 2XCRB 1RHJA 1BXRB 2WWYA 3FNIA 3JU3A 4EO9A 4BNXA 3L8YA 4ZRMA 2VHQA 2OC9A 3DMFA 4EFLA 2VNHA 1YONA 2C4VA 3IAEA 3O4IA 4X00A 5EMJA 4BO0A 1NUHA 2FPXA 3KLBA 1XKQA 5JXHA 1JS1X 1Q22A 3B48A 2ZSKA 3O8DA 1JDNA 2RHHA 4A73A 3NANA 1ZNZA 2OPBA 2YJ4A 3T99A 4AJ9A 4EFKA 2ZBQA 1FFCA 1J0BA 4FU0A 3RH0A 1OW3B 1DIRA 4ZZIA 3NWBA 2LRHA 4PYMA 3OPYA 1OZGA 3DAGA 3WS7A 1IIRA 1JNXX 5K8CA 1HDYA 4IZOA 1EM8A 2CMKA 5ALDA 5EN4A 3PFIA 1F06A 1Z35A 5DPMA 2WJVA 3AB7A 4MIEA 4UJ5A 1OA0A 3T0FA 3F7MA 1L5MA 4FBMA 4OXNA 5LLDA 3PSAA 2SCUA 4IHKA 3UHJA 4D8XA 2W8BB 1F5NA 1NHWA 1ZPDA 1JVNA 2ZZKA 1C9MA 1WXIA 2VAWA 1YA8A 3JQBA 1JTEA 3A2MA 2ZYWX 2FVXA 4ODIA 3T1OA 4W6QA 3T3IA 3RU9A 3PWTA 3ZU4A 5FRDA 2ERYA 1YR8A 1K4KA 3JYQA 1GNPA 2I80A 3HDVA 3GJQA 3IHTA 4ZVSA 2B7CA 4TWJA 4LHYA 1Y48E 4AK9A 1NMEA 1BXGB 3IUNA 1HLDA 5BOSB 4KFCA 2RAUA 3O1LA 3T52A 2HQ1A 4QOFA 2A33A 3PC3A 4HMPA 1C9YA 3DMHA 2CYBA 1ZONA 4NFYA 3JQ6A 2J9RA 5C7YA 5D3MA 3PEFA 2YINC 2H54A 3GLGA 4CEIB 1T1JA 1U3FA 4N01A 1I1NA 4BTVA 1P5FA 1WB4A 4F72A 2RCNA 1VP3A 3QWAA 3GNSA 1T8TA 4BLRA 1X7WA 3K9WA 4Q00A 4MV9A 4NH4A 3T7TA 4HDSB 3DR3A 4NNJA 4C1BA 1ODKA 3SC4A 1MNQA 4BZZA 4Y9TA 3FHTA 4QT4A 3IVGA 4HXYA 4JUBA 5LVAA 1QYDA 4QIHA 4NMXB 3DSRA 5JG7A 5JY6A 3V3KA 4UDOA 2IGBA 1E3MA 5ILGA 2MMGA 3N2EA 4D74A 3FOEC 1JH9A 2FJPA 2ZT8A 1E0KA 3FR8A 1KEVA 4MR8B 3IGFA 821PA 5JEDA 2H1FA 2VDWA 3ZW9A 1J1ZA 4YTEA 4K6OA 4DY4A 3G9XA 3B6KA 3B9QA 3NAZA 2AR7A 1C3VA 3DBHA 2PRYA 1PP4A 1R6VA 5HFJA 1Z7BA 1P39A 5B7NA 4A6DA 2DBRA 3IBGA 4HUQB 4OLAA 2LUOA 4LSMA 4NJMB 5SZJA 5IC5A 2D5AA 4LTMA 2JGMA 3P9RA 4DSOA 5I7WA 2O19A 1KFJB 3I09A 1WSAA 2A9VA 2L17A 2P8SA 3F98A 3LX5A 1FY2A 4WKPA 3L06A 3ZU3A 2AL7A 4BNGA 2RGRA 1PZEA 4Y67A 5KJ1A 3LLSA 4QUBA 3F6BX 3HVIA 2B8EA 1DG9A 4AJNA 1N2JA 1UBJS 2UVDA 3DE2X 3SLRA 1SM4A 3FY4A 3W6OA 2HBRA 4LQDA 5ARCA 3MF4A 4WZAA 4ZKEA 3E05A 4EABA 3LFUA 1KP2A 4RKQA 3WY9A 1PNTA 1X14A 3ANMA 3DWFA 3QVTA 3QNUA 1EG7A 3W05A 3RTAA 5IYZB 4B9AA 3M4ZA 1NOJA 2BFBB 1SCIA 4JR1A 3S7TA 4D3FA 5L4LA 5CLIA 1HQKA 1T3GA 3I39X 3KIPA 3IULA 1ESEA 1OVGA 3B52X 4PYIA 1EK6A 5CT5A 5JNSA 1PJAA 1XD2B 2DBYA 3P0EA 2ZJ6A 4V2UA 4DEYA 1ZH2A 4JMLA 4KO2S 5A71A 2BONA 3JQGB 5LSAA 1K8QA 3BWMA 1OGYA 4BLPA 1KY2A 4HZGA 3HXPA 2V03A 3HXQA 3TVYA 2X5OA 3VZCA 1NULA 3SYMA 1TIPA 2ZJ2A 3GPDG 5E1BA 3G2NA 3UB4A 1ZL2A 4GL4A 3E9EA 1C50A 1MOSA 5IT4A 1EWQA 1Y9AA 2ZKIA 3RO7A 2GMWA 1A8PA 3HDYA 3R6TA 4QFCA 3VO9A 10MHA 3A6PC 2O50A 1EHCA 3DFUA 2OV3A 3U7RA 3OU6A 5DI9A 1RU3A 1UJCA 2CD9A 4G5QA 4MVJA 1Z8HA 1NW8A 3IC5A 3CF6R 4TTVA 2QSYA 5AJVB 1YRWA 5FA5A 2JFFA 4U6QA 4HVCA 2I9KA 1XVUA 4YMHA 5EWJA 4LK3A 2JK1A 4DCTA 5EXEA 4BJ3A 2EJCA 3AUJB 2NU8A 4LG1A 3W2HA 4GYKA 2BM9A 4KQHA 4EHIA 1NKSA 3LJKA 4B84A 1R5BA 2ZB2A 2JVKA 1E7SA 2PKWA 2QI9F 2V3VA 2Q8NA 1NBMD 4KXLA 4ZAGA 3NCTA 5E2AA 5BSFA 5U4QA 4LOLA 3C1UA 2NSYA 4DIKA 3PJDA 2XDAA 2R66A 2VCEA 3OZTA 5CNMA 4NIMA 1L5YA 3CVYA 3VKFA 3BD9A 4ICIA 3HSSA 1E1CA 3D3JA 1WZNA 1SBCA 3Q1KA 2P6RA 4PQRA 4Q3NA 3N59A 2MDTA 3E9DA 5JAQA 4BO2A 1E1RA 1GKUB 4O2AB 1CZNA 2PQ6A 2E0IA 4GSYA 4IUDS 3RFCA 5DFAA 3CUUA 3K2EA 2BY4A 1SC6A 4R1MA 4DM7A 2HF7A 4Q7KA 1A4XA 1HF3A 1XHEA 5EJ5A 1R4MB 2XYQA 1ZLYA 2QAIA 4TM7A 7ADHA 2P69A 3EJ6A 1BVYF 4QSMA 1FTNA 4TQGA 4X1OA 5C5EA 2YKGA 3K9BA 3H3FA 4PO8A 3LWZA 3S2SA 1MUUA 3E3NA 3EA5A 4ZVLA 1LTHR 3EH1A 2YY6A 4RKYA 4YRBA 1TZBA 4LY3A 4KQFA 5EZ6B 1Q1BA 1JWLA 3GFFA 1NV8A 2ZB7A 3A7DA 2WMOB 1XG5A 1GTZA 4Q16A 2UUBB 1TTHA 4HN9A 1ULAA 2VKQA 3DAPA 4P3OA 1KL7A 1NJSA 1Y1TA 2H9AA 4X3CA 3C4VA 3JS5A 3L40A 3E27A 2BBTA 3ND7A 1V8ZA 1GEGA 4A36A 3JAKA 1R6TA 4DJTA 5ALEA 1CEEA 2RB5A 1R3DA 3O8OB 1FVOA 4GEKA 1VL1A 1DIAA 3R9WA 3MWGA 4AD8A 1NMYA 2JZNA 2G9QA 4N5DA 1TVCA 1OBVA 4R2IA 1BH2A 1EKXA 3AHGA 3QVKA 4L78A 5AM1A 3VKUA 5AVVA 5FPKA 3W04A 5BQOA 4M0DA 3ZHSA 2H16A 2PRJA 2PCJA 2Q4EA 4LSWA 5HKAA 2PLFA 1QQ6A 1JXOA 5CLJA 4R1TA 4FDAA 1GSIA 3IMKA 1GLGA 3JVUA 3EEIA 1G7SA 2NZYA 3PDJA 4F04A 3K4PA 4OQEA 3LUKA 1Y4AE 4DXAA 3WGQA 5LQUA 3MPUA 2EL9A 3Q15C 4FOTA 1YS2X 2KI5A 5T4EA 4BECA 2GS9A 5FJIA 5JH7A 2JHCA 3PWSA 2XCIA 4Y2UA 1GUAA 4HOYA 1K5GA 5LDDC 2J30A 3OHMA 1YQGA 3ZDYB 1B93A 1AK1A 4IWXA 3M4JA 1NIJA 3PD7A 4LRQA 4ME6A 2BWJA 4MROA 5K4GA 3BIXA 5CVUA 1CRZA 3VNRA 1ZD2P 3ZZ0A 3OTHA 3LK6A 1SCNE 3D59A 2CE2X 1L3IA 3SK0A 1YZNA 3EIUA 2GD0A 2VYVD 4XWTA 1WDTA 3K9HA 4ZXPA 3A2KA 3CLTC 3D4NA 5DOZA 4FYPA 3ZXSA 1XN1A 3EQ2A 3OOHA 1RXYA 1AB6A 3DLAA 2NSHA 1DKQA 2NUBA 1AQYA 3C7TA 3DWEX 4WLEA 4XGKA 1XTPA 3RWMB 1K6EA 2DCMA 1R0YA 2FZGA 4P5DA 3SX4A 4F3YA 2GK6A 2QLLA 4NBKA 2YVQA 2B4RO 4AJEA 3R3UA 1FDUA 1YU9A 3DL0A 4ZYWA 2IKSA 3EWSA 2DSNA 3IOBA 4NC9A 4TTQA 2I3GA 3VJRA 3CZ9A 2WW8A 3W3AH 3ABIA 3KK0A 3TEMA 1HY3A 2YL2A 3AI3A 4YT2A 5F73A 1DO2A 4N65A 5MGBA 3TQRA 2AZ4A 1GU7A 1IN5A 3D4IA 3DOUA 1JR3E 1IN4A 4H18A 4F96A 1FS6A 3KAPA 2D5LA 4AIRA 2IS2A 2GA9A 3W8FA 2BMWA 1U6IA 1J7JA 3SJBA 3OQMA 4RZQA 2BFAA 3U13A 3SYKA 2EEZA 7GPBA 5KINB 2GHIA 1GV1A 1PAUA 1G21A 4DZTA 1N7IA 4H4CA 1RE0A 2PMWB 4DA7A 3HL0A 1WXGA 3HY6A 4MS1B 1CP2A 3FVQA 2IYVA 2P7IA 3FOBA 2X8JB 5D1HA 2OFXA 2QK4A 3CLSD 3NT4A 4L50A 1O9GA 5ALQA 5DZSA 4AXBA 4D3XA 1F6DA 2VNSA 5ALYA 5BSUA 2B1GA 1WCWA 3T3DA 3DPSA 4DY6A 4PHTA 4PG8A 1N3IA 2G8NA 1KS9A 3AT1A 4H35A 3R8XA 3D0KA 4CLHA 3GZ4A 1Y9EA 4DAEA 2FNAA 1FUUA 1S02A 2H18A 2OOSA 2RAVA 3KWJA 3M5PA 3IA2A 4FYYA 3TTTA 1FFHA 3GRYA 2DFPA 3MT8A 4XDGA 4YAIA 1JEYA 3AVWA 2DXIA 2V4UA 3L0YA 2ODTX 3G9ZA 1KETA 1ND5A 2EYUA 1E3QA 3J7TA 4EH1A 1L7OA 1DT3A 1ZM9A 2ZREA 4MCIA 1C30A 2FG7C 2YHIB 3BHJA 4MS4A 3PB3A 4GLBA 1AVTA 1JG1A 1OYVA 4BO8A 5A4JA 4DNPA 1YJCA 3G0OA 5JXGA 3AB8A 4G8CA 4KN9S 3SXUB 3IE1A 1D8TA 4HH3C 1AO3A 1EHYA 1N3LA 5THQA 5D8DA 3STXA 3DE5X 1X1RA 3TD2A 1AUQA 4P3KA 2XQGA 3EZXA 3VV2A 1T6XA 3KRTA 1OSNA 2WT4A 3QMVA 4J2OA 5FP0A 3S27A 1SCBA 5B36A 3FTPA 4YROA 3OKCA 4UCXA 3RTEA 4ZCTA 2RBGA 5KOHA 1CIPA 1X86B 2FQ1A 1X7WB 3K8OE 4XUEA 3IJRA 3ORSA 1CE8A 4KHPB 2PTGA 2ZQYA 1I3OA 1YS7A 4KRYA 1PJQA 2QN9A 5ALKA 3NBFA 5I3CA 5B3LA 3ZZTA 1MORA 2QMEA 2RHJA 2WICA 3R3JA 3M6MD 5JS1A 5IXJA 3T5CA 1TOAA 3MJTA 4J0DA 4HNRA 3CWQA 4QRIA 1YCHA 2PUBA 4B75A 4CEJB 3UGQA 1LNQA 1WZ2A 3PLNA 1O4VA 1N5RA 3QLEA 4IHJB 4KFSA 1FQKA 1WXXA 4Y6SA 4XJXA 2C5LA 1OTHA 1RZUA 1Y4SA 1VMIA 3EEYA 3H17A 4PX2A 4EFDA 4EY7A 5HKKA 5KC8A 3AY3A 3HV0A 1EZZA 4MH0R 3EZ9A 5FUMA 2ZYTX 1X13A 2EBFX 2CXSA 4FGWA 4UXIA 4YFVA 3RC1A 3L82B 1Q11A 3DYVA 3CF0A 5FTKA 2P91A 4EUHA 3VO8A 5KJEA 4CIXA 5IJAA 3C6QA 2L19A 2ZW9A 3VHRA 4FOSA 1MW8X 1TZJA 1N78A 3SVZA 4PFKA 1U0EA 3UWKA 5F1PA 1OH6A 1KP3A 3SYLA 1W6UA 3DT9A 5C4IA 2AGVA 4RVFA 2VHUA 1TRHA 1N6LA 2RGNC 4US2R 3RDPA 2UVPA 1O3YA 4CKBB 4QM7A 1FFWA 5DTMA 4C06A 3HXKA 3LCMA 4V0QA 2BFFB 4IKEA 3N6VA 5F5LA 4LMBA 4DLSA 4X6XA 3HHEA 1H3NA 4QWWA 4FTWA 1WZEA 4IZ6A 4GGOA 1LSOA 3MUEA 5ALTA 1HNZB 2AZXA 4H1HA 3DNFA 2ZOSA 4KPFC 3Q5EA 2DMRA 2XNCA 1LZKA 1YCDA 2O05A 1U3DA 2GR9A 1LGYA 2VXCA 2E48A 2WYWA 4G25A 1RWKA 4GI5A 4OHZA 3L5OA 1J8VA 1W5SA 2J33A 4RNCA 5DGXA 2HMSA 4N47A 4ECAA 2R00C 4YJ3B 3LPAA 3CRZA 1FW6A 3K94A 4DPLA 2EF0A 3I32A 2VF4X 3QWBA 4ZZ1A 5C8YF 1F2UA 1YJQA 4PLFA 1YJXA 5K4AA 2HTFA 1ZNWA 4OGLA 4OOFA 4Z0HO 3PWZA 3R8FA 2PN1A 5FLKA 3FVTA 4H59A 2HLNA 1YZGA 4B3TB 4TYYA 3B51X 2R4QA 1ZO8A 3KKZA 2DULA 3DONA 2JFHA 3EW9A 2YBEA 1SK9A 3IUMA 2EOAA 4JP5A 4MP8A 1J07A 2K87A 2AMFA 2PO5A 4I36A 1JG3A 4X84A 5EMMA 5NLLA 2WAOA 3TLGA 4XRGA 5TGTA 5B6IA 4HDQB 4P4SB 1ZC4A 3O4HA 1P2TA 2P2SA 1X1SA 1XMJA 3P2JA 2Y27A 1NURA 3VKVA 1FB5A 3VHXB 2IP2A 2PX2A 2HJSA 3AM5A 4HS4A 4ROSA 5IZ4A 2XGSA 3D31A 2CXHA 1J2YA 4UUBA 1NAIA 2ZSAA 3A1WA 3GVCA 2AVNA 4Q9HA 3VR0A 3JQAB 1EVYA 3IDSA 1TJYA 4J9UE 3DXXA 3O3NB 4V0MA 4C07A 3H1PA 4QAJA 5SZIA 1PFKA 1L7DA 3G0CA 4TX1A 3LIIA 4COKA 4ZGBA 1G5FA 3CH6A 1UPFA 5ICSA 2QTVB 5LXTB 2KWIA 4KXYA 3K4QA 2LE0A 1O7JA 1H5UA 3P9QA 3NRBA 1FW8A 4B3GA 1R4MA 5TIIA 4C1NA 4PS0A 4BYGA 1C1XB 2FF7A 1YH3A 3NHAA 5FOTA 3WL8A 3GV0A 5HZHA 2VZ8A 3WV5A 4DWOA 4AX4A 3TRJA 1QSGA 4CNQA 5JYBA 1Y6GA 2DPMA 3PR3A 4IKPA 3ZHXA 3NH9A 3R6GA 4ADSG 1JEAA 4CV3A 2DR0A 5DBEX 4GOND 2A8YA 4TLCA 1HURA 3I52A 4G09A 2ZM6B 3PGXA 2Z9DA 3BRWA 4XXHA 3P9IA 1J8QA 2QU8A 1J23A 3ZX5A 5AVSA 3BDVA 2V5AA 4O4LF 3ZWAA 3NKLA 4HBGA 1SFRA 4TV9A 3PEEA 1JJFA 2P77A 2VP0A 4R2LA 4QOHA 1NSTA 3ICWA 2PUDA 1LVGA 1I6KA 3A4TA 2DYKA 1PDOA 4LZOA 3AH8A 2H65A 5IUKC 2ZSBA 1AJEA 4IXDA 1W8IA 5BN3B 3VSEA 2C97A 4NJEA 5FWYA 4FWIB 4BMXA 1YWGO 2QDKA 3E22B 3ELUA 1HTBA 1SC9A 1XDZA 2I7TA 1WIWA 3HVUA 1J0EA 1MB3A 3IIMA 3PE3A 1L5QA 1LLUA 4UFNA 2IPMA 5AOVA 3RS5A 3WNQA 3ZDEA 1CUJA 3EXFB 4GR9A 4PLTA 4F97A 3W6PA 4FHCA 4IIGA 1I1QB 2FSVC 4I9FA 1O96A 4KVZA 3WLLA 3IR5A 5LUBA 2ZZMA 3JWGA 2GYYA 1P44A 4C0HA 4D2IA 1HYBA 4CIYA 4DA4A 2I6FA 3T1HB 1F7VA 2BHNA 2IZ6A 3ZCRA 2DWPA 3GLIB 3W0LB 3GIDA 3NBUA 2MU1A 3QXHA 4Y9RA 1ODCA 1ZRSA 3P97A 4HAXA 4TM8A 5D5PA 3HCEA 4DLTA 1DINA 2YDYA 3QBEA 1XDUA 3OJOA 3QMPA 3CY6A 4HWOA 4XYLA 1VKRA 2NU6B 1EFPB 1GWNA 4QX6A 4BP1A 2WU4A 4CV2A 4D9HA 5KNBH 2QJRA 5JNUA 1SB8A 4MTCA 3NIWA 2QB5A 1RJWA 1EVZA 1Y3HA 3COZA 3O2SB 3QOYA 1EI9A 4MWOA 3O1HB 1ML4A 2W11A 3AESA 5BR8B 2UV8A 2GPJA 5GVSA 2WNHA 1DEKA 1IHXA 1TYDE 3DVAA 4Q1VA 1JDBC 3KFXA 3AFGA 5GP1A 1L7VC 3RVRA 4C78A 2UXCB 3AL2A 1KC1A 1YUMA 4Q4DA 3T7JA 2JW5A 3A4LA 4A6EA 8GPBA 3AFOA 2ORIA 1YZLA 5DNYB 1J8YF 4CIBA 1IH8A 2KPOA 3QA9A 1N3BA 2A9KA 2ZP1A 4EZEA 3E81A 1XZCA 3KHUA 4FGJA 2AXEA 1RRFA 1Y7LA 3TM5A 5JXWA 2O7RA 1BJKA 1XK6A 1JE1A 2JPDA 2D1FA 1EXVA 2EKPA 1D09A 2C1XA 3BUSA 5HE8A 3HCFA 4XGIA 2P1ZA 4MQLA 1SPBS 1SQGA 4DA0A 4HLUA 4Z5XA 2ES4A 3GEHA 4KVGA 4KV9A 1XU9A 5J2UB 4TN1A 2XOKA 2JA1A 3ZE1B 3KQKA 2AFHA 2O20A 4PBTA 1A69A 4XGNA 4CFZA 1DQPA 4RFVA 4YRJA 3TXXA 2FHPA 2PUFA 3N39C 3N8NA 4RHFA 4RE6A 1KS2A 1VB3A 1WY7A 1GYQA 3C74A 3HEMA 3QLVC 4NHEA 1E2LA 1S3FA 3BE4A 2ECQA 3G88A 2ZYIA 3GLVA 4M9ZA 1CQIA 4BMPB 3P7MA 3ZDFA 1VSVA 5KYVA 3OETA 2CYAA 3S99A 2ZXFA 3HJAA 3MMPA 3VYRB 5L6LB 1UOOA 1FFGA 2GVNA 5CX4A 2C54A 4DV1B 1RPNA 2WOOA 3OUZA 4LHSA 2GN2A 2WSSA 1L4GA 2G9UA 1E5DA 3L7CA 4K05A 2QRGA 3E4CA 3W5UA 1BMFA 1T9KA 3MB8A 2RI1A 2GN9A 1IPHA 5CNIA 3M6FA 1PE0A 4KX5A 4BQNA 1FRZA 2SBTA 4RAQA 4UATA 3AI1A 3FVWA 1LH0A 1LD3A 2O0LA 4NU5A 1VYHA 4MYUA 2VDVE 3EWAA 1H1TA 3QKRA 5AJHA 4K40A 3EVTA 2GJAA 4B7CA 1JDTA 1GZ3A 1KI9A 4LFAB 3M6IA 4BN0A 1TA9A 4YVFA 1X42A 4K0KB 1Z34A 3E3AA 3C3AA 3JRNA 4TGLA 4DUYB 2RJOA 1MEJA 2WSYB 3R5SA 3W5HA 3I1IA 2PKQO 1GU1A 3CCFA 3I04M 3LA8A 4U2EA 4B3JA 3RJZA 1RQRA 1PNRA 1I2AA 3ZNPA 4U7DA 1AKYA 3ZU2A 1JQ5A 3SHTA 2P5SA 4N4AA 4TRNA 3Q7SA 3G2JA 2I2DA 4ATNA 3EGCA 4BEBA 2A78A 2X4IA 1A3CA 1I14A 3PQ5A 1XVLA 4GM0A 3OE7A 1RLJA 1U3WA 2HPZA 4X24A 2FX2A 1KYIA 2K7ZA 1YDHA 2RH4A 4NTZA 4Z9BA 4CODB 1FJ2A 4XJSA 4KLZA 3C3XA 3I2KA 5DLYA 4BEVA 4BRWA 5KDOA 1IEQA 1TA0A 2WP8J 4Z0NA 1G9XA 1M2VB 3UMJA 3NBXX 1V6SA 3QI7A 5LQNA 1ZCJA 4HN2A 1WPXA 3LRXA 4IH1A 2VUSA 4B9EA 2VNKA 5C5CA 1OZFA 1YOVA 4RDHA 4ND8A 3VC7A 1V3QE 1V43A 3SSNA 3SS7X 3L4KA 2VDUE 2B6NA 2B8JA 1RZVA 2BC9A 2P3LA 3NATA 3DFZA 4O4HF 3AVTA 1DXQA 1DJMA 3MWKA 4FYVA 1T13A 4JEUA 3TBFA 1KO7A 5GM1A 3UC5A 1GRCA 1J2JA 4ND3A 1R15A 4PQGA 3GLUA 3NVDA 3L04A 4Y98A 1FVFA 1M8KA 4YCCA 3KJGA 1N5JA 4ZAVA 3BH0A 3FPGA 4NCKA 4MPJA 4LDQA 4S0ZA 4C22A 1Z0FA 1MEOA 4GPAA 4B7UA 1Z8FA 2IW1A 3D1JA 3DO6A 3TKYA 5KKAA 3ROGA 3VZPA 3KAJA 2XMQA 2VP3A 3A25A 2ZJ8A 3NONA 4OKIA 3RRMA 5HGXA 1I7DA 3V7UA 1HK7A 1UANA 3KQLA 1XJCA 2HEIA 2PSDA 2JVIA 3FMVA 3N2GA 1VBKA 3KVRA 5IM4F 5THXA 5EIBC 4FZ5A 4RJTA 4RM3A 5IUNC 2C4WA 3L4BA 3A9RA 3CWCA 2XNJA 4LYEA 2QBYB 3AUUA 2OHHA 3DP7A 4AS2A 1NLZA 4DV0B 4KXQA 2YJ6A 1XDBA 1MB9A 4L75A 4ZQFA 3CKMA 3B1YA 4IVQA 3AIMA 3SSMA 3WHPA 4E7PA 3P2IA 4Q01A 1BS1A 2PQMA 1ZH0A 3WK7A 1RI1A 2WY2D 3EEQA 5A03A 3EISA 2R7KA 3Q5GA 3C16C 4C3VA 1PLKA 1T9CA 1FE8A 5KQPA 1NE7A 2VH2A 1QQTA 2ATIA 2IHYA 5KYGA 1APBA 3IOMA 4FMCF 3HR8A 4HN4B 2HGSA 5TDHA 2P11A 3IB6A 1R4AA 3LYAA 1RQ2A 5HCUA 3B7GA 1N2XA 4ZVVA 1CJBA 3HO1A 2B3TA 1E7QA 4FFNA 4Z0PA 1AQNA 1AKVA 1TVMA 5DYNA 5BSMA 1GRVA 4QQKA 4FMCB 3W5AA 5KSPA 1WBDA 1Q91A 2H59A 2NU7B 2IP1A 4P34A 3BERA 4N8SA 4X71A 2YWBA 3WJ1A 4M1YA 2R5NA 2WPNA 3WYBA 1KAMA 3LGXA 1UMBA 2WD7B 3ZUPA 3EPHA 1LB1B 3E9ZA 1K5DA 2HJGA 4X65B 2P9TA 2GA8A 2F17A 1LW6E 1Q57A 3X0DA 2NADA 4DARA 2HIAA 2ISCA 2OZVA 1I3KA 1KXJA 2NSLA 5AHKA 4I4TA 4OGKA 3ZY4A 3CRQA 5GAJA 3C5WP 1Y82A 1C7IA 3CTMA 3DFMA 5AJWA 4HDMB 3OEED 3L7LA 3E5HA 3UA4A 5A4DA 3ZWKA 5HZGA 2PGDA 2DQKA 1PWHA 4XD7A 1O6ZA 2P2CA 1UBEA 3E3LA 4ZYZA 1UBOS 1IK6A 4GLJA 2AN3A 1P1KA 2F3RA 3QPVA 9LDTA 2IBSA 1FJGB 1XU7A 2O5CA 3ZE2B 1EGHA 1OF1A 4HX9A 3ZV4A 5G4KA 3Q9NA 2JLAA 2V0GA 3AEUA 1Q20A 4PSAA 1H69A 2J5RA 2O2JA 4MEBA 1OASA 1OLOA 2X9GA 3H9QA 4MQEB 1OIWA 3W5IA 4AZ0A 4KO8A 2IUSA 5IU6A 3JCZA 3FPSA 3KT6A 1Y8RB 1Y5LA 2JGNA 3GP5A 5DX0A 3WNZA 4YT4A 3F71A 4TLEA 2WVAA 2W2MA 4HWGA 4CF3A 4YIHA 2WFAA 5I45A 4OXRA 4JLBA 4F9EA 4F5YA 2CLEB 2FSGA 2Q2VA 3EIOA 5EIOA 3EFOB 4DMLA 4ENUA 5C5DA 4ZQHA 1H8HA 2ENUA 2REXB 2R6AA 4BFZA 3JRWA 1LPNA 3S0JA 1GAWA 2IPOA 2FZLA 3AR6A 5CLGA 2O23A 2VP2A 2HFJA 3I6YA 1YC5A 2GJ8A 2WLSA 4U63A 4YCDA 2D7DA 4PEVA 1NUTA 5K5EA 3C6MA 2OQ2A 3IEUA 2BCGY 3USES 3DTVB 5DM60 2V7VA 2WABA 1MQAA 1UBLS 1WSDA 2XIJA 2B36A 3QEJA 4LY0A 3OUTA 4LSGA 1VI6A 1Y8RA 2CFCA 2PKEA 3SKXA 4HEA6 3TOXA 1BS9A 4B0PA 3A7EA 5BN5A 4ITVA 3PHHA 4HY3A 3BA6A 2BRUA 1E99A 4B7XA 1PL0A 1WZIA 3CXRA 3STVA 3KKNA 4II7A 2LZ0A 4E07A 2WHPA 2W6IA 1YIDA 1P81A 4IXTA 2GXSA 2BFDA 2UYOA 5ALZA 4F85A 4YY3B 1FSFA 1QV9A 4DMHA 1XAGA 3F6RA 4KN8A 2J1LA 1PDVA 1E92A 4I3FA 2CB0A 1AGNA 3KOMA 1ZINA 1SA0A 3SC3A 1V3VA 1ZJ6A 5GV7A 4KITB 1NVAA 1SG9A 3KYJB 5EUBA 4ZQBA 5AUPB 5HIAA 4INZA 3IDAA 3WVNA 1W48A 1C81A 4TYMA 1G21E 1LSJA 5IBQA 4B4UA 2C94A 5T6BA 5FUXA 1GAEO 1VHTA 2WSBA 1ZMRA 2NZ8A 1XMXA 1F6BA 2ZVDA 5KHAA 4D3SA 2VYQA 1JQAA 1VBNA 1RW4A 2XMDA 1NW6A 3SIXA 1TU3A 5I9IA 4DG9A 2G40A 3U49A 1U0BB 1K7SN 2OO5A 3LH5A 4M9QA 5CJJA 5I4BA 1RAIA 2WB2A 3CYFA 1V1MB 1KR5A 5L95A 1RJ9B 1ZGHA 4J0JA 2J59A 4NCBA 1FQWA 2NAFA 3KALA 4KDRA 3X1WA 1KPHA 1SMKA 2EKZA 3PL5A 4KKVA 2QDXA 4OO3A 4BV8A 1MABB 5AW6A 4P0PB 1I4DD 1E9EA 3TIGA 3OAAD 3Q7EA 4IV8A 3H4VA 2J0UB 4WASA 1DI0A 3CVOA 3VDRA 2I6XA 1YB2A 3IL2A 5A5DA 4MJ7A 5FUVA 3NCHA 1BIFA 3V6LA 1JFFA 3CNQS 3H8JA 3IEPA 3NX4A 3QI2A 4WDRA 5L3RA 2OCXA 4DIEA 3ICQB 1EINA 2IE0A 4INPA 1QFMA 1YRBA 4ZEMA 5KYUA 1HYQA 5ED4A 2B4AA 4ARCA 5FEUA 5JISA 1XXHA 4XTRA 1FMFA 3H86A 5JDIA 1ORHA 2MINB 4JQCA 2I2AA 1CUCA 5C4GB 4EYEA 5JSZB 4R1SA 5LOVA 1CRQA 1JLLB 3HA2A 4TYWA 2IY8A 4D45A 2NYAA 1Z6PA 4YDRA 2AG0A 2EG9A 5AOBA 3SVTA 1RZRD 1SPXA 2HJWA 3JV7A 3QLTA 1WRBA 4AKTA 5DSZA 4QBKA 1EB8A 2QJOA 1B42A 3KP1A 7REQB 1VFPA 1SUEA 2VQFB 1LC3A 2ENWA 2JD2A 3BMNB 4OMUA 4Q03A 1EP1B 1IHDA 2YOFA 2V97A 4JLSA 1LI7A 2P9CA 4UVIA 3K09A 2H1RA 3A1TA 4JSYA 2NM0A 4GNKA 4Y2JA 2Z2IA 2O06A 2POQX 3BTVA 2VT7A 1ZM4A 3SX0A 1EXDA 1TU4A 2NO4A 4KODA 2AMLA 3DVLA 3TFOA 2VAPA 5G0VA 4FR5A 4WACA 2XTNA 1G18A 1BXKA 1E32A 1ESCA 1P3Y1 1MAWA 2C0CA 2JAWA 2WU1A 3A9CA 3D4BA 3A4IA 4X54A 1KJ8A 3DJFA 3I73A 3NPAA 5EWLA 3WHLA 1R18A 3FJ1A 1KA9H 4QOSA 5FI1B 3V4PB 5C37A 4PLHA 3VR5A 2ZT7A 3WX0A 2L69A 1U7HA 1XCLA 3DEHA 1MRNA 1NXWA 1JHXA 4QYXA 1PR0A 1RJDA 4Q3DA 3RABA 3STHA 1SUSA 3QVWA 1CDZA 1RM0A 3HZZA 4QBIA 1OXVA 2WJGA 2IV2X 5KOJA 1FSGA 2ZJ7A 4OJTA 5KWVA 1BTOA 4IDDA 3DF7A 2QX7A 4P9NA 4URWR 3UMGA 2DBQA 1GPMA 1RLUA 1ZP6A 3IAS1 1DAPA 1ISMA 2A4MA 3C6ZA 3LDHA 3THRA 3UEOA 3I8SA 3ABZA 2OP0A 2F3SA 2UAGA 1QAMA 4I5GA 2IK8A 4MGKR 4O08A 1T1EA 3PUVA 4PLVA 4QQRA 4TV8B 3UFXB 1YAJA 1L4MA 1SJ9A 2ZUCA 4FD2A 4X3OA 4DIBA 4QM6A 3GOHA 1X8LA 3NYIA 3D3QA 3FLMA 5FV4A 2LP4Y 2J0SA 4W63A 2VJBA 1OX5A 2OXRA 3WNBA 1RT9A 5CGZA 4M76B 4RD2A 4BUJA 5B5SA 3G85A 1M33A 2AKYA 2FQXA 4DNXA 1NQVA 4E14A 1J5EB 2XUFA 4BRUA 3F96A 3I6ZA 1XJQA 4M1SA 5IVKA 2AZMA 2YWHA 3OFND 5FO1A 1ZUNA 2BIFA 2YMQA 4TQUS 4HQRA 1NNLA 3FCYA 4IOKA 1DBRA 2W6QA 1OWNA 3W06A 1OWPA 3W79A 1NVVR 3DEFA 3SU8A 4J1TA 2XB9A 3F6CA 4MVCA 4GU5A 2GESA 5DBOA 3LQ4A 5G4KB 4RK7A 2WJIA 3N8DA 2FMTA 2Q4OA 1U5BB 3OMWA 4FHZA 3OBIA 4CLEA 5F1OA 1AK2A 1L5RA 3MWEB 4B35A 3AEKB 4KNWA 3ROQA 4H0CA 5KNCH 4HYTA 1SU4A 1MAHA 1P75A 1DVRA 1S0UA 2FN9A 4JEIA 1E3DA 3WO0A 4AS3A 3H5AA 2VYFA 5M3BA 4RQBA 3VYUB 1M1YA 1KBOA 1EGVB 1JU3A 1VPLA 1C7RA 1O58A 2HJ9A 1EH5A 3A4VA 4CU5A 3HCAA 3EDQA 4ZDWA 1ZD1A 4WUTA 3ES9A 3U4AA 1DBVO 3IKTA 1YUBA 2B4QA 2O2DA 4I1IA 2GN0A 2WFZA 4WLUA 5IT0A 4EBFA 1ZSVA 2RHDA 3DM5A 3H9CA 4ND5A 3REFA 3K9QO 7ABPA 4JC8A 2QXYA 3QFSA 3TL6A 2XLCA 4JKOA 4TXLA 3PFKA 4MW0A 1NXQA 1E9RA 1HSOA 1U98A 2HUPA 1CBUA 5IT5A 3LUAA 4AZWA 4N3NA 2GZHA 2X5KO 3RSZA 1W5AA 1SVKA 2YXEA 1MENA 1SHKA 5FUBA 1Y5NA 1M34E 4DBVO 3PEWA 3IVCA 2I9PA 4JITA 1PS8A 3AHIA 2C8VA 1WMDA 2YNMA 3K0HA 4MAFA 5KYWB 3ENVA 2PDAA 3ADDA 3BN3A 2NO0A 4Z51A 1KYZA 5ES3A 3ZNNA 5BXQC 1V96A 1SZCA 2GN4A 3C5VA 5JNLA 3ZOZA 1UXHA 1P17A 1W59A 2HNAA 2XWJI 4L3OA 4QDOA 2I87A 3C3BA 4L7VA 3K0CC 3M4YA 2ZRNA 3NKFA 4MJLA 6Q21A 4WLFA 1A2KC 1E3TA 1QBGA 2R6GA 1V4NA 1OD6A 3JQ9A 1SHTX 5HKLA 4HVTA 5GTDA 2Q1TA 3FLBA 3H2SA 4NOJA 3SQXA 3FGNA 1MX3A 4O0MA 3JVEA 2DUMA 3R3VA 4MR8A 1GZHB 1NSYA 2OKGA 3UHFA 5CDYA 3SP1A 3UHOA 4G0UA 2VJPA 5JW6A 1I2BA 1QVZA 2J0EA 3D6UA 3OC6A 2W2KA 5J47A 4R1UA 3MUOA 5ADUS 4MW2A 1GTG1 3FNHA 4J90A 2WF5A 1ZJ4A 4HATA 2M98A 1MB2A 1QG6A 5J9FA 2AN9A 5LDHA 1DS6A 1UM9B 3AHHA 4F93B 5K99A 4QPJC 2VTKA 5KPDA 4CMIA 1QH8B 3DHEA 1N8KA 1LBHA 3QEKA 2ZB8A 2XZOA 4BMYA 4WVLA 4I6GA 5CJPA 1QRRA 3VAZA 3RVJA 1VHDA 4TQAA 3VKWA 5B6JA 3D43A 2OC4A 1LVUA 4BLWA 4FFOA 5EA2A 5KDDA 3R4CA 4K03A 5ER9A 5KU7A 4HNAA 1DC8A 5AM2A 4J6FA 2B83A 3CZ5A 4NU8X 1KOGA 1W73A 4U9IS 3U3RA 4C7BA 1XN4A 2VJLA 4TZ0A 3R0VA 3RRFA 4RMHA 3NIDB 1ZFNA 1P0QA 2WTEA 2FEAA 1PJBA 4GDFA 1I80A 2PK3A 1SKAA 2QUHA 4EL0A 2AUTA 4IYRA 1I4TD 4RA9B 2L42A 2VCHA 1RWXA 4J7CA 4F6LA 4LFCB 4GP6A 2R7MA 2VP9A 3GFVA 4LQ4A 3KJXA 1QCYA 2AD1A 5I6DA 1PFWA 3ACBA 5DYGA 1CIJA 4RH1A 1PGOA 1RSZA 5EMNA 3KDSE 1TPYA 1ZOPA 4QLOA 4QXAA 4OLBA 4M9XA 3P9KA 3BBLA 2RGNA 3IE0A 3NBYC 3JW8A 1CYDA 1UBCA 4AWXA 1NVUQ 3A32A 3CZMA 5BN4A 5AW3A 2AIRA 4MW4A 1K9VF 3CMMA 2CMHA 3AZPA 4YC7A 5JBIA 4LSZA 3VVBA 2R79A 2IYXA 3GJ3A 1G291 1A72A 2JFBA 5ED0A 3TKAA 1U90A 3PP8A 1ORDA 3ZDXB 3HVRA 1KEEA 1XAHA 2V7GA 5GWXA 2Q0HA 3N6XA 4KK4A 3TLZA 4BKMA 4J2TA 4PIVA 2IYQA 2QTMA 4EVSA 1Z6AA 3H5IA 5K6AC 5FCDA 4BO6A 3H42B 3ANXA 2Q1XA 2SKEA 2NVOA 4NOKA 4NARA 2GLUA 1DP4A 1OFHA 1BEZA 1X9GA 2OVFA 2QEQA 3DT8A 3HFGA 3MGKA 3QU4A 4UE6A 3V1TC 2SHKA 2WJ3A 4OM7A 1XYYA 4BX8A 3NEJA 3P19A 4LGMA 2R97A 3VNBA 1DAMA 2OE2A 3P9CA 2P27A 1BHQ1 4F4DA 4H3SA 4OHYA 1UWVA 1C1DA 3HACA 2NO7A 5T4HA 2EZ4A 3QY9A 1R37A 1R4NB 3E2MA 1KSJA 4G3XA 1BX0A 2Z3WA 4CEHA 2BEJA 3IQHX 4QU5A 1XNHA 4FLFA 5BN1A 1Y7TA 2C5GA 4LYGA 4PM4A 1CQZA 1XTRA 5ECYA 3G0HA 1XRSB 2QX4A 3RTGA 3RU3A 1KK0A 5JRDS 4WEQA 3TEFA 5D3KA 1MABA 1JMKC 1XSEA 3WMGA 2WWRA 4MRMB 3IHKA 1VKJA 1A5TA 1GZDA 5CXUA 2AS0A 4L74A 3HWX1 4ZMBA 4GECA 4IHQA 5TV2A 2FXVA 4FZRA 4IJWA 2ZRLA 1O5IA 3GRKA 2M6RA 1K6XA 1D1SA 2IUFA 4TLAA 2G9RA 1AGXA 5HQJA 3X43A 4LVUA 1N92A 2WWFA 4MIKA 1BXGA 2WR8A 2HPHA 4GPBA 2IVZA 2DT8A 2NTYC 2XUJA 3L79A 1M2VA 3ORRA 3D64A 4F8EA 1EK0A 1I3MA 1L0BA 3M5DA 1XTTA 4BAZA 2LTAA 3MS2A 5D3MB 3RF6A 2KLHA 4CM3A 3MCZA 1Z29A 2AR0A 2ZTLA 1J0XO 3GLQA 2NU9B 9LDBA 3RUAA 4RHYA 4C3UA 1FLNA 2JAQA 4Q4AA 1E58A 1Q7CA 1YT5A 3E2IA 3EA0A 3D4LA 3FN4A 5E7JA 4JJZA 5CCXA 3EGXB 4RD6A 4N76A 1MPXA 1ZEMA 2ZUBA 3GEEA 4JJGA 3WL4A 1S5PA 1NG1A 2PVSA 2ACWA 5JD5A 4F2GA 2OQIA 4EB6B 1M2FA 2E1RA 2DWUA 2QZ4A 4K6MA 3UT0A 2PS1A 3ZCXA 3NIBA 1RQLA 1ZHHA 5IT9A 4M60A 3WK8A 4IJKA 3EQ8A 4WKNA 4ZQEA 5C46F 2FZVA 3ZLJA 1PK7A 1OFUA 1D5WA 4WWHA 3I6IA 4LJAA 4OKNA 1TD1A 4AU1A 4UQOA 2X5XA 3ZVRA 1IIBA 1RXUA 5GY7A 4QFMA 4WXEA 3DUWA 1NYRA 2FP4A 1O5TA 1XDGA 2YV4A 3L9XA 4FHFA 1I30A 3GARA 3G82C 4Q37A 4YJ2A 2A0UA 1D6JA 3FGZA 2MCFA 5AKGA 1PUXA 3LYUA 1J1IA 1JKXA 4EB8A 2PA0A 2B4TO 2B6HA 3HP1A 4PHFA 3VSAA 4EYKA 2AWNA 2G25A 2H4FA 1RCFA 2XTJA 2CHQA 2OOKA 5TE9A 3H75A 2NVUA 3ZI0A 1JSXA 2AI2A 2Q50A 4OMFG 3VI3B 1DBQA 4N0EA 3HKBA 1INLA 3UENA 2PGXA 3H5OA 4X20A 3OM0A 4F60A 3FKSA 1P6XA 2BW0A 2FFHA 1MT0A 3IAXA 3OA0A 4KSYA 4HV4A 4MW6A 4O0LA 3TOSA 1MV5A 3O21A 1BYUA 4GRIA 1E89A 3KKPA 3WFIA 2HYDA 1B7GO 1ESNA 1XZQA 1JLMA 3COVA 4AFNA 4BZXA 1PSDA 2MSEB 1FCJA 4DQXA 4D4HA 3UIEA 2MSCB 3ODGA 3LP5A 2GRJA 3Q98A 1NATA 2I2BA 1SD2A 4JXZA 2EBUA 5JR3A 1MR3F 1XR3A 2C2HA 4A2PA 2X58A 3GFTA 4FQ8A 1U2DA 3OE5A 1W5BA 1J24A 3QY0A 1ZR4A 1XZLA 3MQFA 5CR9A 5SYAA 3JQFC 2RJ3A 2NVUB 3IEXA 4QO7A 1WSBA 1BN7A 5DHQA 2GEUA 2A6PA 2X4GA 4C3ZA 2WKPA 4FEYA 4IS3A 3TVDA 3O8QA 4CLXA 1H2AS 4D8WA 4W5RA 5F21A 2B69A 3MLEA 5ARDA 1DJOA 1JPVA 1SUWA 4R05A 2A0FA 2VZ0A 1U9YA 2RBKA 2HSJA 3KQSA 4NBTA 4ONEA 2QXUA 2PBZA 4GMXA 4G9GA 1HZZC 4EK9A 4CG0A 3V48A 4EQ6A 4K7JA 1UP7A 2UUCB 3KHTA 1EFDN 2UZIR 1O9HA 2IP4A 4R8MA 4CHTA 3C7AA 4PSKA 2A14A 3RRJA 3RYHA 4MP6A 5F3WB 1V8PA 3OHPA 4NZOA 5KYXA 4FGLA 5MFZA 2KJQA 1XZJA 1YHNA 2YOHA 3DMGA 1DAGA 5IAAA 3H1EA 5K3DA 4PXYA 4ASUD 1N1MA 1JIVA 5EI5A 3SY8A 2LDXA 4G07A 3RWOA 1EYZA 1M2KA 1NQOA 3LECA 4QUEA 2W83A 4WSOA 4E5SA 2DT5A 3FLEA 1G2PA 5K1ZA 4LXIA 1T3LA 1VIDA 2G28A 5BY2A 4R01A 4Q9JA 3ZTWA 1M3SA 3H7AA 1GZSA 3QLVA 4HG2A 2LD4A 2C5SA 4IG4A 5KWIA 1SUPA 1ADJA 2FCRA 2XUQA 5BOVA 2G5GX 4Z3KA 4BXOA 3OOSA 4GMDA 2C2GA 1S8OA 3CA8A 3CUYA 4CL0A 3FNQA 1IULA 5IAJA 1MX5A 3SJAA 4WNCA 1X0VA 2QSJA 2VJMB 3OWOA 2ZS8A 4FE7A 1H8HD 3UMSA 4BBPA 2QIPA 1NF3A 1YDFA 1Q3KA 2IS1A 2ZTMA 3W3AA 1QIJA 2I1WA 5P21A 3G8BA 2AYXA 1A5SB 1I32A 3W9YA 4FQ5A 4LBZA 3SF0A 3BHMA 5BN5B 3VZQA 2ZPTX 1RM5A 1OE0A 2ATCA 2PFKA 3A6EA 4MW9A 5KU1A 1JEEA 2O0KA 1L4NA 1PR4A 3IUQA 4LPSA 3GGPA 3AUSA 4QDTA 5HF5A 4B7AA 3IUSA 4XPZA 5KCMA 2JGFA 1AU9A 1Q1ZA 3CT6A 3O8OA 4S1OA 1CRPA 4BE9A 1NVFA 1YZHA 2UZ0A 2C5HA 2D1YA 4OL0A 3PQCA 4DLWA 2XB4A 3HJNA 3AZQA 2ZIWB 4PNHA 4Y30A 3FA2A 3AFHA 1A2QA 2A84A 3TW6A 1UM9A 2YX1A 1UFVA 4HL6A 3OKAA 1VLZA 3AIIA 2YWCA 1Y1LA 1P1RA 2F43B 1WDMA 3CB4A 1S2GA 5IKXA 5JY1A 1AZWA 4KR7A 3LZCA 1YZTA 4LBYA 2IELA 3I1JA 5BQPA 5KI6A 3BPSA 2NQ8A 4CQLB 4DT1A 1ZVVA 4OHRA 5FR1A 3MRTA 1A4UA 2IUYA 3AI7A 1FRQA 3ER9A 2CLMB 2H1IA 4P98A 2J0QA 4LQLA 1WE2A 1BQEA 4EM6A 2X4LA 2X0NA 4MDYA 4TMZA 2ZSFA 1QHHA 2MIIA 3NALA 5DRTA 2JFWA 3G8CA 4YCNA 1IMOA 4UU1A 3U56A 1P6QA 4RGYA 3NUQA 1FTSA 4GUDA 4H3VA 1GOTA 4Q18A 4EMSA 2O07A 2F1RA 1KR2A 2IXEA 2WYOA 3L8GA 3SFZA 3N7UA 2HYIC 4O2BF 4N6NA 4C01A 4LOHA 5KQSA 5ALOA 3KE9A 4PO3X 1OXMA 2IZ5A 4HNTA 1R50A 4KZPA 1HMYA 5E0KB 1NN1A 4ZGGA 4G67A 1C4WA 2NIPA 2QN7A 4I1OA 1GGKA 3GYGA 1T0JB 2PSFA 4JYCA 4XZ3A 1GNQA 1RD4A 2NZUG 2YN2A 3ICOA 5CYPA 1Y89A 1KPGA 4NE7A 4YMVA 1RQ7A 2XD9A 2H0RA 3L92A 4E30A 4ARZA 1EWVA 1WPRA 1NUSA 1ZXBA 4LXHA 4CT4B 1SXIA 2O1EA 5I7EA 3AVXA 3BRQA 3IT3A 1N9GA 2GM4A 3UB3A 2AQIA 4OB6A 3JWHA 4LHZA 5A3JA 3WBFA 2I7XA 4LC9A 4NABA 2EWMA 2WWVD 3UV6A 2VPZA 5EESA 1Y6ZA 4WA7A 4YPOA 3K8YA 4OJKA 1Z2PX 3RLIA 1RWWA 1ZSNA 3DLPX 5JPCA 1JFLA 5I47A 1UPXA 1V26A 2ZR0A 1JDBB 4B33A 3BVPA 2IH5A 1XTBA 1UBUS 2GWRA 4NYIQ 3L1UA 3PUXA 2BHRA 4UNRA 1EWYA 2V1XA 3MEQA 1WDWB 1ZM2A 5HS6A 1UH5A 1TCBA 2H11A 5K3FA 1JZTA 2VDQB 3GROA 4K5QA 5T57A 4EKDA 1G8KA 3KD3A 2LCIA 2OKCA 2WU0A 3DBVO 3QX8A 4CN8A 1EUYA 2F8MA 2VHCA 1EJ2A 4E4RA 1AZSC 3I30X 1SKQA 3EF3A 4ISCA 3HMKA 1KKUA 1LCIA 2O9JA 2EERA 5JJCA 5JAIA 3DL2A 5KSYA 2ESRA 2DQ4A 3SZMA 2GF0A 2YIVX 4PCLA 3ZNQA 3CVUA 1E8DA 2IXAA 5LPNA 1I7SB 3T5PA 1O8BA 5C1IA 4DG5A 4B3DA 2CCGA 3E70C 3V8BA 5I7HA 5A0VA 4KRXA 2YVLA 4FNOA 2JEYA 4LZPA 1P6UA 5JMWA 2FW8A 1BE8A 2E4WA 2GNPA 1Z88A 2H06A 4MGYR 2VP6A 1QH9A 1ENPA 5CH3A 1IVSA 2PVCA 1XQVA 2NPOA 4U2BA 2JGKA 2W5UA 3B12A 3NTOA 2X1MA 2CSXA 2Q7XA 4ALLA 2C78A 3QP9A 1YC2A 1LC0A 2BOVA 1DRWA 3DF9A 4KNVA 5HUHA 2QJFA 3BGWA 1L1EA 3IVMA 3L0CA 4U0JA 3SIPA 4XARA 421PA 3HBLA 3N6RA 3UC9A 4DJ5X 2JATA 1G6Q1 3FRHA 3RSCA 1TAQA 1VLVA 1H6AA 1P31A 5JD6A 1CUAA 2WZCA 5D1NA 1Q1GA 1MC4A 3B6JA 5GIPE 3FHCB 3HXMA 5DISB 4UUOA 2AZDA 4CWAA 2SCUB 3PPIA 4Z4HA 3PQ7A 3DLTA 3TIVA 5HK8A 4MQMA 2ZYUX 3NYQA 1NGSA 4F4UA 2J85A 3N9IA 3H8SA 4UVGA 5LQRA 1V9SA 2I3BA 3I6QA 4XM1A 4HQLA 3MJHA 5EMKA 1QS0B 1P3DA 4CMIB 2K7FA 1E1QD 3TB4A 1VJGA 2HO4A 4Z4CA 5KNDH 3PXXA 1UJ4A 3ZK8A 3FUVA 4A1FA 2P65A 3WGJA 4DWWA 4CIWA 3T9CA 3OQOA 5LD2B 3ITDA 1L8QA 3LW8A 4KJZA 2QTWB 2PLRA 4LXUA 4XX0A 5E6RB 4IV0A 4JUFA 3IP3A 3IJEB 2ZEJA 4FGUA 1GR0A 5SYMA 1K66A 3AR4A 1OT3A 1P74A 5AM4A 1HO3A 2H0QA 2H1VA 3TUIC 1P4AA 2DTDA 2WSIA 3OQ1A 4HNAB 4YUVA 3RKUA 4B6RA 3AG6A 4BC1A 1DRVA 1P9RA 1EGQA 1F8UA 2WHYA 3IE2A 3V33A 1LDGA 3IAUA 3ELYA 4ZGWA 4ETWA 2NVBA 4EMTA 1LPPA 3OM1A 4NR0A 4ZICA 1W93A 1G1AA 3R3ZA 2TSYB 3QVMA 3SZLA 4EHJA 2AT1A 1C9NA 4BQPA 2CFSA 2N1MA 1KFBB 3QPCA 3HYNA 2FU5C 1GZVA 5DK4A 1JWAB 1YRAA 2XMCA 4KWHA 1ETHA 4CDMA 5DOVA 1WUIS 5BWBA 4QZVA 3PGJA 3PUYA 1JQEA 4C08A 1Z6ZA 3FSGD 3TTXA 1QZ3A 4BMSA 2WJHA 3ORYA 4FHGA 1MO3A 4JJIA 4CQMD 3FB4A 1VXOA 1DOZA 3TGPA 1D2HA 1ZUWA 1H93A 2W2LD 3SDZA 2O6LA 4YBRA 5BN4B 4C0SA 4Q7MB 1E0DA 3PXGA 5BMVB 5JZVA 2EKDA 2FN4A 3C4JA 2GAIA 3BRCA 3TO5A 3U6KA 3HUFA 3RBAA 3CG4A 5CT4A 1WETA 2HBZA 4DMKA 3GAZA 5CXQA 3DCIA 2WEKA 1CQJA 4EAQA 1E79A 3GJTA 4BB5A 1UKAA 1EDOA 1WEKA 2P9GA 5F51A 4DCVA 3L1JA 4RV9A 4MDEA 4CR8A 1KJ9A 3B7WA 3EXHC 1Z2OX 1G19A 2ORYA 1JSRA 4ZYLA 4XDZA 1EGMB 1CY8A 4YJ3A 2BR4A 3HDGA 3BFVA 4V03A 4BCDA 4RTQA 1UXKA 5JPDA 4FI3F 4HJXA 2HK7A 1C1DB 2QQEA 1L1QA 3TDKA 3O5AA 4QJIA 5ALVA 3LC7O 3UOGA 6CHYA 4WNAA 3ZUGA 4BV3A 4YCMA 2ZIXB 3AGQA 4RKWA 4Q93A 1D2GA 2R8PA 1YS4A 3GMSA 1DC3A 1GZ5A 1P60A 1P0IA 3KXIA 2PU7A 5G53C 4C76A 3ER8A 1X1QA 4ID9A 2QP4A 3QIVA 2CK3A 1ZD3A 1PWZA 1AF7A 1UIMA 1L7QA 1OFUX 2Q4BA 3AFMA 4L4RA 5HWSA 1SD5A 3EC7A 5KWSA 3SWWA 5T7BA 2O8EB 3TLGB 2A5FA 1ILEA 3NNDA 4DUZB 1HT3A 4YRPA 1CIVA 1Z7GA 1ZITA 2QVGA 2ZRIA 4RHUA 1HE5A 3J7AC 3WGMA 4HH0A 2QZSA 1G20E 2ZBPA 4NULA 2G72A 2FFJA 5TPWB 2NTJA 3IKMB 3LGAA 3BB4A 3IYLW 4QUAA 2I3ZA 3SQMA 1N2CE 2CLHB 2B78A 3GXBA 4X63A 2VS1A 1Z7WA 2VRNA 3G5AA 2OCIA 3A28A 1JU4A 1E1LA 1GPH1 2R25B 1JHOA 1PZHA 5LB2A 2VTBA 4C6TB 1LA2A 3UFBA 4US1R 3LFTA 3RT9A 1ZZEA 4B3CA 3LF2A 3N2LA 3WBBA 3WIVA 5CVEA 3OMLA 4KBGA 3B9RA 1GRNA 2YV3A 2Z2JA 1V2GA 3E18A 2XCQA 1F2DA 2REQA 5CVDA 5KJ6A 3SF8B 4CF7A 2CT8A 3KXKA 2Q28A 4E5NA 2E5FA 2NUPB 1U65A 3CU5A 2D0DA 3KR2A 3JD0A 4WN9B 4NU0A 2DWCA 4REQA 2WQZA 4DAOA 3PT9A 1IDOA 5KC9A 4PPQA 4CM4B 2PWBA 4MUJA 4DMRA 8AT1A 2C7OA 3GRVA 2BBSA 3Q88A 7MHTA 1F9EA 1QMGA 3QUQA 2C42A 3CLUC 3IAS6 5A9RA 1PFYA 1PYOA 4CG3A 5CBPB 2A9JA 1I51A 3VPBA 4WFIA 2IIPA 2NYVA 2VYVA 1JUDA 1FMTA 1QTIA 2G08A 3AFNA 3GLHB 1Z45A 4TS1A 4TSRA 2J3EA 1F48A 2P3OA 1XNRB 3FFWA 3GHYA 3HN6A 1C41A 4A5OA 4E12A 2OTCA 1U8XX 5JHGB 3QA3E 4AMBA 5JNTA 3NC4A 4G4IA 1ISGA 1KYWA 1CX9B 1XLUA 5LNK6 3BWEA 3PNLA 2HRDA 3F8WA 2VEDA 1WNTA 4X45A 5JWOA 3LL7A 3R40A 3HCNA 4I08A 4HYEA 1JG4A 2BKVA 2CFIA 3KYDB 1VLJA 3M8KA 4LWPA 1P45A 2X6RA 3ZKWA 4DJDC 5FAKA 3KQOA 1BXZA 2HIGA 1AN0A 1DJLA 4IDCA 4UJ3A 3PQ6A 4W5TA 4YDSA 5C32A 2VDLB 3ZWCA 3IILA 4KTTE 3SNKA 4D7AA 4Y6OA 5C1BA 1JJBA 1JJVA 4E46A 4FLMA 4IS2A 1N6NA 1NYQA 1G7CA 4LDJA 4XPIA 5ENZA 2A67A 4YJDA 4EI2A 5FBKA 3HR4A 2J3HA 5J58A 5JI3E 2H2AA 3HKCA 5B2FA 3I5UA 3V4LA 2CJYA 3KU4A 4I1VA 4J1NA 4BUCA 4JAVC 4M0EA 1SQSA 4TSFA 2W70A 3EXIB 1UMBB 1COZA 1XZHA 4EG3A 3BJIC 3IXQA 4ZQIA 4IRXA 3VO1A 4DSTA 1TAUA 1VL2A 1BO6A 3EG9B 4FW8A 1OLXB 1VKNA 4OQDA 2ETVA 3S2YA 3N5CA 3HFRA 4TLBA 1O6GA 2OHIA 4OF4A 1KFKB 1GD1O 3PFBA 4HH4A 1CUVA 1EAYA 1K3UB 1TO6A 4BVGA 4ZCMA 4LJ4A 4UPDA 1G8JA 5JAZA 3HUDA 1P4JA 3IP8A 3AUFA 4WY8A 4HR7A 2ONZA 2D2VA 2PIAA 3CLHA 3EEBA 3Q72A 4MUEA 3X2EA 5BPFA 3PHLA 2BZSA 3EE6A 3B5EA 3RBZA 4DLZA 1ONPA 3WLRA 3ZJYA 4M1MA 1LK5A 4OFXA 1FEZA 2EVWX 2PJDA 4DIOA 5C8DA 4AZSA 2OAP1 2VXYA 1BMDA 1MX1A 4HRXA 4RD0A 4EDFA 5FH9A 2GRAA 3WBKA 5BQ3A 3ZWNA 2BEVA 1QIIA 1JQJC 1NW9B 2PX4A 1PU2A 5CVVA 2WZBA 1AV7A 1B1AA 2QIOA 1CCWA 3BL6A 3PNMA 4JVSB 4RKFA 1K3FA 4WERA 2KBFA 4JP3A 4WBNB 2YXBA 2ZWPA 4B73A 3I62A 1VKZA 3OQVA 4HWKA 16PKA 1BRTA 1MQ9A 1Q7GA 1UEJA 1PZXA 1SUFA 3L1IA 3SQNA 3KDPA 4I7EA 2C4NA 3GLFA 3IMGA 1E8NA 3MCTA 1T6ZA 1VIAA 4DCJA 4UNIA 2HO5A 3VR6A 4B1FA 5CM8B 4JI7B 3NTXA 3ZLUA 2DH5A 1SBZA 3K3PA 2X9NA 1JHPA 2WSSD 2BVNA 1MAVA 2YASA 3JD2A 3PSHA 4P3YA 5C7IO 1PGPA 2LNDA 4BO5A 4HFMA 3TNLA 4YV0A 5I48A 3I2YX 2YVKA 1H8ED 1DARA 2QORA 3LCCA 3PKZA 3P2KA 1DUIA 1VJDA 1ZI6A 4O4JF 2OXIA 1C5KA 4HWPA 2CXRA 4G1BA 5DM0A 1U31A 2AVDA 4FYMA 3KKEA 2ZULA 4HLQB 3WJAA 2XMGA 1N4DA 1KQPA 2BF4A 1EFVB 4GSKA 4J49A 5EHIA 4KOEC 4E11A 3CEMA 4IOMA 3UCXA 1WX1A 4JEHA 1PV2A 1M10A 2AZTA 2JD0A 4EI7A 3RS7A 1QF7A 3B20A 3GC6A 2DZDA 2FGKA 2ZYRA 1M6VB 1C8KA 2C1ZA 1GAQA 3FPFA 3PA8A 4J7XA 4P31A 3H1GA 2O3TA 1M1ZA 3DAYA 3OT5A 2JFZA 4LOKA 4K9LA 4NENB 1A4IA 3OCYA 1XEFA 4ENVA 1YGYA 4QD3A 4UMEA 2DFTA 1PL7A 3R0XA 1J21A 2FSPA 3DHYA 3M9XA 1ZESA 3OJLA 3TMAA 4RTPA 1UDWA 2JCVA 2CFOA 5AKHA 3TW8B 1ZN7A 4LHWA 5A5GA 2XB8A 4C29A 5JCPA 2OGUA 1D4OA 2DPYA 1KDYA 3TXYA 1DZIA 5GVRA 5HQTA 3RVSA 2ZDQA 1OX4B 2I8LA 4I9HA 3MELA 4D42A 4HPWA 4OJQA 2IYEA 1PQYA 3NAQA 2F9LA 1NRWA 1GSOA 2AMVA 2DKNA 3AOEC 3N2KB 3QHQA 1VPVA 4MGIR 3VH1A 4C5BA 1TYAE 1Y37A 2G7ZA 3OSZA 2YV1A 4MQ4A 3N8HA 4HNGA 5DM1A 5T64A 5JQGF 3ME5A 1LPBB 1L5WA 4PLYA 4PYNA 3T9BA 3TS1A 2G9NA 2ZLBA 1QK4A 2XMBA 4JBNA 4N1AA 1QIMA 2I4LA 2M1ZA 3TGWA 1Q15A 4F46A 4ZIRB 2FKAA 2GB4A 3IB3A 3OX4A 3CUSA 1UKZA 1Z18A 1CJUC 2CVFA 2WVGA 1XTJA 3OA2A 1ZRNA 3CB2A 4OJNA 3TW8A 5FTWA 2D2IA 3AP3A 1CY7A 1GNTA 1QLJA 1E3JA 2HHJA 2LCFA 2PIDA 1JEDA 1MU0A 4CBVA 1GGMA 3MJEA 4YWHA 4MQBA 1AKUA 1JLLA 3H4IA 4EO4A 2AJTA 3F1LA 2B34A 3QV1A 2P6OA 2W2KB 2OBFA 4WK4B 5KNLA 4CF6A 2F8TA 1IDN1 1SBHA 4ARUA 2Y6UA 5HF6A 2G0NA 4PYLA 4EDHA 1AIPA 3BK7A 1B6RA 3OZIA 4UUPA 5JZOA 2X42A 3UJDA 4MNTA 3G1UA 2J4CA 4HUTA 2B2NA 1JFRA 4O2LA 3D8SA 3L6RA 3K8ZA 2VSQA 1SVSA 1CDOA 4JQZA 1W8DA 4NONA 4P6VF 5E8RA 1A9ZA 2EGGA 2PKQP 2UZ1A 1IQUA 3GN2A 5DULA 1WUKS 1EHIA 1LDMA 2QN8A 3UK2A 2W6ZA 2NAPA 1R0ZA 3INYA 2FSIA 3HPQA 3R5XA 4JB0A 5F9MA 4YRGA 1Q7BA 4JBXA 3W8RA 3FOFC 1V6CA 4GH5A 2VJQA 2FFRA 1OI7A 2VIIA 1JLRA 5KQLA 1AQ6A 2OBLA 3TI7A 1ST2A 2X0EA 4EJMA 1OB2A 3ISVA 2HDOA 4Y0AA 4X64B 4MKXA 2IH4A 4NCNA 4YAEA 1XWFA 3SBXA 1W29A 3IEKA 5AQ1A 5JAOA 1DKLA 5G0TA 1T9AA 4ZVTA 1UJNA 3HVHA 3PQDA 5EHQA 4BE4A 1TUEA 4EVRA 5FNVB 1RIFA 4ML3A 1CDEA 4NMLA 2COKA 5K6AA 1FS5A 3F7TA 4FFPA 1O57A 2X40A 1P0FA 2FX5A 3MRSA 1TCUA 4IXNA 4Y2RA 5FBWB 4P1ZA 1XRRA 3QBDA 4M21A 4BDSA 2EW2A 2ROQA 1FX0A 5A1TA 3QX9A 5DI3A 1HBJA 1RACA 2BLNA 4AJHA 4TROA 3I01A 1BVUA 3IDZA 1A9QA 4D9GA 3I2JA 5DNDA 3OU2A 3QLUA 4Q1DA 5CVCA 1OV4A 1WLSA 4ZI5A 4P3PA 3VRHA 2GSWA 3B8HA 2X8AA 3HGQA 3TL2A 5HVNA 1A5ZA 5JSFA 3K0AB 1WTAA 3WGHA 2AOWA 1LK7A 1SU6A 4YT8A 3VU0A 5J4HA 2EFGA 1MD9A 2R6CA 2RI6A 3T15A 2GCIA 4BATA 3TIIA 1Q6ZA 4UREA 2ODWA 4XR4A 4S1NA 4NE2A 4YRNA 4IGFA 5SV2A 3KS9A 5AW9A 1ETUA 1NRJB 3RYIA 4EG7A 1CYEA 2BFBA 1H9CA 4TL8A 3WLAA 3JQ7B 3QF7A 3E35A 3N8GA 4LBVA 4NBNA 4E5DA 5BR4A 5HOQA 3B3GA 5E9AA 1WQ1R 3MQ2A 5LP6C 4BNFA 2HA3A 5CX1A 3QE4A 4V24A 2HWXA 3Q40A 3CLUD 2WZQA 1P9LA 2LR0A 3PNKA 2H17A 3A9WA 2O8DB 2H7XA 3DDSA 3GRUA 1EAMA 3D1LA 3SQOA 2HIHA 2OO7A 2ZT6A 4AN1A 4V3BA 4M36A 1E3IA 1E9SA 1PFUA 2E4AA 4TMKA 3SHFA 3G9QA 2TRSB 2JLQA 1GQSA 3U1TA 2GJ4A 2AKAB 2ZJBA 3OCCA 4CM4A 4WBXC 5KOYA 2GZ1A 2EJTA 3ED1A 3LIPA 4NJOA 1A9OA 1GGVA 2ZVQX 3USCS 4TVOA 4E09A 3OWHA 3R5KA 4QXOA 4Q3CA 4BO3A 1KOJA 2GF9A 5KKNB 1G5QA 3UMCA 4E15A 2DRIA 2HKIA 3B8EA 5LFAA 4F21A 1HXHA 3U3OA 3U9LA 1EQAA 2H8GA 2W6JA 2WV7A 1E6KA 4GP9A 2HHAA 3T1YB 3C2QA 4ALNA 1CS0A 4OVKA 2HOQA 1ID1A 4MQEA 4E2ZA 1BE1A 1VG9B 5EJGA 2CNLA 2DHDA 5HBGA 1EFAA 4N5NA 1YMQA 2VDNB 2YZKA 3IVXA 1FXWA 2AOTB 3GY0A 1RADA 1ORRA 1YE3A 1EDBA 3JQRA 4JL6A 4M1QA 5DWQA 4UQPA 1ZCAA 1UJBA 3KZXA 1Q74A 4JSRA 2Y1WA 3O7WA 3OD5A 4XTCS 3WICA 2Q07A 2HX1A 2WWGA 2PZAA 3TOVA 2CEKA 4GAEA 4U6NA 4YP6A 1DAHA 1MJGA 3DTTA 1V7QA 1WF3A 3GD7A 5EE3A 3ORHA 1M2NA 4LS3A 5AKJA 1JP7A 4GKBA 5EKUA 1CR6A 5KAMA 1HLPA 3SLKA 4EW6A 5CEJA 2W90A 2FFQA 1KJIA 3LMKA 3PRHA 4JDPA 5UKDA 1ZAYA 3H05A 1ONSA 2FR8C 3UXMA 3K5WA 4MV5A 1WKVA 2NUAA 3HV2A 2PA3A 3HCCA 3ITKA 5KYXB 2X3FA 3PJRA 3WTCA 5G3ZA 2R1UA 3LCRA 1VE1A 4QYMA 1P91A 5DTRA 3K32A 3DMDA 3U44B 4E2XA 5AHXA 2IV7A 5I9NA 1W0JD 1OGIA 3B36A 1M8PA 4MR7A 2Z2YA 1NMZA 5HDBB 5G1NA 4AZTA 1TMYA 5LLTA 3H8VA 2CL7X 1J9ZA 4P7KA 1P18A 3QSGA 4MQ6A 4X8LA 1L5GB 1HWYA 3ZJVA 3CR8A 5CXXA 2Z57A 4YRCA 4EA7A 2R6JA 1EFRA 1KORA 3IPRA 1I4OA 4KKXB 2JIDA 5T4FA 3K71B 2WJ6A 1U2DC 1IOLA 3D8NA 5DHFA 3OEHA 3VNQA 4BO4A 2Q6VA 3TCKA 1LTKA 3GP3A 4ZRNA 5FBLB 4BFCA 1BD4A 3UAYA 4LVCA 3GG9A 4FZ3A 1QTRA 3BG5A 1XRJA 1S4MA 1Z0DA 3L49A 1M2WA 4KIJA 4DQ0A 4CFYA 5IUJC 2PX3A 2Q5QA 1BCSA 1PF7E 3A14A 4IEIA 5BXYA 3OFKA 2HLPA 5AJZA 3OOJA 4KAXA 2CF5A 5AI6A 1AHIA 2C20A 1XPOA 3KPYA 1Y3BE 3BZBA 4IKOA 1YKGA 3GDFA 3LS2A 1WVMA 4WXHA 3VBEA 2WWTA 3WGLA 5A7FA 4DQLA 1SD1A 3MWJA 3V2HA 3CWZA 3SKVA 2YW2A 3IAAA 3ZZNA 1CZUA 2IUTA 2R9VA 1AKTA 2CB9A 3DE3X 3F78A 4ZOLA 5DP2A 1PBNA 4KBYA 3T8YA 1ID8A 1EQUA 1NP3A 4DWVA 4HAYA 2VSYA 2DHRA 1RYNA 3Q6MA 2P90A 4ND2A 1NXPA 3HZOA 4RTMA 1XUOA 3IV6A 4OU5A 4EHHA 4ZJUA 3L3BA 3HDQA 4HGRA 1PWYE 4WX2B 4W1PA 1G66A 1F6WA 1ULUA 1MH1A 2O6HA 3HI6A 5DW3A 3QXGA 4O29A 5L53A 4LIPD 2OK8A 3EFOA 1T43A 2FFBA 2XUHA 4XVQA 1S89A 2AQHA 3JQCA 4D4MA 1YMVA 1SY7A 2AEEA 4F92B 1QH0A 2C1EA 4NENA 1QP0A 4OQQA 1EJBA 1EX9A 2BTEA 3VR4A 3BWBA 4DDUA 3E9QA 3GCWA 3H3JA 4HX5A 3KLNA 5B3JA 3QEMA 3K0SA 1ZI9A 2P2GA 1SRQA 3A8TA 4G63A 5KNCA 1TUGA 5EWMB 3KJFA 4TMTA 2FPKA 4GZLA 4DR5B 1LDYA 2D1QA 4GEGA 2Q6TA 1G5IA 3FZGA 2R8EA 2X9VA 1LZLA 4L4SA 4NZZA 3TMKA 3VZDA 3WG9A 4MTLA 3WL7A 3H6KA 2PL3A 4I5DA 4IHJA 2OLJA 2AXPA 3DEAA 2OENG 5L3QA 1Z4PX 1IAQA 4I5FA 4KXXA 3N87A 3WZMA 2HJHA 1Z16A 2PRKA 3PCTA 1T0HB 4WL0A 2DTXA 3THYB 1TT7A 1R6DA 2I6QA 2E3JA 2RGUA 4OI2A 5H3CA 2ODEA 4H27A 1VQ1A 1JHMA 5FWXA 3QPAA 5ESWA 1G60A 1SXQA 1I94B 4PZPA 4CUZA 4P5PA 1MIOB 3UWSA 2F3UA 2NZXA 3BRSA 2YJGA 3N70A 3UAGA 3ZXIA 1Z4NA 3A6DA 2NMVA 2HGZA 4RDXA 2DQSA 3P2YA 1J0DA 1L8LA 2GAAA 4YS6A 1K97A 5BSHA 2RCYA 1G8GA 2IEBA 4TV8A 3UFXA 2D1SA 4KWCA 3O7MA 4TYNA 4J8PA 2AXQA 3FDZB 4XWOA 3H84A 3GIWA 2HMUA 3C48A 1Y7HA 1GJRA 2VXOA 5T67A 1CT9A 1CP3A 1HFJA 3HK2A 2V65A 2M2IA 3B5IA 1HEIA 1HZJA 2QAJA 3H5TA 4Z4QA 2HLHA 3P5SA 2FYTA 1MC5A 1X70A 1DFIA 2YCLA 3F4BA 5GV8A 4EELA 4HK4A 3KQQA 5ERXA 4ZT5A 5JWHA 2PE5A 2VNJA 1D2AA 4R0NA 1WB9A 2O8CB 2CLKB 4ZV7A 4F56A 4LJ8A 4W7HA 1RYMA 3EG5A 3P4UA 4R4JA 3S1AA 3GBPA 3FW1A 3GRFA 3LY8A 3C45A 3G17A 3MS4A 2WF8A 3EUAA 1XTKA 4WXYB 1XPJA 4EY5A 1YNOA 1RXIA 4EPXA 1PQUA 4DVGA 4V1CI 2PQ2A 2Q41A 4DANA 2IXBA 3BDIA 1IBCA 4BFVA 4YV2A 4UZSA 5JSQA 2ZUVA 1KP9A 3L8HA 3UM9A 3AJRA 2X7HA 1AUPA 1S1CA 1GCIA 1PWEA 2WTBA 5WRFA 4LF5B 1DLJA 1XQ1A 2ODQA 1EWKA 1DUVG 3KQUA 5JALA 2PR7A 3X1KA 4HBZA 6NULA 3Q7IA 5AO9A 4C7VA 4ZT7A 2IHKA 4KXUA 3DTVD 3U60B 2AOXA 1KBZA 1EFUA 2CVQA 4M4SA 4N5IX 3UICA 2FWPA 4YRZA 4XEUA 3JAWA 1TM3E 4YJ2B 4D5GA 3LCUA 2W71A 1FLVA 3H2ZA 5FI0B 3QXXA 4IMIB 4ZYVA 1Z0UA 3LBAA 3T1TA 2PANA 1W6RA 1JECA 4Y2HA 3C6BA 1FNCA 4AUNA 3DW1X 1GTJ1 4IIYA 3TJZA 5K0FA 2GYUA 2HN9A 2QENA 2ZJ4A 4ARZB 4EW1A 1QANA 4OYYA 1SOVA 3GL9A 2PPLA 3L0BA 5JC8A 3FMGA 1AKNA