1GQOA

Type ii dehydroquinase from bacillus subtilis
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
141
structure length
141
Chain Sequence
b'PHFLILNGPNVNRLGSREPEVFGRQTLTDIETDLFQFAEALHIQLTFFQSNHEGDLIDAIHEAEEQYSGIVLNPGALSHYSYAIRDAVSSISLPVVEVHLSNLYAREEFRHQSVIAPVAKGQIVGLGAEGYKLAVRYLLSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEHYDROQUINASE
publication title Crystal Structure of the Type II Dehydroquinase from Bacillus Subtilis
rcsb
source organism Bacillus subtilis
molecule tags Lyase
total genus 49
structure length 141
sequence length 141
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, X, Y
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2001-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 1gqoA00
3N86A 3N87A 1GU1A 4B6SA 1GQOA 2WKSA 2XB9A 4KIUA 2Y76A 5B6PA 4B6QA 2XD9A 1H05A 2XB8A 4KIJA 4CIXA 1V1JA 3KIPA 2XDAA 4ZC1A 5WRFA 4CKXA 1UQRA 2BT4A 2C4VA 4CKZA 4CKWA 4L8LA 4KIWA 1H0SA 4CKYA 4CIYA 2C4WA 1J2YA 4CIVA 4RHCA 4CIWA 2Y77A 4RC9A 4B6RA 2UYGA 1H0RA 3LWZA 4KI7A 4B6OA 1D0IA 1GTZA 1GU0A 2Y71A 4V0SA 3U80A 3N7AA 3N8KA 2CJFA 4B6PA 4CL0A 3N8NA 3N59A 2DHQA 3N76A 4CKWB 2C57A
chains in the Genus database with same CATH superfamily
3I6YA 1IEVA 4MJLA 1K75A 3INYA 4HQFA 3HCFA 1H4VB 3IX7A 1UQTA 1WAMA 4MGEA 4MTLA 4UCWA 4UBNA 3GEMA 4BFVA 4A0FA 3BGSA 4BCBA 4YPOA 1P9NA 3G9QA 5CA1B 1ISPA 2HA5A 3OZUA 4W9RA 2L69A 3H5VA 5CUQA 2P9GA 2Q7OE 4UZEA 4NPHA 1NKVA 3IEVA 2I4RA 1K6JA 1E1NA 4UTZA 3GFGA 3CZ4A 2WY2D 3ZCQA 3QKUA 2BFEA 5JJLA 5BV7A 3DOHA 1K63A 4RV5A 4LXHA 3TEJA 2CD7A 1JIJA 4JDUA 1DIHA 1E1CA 1TTHA 3AHJA 2WHXA 3FHLA 4MVWA 2VLBA 4WZBB 3SK0A 4HEHA 3GJ0A 3C45A 2OYCA 6Q21A 1XZNA 4GPTA 1PFWA 3SBOA 1AZTA 3IJPA 3IULA 1GCIA 1SXHA 3IIKA 5ALZA 4KYTA 1D1PA 2G4VA 2Z5LA 3WZLA 3RIMA 2HCBA 5EE1A 3LOQA 4EF5A 5AW7A 3OY7A 3R5FA 2PSSA 2ZB2A 3L3BA 4DZRA 2LP4Y 2HWXA 4I81A 1DUSA 1O54A 1QP8A 3DE3X 3ETDA 1PEKE 3GCWA 1FFXA 1N0IA 4IDHA 4PYOA 5DM2A 3T7TA 3V1LA 2QX7A 4JBGA 2UXDB 3EG9B 3I5YA 3LZCA 3M3PA 1L4MA 2AYYA 3M6FA 4H6PA 1GR0A 1LDYA 5DNWA 3BH6A 4C05A 1MTOA 5FF9A 3U4CA 5ARBA 1XEXA 4NABA 2EJBA 2MIIA 4X24A 1L5KA 1QIDA 3WHIA 5JEEA 4P3OA 1JHYA 1UZNA 2XB9A 1UC9A 3JATA 3O93A 2CCGA 4HG2A 4BLQA 1P7VA 1DIBA 1R0SA 2Z8YA 4XGQA 4GRDA 3CZPA 3A06A 3W9UA 1JQ5A 3WNDA 4Q4AB 4QYSA 2PKYX 4YRBA 5LQAA 2W2TA 3OFND 5INTA 4B8WA 1P7WA 3AUKA 3L9XA 3OLZA 1P4SA 5L6LB 2C04A 1X87A 2ZI9A 1T8UA 2OZLA 2CCKA 2R11A 2WUDA 4JKYA 5K20A 4NULA 5TRTA 1V4BA 1DDOA 1ZN8A 2X8WA 1M8GA 3GGGA 3JVVA 3HGMA 3OA2A 4LTDA 1N6KA 3OH8A 3TN7A 5JBQA 4P3YA 3EZGA 3J80A 1EB8A 3AVQA 4GEGA 2GJ8A 3QMVA 4YYEA 3E8XA 3FKJA 4QUHA 4EY4A 1FVFA 2YHSA 4J9UE 5THXA 4F9TA 3MG9A 2IYRA 3CZQA 1LA2A 1XXHB 1IZ8A 2IDJA 1UANA 2IHUA 3CN9A 8GPBA 1CJBA 2KMLA 2TMGA 5DTEA 3ZHSA 2VT7A 3N28A 4J1TA 4QO8A 5CFZA 4KBYA 4EEKA 5I4CA 2H07A 5JC8A 3H3JA 3SQWA 2DTXA 2OR3A 1GSIA 2DZDA 3B6IA 4XM0A 1C4WA 2FQWA 1X1CA 4GWKA 5HHTA 3K9HA 3VR4A 2BCJQ 5E4YA 3UMBA 2ZIFA 2ZEJA 2YHUA 4G07A 3Q0EA 4NMXB 2Y0DA 1UZLA 3DAYA 4KDEA 1V7ZA 4H60A 4AJ2A 4FZ5A 1PR5A 3OTGA 1MJ5A 4XASA 4ZFNA 1OC2A 4PZUA 4D44A 1TCUA 1W4BA 4MW4A 5IVKA 2P2CA 2OAQ1 1J7KA 1UOEA 2ODBA 2YHIA 3TQQA 3CNBA 3FKSA 1E6WA 2H4YA 5CCBA 5ILGA 4OQQA 4WI1A 2ODTX 3TOCA 2REBA 1MB3A 2X7JA 4XX0B 3RFFA 2P68A 3WL3A 4RY9A 4LXUA 3K2IA 1N5IA 2JGKA 4KKXB 5CA0B 2ZSDA 3QBVA 2YFHA 1U7XA 2ODPA 4C4OA 3EE6A 3R7DA 4A1FA 1QDLB 2EQAA 2GCPA 3H9JA 3HJRA 5FL7A 4FQ7A 3I4CA 4HDAA 1QB8A 1U0NA 3D02A 4KOEC 4UXIA 2UAGA 3LFHA 4MV5A 1T4BA 1ZSYA 3NETA 4UCFA 3TXXA 4BN0A 4OJYA 4D4IA 1Z4MA 3IUQA 3KCQA 3MCUA 4JBLA 3WS7A 5M34A 1V3QE 1WV1A 3VTZA 1ABBA 2W90A 1Y0BA 3I34X 4G0XA 4S2EA 3CVWA 4R6XA 2BFFB 1MOSA 3A28A 3GDWA 1EP9A 1ZMRA 1ZXXA 1QGUB 2JGDB 3LKZA 1MVOA 3N7UA 2A9KA 1GNQA 1R8QA 3PDIA 2OB2A 1HLPA 5KVSA 1OH6A 3ELYA 3V6LA 5HF8A 1CVIA 2O5EA 3ZGZA 4QQRA 3GGCA 1N2BA 1FFDA 1U5CA 2ZULA 4WOBA 4LZZA 1V9LA 2X3UA 1M2EA 1Q0RA 2VEOA 4EUHA 3AHIA 1Z6PA 4L9SA 1VL0A 4WKPA 2H5LA 2O23A 4IKOA 4RPLA 4RS3A 4LDPA 1MTZA 4EFLA 4F9FA 3EZFA 1JAIA 1GKKA 1U4OA 4K8OA 5ESRA 5J5AA 4D6PA 2WUVA 5ALJA 1KP9A 1W87A 3I58A 3AHDA 2ONJA 5CJ2A 1ABEA 1OHHD 2CY0A 4U7WA 1Y8RA 4HAVA 2MSCB 2WAXA 4G63A 1K6EA 3MLAA 4RVSA 3UH0A 4TQUS 2A58A 2Z56A 3ICPA 2FP4B 3RIGA 4AM8A 1X80B 4OCZA 3I6MA 1GRVA 3OA0A 2X0FA 4OLAA 1T2CA 2X4IA 4I9HA 1R4MA 1OREA 2H06A 2HO5A 2WTAA 4NH4A 3R7BA 4Q4HA 4DVGA 2AIRA 1Z6XA 5E1MA 4YFYA 1L5GB 1JQDA 2DY1A 1Z7EA 1PV1A 2B4AA 1XHLA 1SQFA 3ND8A 1ODJA 2JHGA 4WLNA 5E9WA 4CDGA 1CRZA 1OZ0A 1FFAA 5DHSA 5T3YA 3KZOA 4RTOA 2J87A 1LZLA 4ABYA 3DJFA 4AJEA 1Z2NX 2ZTLA 4KAJA 1AJEA 4LYAA 5JRZA 3KT0A 4MHOA 3VH2A 2Z2XA 4LX8A 4G5QA 1UPBA 3DOCA 4GL4A 3R9XA 1DBSA 3VZCA 4HUJA 4EITA 5HKKA 2FWAA 3OKCA 2QTWB 3ZQJA 3TG8A 2ODQA 3BFXA 5FLEX 5LNK6 3RS8A 1E2EA 4WACA 3PVSA 1T3HA 4L4YA 4YUVA 1GM5A 2I6TA 3DBVO 2YZGA 4EQ6B 2CLKB 4YRMA 3D2BA 2FUEA 2JFZA 5JLAA 1XSEA 2VJQA 1J0AA 1EZ4A 5F7JA 1AKYA 2DWPA 4YXWA 5KC8A 1B4DA 5ARDA 1DRWA 4L50A 4NS4A 2EC5A 4OFXA 1YIAA 3LCVB 4IDNA 1C29B 4O4LB 4BZQA 3W5IA 3D81A 3QFCA 1B1AA 4YJ3B 1WBBA 1MO4A 3ZJYA 2DQKA 3TVDA 2V3VA 4OAPA 3GIWA 4ENQA 1WB9A 3WY9A 3AR8A 2PVSA 4RIGA 4H35A 2WJ4A 1P8JA 2XUFA 3I6IA 2OYRA 2AF3C 1D6SA 1EE1A 1LPMA 2EYQA 3FTPA 2GDJA 3IUBA 3SC2B 4EBFA 1T4GA 3ZVKA 4OQFA 3ZV5A 1QIHA 2QGFA 4KXNA 3MJCA 3ZY3A 3ERCA 2X2EA 1Z9BA 3G0BA 1YFKA 3DE5X 1SC9A 4P83A 5HDQA 2I2CA 1TL7C 2XCIA 2IQIA 5DHRA 5C1PA 5LM3A 5E9AA 4DLBA 5TSDA 2WWRA 1W59A 1NWHA 1YR2A 2NO7A 3Q7PA 4UULA 4Y6PA 3QKSA 4E09A 1U0SY 2A0YA 2PXHA 3SBXA 3WIDA 1KH3A 3QLEA 2X1VA 4YR7A 1C9NA 2P4SA 4QLAA 3V8PA 5JSZB 3AB7A 5KJ6A 3HRIA 4QXMA 4E5PA 1QIGA 3E2MA 3CRMA 3OUZA 1DC3A 3OIGA 2ZWPA 1ADBA 4ME6A 2P0YA 1Q91A 4OO3A 1BXRB 4KQ9A 1C9YA 5FEUA 4UTOA 2RAPA 3FMGA 5T6MA 2VIIA 2G1AA 3H18A 3PGLA 2E4WA 4Z4EA 1IONA 4J3FA 3F8TA 4IDEA 4FHEA 2IYYA 2WT4A 5LXTF 4EVSA 2NUPA 1WF3A 3VR4D 3FVVA 2O48X 3ZE7A 4WBNB 2WWWA 4OMFG 3Q3GE 5BOVA 5KYNA 4UE3S 3JPWA 4E31A 2F3QA 3ZHXA 1N5JA 3U3XA 1OIWA 4N0DA 2O3JA 3UBMA 2BFNA 1PWXA 2COEA 1XFAA 2AXQA 2Y1DA 4G8BA 3FKSD 4PIPA 1K5HA 1TC2A 3DPIA 3HCBA 4KQFA 2QSUA 3O1HB 3RU9A 3X1YA 4B4KA 2HDNB 3IEMA 1R0LA 1XWFA 2W8ZA 4RVNA 3RSFA 1UXHA 5ADUS 3OU7A 3U3RA 3RT9A 2GM5A 1Q14A 3G6KA 1VL2A 3K31A 1OJLA 3AXSA 1Z45A 1ZK0A 1SWVA 1Z56C 4L3WA 5JMWA 3CLTD 1BXKA 4UAVA 2DFNA 5FL7D 4R3WA 3FMVA 4PR3A 3OBIA 4NONA 4MW6A 1P3DA 4S1VA 1ESZA 4UCXA 1ZDMA 1U65A 1UDRA 1OXVA 1XA4A 3H2HA 1KOFA 3D6JA 3Q8XB 3U4DA 3X1DA 4UREA 4Q93A 5ADVA 1U28A 3PZBA 4RPGA 4ZANA 5KDDA 5TNXA 2K5UA 5BSUA 4U5XA 3M7IA 3WOVA 4FHZA 4B71A 4BBJA 5IAGA 2Q8PA 2P9FA 3E1GA 5FBZA 4BECA 1JEOA 3USZA 4QPCA 2ZYDA 3FPEA 4IX9A 2E85A 2QRMA 3AG6A 3MYYA 5LXTA 3KHTA 3NBZC 1Z7YA 2YXPX 1PFGA 3BB4A 3VR3A 2CLHB 3AKEA 1M6VB 2WWGA 1U7PA 3FDFA 3HWSA 3TZBA 5LCXA 2GR9A 4LGMA 1WMFA 3WBFA 2QHXA 1JPNA 3DXYA 5KAMA 5DHPA 2BFDA 4HNUA 4Y1RA 1XAJA 1TXGA 4XKJA 1SCAA 4E30A 2HSDA 3AL2A 3QNUA 4BRWA 4CKXA 5T7BA 3SZRA 4QBTA 3ZEAA 3PNMA 4KQHA 3JQAB 1DWOA 2AJBA 3BXOA 4U7FA 1IY8A 3QWBA 3ZC3A 3USES 4YRIA 3TGLA 1WHTB 4G8JA 4LHEA 4Q37A 5IFLA 2D3WA 3L7BA 5JYCA 4KHPB 1ISGA 2EHJA 3U4MA 4EENA 4UD2A 4Q1VA 4Y9RA 3U3DA 4ZD6A 1CEQA 4EP1A 4PIMA 5HXAA 4C76A 5CDFA 2ZJBA 4B6OA 4LRUA 3DVLA 1I80A 4FMCF 3MAGA 3HG7A 3UWPA 3VSBA 1QH8B 1CD5A 1A5SB 3FB4A 5CRIA 7REQA 2IYSA 1E79A 1YZGA 3EGEA 4OXXA 4A73A 4AMUA 5JJ5A 2UYOA 3R7SA 3V1UA 2VUSA 1RVDA 4IJVA 2C9BA 3N8GA 4OJMX 4R1SA 4WA8A 4O59O 1OPXA 3X2EA 4FM9A 4URYR 4NYJR 1L8AA 2XITA 4KUHA 4OAQA 1XF1A 3O9ZA 4MMXB 4PGGA 4HBGA 1EJBA 1KJIA 3ONFA 4BUZA 2EX1A 1RYDA 3G0DA 3Q1KA 1RBMA 5EJAA 4OP3A 4AJHA 3LP5A 2RGEA 2GZDA 3PUYA 1ND6A 3QPVA 3IBCA 5K7SA 1IWOA 2QY6A 5HKKD 3WRXA 4KR9A 3TKAA 4Y2GA 4PLVA 4AS2A 4HNVA 3W7VA 3WJ7A 4YQZA 2YV1A 1E1MA 1E1LA 2PKEA 2PLWA 2PZAA 4QXOA 5A9SB 4O4JF 2WRZA 3LA8A 4B32A 3T94A 4DLNA 2AA3A 2NIPA 1P81A 2PWBA 4PSDA 3R23A 3E7XA 5IMBA 2CMHA 4CMCA 3UFXB 5JLJA 1FFWA 4YP6A 1JFVA 1DIRA 1E4OA 4YXWD 3IQEA 4L5CA 4UHHA 3C5CA 2IXFA 2BEKA 5IMSA 2PUCA 1LF0A 4RF5A 3ZYCA 2VF8A 1XKXA 3FETA 1ZRNA 1H93A 2PWYA 4MPPA 4B3XA 4LXTA 1SXJE 3DBLB 1KIMA 1ZNXA 4CZ2A 2H17A 2PL5A 2WIGA 2Q4RA 1N6NA 3CLUC 5HKLA 4GOKA 4X1KA 5H7XA 5D5HA 1XPRA 1OVGA 4XDYA 4E11A 1XRSB 5GVSA 4JJIA 5IWCA 4F11A 2YYSA 3BGOS 4BNGA 2HC9A 1HTTA 1T5IA 2H85A 3GP5A 2VAMA 1QM5A 1A97A 2B8WA 1QV6A 2V0CA 1I2BA 1TMYA 3NNNA 1OBOA 2REQB 4MV0A 3I04A 4EMBA 3CF4A 5ICMA 3VAAA 3KYCB 2XOEA 2HREA 3K05A 3H04A 3NHKA 5ESDA 1EZZA 3CR3C 1UBJS 3FKQA 3HZOA 3V48A 2I7XA 5EWLB 4GI3A 1YQXA 1S2LA 1PUXA 2O7VA 3BBPA 3R8CA 3QUBA 5LQDA 2ZI3A 3RV3A 1S1MA 4ZZ0A 5J2TB 1B41A 1NF3A 4D25A 4IUCS 4LOHA 2XYVA 2ZZMA 2EF1A 2QDKA 3NTQA 1UDXA 1TQ8A 5ITZB 1AUXA 1E4EA 3G17A 4CKEA 2ZRBA 4B8YA 1AZWA 3KQHA 1NLYA 1LH0A 5CMLA 3LVRE 4AT1A 3PGMA 1GU1A 2F4NA 1AHIA 2MSNA 4QIHA 3H0EA 1XQYA 2Q29A 4TMYA 2HJWA 4JLNA 1PP4A 2BI7A 2ZAIA 3GRFA 4NYJQ 1QB7A 4OK5A 3B2QA 4RKFA 1UAAA 1BMDA 2HF2A 1FMFA 4O2BF 1Z5UA 3M3DA 1D1TA 4M22A 2G17A 3HFSA 1Z4NA 2QTMA 3AR9A 4N12A 2QVGA 3CF6R 1IN4A 3F97A 5AW5A 3SJ7A 1QZTA 5EMKA 2JJMA 3VHXA 3WKCA 1KK3A 1M74A 4JR2A 5LR6A 4EW6A 2E5LB 2P40A 1NNUA 1JAZA 1NVDA 2O3RA 3DP7A 4QEKA 5CK4A 4KR3A 5JANA 2GNAA 2RBKA 3U4QB 2X14A 3IILA 1AKVA 3H1TA 3WWOA 2IYFA 1FFGA 2AUNA 3DZHA 5BXYA 2EFDB 1BWQA 3NYQA 3W5AA 5L45A 1LSUA 3NASA 3DTTA 3SOZA 4J3JA 3SHFA 3JQFA 4NMWA 3UV6A 4QPJC 3DMDA 2EDAA 2ZR8A 2ZYGA 2XIJA 5HIJA 4INJA 3SR4A 3KQQA 1KRWA 2DLNA 1AS2A 1NJ1A 2HOQA 1MVNA 2Q0HA 4PZDA 5F4ZA 3ICVA 1CDOA 1ZIPA 1ECJA 3CF2A 3W5SA 5FWDA 5IC5A 5CT5A 2BI4A 1JIKA 4F6CA 1XJCA 4JU8A 4XAQA 3SF0A 4X93A 1KPHA 5IEJA 4DABA 1CSEE 4LC0A 1QVZA 1GAJA 2ZRDA 3ZU4A 4GO1A 3FWHA 3QPCA 3WA7A 1CS4C 2PJUA 4ZIRB 2ONCA 2P1RA 2Q49A 1GADO 3PHCA 4YJFA 1AU9A 2PMEA 3VR3D 5JIBA 3IH5A 2XNCA 3V42A 2CFOA 4PAGA 5GGYA 5F9FA 3HCDA 4DGQA 4CR6A 1ISIA 5DASA 4BNDB 3T5CA 4I6GA 2Q6IA 4O2BA 5LKAA 3DLTA 3WR5A 2JFPA 3AL3A 4GBGA 3N0RA 3O2NA 2V0GA 3CN7A 2GPSA 4JJ7A 2NZWA 3FTEA 2D1YA 1WPRA 3QNMA 4PG7A 3IMKA 3K6KA 5EZ5A 3ETEA 4D3YA 5BORA 3ENWA 2H16A 5L7WA 2MSWA 3EXHB 5FTNA 3V9AA 1Z3CA 1R6AA 3CUTA 1W8IA 4LF5B 2I66A 4COOA 4F60A 4O4HB 3RVKA 3VGJA 2FGKA 5JZBA 4OHYA 1H0RA 4ALLA 5EHZA 1WNFA 2L17A 1G38A 4OMDA 2J1LA 1T0BA 3JPYA 3L1JA 1Q6YA 4X8HA 3VI4B 3L7YA 4LZJA 1CR1A 4Z51A 1EUQA 4EA9A 1KVTA 1O4VA 3CCCA 4QHSA 4UM9D 4C08A 1E79D 1RI5A 3R44A 1LLQA 2HK7A 5DWVA 5U9CA 1LTQA 3VYWA 4BAUA 2CFTA 5D01A 3ZDFA 2NU8B 5TVGA 1IHXA 2WAMA 3OZXA 5I7EA 4JROA 3OHPA 5EIAA 4IDPA 4JOBA 2YBDA 2RI0A 4S24A 4P35A 5T8KC 2YRWA 1HY3A 2EIHA 2PGDA 2I7VA 3TNLA 4B2YA 4N4AA 3GFRA 3MQ4A 2YOHA 5CFOA 2IP4A 4RLQA 3FWYA 3C74A 3W3ZB 1WBDA 2JCXA 2Z57A 1THTA 2AKYA 4AZSA 2EWVA 4YRLA 1V1MA 5BSFA 3KB2A 3OPNA 1O95C 1GZSA 3NAZA 5I7RA 4JVNA 4KC0A 3VPBA 1TK9A 1WQ3A 3U4IA 4WUVA 2FRDC 1K86A 3GVXA 1EI9A 2DBYA 5JD5A 4TTSA 2C00A 1J42A 2GCOB 2UZIR 3NJ4A 5ICFA 1ECPA 4Q16A 1IZ9A 4X1IA 2WYIA 1AQIA 4JVOA 1PI3A 4IIYA 3QBEA 1Y1SA 2GJ4A 4FGZA 1WXDA 4TLBA 5G0SA 4LTMA 5BMVF 5LJIA 2P75A 4DSAA 4J9VA 2KE5A 2BEUB 1HLGA 3AJ9A 4NQRA 2CVHA 4L4SA 4WLFA 2J07A 5JH7F 1CZHA 1I1QB 2GS9A 4WMLA 3VDRA 1GPKA 4L73A 5CT8A 4JYCA 1X7ZA 4P36A 4FBMA 1G8PA 1TCCA 1OWPA 1QTNA 3GG2A 3RS5A 1Q0UA 2ZTMA 1G6KA 1YQGA 3AEUB 3QLTA 2XBMA 3M6MD 1GA4A 1LBTA 2CF6A 2X0RA 5WRFA 3PTAA 3LQ4A 3RC2A 1PWZA 5KAPA 4NRDA 4M7OA 1DAOA 1PVVA 4GX0A 3QY0A 5HQ3B 2DJIA 2JA2A 1Q22A 4IINA 5FR1A 1UXGA 4NEQA 3L4KA 4PPFA 1GILA 5DIFA 4E4TA 3GLIB 1ZCZA 5FPPA 2C4HA 4WGGA 2DHEA 1DKMA 2PBRA 5MGBA 1I9GA 3O31A 3BXPA 4NS1A 4IHAA 3RT7A 1WZCA 4O8CA 4O02B 5E2BA 2QT1A 1D8AA 3IDOA 1M5UA 2QLLA 4H9GA 3D3WB 4FS8A 1FDRA 3DW3X 1JHRA 3R6LA 1QPZA 4B3RB 5SY4A 2A92A 2IP1A 5FULA 5IBQA 3RRMA 3WWYA 3HBJA 4X71A 3NAGA 3P0IA 3RS9A 1U5AA 5BMVA 2GHIA 1TO1E 3M6VA 5JT1A 5K3OA 5G3ZA 2IPNA 1W2GA 5SYAA 3GQBB 4DV4B 4OQZA 5JH7A 1PLJA 4JBIA 3TSCA 4LJLA 3CIFA 1BFDA 3HACA 3V80A 1JA9A 3TRHA 2HF8A 4RX1A 3NTLA 4LY3A 4F56A 3N8NA 1L5SA 1QIJA 1NBIA 3HCOA 2WJ3A 2RONA 3QW4B 1UP6A 2DPMA 4RYDA 3OPVA 4EY8A 2ZBQA 4GH5A 4B3BA 1NC3A 4D80A 2FUG6 1KQGA 1WDTA 3W9SA 5HG0A 2QLNA 3TH5A 5K5EA 1NW3A 1F4VA 1UFQA 1ULZA 3QMPA 4TMFA 1XTVA 2WB4A 4JLPA 2DWUA 4HDMB 2JFFA 3VVMA 4AF6A 3A9VA 5AXCA 4D9JA 5KS2A 1QP0A 1CY1A 4YCBA 1YR6A 4AP9A 1SHKA 5LMCA 2Q2QA 2HLNA 5AOVA 3U7QA 1G4AE 3UJDA 1DS6A 4Y2XA 1LRKA 2I3ZA 4FDTA 2ON6A 1M2WA 5AUNB 4MRMB 3ETJA 1VMAA 4Z1MA 3ZU2A 2F48A 2MOKA 4ZDJA 4PLWA 3UTDA 1Q77A 4BNMA 4HF7A 5KOJA 2IFTA 5LZ9A 1NJ5A 3MB8A 5JDCA 1YRWA 3ZZUA 3VPHA 2EQ5A 3I9FA 4BJ6A 2CXHA 2Z09A 1QMGA 4G89A 1PBTA 5G0TA 3K6RA 5CB0A 4JBHA 4YJGA 1VA5A 1ZCFA 3DAOA 4L28A 2ZB4A 4D43A 3V34A 1TI7A 5BW5A 3OQIA 2R3SA 3IMFA 1SXJA 1G2OA 4JL5A 1Q0LA 1A4IA 3JQEA 3QEBZ 3DVQX 1WCXA 4IIFA 1LV8A 1K88A 1KFBB 1N9KA 5J40A 3MHPA 1WXWA 2H59A 1ZO8A 2NU7B 3B9PA 4CM1A 1JDBC 2W2NA 3UUGA 1Z2PX 4O33A 2NT3A 3RRYA 3TLZA 2EBWA 4JQCA 2IPLA 4MTCA 5T4BA 3ZBUA 5DTQA 1X6VA 2B7CA 2DKFA 1JB9A 2GD1O 3NKLA 3QX9A 3ND7A 4P4GA 4JT4A 2ATEA 4C04A 5K0BA 5B6IA 3M82A 1VA4A 2ZRQA 2IYTA 4HB2A 4OBEA 1L7NA 2QM0A 4KXLA 1EHYA 4E7PA 1X1RA 1NBWB 3MRXA 2HIMA 2OA0A 2H4FA 4RGYA 4TKVA 3IGFA 2GKOA 3L7MA 1JVSA 1WCV1 2G9VA 4EYOA 2V1UA 1Z35A 4MJ3A 1SIBE 2D1RA 1U8XX 2ET6A 3Q40A 3ZGYA 5ALPA 3OEYA 3S4YA 4P4TA 4CN8A 4WXYB 3V3KA 2X5KO 2BLNA 5IYZB 1U8UA 2ZM6B 3EXG1 3F0TA 3K6SA 5ENZA 1KZ1A 3C16C 4GOJA 2Y1OA 1DKRA 3I8XA 5H3LA 2V7WA 3S1LA 4B3IA 1ZA1A 3EGDB 3KPWA 1I2DA 3IQHX 1FL9A 2JEYA 4DTIA 2RB4A 4B48A 1YGYA 2BE7A 4EW1A 5GJVC 2J3DA 2JFGA 2Q3BA 5DB4A 3UCFA 4BEJA 3LCJA 1ORIA 2CB0A 2VJAA 3AFOA 3C5EA 1MC8A 3OZGA 3GNQA 1K0FA 5EQFA 1U0HC 3PEVA 2VL7A 4HMPA 4WFJA 2G1KA 2QS9A 2DKOA 1UBSB 2GH1A 2C1XA 3F9CA 1PFQA 4G1BA 4LZNA 3OETA 4M6WB 1FTYA 2HJSA 1Y63A 2PPVA 3QQ5A 2GK6A 5DNAA 3SEZA 3T4PA 4B5KA 2PN1A 3DLHA 3OF3A 1TF5A 5BP7A 3NVAA 2A1TR 1NPYA 2VZLA 3WKDA 1DOAA 1EGHA 4KYUA 2IZ6A 3CH4B 3WO0A 4LJ6A 4AAYA 3L5OA 1JHVA 4G81A 4AD8A 3R40A 4FR2A 3JWIA 1SXGA 4JSRA 4MUYA 4NOLA 3SXUA 5L95A 2B3DA 1XL1A 2QAGB 2B37A 4UHBA 3HV2A 4PCVA 1WVMA 1JJVA 3LF1A 4B7AA 1ODFA 2WWHA 2F1KA 3G2MA 4FFVA 4AJPA 1O8BA 2PZLA 5AM0A 4MX8A 4HGYA 3V1TC 4Y67A 3ITNA 2IKQA 1H2AS 5CVDA 5FBKA 5FB3A 4BTEA 2YJGA 3UGKA 3YASA 5C8VA 3T54A 1KVUA 3T38A 1B23P 1Z29A 3L6EA 3QWHA 3C2QA 1G6OA 3TQSA 4CG0A 4O2AB 3H1PA 3MXOA 3T1QA 3V1NA 1KK2A 4BMXA 2ZQ5A 2HI0A 4Q00A 4C6SA 4UM7A 3BKXA 3C3KA 4GICA 4NYMR 3SIPA 3IKJA 3I62A 2LW7A 4CR8A 5LYJB 1U7DA 5J4YA 4D41A 4G86A 2FLWA 3LT4A 2XX3A 3QG5A 3R6WA 3P2MA 4DLZA 4YCCA 1A8IA 3GXOA 3ZNNA 2AOTB 2JC3A 4HEQA 1YOVA 1FMTA 2P4QA 1QS0A 3EVAA 2X58A 4IJQA 3ZWCA 4N48A 3IYLW 4V0OA 1EFAA 1P6UA 1VPWA 1C1XB 3GGPA 1L7EA 1PQWA 4WFKA 5B3KA 1H5NA 1T3GA 3V8VA 2FSHA 4GYWA 2OAGA 1ZITA 1IQUA 3MUNA 4KK3A 3LD9A 4HTAA 3AP1A 3EZYA 5TQ0B 4RJIA 5KX5F 3ND5A 4HN2A 3DTVA 1TM1E 3I0NA 4PG4A 3ZOZA 4MKZA 1DUIA 3KSBC 4XB2A 2GZAA 4P5DA 4HDQB 3ZVLA 2HT6A 4FYXA 1TNDA 3GIDA 3STXA 1SEPA 2Q0QA 2ZU6A 2C97A 3NX4A 5B3JA 5ADWA 1BD3A 5JSHA 4PXSA 1WMDA 1BDIA 5DOVA 3W9YA 2BTEA 1Q1AA 5JFGA 1LWNA 3EVEA 4M9RA 1WB4A 4MWBA 3RTGA 1YI1A 2PVPA 2YASA 5MHTA 3S1AA 4Q1EA 5AHWA 1HDZA 3E81A 1YZQA 4JB0A 1E18A 1FU4A 3M81A 4IILA 3CZCA 1JQBA 1RQPA 3HDYA 3HVJA 5DBEX 5JECA 1P1FA 3F4KA 1HE1C 1M5TA 4H7KA 4KQWA 5EKUA 3IL2A 3PK0A 3WBBA 3QX3A 2ZUCA 1ZX1A 1BS9A 1ZBDA 4ZK6A 3T12A 4RELA 3PDWA 2OK8A 4C20A 1EHCA 2JAUA 2PNJA 2WLTA 3EVFA 1DAEA 2YFYA 5ITSA 4CM4B 1PW7A 4IQ8A 2VDWA 1YBAA 4CKBA 2X9QA 4YCAA 1P80A 5JAOA 4HFNA 2IU6A 3DONA 3GQVA 1HE3A 1GITA 3BA6A 2QNRA 4DEXA 2GVDC 3HBNA 4I55B 1CG6A 1FYEA 1QYRA 2OMEA 3K1ZA 3G2QA 3I4FA 4L22A 4FR5A 4BB9A 1PUJA 2XVYA 4IGEA 1F4PA 4Z1MD 1PNVA 1XK7A 2ZBUA 4FT4A 4KSCA 3RHFA 3RG8A 1G42A 1XDGA 4RIIA 1KHHA 5GZ1A 1H3NA 1SG6A 2VAVA 4QOEA 2PGIA 4MQLA 4OH1A 5FUQA 5JQGA 1EXDA 4H3HB 4OYRA 2NUTA 4BX2A 1CTQA 4G0NA 2X9VA 1Z4OA 4Q9NA 5D3MA 5JASA 2D8AA 4E07A 1A5ZA 2XXAA 3ZKWB 1AUQA 1JKMA 1DLJA 1RI2A 4ENPA 3ZWXA 3P4XA 1DWUA 4A0RA 3JQDA 1NI5A 2NYVA 4UBLA 1DO0A 1SXJD 3RT1A 4FX5A 3LYLA 4NG5A 4PPQA 1P0IA 2EEPA 3O94A 2FZCA 4KTVE 1QLWA 4BQRA 2H29A 3N9IA 4A27A 1VDMA 1G21B 2GZ1A 5FFMA 1M6EX 1X2EA 3RAGA 1N25A 4R2HA 4V1CI 3PPVA 4JU9A 4UHDA 4EYKA 3B3AA 4AJ1A 2ZXEA 4AYTA 4G0QA 3IT1A 1TJPB 2ZM5A 1YZNA 3GP8A 1NZJA 1WPGA 1DQRA 5KYTA 4LX0A 4L5AA 2O8CB 1UJCA 4Q6WA 5ESXA 4BWVA 4MPRA 3FIUA 1UXOA 1UMDB 3A1DA 4HGQA 4MDYA 3KVNA 2B1QA 4ZOLB 2A3RA 4B6JA 1NGSA 2PO5A 2WU1A 5EKDA 1ZVQA 3PRJA 4PAOA 4QT4A 2IRWA 4MLCA 3H5AA 4I9NA 4IIGA 4KG7A 2N46A 4G8CA 4FYMA 2FE1A 5BMOA 4NOJA 2QA5A 3MS2A 3HB1A 3AXTA 5DOZA 4MIKA 3I1YA 3N76A 1L1EA 5JPIA 3RTDA 1JH9A 4FDVA 3AU8A 2D5LA 4EHLA 3UAVA 1UMBA 3PFCA 3ZXXA 4LC1A 2J7PA 1ONPA 4ON9A 4AWBA 2VP6A 4MIEA 1KU0A 5FJIA 3G0OA 3DPUA 5IXSA 5KNBH 2Z9CA 2VLIA 1V96A 1ZKMA 2WYWA 4DG9A 1L9KA 3SOPA 4M9QA 2C8VA 1JLLA 3K35A 5A71A 2HUPA 3W4JA 3ZV7A 1V5WA 4IO0A 3KS9A 4FFDA 4U2KA 5F76A 5TF4A 1L5LA 2V3CC 4B76A 3ZGNA 3K4QA 3W3AH 5P21A 1E4YA 1KC1A 1EGQA 1FXWA 3Q12A 1SKUA 3EIWA 4MMZB 1RLUA 3BILA 3F46A 3RRNA 1MG5A 1T1SA 1Z6QA 2GERA 4NCBA 4IZIA 1SOUA 2XGGA 1JVBA 3SYTA 1XZMA 4DR7B 3ZWQA 3FI0A 1PWHA 1UK7A 4GPBA 4Y1FA 2JLBA 4FDLA 4ZOEA 5EIWA 4ISBA 4XGIA 3NCHA 4CV2A 1Q1BA 4IG4A 3OLXA 2IZOA 1I2AA 4PLTA 2FN4A 1LC0A 1NFRA 2WSMA 4B31A 1HOTA 4J16C 1EG2A 1KYTA 1PG5A 2AUTA 4C7KA 2ES4A 4TWIA 4IXNA 2XZLA 3NDIA 3U7GA 5JJCA 2FFAA 4Z53A 2H3EA 4LBVA 1V16B 4R9SA 5JNUA 3HCWA 2ZUEA 4IFTA 2WM8A 4JLMA 4ZI5A 3WAGA 4K0KB 2PUHA 4DLRA 3LP6A 1HRKA 4QBKA 4Y0VA 2XZOA 4P58A 1Q21A 3A2KA 1S2IA 3LA6A 4MS1B 4B44A 2GEFA 4NAVA 1USUA 3VH1A 1V7PC 5KVQA 1KZ7B 2C9OA 1HPLA 1U7WA 1VJ1A 1ATZA 2BH9A 1MA0A 4HTFB 5A0FA 3ZE9A 1KBZA 1H1TA 5BUQA 4XUCA 5H81A 2Q4TA 5IJ0B 2Z5FA 4QFMA 1P5RA 1Q0TA 1IRXA 5JAZA 2F43B 1SU4A 1XD2B 2HQBA 1NZDA 1R3DA 2R6FA 2W8BB 5H5JA 1KFKB 2VSOA 4KODA 3ER8A 2Q62A 3JV7A 1Z0FA 3UCEA 1G60A 4M7RA 3DUFB 4V02A 3F2IA 1P18A 3LYHA 3N2NA 4K2AA 4QL3A 5CAEB 4DQUA 3W6PA 3EXHC 1TCVA 1PL6A 3E7DA 3G5MA 4ZCIA 4WCFB 3CH5A 4MHTA 4DR4B 3BB1A 1Y6ZA 1UAYA 4DLTA 1N75A 1T8RA 1YC5A 2PMDA 2ZRIA 2BGLA 2YCBA 3CLHA 1E2GA 3DTVD 4QDKA 4UUPA 4II7A 4V0SA 4WW0A 1W96A 4UMFA 5KMGA 1VCIA 3QW2A 3B5JA 3PIDA 1HDRA 4HLUA 3UICA 3PF9A 4F4DA 2JLXA 2QU7A 4QC2A 1S02A 3C3CA 5JAUA 2BIFA 2FX2A 3ME5A 3S68A 2IUSA 1TB4A 1YR3A 1S1CA 3STUA 2E4UA 1ICIA 1ZUHA 3BBLA 3OOYA 3VKFA 4ARSA 3FWZA 2HWWA 1KWGA 3RJ9A 2R6CA 5TXGA 3RYHB 3K7EA 1AQJA 4M0CA 3WG9A 1YHZA 1DIGA 4HQLA 4E88A 4A8JA 1QAMA 3GNSA 4GR9A 2OCBA 3IAS6 4DIUA 4DQKA 3ZH2A 1UDBA 1USVA 1BOFA 4R1PA 4TMXA 3KOXA 3N2GB 4GLLA 1N0HA 1L7QA 3C1UA 4PF1A 1RQGA 1Z4JA 2IYNA 3ANXA 1DPGA 3GNLA 3OCUA 4QECA 1R8YA 3FDZB 3U3KA 4YEDA 5TC4A 2EKPA 4RK7A 4B4WA 1L0BA 1W46A 5I7VA 1NVWQ 2J85A 3RVRA 4ARIA 3IT2A 4F38A 1ZYUA 2VDJA 3TQRA 1GL3A 1OE0A 4REOA 2EGUA 2Q6VA 2Y1CA 4LJYA 1O6BA 3BJMA 1ML3A 4U00A 4B6QA 4BBPA 2BKLA 2GN8A 3IVMA 3PUKA 3UFBA 4PIVA 4HGOA 3IAHA 1Z47A 2AQKA 4BO9A 5CDTA 4Z4CA 4CKWA 3CPJB 4TSKA 3A1EA 3MYRA 4EG6A 2C0QA 1UFKA 2R44A 2KHZA 3L6BA 4IVRA 4KO3S 4QAJA 3WLTA 4WKNA 1QKIA 4YUYA 1SGWA 3RDPA 2WTEA 3TZQA 4JEIA 5EJ4A 2R84A 1G5PA 2CUTA 3PXGA 3NIGB 4B2IA 1IFXA 1JA0A 4UKDA 3BIFA 3KJNA 4C6TB 2G07A 2FN9A 2B8NA 5AVTA 1MNAA 1V11B 4CU2A 2WB2A 4R51A 1MBZA 1QR2A 3BMXA 1CB0A 4EUKA 2VSXA 4C03A 3H11B 4YFVA 5CH3A 3TJZA 2QLJA 2BRUA 3CTPA 4KQEA 1I13A 2Q3JA 3RUAA 3FYUA 1G5RA 5DYGA 4EUEA 5CFPA 4HN4B 4EIWA 1IOZA 5ALQA 1Y9JA 2A2ZA 1WSDA 4FK8A 1DBWA 1L4UA 4IH1A 5E2IA 5JXGA 1U0BB 1JJIA 3BS4A 2IZ0A 3KELA 3PD7A 2Z6UA 4F7DA 2BZSA 1DSSG 1KEVA 1VI6A 4N8DA 5BQXA 1HKHA 4ZJPA 3TR6A 2OM6A 2ETVA 3IDAA 5DBIA 4JMPA 4DWJA 2FMIA 2PS0A 4B0PA 4C06A 1CRLA 2WVHA 3PXEA 4GGMX 4IJ5A 4FSHA 4UAUA 4DDTA 3MGCA 3UHOA 3EXG2 5LPNA 1IN1A 2F4VB 3KX2A 3SJZA 4YUZA 4QPNA 3KHUA 1G66A 3F5QA 4P4SB 3RHZA 4E2WA 3D4IA 3HJHA 3TIGA 1VYVA 5BN3A 4J0DA 1NMEA 4A2QA 2P9TA 5D00A 4D4GA 2J0QA 2WHEA 4MH0R 2VQ6A 2XMQA 1IXSB 2J7PD 4KR7A 1E92A 2AZ4A 2I4OA 1DTWA 4EVQA 5KOYA 4M0PA 1N34B 2CD9A 1NLZA 1TQDA 3M0EA 5E6SA 3HH8A 3ZU6A 2F62A 5BYBA 1FYWA 2R9VA 3U9LA 3FCAA 4CL8A 3OKPA 1P19A 1LPPA 1NL3A 3UB3A 2FEKA 5ES3A 3K0AB 2E82A 3NNSA 4BMPB 5B2FA 5J4KA 4F8EA 4E33A 5EJ7A 2Z9BA 1C41A 1MC4A 3WL6A 5JO9A 2RAVA 1GAQA 5I8PA 3B6ZA 3BEOA 1UBEA 1OLXA 4RY8A 4Y6OA 3S2SA 3MWDB 4Q21A 5C8YF 4HS4A 1ZUIA 1AK2A 4FI3F 1ZG3A 1SVOA 5JMTA 2CLLB 3C43A 5FJJA 5EJ9A 3AB3A 4HLQB 3R4CA 5HBGA 1Z33A 5DZSA 1W4ZA 2JI4A 1M83A 1VSQA 3FMFA 1Y5RA 3KJQA 4XD7A 1KOLA 3WGZA 1Z0JA 1NZFA 4JR1A 4UPDA 1ZGAA 4QOGA 1D2AA 4KMRA 4ZTUB 1AB6A 4PG5A 1XEWX 3FFWA 4F8YA 3UGQA 3VR1A 1SQ6A 1FP7A 1NJ2A 5ELXA 2JJQA 1XRPA 2F3RA 1Y5IA 4BN4A 1XVIA 2CMKA 1NA5A 4QJ3A 2QRUA 4CMHA 2WU8A 3G2LA 2CZCA 3K2EA 1G9SA 3QHAA 1E5QA 3A0RB 1U5BB 5DEOA 3UY4A 1MP0A 1HE2A 1SVMA 3ENKA 1CUBA 1UM8A 2BGTA 2X41A 1F0NA 3G13A 4LC9A 3X1XA 4TKZA 4F3TA 1RWXA 4NAHA 1M1XB 5ILOA 1AGXA 2NNLD 4EB8A 3VH3A 8MHTA 3FZQA 3OCYA 3OLWA 4WN9A 1KZYC 3OAAA 2XUHA 1PEYA 3V4OA 3R3SA 1U2TA 1H66A 2QYTA 1L7MA 3AEKA 2IIQA 2ID8A 4AYXA 1EGVB 3IMEA 4L7QA 3ZZNA 1THGA 3I2YX 5KNBA 4DILA 3MCWA 2J32A 4WLVA 2WKRA 1NN5A 3M6LA 3DT8A 4GPAA 1M2FA 2E87A 3QVLA 5F7ZA 4G25A 4PONA 3RKRA 4YTEA 3ECAA 3GW8A 5C7IO 1DI0A 3U80A 5MF6A 2RG1A 1K8ZB 2HA7A 4HSEA 4EHKA 1I5RA 1Z6YA 4W5TA 4RZHA 5C8YA 3NHMA 3WADA 1E7SA 4RD0A 1X1EA 4P08A 4L5IA 1GARA 3BFVA 3E9CA 2WE8A 4YCDA 3UBTA 2Z6QA 4UASA 4NCAA 2GXSA 4MJXA 2BFEB 3B1FA 4IQFA 4BLUA 2IW3A 2R6HA 4BQQA 4CV1A 2C4WA 3UMGA 1AQYA 7ADHA 2PFSA 3MJFA 4JCCA 3T1HB 1E1CB 4MUMA 3FNEA 4M46A 5B4TA 2PD4A 5AM3A 1YBMA 1O6CA 2XOXA 4RF3A 2X42A 2IYUA 4CYMA 1WMSA 5KU1A 1JYFA 1U3DA 1P8AA 4I1RA 5KQGA 5FI3A 5CITA 2FPIA 3DMHA 1KKMA 4BFLA 2Q0XA 2R5WA 3PENA 4RPHA 4D0SA 3UMSA 2XB2A 2ST1A 2XPCA 1ZWKA 4ZAFA 4D3ZA 3EXAA 2XTAA 3WQBA 2IXBA 3J81A 1PG0A 2RBGA 5ALRA 2I3GA 3ZNPA 1IZZA 1FFXB 3ANYB 3A4TA 3DMRA 2AD5A 4L4RA 3T52A 1RRGA 4DPLA 4V2IA 3CB2A 3CEAA 3SZMA 1VKZA 4BB6A 4JC4A 4DUGA 3TIXB 4DLSA 1PVDA 3VU8A 2C3PA 1XMIA 1XCOA 5ARCA 5TB5A 1Z34A 1ZWLA 3U49A 4DRYA 2Q7DA 4DXDA 1SRRA 1XEXB 1JT9A 3MELA 2FKNA 1E6UA 4UXHA 4FGUA 4OQDA 1RWBA 3JATB 3HXLA 1T9ZA 3KR2A 4TRMA 3O92A 5BV8A 1A9PA 4CL2A 4Y98A 1U7OA 3LHDA 3WTBA 5DHQA 4KQKA 1KI4A 1A2QA 2HIGA 1HLDA 2QAGC 2IHBA 3M4ZA 3CVXA 2K4MA 3WYBA 1VG0B 2PRKA 1HQDA 4QNMA 4RD1A 4KO2S 1RS0A 3NALA 1SKYE 4U5QA 5LB4A 1MZPA 1N9GB 1UFOA 4M36A 5EZYA 2RGWA 1ZGGA 3IXLA 1ZFNA 2OZLB 4J1SA 2WF8A 4LTNA 3RVLA 3SXJA 4B6FA 5JYBA 4LFBB 4GI5A 4NFHA 2IT1A 1WHSA 5DSZA 4X7PA 2BEVA 4R81A 3O3CA 1J2JA 1ZMTA 3LX4A 2ZYAA 2AFVA 4DBVO 1ADYA 3QTLA 1PS9A 1N2JA 3PPYA 3R74A 3TNDA 2O3SA 2H7XA 5IM4A 3E53A 1YZUA 1Y6JA 3CWCA 3KPVA 3PG5A 4ND6A 1N7HA 2PT5A 2R66A 4GMHA 3RFVA 4ZHQF 3GD5A 1II0A 1S9DA 1YMUA 3KTDA 3NTVA 2PZ8A 3Q6NA 1JR4A 4PFKA 3OE7A 2TS1A 3PFGA 1FYDA 1GV1A 4HN9A 1YA8A 2HEIA 3QYPA 4EUSA 5AW6A 2C84A 1T8TA 2WTXA 3OOEA 4E2YA 3ETCA 4FE3A 1JDTA 3MWGA 5EHQA 4DCCA 5AW0A 1GN8A 3L6RA 4KOAA 2QQ0A 2R60A 4QEZA 3MTAA 2PSDA 3QEAZ 1VPLA 3VR5H 3JQ6A 4DRXA 2W7TA 1TRHA 3CVJA 3SVZA 3G7UA 3TTYA 2VEDA 1NF2A 4OGLA 1XU7A 3CVVA 1QHNA 1ZP6A 1Q7GA 4AU1A 4HH1A 2R2AA 1IMOA 5FFNA 4CGYA 1P1CA 1DQSA 1GPNA 2FU5C 2AMVA 1T1IA 2GBFA 3DR3A 4CDMA 3RIXA 3RK1A 1KI8A 3WDSA 3MCAA 5B30A 3K70B 5E0OA 1U90A 4KIUA 2B2XA 3Q8KA 1DFIA 4RAOA 1SULA 1VC2A 2QZ4A 5EP3A 4ZAWA 1WTAA 1SU6A 2EKLA 4GZMA 4LRYA 4NHEA 1PLKA 2XUKA 4HZUA 5BWCA 5JXHA 1XL0A 5DHTA 1T35A 2C0CA 3INTA 2EZ9A 2EATA 3RS0A 1YJ5A 3PXUA 3NAMA 4JWTA 3C87A 3WLLA 5JADA 3IQXA 1E3EA 1CPYA 2BTQA 4JKIA 2JW5A 4LECA 4P7BA 3K9FC 4Y3UA 3S2YA 3TK1A 5FOVA 4P6VF 4XD7D 1JEDA 3Q6IA 2IOYA 1JR3A 2OFFA 4HLCA 3DCIA 2D0OB 4F5DA 1G8AA 2XYQA 2UU9B 1G17A 2DHQA 4JYMA 1A4RA 1E66A 3Q9SA 4K28A 3EIEA 4ZU1X 3S99A 3PDIB 4PQGA 3ZGVA 3T5PA 1R6BX 2C5AA 2OCYC 4DBLE 1X13A 4U9UA 1P1JA 4A1OA 4W8HA 1MT0A 1P4HA 4AICA 3TUIC 2WJGA 4QPDA 2Y3IA 3IQWA 1JALA 2XDAA 4A2CA 2QJOA 4GS5A 3CUUA 4KDRA 4R16A 3ZEIA 2XT9A 2WWYA 4X9XA 1M7BA 1KI3A 2V8BA 421PA 2JH8A 5HKAA 3BT7A 1JU4A 4GXTA 3OAAD 1PTJA 2EP7A 4NPCA 5EE3A 3AKZA 4NV1A 4Q1BA 2EAUA 3SC6A 4B6GA 2HU8A 4MS3A 1RAHA 4C87A 2G08A 3FPAA 1JHMA 1V5EA 1Y8RB 2W43A 3IBSA 3LQFA 1YFLA 5JSFA 3I6BA 1WUIS 2XGOA 2WAOA 3M3HA 4TPKA 4XH9B 1SOWA 1YJ8A 2VPWA 5DULA 1GAEO 4DM7A 5ABPA 3ILXA 4X65B 5DCYA 5A5GA 3TBKA 2P6NA 2AJDA 1A9TA 1KXZA 1Q2UA 2B82A 4K9SA 1R4MB 1V6CA 3LPLA 4ZT5A 3L2OB 3EBOA 4M3NA 3QU7A 4M0MA 4PZLA 4Q4HB 3UN1A 1FCJA 3QENA 4HP8A 3VDMA 1ZUWA 3A26A 4OU5A 1E94E 1IY0A 4O0LA 5EQDA 2UXBB 1UJ5A 1PT7A 4WZ6A 5HPYB 5K99A 2ZSBA 1U3CA 1HMPA 3FGNA 2YYZA 5E8RA 4BVKA 1VRWA 3HR8A 2NQ8A 2Z4RA 2YIDA 5FOQA 2O2DA 1GPDG 1H4TA 4R98A 3OT1A 1AVTA 3N70A 4DUPA 1GCUA 1GHTA 1GPBA 5BNFA 2XMDA 4EY5A 1SCNE 3R9XB 3NIDB 3ZZTA 3EA0A 2B5VA 2NXEA 5FI0B 5ULLA 4MROA 1V5FA 3GLFE 1KJ9A 3C3XA 3EGOA 3M4XA 2C3UA 1ITZA 2EU8A 4L27A 1CF2O 5HR5A 4BNVA 4B34A 2FF7A 4LIPD 2X0DA 3ISJA 3PSAA 4UEJA 5K3EA 4HRXA 1OX5A 2AEEA 3R76A 1XXLA 4NYIR 3U81A 2FSSA 1Z08A 3ADOA 1BEUB 1D4OA 2FWIA 5TQJA 2C8JA 2GN1A 4NKRA 3PNQA 3AY6A 3ROFA 4DUGD 1WABA 1MJNA 5U4QA 5AVKA 4RZUA 1QHEA 3KEOA 5LBIA 3ZV3A 2M6RA 1N8SA 4LJKA 4XPIA 2LDXA 4QODA 4R41A 3SNHA 2HNAA 2BSAA 3D64A 2GNOA 1Z7WA 1QNLA 5IAEA 2HMAA 5IBCA 1Z26A 2WF6A 4WN3A 3JQBC 2QB5A 2C3MA 1JI0A 3Q15C 3TLKA 4YJDA 4TV9F 1NVAA 1VBNA 2LNDA 4OHPA 1RHQA 5KOHB 4W82A 2W2QA 2OCPA 3F6EX 1R8SA 5CVTA 5AXAA 1X15A 1NN3A 1NQUA 1QUEA 3FAKA 4GMFA 2NUAA 4P93A 3WIBA 4DSTA 1T1GA 4EMTA 3U56A 4EG4A 4U8HA 3VOAA 1B6TA 1Z2EA 1R50A 1NSTA 2I03A 3HYNA 3MQ2A 5EYPA 2EIXA 3QKSB 4GKBA 2IY9A 4IMRA 1NONA 1IBSA 2PZMA 4NDNE 3ZCXA 4D7AA 3THXA 2YBEA 1FDOA 4NOKA 3R8XA 5AIAA 1Z73A 2CF5A 2GYUA 1YU9A 3JD3A 1MMFB 4N40A 1JHZA 2P6UA 3ROTA 1OV4A 3V7NA 4BFSA 2C61A 3VZRA 4E94A 4XRRA 1KVQA 2WU0A 4B84A 2E1RA 3NMUF 4OFZA 1NP6A 1A72A 4GUAA 5IU6A 5CBKA 1P31A 3RR2A 4Z4QA 5C46F 3E5MA 1N6LA 3AJEA 5ALYA 4I4TA 2Q9UA 2VH1A 4FFMA 4WCFC 2NUPB 2ZIZA 5L4SA 9ABPA 1IN6A 3ANTA 4LJ8A 1UBOS 2VP5A 3IC5A 1UEJA 1YR9A 5HEKA 3IDFA 8LDHA 4CT5A 5KQLA 3WA6A 4Z6KA 5CLFA 4JR0A 2Y6UA 1QAQA 1QIMA 3ITEA 5LNK1 2FSPA 4NZMA 4OD0A 4B3DA 4DV1B 3E15A 1SO8A 2WHYA 4J0HA 4BVGA 2X7HA 2IXEA 1ORRA 3E7PA 1MC1A 1T1EA 3QNWA 4TV9A 3S1SA 4IOKA 3BF7A 3GRAA 1OU4A 4JELA 3OQMA 1U8CB 1XZEA 4DJAA 5CX4A 6NULA 2YKGA 2XNDA 4DKJA 2O3TA 2JLQA 3VU1A 2IV7A 4NYIQ 4KUEA 1H0SA 3OKAA 4JUDX 3UVEA 4EECA 3UATA 3MQFA 3Q9NA 2BM9A 1XNJA 3PEUA 5C3UA 1YSCA 3AC0A 1OIVA 2FW8A 3GT0A 4K6OA 1SCUB 2IHVA 3GP3A 1ZD3A 3ONWA 3Q3IA 5AHXA 5EL0A 5D3KA 3FTFA 3RWBA 3O8LA 4K9NA 3ISVA 4DMMA 2IK8A 4TYNA 1T2NA 2VDRB 1M34E 1F06A 1XMSA 3UAWA 4GE0A 2P9EA 1U1FA 3MLBA 1V3UA 1I3LA 1PL0A 5DN9A 1JR3D 1CUIA 3I2JA 5BWBA 1U8TA 5FH9A 1KJQA 2XA9A 1EPUA 2ZREA 5IHXA 5AR1A 2FPOA 1WPQA 1Y9ZA 1ZGJA 1WQ1R 1ACMA 4MI9A 2RJOA 1P5ZB 1L7BA 1YD7A 3WZ2A 5CD1A 3AVYA 1NY6A 3L05A 1XDUA 2SBTA 3D4LA 5LXTB 1WKVA 4XFJA 1C1YA 4IYRA 5HF9A 3PHJA 2Z0MA 3Q7QA 2K87A 4URHA 3R7AA 3VAYA 1WRBA 4JDPA 4E3ZA 3DA8A 4S1TA 2AKEA 4EARA 3U26A 1QHGA 4PV7A 1E61A 2HA4A 2HW8A 4WLUA 3A58B 2ZE6A 2KWIA 2BFDB 1HLFA 4N7BA 4ARAA 4AO6A 4DIFA 4JP1A 3ZCUA 2Q5FA 3I5XA 1RU3A 4MCAA 5AD1A 2QN3A 4Y1RB 3W2IA 5KDOA 3MMSA 4LRWA 3TQHA 2FQYA 4PRYA 3ZCVA 4CT0A 1G8HA 2PS3A 4DJ5X 2IXTA 1FF9A 3GLUA 1PZNA 2H4XA 1R10A 2V5VA 2B2NA 1F48A 1N4DA 1YACA 3LSYA 2YV4A 3A9RA 5FI1B 1GGJA 3BIJA 3X1ZA 1E2HA 2QMHA 5AI9A 4ONEA 1VBKA 1NXWA 1LFAA 2XRYA 5CYFA 1KZGB 2HK8A 4BFZA 5JSUA 5BRNA 2BGUA 4MR7A 2FFJA 3CGWA 5DP2A 1JEYA 2DJ5A 2XIQA 4UM9B 1W52X 3L8ZA 4I5GA 5FNVF 7REQB 3BWVA 3TNJA 1US8A 4YAGA 2C96A 4MAFA 4KE8A 1E4VA 1XZPA 4JS0A 2B1RA 3ZY4A 3SPXA 1IIBA 2O57A 3HB0A 4M4SA 3THOA 3O4RA 1KORA 1XCMA 3IP6A 3F4BA 4LHZA 4LWPA 2C4MA 3KL4A 3D1LA 3MT9A 2QROA 5ETJA 5IN5A 3RYIA 1PK8A 3M4NA 2AFHE 1FXUA 1VDZA 4IJKA 2CHEA 4YLGA 5F1OA 3UHAA 1BMFA 2I7CA 3TLMA 5JOQA 3LPAA 1OZHA 1T10A 2HD4A 3PWZA 1O5IA 1M75A 1XCLA 1HT2E 1UR5A 3JASA 4H6VA 1D1QA 5HUHA 1EUDA 3MC1A 1ZLYA 1J2TA 1CP3A 1C5KA 3FCOA 4HSGA 4CLXA 4G1VA 5ALIA 4J2OA 4WNAA 3O8RA 3EQZA 5EUCA 4GG1A 1E8MA 5E0KB 4BRUA 2TSYB 4PE5B 3EARA 5L3ZA 5EMHA 3NAQA 2BUAA 4D8UA 2POCA 2UZ1B 3IV9A 2VWGA 1RJEA 1GG5A 2P8SA 1E3TA 4IDDA 4HZGA 3LZDA 1ZD4A 2IXGA 4LJ7A 4AP6A 5PNTA 2C7BA 1DC7A 1IJEA 1WM1A 4RZIA 2DPGA 5F78A 3LQYA 1PE0A 3LUFA 4UBMA 1XR3A 1KYIA 3K5WA 1A9RA 1N7JA 2WG0A 2Y99A 4FMCB 4MVJH 1P2BA 2FG6C 4NP6A 4QJIA 4R40A 4CQNA 2P4HX 4PPNA 5ELMA 3RREA 3ZVMA 5FNVA 3EF1A 3BHJA 1Z2CA 3N05A 3E1SA 4JY7A 3P8ZA 3C6YA 1QQTA 4GEKA 1R5OA 2CHQA 2FLVA 4B0OA 4LKOA 3QF4A 3U2QA 4Z4HA 1FQKA 2PTGA 2R7KA 2ZSKA 3GUVA 4LZLA 4MV9A 4YXFA 5A05A 3PGXA 4F3KA 4ARZA 3C0KA 4A6PA 2XYPA 4LI3X 4WOPA 1XIVA 2PKRA 2V7TA 2WNIA 4H1TA 4KO4S 3KAQA 2BF4A 2HMVA 4B85A 2QRJA 5B7NA 1ZD9A 3GA5A 2BOVA 2C5BA 2CDCA 5H68A 4NC9A 1Y42X 1RM0A 721PA 4GKAA 2PUFA 2GEKA 3V8BA 4C3OB 3TRKA 1E8DA 4ZKEA 1Y8QB 1UK9A 3O95A 2NGRA 4RSMA 3D4PA 2FMUA 3PFHA 3Q98A 2C94A 4KLCA 1E4EB 3R7FA 4CKEB 1JG2A 4ZHSA 4XJVA 1WIWA 4IL5A 2GXAA 1CUXA 1ORTA 1RM4A 3BRCA 5E38A 3OPYI 5B5SA 1Y7IA 4RKEA 4IXWA 2WF9A 1WCIA 2GRUA 4TLAA 4DHEA 1ODSA 4MYSA 3NTXA 1L4FA 3DEZA 4CCAA 3VXKA 3ECSA 5ECWA 5KU7A 5L6MB 3CHYA 4D9BA 2DPLA 5DYYA 1ZUNA 3H1AA 4BZZA 4I2NA 4GQIA 3LY9A 2IV3A 2I67A 3ZIAA 5H9WA 3VHXB 2R25B 2AG6A 5EJEA 2CLFB 2C07A 2DHDA 2WU3A 3DSRA 1CZUA 1M66A 2B9EA 1GYQA 2CYCA 2XNDD 4MK4A 4ROSA 4IICA 3QGMA 3TEMA 4QNRA 4CIVA 4FFPA 5EUQB 4BFUA 5F3WB 1OB2A 2BMAA 2HF7A 4GC5A 3ST7A 2G9UA 1V5IA 4MWTA 4RM3A 1L3BA 1KIAA 5ALOA 1FDTA 1RRPA 3K5PA 3AUYA 4CM8A 1EEXB 5EOVA 1QHHA 3BHIA 4BEBA 2PLRA 1YR8A 1PWEA 3FPSA 3COJA 1EFVA 1KBQA 2AVDA 2BMEA 2Q3LA 2ZI4A 5IXJA 1YC2A 5E8JA 5KZMB 3FG9A 3HR7A 2BP7A 1YULA 1WBJB 1V8DA 3RBVA 3GLFA 3AJRA 3AW8A 2QSZA 1E2QA 2KSQA 4JJ6A 2WAAA 4TS4A 1Y4AE 3ZVNA 2C77A 5D3ZA 3I72A 1GG8A 2HZ7A 1BDMA 2PH1A 4YBZA 3L46A 2JAOA 3SKVA 5HQTA 2QMZA 4HH3C 4KXUA 5FUXA 4YCMA 1BCSA 2IH2A 5DN6A 4F3NA 3HEAA 1JLSA 3MMXA 5F2OA 2WWFA 4YJFB 2ROQA 2D0PB 1QGZA 5AKYA 3FVQA 3SKYA 1E2BA 1MLDA 4RL4A 4IV8A 3WAJA 5IZCA 2C7OA 4QQ8A 3MWKA 4MAMA 2VBCA 2XZTA 2F8MA 3OOWA 4O2BB 2CLSA 2G6TA 2LDBA 3ENZA 4U02A 1E96A 3I5UA 2QMQA 3KJHA 3WICA 5LL6P 4MMYB 4URZR 1DKNA 2SKCA 3UHJA 3ADPA 4JFAA 4OGFA 4A8JB 4EWLA 3V00A 3ND9A 1KH2A 4FKBA 3RJZA 3EVTA 3FTNA 3V7FA 4DIDA 1T29A 2ECKA 1DAHA 2OM2A 3DF7A 1WDLA 3HA5A 4CKYA 4K46A 4K3UA 5JRJA 1TE2A 3T5BA 3G79A 2RHHA 3TM5A 3HBAA 3HLYA 3MJTA 1RC8A 3S2IA 4E51A 5AK6A 1PJRA 2I65A 1QJ4A 3T3GA 1C7EA 2VT6A 2RGBA 2JGLA 2V4ZA 2Q50A 2WOOA 1Z0UA 3A7EA 3I76A 1CFJA 2BDEA 3BWDD 2JL1A 3N8KA 5D2CA 3HJFA 1DZIA 1YS7A 3VU3A 2GYVA 1GNVA 1MDBA 2IPXA 2M6SA 3GRZA 1HMYA 4J1TC 2VUIB 3B6EA 3QE0A 4YDSA 3WWDA 4WY5A 3KFVA 2WQ6A 3EPRA 1C3XA 1E1QA 1G4HA 3RUCA 3EW9A 2FWNA 5HCUA 4LSZA 2JKZA 2YWCA 4LMAA 1GN9A 3WGHA 4R05A 1X7HA 1BMFD 3F5FA 2JCVA 4IM7A 4LRTB 5EZSA 4AKTA 3H7IA 3F6CA 3DXFA 3ZE2B 1KDZA 5C8ZA 4MQ5A 1V3VA 5IJ9A 4EI8A 3WXBA 3ABQB 3FNFA 3G9TA 4Y2VA 4OP1A 5A3VA 4Q1FA 4ZDWA 1P1HA 2H7YA 1I2CA 3R3VA 3KCNA 1RWPA 1GCAA 1Z6TA 1T6XA 4GWLA 5B58C 5AK0A 1XEFA 2HKIA 5T6BA 3RKSA 2ZT5A 4JQSA 5MN6A 4HNRA 3GRYA 1UMCA 4W1RA 1UBGA 3WE7A 1ORHA 5CB6A 3LXMA 4X1IB 4OV6B 3FMIA 4J29A 3STYA 5JBIA 4FEAA 4AKIA 3UO8B 1SBQA 1HDCA 1GTVA 2PYDA 1DDIA 2UVPA 2QW1A 1XTTA 2DFVA 3LU1A 4UJ3A 3CLTC 4DA7A 1FYXA 1Z0KA 4GOOD 4S0ZA 1J25A 2VP0A 3HXMA 1V37A 2RBEA 3DG9A 3CZ9A 1W0CA 4MV8A 4PNEA 4ZI3A 3RW9A 1X7ZB 2X3FA 2CV1A 3HA2A 3UWKA 4C9BA 2V7QA 4H18A 1N2XA 4V3CA 4EHJA 4PLGA 3LWZA 4XXHA 4YR9A 1MD9A 1AG9A 4QZVA 1M34A 3IBFA 2BKVA 3CUWA 4JSYA 3DBOB 4YB8A 1RBZA 1TK3A 2QSJA 8OHMA 3O6VA 3QG1A 2QM8A 3RVQA 3II6X 4MIYA 5I51A 5C0OE 3ZY6A 3OUUA 3ULKA 4OX9B 1O08A 2QX9A 2J33A 3NBYC 3FUUA 3E0XA 2PQ0A 2IEIA 3ZCSA 3DZCA 4TSFA 1ZA2A 1U80A 1HE5A 4WTOA 3PWSA 5KNCH 3BSYA 2AOVA 5SZIA 4UFNA 2O6HA 1HM5A 2QPOA 1LX7A 2QWXA 2Y2VA 4NARA 1A76A 5ILQA 4JLOA 5F3RA 4DARA 5LLDA 4ZYUA 2VBIA 4JGGA 5CNKA 2D3TA 4HNSA 4W5HA 3KXLA 3DHVA 4ALKA 4G5RA 1H5QA 5HM6A 1GTZA 1DX4A 3GG9A 3I8OA 2A6PA 3P4UA 2O3UA 3Q3EA 3D6AA 4OYHA 1JE1A 3SS7X 3PDHA 1B14A 4N0MA 1CP2A 1G0NA 2QLMA 2VRCD 4C2TA 2BBWA 5BMVB 1V6AA 1FDWA 2H5JA 3QXGA 4MXDA 1CR4A 2DRIA 3IUJA 1XAHA 2VNIA 4H17A 3ZJ4A 1L7XA 3R0ZA 1R0KA 5C35A 4YGXB 4ESVA 4Q3DA 1DJMA 5BN1A 4YIHA 4FYYA 4B74A 2O1SA 1QTRA 4U0JA 3GFSA 4UHEA 4BO8A 4BVAA 5DX8A 1LDMA 1ULAA 3HFJA 2PL3A 4PU0A 3QV1A 1QMPA 2N9UA 3WK6A 3AOEC 3PA6A 3V1YA 4KEAA 4GP6A 2AR0A 3EDMA 4Q9DA 4B40A 2P9BA 1H2WA 2YV3A 1QQ7A 2A9FA 1JSZA 1KAHA 3KFLA 5D6OA 1ZR2A 5A4DA 1IWPB 2Y27A 4I9GA 3AO0B 4HDKA 4WKGA 1NJFA 4MV6A 1XK6A 4B3GA 3EBPA 3HDTA 3I2FA 4B3HA 2CHVA 2JEOA 3L7KA 2AFHA 3N58A 2RKWA 3VZQA 3FB1A 2JGFA 3AVPA 1CEEA 3CX8A 3N2EA 4KRYA 1E1DA 4ZVOA 5BQ3A 2OO5A 3EZNA 3GRRA 1C1DA 2AT1A 3U7QB 3UWDA 3V4RA 3NM6B 1SAYA 1WW2A 3VUEA 2Z2YA 3DNFA 3GJ8A 2XUZA 4L8WB 1W88A 4WESB 2H08A 1FNDA 2FETA 4DVJA 2CJYA 3CE9A 4HDNA 5DN6D 5KOJB 1EUCA 1Q19A 2P3SA 3FZNA 4HYEA 2XT6A 2ONZA 3SD7A 3K96A 1EDBA 4I1IA 5CDUA 1EJ2A 4NAUA 4MGIR 2X0NA 3ZWMA 1CETA 4F7WA 4M1YA 4O25A 3AEYA 5AT1A 5I4KA 1OXUA 1L4KA 1W4RA 2OXFA 4YJGB 5I9BA 2NOAA 2XADA 4OXQA 5ED0A 1Z22A 4JB2A 1NLUA 4KQ1A 5BR7A 3OQIB 3GAFA 3ORRA 4UU7A 5LD2C 4WRRA 3JZMA 1SUFA 1ODTC 4RIEA 4OUDA 1DC4A 5EKSA 2JFXA 3T5TA 5HFNA 2ZFUA 1U81A 5EINA 4D74A 1WETA 1Y4ZA 1B3BA 4Q02A 2HXGA 2WMOB 2A4KA 4KH1A 3P52A 1TW3A 2RGYA 1Z4IA 2GJKA 3VU0A 2NO4A 5TVKA 3I73A 3LUDA 4R1MA 2DFPA 2C4NA 5DT2A 3VMFA 4X20A 1PR4A 3K0BA 1JQ3A 1K8XB 1JJBA 4HY3A 5THQA 3D3EA 3C3PA 5KTMA 1WXGA 2F1IA 4J4BA 4PSVA 1G6Q1 1LDGA 3B2EA 3NB0A 3WQQA 5H70A 2F64A 1Q7RA 3M1IA 4FCCA 5EUMA 5G4LA 4CQMD 5JDIA 1YAHA 4TKVB 2ZB3A 3IUNA 5KI6A 2QN8A 3NORA 1SCIA 4N65A 3RIHA 2V65A 4TVSA 1WUYA 3GCXA 2FPRA 2VJPA 2J3JA 4ETNA 1E1QD 4B7ZA 5M5BA 3GR6A 2VF7A 4N01A 5FA6A 3K6SB 3B1JA 5DW0A 3PC8C 4ALMA 3P9PA 1AURA 4B4OA 4LYHA 1A7UA 3RODA 3VVLA 3U6KA 2GK4A 4YUWA 3KALA 1C3OA 4M1KA 5E3JA 1WNTA 3WNVA 3G2PA 2C8LA 3G89A 4MCHA 3T3IA 3N6VA 3UXHA 5IKOA 4C43A 1P44A 5KSPA 5K8CA 2BHLA 4XVUA 2B0JA 3JQCA 3GJQA 2Y1WA 1QHFA 3M9WA 3C6KA 4WDRA 3EC7A 1XMOB 1GAWA 2YOFA 2BSQA 3LHIA 1B8UA 3SJBA 2ODEA 5A1JA 3CRW1 5EJFA 3B78A 3KJIA 3T5DA 1XE3A 3PHLA 4K0RA 2GPTA 3DKKA 3UWSA 3EGXA 4L8LA 2OHXA 1IDOA 4R4JA 4K3VA 3UA3A 4XWOA 2PYZA 3QMMA 4F06A 2VXCA 1IHUA 4B7UA 2O5CA 3FYHA 2EKDA 3O3NB 4K2HA 1YMQA 1HK7A 4MRSA 1EWTA 1LJLA 1RTTA 2PR2A 3L7DA 3JSXA 1LLCA 3QVMA 4ITUA 3VR2A 2AF4C 4EI2A 2PQMA 4CN9A 2WF7A 1Z74A 1PN3A 3EGIA 2ZR0A 2FEXA 2V7QD 4TVBA 3BXFA 1GVHA 4WEQA 1DG9A 4WCDA 5HIIA 5ALEA 2HPZA 4CV0A 1DAIA 4UHCA 4DC1A 4YX9A 1N33B 4KE6A 3DDUA 7ABPA 2QD2A 3ZIDA 5H8WA 3GO4A 2DTDA 3RBZA 4ARBA 4I50F 1TMGE 3G5LA 5H1YA 1FRQA 4H4EA 2FX3A 4RQAA 1N9ZA 2O2SA 5E9QA 4XLZA 3UW3A 2G09A 4OHWA 1U0GA 1K3FA 2BKUA 3INNA 2ISSD 3ANLA 3QXSA 4YT5A 1Z2OX 3UGTA 3DO5A 2CXNA 4TSFD 3TW6A 1YK0A 3GZNA 1ZM2A 3V4LA 4FB5A 1ACLA 1YOVB 4AMYA 1QS0B 1S2DA 4XW2A 4FYPA 1P0CA 4FGWA 5CXUA 1BMTA 1KDRA 4BUJA 2BGMA 1EXMA 3F6PA 4YO7A 2HHCA 2LGJA 2YZKA 3EXFA 3TW4A 1HE8B 4YRAA 1NTRA 3F6SA 2HA0A 2IEAA 3AI7A 2ZUFA 3ZDXB 4WL0A 1J20A 5EIFA 3IESA 4BC0A 3DTVB 1N7GA 3F7MA 3PQ8A 4I9UA 1CUHA 3F3SA 1P1KA 3VOTA 1RXUA 3TF5A 4XWWA 3WO1A 3D59A 1XZKA 3NHWA 4G24A 4FVTA 2WT9A 1NN1A 4L08A 5F9MA 1HFJA 1YA6A 4NCXA 1QE5A 3PJDA 1SFRA 2H2FA 3P1JA 1WZEA 3R0QA 4K6CA 5EG5A 2NZVG 4H31A 3WK9A 4AQYB 3DVRX 5T8KA 3EEQA 4DA6A 3KB8A 3OCVA 1NW4A 2ZRAA 4JHLA 2P7HA 2OV4A 4I5DA 4OMUA 1KPGA 3L6CA 3OZ7A 4I50A 2WP8J 4L9AA 4MVYA 2ZYVX 3G8DA 1V71A 2ZSJA 1UBUS 2J5KA 5JUWA 2JAHA 3WRXC 4CM5A 1Y1PA 1YVDA 2XB8A 3P2EA 2FZGA 3V8NA 2FKAA 4ZC1A 3SJUA 5A4MS 2VDWB 2WFAA 2J3KA 4CKBB 2IEBA 5KJ1A 3C1TA 5IG2A 4ALIA 1FPQA 1YB1A 2QAJA 3T7IA 1VL8A 4ND7A 1KERA 2BL4A 1XJ0A 4LV6A 4DN6A 5EIEA 1AA6A 2K2QB 3JU3A 4ZYVA 3SHVA 2C1EA 5JRDS 4RDHA 3I9NA 3FOAA 3KQKA 2O0KA 3ISTA 5ESWA 4LV5B 4MVJP 4RGVA 4XDGA 5JQGB 4ZEMA 3I01M 2NUTB 3JALB 3OO1A 2OLKA 4RHXA 4AF8A 4DY6A 1A88A 5D3MB 1GQOA 4DXAA 1NVVQ 2XTNA 4B4UA 4PZ0A 3TR0A 5BW4A 4F93B 2XXAB 1Q0PA 3CLUD 3P27A 2V54A 1L5ZA 1YIOA 2ONKA 4GKKB 1T3TA 3PC6A 4OI0A 3JVDA 3BM5A 4QRDA 3STWA 2CXRA 5KQSA 1XWWA 4N7RA 2QI9F 4R8VA 4UCQA 4TVOA 1TZCA 2BCEA 4IRMA 4PYRA 3IQDB 3V55A 1C30A 3HZZA 1NSYA 3H0KA 5DLEA 4CUZA 3AIKA 3OQHA 4U9IS 5LBUA 2V6MA 1IK4A 1NT2A 1L5NA 3DHNA 5KKCA 1T5LA 1FX1A 3AU9A 1TPYA 1NRXA 4RE6A 3I9KA 2M6KA 1U63A 1TLTA 3HO6A 4G56A 3PU6A 4KQMA 1XKLA 3RK0A 3DCJA 1WUTA 4IV5A 4KJXA 3UJ8A 3V4FA 2AQ8A 3FOZA 4NV3A 1UH5A 2ZUDA 4OIMA 1S8NA 4HCJA 3G8AA 4IS2A 4RPCA 3BFKA 4OUKX 3I1JA 4QYIA 3WV5A 1ONOA 3EC2A 3VKHA 4PBTA 1PT8A 3VO9A 1BH2A 2AJ8A 2E1PA 3MGGA 4OVKA 4U1RA 3TZLA 3ITDA 4HOYA 3HI6A 5FORA 3PBKA 4XQ9A 4YMGA 1KMMA 1U2PA 4MQUA 1RQNA 3T7JA 5ADHA 1H9CA 1YZVA 4PYJA 1I4EB 1MV8A 2WHRA 2XF8A 4BLOA 5BSWA 2PXCA 3D7SA 1UMBB 5EIXA 3GDGA 2UYCA 2QPTA 4Q1DA 3DMPA 1WXEA 1ZGBA 3ZG6A 2J4CA 3NOXA 4F3RA 4PHHA 1JG4A 4BNJA 2GAAA 1FU8A 3L7NA 1JLLB 4AZWA 3MWEA 2WMNB 4NFLA 4HXYA 4DPMA 1UBHS 2K7FA 4DA9A 1A0OA 3W90A 4C4TA 4KITB 4K03A 1V8BA 1X8JA 4I3HA 4CPDA 2VJMA 3S2GA 4HQ6A 1LUAA 1AH2A 1SCQA 1AD2A 4XFKA 2HB6A 2GEUA 1AE1A 4NBKA 4RHEA 5IULC 2ZJ7A 3BYZA 3DZDA 2JIMA 3W78A 4TMWA 3JQFC 4UD6A 1LVUA 3A6LA 3MJSA 2WIAA 3VR2D 1SUWA 1W19A 2A9OA 2AJTA 3ZS8A 2VTEA 5BT8A 1NMSA 2RHMA 2WIFA 4R71A 1UKCA 1SN7A 2RH9B 3NHSA 4A2WA 1FZTA 2EZUA 3ZTTA 1TIPA 3NONA 1Q0ZA 4F04A 1F3OA 2IHNA 2R2GA 5C7OO 1RADA 5BT9A 3S81A 4FFSA 2I6XA 2RCNA 3BJIC 2O8FA 1QSGA 1S2NA 2PQ6A 4K87A 2ZQYA 4RHUA 1TUIA 3T6KA 3R9WA 2TRSB 4YUXA 1Q92A 3HA3A 2HWKA 1PT9A 1U11A 1EWVA 4YV2A 2MHCA 4FBGA 3QVUA 4QUGA 4UXJA 4C0AC 3NM4A 1M8FA 1ZKDA 5CX1A 2P67A 2W2VA 3HCNA 4BYMA 3GUYA 4BMNA 5AHOA 3KLPX 4RNDB 5CHEA 4WFIA 4IHJA 2W42A 1ZI8A 4TTVA 3EWAA 1MPXA 2BR4A 3KZKA 4QDUA 1PR3A 1XTQA 5JI2E 5F21A 4REQA 5IAKA 3R20A 4RH3A 3PQ2A 1BNCA 3EH2A 2P5SA 3EEIA 4P81A 2NO0A 3E5NA 4A03A 1G3IA 4RZ2A 3TLCA 2QVCA 3LY7A 1U7ZA 1XRRA 1IK6A 3I9OA 2H1SA 3GZ4A 4OAOA 4ZOQI 4FJ0A 1I4LD 1NP3A 1XJQA 2GFIA 3AYZB 1FK8A 3BWEA 3W5JA 3AF1A 4ZP1A 1WG8A 3GI1A 2FN8A 2EJTA 4IH4A 3U7RA 3REGA 4GPIB 4BNZA 4GECA 2E5WA 1M7HA 2GBGA 2AUMA 5E4FA 2WJ6A 4ZVUA 1IULA 3C6XA 1K8YB 3UJBA 1E98A 1SUDA 4RBNA 3H2KA 3QE9Y 2NM0A 2B92A 2IEDA 1VPTA 3RUDA 4GHWA 1QOPB 2HBZA 1JG6A 1YI0A 3P9QA 4JBXA 1BTOA 4ZCTA 1FRVA 2YQ5A 1EUZA 1ZJ6A 3HCPA 4YASA 4MKHA 1LRLA 2JGEA 4EO4A 4JEHA 4GW3A 5GJWC 1FY2A 2OV2A 2VKQA 2ZWIA 3VI3B 2OQRA 4MEJA 1L3CA 5EPOA 3C3DA 1WXHA 5EEGA 1C9MA 5TY0A 3RYCA 2JLYA 4MA0A 1EHIA 1A2OA 1BEEA 1T25A 4TZ0A 3LPCA 1HYBA 3GJ5A 2BKAA 5KQRA 1E5XA 4FUQA 2JGJA 1TEXA 4BFYA 3LC0A 2AN3A 1WDMA 3NWOA 3QJYA 4L3VA 1E3WA 2VZ8A 1UJBA 4F45A 3R8FA 1TAQA 3GJ3A 4HNHA 3ROPA 1UT6A 2AG8A 3DD1A 1VLQA 5BWMA 5J4VA 3GNTA 2Q0SA 4CKWB 2BGIA 4WUTA 1E62A 1VJ0A 3QBTA 2DWOA 3O2SB 4L0MA 4AUEA 5K6AC 4DYVA 5EKTA 4TM8A 4F84A 2B5WA 4L07A 4IV0A 4YRNA 3U16A 1H2EA 1QE3A 5C18A 4M99A 2HADA 3F73A 5AXBA 3OLYA 3KG2A 4UBIA 2QPAA 3OQOA 3LJKA 3WLKX 4C5BA 1V8OA 2FDCA 1SU8A 4ZT2A 1U0OC 3U3MA 3ZD9A 1RWWA 2YNMC 4DT1B 5HUJA 4DMCA 4YHBA 3R7WA 4RVDA 2CLCX 2PRSA 3BTUA 2V4MA 3VV2A 4CTMA 3FYUB 5AHRA 4RK1A 3N2IA 4C7XA 4C7BA 4KX5A 4BPRA 1OGIA 3H65A 1S4QA 1KJNA 3GUHA 5I7UA 1R9GA 4BFCA 3P0HA 1YQDA 3QSYA 4OH7A 1OXSC 2TMDA 3AF6A 4G37A 4ZTBA 1A9XA 4YRZA 2Y6VA 4CM3A 1RKBA 2O1XA 2X4GA 4F0JA 4S1OA 4YBRA 3SF8A 2ID9A 1P6XA 2ZTSA 1VZ3A 3WIOA 4LOKA 5DCLA 1I1OA 1KO7A 4JI2B 4BVFA 3G0HA 5D5PA 3IRVA 3CEPB 4LXYA 1TYZA 1LQTA 4L3OA 4N5HX 3I2GA 4UVEA 5FPHA 4KR6A 2RC6A 5CDGA 4L5YA 4P7GA 4KFRA 1GSAA 3IAS1 4YNBA 4C4SA 2PUTA 3KTAA 4I6JA 2VDPB 1A9YA 1W1UA 4X90A 5AJVB 3H17A 4TRRA 2QTGA 4J7AA 1DTWB 4TQAA 4MQMA 4PZYA 3FCUB 2GF2A 3SMQA 1XRNA 2H1VA 4N0PA 2BHTA 5E6SB 1JSCA 2I1QA 2NPIA 1AV7A 3BIXA 3DDCA 4PZPA 4G01B 1EWYA 4B3SB 2C7GA 4KQ2A 1UBFA 2EZTA 4B43A 1NIJA 3ICCA 4ZVNA 4AY6A 1PSWA 5EMJA 5GMOA 5IKMA 1CRQA 4RTNA 2GBLC 4QU9A 1C50A 3X1KA 2H2IA 1U1IA 3FJOA 1PQ4A 1SZCA 1ESNA 1OLXB 4IIEA 2BEWA 2QZZA 4Q82A 4U7HA 1WF6A 2GAIA 4TRNA 3CUVA 4DV5B 1FFHA 3D7MA 4C1BA 1ELOA 2P2SA 2KYRA 2JBHA 4HLDA 2CT8A 4YALA 4X1YA 2H7CA 3TSOA 2XKJE 1BIFA 1U6JA 2FPGA 2FW9A 2GA8A 5DNEA 3D7LA 4G6ZA 3V4PB 1FUKA 5I9SA 1DC8A 1WO8A 3RAEC 1EDDA 2OO3A 3BD9A 2ERXA 1MV5A 2UZ4A 4NNOA 1AQLA 3HKCA 3DOIA 2CBZA 3BWMA 3LAWA 4MVCA 4QHTA 5F1PA 4AN1A 1K8QA 4HNAA 4Y9UA 4NOMA 2O8DA 2IBSA 1Z2DA 1M7GA 1RXYA 4OBXA 1AHNA 5JY6A 5EHXA 1MHPA 5KINB 5CIQA 3AM3A 3KEGA 2H00A 5AI6A 3U9SA 5HZMA 3WYCA 1FE8A 2QUKA 1XLVA 4KVZA 2O50A 3VSAA 4BO4A 4ZKDA 4DR2B 4WN9B 5DLQC 4AJOA 5TR9A 1PR2A 2FOIA 3AEKB 3DAFA 3K0CA 3J81k 2VNSA 1SXJC 4F4IA 4KLZA 1VLMA 3LCUA 4JQYA 2HFJA 4XTRA 5GJCA 4EY3A 1KJZA 1ZNQO 4NJEA 3A36A 3PQ4A 3WI7A 1Y6RA 2C5GA 3VBEA 1I2ZA 2ZPUA 1L3IA 4FMPA 2R6ZA 1RNLA 1E2JA 4JEUA 4OF4A 4Q7LA 1PGJA 1SQ5A 2HBQA 2PD6A 1ENYA 1PQPA 4BMDA 5AESA 4DADA 2HQOA 2O2HA 1Z28A 3JZFA 2BGGA 4XUDA 2RD2A 4Q3KA 1PAUA 2YINC 3B7PA 3Q9UA 4ND4A 1N0WA 4N3CA 2BBSA 3ASZA 5C8YB 4TMZA 2C9ZA 1SXIA 2YZMA 3I8SA 3KZVA 1JSLA 4UNSA 1F2UA 3AZPA 4KQJA 3ORSA 2ORWA 1L1RA 1P1BA 1H9AA 1PLLA 1ZH6A 1RYZA 4ALNA 3EUAA 2ZPAA 1DIAA 1YHYA 3RVBA 3PPIA 2IUUA 2ERYA 3K6JA 1VHQA 1QVAA 2O2XA 2J59A 4WNYA 2I2AA 2J41A 4OQ4A 5HX7A 3R0JA 1YS6A 2HL6A 2XLCA 4HQOA 3UJ9A 1TZJA 2FPIB 1YRBA 2NQTA 3PX7A 2P0EA 4MWOA 2I8LA 2PSFA 1NAIA 2WILA 4DLAA 4R6WA 4RVUA 4Y2RA 3O82A 1GT91 1IY2A 1Y5LA 3K8YA 3WP1B 2Y77A 4X5OA 2VNKA 5A4FS 1LSOA 3KT3A 4D0RA 1FIUA 1N8NA 4JUCA 4B7CA 1FA9A 1BDJA 1BJRE 2J9ZB 1W93A 3CSUA 1NMZA 2A7QA 1RM3A 1QUFA 1VGQA 4QE3A 5ALLA 3RQSA 4WQMA 4C0JA 4PS1A 3AR3A 3A1FA 5G1NA 5A7HA 1JF8A 1K9SA 3S40A 5BQFA 4D4KA 4NE2A 1GDDA 1XQ9A 5KSOA 5L53A 1GNTA 1Z5NA 2EW8A 4E46A 4ERNA 4Z54A 4OLHA 3RC7A 4H7DA 4EFKA 4S04A 3RASA 3GMIA 3ET5A 3IOCA 3ANSA 1H6DA 2PAFA 3AUAA 3Q1LA 4HUQA 3ZHBA 3PJRA 2FZKA 2HXYA 2G5PA 2J3IA 2ZSEA 3B6KA 4GPEA 4J16A 4ETWA 1CNEA 3EJWA 2R87A 4AB1A 5FO1A 1JZSA 1TCAA 2ZIXA 4Q3NA 2Y66A 4OK6A 4L57A 5IAJA 2HRQA 3F8WA 5EZYB 1KNXA 5SZJA 4DLKA 4YP1A 4NBLA 2V7BA 3CWZA 3ZWDA 2CYAA 4LZOA 1WHSB 4X3PA 1C8BA 3HJAA 1QLHA 2BEVB 2F2TA 3NHFA 4RD2A 2EFJA 1NDHA 4X60A 3I92A 3C41J 1ZNWA