4HNSA

Crystal structure of activated chey3 of vibrio cholerae
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
124
structure length
124
Chain Sequence
ANKNMKILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGDFDFVVTDWNMPGMQGIDLLKNIRADEELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLKEKLDKIFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Barrier of CheY3 and Inability of CheY4 to Bind FliM Control the Flagellar Motor Action in Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Signaling protein
molecule keywords Chemotaxis protein CheY
total genus 39
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hnsA00
4JB2A 3JY6A 4RXTA 3F6PA 4RU1A 1DZ3A 3HK2A 1QO0D 3H5OA 4XARA 5TE9A 1T34A 3BRSA 2DRIA 4HNSA 2MSWA 4MQFB 2E4XA 4O5AA 1BVHA 1A2OA 2HPHA 1YK1A 2AYZA 3QLUA 3EODA 3ILHA 4QPJC 3C3WA 4PEVA 3FFTA 1L5YA 3H5LA 5KI6A 5KC8A 1ISSA 1DBWA 2CD7A 4QYWA 1H9CA 4QYMA 4EVRA 4F12A 1URPA 2JBAB 1ZITA 4Z0NA 4YV7A 1U2QA 4N47A 4D6YA 4RY9A 5HM6A 4G0QA 5KQLA 2GI4A 1SXHA 5FBKA 1D1QA 2R25B 3O2JA 4Z4HA 5TPZA 2E4ZA 4W5OA 1OXBB 1Z12A 3QLVA 3SQNA 4Z9AA 5CNJA 4F11A 7ABPA 3A0RB 3MYYA 3OQOA 1JDNA 2FMIA 4JA2A 1PUXA 2FSPA 5HKOA 2E4YA 3KSMA 5JNTA 3LUJA 4M88A 3GYBA 5JNSA 1XHEA 5DCLA 5KQMA 5KWSA 3O74A 3RVOA 4RXUA 4KK3A 3QLTA 1SD5A 5JNRA 4P98A 1W25A 3R0JA 3C97A 3ROFA 1LJLA 3QELB 4RSMA 5T3YA 1DBQA 2FXIA 4YGXB 1EHCA 2B4AA 3KLNA 4B09A 5B3JA 2RGYA 4MR9A 5E3JA 5IULC 3CTPA 3KYIB 2VUHB 3O1JC 2F8SA 4KQCA 1TJYA 4KK4A 2IPAB 3F73A 1YMUA 2MYTA 2QVGA 3QEKA 5JNUA 3O2QB 4QICA 1JLKA 5EWLA 3RVRA 3N6VA 2A9PA 3N8IA 5PNTA 4EYOA 2WRZA 1BAPA 3KS9A 2FKAA 3NNNA 3EQ2A 1ZGGA 6ABPA 4HNQA 2QSJA 1Z26A 3IP5A 2NT3A 2JB9A 3JS5A 3B2NA 1NXWA 4WZZA 5IC5A 3A0UA 4NICA 4Q6BA 4RZSA 2E4WA 1BDHA 1JFVA 3C6QA 3Q7RA 1DBPA 4MQFA 1GCGA 2GBPA 3Q7TA 3NBMA 2FMKA 5TQ2A 3LTEA 4WXEA 2L2QA 4Z99A 2V0NA 1U2PA 3QX8A 3LUKA 2HQRA 2YHBA 1B00A 2R47A 2IYNA 3H1FA 4ZJPA 3OO1A 2R48A 4S05A 1KGSA 3HS3A 4WWHA 4GNRA 4ZMSA 5ABPA 3HXMA 4IMIB 3RVLA 4IF4A 3BBLA 2PUCA 4LDZA 5FWYB 4RY8A 1JFSA 4TLMB 6CHYA 3GA5A 3FFWA 1JWLA 1FFWA 3OM0A 3OO0A 2FQYA 1A0OA 4LE0A 1LK0A 4TLLB 5BR1A 2BGGA 3CKMA 2QXYA 3F7NA 3I09A 4RK1A 1JHZA 4ETMA 1U0SY 4E7PA 4EYGA 3OQMA 4N76A 2HQBA 5GQSA 4W5TA 3N0XA 1DCFA 3LMKA 3H5WA 5EWLB 2QVCA 1TLFA 4ZYLA 2JRLA 2FQWA 2ID7A 4LDAA 4WXMA 2L17A 1Z15A 3KCNA 4MS3B 4YRZA 3KG2A 4RKQA 2PMCA 5TQ2B 1BDIA 4WUTA 2PE5A 2H3HA 2I6FA 1S8NA 5CHYA 8ABPA 2RJNA 3H1GA 4LE2A 4WT7A 4DADA 1CHNA 3RH0A 4FE7A 1AB5A 5IEBA 1KRXA 1DC7A 3HSYA 1SRRA 4MRMA 3T8YA 1UDRA 1ISRA 2QR3A 2VK2A 3UUGA 2OENG 4YO7A 4PE5B 5C5CA 2P4UA 5HSGA 2HQOA 4N0PA 2CWDA 1USKA 3H6HA 2MSKA 3M6MD 3IDOA 1ZAYA 3IPAA 3C3MA 4G97A 4RWEA 4MAAA 5IUKC 2NZUG 3MM4A 3LKBA 3DZDA 4ZPJA 1D1PA 3KKEA 3T95A 4W5QA 4MR8A 3QELA 2LUOA 3E3MA 3H5IA 2P9HA 4UHJA 2PUEA 3OMWA 1PEAA 1P6UA 4OG2A 4TMYA 4MRMB 3VNBA 4MS1B 1RNLA 4NCBA 4MR7A 3QLVC 1KRWA 1NTRA 3RVPA 4KRFA 3SNKA 3N0RA 3I45A 3CG4A 3CHYA 3L49A 4RK6A 3TX6A 1E2BA 3IP9A 3D02A 5GOTA 1JH9A 4MQEA 3RQIA 3H6GA 1QKKA 3GBVA 2M98A 3LUGA 1EWKA 4KZKA 4LZLA 3CFYA 4KNYA 1PEYA 3JVDA 3N53A 1FFGA 1NXOA 4HYEA 5EWMA 5TPWA 4PZ0A 2JK1A 2IDMA 2R4QA 1EAYA 1NY5A 3EJWA 3LUFA 1M2FA 3Q7SA 3LUCA 2ZWMA 3CRNA 5EWJB 5FBHA 2MYPA 3TMYA 4FB4A 1GCAA 1JX6A 1LJUA 4LX8A 3OLWA 5TQ0A 2IKSA 1USIA 2IOYA 3O1IC 1ZH2A 1JDPA 3O2SB 3CU5A 1ABEA 2WY2D 2GKGA 2JVIA 4Z4FA 4S04A 3NHZA 4G0XA 1WETA 2JCGA 3MF4A 1Z2EA 3C3KA 3EQZA 3FGZA 3MIZA 4XAQA 5JNWA 3L6UA 4CBVA 4ETNA 2W42A 3KYJB 5KQGA 3H5TA 1ZY2A 2FMHA 1RZRA 1TMYA 4RDCA 4RKRA 5BRAA 4G0ZA 2NZVG 1QQAA 5KC9A 2FW0A 1FFSA 1JFTA 2NT4A 1R8JA 2WJWA 1ABFA 3NHMA 5IEJA 5TPWB 2A9OA 3JPWA 3MQ4A 2TMYA 1Z25A 1D5WA 4YCSA 4RV5A 5DKFA 3HJFA 4KREA 4XXHA 3DGEC 2HJ9A 2H0AA 4YWHA 1QPZA 3FDFA 4NV3A 2GX6A 2QV0A 1D2AA 3MA0A 1Z13A 4MR9B 4IRXA 3KHTA 5TQ0B 1Z16A 4OLBA 2PUDA 4Q6WA 3LOPA 1Y1LA 4MGEA 4MR7B 2WWVD 5ED4A 4IGAA 4G0YA 2AYXA 1JF8A 1RZRD 1RPJA 1IIBA 2FN8A 1L5ZA 1M5TA 3DBIA 2FEKA 1DG9A 1K68A 4H3KB 3SM9A 4EVSA 1APBA 2ZAYA 3OMXA 4MR8B 3DGFC 2NUBA 3ILYA 3UK0A 3CS3A 2A9QA 3JPYA 1P6QA 4RY0A 1E6KA 4H60A 4LE1A 4IMJB 4JP1A 3S99A 2B1JA 4Z4GA 3URMA 1LBHA 1NATA 4JAVC 1QP7A 3RVNA 3A10A 1M5UA 4DN6A 2JVJA 1I3CA 2FLWA 4P1ZA 2F8TA 2WMYA 5JS2A 2JBAA 4MS1A 1QMPA 4PYRA 4KFCA 3HM9A 2IPMA 1ZDMA 4H3HB 3HUUA 1EFAA 4F8JA 5T7BA 4NCAA 3EAFA 4ZMRA 5DTEA 1YK0A 3DLHA 3EGCA 3OQNA 3LKVA 4G0OA 4D6XA 4YR7A 1VLZA 3FFXA 2FQXA 4TN5A 5CNKA 1YMVA 3GWGA 2FEPA 3O75A 3OLZA 1BA2A 1XWWA 3P9YA 5DGCA 1QP4A 2FN9A 4Y9TA 1NXXA 1VKRA 3SAJA 4N0QA 4YLEA 4JASB 4Z4IA 1MB0A 3BILA 3GV0A 2FMFA 9ABPA 4MLCA 4N41A 1EWTA 4KQ9A 2ID9A 1CEYA 3CNBA 1DCMA 3HDVA 3T38A 1JBEA 1MVOA 1E6MA 1YS6A 1F51E 5CNIA 3TB6A 4OTZA 1TM2A 3OM1A 1VRVA 4RK0A 3SG0A 1Z17A 5I4CA 2IPNA 1P2FA 3RVMA 1BDJA 1D4ZA 4MS4A 3A3KA 3OLVA 3G1WA 3KJXA 1ZN2A 2WJAA 3H5VA 3CG0A 3SY8A 2PUAA 1NXPA 1DC8A 1ZESA 1HEYA 4MS4B 1F4VA 1PHRA 1NXSA 1GUDA 1JL3A 1GLGA 2QW1A 3I42A 3BREA 1JYFA 4L4UA 2N9UA 1YVUA 4HNRA 4W5NA 1TVMA 4RXMA 4W5RA 1U04A 1C0EA 3HVRA 1LBIA 4XFKA 3RVJA 3M9WA 4EYKA 2PKXA 3GL9A 1NXTA 3HZHA 2VYCA 4Q7EA 3GRCA 3RVQA 2J48A 3HUTA 2CHEA 2O20A 3TD9A 3IP7A 3OLXA 1W9HA 5IX8A 1QO0A 4O1HA 1A04A 1ZGZA 2QU7A 3HEBA 4NQRA 3RVSA 1VPWA 1Z18A 4MPTA 2FLKA 3HV2A 1KMIY 3JVIA 2Q5CA 1E6LA 4EUKA 2PL9A 3QK7A 1JYEA 3QEMB 4L85A 4MQEB 4YP9A 4EY3A 4MLDA 1PNRA 1MIHA 3T6KA 3EDCA 4Z9BA 2PLNA 4RK5A 1NXVA 3I5AA 3NNSA 2WB4A 4LRQA 4PICA 4KMRA 4Z4CA 2FEWB 2MYUA 5B3JC 1DCKA 3HDGA 5C5EA 2PUGA 2QZJA 5HQJA 5EWMB 1YS7A 1ZH4A 4OBBA 3M9XA 4GPAA 4RK7A 3Q9SA 5DLEA 2MYNA 4JOQA 4D74A 4KVFA 3CZ5A 2PJUA 2FTKE 2FVYA 3D8UA 1YIOA 2LP4Y 1FQWA 3GBPA 1DP4A 2VUIB 1USGA 5FWXB 1M2EA 3LUDA 3O21A 3HO1A 3K4HA 4RK4A 3W9SA 2PUFA 4KPYA 1U8TA 3Q15C 4MYRA 3HCWA 1RXIA 4O1IA 3N0WA 5IUJC 1P8AA 4UHKA 1DRKA 1SXGA 3O1HB 3CLKA 3IP6A 3ROTA 3E61A 4FE4A 1YTUA 4DQDA 5BQ3A 2RDMA 4N03A 2LPMA 5FWXA 1DRJA 5BRJA 2E4UA 3N75A 3QLUC 3UKJA 5IUNC 1PNTA 1Z2DA 4EYQA 2LIVA 4Z4EA 2YHAA 2GWRA 2PUBA 3QX9A 2IPLA 4G0PA 5TQJA 3VNAA 1MAVA 3JTEA 3H1EA 3F6CA 5JS1A 4YS6A 5JNVA 2XDYA 1SXIA 1MB3A 2KYRA 1CYEA 4ML3A 3FMVA 4IILA 3DLBA 5FWYA 4EGSA 4F3TA 2X7XA 3QEMA 4MS3A 3NNDA 3BRQA 5F64A 4E7OA 2PL1A 3RVKA 3LFTA 2L19A 2RJOA 3LUHA 3IPCA 4KV7A 3GT7A 5KQPA 5CNMA 3KLOA 1QQBA 1EWVA 3MMNA 4G0MA 3TO5A 2CHFA 1ZVVA 4F06A 3OLYA 4EVQA 2E4VA 4XLTA 1XHFA 3G85A 4G86A 1QNLA 2A9RA 3Q41A 3H75A 2PAFA 3EULA 5D2CA 2MSLA 1DJMA 2JVKA 2M1ZA 4RS3A 3CZCA 1ZHHA 5IBQA 4ETIA 1QP0A 4OLAA 1C4WA 3LUAA 1OXKB 1GUBA 1RXEA 5EWJA 2OQRA 2LBPA 1AB6A 3K9CA 1K66A 4JB0A 1J56A 2L18A 2HSGA 4OATA 5TPZD 1FSPA 3KTOA 4XASA
chains in the Genus database with same CATH superfamily
5IVIA 1XE3A 1KDTA 1NNEA 1U8EA 1O96B 5KBYA 4B2YA 2BZ1A 2C1EA 2O8DB 5JXIA 1RT9A 3JASA 4DSNA 4FTWA 3ETHA 2ZYSA 2FRVA 2QTVB 2WJZB 3RR2A 4HNSA 2ETXA 4E4RA 2X5OA 2RGCA 5CPBA 3EODA 4TVSA 3C3EA 1OXTA 2VJKA 1G64A 1TIBA 2IH2A 1VJ5A 4B46A 1ZINA 1SFRA 1FQKA 4QRIA 1DXOA 3K2QA 1R6BX 5IM4A 1UPUA 1GZ4A 2CD7A 4PS1A 4H7PA 4R8VA 4ZCTA 4IXWA 4IBOA 1BOOA 4BPRA 5ALUA 1GSHA 3NDIA 2FOLA 3G0HA 4P32A 3NRBA 2RHRA 1NUQA 2AZMA 3U7QA 4EW6A 5AM4A 1NDHA 1Z88A 5BSMA 5EJ7A 5HZHA 1B8UA 1NN5A 1REQA 2JA1A 3STYA 5JAUA 2CJFA 1UINA 3FZYA 4QQ8A 3ZHBA 4P54A 4RA6A 4KQMA 4PZAA 4U2CA 4B7XA 2Z95A 3BMQB 4F11A 1FYFA 1TEZA 1W94A 1RYEA 1ZD9A 3ZCRA 1TO1E 2BE7A 1XZGA 2WP0A 2E4YA 1VOTA 1AK2A 3C3CA 2MTBA 3CZAA 3SBDA 1A8IA 2XECA 3LVQE 3OZVA 2AJLI 4W5WA 3WQBA 1KH2A 1UJNA 1YACA 3QLTA 1J1UA 1SHKA 1AV7A 3B9PA 4U8HA 1BFDA 1GEEA 3HU3A 1IK6A 5CT9A 5F5LA 3JARA 1W25A 1PQPA 3CTMA 3SJUA 2HJHA 3ZV6A 2EEZA 1Y63A 4RPJA 3T1QA 5K0GA 2ECKA 1ODTC 3IAUA 4Q9NA 3U7HB 2H3EA 5L7YA 5EESA 3I2FA 1UBUS 3EH1A 2QBYB 2MYTA 1PT5A 1VPLA 1DLIA 4FFBA 4EABA 1GSIA 3VO8A 4PN3A 4MKRA 4YR9A 4JD5A 1NE2A 2W6QA 4IFIA 1AGPA 2P90A 5KNCD 1TUGA 1BAPA 4RVFA 4ZOCA 1EQUA 3KS9A 2CUTA 4JBHA 1QX3A 5JI2E 1VJGA 5JADA 5DT9A 1P0PA 4Q82A 2CF5A 3PX3A 5ICGA 1FUUA 1VL1A 3H5RA 1LS1A 4BZPA 5FA6A 4BRUA 2I6UA 1XAJA 2AZDA 1W9MA 4JUFA 4CR6A 5J3JA 3O1LA 1YBFA 3Q7RA 4FFPA 4V1CA 2QRNA 3P32A 1HT2E 1J22A 3FAZA 3LHDA 4JR2A 4KH0A 5KYXA 1EG7A 1FW8A 3QA9A 2H51A 3WSVA 1AN9A 1N1EA 1DAEA 3CCBA 3FI0A 1A9ZA 3MG9A 3E5MA 2FEXA 2R48A 3KSZO 3VBEA 1UWCA 1XF9A 1ZYUA 3PXAA 4RULA 5DBIA 1P91A 3UYKA 3AB3A 4QUJA 1XDSA 4I19A 4LDZA 4LMBA 1M83A 5I9SA 1L5NA 2FLVA 4HGZA 3ZY4A 3KBOA 5FAKA 2IS4A 2C5LA 3DMGA 4C3OB 4MKXA 1T1IA 3OJ0A 4GEGA 1DJPA 3ZUPA 3BHJA 3FTNA 3NM4A 2F1IA 2GO7A 4UPDA 2EX0A 2ETVA 2C5HA 2OSBA 4M38A 2FUNB 4NHOA 1RBMA 2F59A 2BPOA 3JZAA 5CYOA 3JD3A 4CODB 1W2GA 2FQWA 5KNDA 2BHRA 2BKUA 3KJNA 2OXRA 4MK4A 4X63A 3HB1A 5G0UA 3S28A 3TG8A 4RTNA 3CLSD 1W1UA 1D1SA 1QRDA 2O3SA 4ZVKA 3WWCA 5IXJA 4RKQA 1EVYA 4TMFA 1C7RA 1WMSA 3QMVA 3E2PA 3HU1A 4OHUA 5JI3E 3VHXA 4AB1A 8ABPA 4Y2YA 3O8CA 1QRRA 4LJKA 4FDLA 4E2XA 4LE2A 2AHOA 2YWGA 4ZYTA 5AOCA 3A1CA 4IWYA 3OX2A 4GW3A 1XZFA 2VK2A 5JMWA 3TKYA 2QD1A 3QLJA 5EERA 5AUNB 3AM1A 4LDRA 4ND4A 2A67A 3LBIA 2QGFA 1G8FA 1OFIA 4E32A 4OX9B 1KP3A 3A2KA 3RYHA 3FFAA 3FTQA 2WJ3A 2WT4A 3VKWA 5HFJA 1NVWQ 1ZAYA 3OTGA 2IZ1A 5JSZB 2H4WA 4ANFA 5JJLA 2W6ID 9LDTA 1QFJA 3L7BA 2CFIA 2QXUA 1NBWB 2IYYA 3ASYA 3HUDA 4KE9A 1ODSA 3AIKA 3HUFA 4ZVNA 2CZCA 4PZDA 1JVNA 2RK6A 1Z8FA 2IP1A 5B1DA 3A1SA 4CNQA 1DV2A 3IX7A 1E7RA 2W43A 4GQBA 4RVGA 1ITZA 1WF3A 2YZNA 3II6X 1YZQA 4KE8A 2G1JA 4Q1FA 3KJFA 2AX3A 4R83A 1GAWA 3GD5A 5AJZA 1T4DA 1VXRA 3SEQA 1U8CB 1U0OC 1CRPA 1M8PA 3CEJA 3MGBA 5GIOE 1XZKA 1BCRA 2YMPA 3BKXA 2AOVA 3D8BA 1X7WB 3EEQA 3H16A 3D7LA 5EEGA 3IDAA 2VWPA 1YV9A 3GQBA 1XQXA 4WIAA 3LVRE 4QZVA 1HA3A 2H2GA 3VU1A 4C22A 4L22A 3VO2A 2ZSIA 4MV4A 4NZMA 4EG3A 1TYCA 3ZU3A 3EFOB 2NU8A 2XYVA 4BVFA 1W5AA 4M89A 1IHOA 5EMHA 1XXHA 2HBYA 3SFZA 1RJFA 1ACMA 4CXMA 3J7TA 4YMUA 3GLFE 2ISCA 3FSEA 2I7XA 5JD5A 5EIBC 1L7BA 2XT6A 4G5HA 2HZ7A 3EPKA 3NXKA 2O8CB 3UFXB 4ROSA 2ZCJA 4CM5A 1DDGA 4OGGA 5HFNA 3CRNA 4F9FA 3AOEA 2EZUA 3ELWA 3TNDA 4C7BA 1CRQA 1ZH2A 2OB2A 1RQPA 4NEHB 2POCA 1LW6E 5HKBA 2GKGA 1XEXB 3QVXA 5TEVA 5K8VA 5DBHX 3ZWQA 3GBSA 1CDZA 5A9SA 5HCIA 2DAPA 2TECE 3IE2A 1G4UR 5ENZA 1KDVA 3WFZA 2DPGA 5IVDA 2NUTA 3L5OA 4CR8A 4KLCA 3TW8A 2ECPA 3GFTA 2HA3A 2ZYDA 1VKZA 2VDQB 3IIEA 4WJKB 3IURA 4OH7A 3HKBB 4RM2A 3V7FA 3A25A 2H1WA 3KYJB 2BFPA 3ERCA 3KYCA 4BNGA 2PGNA 2VZ0A 3DC2A 3IUYA 1N9GB 1DEXA 3MINA 1JXQA 1FFSA 3NBXX 4OXIA 2XITA 4F04A 4J91A 1SHLA 3L05A 3OCUA 2GXQA 4AZ3A 4CQJA 2WJWA 3KL4A 4F38A 4L9WA 1ORVA 1VGRA 2ES4A 3DTTA 3DUFB 1PTJA 3H5AA 3SN6A 3D0KA 2EXXA 3MQ4A 4JP2A 4EI8A 3F5SA 2H1HA 3DDHA 3OFND 4RMGA 3OQVA 4WN9B 1Z5VA 1EM8A 5KEIA 3RAEC 4DPMA 2A3RA 2QRMA 1DHRA 3NTRA 3X1YA 1QPZA 5LA6B 2PV0A 4I1SA 2OYRA 2AK3A 1IE3A 1D2AA 1FEZA 2ZRBA 3ZGVA 4BJHB 2V6GA 4KKVA 3RIGA 2KMLA 2ADOA 1GRNA 2ASEA 3P97A 4TZKA 1N9KA 4B4VA 3LOPA 2A57A 3WV4A 4CW7A 5BV8A 5EHIA 2XEDA 3LQQA 3DXYA 1E79D 1V96A 2YC4C 4IGAA 4MLPA 1IDN1 1OXVA 1CJCA 4HDRA 1GKLA 3C85A 2NO7A 2BJVA 1UKAA 2OR3A 4RIHA 2LCFA 2X86A 5AK0A 5FI3A 3RO7A 4A8TA 4K9PA 4N9QA 2VH5R 2WR8A 4HYTA 1LBEA 3OCWA 5EE5B 4BVLA 2PKQP 3CS3A 3AETB 2HUPA 5K20A 1I0IA 3ZH9B 5EMNA 2WVHA 1VG0B 2QTTA 5FUVA 3B5EA 1IQUA 1RVDA 2RGWA 4QDOA 4U63A 2IT1A 4IMJB 5FOUA 1AZTA 2GJ8A 9LDBA 3ICPA 1SEPA 4E15A 3A1WA 1U81A 3EMDA 3WO0A 2BBTA 3HYLA 5JRDS 3NAZA 3OESA 5HYVA 1FDIA 2XWBF 1H4SA 1GPLA 2JIQA 4KFCA 5E7JA 5GV7A 1SU4A 4UD6A 2Q2QA 2HMUA 1XZCA 3PJRA 4LK2A 4PFJA 1XDZA 3G5MA 3S1AA 1N2CB 1XLUA 2FH5B 1ARZA 1LSJA 2OFWA 2PXCA 3CW8X 4YLEA 3R7BA 2O2ZA 3CEHA 1R5OA 4O6VA 4O2AF 2WWYA 3IJPA 5DT2A 2UXBB 4GP7A 2FEPA 4JBNA 3KWJA 1XWWA 5DGCA 3V4FA 1M1XB 3BWDD 3N2LA 3NBFA 3WYGA 3O84A 4AS3A 3ESYA 2RHGB 3E15A 3EDMA 1DTSA 4BXOA 5TX7A 1QIFA 5E0KB 4FYMA 3EQ6A 1QVZA 1QVAA 3K0BA 4AZTA 1IM5A 4N41A 4UC0A 1QCZA 2WIFA 1RZ3A 5E2IA 4YP1A 5LZ9A 5I5EA 1W30A 2ZGVA 4KWIA 1L5LA 3TL2A 5K5EA 5JFGA 2IXDA 3DE6X 4FYJA 2Z0MA 1RIFA 3C8ZA 1WE2A 2V97A 1QHIA 1TM2A 4BQEA 1OJLA 1V43A 4MVJF 3NXSA 2AXQA 2HU2A 4H2DA 2ZIFA 1BDJA 2VK1A 5LOVF 3HZRA 3QPCA 1Q0SA 4AWXA 3TTTA 1Y8CA 3G1WA 5F4ZA 2FW1A 3KZ1E 3H5VA 4GX0A 2NTEA 1L7MA 1BU5A 1SD2A 1R6DA 3IAM1 4LQCA 1SQGA 3ZJYA 3K71B 4XX0A 5AK4A 1EQAA 2AQHA 3I42A 1GUDA 1MC1A 3IKJA 2GJKA 4L4UA 2EL9A 2YXBA 4Q4AA 1E66A 5EG5A 2I6TA 3ZHOA 1RLJA 4UBKA 5CVVA 1WD7A 2AOUA 3E22A 1YI1A 2OBNA 5CITA 3LWZA 4LZZA 4K6CA 4D44A 1TQ8A 1Y9JA 3M4NA 2KB0A 4AULA 1Q0HA 1ND6A 3U44A 5JD3A 2Y4OA 4RNCA 4RWZA 1CUBA 4LKOA 2IF0A 2C57A 1I6WA 2IU3A 3NCTA 3GCZA 2EF0A 5DM0A 4HI0E 3UAOA 1H1LA 5FL3A 3TZ6A 4ZYUA 2QVLA 3TEJA 1WULS 1P0QA 4WCFA 2XCRB 1J8VA 2WF7A 5GAJA 1A9SA 1CJKC 3WMXA 3FYTA 4YP6A 1GV1A 2J32A 3UMVA 2O2JA 4TMTA 4AN0A 2X23A 1VPVA 5CH3A 1PYOA 5JCOA 4JXZA 1NSFA 4XYLA 1Y6QA 3EA4A 3RREA 1UAYA 2FEWB 4WBNF 2QUZA 5T6BA 1L5OA 4LGMA 1R5NA 3VPDA 4WLEA 5HNKA 4P08A 4HAYA 1YGYA 3LK6A 1M1UA 3R5SA 4Q4JA 1GYPA 2O0HA 3CZ4A 4GPAA 1M6YA 3GJ6A 4IDGA 1DAFA 1EGVB 2GFIA 4CMEA 3PPVA 2HF2A 5GM1A 5HK8A 2P3QA 3AFMA 3JAKA 4N7MA 4B9AA 1W19A 2AKEA 3P0RA 1WZIA 1QK5A 1W87A 2C97A 3MTGA 3GBPA 1ZOSA 1QHHA 3AG5A 3EZNA 1QIHA 3BH6A 3G2IA 3TOCA 5HTOA 3BWEA 4DOMA 4HNVA 5THXA 1ZOPA 3RE1A 1HSZA 1VDZA 2X0DA 3F6RA 2L69A 4OHCA 1XJ5A 3L06A 4YV2A 5KWEA 2YVAA 4GQIA 3TQCA 3NHLA 2XADA 4MUFA 5GP1A 3ETEA 3DZFA 4CF3A 4ESOA 3O90A 4FX2A 1RWPA 2H1LA 1T1SA 2Z2KA 5JD4A 1H4QA 1B6RA 1OGJA 3T3EA 1LTQA 1JG2A 4IZIA 4TWRA 4BMDA 2Q9BA 3ANYB 4N03A 3QF4A 4AKTA 3GJTA 5DU2A 1NLFA 1FNDA 5IF3A 2VSQA 2P65A 1PFWA 1A71A 3AJ8A 1PGPA 4YPFA 1GZDA 3T5BA 1Q0QA 2VXOA 4DV2B 2UAGA 3CF4G 1LPAB 1DAHA 4U2EA 4FS8A 1E4YA 3I83A 3VZPA 4K86A 1Z8HA 2ZE7A 2ZRDA 5EKSA 3ZDRA 2GUGA 3MAJA 3H1EA 1YZTA 1UMKA 4KGXA 3WK5A 2O2IA 2ODWA 4JLAA 5HG0A 4KIJA 4FK8A 1R6UA 3EVZA 1WZNA 3FN4A 4W1QA 3NEPX 1JW9B 1Q12A 2PLRA 3S1SA 3E0QA 4ML3A 3H97A 1AGRA 2BRUC 4GMGA 4GX1A 4GVPA 1U1EA 2ZXFA 4NDNE 2OAQ1 4V0LA 3ZCVA 2B6NA 1YCHA 4QELA 3DQZA 2PL1A 2RJOA 4KWEA 4E6EA 4NLLA 1X19A 1FS4A 1H2XA 1O7JA 2PJZA 4FOOA 5CNMA 2QUIA 3MMNA 5FWAA 1UJBA 1X15A 2GAJA 4EVQA 3QWFA 4C78A 5BSGA 4UTOA 4XLTA 1JDVA 2GSDA 2A9RA 1QLJA 2HDNB 3QW4B 4MYDA 4IKPA 4R6WA 3FR7A 1KJ8A 1OX6A 4B3IA 3IEMA 1N36B 3KQYA 1UXJA 3HCNA 4EKEA 1NPYA 1YDMA 4KHZA 2BEJA 1MX1A 4NCNA 2LBPA 3BWCA 2CNWA 2DC1A 1GL9B 3B9RA 3IBTA 3LBAA 1WB9A 2L18A 4Z2AA 3D7KA 3LGAA 3HDTA 3KTOA 2EATA 4XASA 3DWIA 4JB2A 4RXTA 4CEJA 5IMSA 4FFBB 4FT4A 4LVOA 4N3GA 3THYB 3UJNA 1KAQA 4RPHA 5EQDA 5ESWA 3TNLA 2F43A 1KC1A 4HDMB 4JEHA 4D92A 1YASA 2E4XA 2P7IA 2R1ZA 4MQFB 1DRUA 1BX0A 1YNSA 1D2MA 3QLUA 4C7JA 3H8JA 1AGNA 1P81A 1H23A 2NZXA 4MUNA 2NQTA 3WXMA 2PSFA 1GQSA 3E6AA 4MUGA 4MYTA 2R7LA 4KGVA 3CLVA 5HDBB 5L9AA 4OBXA 3REQA 1QFZA 3IYLW 4MSUA 3GFVA 4H6XA 4QFMA 2NSLA 2HNBA 4BVGA 2B98A 2C3YA 2GBLC 4E4YA 4YQYA 4N47A 1E9SA 4IINA 2C1ZA 3GROA 4NNPA 4ZOAA 1D2EA 3EBOA 1GOTA 2AEJA 3RU3A 4IHJF 3EGEA 3ER6A 1LV7A 2PNJA 3P7MA 1LNSA 3KZOA 2C4NA 3DJFA 4GPTA 3ZIAA 4AJNA 2BUAA 3HDQA 5D5PA 2Y1WA 3B5IA 5HMMA 4BLWA 1QJ4A 4CKEA 3WJ7A 3WYFA 1AHPA 4TXLA 1WRBA 2GVNA 1QHNA 2JJ2D 3KBBA 2R7NA 2AG0A 1NY6A 3KEFA 4OJTA 5JNTA 3BG5A 3PHBE 4F4FA 1Z06A 1VLJA 2XODA 6PFKA 2GZ2A 1R8XA 4A8PA 3W5BA 3K70D 4B43A 3EYAA 3OURA 4KOAA 3EGIA 3KD3A 2CF6A 4P4TA 1KSFX 4P98A 2MSDB 3OZAA 1U7ZA 2VCHA 3KWLA 2EKQA 2G72A 5LQRA 3L8FA 1DHTA 4PG4A 5THQA 2HRZA 4ZJZA 3KZNA 5IT0A 4HQFA 3TPCA 3N8KA 5KOHA 3KQPA 5DIFA 3HM2A 4EX6A 1JGTA 4L8WB 1XG5A 4KQCA 4L16A 3NJ4A 3N0VA 1RMTA 4A3SA 3F6EX 3OIFA 1ZM7A 2PZGA 2ZRAA 3FYDA 3P71T 4G4GA 1ESMA 1XV5A 2IP4A 4Q93A 4AMVA 1VM6A 1A4UA 1RSZA 2NACA 1RAIA 1S2GA 3KV3O 3S29A 4E5MA 2GEDA 3N2ZB 3QLEA 3JQ9C 4TYMA 4A6PA 3IBSA 4AJHA 4CDNA 1SHJA 4AUEA 1ETUA 3EASA 5JE8A 1T2NA 5J9FA 4B3HA 5BYJA 5JXGA 1KXJA 3RHSA 3WGJA 2RG7A 1BDHA 1F1BA 2XCLA 5HPYB 1SB8A 1VB3A 3T4EA 4JI7B 3QX8A 3ZVRA 4Y8VA 3FBTA 1E5DA 4TQUS 4ZT6A 2D3TA 2R6FA 1S2DA 1IONA 4B31A 2J0EA 1SPXA 2QNIA 5K4HA 1I01A 3QNUA 3PVSA 4L8YA 2F8SA 4EMUA 3OJWA 3G13A 1QVRA 5A06A 5H70A 4XDZA 4ECEA 1VIMA 4UAVA 3ZD8A 5IJ0B 3BBLA 5I4BA 2BDTA 4ZYXA 3SSNA 1T2VA 3IB6A 4JR1A 4TZTA 1DBVO 3DO8A 3T7CA 4XVHA 3NTQA 4CL8A 4MJXA 1W0KA 2BL4A 3E7WA 1LLFA 3HLYA 5IT5A 3AKCA 3CIOA 1LK0A 1JAHA 1FP1D 3F7NA 4ZRDA 1XD9A 4NL4H 5EKDA 4PM4A 3DJYA 1U5BB 3N2GA 4MLZA 1XDBA 3SVTA 1Q0RA 5FOSA 1E1YA 1QIDA 5GINE 1BX3A 3STWA 2FDCA 4B6QA 5AK5A 5BQXA 4IQGA 1B6SA 5G02A 7YASA 4QJIA 4Y9UA 4MOWA 1T13A 5ALKA 1PT6A 2VJYA 2FPIB 1IBCA 5CK5A 3H86A 2IHZA 3L0SA 2I6FA 4MAMA 3WAGA 4EB3A 1PLKA 2ZT5A 3TQOA 1IUNA 1CHNA 2LGJA 2TMKA 2GJ4A 3KOOA 4KB5A 4TGLA 2OCXA 2ZAMA 3SQMA 1Z0KA 2BDUA 2XNKA 1ZCBA 3KJZA 4KRGA 1NFRA 3CCCA 5E2AA 4DV7B 2P78A 5FRDA 2VCEA 4R84A 2WIBA 4FCTA 4FQ8A 3CO0S 1DKLA 1QRUA 3REFA 1USKA 2QUBA 1WUKS 3QWAA 4P86A 2VAVA 5D84A 4Q0MA 1PT9A 1RHKA 1RWOA 1YVRA 1KOJA 2OXFA 3MM4A 4RWEA 5HKLA 2X9VA 3LX4A 2JCSA 3ANTA 1HE5A 3TTSA 4LG1A 3LYHA 1P44A 4IG9A 2J9XB 2WYVA 4LTMA 3REOA 3UAWA 4AVYA 1BWQA 2ERCA 1BN7A 3KKEA 3NG1A 1KQGA 4LBYA 1I5EA 2XNHA 3H5IA 2XYPA 3C24A 2JA2A 3S1AB 5I7VA 1M34E 1IHXA 3Q0IA 4CMCA 1H2RS 3RCBA 3SS8A 4JVMA 3GDFA 1CNEA 3E7FA 4C5BA 4MR7A 1G6OA 4MWTA 4PCLA 2BM0A 2WYIA 5D00A 4INOA 4B3JA 2C59A 1E61A 3ZCPA 2YZGA 2FPIA 1U0JA 4HAIA 4HZIA 1QGZA 4XPZA 2VXCA 1KVSA 3AF2A 2NADA 4MP6A 5I8ZA 5IXYA 1MJGA 4F4JA 1ILEA 3AETA 3LUGA 4IQ4A 1L1RA 3HCAA 4WLFA 3T9CA 1TUIA 3UPDA 3UVEA 1K8XB 1O03A 2D0DA 4I3FA 5FULA 5A7GA 5BP7A 4L5IA 4ER6A 1L8LA 2ZITA 3OJOA 1JHVA 3JWEA 5K2MA 3WGIA 4P3XA 1ZZGA 2WPDD 4OHKA 3O31A 5EP2A 1JG4A 3NH6A 1E2LA 3LV8A 2G1UA 1JFRA 2OEPA 4O4JA 4AP9A 4W1SA 5BW4A 3CVXA 1E1QD 3KAJA 4B7ZA 4H6VA 3F47A 2JHPA 1XKLA 3NTVA 3C4VA 2W70A 1OB5A 4NBWA 1RW4A 1YBHA 1Q1NA 2I2CA 3OBBA 3CU5A 4CG2A 1X6VA 2WY2D 4ALJA 1YS4A 3ENNA 1HDIA 2IZOA 4J03A 8ATCA 1M0TA 1BMFA 1M6WA 1V7QA 1YQGA 3QKSA 5KOJB 4G0XA 3SK0A 2WQZA 4PHFA 1QTRA 3I2YX 2W2LD 5F2OA 3ZKAA 2ZM6B 1J8DA 3OFSA 1COWD 4MYUA 1QBGA 3PGMA 4UUOA 1ZMOA 2O8EA 3RV3A 5EHZA 3VKGA 3D5EA 3DW1X 4B87A 1H94A 1NUSA 2BFFB 2Y1EA 3H5TA 3VR3D 2O8BA 4CGZA 2OBXA 3QXGA 4RVUA 3DNFA 4AO8A 4M83A 1TZJA 2J5KA 2XH8A 2ZUTA 4AJKA 3B7GA 3B38A 5DBGA 3OQBA 3UQYS 4JU8A 1YL5A 4KFSA 4JUDX 3GAFA 2XE7A 5BPFA 5BSFA 1PKEA 1ANKA 221PA 3B13B 2A9FA 4P4SB 3PDCA 5K0EA 3J7AC 1FC0A 1MP0A 5IK2D 4HWGA 4RH0A 3DOOA 1E9FA 1XEXA 2BBSA 3IAEA 2J3HA 3P9CA 3GLKA 3WX0A 4KXQA 4MR9B 3EEOA 2ZKIA 1TIPA 3O93A 4IRXA 4HEQA 1P4SA 3L0CA 4D9JA 1O0CA 3HGQA 2FDXA 4II7A 3E27A 3LPNA 1E2MA 4KPGA 5FBQB 5MFPA 4YAJA 2R1VA 1QNFA 3KQVA 1QGUB 3SJCA 3QE4A 1OC4A 2WM8A 5KHLB 2EG5A 4DABA 3M0EA 3PXCX 1IIBA 4LJ7A 5DNCA 3AR5A 1OREA 1SURA 1K68A 1MX9A 3M83A 2H5EA 2VPYA 4H3KB 3IAFA 4I55A 2UZ1B 4K5QA 4TVOA 2BCEA 4A1FA 5HBGA 1FXWA 1GL3A 2AFIA 4BEBA 5CG1A 3R0QA 4FMDB 5J59A 3SS7X 4M2LA 4RQAA 1Z63A 1GTRA 3MOSA 2RI6A 5IBCA 3BL8A 4HLNA 2F9MA 1FUEA 4EHFA 1ISPA 2WFLB 2YWDA 2Q41A 4JP1A 5ICMA 1E63A 2QX9A 3IMKA 2FZ4A 4RQUA 4DCSA 5FPPA 1YZYA 4DN6A 2WE7A 3S70A 5GIPE 1FDSA 1PR6A 4RKWA 5FBZA 2PBLA 2PS3A 2BMJA 3QKRB 4H0FA 3TTWA 2ZULA 4R7TA 1A7KA 1QWOA 4DE5A 3BQ9A 3RAPR 2Q27A 5KYYB 1H5UA 4AXBA 4JJFA 3T9FA 3ILXA 1NQXA 4G4SO 4OXXA 4LY0A 3A1VA 2WV9A 2UZ0A 3AGPA 1BHSA 2UUAB 1N3LA 1Z9BA 3L3BA 3S5UA 3RLIA 3ZV7A 4O4HA 4OI4A 4D6XA 4O8ZA 3JSAA 1F9EA 4KQHA 2P41A 3K15A 4RDHA 4RORA 3ESDA 2CNOA 4LC9A 1I14A 1J8YF 2GF0A 2NAPA 3ZIAD 1PW7A 1MA3A 1K2VN 2JIRA 4ZZIA 1E1CA 2WUDA 2X8AA 2WAYA 2P3LA 3GLRA 5F7JA 4CM4A 1F2VA 1ADJA 4EJ6A 1GA1A 1ATZA 2JIBA 4NEGA 1LDGA 1JBEA 5LD2B 3Q3CA 1PNVA 1Q1GA 2X2FA 3HVUA 2FE1A 3VHXB 4E1VA 4ECAA 1VRCA 4NX2A 1I2MA 2BE9A 3DHEA 4C2UA 2J5XA 4MAFA 3WYNA 3CWZA 4PF1A 3RVMA 4XLZA 5BUZA 1GXSB 4JQZA 4QBIA 5A5VA 1JDBC 4MI9A 1WF6A 3IPRA 4LOLA 1E9RA 2C9YA 4Q3EA 2WZQA 3TLGA 1KJNA 1OBCA 1WCXA 4D99A 3UO8B 1X1QA 1OIVA 3M1IA 3FPCA 1FRQA 2FXVA 3AR6A 2EWWA 1JYFA 1WOYA 4FFVA 4Q9DA 4C0XA 3JVVA 1TDJA 1GN9A 1XBTA 1GR1A 1LBIA 4UM8B 3RS7A 4XFKA 2VT7A 5A7FA 2OZVA 1BMQA 3AY6A 3UENA 2VYCA 5K7SA 4G2TA 2E18A 1GPAA 3ORQA 1O5OA 2IEIA 4DBZA 1NFQA 2H06A 5MGBA 1QIJA 2AJDA 1F4LA 3PR2B 2W58A 3SE0A 1W9HA 4QULA 4D3SA 4F46A 3TTVA 3WK7A 1QZUA 3O7MA 1BMTA 5FPHA 2GF2A 2JIDA 5GZ6A 5CLLA 1ISGA 4YJFB 1ULUA 2NU9A 3NGXA 4MQ5A 2J0VA 1GXSA 1ZJ5A 2HXGA 4F6RB 2R8EA 1XEWY 4YP9A 1OBHA 4EY3A 4OQYA 3KB2A 4RMJA 2JZOA 3NW9A 3KFLA 2V9ZA 4IIHA 3TEFA 1JQEA 3AFNA 4TVBA 3QQ5A 3F67A 4GZLA 4HYQA 4URYR 4KH1A 3FOFC 3FVVA 3IMFA 3I9NA 3O4RA 3RARA 1PWXA 1Z6YA 3HDGA 3I73A 1QQTA 1KKLA 2JFZA 3U7EB 1EIWA 3PFKA 1PO7A 4OBBA 4YMIA 2DUUA 1IY1A 2EBFX 4A10A 4BQSA 3EUWA 4A0QA 2EHJA 4NFHA 4I4TF 2YJZA 5KSWB 2NAFA 1JIVA 1KVQA 3AUUA 1WZCA 4G1MB 2NU6B 1K7FB 4IOJA 4MUJA 3BVPA 5IF9A 2HDHA 2Y1KA 2BBWA 2I66A 4M0EA 5CLIA 2BFAA 4QATA 4R1NA 1M2EA 5FUBA 2ZJAA 4HVCA 1QE0A 4ITRC 2R66A 3L0YA 4G65A 4IJKA 4HAUA 2XF2A 1P8AA 1H6CA 2ATCA 2JFHA 5DHRA 4QUEA 1DMSA 3Q72A 3M3DA 4KSCA 3LLMA 3CN7A 4G0NA 1W73A 4DGSA 1H8ED 4TSRA 3OD1A 3WGNA 1RAFA 2XZTA 1ZMBA 5JZMA 3OU6A 2H4HA 1NW6A 2VOJA 3I2GA 1XMPA 3EF1A 2GHQA 2CBGA 3UOWA 2J0UB 1L8OA 2HJRA 2NVWA 2EW8A 5KVQA 3RIXA 1ADCA 2YHAA 4U7WA 4ZOLA 5KVCA 2ZWVA 3ACCA 1CG6A 2Q46A 2J8ZA 4D9BA 2C4VA 2AK2A 3ZHSA 5EMJA 1Z68A 2QL9A 1A8QA 1JTEA 3CZMA 3U44B 2W4IA 2XDYA 4UW9A 4ZQGA 3UATA 3WL7A 3VOTA 3IIJA 5JVDB 3AESB 2YXPX 3FBWA 1A9YA 1JQBA 2IW1A 1CUXA 1JRLA 1OZHA 3E22B 3H13A 3H2YA 1WXQA 2FJ0A 4JJAA 4X8MA 2TMDA 1UMBA 3I4CA 3LQRA 3T3DA 3IVAA 2AA3A 4ZCMA 3ZZ1A 2DCUA 3HBJA 2XTAA 1OE0A 3BRQA 3UXEA 2YWCA 4BFYA 3LFTA 2J3QA 2O2HA 2WWRA 3BB1A 3VSCA 1DRVA 3I34X 3LCUA 2ESRA 2ZQYA 4G0MA 1PJAA 3I8SA 2RH9B 3EN0A 3PZBA 1JZTA 1TB4A 4CKYA 4LYAA 3HJNA 4TS4A 4O2AB 2PTHA 1HOTA 1HQYE 4NE7A 3RW9A 4E5SA 3FRJA 3EWIA 3C74A 4OP1A 2VK4A 1BYIA 5FJIA 5K0NA 3RRNA 2M6KA 1UM9A 4Z3OA 1CZUA 1OBOA 3C14C 2K2QB 4QUKA 1CR0A 3H5NA 4M37A 5H3CA 2DTDA 2HCFA 3MCWA 1U6JA 4KN5A 1H9AA 3OEEA 4BLUA 1E3LA 2GRAA 4PSCA 3VPAA 3CCFA 5JAHA 4C88A 1CE8B 3H9UA 1MW8X 3WLHA 2Q45A 1XJQA 1HFEL 4H16A 2EJBA 2DFNA 3H3FA 4R68A 4J94A 4HUQA 2A0XA 5E9WA 5EL0A 2V6MA 3NASA 3OKPA 3U26A 2XZLA 1OYWA 1AQ6A 2DRIA 3NBKA 2Q4BA 4NBNA 4PPNA 3VX4A 4CCSA 3A11A 4DPKA 1Y1PA 2JZNA 5TV2A 3AI1A 2ZIGA 1V45E 1UR5A 4BFCA 1VPDA 3VMMA 1YL7A 2QN6A 3RB8A 4N5NA 1M2OA 4AWAA 3AWDA 3R44A 2VDVE 2JEYA 3WLPA 1S1MA 5K3FB 4EFKA 5FEUA 3VHLB 5EGSA 4V39A 3K31A 2J4DA 1KZ9A 3O0TA 4PINA 1XZDA 5DHAA 4EQZA 4NAHA 4D6YA 5C80A 4QDZA 1T10A 2IXGA 4HMPA 1U0GA 2ZR9A 4QBGB 3B78A 4NV1A 1FP6A 3O2JA 4K9OA 1L7NA 4Z8YA 3ZU4A 1O2DA 3ZWNA 2UUPA 3FJ1A 2WFMA 4BO0A 1ONBA 3A0RB 1Z47A 3ZHXA 2C5EA 5DWVA 3STHA 4BX9A 4Q9IA 1UZLA 1O94D 2WT9A 5A4FS 2ZU6A 2W71A 4B3CA 3AK4A 1RACA 2DFPA 1RM5A 1YIDA 4ZVTA 4ALKA 1E0JA 2RHTA 2ZJBA 3KV1A 3UJHA 4BP9A 5TJHA 2ZR8A 3DKVA 4HCJA 4ENSA 3R3ZA 1VJCA 5ALEA 2VATA 2F3QA 1JAIA 3DL0A 3FSGA 3ABSB 3D2CA 3NKLA 1O1YA 3FGOA 4HDCA 3ROFA 1HDCA 1UK8A 3JYOA 4RH3A 3W1WA 4D9HA 2IZ6A 5B3JA 4H35A 2MCFA 3ESZA 4H4DA 3GJZA 3DZ8A 3FPEA 4GF5A 1AZSC 1KO7A 4JLKA 4UUPA 4ENTA 1OZ0A 1S9DA 2Y8EA 1RVV1 1PK8A 1WQ3A 2QVGA 3IQZA 4KK4A 4MITA 1MO5A 1EX1A 2GZHA 1MAAA 6AT1A 1EP3B 3EMBA 1U5AA 3PC8C 2H29A 1CUYA 2YWXA 4P53A 4KTVE 1HRDA 4EYOA 3TCNA 4V0NA 3K1AA 3MXOA 2I7DA 4GI3A 3PUHA 4ZO6A 3I9FA 5CM9C 4BLVA 2GILA 2WF5A 4C7MA 2ZE8A 2FW7A 1U31A 4R2IA 1W88B 2D74A 3U3DA 1DO8A 1GNSA 2HYDA 4ZEMA 4JFRA 3DE0X 1M2WA 4BAZA 5CA0A 3NBMA 1ZA1A 2XGSA 4O2AA 3HWWA 3VOAA 4QREA 1X7YB 3I62A 4J0EA 3L4KA 1O77A 4IRMA 1P3DA 2VZ8A 2IYAA 3MLBA 4PR3A 1I4TD 1M1NB 1AIPA 4OXNA 5BNZA 1G5HA 1JNXX 2N46A 2V6JA 1GHTA 2ZAOA 3DB2A 3ZW8A 4IYRA 5J4KA 3BZUA 1ZVKA 3VA7A 1V47A 4S05A 2K7FA 1Y6GA 1GTSA 4B1FA 2ORVA 2QGZA 4YP7A 1B4DA 3PICA 2FN7A 2JDID 3PFFA 5KAPA 3CR8A 4BKMA 2FG7C 3GMDA 4R31A 2ZI7A 2Y9PB 1Z39A 4ZZ0A 1JWLA 1TA0A 2REQA 4DILA 3CV3A 4ABTA 4M9XA 1OTHA 2LXNA 4GBGA 4WXPA 2OXEA 4B2PA 1OF1A 3WLTA 4F9TA 5GQSA 4MKGA 5CX1A 3Q2IA 2FUG6 3LPAA 1IMJA 1CB0A 4X1OA 4L3WA 4QNRA 4HAXA 1M7GA 5FAXA 4MDFA 4J6EA 5K8LA 5BVHB 4QEZA 3ED5A 1XLTC 5FLKA 3TZQA 3DE4X 3K0FA 2ZRGA 4DLVA 4JYAB 1MG5A 1UBLS 1E8NA 1OLSB 4QQKA 3HMKA 3ZDBA 1XMIA 4KN6A 4NU5A 4R05A 4YJDA 3LY9A 1VE1A 2QMEA 5IEBA 4QL3A 1U90A 1KRXA 1NLZA 2GN9A 2H4ZA 4N3NA 1RHMA 2EYQA 1BS9A 4R1LA 4LQ4A 1XNRB 2R8ZA 3AFOA 4X8HA 5ES3A 4DFDA 4N18A 4EKDA 2FE4A 4QGSA 4C0LA 4B6OA 4JC0A 1OX4A 1JU4A 5L3SB 1GNVA 4DY4A 2PX8A 4EYSA 2C4WA 3KT0A 4MVJA 4KIUA 4RHYA 4HX9A 1SBQA 2AKAB 2DFTA 4MNTA 2H65A 3DZIA 1K27A 4QHSA 1WR8A 2VDRB 3BMNB 1KGDA 5IN5A 3PC7A 3T5CA 1BVUA 1P45A 3L6OO 4NY1A 1T3TA 3GFBA 1XX6A 4FYIA 2B94A 3TLKA 1L5WA 4IGEA 5COQA 4ZOQI 5BR8B 2J3EA 2YHSA 3OMWA 4HH1A 5EJ6A 1ONNA 1W4BA 4OLBA 1F9AA 1HBJA 7REQB 3TXXA 1EXVA 3MILA 2PFKA 2Q7OE 3PEEA 2RHMA 5T4HA 1MAWA 1P2BA 2EKLA 4PZYA 3SNKA 4OSPA 4B8YA 1F1JA 5HWSA 4JJGA 3OFVA 4GECA 1CS4C 1GUYA 3E9DA 5F78A 3D02A 4D8XA 4HAZA 4MCAA 4FJ1A 2PUTA 3H6GA 3KRTA 2HA6A 4LXYA 4N7JA 1XJ0A 2CVFA 2BUBA 2R6CA 3E70C 3NR2A 1ZL2A 2CL5A 3VR5H 3VYRB 4G4JA 3U6KA 4M3NA 4V1CI 3DPSA 4NMXB 3GARA 3N53A 4TSFA 3QU2A 3CVYA 3S2SA 3DM5A 3O8LA 3E9ZA 2ZPAA 3FYCA 3GMTA 1OILA 3NAQA 4M87A 4OMCA 6GPBA 3A2MA 5AVQA 4M49A 4XIYA 4G09A 1HQCA 2SECE 4FB4A 5KVVA 2AVDA 4NQZA 2P9ZA 4WJZA 1JIXA 3B1XA 5IHPA 4DV3B 1GITA 1U3CA 4DBLE 4GGPA 4EGAA 1TQDA 5E1BA 3ZVNA 2C2MA 4M8SA 1Q7CA 3GRRA 3ND6A 3D43A 4XVCA 1J25A 2R96A 3PWZA 1Q14A 2OUIA 4LHZA 3TVTA 1MIOB 2PMEA 3KHSA 1JLHA 2X5XA 2Z5VA 4NCHA 2QAJA 5BMOA 4IX9A 3M89A 3RRMA 2YHUA 4BNNA 4CBVA 2W42A 5KQGA 5BOSB 5KQLA 3NJRA 1D04A 4I9FA 4RFLA 5FHRA 2XAAA 3ZDYB 5BT8A 4FOPA 2NT4A 3EE6A 1R8JA 4LECA 3NPMA 3T4UA 1BKYA 4U0KA 5ARCA 1P31A 1QH8A 4CM4B 1ID8A 2A9OA 1ZVQA 2Z1MA 4O2BA 4PLPA 1ECJA 1XRSB 4P22A 1TVKB 3D54D 2KLHA 2WUGA 3HBNA 3MWYW 5EIHA 4ATNA 1OHHA 2WUEA 4G1CA 4L51A 2YN2A 4H0CA 4L27A 5FLEX 1ZQ9A 4DCUA 1KNQA 2HJWA 3R0ZA 2H0AA 4IHJA 1FTQA 1XCPA 4FLMA 1WVMA 3W5JA 2O8FB 1ESNA 1B1CA 1GG8A 2NVBA 2QV0A 4PFQA 3UJBA 4XR4A 4DLXA 4H6PA 3VSAA 1J5EB 1ESDA 1PYDA 2B83A 3QPWA 1Z16A 4BJ3A 1OW3B 2V0CA 2ZYAA 2DLDA 3BXHA 2HBQA 5LP6B 1JUDA 3WA7A 4F4CA 1FFHA 1LLUA 2C31A 5J4VA 1QRTA 4HQKA 1XA3A 3B60A 5JIBA 1UJ2A 1JF8A 4L8LA 5AO9A 4C0BA 3H2SA 1BVYF 1G7SA 4XQCA 4JYZA 3Q9LA 1AKRA 5KTSA 3F71A 3L41A 3H4IA 1KDYA 1APBA 1I1HA 2RCYA 4LYDA 2VAMA 4BAUA 1EFPA 1XB2A 3CX6A 4K40A 4LRTB 1K1EA 4UHDA 5KS2A 1G7TA 4HUTA 1RP7A 2HDWA 4RA6B 2FPGA 2HO4A 2XTMA 3JZFA 2H85A 3MC1A 4L02A 4MUMA 4PSUA 3MQ2A 3SOZA 1Q16A 4EX7A 2B1JA 3BXEA 4DDUA 5TSDA 4DSOA 4OGKA 3X2EA 3STVA 4I4LA 1ZM4A 1N3BA 3VR6H 4CDMA 1JSXA 4OXQA 4TTSA 4HDSA 4H3HB 5LQKA 5CCDA 3N86A 5AKHA 5AKLA 2OFOA 3W06A 4LHEA 2CHGA 2JGRA 3EZYA 1L4MA 3E48A 3EAFA 2B8EA 3LX5A 5HZMA 5E9JA 2F8LA 3QBDA 5IT9A 1ND5A 1SEVA 3OF2A 1DAGA 1NVAA 3JAMA 2XRYA 4RSHA 5GTDA 3LKVA 4TZ0A 2XD9A 4G1UC 4Y6GB 4YR7A 2VDJA 2CV1A 2F67A 4M36A 5LLSA 1O96A 5LM3A 4M9CA 4R9VA 1YR8A 5L3SA 2BGWA 1C1XA 1TAGA 2FN9A 3AJAA 3CN9A 4PLWA 3G6WA 4QEKA 1PJRA 1R88A 1XDWA 3AIMA 4OXKA 4Y2GA 1YFZA 2IVZA 3HBLA 3KIPA 4JQCA 5JC1A 4G41A 2PKEA 3L7NA 4IP0A 3DD1A 1IQRA 1DCMA 1W85B 5ALFA 2XEXA 1PZXA 4CM6A 4MIOA 2VXBA 3FHTA 4YRSA 4YIHA 4PZCA 1HSOA 1HDEA 1E2IA 2GD1O 3I92A 5EP3A 2Q0XA 3ZC3A 3ZX4A 4RK0A 3ETGA 1T8PA 2WDPA 3I0MA 2RGXA 2H4FA 2EW1A 3T9BA 1FP4B 3OCJA 2GEKA 3H0KA 2C20A 2ZAGA 3Q6MA 1RYZA 1DJOA 3C7KA 1I51A 5D51S 1DC5A 3GRAA 3TOSA 3WADA 3BSFA 3K70C 3K9HA 4XDGA 3UPTA 3E4CA 1SVUA 3O9VA 4JJKA 4AN4A 4MS4B 1ICIA 1MOZA 1XZIA 4Y30A 5ANRB 3COWA 3TFOA 3F1LA 1KP2A 2JKYA 2Q4OA 3PUYA 5ER9A 1L5QA 4NJMB 4U9IS 1U04A 1KNXA 3ICQB 2GB4A 1RMYA 4UHFA 1K6JA 4RIGA 3O6VA 4RZIA 1UZNA 2V7QA 4URUR 5TF0A 1GFWA 3LPCA 1W8DA 4DA9A 3OLXA 5EA2A 5GJBA 3DPIA 1PL7A 3WKDA 1T6NA 4HOYA 2BKAA 2B5VA 2B3TA 3OLCX 2QU7A 1YZVA 2CNNA 2O6HA 3PI6A 4YBRA 1Z18A 1M8FA 4Q18A 3V6MA 3IBYA 2RGUA 3G1UA 1SOAA 4Z86A 1W4RA 1G8MA 1WMDA 2OK8A 2VJMB 3GLUA 4DV0B 4MLDA 3ND7A 5B36A 1IM2A 3QUSA 1E0KA 4LISA 3NNSA 4LRQA 3SIWA 1CY2A 1V3QE 3ZNPA 4P0PB 4W7SA 3KB6A 4MROA 2PRZA 2NTVA 3DONA 3N3AC 1B41A 2Q6LA 1R74A 5IDQA 2IVFA 4HP8A 3EXEA 1BXKA 1U0FA 5EOVA 2FUEA 4L8FA 3RJMA 5KJ6A 5JUWA 2IXAA 1RJDA 3I30X 1OWPA 4KXFB 3Q9SA 1SVOA 5AKYA 5LB4A 2JIPA 2MYNA 3IJRA 3RC7A 4UNRA 3WNQA 4D6PA 4Q1CA 3ROGA 3AI7A 2NIPA 3MB8A 3ZTYA 1N2ZA 1X1AA 3LHIA 3O3OB 4Z7JA 5TMEA 4JYMA 4MUKA 2GJ9A 2Q1WA 1T0PA 2Y1OA 4FGZA 4R2HA 3DMHA 5CEEA 2VUUA 1TTPB 3EXAA 1NQTA 3VVCA 1ZGHA 2Y0PA 4MGIR 2V3WA 1Z45A 1L3CA 1TMOA 3NTOA 2XQJA 4RETA 1SHUX 2NX2A 4G37A 2DBVO 5JLJA 1A27A 1RXIA 2FUG1 3L92A 2QPAA 4K26A 3EZ7A 3JQAB 4LZWA 1QS0B 1J1ZA 1ZD4A 2V6IA 3DHNA 4PNPA 4L7VA 3WRWA 2D4AA 3KPUA 2QT9A 3KPJA 1FDVA 4RD2A 3A3YA 2Y3IA 2NPIA 5H3HA 1VE6A 2J08A 3A1TA 2QA5A 3AOEC 4LNUB 1VLQA 1SVKA 4RF3A 5ALSA 1AKYA 4YUWA 2J30A 2AT1A 1PL8A 1R0CA 1X0VA 2Z4TA 3FTCA 4LVNA 4ZEXA 2QW0X 1NVVR 4EFLA 4CFYA 4DA0A 4ZQHA 2ZQ5A 4IQ8A 2X1LA 2YRFA 3R6DA 2AV6A 2FWAA 1OLUA 4WA7A 4DIOA 4TL6A 4EKGA 1J23A 2X0NA 3T54A 2PUBA 4EAQA 3GMIA 3FPBA 1CIJA 4KDFA 4NBUA 4QGGA 3VZSA 4DGQA 3Q2OA 5JLAA 5TQJA 4Y67A 3UJAA 1M2OB 2RD2A 3GU3A 4ENQA 5CFOA 4QO7A 1NX9A 2J3IA 4OB6A 4FPXA 1PG5A 5JAPA 5JSFA 4RTRA 1IBLB 1J0DA 1UZMA 1OFUX 1WP4A 2Q3BA 5LL6P 1DQYA 1M1YA 4IILA 2J9GA 1JXAA 4L0DA 1XVTA 3TLBA 2IITA 3GUVA 3AIOA 3QVKA 5ILGA 4D7AA 2QQ5A 3TJRA 2C2HA 1G0NA 5F64A 2JLYA 3LUHA 3IP3A 2J33A 4EPRA 5C1DA 2XVMA 3GEHA 2W6MA 2CXSA 3A6KA 2VL7A 4FP9A 2DWOA 2PT6A 3TO5A 1ZUNA 2XB6A 3SVLA 2H11A 3JX9A 4IIFA 1A7AA 4NU8X 3DUFA 1XHFA 3DZHA 4GI7A 4N5HX 5EIFA 5ENDA 4ZANA 5FNVB 2AUMA 5F23A 5HVNA 1L4UA 4WY2A 1EJBA 1ZI9A 1Q0LA 3EAGA 1DJMA 3L0IB 4O4LA 3NAGA 3LOQA 5EXSA 5KAMA 3HXPA 2H9IA 3AJDA 1OWNA 4H4EA 1ZMTA 3B1JA 3I1IA 3NOQA 5GMOA 4TTRA 3EDOA 1RABA 5EPUA 3CNLA 2GBIA 3EDYA 4XGKA 4FCVA 5BWMA 3PUZA 5KYKA 4R1UA 1CWUA 1AKNA 3U1TA 4I2VA 4L08A 4MVJI 1XD8A 1Z35A 1Y3DE 4R40A 1U1CA 2TMGA 5AVJA 4YRNA 3AVTA 1CVLA 2VUSA 2GRUA 3LWBA 2AJ8A 3BMCB 2R6DA 2UXDB 4WOCA 1SA0A 2QM7A 1JSZA 4UAJA 4NNOA 4CMHA 2XJ9A 3HVJA 4IJMA 3U5TA 3B2EA 1HT3A 1UKCA 2CLFB 3C3WA 5LQJA 3QXXA 2W48A 5BWBA 3QVMA 1WWKA 4QHTA 5J5CA 3UFBA 1CRLA 1CRWG 1EP9A 1NL3A 2P3OA 2VKQA 1AQUA 5TGZA 4ENRA 2KS6A 3DAHA 3U39A 1URPA 3EMVA 4IGKA 4I50B 2MU1A 3GUZA 3D7RA 4LS3A 1DJNA 3OOHA 4ZCSA 2FSVA 2MWMA 4IWNA 3ETJA 2IUTA 3FF4A 1J21A 3SFVA 1NLMA 3OF5A 3EXIB 1W6RA 1I30A 2OV8A 5HK9A 1V5IA 5SZKB 4LCJA 3ADDA 1GNRA 3GC6A 5TVGA 4J0CA 2B69A 1CUDA 1C1DB 3FHCB 3AL2A 1QB8A 4M88A 4XVRA 3SSMA 1YMQA 2DWQA 5KWSA 5KHAA 3AUXA 1WL8A 4DBLC 2GHIA 4Y98A 1ZSYA 5LWHA 1S2LA 4EEZA 5ICCA 4FFSA 2HN9A 5ALZA 1RXYA 2AS0A 2P91A 4WW0A 2HFJA 4KWHA 2RAPA 3UF0A 5JXJA 2QWXA 1FNSA 2QSUA 1GGMA 4X6LA 5I7AA 2XNJA 4COKA 2ILTA 3GEBA 4MA4A 4XD7D 3MWEB 3LCVB 2P9GA 3P27A 4W5HA 1V6SA 2OCYC 4KVZA 5G0WA 1OBFO 3MVEA 1OB2A 3B7PA 3GJQA 3WLRA 3U4QA 4BNXA 3I04M 2PR7A 4EDFA 5H02A 5DM70 2X19A 2GJAA 1YRBA 1MD9A 1EBUA 1FYWA 2JDIA 3PFHA 5F1KA 3I05A 3RT9A 1PT8A 4AKIA 1POWA 2A9PA 2B82A 2PJRA 3L1VA 4ZO4A 4C43A 2FJPA 2XWQA 4IRUB 1E9AA 2JW5A 4UTRA 2XBUA 5DBOA 5FPTA 1HDXA 1L7RA 3CSDA 4U6SA 2W6PA 5C34B 1ZN9A 5FUMA 1C8VB 4AROA 1O4VA 3I9LA 4Q9AA 4WFKA 3V8QA 4A82A 1RLTA 2OM6A 1PJ8A 9GPBA 3UB4A 2BMFA 3W9YA 1DBPA 4BYMA 3O0DA 1HF3A 4WLNA 1Y6FA 1T36A 3OHPA 3NHBA 1MB4A 2QZ9A 2O0MA 3EDQA 4D80A 2YHIA 4NZOA 3UANA 4QFDA 1T5OA 2NO0A 1BVRA 2QYHA 2CZQA 2H4XA 2ZBQA 4RD6A 5KSOA 1EDOA 1JLLA 4KXVA 4RZUA 3ETLA 5HE9A 5K8TA 4JBWA 1K7EB 3EQ8A 5CA1F 4K3UA 1SCKA 4R9SA 1TW2A 1OH8A 2BMVA 1PV2A 2HI0A 3ZWCA 3THXA 3LRXA 4B4DA 1R4ZA 4N54A 5B2EA 6CHYA 3N70A 2Z2JA 4GYWA 1W4AA 2CN1A 1AO0A 3KC2A 1U9IA 2R85A 2ZPUA 2Z6UA 4U2GA 3WYAA 3DE5X 3PHLA 1R6XA 2B36A 2Q9UA 4H7FA 3W7BA 5JJIA 2IXEA 1PL0A 5IK2A 4UXHA 3ZI7A 3G89A 2WWGA 2VF8A 1KI3A 4X93A 3LIIA 3N0XA 1Q84A 4OQZA 4C06A 1KYQA 5FA5A 1EA5A 4S1TA 4WNCA 3M6LA 1T0HB 3OZSA 1E3MA 4RA9B 1AXGA 1VPTA 2XJ4A 1G5QA 2EWVA 3FROA 3PUWA 3GVXA 1UIRA 1ZJZA 4LW8A 1EX7A 2HPVA 2XYRA 5KYXB 3HDYA 1TC1A 1Q6ZA 3GLVA 4YWJA 3SD7A 5BQOA 1IJEA 5CBKA 4L4XA 3TZLA 1Z4JA 3S1LA 1XMJA 2H1FA 4JKIA 1EHYA 4K9SA 1KDOA 2YWJA 3H1GA 4I81A 4Q3LA 1SVIA 3C39A 1P4RA 2FW8A 3KZMA 4ZA2A 3I8XA 3T8YA 5HUHA 4FD2A 1JPNA 2WSIA 4HEJA 1R8QA 3IUBA 1RR6A 5EQTA 2NUAB 3UUGA 4DQXA 3LRTA 4A16A 3QFFA 4A2QA 3UJ7A 1XA0A 3P96A 4IDAA 3PSAA 3NPAA 4WQMA 4D97A 5AW8A 2MSKA 3K2BA 4CDRA 4YH1A 1UBJS 1EG2A 1KK3A 1QCYA 8MHTA 3OAAD 5DM1A 4QTYA 3MOIA 2XGJA 2GK6A 4DV6B 1NMSA 2ZG6A 2CLSA 1TF2A 3ESBA 3IP8A 3C16C 4P58A 2X2PA 3D6MA 4JSYA 4XFJA 5FV7A 1P9NA 4HWSA 5I48A 4UM9B 5CEFA 3BE8A 4AY3A 4QRDA 3QKRA 3KL2A 3MTBA 4PZPA 4QYIB 3HC7A 4TL7A 3EXHB 4MWEA 5HTKA 4Q5IA 1G8KA 1RNLA 4B6RA 1YH3A 1T1EA 2C0QA 2EJCA 2ZYVX 1M2HA 2W0SA 4Y0VA 2BZSA 5IAAA 4F2WA 4CIAA 3OHSX 2HNKA 4GX2A 3WK6A 4ZZ1A 4B4UA 5JO0A 4N6GA 1E2BA 2WFLA 1UPTA 1WIWA 4NHEA 4ZHQA 4YONB 3ASVA 5AXBA 2A0KA 3C4QA 2CYCA 1IAVA 3G2JA 4K6KA 1V39A 2ZS9A 3LZ6A 4TM7A 4F2GA 4HY3A 4PQRA 3JXEA 1I7NA 3HH8A 3I76A 1R0WA 4ABYA 1Z36A 1SUWA 3DDWA 3EIHA 5HQTA 1FFGA 5J4LA 1ISFA 5ALDA 1E1RD 3RANA 4PZ0A 4DARA 2IEZA 2R4QA 4NU6A 1EI9A 3BXPA 5DK4A 2OQVA 4NDZA 2JD2A 4MQ6A 4I8DA 4UNPA 4MUAA 1G16A 1USIA 2IOYA 3NM6B 5IBPA 2AOUB 1JQKA 1B0ZA 1UFRA 1V16B 1RDFA 3ICEA 2H7XA 1G3IA 4OU4A 3AVXA 2IHBA 4EZEA 4Q4AB 4XX1A 2WQ7A 4KUHA 3DZJA 3JZIA 2FF7A 2DUJA 3P9IA 1ULTA 1SVWA 2AG5A 2EJWA 1GZVA 1ZM2A 4HGNA 5FYDA 2ADMA 2XPCA 4D8VA 3F97A 4A8JC 4QT4A 1PSWA 4D3DA 2O5RA 3MTDA 2P0YA 1FDRA 1I0LA 3LOUA 1EBFA 3GRZA 4XOIA 4W9NC 1PVOA 1PGQA 4MTCA 4OX9Y 4QE3A 4KXYA 3OZUA 4G0ZA 3RS2A 1WY7A 1P0IA 2LIPA 5AKXA 2CD9A 1O5TA 5KMGA 1FFDA 1EU1A 3K72B 4JI0B 3Q8XB 1JR6A 3NIWA 4BC1A 4PYQA 4YRKA 3DVAA 3MRVA 3NKVA 5DISB 1TVEA 1ZOOA 2BGNA 1TYBE 4P5PA 3BOSA 2PZBA 4LI0A 1B14A 4QU9A 4DT1A 3OIYA 1PG2A 1QU3A 5CLGA 3T7DA 5BW6B 4F7WA 2J1LA 4RD3A 1E20A 3NDRA 1NVTA 1C3LA 5EJEA 2IHNA 3JRXA 2HJ9A 2EFGA 2ACWA 3FOCA 2I8CA 2WFZA 4MJLA 1G291 4P4GA 1XYGA 3QKSB 1YR6A 5B53A 1MF7A 1YL6A 2L42A 4DA6A 2WWTA 1VSUA 3DSRA 4OHYA 2BVNA 1GPNA 2V6BA 4P92A 5BQ5A 3D7MA 1QCCA 2Z2YA 4MW6A 2OMKA 3MT8A 4Q01A 3GLFA 2GK3A 2Q6TA 3CF6R 3BJMA 3EVCA 4N01A 4Q6WA 5F5XA 4Z4QA 3HA5A 3KJEA 1BWRA 2PV7A 3HRKA 4G67A 3W1VA 1N2HA 3FVRA 4AMZA 3G5UA 2FFJA 4EATA 3OQOA 4GU5A 4E5UA 4DIEA 2BMEA 3C70A 4GOJA 1DUVG 4LK3A 2WZCA 5K01A 1I4DD 4EVSA 2F1KA 3KHUA 5L40A 4N6OA 1E9EA 1G3QA 3EPRA 3H17A 1TKRA 3ODPA 2Z08A 2NSDA 3NEYA 3UK0A 1JA0A 3UXYA 4LN1A 5J5AA 1Z5UA 1OXXK 1XT6A 1A9PA 1YUBA 1E2GA 1X13A 4L95C 1XTIA 4WECA 3GJ8A 3I9JA 2QDXA 4FYVA 2ZB3A 1ZIYA 2GYYA 3EGDB 4AC9A 1OGIA 5EP1A 5KNBH 4OQQA 1NN1A 2JVJA 2N0SA 3GCXA 2HT1A 1QANA 1RP1A 4LWZA 3SX2A 2RFLA 1DWQA 1GG2A 2VLIA 4AF6A 5AVSA 2R44A 4BBAA 1ZRSA 1C4KA 4C03A 4FC6A 4D02A 1SU6A 4UBMA 1SC1A 3QJYA 1VGQA 4YMGA 5ITSA 3M34A 1U8FO 3L4SO 1SNYA 4CQMD 5A9RA 3LFUA 1NP3A 3DL7A 2H00A 2JGAA 1NPDA 2IZZA 1CUUA 3AEZA 3PX7A 4D4LA 3GZJA 4JJ7A 4M1QA 4G0OA 1JZQA 5IAJA 1FLNA 1XNQB 1CXZA 1XUOA 2VRBA 3AM3A 4WAUA 4CI0B 3FWHA 1UCFA 3MNFA 1V5EA 4TROA 4MKFA 1CZLA 4XKJA 5DIZA 4RX1A 3SICE 1JECA 1W96A 3CUWA 4NU0A 5KTOA 2H0QA 5AFSA 4CIDA 4QOIA 1MB0A 1EB8A 1NMXA 1TM3E 1U1IA 1V7PC 3K5WA 4TRJA 4CUJA 1SXQA 3GPLA 4I4CA 1QV9A 3ISJA 3AUFA 1YZLA 4LOJA 4Y2PA 5JCOC 3O3NB 3NALA 4S3MA 3UUWA 5E38A 5IZCA 4IV0A 3LC0A 5IJXA 2AFHB 2V9PA 1JJFA 5CNIA 1U7OA 1Z4IA 2GARA 2EIHA 2BFDB 3IIMA 4LVCA 1US8B 2BTOA 1YE8A 3KYCB 1W1IA 4R1PA 2D7JA 5EIWA 2AG6A 5FTMA 3RPEA 4ARSA 4EEXA 1Q21A 1VI5A 1CUAA 3KJHA 4TWZA 4YAKA 3J80A 1BO6A 4UVIA 4CF4A 1YI8A 4XYBA 2G83A 3CG0A 5GGYA 2YV2A 3FTEA 3K0HA 5DFAA 1IN7A 1U99A 1ZESA 1CP2A 2Z57A 5MF6A 1VCNA 2Z30A 4CDGA 2I4MA 1VI2A 3C1UA 4GPBA 1XMVA 3TWOA 1TVMA 4RXMA 4B82A 2R00A 3OEHD 4KLNA 5IYZB 1CPYA 3VOBA 4N48A 1TT7A 4ZQBA 3V34A 1NVXQ 4BEVA 4FGUA 4OL0A 1JDSA 4X6XA 3OFNA 1D2HA 4XGQA 4YXWA 3ZTWA 3PYMA 1O89A 3H6KA 4KQKA 2JI8A 1YNOA 2OCAA 3CKKA 1LC3A 3KWMA 3P9QA 4N5LA 4XEUA 4ZI5A 3ZDAA 3AVPA 1DO0A 1NQ5A 2GCIA 2Z3VA 4L5YA 1JXOA 2OBBA 2X40A 4J07A 4UDXX 1ZGAA 3RTDA 1E0DA 2EGHA 3P9RA 4LMAA 2NO6A 4EJ0A 1JE0A 4LBZA 3AF4A 4NBLA 3RVSA 5MHTA 3EFOA 2JCYA 3HJHA 2P5TB 1ADYA 3NBAA 3LUBA 3U4QB 1C7IA 2CXNA 2BGKA 1HNXB 4LUCA 5EUBA 1LPNA 2V98A 2HW8A 5TMPA 3GRPA 2C54A 1N7IA 2P79A 3GQBB 1YKFA 3I2HA 2NQ8A 1MEJA 2BIFA 3FSRA 3OZXA 3I5AA 5M04A 1T9CA 3G2MA 4X44A 4J9UE 4DKXA 2RHDA 3KKKA 5HIIA 3RSLA 1OLXA 1U98A 5AW9A 1GFZA 3OZGA 1MNAA 2RC6A 1VZ3A 4XZ3A 2PZFA 2HRQA 3K94A 1C8BA 2WM3A 2IZ0A 3IAM6 2P2CA 3ABZA 2ZJ5A 5LBTA 4CM9A 2CUNA 4JOQA 4L2IB 4PIVA 1HMPA 1LA2A 3G2HA 2BEKA 4PC3A 2QD2A 5K3AA 3NIFB 3QVLA 4KR7A 4O5OA 5BVGA 4FLFA 2Z1NA 2IYRA 1G3MA 1FQWA 2QLBA 1ECGA 5KKAA 1YDGA 2VN8A 3TLEA 3UCXA 5D3ZA 3WI7A 3O21A 3CA8A 3D6AA 1F38A 4KPYA 2A88A 4RGVA 3OX4A 2GD0A 2RGGA 4JKYA 5HF6A 1P4JA 5F51A 2BHSA 1K8ZB 3LQFA 2KSQA 1FNMA 3FZGA 3T94A 2IU4A 1GTMA 3ZE0B 4D0SA 2WD8A 5T4FA 1SXGA 5REQA 3IP6A 1EUCA 3E61A 4KODA 1KTVA 4PYKA 2MOKA 2LD4A 3FI9A 3ISVA 5BSTA 4AY4A 2UZIR 1WO8A 1PAUA 2V8OA 3CGGA 4CKEB 1CHDA 1T9ZA 1VLLA 2C3UA 4ZAYA 5FI5A 3I72A 4LJYA 4PW0A 3NHYA 4QX6A 1ZR4A 1SOMA 3D4BA 2I3DA 1T9GR 2IC5A 2XOXA 3QLUC 5FYQA 1Z0JA 1UQUA 1N2GA 3OE4A 4HMQA 3UGQA 5IUNC 1PNTA 1T0IA 1X7HA 3ECAA 4WZBA 3UV3A 1E1KA 5EIXA 2VBCA 1V5WA 3W8NA 4QLOA 2KJQA 5B57C 5DRTA 4PLZA 1OAKA 5LR6A 3NWPA 1OLOA 3CLUC 3DZKA 4OI2A 4QOHA 5ALHA 1KORA 3DCJA 5HGXA 5JS1A 1CEXA 3QTLA 1XQ1A 3I6BA 3IVRA 4P5EA 4RVDA 4BUZA 1LF0A 3RIHA 4O4LB 2ATVA 3BGWA 4IKOA 3TUIC 3FMVA 1UDAA 1V9LA 3NM5A 2X8JB 3HKDB 3Q3HA 4TMKA 3C5HA 521PA 5TT0A 3OD5A 5IBRA 3UGTA 3QEMA 4Y6PA 3A1EA 3A31A 3NNDA 1PFVA 4UNSA 2KI5A 1UUFA 4WNYA 1G9TA 5J5VA 1EDBA 1MQ9A 3IPCA 3UMSA 5A5DA 2X22A 3CH7A 1TLTA 1U1DA 1Q92A 1EWVA 1XCOA 4K0RA 1AX9A 3BBPA 3OTHA 2W7TA 2DLCX 3BN3A 4G86A 1GY8A 3I2KA 1M34A 1KU0A 1GYRA 1M0SA 1MXHA 1X9HA 2C9BA 3EULA 3VR4A 5EJ9A 1I80A 4RDXA 4C7OA 4EUNA 4WFJA 5GOZA 2WZDA 1DKRA 3DDZX 1P5ZB 3QU7A 3NHSA 2B20A 5FTKA 4OHOA 1B8PA 3GZTB 5TPZD 5KNBD 5E6UA 4DLKA 3GEGA 1G18A 4E3WA 1TRKA 3KXKA 3L2OB 1C0PA 3COZA 3KVVA 1IPHA 3F6PA 2IUSA 2BSQA 1F12A 1T1GA 4MB2A 3S4YA 4R9NA 1JQLB 2QRUA 4W7IA 2MINA 5TE9A 2FZWA 4CZ2A 5JCZA 1L3BA 4K0KB 1B73A 1NOJA 2GN8A 2WYUA 4ZTBA 4BO4A 1CDEA 1KMQA 2PD3A 1T8SA 4AUKA 1G8GA 3R9KA 3AHEA 4LF7B 5T4EA 4M1ZA 5KI6A 1R0YA 2IPOA 2YC2C 3OT5A 1DXHA 1NNI1 4F12A 4Q3OA 3KTDA 1VG8A 1ZKMA 1ODKA 3VYVA 4TV9B 3V1KA 1G38A 3RSGA 4UDNA 1GGKA 2H1RA 1EZ1A 3R5XA 2H2FA 4RY9A 4YUZA 2AYYA 3TMAA 5FPYA 1AKQA 2HRRA 2VEOA 3K9GA 1MQAA 4OU5A 5K4AA 2C58A 2VAPA 421PA 1MOPA 3HN2A 5C46F 4XPIA 4BB6A 1NJ6A 2XWPA 1R10A 2V45A 3DO5A 4B45A 2VA9A 2PZKA 2HA2A 5MGNA 2R8OA 2CY0A 2G6BA 2FSHA 1F7VA 1L5HA 4OVKA 2GS9A 5E7IA 2OA0A 2GEBA 3F49S 1W2HA 4QBTA 2FR0A 1EJ2A 2QTNA 2X7JA 2Z5FA 1P74A 3E81A 3MFYA 4GOMD 2BTEA 4ARBA 2H7VA 4HVTA 5F3WB 4P84A 4RJKA 3VKUA 3IVMA 5SZIA 5CDYA 1KMHB 2VQ3A 3K2IA 5A3QA 3R20A 2C4UA 5JYCA 3ZGZA 2W11A 1UAAA 3KLNA 2B4AA 4UVDA 3TLJA 3W5VA 2ZBRA 2WMNB 6LDHA 3ME5A 2ON6A 5IULC 4UM9D 2RHCA 4XW2A 3AF5A 3O1JC 1DPFA 5A03A 3I5YA 4YCAA 2FZEA 3QEKA 5HF8A 3VR6A 1GAQA 4DIFA 2GKOA 4DEXA 2WKQA 4R4JA 5JSHA 1L7PA 2FWRA 1JLKA 4LSWA 1LUAA 2HC9A 4FW8A 4GBED 1SQ0A 1Y4DE 4MVJE 4NI5A 4TTJA 3FCUB 2BTQA 4GDMA 3PEFA 2FKAA 4JYBA 1XMQB 4COOA 3BQMB 3E7XA 4N3AA 1MHTA 2B8JA 3AJRA 3TR6A 1Z8DA 3FIJA 1I4OA 1IEXA 4EB6A 2GVDC 1ESCA 2YV3A 3JQ8B 2RH5A 5CFRA 1MQ8B 4A15A 2V55B 3MTQA 3QYPA 1X1RA 3JQAD 4Y2SA 4Z99A 4C21A 2FVXA 1P62B 4GRIA 3AP3A 1IZ0A 2F9FA 4FI3F 4R7ZA 4TUYA 3LUKA 5AM5A 4EG6A 1H0HA 1R50A 1NBAA 5BWLA 1LPBB 1T24A 5E8JA 5K8UA 3V33A 2EP5A 4JP3A 1Y34E 2ZR0A 1Z37A 2O7NA 3SF8A 2QR2A 2ZJZA 4D43A 4JLOA 4E4TA 1TTTA 3AV0B 1Q1BA 4RMIA 4JITA 2XT9A 4P4UA 3VNQA 1SQSA 1PKXA 2NN3C 2R1TB 5EKUA 1CD5A 1JIUA 2FSVC 3BULA 1RWBA 3A4TA 1H3NA 3HY4A 4MRRA 2X9QA 2NXEA 4M6WB 3WGUA 1OHHD 5JTUA 1RZRD 3ZHZA 1S1CA 4KQWA 3GPCA 2NPFA 4BCDA 3R7LA 3ZBUA 1Y9DA 4E7PA 2I76A 2BTQB 1V1MA 1KEPA 4J2TA 2RE8A 1JEJA 1UT5A 5AW7A 1TKCA 5FOTA 3DOHA 2QVCA 1C1XB 4ZYLA 2JLBA 2JRLA 1BH6A 4MUHA 4RF2A 1G3UA 2A4KA 4XOUA 5AH0A 2C2GA 2DSNA 3A14A 2FK8A 1J9EA 2NO1A 1UBTS 3ETCA 3OQIA 2Q3DA 4FYYA 4I14A 1G21E 1TFUA 2HH9A 4F3NA 2JFFA 5EC8A 5A6SA 5EXPA 3R7NA 4BU1A 1I32A 1YF3A 3GAZA 3NIGB 3IH5A 3WQSB 2UYGA 1Y98A 1KMHA 4RKEA 4ZHQF 3DTVA 3LC2O 3HJAA 2PD4A 4CVNA 2O59A 3AU8A 2F2TA 1UDRA 1A97A 3RWMB 4HDSB 3NYQA 1JR3A 1Z8NA 4BVBA 3C7CB 4AO6A 3HB5X 1YI0A 3Q40A 5LYJB 5F52A 3MERA 5K1ZA 2QXTA 1AKVA 2F1OA 3ANNA 3KNZA 3WK8A 1ZJWA 4PRLA 2GYVA 3CW9A 2BLNA 2GN2A 2VHYA 1C3EA 2CJPA 3LQ4A 3LLSA 3QEJA 3C3MA 1X87A 1T9DA 3C5CA 4IDBA 3R4VA 4TT3D 2HWUA 4LQLA 3MWKA 3LKBA 5LQUA 1A4RA 4KPUA 1EFPB 3PSHA 3TSWA 3VPGA 4X54A 3TCKA 2C7RA 2ERYA 3GLTA 3LQKA 4QUAA 2XMRA 3ILSA 4V3BA 3P1JA 2ALJA 3VR3A 2ECOA 4FGJA 4YAGA 4UUMA 4MRMB 3BORA 5ARBA 1QQ5A 1CTQA 3B12A 4KYVA 4HXEB 4DLRA 5LKRA 1IZ9A 1ZSNA 3GAAA 3NU1A 3PC4A 4R5MA 3BJEA 4FW9A 1DO2A 2XUPA 4NXNB 5KUTA 2VSNA 3Q9UA 4L07A 4O1MA 3IOBA 5DHPA 3HDHA 2BF4A 5ALRA 2A8YA 2MINB 2XCQA 3GBVA 2KQUA 1UF9A 1JIIA 3DBOB 1TZMA 3CRW1 5JAIA 3MBOA 3WDKA 1JQAA 1TK9A 1EWKA 4QOEA 1GT6A 5J2TB 5A4JA 2W6OA 4AU1A 1HY3A 5IWCA 5KVAA 4IG4A 721PA 4CV2A 5K6RA 1XP8A 3EYWA 1TVKA 5GJVC 2PSSA 5A9TA 3BIJA 3JYHA 4HMOA 5HBRA 1U2RA 2AD5A 1UXGA 3SZ3A 3WHIA 3DCNA 3M2PA 1TMGE 2PX5A 1WMAA 8LDHA 1YA6A 3KPVA 1A69A 2C2OA 2V1UA 3PD0A 2MYPA 4MV5A 3D8NA 3IFSA 1GCAA 4EUHA 4OQXA 2BGLA 3BGOS 3U16A 1Y8ZA 1XQYA 3S2YA 1T3LA 3IALA 3EA0A 3KPWA 3AC0A 3MLAA 2AFVA 1NUUA 3O8DA 1N1GA 4N12A 4CTNA 4CLRA 2RGBA 1QVWA 2REOA 5D1NA 3RODA 2CLEB 2JVIA 4HDAA 3AB8A 2NU7B 4KVAA 4LF5B 3PFWO 4NMWA 5KKNB 5AI0A 5B3AA 1VIYA 1WV1A 2YWRA 4ZOBA 4G25A 4TZ6A 1B93A 1JAZA 1AQJA 4MVCA 3X44A 2VDWA 3UMBA 3QGMA 3F5DA 1UT6A 1GGVA 4IO1A 1KY4A 2D06A 3H8SA 4IV8A 4TVKA 1TYEB 2RHLA 4G8JA 4QLBA 1Z7EA 2X0JA 1YAHA 2EZ9A 2GGSA 3O9ZA 1SU8A 4JV5B 1NDQA 3K1ZA 3LP6A 1ABBA 3INNA 3N6XA 2PVPA 2HIAA 3L43A 4QDUA 1KL7A 3LT4A 5DLPA 3DS8A 3E5NA 3PCXA 4D57A 4D9NA 5BR7A 3PQFA 2X2EA 4BN4A 5K09A 2HPZA 2DQSA 1GGHA 3URKA 4TKUA 1UK9A 3MJHA 2OHJA 3EC1A 3JYLA 1DQNA 3ZLVA 4HWTA 1P72A 1HDRA 3P5BA 3BMOA 1LFDB 1OI2A