4HNSA

Crystal structure of activated chey3 of vibrio cholerae
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
124
structure length
124
Chain Sequence
b'ANKNMKILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGDFDFVVTDWNMPGMQGIDLLKNIRADEELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLKEKLDKIFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CheY
publication title Conformational Barrier of CheY3 and Inability of CheY4 to Bind FliM Control the Flagellar Motor Action in Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Signaling protein
total genus 39
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hnsA00
1TJYA 4OBBA 4LDZA 5FWXA 1JFTA 5JS2A 3O1HB 4Z4HA 5JNRA 3I42A 4JASB 3GYBA 3LKVA 3OLWA 1AB6A 1M2FA 4WXEA 2Q5CA 2FLWA 2FEPA 4RZSA 1SXIA 2JVKA 3TB6A 3A3KA 2MSKA 2QSJA 4LX8A 4LE2A 4MLCA 3RVQA 1YIOA 1P2FA 4EYQA 1QO0D 3O2JA 2PKXA 1YS6A 1PNTA 4Z0NA 3SQNA 2L18A 3RVRA 2HPHA 3SAJA 2IDMA 5E3JA 5JNUA 2QZJA 3B2NA 3DGEC 3H5TA 3JVIA 4QYWA 1FFGA 1M2EA 5HM6A 2MYUA 4XAQA 4G0MA 3OO0A 4RV5A 3KCNA 3R0JA 4MS3B 4YV7A 3LUCA 4RK5A 3N75A 3LUFA 1RZRA 1Z12A 3QELA 3QK7A 3H5VA 4MS1A 4RK4A 3UKJA 5D2CA 3FFXA 1W9HA 2VUHB 1JFSA 1UDRA 2R4QA 3GBVA 1GCAA 1YK1A 2GI4A 3S99A 3H75A 2YHBA 3EAFA 3QX9A 3FFTA 5ED4A 1FSPA 4QICA 1Z13A 3F73A 3KS9A 4KNYA 1NATA 3C3WA 2HQOA 1AB5A 1JYEA 4KREA 3LOPA 4D6XA 3RVLA 1U2PA 4MS4A 3CHYA 3CKMA 3OQMA 1ZH4A 4PEVA 1EAYA 1JDPA 1U8TA 1LK0A 3D02A 3E61A 4LE1A 3W9SA 1NXTA 4NCBA 4S04A 2FQYA 4KZKA 2E4XA 3H6HA 8ABPA 4PZ0A 4YR7A 3KSMA 2E4YA 1IIBA 1LBIA 3T95A 3RVMA 1VPWA 1E6LA 1YS7A 4HYEA 4MGEA 2B1JA 3K9CA 4W5NA 3M9WA 1FFWA 5KQLA 2E4WA 3D8UA 3EQ2A 3I5AA 1QP4A 2IPAB 4NICA 4HNSA 3RVJA 4RDCA 1L5ZA 3KLOA 5TQ0B 1ISRA 3KG2A 5T3YA 3HO1A 4RKQA 3CZCA 3O1JC 2FW0A 3BREA 5IEBA 5KWSA 4G86A 2ZWMA 2BGGA 4OLAA 3CZ5A 2MYTA 3HVRA 1Z15A 1E6MA 3MQ4A 3H5IA 4YP9A 1YMVA 2R25B 1USIA 4Z9BA 1RXEA 4ZMRA 5C5CA 1B00A 2P4UA 4MS3A 3TMYA 3UUGA 5IULC 4RK6A 1Z18A 1ZAYA 2VK2A 4H3HB 5PNTA 5CNMA 4Q6BA 1QKKA 3K4HA 3O21A 1TM2A 2NUBA 1ZHHA 4GNRA 3C3MA 2CWDA 1PUXA 1CHNA 1YTUA 4NQRA 1NXSA 1A04A 3NNNA 4CBVA 1LJLA 1EWVA 3EULA 4Z9AA 2VUIB 1KGSA 2HJ9A 1DCKA 3CRNA 3IPCA 3MYYA 1Z2EA 1DRKA 5CNIA 4N76A 3JVDA 3N0WA 4P98A 3HDVA 5GQSA 2ZAYA 5CNKA 3KHTA 3KJXA 1Z16A 3HM9A 4RSMA 4YO7A 4RWEA 2L19A 2LBPA 2QVGA 2R47A 5B3JA 4PICA 5TPWB 5JS1A 3H5WA 3FDFA 2XDYA 5IC5A 4EYGA 2E4ZA 3OM1A 4F12A 3TD9A 2PUBA 1H9CA 4KFCA 4Z4IA 3QLUC 4N0QA 1ZGZA 3FGZA 4ETIA 3BRQA 1XHFA 4Q7EA 1W25A 2V0NA 1RNLA 3MF4A 2FLKA 1EFAA 4M88A 4F3TA 4ETNA 3T38A 4B09A 4RK0A 3SY8A 3LKBA 3DZDA 3SG0A 2QV0A 3LTEA 4Z99A 3LUJA 4RS3A 1A0OA 5TQ0A 4RXUA 3GWGA 5EWLB 4YLEA 4G0PA 4OATA 3H5OA 2PUFA 4WXMA 2F8TA 1KRXA 4MQFB 5KC8A 4RK7A 3QLVC 1DJMA 3DGFC 1DBPA 1GUDA 2L17A 4G97A 1NXVA 4Y9TA 2AYXA 4YS6A 1RXIA 4KPYA 2GBPA 1QP0A 4JOQA 1BDHA 3RQIA 2OQRA 2JBAB 3IP6A 4YCSA 4Z4EA 2I6FA 2GKGA 2WJAA 4RXMA 4EYOA 1R8JA 1BAPA 4EVRA 3IP5A 4IILA 1L5YA 5B3JC 1Z2DA 2IPNA 2PE5A 4W5QA 5DGCA 1JX6A 3HZHA 3HEBA 1CEYA 4OG2A 1DC8A 2WB4A 3HV2A 4DN6A 4F06A 3OM0A 1JDNA 4IMJB 3H1GA 4RKRA 4RY8A 2NZUG 4ZPJA 1WETA 1D5WA 1LJUA 1MB0A 2N9UA 3OLVA 4ML3A 3HXMA 4MLDA 3EQZA 3TO5A 2LIVA 3FFWA 3MMNA 3O1IC 2WRZA 3L49A 4IF4A 2PUCA 1E2BA 3QEKA 4MQEB 5JNVA 1ZESA 4KK3A 2X7XA 1ZGGA 5TPWA 3MA0A 1TVMA 3NNSA 3CTPA 4RY0A 1PNRA 1BDJA 1J56A 1Z26A 2JVJA 5GOTA 5JNSA 1EWTA 4LZLA 3H5LA 2RJNA 3O75A 3E3MA 1F4VA 2J48A 2GWRA 3IP9A 5CNJA 9ABPA 3NNDA 1VRVA 3HCWA 4NCAA 2IOYA 3CU5A 3JPWA 5BRJA 4JA2A 1MIHA 5T7BA 1GUBA 5IEJA 3MIZA 5FWYB 4IRXA 4IGAA 4N0PA 4XARA 1DCFA 5TQJA 3DLHA 1DCMA 1P6UA 2JB9A 3EJWA 4GPAA 3H6GA 5EWLA 3HK2A 3ILHA 2A9PA 1ZY2A 3HUTA 5KI6A 2HSGA 4G0ZA 2KYRA 2FMKA 3OLYA 3QLUA 4L4UA 4MQFA 4OLBA 1CYEA 2FMIA 5BQ3A 2IKSA 1ZN2A 1PEYA 5FBKA 5JNWA 5KQGA 4RY9A 3G85A 4L85A 1URPA 4ZJPA 2PMCA 2FXIA 5DLEA 3LUAA 4TLLB 2FSPA 4OTZA 3M9XA 3VNAA 1U2QA 2JBAA 2A9OA 3GRCA 5DCLA 2W42A 3NHZA 3IPAA 5CHYA 4N03A 2B4AA 4UHJA 3RVNA 7ABPA 4O5AA 1TLFA 3TX6A 3QLVA 1BVHA 1DBQA 3RH0A 1VKRA 5BR1A 1FQWA 1NTRA 2PL1A 2CD7A 2O20A 4RXTA 4Q6WA 1MVOA 1YVUA 1OXKB 2FKAA 3L6UA 4IMIB 2H0AA 2VYCA 2WJWA 3GA5A 3OMXA 3URMA 2PUEA 5IUJC 5IX8A 3LUGA 1RZRD 3H1EA 4MR7B 1ZITA 4H3KB 5EWMB 3IDOA 1TMYA 2R48A 2YHAA 4MQEA 5TQ2B 4FE7A 3GL9A 3OMWA 1JLKA 1JYFA 2FVYA 3O2QB 5C5EA 1C0EA 2MSLA 4WWHA 2FMFA 4G0YA 1U0SY 2WWVD 3JS5A 5EWJB 1USKA 3QX8A 2ID7A 4FB4A 5HSGA 2MYPA 3Q15C 1U04A 3C3KA 2IPLA 4EY3A 4G0XA 3P9YA 2FEWB 4KMRA 2IPMA 5FWYA 2FTKE 1P8AA 3A0RB 1P6QA 4UHKA 3RVKA 1JH9A 2NZVG 2QU7A 2NT4A 4RK1A 1JHZA 3H1FA 1QPZA 4PE5B 1M5TA 2QVCA 1JL3A 1NXXA 4G0QA 3I45A 1KRWA 1DC7A 6CHYA 2DRIA 3JY6A 1D1PA 4KVFA 1D4ZA 1Z25A 1EWKA 3RVSA 3JPYA 4W5OA 4TN5A 4P1ZA 2GX6A 4LRQA 1DBWA 1NXWA 4MRMB 3KTOA 4D74A 3DBIA 3T6KA 1SD5A 1QP7A 4Z4FA 4KK4A 4TMYA 3CFYA 2FQXA 2HQBA 2FMHA 3QLTA 2CHFA 4EVSA 1XWWA 3OLXA 3ROFA 2LP4Y 1S8NA 6ABPA 2RGYA 1PHRA 2JK1A 1FFSA 1DRJA 1LBHA 5IBQA 1BDIA 1D1QA 1XHEA 3JTEA 3KLNA 2QW1A 1EHCA 3BBLA 4EYKA 3IP7A 1YMUA 3SM9A 3SNKA 1MB3A 5TPZA 4DADA 3C97A 4XASA 4EVQA 1DP4A 2JVIA 2TMYA 2QR3A 3KYJB 4MR7A 1GLGA 5EWMA 4WUTA 4ZMSA 3VNBA 1Y1LA 5TQ2A 1ZVVA 4MR8B 2F8SA 3CLKA 4JAVC 3QEMB 3OQNA 3F6PA 4O1HA 1JF8A 2FN9A 2NT3A 2RDMA 3UK0A 4F11A 5EWJA 3O2SB 2OENG 4W5RA 1SRRA 5IUKC 2E4UA 2A9QA 3HDGA 4HNQA 3O74A 5TE9A 2PUAA 1T34A 3G1WA 5HKOA 4O1IA 1USGA 5I4CA 1E6KA 1ABEA 2PLNA 3C6QA 4F8JA 1ZH2A 3N8IA 5FBHA 1F51E 3I09A 4E7PA 3RVPA 2AYZA 1DG9A 1QMPA 3GV0A 1MAVA 3HSYA 4JP1A 4MR9B 4JB0A 1D2AA 4JB2A 5IUNC 3T8YA 3ILYA 2WMYA 1RPJA 4DQDA 1QO0A 3LUDA 4MPTA 5HQJA 2PUDA 1SXGA 2PL9A 3A0UA 3HUUA 3FMVA 2FN8A 5JNTA 4N47A 4PYRA 1K66A 2A9RA 4G0OA 5BRAA 5FWXB 1I3CA 4MRMA 1M5UA 3Q7TA 4S05A 1ZDMA 3LUHA 3Q7SA 3NBMA 4D6YA 1KMIY 4EGSA 3N0RA 4MYRA 2RJOA 2ID9A 1NXOA 4XXHA 1JWLA 4Z4GA 1K68A 3MM4A 2WY2D 3KKEA 1Z17A 4WT7A 4KRFA 5ABPA 4KQ9A 1NY5A 4YRZA 3LMKA 5F64A 1DZ3A 2H3HA 4YWHA 3N0XA 1HEYA 3CG0A 4H60A 4EUKA 1A2OA 3N53A 3M6MD 4N41A 1YK0A 4QPJC 4E7OA 1BA2A 2L2QA 1JBEA 3EDCA 3BRSA 3NHMA 4WZZA 5KQMA 3RVOA 1VLZA 2PJUA 1PEAA 4MAAA 4HNRA 5KQPA 1QQAA 3HJFA 3F7NA 1OXBB 3A10A 4RU1A 3QELB 1APBA 4MR8A 2PUGA 4FE4A 2QXYA 3EGCA 4MS1B 2M1ZA 1NXPA 3QEMA 3N6VA 2LPMA 2MSWA 2P9HA 2FQWA 4W5TA 4XFKA 2JRLA 3OO1A 5TPZD 3KYIB 3EODA 4QYMA 4KV7A 2HQRA 4ETMA 2M98A 1SXHA 2PAFA 2LUOA 1C4WA 3OLZA 2E4VA 3DLBA 4KQCA 4LDAA 4XLTA 4TLMB 3LUKA 1QQBA 2CHEA 3LFTA 3GT7A 5DKFA 1ABFA 2MYNA 5KC9A 4NV3A 4MS4B 3F6CA 4MR9A 1ISSA 2JCGA 1JFVA 2IYNA 3BILA 3CNBA 4YGXB 1GCGA 4ZYLA 3HS3A 3Q7RA 4LE0A 2FEKA 5DTEA 3GBPA 3Q9SA 3CS3A 3OQOA 3ROTA 1QNLA 4Z4CA 3Q41A 3CG4A
chains in the Genus database with same CATH superfamily
1JXAA 4QDKA 3IA7A 3TE7A 1PR0A 1NUTA 1JFTA 2C59A 3ZWBA 2ZE7A 3MTIA 4Q1VA 1WCIB 1YQ9A 5ALQA 3L1KA 2X76A 3LKVA 4BDTA 1AQNA 1QGED 3X2EA 1N3IA 1ZRHA 1EGVB 5CM8B 3VZCA 1EP1B 2WZCA 1QIGA 3H5NA 4TMKA 2DFPA 2XQVA 4C0LA 4DWOA 4OHYA 2G4CA 2CFOA 2BMEA 1SHKA 2N46A 3QE3A 4D4LA 5EZSA 1XZNA 5FUBA 5D01A 5F76A 3QPCA 2P8JA 5ELMA 4RL6A 2PM8A 4BGVA 2IDMA 4XIYA 4MQUA 1ONSA 3UTCA 2JLYA 1T1IA 3RSLA 2GHQA 3FDJA 3PDIA 2J7KA 1Z0IA 3TLAA 5KMGB 5C9ZA 4RHFA 4H08A 3LXUX 4OHOA 3RS8A 4E15A 2TMDA 3W5VA 4YV7A 5HQ3A 5BMVB 1KQGA 4E30A 4ZC1A 3CTMA 2PZGA 1RHRA 2G67A 1Y6GA 1Z6GA 4S2UA 2UZ1B 1L5GB 1G4UR 1LFDB 1YB5A 5E1BA 2GM4A 1NWHA 3KJIA 3QWIA 5A7HA 2O5CA 2BFEA 3DLCA 1QQ5A 1FPMA 5EHGA 4GYYA 5KX5A 3SNHA 2AV6A 1PTJC 4DNXA 2GI4A 1EP9A 2ZQYA 1NUAA 4NJOA 2XLBA 2VDRB 3EFOB 5DHTA 4RULA 4A1FA 1G291 1ANKA 2JF0A 3SZUA 3F73A 1K9SA 1N1DA 4B3BA 4YJHA 4KNYA 3NWEA 2H9IA 1TC1A 2B5WA 1EX9A 2Q50A 2VP2A 4KN5A 4NL4H 4QARA 3ZV6A 4GRIA 1KZ6A 1JT2A 2GQ0A 3KXLA 4YCAA 1X92A 4MWTA 1CHDA 3EDQA 2ZBEA 4PEVA 3CBGA 3MTQA 4KGZA 2GD0A 4UUNA 4ARAA 1IM2A 2FQYA 1XZGA 1EVQA 4Y6PA 3UK6A 4GLFA 5F33A 1DPFA 1KEEB 1TRKA 3OA0A 4PZ0A 3VSDA 1MUUA 1N5RA 3G0DA 2KB0A 3L4KA 4O4JA 4L4RA 4IGIA 3EZ9A 3OKPA 4CCAA 1IOVA 1OBHA 4GXTA 4JI4B 1KH2A 1E3TA 3VVLA 3RUFA 3B7PA 3HN2A 4IDPA 3ZR4B 2WNSA 3EXG2 2IPAB 1DIBA 3AX6A 2OCPA 2WUDA 5LFAA 4YH1A 1JA9A 1C80A 2XXAA 1KU6A 3D3NA 4LJ7A 3M5CA 2ZJ6A 3I1JA 4D2IA 4E5NA 2BF7A 1QDLB 1GCUA 3GEHA 3AVUA 1JXOA 2WAOA 3GOQA 2PRSA 2RHCA 5AM1A 4GZ5A 4BRWA 5BV8A 1M1ZA 1A9PA 1VCHA 3ACDA 2XCOA 3CUUA 5KWVA 2FK8A 3EF1A 1YA4A 2XE4A 2AMJA 3DM9B 1TTHA 3Q6NA 1PG0A 4B2YA 2AR7A 8GPBA 3A28A 1F38A 1GZ6A 3B3FA 3GEIA 5CNMA 3N3BC 1VMIA 3TLGA 5HF8A 2XUHA 3JWPA 4EG8A 5KTPA 1DI0A 2QA5A 3GUUA 2JKVA 3VVBA 3MMXA 4RJIA 1NC3A 1Z88A 1CHNA 1EUCA 1Y5LA 2J67A 2OZVA 2PLRA 2QS9A 1H0HA 1RAAA 5FCDA 5I7SA 4JBHA 4AZWA 2GPTA 3CNHA 2X5OA 4J0IA 4L07A 1FL9A 4Z9AA 1NKTA 3MYYA 1K5DA 1M2VA 1WPQA 1KZ7B 4GGPA 4JBWA 5FI0B 3EGEA 4FYMA 4OA5A 1ESCA 4LYHA 4II3A 3KBOA 3BJRA 5TMEA 3O3MB 2I3BA 1Z6ZA 3DKVA 4ALLA 4MPRA 1S01A 4UBIA 1HX7A 1UXKA 2FZLA 3TLEA 1FBTA 4YO7A 3OZSA 1W19A 5K05A 4DR2B 1QB8A 1IZ0A 1Z38A 2B7CA 2QVGA 1V5GA 3AB8A 1FXWA 1ZU5A 4GWKA 3H5WA 1IUKA 3FDFA 4IQ8A 2ZXUA 5L95A 3KQLA 2BI8A 5JJIA 1XZDA 4QUEA 3K7EA 1SUSA 1P3JA 1PWEA 4GKVA 3DNFA 2EFJA 3NBFA 1GLNA 3O8QB 4RENA 2CYBA 1T8YA 3WP1B 4AJPA 2IXBA 5I48A 4BXOB 3ER8A 1S2OA 2R8PA 3BRQA 3INTA 1XELA 4MUXA 1W25A 1UPBA 2Q8NA 1YOVB 2QMOA 3O8OB 1FW8A 5ALEA 1E89A 2V7UA 3PB3A 4D8YA 1AMOA 3EEQA 1M72A 1N1EA 4TV8A 4WKGA 1EX7A 1OFIA 4LKOA 1DFGA 3AUXA 3FOBA 5K3SA 1MF7A 4AWXA 3RTCA 2NMVA 3P0HA 5JARA 1H94A 3IPXA 2SCUA 2R86A 4A8JC 2P6MA 1LF0A 4M7RA 2FDXA 4M55A 1W47A 3K05A 5DLYA 3WB9A 2J9YB 3BRWA 3DNPA 4CM8A 2F8TA 1CX9B 2R5WA 2ZATA 4HDCA 4RVNA 3QLVC 1NA5A 4RPHA 1DBPA 1P29A 5EJAA 3TRDA 4JNKA 1MW9X 3FUWA 4XSGA 3NU1A 4DANA 4ZCIA 4KITB 1TO1E 4HVAA 1KE2A 2F90A 4WERA 4XDHA 1UT6A 3FM9A 1XF9A 2G9QA 2RK6A 4F4FA 3CH4B 1IBMB 2LTAA 1W94A 3RFCA 4N65A 1X87A 2FSGA 3JQPA 2ERXA 3ME5A 1M6NA 2HJRA 1KH3A 1D1SA 5C3MA 1VYHA 3K6SA 2RIRA 5CXUA 4CMIA 1GA6A 4X97A 3ZTWA 5HOEA 4PFKA 3DMRA 1CJBA 2XD9A 3K73O 4MKXA 4CU2A 1M6WA 4Z54A 4MV3A 1DC8A 2WM9B 3VUFA 4IMJB 3RU3A 2Y27A 5FUVA 4RKRA 3SBDA 2BJHA 2PX2A 3DULA 2BFBA 2AC7A 2FR1A 3L0PA 4MTLA 3RC2A 4M1EA 1KTVA 2CSXA 1C9MA 3NTOA 1QYVA 3U3ZA 4CCYB 2WKRA 4DV3B 3M34A 4HDNB 3D6AA 1A7UA 2PUCA 4FW8A 1F17A 3QVOA 1K92A 1E79A 4LC0A 1YQUA 4FDUA 4TSFA 5TC4A 5KYNA 4L5YA 1YA8A 4MWSA 2FZEA 1DNPA 1UDAA 3CTPA 1A5ZA 1R15A 4REQA 3WLQA 4E46A 3R7AA 4MVJD 1XI2A 5ALWA 1ZEMA 3ESYA 3Q3HA 2CT8A 1F4VA 2J48A 3G23A 1KDVA 3SSAA 2EFCB 2HDNB 5AMXA 3JVUA 5KKCA 1BJTA 3DDZX 3UHFA 1W85A 2ATVA 2I99A 1PR3A 2AOWA 4G1MB 4H1WA 3WGMA 3F5DA 1EB8A 3TNYA 1O4WA 2ZUWA 3CUEF 4TTQA 4A2PA 1JKJB 2HF9A 2OBLA 1S4MA 1X77A 1RKUA 4TUYA 4UEKA 4EBBA 3PX3A 4M3NA 1HI9A 5DW3A 4CETA 2GAJA 4KW7A 1T3TA 1Y4DE 2VF7A 3AR5A 3HYNA 4G0ZA 3QLUA 4GO1A 3HB4X 4QASA 5DNUA 2ISQA 4OX9B 2JLVA 3BVPA 4FS8A 5LXTF 4MZDA 5JCXA 5JNWA 4HB3A 2ZUEA 4AY4A 2HXSA 4J7XA 1R88A 2PO7A 3AESA 4UCXA 2EAUA 5IXYA 2XVYA 1PLLA 1RACA 3C5HA 3ZJYA 4WX2B 3VNAA 1A4IA 1JLRA 2XKBA 2W42A 4KPEC 3DYVA 4QVGA 1KY2A 5JJCA 1KK2A 5DSXA 2BH2A 3GJZA 4YV1A 3HSSA 1HWYA 2VTDA 3NRCA 4KUHA 4NMMA 4UCFA 1XAHA 5KWEA 2Z2KA 3BXXA 3E5MA 5C46F 1PVDA 4GKAA 3CISA 1N2OA 1KJYA 4JYPA 4KQHA 3F98A 2XGMA 3P32A 4P4SA 2NU9B 1VKRA 1W581 3NC1C 1QFYA 4B44A 3BSWA 421PA 4YAOA 2ORYA 4L08A 2KBFA 4GECA 2W6JA 4GFDA 3H8JA 2D2EA 3HPQA 3SQLA 4RL4A 1UC4B 4A23A 1T9GS 3O1LA 4K03A 2ZR8A 3LUGA 4M6WA 1U98A 3JR3A 5U1PA 3OBIA 4BFVA 2P91A 5HZHA 4H3KB 4WN9A 5CHEA 1V3UA 4IOKA 3T1VA 1BX0A 2GZRA 3D5QA 4NFYA 3VU8A 1CIJA 2AWNA 3EA5A 1V41E 2FVYA 3KVVA 2JBHA 2WHPB 1W30A 2FMFA 3EBPA 4YGYA 1U0SY 2P4SA 4IDDA 4D5GA 1W36B 5F5XA 2O8DB 4OP1A 3ZXUB 1KF0A 1IUNA 5EEGA 2C1EA 2VG8A 1DB3A 3MD0A 3L1UA 3NV7A 1K3TA 1A4RA 2WIGA 1SIUA 4BYMA 4TLCA 1X3LA 4YALA 5CDSA 3E27A 5IZ4A 4YRBA 5INTA 5HILA 1OIWA 4IJUA 5BXYA 2PWBA 3UV3A 3A1VA 2BGWA 1N9ZA 5JBNA 3FTQA 3KV3O 2C5EA 4QL3A 5FPYA 3DH0A 4DR6B 1A96A 1M6YA 1EUYA 5K0NA 3X0DA 1AH2A 2H1RA 3QJ5A 2EJWA 4CR7A 1A7KA 5C7OO 3I45A 1L6IA 1XRLA 2ZFUA 3GCXA 1YZUA 5BVHB 2ZYGA 1KXJA 1OLXA 1US8B 4OGLA 4RPLA 1HO3A 3ITKA 3FLMA 4MPDA 4MWGA 1EFTA 4XTCS 4W5OA 4IGEA 2IUFA 4D9KA 4BVFA 3O8NA 5G3YA 1EHIA 2XZTA 4MWDA 1A2KC 2WIJA 3NORA 3HKEA 3FWYA 1OH7A 3HDHA 1XXHB 1D7OA 4N8DA 4WKOA 1W0JD 4FQ5A 4QA9A 2GD1O 4YJGB 3M6IA 1E1CB 4IXDA 3N5KA 2FUG1 2HLDD 4AM8A 3DKRA 4OGFA 3ZZTA 3I04M 1E1NA 1ZD3A 4NQZA 4I4LA 3GRAA 3I53A 2YWHA 3JTEA 5BSVA 3FOWA 5MGBA 4TYMA 4YRQA 1SQSA 1VLLA 3LY8A 4RA9B 4KFSA 4X7RA 1UPXA 3DB2A 3G0IA 4XASA 1R0WA 5FEMA 3ZNOA 4BO4A 2FN4A 2R4UA 4PC3A 2JI6A 1ADJA 1CC1S 1B7GO 1JHUA 3TSAA 3ZOZA 3W34A 2XLCA 5ITWA 1GRRA 1N6IA 1YVEI 1WB5A 3A31A 3T3MB 3FOFC 3GPLA 1CS4C 4DBZA 2OO7A 3V2HA 1X1DA 4UE6A 3RRFA 4DARA 1UPUA 1G21B 1NOIA 3HXTA 2QRUA 1RC0A 2NVUA 2FUEA 1DSSG 3A4TA 3RC7A 1EFVB 3FIUA 4AZ3B 1VIVA 5CA1B 4UKDA 2PL3A 2E4UA 2P0EA 2C2WA 5AJUA 1DGQA 3HXOA 1I0LA 3O74A 2PUAA 4IX1A 4DBVO 2OCXA 3BMXA 1JKFA 2W2XA 4N49A 1PK8A 2WSIA 1NVMB 3K2QA 4EW3A 1KMHA 3ZVMA 1FNDA 1YO6A 1ZH2A 2ZBPA 2QX8A 3TQTA 1DOAA 1X1SA 2QUJA 2XVAA 2RSLA 1HSZA 3P7MA 4L7QA 4X1KA 5ALIA 3AH8A 4KXLA 5EQFA 3GV0A 3JQQA 2XWSA 3GJ4A 3GP5A 5JAPA 1FUYB 4KG7A 3HR4A 3IOYA 2G8NA 1RQGA 2EJVA 2P9JA 3DEYX 3LUDA 2H16A 2PGIA 2RHRA 3R6DA 5AW5A 4POOA 2PA3A 3AF3A 3AUUA 5TVGA 5BT8A 4G0OA 1O4VA 2Y66A 4QWWA 1F2UA 2IPOA 4C03A 3T7AA 3M4JA 5IHPA 3CPSA 1CUHA 1XRRA 3HU1A 4LJ8A 1HTWA 3PF8A 5CDHA 2A94A 1RYMA 2FZGA 3B82A 3LZ6A 3A6KA 3H1PA 2FPGA 4P2GA 4PCLA 3H2IA 1TZKA 1QH0A 2D2XA 2V7TA 3UH1A 3UUFA 2JAXA 4PAOA 2O59A 5BT9A 1U4SA 3AL3A 1UMDA 1WUKS 2NTYC 5ITSA 4AN1A 5IT5A 3GVIA 5DFAA 2PS0A 4I1VA 1MA0A 4KB5A 1UDBA 5CYPA 3VH3A 3C8MA 2B2CA 4JLAA 4N41A 4KLAA 4V1CA 4EARA 5F3DA 1TM4E 5DM2A 3SJCA 3I3OA 2HMSA 1ZUD1 4XB1A 5EIOA 5J1SB 1W36C 4QD3A 3UCXA 1X38A 1UDWA 4OHMA 3OPYB 1CNMA 1CV2A 4B17A 4PQFA 1JZTA 3OZIA 3PXBA 4PAGA 1DEKA 2QTHA 1SPXA 2EG5A 4GMXA 3LY5A 1DTWB 4KH0A 3ZUGA 1E3MA 2ZZKA 4B73A 3MCVA 1HOTA 2FVXA 3ZVRA 4S1TA 3EGCA 4QWMA 5B5SA 3QEMA 2NXJA 5KIAA 1YJ5A 3BIOA 1EIZA 1NUQA 5IT4A 4HUQB 1JECA 3HP7A 2ZBRA 2JGDB 4G8BA 4MUYA 4WE3A 3U9TA 2DJIA 4HLNA 1O96A 4D3FA 4MVJM 1N2HA 2HQRA 3W6NA 2H2AA 4L2IB 1HDRA 2GZMA 2GSWA 4OQEA 2VK1A 3CINA 3DZGA 1WD5A 1Z2AA 5G0TA 2IH5A 3U13A 1SEPA 2WWTA 3VU9A 4HS9A 3ZE9A 4FNAA 4IY1A 4TLMB 3UYKA 5I7EA 1ZC3A 3KAQA 1C4OA 4J7UA 3W78A 2R00C 1TQ6A 2MMCA 3OTIA 1P73A 1S96A 1SQ0A 4J2OA 4IV8A 3UHPA 1G6HA 3UIEA 2HRQA 2OFFA 4ENQA 3KKZA 3C39A 2F17A 4JT2A 4ERXA 3EVBA 1I1HA 2DKOA 1GCGA 2R11A 4HV4A 3HS3A 3EY9A 5IANA 2JJQA 4I4TF 4BNIA 3VJKA 1N1GA 4FOOA 3EC1A 1SCUA 2H2FA 3WYAA 1N75A 2IE0A 5T3UA 3H99A 1N2CE 2O8EB 4HTAA 5G02A 4B8WA 2VJMA 4BVGA 1W2HA 1NXQA 1MJGA 3MAJA 4X6XA 3WA7A 1DKQA 1DWQA 1YUNA 5A4AA 2H5LA 4WXEA 1U0HC 3LXXA 3ESAA 2Q7XA 2OD7A 4EEKA 1PJCA 1GSAA 4NS1A 5EUMA 5AKLA 4E2XA 5BW5A 1O94D 2HA2A 5CT5A 3AFMA 2EZ4A 3PXCX 5IU6A 1L5QA 3RYIA 3TKYA 5HZKA 3H2GA 3L6RA 4B3HA 4NHOA 1QHXA 1UKYA 1O08A 3AF4A 3NBKA 4TTTS 1E9FA 3RVRA 2HPHA 2BP7A 1UZMA 1YZYA 3W8NA 4CIDA 3H5TA 4CG0A 4L74A 3OQHA 4QYWA 4FCTA 1IHUA 1TKCA 4R3WA 2WNHA 3RAFC 3KT0A 1PQPA 2A92A 4WK2B 4J8PA 3ED5A 1H5NA 1RZVA 4XAQA 4Y6GB 3T3DA 4G0MA 2YUIA 3QWFA 3M1IA 5H81A 4F3CA 2GBLC 2V9CA 2C3PA 1R3UA 2WYHA 1JFLA 1PU2A 4GI1A 5B1EA 4LF8B 1CR6A 1AKQA 1C50A 1GN9A 2YASA 1Z7WA 3DUFB 4M53A 4NESA 5EXSA 3U26A 3L8DA 4HQRA 3HDTA 1NQUA 3O0TA 1NJGA 5ISMA 2C03A 1A4XA 1XTVA 4DWVA 3RU2A 1UDRA 2HF7A 4E09A 4XLLA 3NV9A 3NC4A 3AFGA 4QT0A 1FTYA 1FYVA 1POXA 4OBEA 2NSHA 5AM3A 3ANXA 3LL4A 4MARA 4D4GA 3C98A 3EEIA 3TIGA 3NI2A 4OMCA 4O2AA 1GEEA 2Y4OA 1SIOA 3P9CA 3W5AA 4CEHA 3ICVA 1FUUA 2V98A 3IIIA 3IUNA 1FLVA 2SKDA 3L84A 3ZIAA 4BQIA 3UAWA 1U2PA 1NY6A 5CTAA 4DDWA 2I7CA 3GRPA 5DGHA 1OI2A 5JAIA 3WTBA 2RCYA 1TU4A 2V5VA 3HI6A 3U3JA 3C7CB 2OXRA 4LE1A 2A5FA 3DAHA 3ZK7A 4CF3A 3UV7A 5KWJA 5J2TB 1Z0JA 2XX3A 4BZWA 3RB8A 4P81A 1JSRA 5A3VA 1N1MA 3ZY2A 2XNSA 4QGBA 2IYAA 2ABWA 4R54A 3VR5D 4J7CA 3CVJA 1BWPA 2G9VA 4NI5A 4ARIA 1SVKA 3B5EA 3NB0A 1CIPA 1QYCA 3Q7EA 4YUYA 3IMFA 8AT1A 1S3IA 3FWKA 5CW1A 1BYIA 3A2MA 3ZZUA 1Y33E 1L5HA 3ZJ5A 2IEYA 3L6CA 2Z6QA 1L5ZA 3KLOA 1E1YA 2VP9A 2QN9A 2ONCA 4QU0A 2QSYA 3FD8A 5LOVF 4ZGWA 5LQMA 4JBIA 5D84A 5E6SA 1QFXA 1ZGJA 3O1JC 5FV7A 5HUQA 1MMFB 1WKCA 2K4MA 3T41A 3ZJVA 4NLLA 3G2IA 3O4RA 4V0NA 7REQB 2PSEA 1XUOA 2AYYA 3NAGA 4WCFB 2XF8A 3SC6A 3TJRA 1RZUA 3X2SA 4AG5A 2JLXA 2GTIA 1CQWA 2FXVA 2O7QA 2Z5GA 2FSHA 4FR0A 4QSHA 4YT5A 4OFZA 2E87A 1AF4A 4HHEA 3WDLA 3PR2B 2ZBVA 1K08A 1SVIA 3GEBA 2YWGA 1TYCA 4ID3A 1LD3A 1RP7A 1V7PC 4DMKA 2JAUA 4EW1A 1NX6A 3TK1A 4CLEA 1FP4B 4K9DA 4BMYA 1KARA 3R4VA 3LW8A 3AF1A 4W5JA 4ECAA 3CZQA 2QR2A 4KL8S 3NNNA 2GTPA 1NR7A 3MILA 4NDAA 2JDIA 1SN7A 5BOVA 5EJ7A 5I8ZA 3UPDA 1FMLA 1Z2EA 1UWCA 1Z6QA 2D7JA 4G5RA 4O0LA 1DX9A 1LPBB 1Z74A 4L51A 3REOA 3UUEA 4N76A 4HKTA 3HDVA 3Q9NA 3WIOA 3PNBA 3WGUA 5KYYB 4C14A 3UPTA 3KJXA 4KQXA 2GILA 4KR6A 1NURA 1CRPA 4N6GA 3DS8A 1M34E 1C3OB 3ZE7A 3G0HA 1T3ZA 2HQSA 4JBNA 4L7VA 4Y9SA 1MJ5A 5CPFA 1MKYA 5LNK1 4LPSA 2ZAGA 4DLVA 1P4HA 4N7BA 1MEEA 3ETCA 5CX1A 3RNOA 2Y1GA 2X9VA 5JQGA 2EW8A 2IL1A 1OHHD 4E5UA 1AZTA 2JL1A 3AR3A 4QBHA 3IDFA 4YJ3F 3ROQA 3VU3A 2HEGA 2BAGA 3AW9A 3QLUC 1ZGZA 4RTLA 1XNRB 2FZ4A 2EF0A 1X7HA 4C0WA 4LMPA 1U5BB 1XOIA 5DCUA 3CF4A 5HCUA 4DSUA 1QX3A 4B6OA 3PD7A 3PXUA 3GJ7A 4JSRA 3SG0A 3QBDA 1ST3A 1DX4A 4C4XA 2RD2A 4LJKA 3EC7A 3NHWA 4RS3A 5COBA 2J9ZB 4WOCA 1U2SA 1ENPA 2B4YA 1M2HA 1SCJA 4MVJH 1UJ6A 1UK9A 5AKJA 4OAQA 2VP3A 4H7PA 2ZJ5A 1TYZA 3WKBA 1S6YA 1ZJYA 2XBUA 4YCBA 4ZVUA 4UCQA 5KC8A 1KRXA 3IC5A 3JAMA 4TTJA 3GDWA 3WYGA 1AY0A 1QOZA 3BGWA 1U0EA 2L17A 3KE8A 1U3DA 1AS2A 3PNPA 3OE4A 1WZNA 1VKNA 2J4CA 1C1YA 2Q29A 3SHQA 5LMZA 2IOFK 3AEUB 5FHQA 1JHMA 2GHIA 1QP0A 4V0QA 3B3AA 4UNQA 3FPAA 2XSZD 4FOPA 1T2NA 3WWZA 1LDEA 3FOEC 4Q82A 1CUJA 2G1UA 2GM3A 3IP6A 5ARDA 4AO7A 1QTRA 3BMNB 1I0ZA 2FW8A 1XPJA 5B1SA 3VMMA 2YYAA 1KXZA 1IAVA 1VLMA 2M32A 1XLTA 4HQOA 5E9WA 4WCDA 3WDSA 4BFWA 1V16B 4BFTA 4EZBA 1YE3A 5F9HA 4MV4A 4MWCA 4CJXA 4E0BA 1PZHA 1TXGA 2HA3A 3K0AB 1H0KA 3D8HA 1K8QA 2QJRA 2BWJA 3C74A 2P5UA 1ZINA 4AIIA 5L7WA 5C5IA 5B2ZA 5KYXA 2VZ9A 4OAPA 5M3BA 4KTVE 1MB0A 3CN9A 3OLVA 2Z6AA 3HXMA 1O2DA 3FVTA 2XB8A 4UBNA 4C89A 4KR2A 1NBME 1WXFA 1QU2A 4NXMB 2RGCA 3L49A 2VBCA 4Y2VA 1FVHA 1E2BA 4QYXA 521PA 4K2AA 3L7LA 2DC1A 2FX3A 2ZKLA 4JC8A 2D7DA 1OF1A 1OMOA 1SHUX 3DXZA 5GM1A 2C4WA 1XMQB 5ICEA 4FMCB 4RY0A 2EWVA 1QIHA 2ATIA 4GZ3A 1K88A 5KAMA 3BFXA 1OYOA 1RKQA 3VDNB 4KAFA 2O2SA 3ENNA 3IP9A 3LWBA 4HZGA 3THWA 1JPVA 3NNDA 4IIJF 4IZOA 2A4KA 1H8ED 3H87A 2IOYA 3THRA 4BZQA 5J4LA 5ICCA 3IXQA 1FTQA 2J3KA 4NEGA 1QWSA 4HB2A 1UP4A 2ZWAA 1OE0A 1ZAKA 3F6RA 3SDBA 4A0SA 4DIDA 1MXHA 4WCFC 5CGZA 4XARA 2G40A 5KCZA 4HNAB 1KDPA 2H65A 4MW4A 5EKUA 4GUDA 3W90A 2JGAA 1ZH0A 1HT0A 1H1DA 1JMKC 2C2YA 3IUBA 3LPAA 4CT4B 2HHCA 2KYRA 3ZU3A 1Y5MA 3BS4A 1BDBA 5TDHA 4HB4A 1DG1G 4RVDA 2IITA 2XY4A 3R0XA 3PFWO 3PUYA 3O8RA 1ISIA 3L8EA 2C88A 2PFSA 1H05A 2JFNA 2P5TB 4HN2A 1Q6ZA 1XZEA 1EH5A 2X0FA 4JX9A 3SS8A 4BNHA 1B93A 5BNWA 1X9HA 1NJ8A 2DQ4A 4L9AA 3O6VA 1PV4A 3LBIA 3KD3A 4UBLA 2KE5A 4FUTA 1KEVA 2PV0A 3WC4A 3GRCA 4DZZA 2FSVC 2Z3WA 5ALOA 3HU2A 2HRDA 3H4TA 1KQNA 4R9VA 3WA6A 4DG5A 4NX2A 4RIHA 1QX4A 2OBFA 3BRCA 4GUAA 5D7NA 4NBTA 2OCYC 1HFEL 4BKPA 4QSMA 4WOKA 5EMNA 2IS2A 4J0EA 1K3UB 3GLTA 4NATA 1XCGB 1Z4QA 3FF1A 3D43A 3M81A 4WLVA 3ET5A 5AI8A 1I36A 1MGOA 3D64A 1LH0A 3FVWA 2O2JA 2VNKA 5C8VA 4WXYB 3WL5A 2PH3A 3PD0A 4DSNA 4ESHA 1XDSA 2WPNA 3NDRA 2O14A 3CH6A 4IJVA 1ZJWA 3WB1A 1PL8A 2ZYTX 3FTDA 1PVOA 2VA9A 2F6RA 4BFZA 4XI9A 4Q4HB 4FE7A 4GDMA 5J5AA 3E0XA 4DIKA 2PD3A 1BRTA 4K1XA 4LGCA 2XDQB 1YBHA 5BNIA 3O2QB 5C5EA 1PQUA 1EK6A 4RF4A 2XE8A 3K4QA 4HMQA 5EWJB 3W5HA 4GR9A 2BVNA 4EGFA 4JC5A 4RCYA 5KSPA 4Z7OB 1CQPA 3KUDA 3X1XA 3X3HA 4N3NA 4HH0A 3KZXA 1BCSA 1L4LA 3P9YA 4KMRA 1RS0A 4EHDA 1CUDA 1EA7A 3KPYA 3BXOA 4HXEB 4MV8A 3JQAD 4YRPA 3SBXA 3TG8A 2B4TO 1JDUA 1LDGA 3ICOA 3ONVA 3AEQB 2C58A 3E8MA 1V6CA 2VYFA 1NJ6A 2PK3A 1QORA 3U4IA 2C9BA 1JA0A 2IYTA 2ZIFA 2J0VA 3BHMA 3H1FA 3HCNA 3NUQA 4FBGA 4G0QA 3EEOA 1L5OA 2H2HA 3T1YB 4AMYA 1D1PA 4RHYA 4E5SA 1C0LA 1ENZA 4E03A 1P7WA 2C5AA 3GFGA 2DUWA 3LDGA 5KYWB 4LXYA 1FLNA 1JZQA 3GELA 5NLLA 1CZOA 4HDMB 3V1UA 3VZQA 4D4KA 5HTOA 4TXHA 3KTAB 4LSMA 2CE2X 4W8GA 1RI3A 1G7CA 1R6TA 2X1VA 3FKJA 3TLJA 4AS1A 3AJ9A 2B5VA 2BE7A 4FS3A 2V58A 1DPGA 3LE8A 1J7KA 5KO2A 2QI9C 3HN6A 3S8YA 3D3KA 2QTCA 4XX0B 1GJRA 4NFSA 4OD0A 4BE7B 5AESA 4M0UA 3CSUA 1GNTA 2DH5A 2OCLA 4OYRA 4EENA 1MG5A 1QE0A 1X7GA 3EJ6A 4FPXA 3IAAA 5FPHA 4LZZA 4EDHA 4DF3A 2ID4A 2RGYA 5HDBB 4CQMB 5IDQA 4L76A 2DKNA 1WHTA 4BP1A 3BK7A 1ENYA 2BBWA 1UK6A 2A8YA 4FNMA 4FYVA 2ZXEA 4KBGA 4ZEWA 4RTJA 3OQIB 4YPOA 5HW0A 1VRCA 3MPOA 3MWJA 3VU1A 4HUTA 1U9IA 4HL6A 4IIBA 3B1VA 5ADVA 1H4QA 5K9ZA 1XEWY 3B5IA 3PPYA 3IESA 3GDHA 1VG9B 2BTQA 3BB1A 1NLMA 1D2MA 1MNAA 2PU5A 3DBRB 1A8SA 4QUKA 2QD4A 4R5HA 4DRXA 1KJZA 4BKMA 1NNEA 5JAQA 3KKNA 5GVSA 2R5FA 3HZOA 3D0KA 3OAAA 4A0GA 2WWXA 1KEPA 1QOPB 5FA5A 5D51S 2A7XA 4PLCA 2YJTD 3DEZA 1SKYB 2Q28A 4FHFA 2SICE 4IEFB 3CJQA 4WXPA 4AMZA 5I4CA 2DMRA 3ZY3A 4CLOB 4Q1EA 2AOUB 5LLDA 1CB7A 3VQTA 1N6KA 2Y76A 2I6TA 3D6UA 4AMVA 1GDDA 2X7HA 5FL3A 4UTRA 3LX5A 1P75A 3UNXA 1KOJA 3RUIA 5DEIA 4GYJA 3RROA 4M1TA 3MJEA 4HLCA 1SKUA 1R0LA 3Q2IA 3FN4A 2BDUA 4NAVA 4DQDA 4ZI7A 1U1GA 1KDOA 3RU9A 3OJCA 1TAUA 4DDTA 3NVKI 3DE1X 1KI4A 4XOUA 2XYPA 4N47A 2IYRA 3ROMA 4Z3KA 3RO7A 4MV1A 1YR6A 1EYZA 3RHTA 1H2AS 1SOMA 2EDAA 1D8TA 4XKJA 1A5BB 4TTVA 3C43A 5HHTA 1K6EA 2NYVA 4F9GA 3QH4A 2AIRA 4P0QB 3BD6A 3KEGA 3KOMA 3GCDA 4IKEA 3BC1A 5DYWA 4BO0A 4Z4GA 3DVSX 1K68A 1YUBA 3LCRA 3MM4A 2VDWB 3WLFA 3ZW9A 1YGYA 3AUTA 1U7PA 1Y5IA 3MWFA 4C7JA 2C9DA 3HB0A 4NKRA 3KB8A 2OO5C 4NEHB 1KKMA 1FMFA 4KSCA 3RIYA 3U4GA 1MOSA 2NG1A 4NE9A 1GSHA 5IJAA 4U1RA 2Z5VA 5F7ZA 3MQFA 1BEZA 3IUEA 4J4HA 5EGNA 2WVAA 1SC9A 1UPTA 2FPSA 3GT4A 5E1MA 1KOLA 3SP1A 3TSZA 4AC9A 4HNUA 2V0GA 1VC2A 1PEAA 2X5JO 4HNRA 4D8TA 3QUQA 1ZMBA 3PJEA 1WMSA 4QRDA 5IJ9A 2X0RA 3FCEA 3FGNA 4IDGA 3GFOA 3PNMA 4Y2GA 2PQ0A 4TMTA 1AHHA 1MB9A 4F5YA 5HRCA 2RIPA 3P0JA 3N8GA 4W1PA 2FW6A 1L7EA 4WINA 4DT1A 2LPMA 5DJ5A 4DY6A 4QYTA 3Q8MA 3BHNA 2G17A 1JYSA 2AF3C 1PHPA 1D6JA 2J3QA 3KEOA 1DQSA 1RQ2A 2I29A 3NQ41 3VKFA 2JRLA 5HUHA 5GY7A 2XZLA 4KRYA 3CEPB 1IC6A 4EGQA 1RT9A 1QGZA 3JARA 1CD5A 2DB3A 1WUHS 3K0EA 1OYWA 4LZOA 2BFWA 1H2HA 2IEIA 4U6NA 3N58A 4BJ3A 5EAIA 1Y1PA 4WQMA 3SF8A 1RYDA 3T54A 1BRMA 2OUKA 1SNYA 2JPDA 1TGVA 4OQDA 4W9RA 2RHWA 5JZOA 3NWBA 1ISSA 3GJYA 3GQBB 3AM3A 4TXNA 3DOHA 5DW0A 3VDXA 4IHJF 3VPCA 4ENSA 3Q9SA 4MCHA 4FDVA 2EBFX 2G5GX 3N07A 5KKNB 1DUSA 1TJYA 1QQ6A 1CUWA 1FU4A 3GAMA 1SBYA 3OI7A 3O9VA 4JNCA 4MI3A 2XB9A 1NJ5A 2DTEA 3UJ3X 5JNRA 3DBLB 1S0UA 3WJAA 1GU0A 3Q9LA 2C92A 2IEGA 2BGRA 3M8KA 5F4BA 1MOQA 1ZKDA 1BMQA 1NHGA 3Q3GE 1TQ2A 4ZHSA 1WVGA 5D3MA 2VJAA 3DZBA 2C9OA 4RACA 4L0CA 4Z1MA 2DHDA 3G5UA 4RA6B 3O3OB 4IYJA 2VJKA 4JI7B 5KYUB 1IVNA 1NKSA 2PCLA 3OCJA 3VR5H 2CLEB 4KN8A 5F5NA 5A0FA 4BBPA 1M0SA 4YXFA 1X14A 1HE5A 1PJBA 2F43A 2NIPA 4H7JA 2PX6A 4CU5A 1Y1KE 5EUQB 4UFPA 3R5KA 3L2OB 4B31A 3QUCA 1VI5A 4U6SA 5DO9A 2VXCA 4RCVA 1SQ5A 4TL7A 5JZMA 4YRTA 3I6BA 2HF8A 3FNFA 4KVGA 2FHPA 2Y1CA 5AVYA 2QM8A 4K26A 1VLVA 1X70A 4RKWA 4FHEA 3Q1KA 1KBQA 4MS1A 3A4MA 3ASYA 3THXA 1HA3A 3FNGA 4P8RA 3GNTA 1YULA 1P8JA 1SC1A 1GQSA 2XUAA 4HBZA 5ENZA 3R7BA 2ONKA 1N3BA 1DV2A 1V8BA 1W44A 4WGFA 4OHRA 2H18A 4NVRA 1ULUA 3P2JA 4L0QA 4U0KA 1FDSA 1YBAA 2YHBA 1P4RA 2XCIA 3GLSA 2VZ0A 3QPAA 4DDHA 2UZ4A 2JLWA 1XQVA 4GSKA 4QICA 4XIJA 1FSPA 3CVOA 2DQSA 2VHYA 1Y5RA 2MWMA 1FC0A 3HTXA 1NI4A 3KQOA 1I0IA 1AB5A 2R7AA 3OU6A 1GGMA 4LRSB 3RW9A 3AERB 1M6HA 3KWMA 4AF8A 4CGYA 1RBMA 2BKVA 4LWOA 1JDPA 4RO0A 1N92A 4KE7A 1HDGO 1JAZA 1DDGA 4NCBA 2E82A 2BUAA 3HYSA 4OCZA 3R3SA 1G8SA 3O73A 3QQ5A 4JLBA 3WQQA 5I4BA 1ZMTA 1VYUA 3AJAA 3CW2A 5KJ6A 4KPGA 4LJ6A 3RVMA 4XVRA 3TQRA 2AFIE 2GZDA 4PHCA 3GA7A 4CKWA 1D4OA 1W29A 1ETHA 5L6MB 3ZC3A 3KYCB 3RRYA 1RM3A 3IDSA 1E92A 4HDKB 2P90A 2WFMA 4QM7A 3DNMA 5DCWA 1RWBA 1NN5A 3H9UA 1U99A 1RAFA 3K31A 2DBZA 3CIOA 1ZHOA 5I7RA 5HX7A 2CNWD 4LC1A 4TS1A 4OLAA 5LKRA 4J1NA 1E8DA 1SBHA 3ABOB 9MHTA 3ZTYA 2FFAA 3ZWYA 1XLTC 3BKWA 1DAFA 1USIA 4O4HF 4UM5A 2B61A 3QVTA 3TGWA 3M6UA 5KYTA 2BR4A 1VJDA 3KSAC 3GEDA 3FRIA 3BMOA 3R9XB 2DBVO 4Q6BA 1BO6A 1PI3A 3GZJA 1UJ4A 3HKDB 3T0IA 4U6QA 3FAKA 1FP2A 1TJ5A 3B9BA 1V5FA 3F7MA 1YTUA 4IH4A 3LQ1A 3IT2A 1QKIA 2J5BA 4DG8A 4RVGA 3JX9A 3EZYA 3ONDA 3INGA 4YT4A 1AKRA 1E61A 3IPCA 3S28A 4PYMA 4B8YA 5T41A 1Z2PX 5LQJA 1KSHA 2ISCA 4DUPA 2CB0A 1FTWA 1N6RA 1RMTA 1USVA 2YXEA 3W8EA 5HF5A 2Q0QA 3KHTA 1BVYF 1YDHA 1ZH8A 1W1WA 4R05A 1UAGA 4YQEA 4K0RA 2Y2VA 4F1JA 5IJ0A 5AVOA 4O2RA 5A9TA 1J8MF 1OY1A 1W96A 4OM7A 4YROA 4MJ3A 1B0AA 5TPWB 3ZXXA 5CB4A 3IDQA 2OXIA 3DAGA 2B2NA 2JH9A 1G60A 1F48A 1GV1A 2EP5A 3WIVA 2DCUA 3OUTA 2IX9A 2FPIB 4DG9A 3QF4B 4OSOA 1EFAA 3VH4A 1V8ZA 4JUCA 4F3TA 3WDMA 4ZC8A 3K4PA 3TRIA 1C3VA 3E8SA 2YZ7A 1QAMA 1VIYA 2HCTA 5GTDA 4DM4A 2R751 3NVAA 5BN4A 1FJXA 1THGA 4XDGA 2ONZA 5EWLB 4BX8A 4CMEC 3JQBA 1JBKA 3FPLA 1P7ZA 4MVYA 1EFRA 1XA3A 5J5VA 3OLQA 4EJ6A 2BL4A 1KVQA 4AMUA 4NU6A 1O5IA 2O1XA 3JASB 4B2PA 2ATEA 1OFVA 4BRUA 4CKCA 5F7JA 1SHZA 2AYXA 2YMQA 1OSNA 5JWOA 4B3GA 4JL6A 3TMAA 1FFXB 4JLMA 2I2DA 1GDTA 3ZXYA 1G8KA 3AI2A 3ND8A 4R0VA 2JBAB 1UEJA 1CY7A 2O8VA 4V0SA 3LF2A 3EXEA 4Z4EA 4LX0A 4YJFB 5KNCH 1W8DA 1XPUA 4IDAA 1KI8A 3WV5A 1OT5A 4I1YA 2B8NA 1NF2A 1GGEA 2A14A 3OM8A 2L0XA 2XUDA 3C14C 3BGOS 3F90A 1LBEA 3SE7A 1C30B 1IYZA 1VE3A 2PUHA 5F12A 4TVOA 1LTKA 2HLNA 2QRJA 1BX3A 1L7PA 1LJ8A 5IABA 1LWNA 1BWSA 1TLLA 4OG2A 2FEAA 3VZPA 5JD4A 3GLFE 1TPYA 3FZEA 3PQ4A 4FSXA 1JWAB 3KUXA 3PNKA 1YCGA 1OTYA 5AIBA 1SWWA 4EG3A 1ULTA 4OUDA 5FI1B 3NATA 4NZNA 4CQJA 3AOEA 1GO2A 3FW1A 3P9SA 3OD1A 1D9ZA 4Y9UA 1QH8B 4PXSA 3BEDA 3A1SA 1H2YA 1DRUA 1OI3A 3MMSA 2HU7A 4MULA 3OOEA 4NG4A 3VUEA 3KQKA 4FWTA 1YU6A 3PGVA 4LZLA 1V48A 3DDHA 3BWYA 2ZYWX 1QF6A 4L5JA 1CFJA 3B3JA 5IBPA 3WDKA 3OT5A 2WG0A 1OPRA 3H86A 3O8LA 1YHNA 3RT9A 4F7WA 2P3SA 4UTPA 5K09A 4CMHA 4I3GA 3KEQA 3MIZA 1GL7A 5JAUA 2YJGA 5EOVA 4B3MB 1MENA 1Z33A 2YQZA 3OEWA 1FDVA 4ISCA 1TE2A 4M9UA 5EA2A 5LN1A 3WKAA 2IUEA 2BBTA 2WTUA 2B2XA 3MRTA 4FIZA 3WBJA 2QE7A 1LZKA 5HMMA 4NYJR 3VZBA 2E1RA 1P5ZB 2QX7A 5KBYA 3A1TA 3TLMA 3AXSA 1JHRA 4ARZB 1YR8A 2PVPA 3VHQA 4ZK6A 3FRJA 2JAPA 4R71A 3LX8A 5C8DA 1ZA1A 2JLAA 4IGFA 1PR2A 3ZZNA 3B60A 4PO1A 4A27A 2WQZA 3ND5A 3PP8A 5E4FA 3LH5A 3AIIA 4MRVA 5CG1A 1JR2A 1SVLA 1W9MA 2E6KA 4J75A 4JJFA 3LIPA 1BGVA 1U3FA 4OA8A 4X7PA 1OBCA 1T5OA 1O97C 3U81A 1U9IC 2B7LA 5EIBC 5EP2A 4Z0PA 2W0MA 4MW5A 4YDHB 3RLFA 5L3SA 1OFUX 4JKYA 3CQ9A 4W8HA 4TKVB 4Q4AA 3ZWMA 4EG5A 3RH0A 3EZ7A 1RXWA 3ADPA 2JBWA 4RH1A 1T29A 1TUGA 4FD2A 2CEKA 4RXTA 4BNDB 3A3PA 2JAQA 3IOEA 3PQEA 2OILA 4RMNA 5LB4A 4MRSA 2A2ZA 4EYSA 2IYUA 3E7FA 2CMGA 5LYJF 1SA0B 3D5TA 4F71A 1A9YA 4BFLA 1BYUA 1DTSA 3KTFA 4WBNF 3AWIA 2W98A 4BNNA 1Y8CA 5EWMB 1PT5A 1VKOA 2O05A 3IDOA 1X7XB 2IWRA 1E2DA 3ANNA 3E3AA 1ISGA 3FKQA 3GRVA 3JALA 4Q24A 5TQ2B 2QT1A 1CS0B 2UZ3A 3P4YA 3THSA 1RQLA 2AUNA 2WEKA 4WWHA 1ZVJA 1Z7YA 2ZRGA 1XMIA 2OCKA 4P58A 3UK2A 4M9XA 3JS5A 4PZDA 1HT1E 4RSHA 1TEZA 2P6OA 1UL1X 1PF7E 3SHWA 1ISFA 3D2CA 4QHTA 2C5BA 2ZWIA 3EZLA 5EZQA 2QJTA 3TAHA 3H4IA 4DJ5X 2NU6B 2AR0A 4MOWA 4F60A 4JD5A 1VLJA 2WG1A 3A0RB 4YP0A 1U8YA 4WADA 3W2TA 3LDAA 3UENA 3CPEA 5FIUA 3V46A 2FRDC 1M2NA 1Q7TA 4HEJA 2G9NA 2XMCA 4DV6B 2NTJA 4WJZA 3OT4A 1GKIA 2PYZA 3ELWA 4QGSA 5KNBA 3L8HA 3DF9A 5JH7B 2DLDA 2R6FA 1RCTE 1OZAA 4JJGA 1PJTA 1EWKA 1WX1A 3A6HA 3G2PA 3RVSA 5CVTA 5KNCA 2CDAA 2P67A 1QKJA 1NLYA 2GYUA 3EVTA 2VOJA 2XUZA 1Q21A 3REQB 2VRCD 2VTVA 3QU5A 4EA8A 2KMLA 3H05A 1SU8A 1GZ3A 2PIDA 2R68A 2IUUA 4JELA 2W6ZA 2H5IA 4FEEA 1OX4A 4IV5A 4MMYB 5COAA 4ACAA 2JEZA 2PSJA 2HJHA 4FZ3A 3S44A 4DYVA 5ADWA 5KPDA 1FF9A 2DLNA 1INLA 1Q74A 2NO0A 3ABRB 3AHFA 3PUKA 1QLHA 1DIOB 3ROFA 1H2BA 4GBGA 4RVCA 1UEXC 2Q9UA 2ES4A 3RSCA 4DV1B 2CNLA 3GJ6A 1CY1A 5DMHA 1SD1A 2DWUA 1D2EA 3BBLA 1PWXA 4J0CA 4RJJA 5CK4A 2CDRA 1UJ2A 4PHFA 3VR0A 4COOA 4ZGBA 3WAGA 2F4NA 2NUAA 1LPOA 2QQFA 2W90A 3FHLA 4RMJA 5JXWA 1QMGA 3OSUA 4F96A 3U62A 4NWIA 3KYJB 4XJSA 2DPXA 2XOKD 3ABZA 1G5PA 2XQFA 3H7AA 2HY7A 1UJMA 2WT4A 3NKFA 4L1KA 3WLHA 1ESDA 1KP2A 1F5NA 2NYRA 4NMHA 4TTIA 3AYXB 1FX0A 2O0JA 1UQUA 3OQNA 1U3GA 3TR0A 1YD7A 2AL7A 4UFNA 5AI6A 2WTNA 5T8KA 2QTMA 2GPSA 4CDGA 2QBYA 1JQEA 5TEWA 2AK3A 2ASEA 2G0AA 3N7AA 4Q39A 1RWQA 3I2KA 1C3LA 2HMTA 2Q2WA 4O4LB 5HKOA 4BKQA 3GLKA 2PLNA 3OTQA 1DC3A 5DK4A 3TW8A 3FLBA 4B4KA 4V0MA 1NVVR 1QRRA 5E6RA 1AKWA 3FZQA 5AM5A 3HVIA 3G7SA 4EF4A 1KAOA 4AQ7A 4RESA 2ZK7A 4KXQA 1LF5A 2J9XB 4XJVA 4B43A 4UDOA 4AI6A 4I6JA 5ALXA 3O2NA 2QRVB 1RPJA 1UDCA 1QO0A 1ACLA 2P8SA 3K8ZA 1NQ5A 4H7DA 3UMVA 3LP5A 1SXGA 4BNMA 3A0UA 1J2TA 2X0KA 1P6XA 5D87A 3VTKA 3CRW1 2O7VA 2FFHA 2XNKA 3CZAA 1KS2A 1Y6QA 3EUEA 3NGMA 4DWWA 1JU4A 4KVZA 2ZB3A 5DB4A 5C4IA 8OHMA 4MRMA 1U3WA 2C7PA 1R0XA 1M1UA 1G8YA 2YWCA 5AVVA 5DGDA 1ISMA 3R1IA 4JMLA 2DUMA 4IJ5A 2J3LA 3M49A 4WVLA 3CLSD 1L7XA 2A0XA 2I6SA 4IIFA 3RKUA 5DNAA 1Z47A 4O8CA 4WT7A 2BM1A 4PGAA 4L78A 3EXHB 4NZPA 1YZGA 4PU0A 4YCMA 8ADHA 1A95A 5HEKA 3MLBA 2AJ8A 3BCRA 3T7RA 4BMZA 3UTDA 4CCWA 3OPVA 1XAJA 2OESA 4CG1A 3FE2A 2OXEA 4IICA 4HWSA 2WSMA 3E2PA 3PFBA 4MI1A 1WMAA 1IJFA 5EJ2A 5AUPB 3EDCA 5D3KA 1KK3A 5H4GA 1IN6A 2DE0X 3WMRA 4KODA 3O8CA 3QVSA 2R7KA 4LSGA 1N3YA 1ADGA 4GEGA 4MAAA 4D56A 2A9FA 2WFZA 5JCJA 1ORWA 3DHYA 3EEFA 2HWWA 2ANBA 4Z51A 3ZGVA 4ZCSA 4BEBA 2BEVA 1EFHA 4Q93A 3DYBA 3WRWA 1Y7HA 1QHIA 1NVKA 4LOKA 2AE2A 1Q0RA 2GK3A 3KELA 2DPGA 3FPFA 4YP7A 4JB3A 3MINA 3GHYA 1W5SA 3FF4A 2YVLA 2PD4A 2PZKA 1G42A 2UVPB 2VF4X 4E22A 1VPDA 1UMKA 4BBZA 5JAZA 2RGBA 5B1YA 3EODA 1HG0A 4C6HA 1V47A 1YXMA 2I1WA 3OLZA 4JBLA 1G2IA 2I7VA 2ADFA 4XSVA 2IHZA 1RFGE 4KQCA 3Q3VA 1PP4A 1KK1A 3UJBA 3WS7A 4E31A 4DC9A 3LFTA 4IOLA 3E9YA 5AHOA 1LS1A 2QM3A 1TUIA 2GCOA 2DR0A 3WHLA 2V5UA 3IIJA 3BGVA 2J33A 4MEJA 5GGYA 3S81A 3PFNA 2ZE6A 1JG7A 4MR9A 3ZD8A 2BYTA 4OP2A 4Q4JB 1XRNA 4JLJA 4A9AA 3U48A 3WLEA 3EOZA 4L6CA 1NE2A 2E89A 2VAVA 1VI2A 4KN6A 1L6RA 4AICA 4XPZA 4F5DA 1F60A 1ZN8A 1EG7A 1LSSA 3H5VA 4EW2A 4J9UE 1Q17A 1R6XA 3GLHB 5EHNA 5JS2A 3PYXA 2H4HA 1G4AE 1WDLA 2Y1FA 4JASB 1REQB 3JVVA 2Y68A 1XQWA 4ZT4A 5FL7D 1L5NA 4OHVA 2IZZA 1AKMA 4WY5A 3E1KA 2JIBA 3PKJA 5CLHA 2B1RA 4X20A 5IAJA 4HX5A 5A0TA 4MLCA 4K9RA 3O4FA 3G9TA 5IAAA 4C2UA 4ZO9A 2D59A 2HBQA 3O84A 1RKVA 1A69A 2AG5A 3DG9A 3LU1A 1WM1A 3THOA 4ARUA 5K3FA 3DMPA 5EG5A 1T36A 2O3SA 1XN1A 1YQDA 3R2JA 2GN0A 2R0QC 5C53B 3LNTA 3KYBA 3K70B 1K8RA 3R0JA 3LVQE 5AJTA 1XTJA 2DBQA 4IVRA 1AGYA 3HJNA 3UGJA 1L0BA 3HEMA 4RQAA 5B3KA 5CFRA 3A3YA 3QK7A 3CX4A 4B4WA 3CW9A 5LKAA 3HLYA 3UKJA 2ZZNA 1W9HA 1ZI8A 2BGTA 4HGOA 5E9QA 2PVCA 4F6RA 3LGAA 1C7IA 2F1OA 1PG5A 2OZKA 3GBVA 3MTBA 1N6NA 4HFRA 4TQ9A 4Z3DA 4CKYA 2F9MA 4DA0A 1SBTA 2QTVA 3W9BA 3SWWA 3GGGA 3PC3A 1K4KA 1K8ZB 2QD1A 1P72A 2BHTA 3AEZA 1JJIA 3CSDA 1QIMA 1A1SA 1C8KA 4ITVA 4F56A 4MB0A 4OJMX 4UREA 2QLTA 4C4TA 2XCLA 2B94A 2EP8A 5F9MA 4DV4B 3EQ6A 1RQXA 3QZUA 1MC5A 1E1RD 1G5HA 3JYPA 3LX4A 3LQ2A 5EP3A 1OT3A 4UEOA 3F74A 2GF9A 3U40A 3W5JA 5T64A 3HCFA 3GEEA 1NVDA 4LNUB 3W3AD 2EIHA 1V39A 4BWFB 4R8LA 2Z1NA 3J7AC 3I9KA 3ROEA 1J8DA 1Q0PA 2XKAA 4JP3A 4Y18A 2VHTA 3AG6A 1N7HA 2VLIA 1KJIA 2GR9A 3DTVB 3AR8A 3HGMA 3A7EA 3OT1A 4Y6QA 4CKEB 4ETWA 3G1UA 5BMVF 1ID1A 1CR4A 2D5LA 2RHJA 4F3YA 2QHXA 3UJ6A 2JFQA 3PDCA 4FX5A 4GZMA 4XPIB 3SLRA 5HFNA 3TXYA 4K6GA 5AICA 2GCNA 5H80A 1T9CA 2IZ7A 1TD9A 4OMDA 4IM7A 4MVXA 4OBXA 4JI6B 3ZWWA 2Y0EA 5A2QA 1G20E 1QANA 2AZDA 3PRKE 2WHXA 5GZ1A 2WJ6A 3AY0A 2I1VB 1LV7A 4ZV7A 3AF2A 3N2ZB 1JU3A 5JD3A 2PZ8A 2ZUBA 3DOUA 4HWRA 5G0VA 1WPXA 2OGSA 4P7BA 1EFPB 2WAYA 3AF0A 4HTFB 1NMSA 1TYEB 3AKDA 4GI2A 3WP0A 3EFBA 5JALA 2FZKA 2OBMA 5BW6B 4ZYWA 3TECE 1PZEA 1Z18A 3KZCA 1KOFA 2XCUA 2BFNA 3EVFA 5AI9A 2UUPA 3ESBA 3GBSA 1RSZA 3H9EO 3NPMA 3Q11A 4JLWA 4K9MA 4LYYA 1IULA 2OGUA 4HAUA 4PIMA 4BO8A 5DT2A 2CVHA 1R27A 3V4LA 4LBVA 3MGAA 4XH9B 3MJFA 2DF8A 2Y0BA 2RI6A 3P0IA 4YI3A 2OHFA 3QITA 1BOOA 5CA0B 2LR0A 4L02A 4Q9NA 2DUUA 1YB2A 2IXDA 3EULA 1P1BA 1PE0A 3DUWA 4FKZA 1PW7A 1Y0BA 1Y3FE 2WJIA 5CNIA 1G5FA 2X6QA 4ZEOA 3WADA 5TIIA 4AUMA 2K7FA 1PJ4A 2G1JA 4YFVA 4AK9A 1GVHA 2JGIA 1FYWA 2FA9A 1SXJA 4G85A 1Z16A 1CF9A 1KYVA 2W00A 1G2PA 3AKEA 3FYHA 1ZW6A 1IY0A 2ZJ0A 3CR8A 3QM1A 4D98A 2Y1WA 3MS4A 5D7BA 2WTAA 4B3XA 2LBPA 4L75A 4ZAZA 1M5RA 5AKYA 4JR0A 4RZ3A 2J32A 2WJGA 5KDDA 3FETA 5H4HA 3CMCO 1GLVA 1WZEA 4OM8A 3MTGA 2VYND 4M0EA 1RRGA 2AFVA 2QDXA 3ZEIA 4KFCA 2W6OA 5AVQA 2ODWA 2VDNB 2CXHA 5K4GA 3W2IA 5K3BA 2CWWA 3L4EA 4BWVA 5DASA 5JAOA 4B09A 3THYB 5ALFA 3LKBA 1IE3A 3K70C 3LPLA 4ZEXA 1MABB 3A6LA 2HBZA 1NZJA 2XJ9A 3G2QA 4WLUA 4RV9A 4YJDA 5TMBA 3T94A 2D3TA 1UMCA 5JZSA 3I5XA 5CLLA 1DJPA 4NU8X 2VR1A 4GOXA 3SR0A 1VLQA 4PTYA 2ZUUA 3ZE2B 4LBWA 2XNDA 4JU8A 3AY6A 4IMPA 2ZROA 3DGFC 3G2OA 1G5IA 1I2AA 2QX9A 1E9BA 2NWQA 3NIGB 1NXVA 2YW9A 4KAAA 1NIPA 4URZR 5ALNA 3W5IA 1T9HA 3RFUA 3ACBA 2IYEA 1KPGA 4CCSA 4L0MA 5DRTA 3VM6A 3PEWA 4LMRA 5CFQA 4LNHA 3ANLA 3WHPA 1OW3B 4M8KA 4I99A 4EY8A 2VNAA 3ZV4A 3RVBA 5DV9A 1SXPA 1IN1A 2FWRA 2RH4A 4RETA 1JHVA 3RASA 3TSCA 4EYOA 1AM4D 1JAYA 5K0GA 2DP4E 5JMPA 1CEXA 4M21A 3H0EA 1L5YA 2WWIA 5FOUA 2JJ1A 4W9NC 1C1XA 2P9GA 1M8PA 3HEBA 1D2GA 4NNOA 4WLFA 4P0PB 1DE0A 4QRIA 5KPJA 2ZI6A 4TM7A 3QMVA 1WETA 1R6UA 1D5WA 3WB0A 3DPIA 3ZH9B 2H1IA 4A2WA 5KOHA 3MJHA 3EIQA 1ZK4A 4IP0A 2VRWA 2GMWA 2XXJA 3TO5A 4TX1A 5DWDA 3ZW8A 4EJFA 4ER3A 5JNVA 3AJEA 3TZBA 3E9CA 3KV1A 5CAEB 1JKMA 3JR7A 1G3IA 4DZRA 2JVJA 2RGAA 3HLTA 3PUXA 4J2TA 4WZAB 1H1LA 1RTTA 3HCCA 2DHCA 1ETUA 4JFRA 4GLOA 1CF4A 1D7AA 2CUZA 2Q0HA 3KOZA 5JI3E 3K1AB 3UHJA 3SEFA 1K7EB 1UMBB 3A1UA 3QTLA 4M1KA 2ZUFA 1DXHA 1KJ9A 3GP3A 1DCFA 5JWHA 3S2FA 2PT9A 3QVKA 1U1FA 3WK9A 3LBYA 3EG5A 5J2UB 1U6KA 4C1NA 2W4IA 3HFJA 1S2LA 2MHCA 1TZBA 2QMEA 3D6VA 3BK1A 4LI0A 1GKYA 5KZMB 1JEYA 2QRQA 3A9SA 4JIGA 3RVDA 4KMOA 2G0TA 1DKNA 5BQ3A 4K9KA 1FBNA 5C32A 1QF9A 5E7QA 5LUAA 4YRRA 4QATA 1EP3B 5K3DA 3R3YA 4JV5B 4RY9A 2Y3IA 4EUEA 4CM5A 3ISTA 4CYMA 4D9EA 4YAFA 5AW3A 2ATXA 4DQKA 3G89A 2MSNA 2N75A 4U7PB 3KXKA 3MJTA 1GTVA 3NTVA 4QGGA 3WMXA 5SYAA 4AX4A 4KDRA 3VO9A 5LVAA 3HPRA 4L3OA 4XJXA 5LQUA 4NE2A 1FNMA 2O1SA 4YUVA 3SYKA 5CM2Z 4DR3B 4HWPA 2Q4OA 4UUQA 5F98A 3QVJA 3NR2A 1BJRE 1BMFD 4R6WA 2CD7A 1CP2A 1RRFA 5T8KC 3B9PA 3EGXA 1ADYA 1W1UA 3R7LA 1O87A 5LXTA 2EGGA 1ZS9A 2KI5A 2H0AA 1WR8A 3CNLA 1AU9A 3GA5A 3MVEA 3F46A 3QVGA 2WE7A 1MQ8B 1ZD8A 3TWOA 4F45A 2B82A 2CBZA 5IX8A 2ACWA 3G8AA 2NXNA 5KNDA 2PKYX 4QBTA 3OC0A 1JHPA 4I9GA 1TMYA 2X41A 2Z1DA 3OCZA 3PD1A 2W2OA 4P80A 1Z5NA 3FI9A 1SUEA 2VJLA 1E7RA 3JD4A 3B12A 4BNTA 3LA6A 3MJCA 2IYWA 3UT5A 1S2GA 1JYFA 5IK2D 4UXHA 4AP6A 4LXQA 1Y3HA 5CYGA 2HSWA 1USKA 1WMFA 3QHPA 3RFVA 4EL5A 5CXQA 1WXXA 2CLFB 1NYRA 2PZAA 3CZPA 3Q0IA 4HQKA 3U56A 1GP2A 2QY6A 3IA2A 5DMXA 5CJ2A 5B6IA 5FOQA 2FEWB 3DVRX 2YJ5A 3X44A 5HIIA 4ACBA 2BDEA 2VTBA 4U7WA 4R9SA 2FQ1A 5CVJA 2J08A 4DLUA 3DZHA 4LDNA 4YAUA 3HV0A 3AEKA 2DFTA 2E5FA 2ZRNA 4I19A 4QU5A 4KO4S 1JQAA 3VNVA 5JVDB 1SUWA 1R5NA 1M5TA 3BA6A 3QP9A 4URXR 1KRWA 4FX2A 3E9NA 3AJ8A 3D8RA 4MINA 5FUWA 1E32A 3C6MA 4HLQB 1DELA 1MQAA 1XZLA 2ZSFA 3KLBA 1XKLA 4GEKA 2IYYA 4TN5A 5IAEA 2HU5A 3VR4D 4JLNA 1VJ0A 2G1KA 2H1FA 1Y1TA 1JLLB 1MAWA 2DSTA 3AIKA 1SCIA 2V7VA 3FCYA 1MVNA 3INRA 4M0MA 2HU8A 4UBMA 1BW9B 1SD5A 3T6KA 1QP7A 1R4MB 2H92A 1VL8A 3I37X 2CL5A 4N8SA 3S1SA 1K8XB 4QOJA 3TVTA 4DYHA 4YXWD 4E2FA 2J9FA 2BLNA 2M1XA 2W6QA 5L3VA 1VXRA 4DKXA 1T0PA 2IVZA 2JHCA 2OFXA 4C0QC 2FPOA 4WESB 2IHVA 2P40A 1R9NA 3HHPA 4GPZA 3VHXB 3HXKA 5DTMA 3AP2A 3A6FA 3M4NA 5EXTA 5H3LA 1EJ2A 4YMSA 2QW1A 1EHCA 3LWZA 4ZIRA 3CA8A 2I6XA 2PXHA 4ARBA 3GAAA 5TPZA 1MB2A 2ZWPA 4YYEA 4EHAA 3F6YA 3OE7D 4BB5A 4UW9A 1GLGA 2WP0A 1PR1A 1U7HA 4G9EA 4XCQA 4QXOA 1HDXA 1N7IA 4I0WB 1M2OA 5FKJA 5K8TA 1UWLA 1W1IA 5CVDA 2YVAA 3JQCA 3V8RA 2YQ4A 3M6LA 4MR8B 3BJMA 4YJ2B 2QRPA 4DUZB 5A1JA 4BMPB 4EB0A 5GIOE 4DIOA 2GBGA 3LQFA 4H6WA 4IIDA 1TQ8A 4CIYA 1U7XA 1KMMA 3BIJA 4W5RA 5G53C 2ATCA 3IILA 4EAAA 3TDMA 5FXMA 1QS0B 3DT9A 1M75A 5GMOA 1W4RA 3RSOA 2UU9B 3ITNA 2GHRA 3P9XA 5TE9A 3DLPX 3I0NA 3TD6A 3EZFA 3T7DA 2ZW9A 1BS2A 1GCIA 1WXQA 3E7PA 4IUCS 4UUMA 5LA6F 3VBEA 1B74A 3D4BA 4HAXA 1QPGA 4BN4A 5SY6A 5ALPA 2OLJA 4X1IA 4UAJA 3IBYA 5IUNC 4ZCPA 3LKDA 2OKGA 3SDZA 2O2YA 3GDOA 5DX8A 2IY9A 4QTTB 4NDNE 1TCBA 1WCYA 2EZ9A 3BSYA 4RVFA 4ZOLF 2FN8A 2ZJYA 3OX4A 5TY0A 3WXBA 1TT5A 2AMLA 2R6AA 4KNWA 2B35A 1SB8A 4TKMA 3EA0A 5J47A 2AG0A 3HQ4O 5K0LA 2HOQA 1O95C 1A97A 3GRFA 5KQRA 1IEVA 4MGKR 4YRNA 1CUCA 3PL1A 4F85A 2V3VA 4BMVA 2UVDA 4KVAA 3V6LA 3NM4A 1QTQA 4S2EA 1JDSA 2XTJA 2R60A 2AI1A 3UOAB 4MJ7A 2DPYA 1X80A 4KQ9A 1BA3A 3NIWA 4CMBA 5CA1F 5CCXA 4DB4A 4BKUA 4NARA 1VB3A 1HLDA 1AN9A 2RFLA 2XVZA 3SDSA 4M1WA 1LDYA 3ZJUA 2VAPA 4NEQA 4C06A 3H1BA 3LCVB 1NBEA 4B7XA 3OX2A 2WTEA 4TXLA 4MWEA 2VEDA 1ZGCA 4WNAA 1GNRA 4WZZA 4X9XA 2GRJA 5TGTA 1PEDA 3E81A 3W7AA 1P19A 3EBOA 3N8HA 1MR3F 4AF6A 4BLUA 1OZFA 1SRQA 3ADDA 5CJPA 4MHTA 2YRXA 5HXAA 2X15A 2P6NA 3IFSA 4REMA 3QEBZ 1VCOA 1OAAA 3L4JA 3EYWA 3F6EX 4I55B 4EHFA 5JE8A 4F92B 2LRHA 1EGAA 5IP5A 1B76A 2XRZA 5EJMA 3NWOA 3VRHA 3NX4A 5EGSA 3IO5A 4N5DA 2EKDA 2ZJ2A 1SXHA 2IW1A 2GN6A 2OYCA 1RWOA 1QR2A 1JSLA 1RC8A 4WACA 3DLBA 4LDAA 4QE3A 3I1IA 5IN5A 1PT8A 3AUFA 4FDMA 4ND8A 5EP1A 1WY7A 3M1YA 1U81A 3SR3A 5I8PA 1B42A 3N0VA 3WQSB 4IKOA 5KC9A 1O0CA 1RYFA 4ZYYA 2GCGA 4UOEA 1U8FO 4Z9XA 2WA2A 5FBZA 4PG8A 4TL9A 2AXPA 1P2GA 3IKLA 4QLOA 3DP9A 1HH4A 3A27A 3LP6A 1AXGA 3OQVA 2BHLA 1IQ0A 4U5XA 4PZZA 5E8RA 1QDEA 2VZEA 1K2WA 1RMYA 2Q3BA 3EF3A 1W4CA 1WUJS 3LQYA 4CUJA 2Q2VA 2DH6A 4PRKA 4E1VA 4HVCA 4DS3A 2ZBFA 4LZPA 1IWOA 4BMDA 4K6CA 3HYLA 5B7QA 1I7QB 5A2GA 2FEPA 1IK6A 2D8AA 1E9CA 2XQJA 3A9UA 1XTQA 5SZHB 1NW7A 4BUJA 3ZV5A 5JS7A 3DVAA 1EVZA 2Z4SA 1BHQ1 4LYJA 4PIPA 1DQYA 2CZQA 2D5BA 2DFVA 2CZCA 3O2JA 3WYFA 5IMBA 4IDCA 5KTSA 3ZWKA 2VPYA 5ITZB 5LMUB 1GPYA 5K45A 3UJCA 1BTOA 1G3QA 5E3JA 1G1AA 1THMA 2VBFA 3WK6A 2C1ZA 4I4TA 5JNUA 5AXCA 4DSTA 1WDTA 1HF3A 1UAYA 1T8WA 2Q2OA 4RNDB 3KVYA 3LA8A 4DXDA 3PXAA 2XUPA 4AZTA 1W88A 3KUKA 2OPBA 4YAIA 1ZOLA 1F4PA 4MS3B 4UXJA 1SZCA 3LUCA 1QZXA 5BN5B 1DT5A 2IU6A 1DC6A 1RPNA 3KYDA 3K53A 4M9RA 1JR6A 1Z12A 5EIWA 3PV0A 4K2HA 5ALYA 5FO0A 2B4RO 1TU3A 1J97A 3QE4A 5JYBA 1I4WA 3FHCB 3LGSA 5D2CA 1VJTA 4CQMD 1KI2A 1AKEA 2ZYAA 4EQ6A 3VSAA 2ZTMA 2ZTUA 2R4QA 4M7WA 1K7SN 2VJQA 4PLFA 3STWA 4R68A 2QTGA 5A0VA 1O96B 3EN0A 3HL4A 1OLSB 1KTIA 2CJWA 2Z8YM 3K32A 3ZV7A 1SQFA 4NYIR 4RJTA 5ED4A 4C30A 2WSSD 3B13B 3IPYA 3KZOA 4CM4B 3NH6A 5JATA 2XVXA 4JR2A 3A26A 1JYEA 5G0WA 1IY1A 2OTCA 3NP9A 2VHZA 4Z7NB 4CF4A 3N2GA 3EPKA 2C96A 4V0OA 3ZWNA 3OQMA 1ZH4A 1E2LA 4M89A 4RMIA 1MTOA 1C7RA 2WSBA 2GAIA 2ZDHA 2NPOA 3EWIA 1XRPA 3LIIA 2W48A 1E1MA 3L0BA 4FT4A 3S7TA 1YS4A 4ME6A 4DGSA 4JLUA 1PAUA 3A8TA 1JQLB 4FFPA 4X61A 2OE2A 4ZQFA 3IXLA 3HRKA 3WHIA 1ZIDA 1HQYE 2HWXA 1SHTX 3TF5A 3OCVA 3MS7A 4FKBA 4ZOEA 3NJRA 5CYOA 1N0HA 4EFLA 4LRWA 3PKZA 2ZI3A 1E9VA 1XRMA 2XIQA 1AQYA 1OILA 3EQ2A 2OORA 2FEMA 2BLLA 2XA2A 4N9WA 4A8PA 2V5AA 1RZ3A 1IRXA 1N0UA 5T3YA 4R8SA 4NOLA 3LYLA 1XD2B 5KJFA 4F4IA 2DFNA 3BREA 2DM6A 3F8WA 3PC8C 1WZCA 2FSSA 2UYYA 3QY0A 4LDPA 4TL8A 2NZ2A 4ZVPA 1MC8A 1H1TA 4M8NE 4YP9A 4I46A 4OHWA 1FJ2A 2I4OA 2ZBDA 4G1UC 4Z9BA 3WO1A 1QHEA 3DMTA 4DM3A 5L3QA 2AOTA 3AETB 3R74A 2PGJA 2A3NA 1IEQA 1HQKA 1UBRS 1XVUA 2OXCA 4AJ1A 2AC4A 1NF8A 2J6CA 1ZG3A 2HMWA 2NXCA 2OL4A 1RXCA 3MT0A 4CI9A 1Y82A 2H4ZA 4X65B 3H19A 5F7XA 2PA0A 3A6PC 5DOVA 2IIVA 1L4KA 3INYA 3PIDA 5J2TF 5LMCA 3GFSA 4P3OA 3GARA 1AUVA 2R5NA 5I9LA 4DB2A 4EHLA 3D7LA 3KX2A 3TNJA 2PMEA 5A9RA 1HE8B 1X7WA 1MEJA 4BRZA 4A7PA 2O7SA 3GEMA 2A3RA 4PLHA 4QNNA 1P1JA 2Z0MA 4JJEA 3TOVA 3OEED 4IEEA 1OXUA 4IXMA 4JP5A 3V7YA 5CNKA 4XVUA 4YONB 3AVYA 1P0FA 1Q3KA 2P9ZA 1J25A 1VIAA 1YJBA 2X3YA 3FDIA 4MI9A 2FWNA 2IODA 4GPIB 4RGBA 2QRLA 5SY9A 3RUAA 3UJAA 2A33A 3QOWA 4HSGA 1CJCA 3X1ZA 2HHJA 3ROXA 4PYLA 3VPAA 4P3PA 1TUBB 4BP3A 4R1LA 1Z7EA 3AW8A 4TROA 4H18A 2CL0X 4R31A 2BEWA 5JASA 4EJMA 4M8IA 1FW6A 3IMCA 4G65A 3EK2A 3MF4A 4H17A 1MX5A 4YUWA 1AUPA 1LW6E 4L57A 4NBVA 1F3OA 4EI9A 1SUBA 1N2CA 3O94A 1KI6A 5C8YA 4CM9A 4F2GA 3BT7A 1Z36A 3NAQA 1P1KA 1P45A 4JXKA 3KQNA 4RKFA 3WVNA 3KP1A 2OZPA 2WD7A 1C1DA 1ZYUA 1D0IA 4F5ZA 4XQGA 4BQSA 4YJKA 5J59A 3NEJA 4HEA6 4WXMA 1ESEA 2YDYA 4DCSA 5K0TA 2XGSA 4W4TA 1MNQA 1VE1A 2PXAA 3C8ZA 3DQZA 5KVSA 3ODGA 5G4KB 2F1IA 2JJYA 1NPTO 3NCHA 3I4LA 4I36A 5EUBA 4C0AC 1I7SB 1FFAA 1M66A 1WW8A 3ITEA 4Q9HA 2BGUA 4F7DA 1D07A 2GBPA 4ZAWA 2Q0SA 5JSZA 2VAWA 3WYNA 3IVCA 3CCFA 2A5DA 4QX6A 3ENWA 3RYFA 4RF3A 4HAWA 3F6SA 3MK31 2IELA 5K3CA 3ST7A 4AECA 4C5BA 4YCSA 1QHHB 4ZAXA 3LVFO 3KM0A 2OHJA 2QR5A 3PPWA 3RS5A 3V2UA 1WABA 1QGDA 1H2FA 3AQ4A 4IVNA 4TTAA 4XYMA 4ZPXA 2C94A 2EZUA 1GNVA 1W35A 3VYSB 2EKBA 4P93A 1E3EA 5HIMA 2YXNA 3W4KA 3WG9A 3WKCA 3EXFB 4DCGA 4RJKA 1CEYA 3NWJA 3QU2A 5JSQA 5BWNA 4FFOA 3HV2A 2JGEA 3LCMA 3OM0A 1THZA 5J4KA 1CQZA 4JEMA 3OQOA 3O4VA 1JNXX 5A5DA 2QLLA 4D4JA 2BSXA 3HVKA 4NULA 5DLQC 1QVRA 2VWGA 1TCCA 1HTBA 3H3FA 1FFCA 1FOEB 5HIJA 3FH0A 1W49A 1EBBA 3QEKA 1KY5A 3A1WA 4HDSA 1ODFA 3U7QA 3ZU5A 2QN1A 3H84A 3LHKA 3SE0A 2JI4A 2G09A 2PWYA 1QE3A 3RADC 4OQMA 1IMJA 3SN6A 3G2HA 4B9AA 3TCXB 1EBFA 2AFHB 2GNAA 1Y8RA 5LBUA 4EEXA 2K87A 5BRJA 2REQB 1KPHA 1Y4UA 1XG5A 3OCYA 2N47A 2OGZA 4PFJA 3JRNA 2JZCA 3FHJA 5KHOC 2B4KA 4DDVA 5EXEA 1YBFA 2X8AA 4PYJA 1V4NA 2A9KA 2DPHA 3RIHA 1O6BA 4D02A 4WKNA 1N4DA 2PL5A 2A9PA 1CRQA 4LZAA 3EGDB 4E6PA 2BRUA 2HSGA 4B32A 3P2IA 3OSZA 4WLEA 1E3JA 3BE6A 4O6VA 4WZBB 2J5RA 2NGRA 4NTZA 3KFVA 5FTNA 5K3AA