4HNSA

Crystal structure of activated chey3 of vibrio cholerae
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
124
structure length
124
Chain Sequence
ANKNMKILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGDFDFVVTDWNMPGMQGIDLLKNIRADEELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLKEKLDKIFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CheY
publication title Conformational Barrier of CheY3 and Inability of CheY4 to Bind FliM Control the Flagellar Motor Action in Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Signaling protein
total genus 39
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hnsA00
1D1PA 3Q7TA 4MS3B 3TMYA 1F4VA 4KPYA 3HM9A 3N8IA 4RK0A 2GWRA 2RGYA 3LOPA 1Z13A 4ETMA 1USIA 4M88A 2JK1A 4QYWA 4O1HA 1MVOA 3I09A 1W25A 1YMUA 1DBQA 3BRSA 3K9CA 3HS3A 1JYEA 4WXEA 3CZCA 3HZHA 2HQBA 3T95A 1QP7A 2PUDA 1BVHA 4DN6A 2QXYA 2A9RA 4EVSA 1ABEA 1VPWA 3LUJA 1FSPA 2P4UA 1Z25A 3I42A 1YVUA 7ABPA 3QX9A 1S8NA 1LBHA 1DJMA 1DC7A 1NXSA 1DP4A 1PUXA 2FEPA 5KQPA 1DG9A 3BRQA 3CS3A 2Q5CA 2VUHB 3OLZA 5PNTA 4Q6WA 4KFCA 2PUBA 1RNLA 1ZHHA 2HPHA 1BAPA 1QP0A 4Q6BA 2H3HA 5JNUA 5JNSA 1I3CA 4MQEB 4UHJA 4B09A 3QX8A 4RK5A 5E3JA 5BQ3A 4P98A 4YLEA 4YWHA 2NZUG 3F6PA 1QO0A 4G86A 1ABFA 2W42A 2O20A 4OLAA 1TM2A 1JFTA 2WJWA 4RY0A 3TO5A 1F51E 3E3MA 2CHEA 4XAQA 3MYYA 4IMJB 2L2QA 5TQ0A 4HYEA 4UHKA 2QZJA 4XLTA 3HJFA 4F11A 1EAYA 1P2FA 4Z4GA 2NT4A 2HJ9A 3NHMA 5JNWA 1QQAA 4RK6A 5HQJA 3I45A 3OQOA 3IP5A 4DQDA 3H5VA 2PAFA 1NXVA 2WB4A 4RK7A 5IEJA 3EJWA 2JCGA 1ZH4A 4XFKA 3KYJB 3JVDA 3QLVC 1JDPA 2A9OA 5TQ2A 4G0XA 1XHFA 1PHRA 3EAFA 4N0PA 3SAJA 4H3HB 4NV3A 3M6MD 3GBPA 3N0WA 1JYFA 1TMYA 4D74A 4W5QA 2F8SA 5DTEA 3DGFC 4N47A 1Z16A 3C3WA 1GUBA 4YV7A 4KREA 3JTEA 5GOTA 3N0XA 4YR7A 3NNSA 1ZESA 1ZN2A 2IDMA 3H5IA 4JOQA 2JBAA 2JRLA 3CG4A 4LE0A 4HNQA 4KQ9A 1DCKA 1E2BA 4RY8A 1QNLA 3BREA 3CNBA 2FQYA 2IPLA 1LBIA 1GCAA 5B3JA 4MRMB 1QPZA 3DLBA 3RVJA 4QPJC 3OO1A 1E6MA 1OXBB 3NHZA 2L18A 3KKEA 5HM6A 3TD9A 1W9HA 2LP4Y 2WJAA 4H60A 4KVFA 3FFTA 3QEMA 4JA2A 4RKRA 1KRWA 4IILA 2JB9A 1RXIA 4ZMSA 2RJNA 1DRJA 3OQMA 3FFXA 1Z2EA 3HCWA 2QW1A 3KLNA 4MAAA 2IYNA 3LUGA 2NT3A 3A0UA 4MYRA 2QR3A 4RXUA 4KQCA 5TQ2B 1RZRA 2FW0A 1QP4A 3E61A 2L17A 5IX8A 2CD7A 3RVRA 3CHYA 2TMYA 4MGEA 3VNAA 4MS1A 5I4CA 3RVMA 2J48A 4DADA 2FMIA 4E7OA 4NCAA 5IULC 3KSMA 3JS5A 1EWVA 2ID7A 4F06A 3H5LA 4JASB 2JBAB 2VUIB 3M9XA 4TLMB 4EYKA 4FE7A 3C97A 4YRZA 1QQBA 4FE4A 3KCNA 4MR9A 2IOYA 3F6CA 3IPCA 4Z99A 2LPMA 3P9YA 5FBKA 2DRIA 1NXOA 2M98A 1ZAYA 3OO0A 3JPYA 3M9WA 3A10A 3R0JA 1JLKA 2X7XA 4XXHA 3RQIA 3HDVA 3A3KA 1FFGA 3QEMB 3TX6A 1EFAA 4LDAA 3RVPA 3OLXA 1ISRA 1NXXA 4NCBA 4KK3A 3OQNA 3HXMA 2MSWA 4Z4HA 3BILA 1U2PA 4W5TA 1QO0D 5CHYA 2PUFA 3B2NA 3KS9A 5JS2A 5JS1A 2MYUA 1ZY2A 3O1HB 3EODA 3C6QA 5DLEA 4ETIA 5T7BA 3G1WA 1E6LA 2YHBA 2E4WA 1U04A 3LFTA 5CNIA 4W5OA 5TQJA 4MS1B 3LUHA 5CNKA 1CEYA 2PL1A 3KTOA 5CNMA 1HEYA 3QLTA 4LZLA 4Z4IA 3H1EA 2OENG 1SXGA 1YS6A 4G0OA 5IC5A 4ZYLA 3LMKA 4LE2A 1TJYA 2JVKA 4MR9B 3H1GA 2QSJA 5C5EA 3JY6A 5T3YA 2IPMA 5ED4A 3LUDA 1BDIA 4PEVA 2KYRA 5KQGA 2R4QA 2V0NA 2PUGA 2PL9A 4Z4EA 1CHNA 2XDYA 3O2SB 5CNJA 5FWYA 3QELA 1PNTA 2WRZA 4RKQA 5KWSA 1FFWA 4KNYA 2GX6A 3N0RA 1MB3A 3CZ5A 3IPAA 3A0RB 2PUAA 1JFSA 2BGGA 4L4UA 1U8TA 3HEBA 3ILYA 3RVOA 1NXPA 4EGSA 3CLKA 2E4ZA 1JF8A 1M2EA 3GWGA 4RZSA 1C4WA 1ZGGA 1LJUA 2JVJA 3RH0A 4ETNA 4L85A 2GI4A 1U0SY 5GQSA 1Z17A 1ZDMA 2FEKA 3LUKA 3NNDA 3ROTA 4YS6A 3CFYA 2FSPA 3KJXA 2R47A 3FDFA 4YCSA 4OG2A 3RVSA 4E7PA 1SXHA 1BDJA 3KHTA 2ID9A 4KV7A 3C3KA 4Y9TA 2PJUA 1DCFA 3QLUC 4Z0NA 5BRJA 1DBPA 2QU7A 2PLNA 4EYGA 4WWHA 1JFVA 1SD5A 1RZRD 2FMFA 2CHFA 1PEAA 2FMKA 1DCMA 5TPWA 4YGXB 1AB6A 4RWEA 1ZVVA 4YO7A 3CU5A 3QEKA 3GA5A 4IMIB 2ZAYA 1JDNA 5FWYB 3QELB 2WWVD 4O1IA 1PEYA 4PYRA 5IUNC 5TQ0B 4D6XA 4FB4A 5KQMA 1CYEA 4ZPJA 3G85A 1B00A 5HKOA 1NY5A 3SG0A 5EWJA 3NBMA 1YK0A 4G97A 4Q7EA 3H6HA 3LUAA 2GKGA 4P1ZA 4HNRA 1YK1A 4N76A 4ML3A 3S99A 1SXIA 1MIHA 3D02A 1E6KA 2FVYA 2HQOA 2NZVG 1KGSA 2MSKA 4W5NA 1QKKA 2HQRA 2LBPA 3H5WA 1P8AA 3GL9A 3MIZA 4IRXA 3T38A 4S05A 4RU1A 1GLGA 3JVIA 3QK7A 1JHZA 4MR7A 3IP6A 4F8JA 4MS3A 1USKA 3I5AA 1K66A 3UUGA 2RJOA 3CG0A 3DBIA 3IDOA 3RVNA 4Z4FA 5IUJC 3HUUA 5TE9A 2VK2A 5IBQA 1KMIY 5TPWB 2FTKE 3QLVA 4ZJPA 4KMRA 2E4XA 4PE5B 5KC9A 2PUEA 3URMA 1ISSA 1YTUA 2AYXA 3NNNA 4G0YA 3HK2A 4IGAA 1APBA 2FN8A 2PE5A 1D5WA 3H5OA 2R25B 1NATA 2IPAB 1MAVA 2B4AA 5C5CA 3MF4A 5EWMA 3N75A 4OTZA 4XARA 5FBHA 1J56A 4EVRA 3HDGA 2FLWA 3KLOA 5KC8A 2WY2D 2FQXA 2A9QA 1A04A 2MYNA 2OQRA 3GYBA 4MS4A 1DBWA 1EHCA 8ABPA 2B1JA 3O2QB 1BA2A 3Q9SA 5D2CA 4ZMRA 3T6KA 4D6YA 4JP1A 3FGZA 1A2OA 2FLKA 4F12A 4S04A 5TPZA 4RK4A 3LUCA 1ZITA 2FQWA 2FMHA 4MR7B 3H1FA 1VRVA 1M5UA 5HSGA 3EGCA 3H5TA 3N6VA 1Y1LA 4IF4A 3O21A 4OLBA 4N41A 3CTPA 4JAVC 1JWLA 1PNRA 2E4VA 2ZWMA 3L6UA 4QYMA 4RV5A 2CWDA 2M1ZA 4KK4A 1OXKB 4TMYA 2H0AA 1RPJA 1JX6A 1RXEA 5DGCA 2NUBA 3C3MA 3IP9A 1FQWA 3O75A 3ROFA 3O74A 3MMNA 4WT7A 5IUKC 3T8YA 3HO1A 2PMCA 3HUTA 1SRRA 2E4YA 3OMWA 3LKBA 4WUTA 9ABPA 5DKFA 4G0QA 5B3JC 3MM4A 4MPTA 5EWMB 2MYPA 1L5ZA 4G0MA 3SM9A 4CBVA 1TLFA 4RXMA 4MLDA 4NICA 1JBEA 1URPA 1TVMA 3DLHA 3OM0A 4MS4B 1D1QA 3HV2A 1AB5A 1DC8A 2RDMA 2PUCA 4YP9A 4LRQA 3UK0A 5JNVA 2FN9A 3GT7A 2R48A 4WXMA 3UKJA 5BR1A 1VLZA 5EWLA 4MRMA 3O2JA 5KQLA 2I6FA 2MYTA 4H3KB 4PZ0A 5JNTA 1DRKA 3DZDA 4G0ZA 3SQNA 1WETA 1L5YA 3LTEA 1EWTA 1XHEA 3OM1A 5IEBA 4MQFA 1YS7A 4PICA 4EUKA 2E4UA 1M5TA 4GNRA 4KZKA 3RVLA 1U2QA 1Z2DA 3F7NA 5KI6A 4Z4CA 4MR8A 2IKSA 1ZH2A 1VKRA 3SY8A 1P6UA 3CRNA 3TB6A 3IP7A 1D4ZA 5BRAA 4KRFA 1EWKA 4EVQA 4WZZA 1Z12A 3D8UA 3EQZA 5F64A 5JNRA 3H75A 3K4HA 4Z9BA 4XASA 4N0QA 4EYOA 3VNBA 2FEWB 1YMVA 2N9UA 3BBLA 4G0PA 3SNKA 1A0OA 1IIBA 3GV0A 2HSGA 1ZGZA 4TN5A 2LIVA 4HNSA 1Z15A 3OLVA 2AYZA 1LK0A 3Q15C 1MB0A 2GBPA 3O1JC 4LE1A 4NQRA 3Q7SA 1LJLA 4GPAA 3KG2A 1BDHA 2QVCA 1GUDA 5EWLB 5FWXA 2QVGA 3DGEC 1QMPA 4MLCA 4RSMA 1D2AA 4RDCA 2JVIA 3MA0A 1NTRA 1M2FA 3HSYA 3JPWA 3MQ4A 1C0EA 4MQFB 1K68A 2F8TA 1GCGA 4QICA 3Q41A 3KYIB 1R8JA 4Z9AA 3OMXA 4MR8B 1DZ3A 4LX8A 2LUOA 5DCLA 4RS3A 6ABPA 4O5AA 4JB0A 3RVKA 1JH9A 3OLYA 3W9SA 3F73A 5TPZD 1YIOA 3ILHA 2FXIA 3EQ2A 4JB2A 1Z18A 3H6GA 3L49A 1FFSA 3LUFA 6CHYA 2VYCA 3OLWA 4LDZA 1T34A 3QLUA 1H9CA 3GBVA 1USGA 2FKAA 2IPNA 2MSLA 5EWJB 1Z26A 2P9HA 2A9PA 3Q7RA 1P6QA 3CKMA 2WMYA 3LKVA 1JL3A 3FFWA 4RK1A 2L19A 1NXWA 4RXTA 2PKXA 4OBBA 4MQEA 3EDCA 2QV0A 4N03A 4F3TA 3N53A 5FWXB 1KRXA 4OATA 3EULA 3GRCA 4EYQA 1NXTA 4W5RA 4RY9A 5ABPA 3RVQA 3FMVA 1UDRA 3HVRA 3O1IC 2YHAA 4TLLB 4EY3A 1XWWA
chains in the Genus database with same CATH superfamily
1OFHA 3TUIC 5HK9A 10MHA 3WKBA 2QRHA 1OBHA 4L8WB 3MOSA 4MS3B 3QEBZ 1YVPA 2IPXA 3OICA 1N3LA 2CNKA 2AK2A 3Q0TA 5E7QA 3CWCA 4O4HB 4CQLB 3LZCA 4MWSA 2UAGA 4B82A 1HNZB 1Q19A 2DQSA 3LX5A 1VYVA 4Y9SA 5FNVB 4RDXA 5KTYA 1JNYA 1V9LA 1BVHA 3HZHA 3T3IA 2I6SA 1I6LA 1MGPA 1XRSB 3I04A 4EVSA 5KCZA 2PXXA 5DXFA 3PEFA 3ZK9A 1CS0B 4EO4A 3PEYA 5JSYA 3RC3A 4WHMA 2O3UA 2P4UA 4N7JA 4ZYYA 3HJHA 1WG8A 2GERA 1GYRA 1GGKA 2GAIA 1DG9A 5FTMA 5F4ZA 1N3BA 3IDAA 4FEEA 2JLWA 1XRQA 1NW9B 2H2DA 2QMQA 2IIPA 2YWJA 4BLRA 1AZSC 1GGVA 1NV9A 2ALJA 4R98A 1XZAA 4B6SA 3C7DB 2NTYC 4MW5A 1E5VA 2XMZA 4UAVA 3C3EA 4DRXB 5J59A 2B4RO 2NXJA 3CMCO 4XJVA 3ROZA 4GWGA 5K3OA 3AF4A 4G86A 3ZJ5A 2NOAA 3MXTA 2PRZA 4Z51A 1B0PA 2FFHA 1JFTA 1NKSA 5D1HA 3VOBA 3U4CA 3I83A 4LOLA 4XAQA 1T10A 5AVJA 4DMLA 2CBXA 1I4TD 3KQKA 1U2GA 4K26A 4LRXA 4I4TB 3AJRA 4MVCA 4LVCA 2ZVQX 2W8BA 3B6ZA 5C1BA 2Y1LA 1W47A 2VL7A 3W9YA 1AHPA 1G8KA 2QL6A 2NT4A 4H7IA 2GF9A 3NHMA 2WWWA 3HGMA 4GMKA 3HXPA 5CFZA 1WY5A 2H7VA 2Q8QA 3IIKA 3DLAA 2PMBA 4RJTA 5JH7F 1VKOA 1JQAA 4C4PA 1JEQA 5DPMA 1WLSA 3COVA 2PBFA 4TXJA 3OY7A 2A33A 3HYTA 3EFBA 2OLJA 5AKIA 3SAJA 1N25A 2NXEA 5JNLA 4FCTA 1UFKA 4BWVA 1E2LA 3AXTA 1EG2A 1D2NA 3DGFC 1PRYA 3UB4A 4LHSA 3P9RA 2GGSA 5H3LA 1F8GA 1FRQA 2FHSA 4IRUB 3BXGA 4Q16A 4PNZA 4UUNA 4M87A 2UVDA 4LHXA 3VR3A 1TGYA 4JX8A 4UEOA 2XUKA 3BD6A 3M6UA 4J0FA 3BXHA 4I9FA 5EKUA 4ZZIA 1Y5LA 2QAGB 3AXSA 2LGJA 2P0AA 5CK5A 1QYVA 4EITA 4Z3OA 4HDAA 4PLFA 4QPDA 4WW0A 5JVDA 2P2SA 2O8VA 2IPLA 3LBHA 1PF7E 2OORC 5B3JA 4D3YA 1ZSVA 2F55A 2QM7A 3DMTA 1PK9A 4QPJC 4G1EB 3RVJA 1DC6A 4EHAA 1H2XA 3QF7A 3WLEA 4FUQA 1C8LA 1H6AA 2JK0A 2LP4Y 4OUDB 1NP3A 1A5BB 1NQXA 4F6RB 9LDBA 1YRYE 1MOQA 1IXZA 4O3MA 2VNSA 2QV7A 3IP1A 2PEYA 1QTRA 3FFXA 4Y0AA 4HJRA 2FWNA 2FP4A 2WW8A 2G6BA 3M4NA 4JP8A 5EL0A 4AROA 1KO1A 6REQA 2IYNA 1S4QA 1Y3DE 3FPFA 1RZRA 4PHCA 2BFEB 4R1TA 3ZDDA 4NC9A 3M2PA 4U2GA 1QIMA 1WVIA 1L7QA 1OT3A 2CD7A 3PQ6A 2UZ1A 3CHYA 1J90A 3E1SA 5B3KA 3P2EA 2IZ6A 4HDRA 5FB3A 3C8HA 3TINA 3N8GA 3HHEA 4M86A 2O5VA 3TW8B 3VC2A 1JQ5A 3I4LA 2OCKA 4RVOA 4TS9A 5LB2A 3S4YA 2VUIB 1YBHA 4CFYA 2EARA 4Y7DA 4G4SO 4FCCA 1A9QA 2X23A 3MJCA 3ANXA 2RAPA 3OIVA 4KXXA 4CCSA 5ITZB 5E6UB 3UPUA 2BHTA 2O3RA 4ZVKA 4GH5A 2FI1A 2J9FB 3VPBA 3K9LA 4P33A 5FBKA 1RRMA 4QUKA 3GFRA 4D96A 2QAGC 2VJLA 3IBTA 3HNRA 2I1LA 2NO5A 4YJFB 2GNAA 1Q6YA 4IUBS 4YT4A 1FFGA 4MI6A 4PR0A 1G291 1LQTA 1LA2A 4HGYA 5EJMA 3M3DA 2H4FA 2YMQA 4LJ7A 4O4JB 2QD2A 2QG4A 4NP6A 4OKNA 3I32A 5AIAA 3HKDA 1NXXA 1AQNA 4NCBA 1NJSA 2GNOA 4UFPA 2JHPA 4Z0PA 3IELA 4Z4HA 2QX4A 1TPYA 3BILA 2BI8A 2NUPA 3UF0A 1ORRA 3EGIA 1JH8A 5C53B 1N8NA 5JT1A 1HE5A 1UQUA 3GUZA 4AY5A 4B3SB 1OXSC 4JA0A 2DBVO 3MT9A 1KI2A 2BFCB 1L7DA 3OAAD 5I7OA 2V59A 2DQKA 2ZJ8A 3SSAA 1RI3A 1CG6A 3AR3A 3L7OA 3ADKA 1L5GB 3FPGA 5CR9A 1LU9A 4C4OA 4KXYA 2AN9A 1J2UA 4V2IA 3VJLA 4JJ4A 4DBVO 5BQOA 3QQPA 2A5FA 2EP7A 1R00A 2RKWA 2Q50A 4EJMA 1GR0A 2DQ4A 3KIPA 5H83A 1JV2B 3D64A 2C31A 3FJ1A 3I2HA 2JVKA 1H4VB 5C3MA 1GQOA 3R4CA 4B34A 5JQGF 2BE9A 3GPBA 2O8FB 1JIQA 3GY0A 1POXA 3ETHA 3EIQA 3HMQA 1M8JA 1TF7A 3IHTA 1JDUA 2V7TA 4WGGA 3RVDA 1T2CA 2ZREA 4OHZA 4GICA 2VRWA 3AFHA 4K2HA 3VR4D 4H4DA 4GECA 1CHNA 1VL6A 4MWTA 3NAGA 4OQZA 3R44A 1A8UA 1T43A 2I62A 4OK3A 4QTTB 5KWSA 1FSSA 3RRBA 3ED1A 1RWMA 2Z4TA 5IM5A 1YA6A 2I4MA 4DSOA 3TGLA 5CEEA 4HWOA 3SR4A 3T4EA 4YYZA 1NURA 2R1ZA 3V4ZA 1DKLA 3IBFA 4IKEA 5LZ9A 4B75A 2YHSA 4RZSA 4D8TA 2X5NA 1BX0A 3A31A 1SG0A 3E18A 3I2KA 4Q48A 2G17A 4DIBA 2OZVA 2PZBA 1PV2A 1RZ3A 3GUUA 4YCAA 1OYVA 5LU8A 1XJWA 1OFUA 2Q7XA 1WUIS 4EY7A 2A1TR 2KM1A 2H5JA 4AJKA 4EEXA 5CMLA 5LYJF 4V1CB 1XP8A 2X1HA 3BMCA 3DEZA 1IY8A 3DAPA 4MA5A 2WIAA 5FYDA 5LUBA 3KHTA 3GMIA 4NFHA 1L8AA 3HCBA 4TVBA 4RQBA 1MA0A 4EFDA 2ET6A 5ALHA 5JJ5A 4IH9A 1GKYA 4LSWA 3OWHA 3ACCA 3BXEA 1RM5A 2IELA 1RLOA 4C4SA 2A1IA 1BHQ1 1J8QA 2J0UA 3TPCA 3GA0A 5LQMA 3D6AA 3WBKA 3FDZB 1C5KA 4HFRA 2JLSA 1VE9A 1X8JA 1TU4A 2XOKA 1SKAA 2EGHA 3KQVA 4UOZA 1FRZA 1ZUNA 3CX6A 5FWYB 4AZ0B 5DN9A 2W70A 1E99A 3TSCA 4ZYVA 4D6XA 2FDRA 5HUQA 3BHMA 3ZEIA 4V0QA 4M60A 2C9DA 5EJ5A 3BF8A 3OUZA 1QC5B 3I4CA 3NAQA 2MR6A 4A6EA 5SZHB 3ZWKA 5HKOA 1X7XB 3V7FA 4LV5B 4MAFA 1UFRA 3FTDA 5FL7A 2CY0A 2FY8A 2EJVA 2GM9A 3D54D 3Q2IA 4AJEA 3DP7A 2DFVA 4P1ZA 1D2MA 3LHSA 2QRPA 1UPAA 1L4FA 1M8PA 2HMAA 2FA9A 3UWPA 3B48A 4G37A 1PQPA 1RWXA 3UA3A 3V8EA 5A4KA 1S9HA 5C4MA 1Q0LA 2AJLI 3VNRA 1P0FA 4YRCA 5FA5A 2WD9A 3NWPA 3M8KA 1LPMA 1DAHA 2GZDA 4CWAA 3MEQA 1GLGA 4FFMA 2HZ7A 1XKQA 1TTTA 3QK7A 4I36A 4EIWA 1JHZA 1HH4A 4WKPA 3E0QA 3JAKA 3REOA 3JQ7A 4MS3A 4DS3A 2WIFA 3M82A 4IV8A 1V16B 3GLVA 3GAAA 3IDOA 3WDLA 5K8VA 1DVRA 1XTBA 2YIDA 1W4RA 5FH9A 1Z8NA 1WF3A 5HQTA 2IY9A 4DV2B 5B1HA 5DSZA 5LFAA 1PWYE 3C1OA 1IYZA 2R6DA 2WPNA 3C85A 4CFZA 2X3UA 1WV0A 4DGQA 3VYRB 1VSVA 4FYIA 3F8SA 1E4EB 1XVLA 4ZAZA 1J9GA 3MF4A 3RUIA 4DNOA 1X70A 4G8JA 1XCLA 2MTBA 2PZAA 2AUTA 5B12A 3W5DA 4Z3DA 3B2QA 2FLWA 1S6YA 2ZJFA 3AVWA 4ZT4A 2QTZA 5D1NA 4AF6A 3PEVA 2A9QA 3MN1A 3VVBA 3BH0A 4R0NA 1CY0A 5M34A 1VRCA 1AO0A 3ZJTA 1XLVA 2XB2A 1YJXA 1C9JA 3K72B 1H2RS 2OFWA 2OORA 3HA5A 3BPSA 4N1AA 5HCNA 3UOWA 1Z82A 2WTEA 2J5QA 1M67A 3M70A 2VBGA 5ES4B 4J3FA 4TWBA 4X94A 1RYDA 1ZMOA 5K0JA 3TMKA 4QARA 1ZITA 2H1IA 2Z3VA 1AZLA 1R5BA 4NRDA 1J1UA 1UJNA 2WMDA 2A9VA 1OI7A 4BGIA 1FMLA 2WEKA 1JU4A 4I4TA 2AWNA 2IYOA 1PEDA 4BVHA 1ZNQO 1CCWA 2XQKA 1QX4A 4HN4B 1F8UA 1ADGA 5AVTA 2QTRA 5JATA 2DT5A 3SDZA 1X80A 1NSFA 2PZKA 3AUSA 2XCSB 2WQ6A 4XD2A 4G63A 4IHJA 5CB6A 4JC4A 1DEHA 1ZCZA 2B8JA 2Y9MB 3TLGA 4CMBA 3B53X 3G23A 1K4YA 1UUFA 2OZLB 5DNWA 3OZXA 3RANA 3GNQA 3P9NA 4WFQA 3W3AH 2I2AA 3W0LB 5FA8A 2D54A 5DISB 4IYJA 2Z83A 3KAPA 3UCFA 4ENTA 2H1OA 1FTWA 2H11A 4P35A 5G0UA 4Q37A 3WX0A 3RJ5A 1CQXA 2BONA 3IV7A 4HP8A 3GLHE 1BU8A 4FOOA 4NICA 1I0ZA 4WFIA 4ID9A 3QXHA 1W5BA 1A2QA 3GMTA 3STYA 4AZSA 2WJPA 2IYAA 4I4CA 3DBLA 1Y8ZA 2HGSA 4DWOA 5CB4B 2GA8A 3DF7A 1J7JA 1SC3A 2RDMA 3WFZA 2Y71A 3O38A 5HG0A 5AKYA 1P2GA 3P27A 3AC0A 1R6AA 3ETEA 2CXHA 1RQNA 1C1YA 2Q4OA 3MS7A 3O2JA 3B13B 4QQRA 1Y6RA 4BLQA 3FCXA 2QRZA 1DKMA 3JCZA 5BRNA 1DIBA 4G0ZA 3W2TA 4NZ9A 5LM3A 5EIEA 3M6AA 1G5IA 2PQ6A 4DB2A 6Q21A 3PSAA 4ZVQA 5L3VA 5AI8A 1T5TA 2VH2A 1H85A 5K0TA 5LLDA 3QVJA 1UP4A 2FYTA 5I9BA 4KWHA 1ZC4A 1ZN8A 2OESA 4C0QC 4MR8A 3L0BA 4ENRA 3TLXA 2QGFA 2P6RA 4Q01A 3PZBA 1P0MA 1QR2A 3HDJA 4GQBA 3OOJA 2OV8A 5F7JA 4F56A 2C96A 4UATA 4X7RA 4B8YA 5C4IA 4TT3D 3C6ZA 3LW8A 3SM3A 1GU0A 3T61A 1V0JA 3LL4A 4Y6SA 2Z4RA 4QOIA 5L3SA 1ADCA 2QMEA 3AM4A 1P3JA 2ZDGA 3NC4A 2W0SA 4M8KA 2RGXA 4TXNA 1IU9A 2CLSA 2XKBA 2YDYA 1WXQA 1ZRNA 4OIFA 3CUUA 5DLPA 3BMNB 3N5KA 1K8ZB 1O58A 2DWQA 2WD7B 3OHMA 1GPWB 3R3JA 1V3QE 3SSMA 1PKEA 1KOFA 3QBVA 3TXXA 3WK5A 1U4SA 4UQOA 3VU8A 4WLFA 2FR8C 2VUSA 5IJXA 1W4LA 1KFEB 2Q4TA 3TRDA 5C7OO 2CB9A 1AGXA 5TMEA 3CA8A 3ND8A 1U94A 3QVGB 4RDCA 2ILVA 1IQ0A 1NLUA 4U1RA 2BLLA 4PO9A 3OJEA 3SFZA 5T6BA 2WYWA 4BBJA 1O5IA 3IGFA 2V1UA 3UY4A 1EVIA 2HUPA 1I7DA 2QW8A 1VLMA 2R6JA 4FSHA 1BYUA 4CR7A 4X63A 2ZI7A 3GW8A 3VX4A 3AI7A 3BQNB 2YW2A 2E55A 3SHTA 4PRZA 4CQMD 2P0EA 3UCXA 3MVEA 3P0IA 3I5MA 5DHUA 2D1RA 3ESRA 3U4QA 5P21A 1C1XA 2HIMA 1GNLA 3H6GA 3R3SA 4JQCA 1FFSA 5F7ZA 5GGYA 2AD1A 4H31A 5DTJA 5LMUB 3OLWA 1BXKA 1I2ZA 4JBHA 1Q1BA 4P32A 4X45A 5B2ZA 4MVJD 2WF5A 2H1LA 4C0JA 1MPXA 2D0OB 2Y66A 2NVBA 5KTRA 3KVNA 4JOSA 2QTCA 4GI2A 3KK0A 5B57C 3H6KA 1XTPA 4UTPA 4ZHSA 1NXWA 2JGJA 4J0JA 2OCBA 1JE1A 1C9KA 3BB1A 3G3EA 1A9YA 4GC5A 4J49A 8MHTA 4Y6GB 2FWMX 1KO8A 4JJFA 1HE3A 4YFYA 1THGA 5IFLA 2RGEA 3LUPA 4LAFA 3BX1A 5KTTA 1C0IA 4QRHA 5CX4A 3EX7C 1XWWA 1XYVA 4XGQA 1PGJA 4XVRA 1JAHA 3PA6A 5EJ9A 3ST7A 4AI6A 1ML4A 1IQRA 3P2YA 1XRNA 4DQ0A 2J30A 3HDTA 1LV7A 4WJLA 1R3DA 1QO7A 3TI9A 4BO5A 1FNCA 1WKCA 1X1QA 2CMGA 3DHNA 3AV0B 3DBHB 4HAWA 4RTPA 1JI0A 2ENWA 3I01M 4WXEA 4PQYA 2VC2B 3D3QA 2IYEA 2Z56A 2ZWAA 4UKDA 1VBKA 5TX7A 2A9RA 5K3CA 2X40A 5ALRA 2OSVA 2G9VA 5JMWA 4WOBA 4RD0A 1VRWA 3N6XA 3I2GA 3NRBA 3N0TA 4ASUA 2HMWA 2I78A 1XVAA 1W93A 1YVUA 5K3AA 4HT3B 4RAQA 5J47A 1DP4A 3K0HA 1N0WA 3KOWA 5BVGA 4B5LA 1P3DA 4MLPA 5LPNA 1YU9A 3T0GA 4BGEA 1PS0A 4UQLA 2PUBA 1JLMA 1EFDN 1ZGAA 3FR8A 4F4FA 3WJ7A 1VDZA 4R1NA 4ER3A 6NULA 2DUJA 2RHOA 2G1UA 3NP7A 2OYCA 3WNZA 3MZ0A 1KETA 5KYXA 2ZVJA 5D3QA 4LI0A 2HEIA 2NZUG 4OLBA 2I3BA 4EHHA 1JB1A 3IUPA 1XCJA 4H59A 3MSCA 4DHEA 3LOQA 4EEKA 2O3QA 2JPDA 3GUYA 3I9OA 1U2EA 2E4AA 2BMEA 3PGXA 3CVVA 1KR2A 2EFDB 4MB2A 3J80A 5M2QA 3NONA 1YOVB 3PDUA 3IQXA 3T1NA 4OB6A 3SJAA 3IEMA 3KQUA 1JWBB 4F11A 2ZU6A 1IONA 1NN1A 4W4TA 3BIFA 2HJ9A 3C70A 3ZZ1A 1BXRB 4DXDA 4LZJA 2X0EA 4BB0A 1U0GA 1IRIA 2FWBA 4KXFB 2WUGA 2BH2A 1SZDA 5I9TA 5G1NA 5BYAA 2E5FA 1NW4A 1ONBA 1XEFA 4OU5A 1OLXB 4GYJA 4K9MA 5JDCC 3MBIA 1T25A 1RADA 3R7LA 2V3WA 3E9CA 4WERA 4XWTA 1T4DA 2GK3A 3T9EA 3TRIA 5EZSA 3DDHA 4DV6B 1Q1ZA 2ZJOA 2FGJA 3G2HA 4BFZA 1Z22A 5BSGA 4R3NA 2QTBA 1JYFA 1J2YA 5ALYA 1D0IA 1UBNA 4EMBA 3DFIA 2PUVA 3S1AB 3UWMA 4RLHA 1TAGA 1NSYA 3DE7X 3OPYI 4AC9A 2I8AA 2QUIA 4KXNA 2Q1XA 1IK4A 5CXSA 1BROA 2Z8XA 4BIMA 3EWNA 2JRLA 4NBLA 2XMCA 4E33A 1TCUA 2G9UA 1Z35A 2A5YB 4CL0A 2ZAIA 4DJEC 1JW9B 3L1JA 3ET5A 4W6ZA 1OX4A 5CTAA 1TUGA 4TROA 4X41A 2JAQA 1OXVA 3LDUA 5EJFA 3TKAA 3W7AA 1QPZA 5F9MA 4ZO9A 1YVEI 1WPXA 3VOTA 2FPSA 2HMUA 3TKLA 3LVRE 3PD0A 2HV8A 3RRFA 5IVDA 5L3QB 3MW8A 1E79A 1E5LA 3P8ZA 1EINA 1R88A 5KSPA 5C8YB 4EKNB 4KDFA 2BSQA 3KYDB 1I2CA 1XZPA 3E5MA 4CU2A 3KOYA 3KLNA 5C81A 4MB0A 5DHFA 1BVYF 4V3BA 4ZAFA 1F06A 4OB7A 3LUGA 4KZPA 4LOJA 2K7ZA 3FWHA 2XJ9A 3NGLA 4RXUA 4Y7CA 2TMKA 3FB1A 3ZZ0A 1XA4A 4BRSA 4CHGA 2VP9A 4CT0A 4D9GA 3QTTA 5F9FA 3NXKA 1EJ0A 1F4LA 4O0MA 3U3OA 3CNHA 4YX9A 4E09A 1CX9B 2HI0A 2HO4A 3LBFA 1IK6A 1N2SA 5IULC 4G5QA 3LBAA 2ZUDA 3GC6A 3IIIA 1T3HA 2G1KA 1G18A 1IZYA 2VAWA 2WHPB 3O4JA 4FE7A 4IXNA 4K0KB 1KP9A 2C98A 3BJRA 4R2HA 2HCTA 1TCAA 1THMA 2QTVB 4FFLA 4PRYA 3MINA 1KA9H 4QNRA 1NBMD 1FUUA 4LA4A 2M98A 1PT8A 3EQ8A 3H1TA 3ZKAA 5E1DA 2OCGA 3ORHA 2OZLA 3PHBE 4FD3A 4IMPA 4L6IA 5A5FA 4MQ4A 1JEEA 1V11B 2J3QA 3LXXA 5IN4A 2B2CA 4BX9A 1LDMA 1G98A 2JATA 5JWRA 3A1CA 4JLUA 1HV8A 2CCKA 4FQ7A 4ARVA 3G7UA 3PRKE 3D4OA 2YXPX 3IT1A 5EXDA 4D42A 4JVSB 4A2CA 2PLAA 2ZIXA 1DDGA 3H2HA 5GOZA 1MAWA 4MV4A 2FR8A 2IZ0A 2NNWB 3EODA 3N8NA 4KVGA 3V8MA 1NW3A 3ZGOA 1CP3A 2VWHA 4RM3A 5J4YA 2J59A 2AW3A 2CV1A 1U04A 3HNPA 5EYPA 1IDOA 5DIZA 4Z9XA 4I66A 1WVGA 3ANLA 3RFUA 4AURA 5BVHA 2ZK7A 2BR4A 3QLTA 2FG7C 5A3JA 1SC6A 4QFDA 2RE8A 3AVPA 1M1YB 5K3FB 3LC7O 4IIJB 4TL9A 3ECSA 3GJ0A 5HRCA 5JADA 2CZCA 5JO0A 4XIJA 1BWSA 4CF7A 2DYKA 2DQYA 2G9QA 4JENA 5GIPE 3OA2A 1YJ5A 1L8OA 3G2MA 1A4UA 4AY4A 3T3HA 2WG2A 2BFPA 5KNCA 4DFDA 3H65A 5I4BA 3QPBA 3ZWWA 2KYRA 3KKMA 4UTVA 3RFXA 2CJFA 4D80A 1NASA 2UYHA 2JJ2A 3GJ4A 2HNKA 1RHUA 4RL4A 1HORA 1YCHA 2XDYA 4I1OA 4FX2A 2ZIGA 4B3TB 1C80A 3I5YA 4GYYA 4RKQA 3O8QA 1CVRA 2H54A 3AOGA 4W9NC 2C3OA 4EI2A 3QP9A 2REBA 3E70C 4QJ5A 4R4JA 5JZBA 1EQ2A 5AW3A 1X7WA 2BUBA 3RVOA 1SU8A 1NXPA 3V2UA 1N32B 3FNGA 2DFDA 2E4ZA 5E2IA 2ZWPA 1BYIA 3AHGA 4ZT7A 4OU4A 2GD6A 3DEIA 3SK0A 1MXFA 1E5XA 2AKYA 3RH0A 2VP2A 2D8AA 3BMNA 1JDJA 4UU0A 5KDDA 2GXSA 2JZCA 5KTSA 1RPZA 3CKYA 1UEXC 4TLDA 4U3JA 3U60B 1Z68A 3AFIA 1T1JA 4XSGA 4H0NA 1X8KA 1F2UA 1J8VA 2A9JA 2B25A 4LHWA 1DKOA 5DHAA 3VYTB 3TNLA 1N8KA 4DCUA 3ORFA 2AGVA 3MMXA 3IX7A 1WXEA 2D1TA 5ARBA 1N36B 4IDPA 3BG5A 4EJSB 4ZIRA 3FTNA 1L5OA 2QSUA 3EIUA 3QH4A 1E9VA 2YZKA 1FJXA 2QU7A 1A4RA 1C7QA 1Y4AE 2XNDD 4WWHA 5CG2A 3N6RA 3NEPX 2HADA 2HLNA 3FOEC 3EVZA 4Z1MA 3RYTC 1H1LB 3PYLA 4QDTA 3O5AA 3MT8A 1E66A 5F5XA 1H05A 3KP1A 1P75A 1XAHA 4ZEMA 3FNRA 5D3KA 3BYZA 3D5EA 4H7FA 5TT0A 4MYDA 4NY1A 3CUVA 4BTEA 4FB4A 4Y9DA 2OWEA 2BTEA 4KXQA 5JARA 1LTHR 1YV9A 5K20A 3OZFA 1B00A 3HCNA 2MSCB 1U2RA 1DL5A 1ISPA 2AYYA 2NX2A 3QG1A 4MULA 3IVGA 1E4VA 1QQ7A 3P2MA 4EFKA 3V7WA 1Q17A 1G5HA 1KY2A 1O4VA 3JASA 3S7ZA 1XTQA 2PSEA 3N39C 1VA4A 2ZB2A 1AKMA 1CZNA 4Y2TA 3E05A 3B6KA 4ISBA 1G7TA 3UAVA 4XD7A 4NOMA 1YJAA 3ZYZA 1A5SB 1CQJB 2NQTA 1CC1S 3PP8A 2BHRA 1XPOA 1KGSA 2FV8A 3T3PB 3Q88A 1W85B 1WU8A 4YXFA 2OXEA 3U7JA 3SCZA 4BYGA 2IH4A 3T38A 1YRWA 4JGBA 2IXEA 3AB7A 3IA7A 1J6UA 1XB2A 3LXRA 4WECA 4P93A 4IDGA 3IUSA 2HBYA 3KB6A 1KYYA 2QAIA 4IDDA 4I5EA 5DCUA 1MB4A 5CCEA 4YMSA 3W8FA 2X3FA 5EJ4A 3T1HB 4Z4FA 3FNEA 3EASA 3IJ5A 2SKDA 5JDCA 2EKLA 3PHIA 2AQKA 4PHGA 2LV8A 5IT5A 1LVUA 4GM0A 1TJ4A 5L9AA 3GVIA 2YQZA 1ZUHA 3BSSA 3QMPA 1U0NA 4HLUC 3JARB 3ZI0A 4F4CA 1U7HA 3QU4A 1SBZA 1KU0A 4YMWA 1H8ED 1U7OA 2CXPA 3IQHX 3OOHA 4M1KA 2IZ1A 1RE1A 4Q4HB 4TVOA 3KQLA 3LXMA 3OQVA 3OJWA 3IOYA 3QM1A 1R64A 2JD0A 3PUXA 1PL7A 1PGNA 2EKZA 4J4HA 4C01A 1GA1A 4NNPA 1OBFO 1T6NA 3MB5A 5EESA 1P5FA 4G56A 1KJ9A 4LMRA 3T06B 3P2OA 4I6GA 3CH4B 4ZOLB 4BBAA 1T5SA 2D4HA 3PI7A 4MKZA 1EHCA 1NNSA 3O2QB 4WFJA 3RS3A 5L40A 4P58A 4MUEA 1PO7A 1WIWA 1BEUB 2R79A 3DT6A 4I99A 4AKIA 2FLKA 3GCXA 3I1JA 3RHSA 4B3MB 5CPFA 1PJQA 4CMAA 3LUCA 1J09A 3GAMA 3PXCX 1G66A 1UJMA 1KS2A 4FMDF 2BSAA 4W7SA 5AHRA 4AKGA 5BN3B 4UHBA 2AQIA 3EGCA 5CM8B 2G1PA 3FSGD 4UD6A 3UJPA 4AN0A 1PNRA 4Y18A 2ZWMA 4QYMA 2AS0A 1GRQA 4XPZA 3HQ4O 2CWDA 3C24A 4KK4A 2EX1A 1BXRA 3FPSA 1JX6A 4X1YA 5KOHA 5FBVB 3AGQA 4ZDKA 1ZD2P 4II7A 3GN2A 3KAJA 5ELLA 1C7IA 2Y2UA 3HUTA 3OSZA 2WG0A 2A9FA 5EN4A 2WD8A 3RI3A 3VVCA 4Y3UA 3E2PA 4C4YA 4EI7A 4ZWNA 3U7FB 2ZUVA 1VYHA 3W79A 1IUKA 2B94A 1K7FB 3GEHA 1TLFA 3BFVA 4JXJA 4WASA 1YMQA 1CRQA 3AB3A 1T2EA 3WHLA 2ZU0C 4BLOA 4GVXA 3W2HA 3OM0A 3VJKA 2IBMA 5GP1A 3VTZA 1CJVC 1NZDA 2EKBA 2O0MA 1R4ZA 2WJJA 1DG1G 1G63A 3E84A 3PR1A 3AKYA 3R7BA 3V34A 1JXQA 2B5WA 2O5RA 3E22A 5KYWA 5MN6A 1NQ5A 3A4NA 1IXKA 2GYVA 3LBNA 2Z1DA 4M0FA 1ZK2A 2I4NA 4NK5A 4WBSA 3DTVA 5CGZA 4YRFA 1Q3TA 1SVWA 1NRIA 2C61A 1FLVA 2CJYA 1JEJA 4HAVA 4RCZA 2EF1A 1K3TA 2OCXA 2ZATA 4E5DA 3KAKA 2FSGA 3PDHA 1Z4NA 3UFBA 2I2DA 5HF5A 1ZR2A 4LHYA 1LW7A 2OV6A 1ZBQA 4YK7A 4H1WA 2NO7A 3AR8A 1FCJA 1SB9A 3EZXA 3CZRA 3WLRA 2ZZNA 4NZYA 4EAQA 4I3GA 4BO6A 3Q7EA 1NJ1A 3ZWCA 4DR4B 2B3DA 4J2TA 3K70C 1M2HA 3GPDG 1M73E 3W2FA 4AQDA 5KI6A 5FA6A 2WKRA 3HSKA 2GCPA 3PRHA 1SNYA 3DOFA 1D6JA 1YJCA 2XB8A 1JHOA 1KZGB 3DPIA 1VB3A 1EWKA 3D8UA 2H2HA 4NVRA 1XXHA 4MPJA 4UAGA 2QVYX 2C59A 5KX5B 1U4NA 1BRTA 1CZLA 4GSKA 1YMVA 2MMCA 3BBLA 2OYRA 4P5PA 3ENZA 3ZV4A 1U80A 2UYCA 1E61A 3E9QA 5JCXA 2R6CA 4V38A 2ANCA 4J9VA 5ARCA 7MHTA 4Q7KA 5TQVA 5CU7A 1W5SA 4DSTA 1DFGA 1N7IA 3DA8A 4ER7A 2WWYA 1OB2A 4HLDA 2UV8A 1ZL2A 4G9GA 1IHDA 4X00A 3VPHA 1SQ5A 3M6XA 4MKIA 3HWX1 1RKUA 1P2SA 2QZ4A 1GUDA 1HE2A 3JQBA 2BCJQ 4GZ5A 4W9NA 4E32A 4J43A 2PLFA 3NMUF 4LRUA 3VR0A 1IWPB 4O02B 3OX1A 4FEGA 3TFQA 3WLFA 5SYMA 4LKOA 1QU2A 2MWMA 3MA0A 5C0OE 3TEFA 1EK1A 2Q4DA 2PHZA 2BFBA 3N7AA 4UXHA 2WWGA 1PT5A 2C7VA 2XMSA 1PI3A 1SD2A 1T2NA 3DAFA 4ICIA 4OREX 5E2AA 2J8ZA 2CJWB 4Y6QA 1R8JA 4BAGA 4DEXA 1WB5A 1KEZA 2VBIA 4YMHA 4DXHA 1DJPA 4M1ZA 1BXGB 2XTAA 1BGVA 1OH5A 1D0SA 5EZYA 4PYJA 5LXTB 2IYTA 2ATIA 5BV8A 4YPOA 1E2UA 1E92A 1X1RA 4WLEA 1H2HA 5C1DA 1OY1A 1Q7GA 2N47A 3OEED 4G41A 4UTZA 4B85A 5IW8A 4P22A 4HBGA 3GBVA 4LY3A 4MA4A 2DPHA 4ZEWA 2ZIFA 4L1KA 3SZUA 1S8FA 1L4YA 2FPUA 4YQEA 2Q2NA 4H3VA 4FDVA 4ZHQB 5HOEA 5AM3A 4LV8B 4NDZA 3ZCTA 4NOJA 3C7TA 1JHMA 2G9RA 2QF7A 2ZWIA 2W2KB 3A58B 3HABA 4X3CA 1GYQA 3BRWD 1J97A 1K08A 2CLFB 2P7HA 3VZSA 5JXWA 1K7EB 1KRXA 1E8DA 5K09A 3U3KA 1Z4MA 3OX2A 1W48A 2KE5A 2PT7A 5AYVA 5EMJA 2XV1A 1QIEA 1HYQA 1Q0SA 3O9MA 3DDUA 4KPUB 4UUBA 2Q7DA 4AIRA 1EB9A 1YUBA 1PD0A 2P68A 2V7UA 2YV4A 4JVLA 1U2SA 1WR8A 5K8IA 2RGYA 2JJMA 4GOJA 4S2EA 1Z4KA 3M6WA 1Z13A 4D4MA 1JIVA 1HDOA 2QOEA 1JAIA 3IDZA 2QRUA 3NO4A 4YRMA 3SJBA 4C43A 1QKIA 2X8WA 5HX7A 2E6KA 1F0KA 4KE7A 2YR0A 2DPYA 3TSAA 4ZZ3A 2YJ3A 2AXNA 2C20A 5ERGB 3QHQA 1ABEA 1SBYA 1ETHA 1NDQA 1SWVA 1E7YA 2PR7A 2ZJ4A 4P83A 2BW0A 4UJ3A 3M3PA 2OAP1 4OSOA 2ZEJA 1NVXQ 2CGEA 5AK0A 3WGTA 1OPXA 3CLSD 4MQMA 4NH4A 3ZQJA 5AI4A 7ABPA 3SVLA 5LD2B 2EV9A 4EHLA 3I61A 3R5HA 4Q9HA 4JI8B 2GD2A 1ELOA 5EXTA 4MUAA 2IIVA 4LYGA 2Z6AA 1ISJA 2B30A 2IP2A 2QQGA 1DOZA 1ZONA 4RPKA 4FYPA 4MQEB 1Y8CA 4BJ3A 1TO6A 5EI5A 5HZMA 4YLEA 2GSDA 4HLUA 3TQHA 1JA9A 3K6SB 1SHJA 5AKXA 3VKHA 4UPEA 1MG5A 3LHFA 5A0TA 1EQAA 3WLNA 3WLAA 2F8LA 2JFZA 2CYCA 5G41A 2CNLA 1C1DA 4LF6B 2QENA 4GAEA 3SVTA 4M1SA 2H7CA 4MCHA 2XCQA 4WLNA 3PRYA 1N2OA 3FGPA 1P9OA 3EZFA 2MSDB 3HYSA 4FFOA 4ZV9A 3UMRA 3VU9B 3VV2A 1UKAA 3AJAA 5JO9A 4D46A 5JNWA 5JISA 3FDJA 2H2GA 1FVXA 4K3VA 1U8EA 2QN9A 1CD5A 4GOKA 3MTAA 1DGQA 2DB3A 1DJQA 2WB4A 3GRUA 1JHPA 1Y63A 2JC3A 2HL6A 1PVVA 4I08A 4MWBA 5TMPA 1QHHA 3GLUA 4HEA6 1QRDA 4OM7A 5KKAA 1G9XA 2PTHA 1XMXA 3ZH2A 2IX3A 3FZEA 1B2LA 4GWKA 4NAUA 4A73A 4P7GA 1VIDA 5EHIA 3BF7A 1J22A 2P4QA 2Z3ZA 3NV9A 4MUGA 4X20B 4EG6A 1DFHA 3QVMA 4O2LA 5CW2A 1PR1A 3GCWA 4DA6A 3TD6A 5LD2C 1MF7A 4M76B 3ZQ4A 1DKQA 1KI3A 3EISA 1RWVA 1GG2A 1HT0A 2GYYA 3HI6A 3I1FA 1RPTA 4MP3A 1PUIA 1SVNA 3ESCA 3KJHA 3QPWA 1UPTA 1BX1A 5WRFA 4D82A 1QGAA 4MOWA 4OI0A 2YYAA 2FQYA 4QGGA 3JWPA 2J4CA 4G2TA 4PO3X 4U0JA 4ZO4A 2QVZX 4ER6A 1K92A 3JD1A 1LBEA 2OMKA 2QQFA 3C3JA 4LQDA 3CZMA 4XOUA 5C31A 3PXDA 3UOGA 4A0FA 4R40A 4F4DA 1RYMA 1TW3A 3QKSA 4JKOA 2Y77A 1O6GA 3L7YA 3IRUA 4QDXA 2BFWA 2YJ6A 2GZSA 3NPMA 3RKRA 3UC9A 3G82C 3FTPA 3GPCA 1USUA 2I71A 2PGJA 1Q0QA 2W4IA 4AU1A 1VFPA 4WXHA 5I45A 4ZTZB 4TRJA 2W6NA 1SOMA 1QP8A 1F2TA 1A77A 4MYTA 1M7HA 1N2BA 1SVMA 3I05A 3KUUA 5FJIA 4W9RA 1IRXA 4IP0A 4YIKA 3EVAA 1MJGA 1Z5OA 2DHCA 5IYZA 3T1TA 3RUHA 1SR8A 4M0CA 1W87A 2WDZA 1F0YA 5KHOC 1T9ZA 2ONZA 1SUSA 5CBPA 1S0UA 1L4MA 2B1QA 2C77A 2W2MA 2FOXA 1IHPA 4E7OA 3SYKA 3B38A 4J0DA 4OHUA 5D84A 3LQFA 4EKYA 1A27A 3SQMA 4F2WA 2WAOA 2CXTA 1J2EA 4XE5A 2G67A 5D01A 5ALIA 4EYKA 2B2XA 3JQPA 4E22A 4KW7A 3BGWA 3ZC3A 1C3EA 3A3NA 1S3GA 3IPCA 4QQNA 5HDQA 2HJWA 2B99A 2G8LA 1H2EA 4XGIA 2LNDA 5E95A 4ZOEA 4HQNA 2FQ1A 1X13A 3KPYA 3UV7A 1BHSA 3I0NA 2XXAA 1JECA 2O6LA 2BEUA 2ZR9A 3WWZA 1E9SA 3G0GA 5JLAA 4F1JA 3N86A 2HRQA 1YGPA 4KFUA 4MEBA 4BZQA 1AE1A 2RH5A 4QXAA 3C41J 4CL3A 2XUJA 4ENVA 4OD0A 1J0AA 2C8VA 2IE0A 4WVLA 3GLTA 5IBRA 1CZUA 4PTLA 2XCUA 3QVKA 2FGKA 3U4AA 3WRXC 1R27A 1NMXA 3GEDA 2AE2A 5AUOB 4MNTA 1F0NA 1P0CA 3HM2A 1U2PA 4A26A 5M29A 1CYDA 4BO7A 3ZWVA 1JAZA 2W6CX 1CRPA 3PPVA 4YDHB 4PZUA 3A9WA 3KXPA 3H11A 3G1WA 1OKKA 3W34A 1FP1D 4KAAA 2CHUA 3VNUA 2C8LA 3ESDA 1G3UA 2DMRA 5TJ9A 1FEZA 1R5NA 2OENG 4EFNA 1QOQB 1JLLB 3I1YA 2HHAA 2QX6A 3R5FA 2OLEA 3HJAA 3IQGX 4IQ8A 2IYZA 1NVDA 3M4JA 4GD3Q 2V58A 4XEUA 3ZWQA 2AUNA 3NG1A 4G0VA 3UMFA 1ESCA 1PKXA 3A4TA 1MC4A 4DJ5X 3NUGA 1N9GA 4HWRA 4I55A 1SQFA 1JKMA 2YZNA 1H1TA 5K9ZA 4NYIQ 1AUOA 1PIWA 2PN1A 2HV9A 5AW1A 1GZDA 1EJ2A 3ICPA 3LY5A 2IHJA 4H7HA 3WBBA 4CTOA 9GPBA 5D51S 1RWWA 4UBKA 1UOPA 4TKLA 4HFJA 3OWXA 3QPUA 5EJAA 5JAHA 3VR3D 2RAFA 2IS2A 3EDRA 2R7KA 2CW5A 3JQAB 3LT4A 3RGWS 2EZ9A 4IDNA 3MJ4A 4R1OA 1GGFA 3B5EA 1D03A 3ZTYA 3E82A 2ZJ7A 3FPEA 1EVKA 1W5TA 2QT9A 1SBIA 3LO5A 4PLPA 3FF4A 1IBMB 4NPCA 3KKNA 4PGHA 3F97A 1I0IA 2HCFA 2P65A 1P1CA 4HXEB 3DVSX 3GMDA 2CLKB 3A6PC 1AKQA 2B9EA 1JVNA 4PC1A 4PSCA 2HMVA 4R6WA 1KAQA 2VSYA 2JFUA 5CVCA 4CE6A 3FY4A 1HTTA 3IAUA 3RVSA 4ARIA 1DRUA 3AM1A 4LQCA 4ZCMA 2Y4NA 1E1CA 2PA0A 3OIFA 4I8IA 5KIAA 2HJHA 4KXMA 4FXPA 4F91B 4RGVA 4JYZA 4AWAA 2DR0A 2VRCA 3N7UA 2DHEA 3NCTA 2A0WA 2Z9CA 3AJDA 1P31A 1Q1QA 2VF5X 3D3WB 3OPVA 4JY7A 3T5MA 4DPLA 2FX2A 2AK3A 3TIVA 1OH7A 2ZWOA 5EE9A 1RZRD 2BC9A 3RT7A 3SZLA 4CCWA 1GILA 2G4LA 4X84A 1DCMA 2ZXUA 1ZO8A 4N5HX 1ZINA 2QPTA 4KQHA 5M04A 1ECPA 1SCJA 3D8RA 3UZUA 5LXTA 1ZCJA 1B42A 2ZAYA 1XC7A 3BICA 3NDPA 3PR2B 4OEHA 5KBYA 4M0UA 1V25A 3NFRA 4ZRDA 2D1FA 4EMUA 3MS4A 1US8A 5FOQA 3W77A 4ZCQA 1L7VC 4S1TA 1UBHS 4ZPJA 3PGLA 1UJ5A 4XVQA 1EIWA 1EGHA 1T6YA 2DOKA 3O0DA 1Q7EA 3AOEC 2IEZA 5EC8A 1NY5A 1SELA 4DDWA 4DM4A 1AS2A 1TF5A 5HKAA 5LYJB 3U0BA 1BE6A 2BEVA 1VCNA 1XMQB 1CUZA 1NT4A 1YK0A 4R9UC 1EUCA 4Q7EA 3PPWA 2GKGA 4UBIA 5EUQB 5HIMA 5LBTA 5TR9A 2HBQA 3CX8A 4JI1B 1UZLA 2O0LA 1EHYA 2TMGA 3WIBA 4EFMA 1Z5VA 3DB2A 4YHHB 1CQZA 2W2KA 3QBEA 1CRLA 1S4MA 2IK8A 1QV6A 3ZKWB 2PKYX 2ZYDA 1N33B 3LA6A 3R0XA 1NJ2A 1XK7A 3FPJA 4OQFA 4M0DA 4O4IF 4CEJB 2IUYA 4UDXX 3NKVA 4ES6A 2DC1A 2XUOA 3G8BA 3QLEA 3INRA 1K66A 1CFZA 5J4VA 1Z63A 3VHXA 2QTGA 3BMQB 3AEKB 2OP0A 3SGLA 4ZJPA 2I66A 4KUEA 4G1CA 4PLZA 4W7IA 4I5GA 4P7FA 1ISSA 4EJFA 5A62A 2Y1EA 3NHRA 3ZG6A 1NBME 1UKZA 4D0LB 1PS9A 5AVSA 3L1IA 4IIFA 4KFSA 3ZJYA 1RHQA 4AJ4A 2X5OA 3MTGA 2BEWB 4XWGA 3G17A 4DRZA 4QGAA 1IJEA 4JJEA 3NHSA 4I7EA 4HQ0A 4R71A 5EWMA 4L15A 2VDJA 2ZJ2A 3MUOA 3KSDO 4N6NA 5BWLA 5ILGA 5ELXA 1J56A 1PG0A 4TKVB 1WU7A 4A6DA 1CZHA 1RVV1 1PBNA 1VKNA 3DZJA 5I8WA 5I8PA 2C9CA 2QT0A 1CERA 2QWXA 2R00A 2MYNA 3F4KA 1WMFA 1FFXB 2B6HA 2OQRA 3NASA 4S2UA 4DB4A 2Y3IA 3P26A 4W82A 3ZHZA 1COWA 5CA0F 1VZ3A 3CR7A 2E2WA 4C03A 1OXMA 2JI8A 2ODPA 3I8XA 1XTIA 4BMCA 2XSZA 3K2IA 5A6SA 2GHQA 5EERA 4AUNA 2ACEA 1TDJA 3IALA 3QGMA 2PGXA 2GF2A 3R7WB 2AV6A 5EQFA 1K8XB 3ZZNA 3THWB 5JFTA 1KVTA 2YWXA 4NHEA 4CIAA 4N41A 1LTKA 3RTCA 1QFMA 4UZEA 5EIFA 4Z7NB 5F77A 2P4SA 4J1NA 4TWJA 1I5OA 1QQ6A 3CCBA 2ZJAA 3RTDA 3ILXA 1Y0BA 2NP6A 2NUBA 4M8LA 4TKUB 5H5JA 4JFRA 2E3JA 1UXGA 3HVUA 1UMCB 2HHCA 4TLEA 3WJ2A 2ORWA 3THOA 4IJ6A 4D9KA 1AUVA 1JIIA 1LLUA 1YZ3A 2YYYA 5AHXA 4EY5A 1FMJA 1DU4A 1FE8A 2KHZA 4YONB 3A36A 4MLDA 1M6VB 2YMPA 4V1CI 3I9LA 4FZ3A 5C2JB 1RYZA 4D8UA 4H6WA 4KTTE 1SEPA 2B9VA 2CL0X 2ASEA 4EELA 3DPUA 5D3MB 5HBRA 1BHJA 4N3GA 1F7VA 1HKHA 3BQMB 4ZI7F 1W29A 2Q2WA 3ZWOA 1QHYA 1XD9A 1RYEA 5AW0A 3RG8A 1DLJA 3OIYA 2ZRFA 4GNKA 4DIDA 3H84A 2I6FA 2MYTA 2AIRA 3DZCA 3QW2A 4GM4A 4WKOA 3F3MA 1OGYA 2XE6A 3EW9A 4N8DA 3R7AA 4MUKA 2G76A 3RRJA 1B6RA 1NVBA 2QY6A 3WRXA 5FL7D 1R12A 3ESQA 4L8YA 2ZSEA 3HY4A 2HU2A 3IQFA 5HKKA 3KYBA 5L3ZA 5IC6A 1EBFA 2QRNA 3EXFB 4LOAA 4TYNA 1EFCA 2UYGA 3HCAA 3P4XA 4FGJA 2IUFA 3AF2A 2CEKA 3PT9A 4KKVA 4LMBA 4ZC8A 4AUKA 4AX8A 4TZ6A 1RRGA 3ZDEA 3EGDB 1TRHA 2CFIA 1VBNA 1IM2A 1ZM2A 1JR4A 3A7EA 3RLIA 5JFGA 1Y5NA 1JFFB 3QPDA 3EHDA 3O47A 4OJNA 1QTNA 3AF3A 1KC1A 2EJUA 3BDIA 3HVIA 4UM5A 1UKCA 3ZIAA 1NVUQ 3B12A 4J2HA 2XCIA 2AWOA 1G1AA 4DLXA 1XRJA 3LGAA 4RLQA 1ABBA 1Y3IA 2G4VA 2NU8A 4LWZA 4XUEA 4EM6A 4F7WA 2G36A 3PCTA 4ISCA 5TIIA 1QXSA 2Q1WA 1VHTA 3LLUA 3O2NA 4QOSA 3ITNA 2R0QC 2FZCA 4NV1A 1H69A 3VR2A 1KY3A 3I6QA 3KHUA 3LD9A 3SI7A 3A6JA 3I62A 2VIIA 3CZ4A 3KZNA 2C29D 1Y5RA 5EWLB 2OC4A 4WFKA 4YRDA 4ZALA 3RYCB 2I87A 1XZFA 4FNMA 3AZPA 5BW5A 2IZZA 4TKMA 4RV9A 1YD7A 1DJNA 3EFOA 8OHMA 4IX1A 1HFWA 5EFOA 1XD2A 1O8CA 1U28C 2A58A 4ZC1A 2ZIUB 3O84A 5KSYA 1K5GA 4TTTS 1RC8A 4ZYWA 4CMGA 4NATA 3ISJA 1SRQA 4RJJA 2IXBA 3WMRA 4O6VA 1N2XA 1JDZA 1GTZA 4Y2VA 2GDZA 2MDTA 1KVRA 4KQGA 2JI9A 4O5AA 1RSZA 1ZA1A 2JFYA 2HPAA 3Q3GE 4ZCPA 1QTQA 4E5VA 2XDQB 2YC2C 3KV1A 1EFVB 4NXNB 2ZUBA 5BYBA 2C5SA 2R8RA 4EG1A 1GFIA 1TTPB 2YVQA 3UJCA 4JSRA 5JCPA 2XYPA 3QTLA 3COZA 1BMFD 1T26A 2HRDA 1T34A 1NPYA 4G8BA 4J2OA 4JZKA 4LDZA 1TCBA 1T2AA 1PAUA 2FKAA 3IAS6 1X94A 4PLWA 5IJ9A 4JSTA 2WM2A 3AT1A 4OBWA 3WNBA 3DV2A 4A0GA 3EBPA 3FFWA 2EFJA 2L19A 5IJZA 4BQFA 3CNLA 2GJKA 2WBLC 3HZOA 4KU4A 4S12A 3LAWA 4YJHA 2HX1A 4F5EA 4FCVA 1YT5A 3S5UA 1Y4DE 1CW2B 2ZPUA 4OATA 4PQEA 5CDSA 1LLDA 4U7FA 1Y8QA 3C3BA 1KQOA 1V45E 2JZNA 1YQGA 2IP4A 3L8GA 3PE6A 4N7BA 1N5KA 3EG9B 3IAFA 5ALJA 5GV8A 1NRXA 4B0OA 2WA1A 3AOEA 2ZRAA 4A36A 4B2LA 2JAOA 3SHVA 2C94A 3D6FA 3P2IA 4S1OA 4NBTA 2KQUA 1TL7C 3K0CA 4RK0A 3NC0C 4P4SA 5DBHX 1M2GA 2JAUA 421PA 4Q3LA 5FOVA 2QE7A 4O1HA 1XXLA 1BFUA 1SVIA 3H3FA 1YMUA 1KEVA 2AFHB 3WLJA 4UXJA 2YXDA 1AC5A 1OHHA 2XQVA 4OH7A 1W76A 1V7PC 2HQBA 2VZLA 1SC1A 3R7DA 3KSBC 2YWDA 1R4NB 3B9RA 2WNIA 3LRTA 5E3HA 5JXHA 4MZDA 5BWMA 1SXQA 1VM6A 1AX9A 2VAPA 3IB6A 1JG2A 1E89A 4BP8A 3TZQA 4NBKA 1XT6A 4K6OA 3WR5A 3PVSA 3MWGA 4BJ1A 3U7QA 5BN5B 2PSFA 4ACAA 4J0QA 3R23A 1QHXA 2VRBA 2ZRMA 4HB0A 3RYIB 1ZHHA 4EQ6B 1BAPA 3U7HB 2B8EA 3JYNA 1CIJA 3AYZB 1G21E 3D3WA 4YRSA 1ODCA 3Q12A 2GN0A 4FU0A 1LF5A 2ZSKA 1W0CA 4XW2A 3WB9A 5BQ3A 5F4BA 1VLJA 1H8HA 2I3GA 1P7YA 3FMFA 2VSFA 1QO0A 2HIAA 3MOIA 4JLJA 4E51A 4ECEA 1P7PA 1Y1TA 2H7XA 1PDWA 1J0EA 4MI9A 1E9RA 1PYGA 4MDFA 2WJWA 4NDNE 1F6DA 2D0IA 4LPKA 3A25A 4CTJA 4WBNB 3NVMB 3Q1KA 2AQHA 4HB2A 3E9RA 3U81A 1CJTC 4PX2A 5JS8A 1ADYA 5BYJA 3COSA 4CV0A 2I6QA 3W5JA 3WIEA 3G68A 4HEJA 2A8YA 3TW4A 5K45A 4DLTA 3F5FA 4DV4B 4YRKA 1T0BA 2G0TA 3DPSA 4FFNA 4CDRA 4BWGA 2O48X 4DQDA 4MK4A 1XN4A 1FYEA 1ZNZA 3AHEA 1U1EA 3VHRA 3HLKA 3SKYA 2C88A 2VT6A 3S1SA 4LF9B 3TIGA 2ZB3A 2FZWA 4HXGA 1WPQA 3WMFA 3C15C 4MSUA 5KU1A 1C2TA 1PT9A 1QG6A 1Y1SA 1ZM9A 4HAXA 5K4GA 1Z6YA 2AEFA 4LWOA 4IOLA 3OM9A 4N8EA 3V4FA 3S2UA 2F43B 3WQHA 1YQEA 1CV2A 4S0ZA 1T13A 2C4KA 2ZKIA 1TMYA 1JQEA 3N0WA 4FT2A 4MGYR 4URFA 3SIPA 3PC4A 5A3QA 1XPUA 2Q2OA 3ZZUA 1ZU4A 3PIDA 2BFDB 4X90A 1IBKB 4JOQA 1E94E 3LCJA 4CR6A 1TM1E 2ILTA 1EE2A 4MGKR 4RF5A 2DBQA 1X0XA 1KE1A 1Z2AA 1FL9A 2BFAA 2A0KA 3AEKA 3N74A 3M4YA 3R6LA 4C04A 4EB0A 1MU0A 4B87A 3RAFC 2IYYA 3RB8A 1PJ8A 2B5VA 4V0KA 4W7HA 5FCDA 7REQB 1S3SA 3S2SA 3OZEA 1H6DA 2JIMA 1C7ZA 4LSGA 5I9LA 4JJ7A 2WJAA 1XVVA 2FEXA 3VBCA 1J1ZA 2NYRA 5K7SA 3AR2A 4IILA 3M4XA 4PR3A 1D2CA 3QHAA 1D3AA 5D3ZA 3VR5H 4ZMSA 1OH6A 4WZAB 1KSFX 1ZICA 4C3ZA 2OHFA 3ZDXB 4X6UA 3ETGA 4I8DA 4JLSA 4F3RA 1EUZA 1KFKB 2QW1A 3DWEX 1KWKA 1FFXA 4C6TA 1J70A 4FDLA 3UMCA 3PTLA 4NSNA 4YO8A 5CA1B 2XMBA 4D9IA 2P3OA 2BGKA 2QDKA 2EP5A 2V0CA 3MAGA 4IV5A 1U7WA 1RJ9A 5GZ1A 3Q8XB 3R3XA 3E61A 4ZMBA 1DADA 3S44A 4NG5A 1VMAA 4WVFA 4C7MA 3DBVO 1UK9A 4DADA 1E9BA 4HPJB 5C18A 2IXGA 3G0DA 4LEIA 2ATVA 1IXYA 2X6QA 3THWA 3X1XA 4A2WA 5KQRA 1I1OA 5LCXA 3D0RA 4CGYA 2GWHA 4FE4A 5CYFA 3RRMA 2Y1CA 4JL5A 2ZBVA 1O94D 3LY7A 3PJDA 4L3OA 2GEBA 2LPMA 2X9NA 3N70A 4I1RA 3IHKA 4ASUD 4BQQA 5TC4A 1AK9A 1K2WA 5HZGA 2RD2A 4MQ5A 2DY0A 3F5MA 3B51X 4PZCA 1JJIA 1I10A 1N8TA 4G1BA 4TZKA 4KR2A 2AI2A 3U39A 2B20A 2H57A 3GRVA 5JLJA 5J2UF 3JQ8B 4A23A 5DHTA 2P40A 1GTJ1 4UVEA 5HXAA 3FCOA 721PA 2D3WA 1E2DA 1SCUA 4UUAA 1I3MA 4AP6A 2GM3A 1M6VA 5EKDA 5G4KB 1XLTC 2JGRA 5HIKA 4M1WA 3BHIA 4LSZA 1B8OA 3QKTA 4TLAA 1SY7A 2GZHA 2MYUA 2OQIA 3SYRA 1IG0A 4C0LA 3DOEA 4E21A 4JJAA 3EH1A 5DLEA 3SF8B 3TF5A 4YY3B 3HWRA 3NOXA 4M0MA 5E9JA 3FSEA 5AXBA 4W5OA 5ESWA 2BEKA 1U8FO 4CLDA 1FBNA 1YNSA 2TRSB 4D45A 4BQIA 4G0WA 4R31A 4UVHA 1MOZA 1YBAA 1PGOA 1C7FA 2P75A 3FIJA 4HB4A 4I50F 4LC9A 1DXOA 1YS6A 1MV8A 4H3SA 1F60A 1MZVA 1A72A 3C4QA 1J8MF 3CN7A 4LF7B 1DBIA 1YB1A 3V7YA 4IJQA 4J94A 4URWR 5AVOA 2VHWA 3A11A 3B1VA 4MR9B 3F90A 3DFKA 1WDKA 5AIBA 1HT1E 2IXFA 2J3KA 2WSLA 3EXFA 3LUDA 3L40A 4G67A 1YDGA 2OUIA 3K09C 1SKQA 3FRJA 4UNQA 3U4HA 3G9UA 5EUCA 4D98A 4TQ9A 1LRJA 3GGSA 2JIZA 4RL6A 4NEQA 4L4XA 4Z4EA 3F4LA 4E07A 4K6GA 5CNJA 3CSSA 2IVFA 2JKVA 1XRRA 3QELA 4PLVA 1PWXA 1YQWA 4Q39A 2WMNB 2YN0A 2HK7A 2YKGA 3GEGA 4QWMA 5CH8A 3WLMA 2HU8A 1PV4A 2OO5A 3WBFA 1CVLA 3NYRA 5JCJA 4ECAA 3E9EA 3VPAA 4RZUA 5B58T 3CLKA 2X6RA 2UUBB 1VMIA 1E3IA 5HS6A 1TTQB 2CEAA 1NYLA 4C5CA 1WCXA 5DYWA 3SKXA 4AZTA 5H68A 1OFUX 2N42A 3HTXA 5LOVB 2QUBA 3K0AB 3VPFA 1E79D 1DJOA 1BDJA 1DWUA 3QUQA 2VQSA 1KI6A 4JLOA 4YBRA 1PNQA 5KQSA 1CUXA 5KEIA 5HGJA 3IODA 3UC5A 4GZMA 4Z0NA 3MTBA 1FTYA 3GZNB 4KE9A 5A4JA 5BN4A 4TV8B 5G2OA 3R7SA 2VEDA 4EYGA 1JFVA 2ICAA 3HXQA 1MBZA 5MF6A 1JZQA 2FPKA 2YQ4A 4MVYA 2FMKA 4I9UA 3QF4B 3Q4GA 1WZCA 2OD9A 2VQ3A 3QEKA 2GUGA 2C5EA 1LPAB 3O94A 2WG1A 1EFVA 4WA7A 3C6KA 2Q2VA 2QSYA 1PJAA 4N5IX 3RUDA 1B8VA 3HKEA 4PG6A 2VPZA 5ESRA 1MAAA 4BRWA 4KLRA 1TXGA 5KOYA 2QD5A 4I1VA 4MV8A 4MYHA 4DLNA 1I7LA 1MG0A 3IIMA 2G9NA 1I2AA 1C1HA 3CCFA 3TR0A 4F60A 3SZRA 1KKMA 3VH1A 4YP1A 3TG2A 3GCZA 4QA9A 3CX4A 1JKIA 3FH0A 1YK1A 2PYDA 2CCJA 5K8TA 1AJEA 4Q9LA 4PZPA 1KDVA 3ZDQA 4FIZA 4B4OA 5CEFA 1ZUIA 2JIRA 3CC8A 4N54A 4JLDA 2B92A 2WWTA 4IJUA 1UT8A 3F49S 1P8AA 1UAAA 4FT4A 3UBMA 4D57A 4S05A 3B7PA 1AKYA 1SZJG 2XGMA 2XYQA 3SYMA 4CM8B 3A1VA 1T0IA 2PO5A 2G80A 3IP6A 5K3BA 4CG0A 5IDXA 2D06A 1U9IC 4TZ0A 3EUAA 1IPFA 1G0OA 4CFSA 4R16A 4EO7A 4BXOB 5DW3A 4JVNA 1GGNA 1KPIA 5J23A 2QIOA 3FYCA 3WLLA 5IBQA 4QUBA 2GVNA 3BSFA 2DTEA 4GLBA 5KNDA 2ZSJA 2Q28A 1DEKA 1Q2UA 4LN1A 2OHOA 3DYVA 1E2EA 4XX0A 5LZ5A 3B9BA 5GPBA 3NRCA 2I7CA 2LWIA 1NOJA 1V1MA 3EMBA 1FXWA 1D5WA 4ZT2A 3B78A 5LA6A 4IJMA 1MH1A 1L4UA 4K9DA 1WTAA 2I0FA 2R7MA 4H08A 5KKNB 3T35A 1SU4A 5JEEA 5AKLA 5BN5A 2OBYA 3RBXA 2F1HA 3KLOA 4F9GA 1Z62A 5FV4A 5KNCD 4FGLA 5ES3A 2YUTA 2G9ZA 4MV6A 1EH5A 1T5IA 1SU6A 1K27A 1IB0A 3E0XA 3EEBA 4LNHA 5CH3A 3TTYA 3VNSA 2JJ2D 3X1WA 3F3SA 3NEJA 1LDNA 4ZD6A 4P0PB 1F8YA 3BWDD 3PQCA 4MYCA 3RADC 4ZXPA 3UGKA 5D2CA 5AJHA 3CVYA 3MMPA 2ZR7A 4XVHA 3OOSA 3W4KA 4CKYA 1LK5A 4DR5B 3GFVA 5BWNA 5TPZA 4HWPA 4N5DA 1JKJB 1MV5A 1P6XA 2FMHA 4H7JA 4N6OA 2Y1FA 2YWHA 5FNZA 4RENA 5IABA 2ZUFA 3H5TA 2YWBA 4RZIA 3HNOA 4ZVPA 4C2BA 1RWNA 5T4EA 2W7TA 4DRYA 3C6XA 2I67A 4YUAA 1TKCA 1TT5B 3L6UA 4B6PA 4EKIA 2H85A 3KALA 3Q2OA 2HSZA 4I81A 3OCUA 2P3SA 1H42A 1TIKA 1OXKB 1UM9B 1XDDA 2H0AA 3OEWA 2C4WA 2CXXA 2J31A 2N1MA 3DMYA 4TOIA 5BO5A 1H0SA 3JRNA 1RC0A 1GT6A 1UH5A 3SKVA 2AMLA 3UQYS 3IP9A 1EXNA 3O75A 2VSNA 2Y1KA 3KJZA 3PQ7A 2HSWA 5AW6A 3ADBA 2WZCA 3PUZA 3W5BA 3IYLW 2E5WA 3RWOA 4U63A 4YJGA 1LLFA 5U1PA 5I5GA 3LLVA 1L5ZA 3GDHA 4BP3A 3QEOA 3DOOA 1DZIA 1JBEA 2PFGA 3DWFA 3KLPX 3UK7A 4J76A 2QBYA 4JBYA 2DFPA 3RHZA 4Z1MD 4CKEA 3L18A 3SQDA 1SCBA 3CPEA 4JCCA 4WE3A 3CBGA 4X7PA 3MWFA 5HZHA 2BTQA 2ZRNA 4DA0A 2UKDA 2QN2A 2RGWA 1FJ2A 4DBLE 1Q74A 2ANBA 4LXIA 1M76A 4XRGA 3D1JA 2WV9A 2ZULA 4TQUS 3PSHA 1OE0A 1WM1A 2IYLD 4LRSB 1WQ4A 3NWJA 5JNTA 1H3EA 2E48A 3A4IA 1NF8A 2VVTA 3TECE 1X3SA 1XLTA 2NYUA 4KTVE 3DLPX 3HUEA 5IT9A 4WNAB 2AOTB 1MH9A 2H1RA 3TS1A 4PICA 2W2PA 1KDTA 3UWOA 3GMSA 3ZIDA 1NHGA 2F4NA 2XZTA 4TS1A 4XD7D 4A9AA 3E1KA 2ZXFA 4LW8A 2ZVPX 1RYHA 3PD7A 2XT6A 3ZHRA 1JG6A 2VH5R 3DW3X 3G2OA 3DCJA 5AKGA 3FETA 1T4CA 3ONNA 5K0EA 5L4LA 3GXBA 5DM4A 1XNQB 2GK7A 4BE4A 1RWOA 4M21A 1X9IA 5BRAA 5DM70 5CURA 4H7PA 1Z6ZA 4X24A 2Y68A 5IF3A 4F93B 1N34B 4CQNA 2GJAA 4IFIA 4YA6A 4GR5A 2X1VA 2VAXA 3JALA 3M81A 3HJGA 4R1SA 1UADA 5LP1A 5LQRA 4WN9A 3M1YA 1A1VA 1XFDA 2PKQP 3EZGA 3SNKA 3TG8A 1TJNA 3GLHA 4TN1A 2CLLB 4IIGA 3ZZMA 4ITRC 2XTMA 1FQOA 3HWSA 5KJCA 4WL0A 4UHEA 3OLVA 5LC1A 3DNFA 4D9NA 1E3SA 2W5UA 1GIAA 3J7TA 4YAIA 5A03A 3PF9A 4KQXA 1O0CA 1NNUA 2GRAA 5FWXA 1NQUA 2OEPA 1RZUA 3KM0A 1OYYA 3VRHA 3ESYA 3HP7A 3UFXB 4C3VA 4IWNA 2WUEA 4AJJA 4MRRA 2C7PA 3RCBA 5EEGA 1NTRA 2M2IA 1T2DA 3JQ8A 3KXKA 4AM8A 3C4JA 4KWIA 2V8OA 3UGJA 1W46A 1Z3IX 2H06A 4IY1A 3L4EA 1Q0TA 5A5EA 3I9JA 1TA9A 4UVGA 3V1LA 4C7XA 4CGZA 1J42A 1DZ3A 2WINI 1FRNA 1PR0A 4RS3A 1D6MA 4JB0A 1JH9A 1VGRA 2YBEA 1N0IA 4WRRA 2EFYA 2HF9A 1FDIA 4JJIA 4XB6B 4EY4A 1N6IA 3CH7A 4M54A 4IZIA 2JCVA 1GAXA 2V6JA 1VCOA 3R77A 4JB2A 5TB5A 1H3FA 3MGBA 3GEMA 4KJXA 4M9CA 2V03A 2V7PA 3ROXA 4PPQA 1D4AA 1ZA2A 2PMEA 1P91A 4QRDA 5LR6A 5EWJB 1EEHA 2X7JA 1V37A 4G1MB 1TIBA 3DS8A 4GSYA 1JKXA 1ESMA 1AA6A 2IU6A 3C16C 3DAYA 3IP8A 4P3NA 1U9YA 5AKHA 4IUCS 5IU6A 1KOJA 2Q3CA 2XA9A 2IYUA 2O2JA 1ZGBA 3H1BA 5E9WA 3W1EA 4FGKA 3T12A 4C6SA 2VJQA 2KWIA 4PNHA 1NXTA 4B43A 1RKVA 5FV7A 5K0CA 1N2CB 3E53A 3COPA 1P61B 3FMVA 4HH3C 2P9JA 3WSTA 4YDRA 1T1IA 3MCZA 4R51A 5HMLA 2ID4A 1NNLA 3ZU4A 3KD2A 3NDJA 3KDAA 4GOLD 4YQYA 1BN6A 1EP2B 1NG1A 4YJ3B 3GOQA 3SJ7A 5DU2A 3T9FA 3U80A 3SN6A 1SKUA 5B1EA 1V1JA 3H0EA 1CR1A 3M6LA 4R41A 1ZNYA 2IHVA 2AFRA 1PCXA 2PKRA 4US0R 2ZIEA 3DC2A 3V6LA 3ZNQA 2QM0A 2ZRGA 3HA2A 1B8PA 2NU6A 3PB3A 1WHSA 1W8DA 4BFSA 1O0BA 3DTVD 3R1IA 5IWCA 1AURA 5GVSA 3RRXA 1W4CA 2EFHB 3WGMA 4RTOA 3HUFA 2H4ZA 1VMEA 1PWHA 4YT8A 4BNIA 1GAQA 2HDWA 5ICSA 4K9PA 4L3VA 2XVXA 5JC8A 4Q1AA 2GTIA 1C8VB 2NWQA 4QJBA 1IQPA 3QU2A 5DLDA 3W8EA 1PUXA 2GEVA 2XKJE 1MO2A 2Z2IA 2WYUA 3LSTA 3QE4A 4GSLA 4REOA 3ZX4A 2ECFA 3K92A 4KDRA 3GHHA 1RXWA 3NPAA 4GE3A 1UT5A 3RYHB 4P3XA 3L0YA 4MMYB 1WUYA 4QJ4A 2NO1A 1I3CA 1LSJA 3P7MA 4Q12A 4TV8A 5EEHA 4RBNA 2GCOB 3M1LA 1YS2X 1NQOA 2Z57A 3E3NA 4D0NA 5ECWA 1XCMA 1KWGA 1X92A 4IDHA 4BWYA 2IBSA 1EFLA 1UZNA 1C7JA 3G8YA 4RMIA 2AC2A 4P4GA 5FBWB 4L5YA 5GMOA 4ZOAA 4WSOA 5IM4A 1DRVA 1HQCA 4Z8XA 5CJ2A 2EHDA 2CHEA 3BZBA 4ZANA 1FXUA 3P97A 1FX0B 1P72A 2JEYA 2QTTA 2W71A 2IYSA 3MLEA 1OPRA 4QL3A 4B84A 2PL5A 1FFCA 1JJFA 2J6IA 3O26A 5NULA 2BM9A 3TE7A 1P2FA 3EPHA 3FCEA 3GFPA 2HWXA 1WE2A 2VQFB 2ZI3A 1TCCA 2EG9A 1QCDA 2IQ5A 2OCLA 2ZBQA 3EARA 3BTUA 4IHQA 2Q4BA 2QG6A 3OCCA 4C88A 3L0CA 1ZHOA 4RFVA 3QOXA 3EJWA 1XROA 1ORDA 2VRNA 5GVRA 2YVLA 3AGPA 4HAZA 1V2HE 2VP3A 1RBYA 2P9EA 4MLZA 4UPVA 2YINC 4AZVA 3JQRA 1H3NA 3TSOA 4DQKA 2J32A 1M0WA 1TYBE 3NBFA 5LWQA 1QGUB 3U49A 3OBIA 4X8LA 3LP6A 1V6AA 3RBZA 5C1PA 2G5GX 2R1VA 5A02A 2ZCJA 1A7AA 1DAFA 2CBGA 4HDKB 3AUTA 4KREA 3ZLBA 2VUUA 3ICEA 4KMSA 5F1YA 5CAEA 4BXOA 4JBIA 2ECPA 4XA8A 3T7AA 1OZFA 4FI3F 4QAQA 3ZCXA 4BE9A 1GEGA 2C9MA 4AN4A 4L95C 1ZM4A 2JRCA 5HF8A 3T3EA 2VZ0A 4FOTA 4MIEA 1MD9A 4GMFA 5SZKB 4AJLA 3EY4A 3IJPA 1PJSA 3CCCA 1UBEA 3IKVA 5EPOA 3QKRB 4C7BA 1KBOA 1ZJ4A 4IZ6A 3TD9A 4C4RA 3LPDA 1N3YA 2XCLA 1RZVA 1WMAA 2XYRA 3DMPA 4BVBA 3GLFB 3CUSA 2RJNA 5HTOA 1T0PA 5G3YA 5ADWA 1ZJYA 3ABZA 3FPKA 4KEAA 2HR1A 3UH0A 1LI4A 3K53A 2FWAA 4QX6A 2ZYWX 1G19A 1V8ZA 3HFJA 2O23A 3JAWB 2VP0A 3LX8A 5G0VA 2OOKA 4FFDA 4MZXA 1FFBA 3ZE8A 2JF0A 3L77A 5J63A 2R5WA 1XL0A 4GKVA 1EXMA 1MIOB 2Y76A 5EPUA 4DUPA 4MGEA 1KS9A 3UWDA 5KINB 4OQEA 3WMGA 2DM6A 3X1DA 3I6BA 4RVUA 3U9TA 4F9EA 5F7XA 3PEUA 3L5KA 4RLFA 4WOPA 4UZSA 3BIWA 5B58C 3DHWC 4XFDA 1KZ4A 1MQAA 1TLLA 4XTRA 5KB3A 3WA7A 1QGED 4BMZA 4EA8A 2HRCA 3WDSA 4H1TA 2PH3A 4IDOA 3RS7A 1I9GA 1OU0A 1WUKS 2P78A 2WC1A 2X0RA 3CIOA 4QJIA 3E7XA 5DRYA 4BB6A 4M55A 1T3SA 4XUCA 3LQ1A 4REMA 2RGGA 2ZTMA 4XXHA 3C6MA 4K9RA 5BSWA 5BOVA 3TZ6A 2QZPA 1SC4A 3OPXA 1Z8DA 3MELA 1G1MA 4CM7A 1LBTA 2C95A 4D81A 1N0VC 4D5GA 4PAQA 1LC0A 4K8RB 4KIUA 1G8MA 3L4KA 3LHIA 2OB2A 5DCYA 4MIYA 4WIAA 5JROA 4FC7A 3DO6A 1M8FA 3DM5A 4L08A 3OQIB 3STTA 3OOWA 1YRBA 2FN3A 4XTCS 3RHFA 1ZY2A 3IVCA 1Y8RB 4QPNA 4RH3A 4ETIA 3T7RA 1KJZA 1E6LA 2NVOA 2VCEA 3HPQA 4OXNA 2E4WA 2KSQA 3RPEA 2ERCA 2JGDB 3RIEA 2ST1A 5AJTA 5CFPA 3EYWA 5CB8A 1UXKA 2O2HA 2WVGA 1U1CA 3LUHA 4C0KA 2O2XA 1NBAA 2XUAA 5KMGA 2RGDA 3CLTC 4U8HA 2P2LA 3E4DA 2DUNA 2PKEA 1A8HA 5IFKA 1SHTX 1PV1A 3LVFO 2DPXA 5DRTA 2QLTA 3MILA 5JJBA 4XJXA 1ICEA 3B7GA 4DG5A 1OQAA 3HB7A 3MJEA 4IOKA 2QJRA 4XLZA 4W5HA 1SH7A 3TCNA 4G4IA 1NI5A 1QGYA 2QUJA 3RUAA 4A82A 4RA6B 4COOA 3HCFA 5CVVA 3TQQA 1HSZA 1C81A 2D0PB 1ZVQA 1GPAA 4K03A 5LJIA 4MPPA 2ZT7A 3HVHA 3IKLA 4RGBA 1L1RA 2P30A 4FDAA 5FLEX 1TO1E 1P33A 1WCIA 1HUQA 3DEYX 2OA0A 5K0FA 1JRLA 4JUAA 1T9HA 3CRVA 4BAUA 2ZS9A 3IIEA 3OJOA 4ZGWA 4U00A 5CLFA 1RKXA 4YCMA 2PSDA 2XF8A 3OTHA 4DXAA 3CR3C 1JG1A 2Z08A 3AL2A 4JT2A 5I7EA 2FSUA 3QJ5A 2XRFA 4BVEA 1R9MA 1T8YA 5IJWA 2ZUEA 2J7PD 3LC0A 4YLGA 3DTTA 1R3UA 4NWIA 1AKTA 4EBBA 2QB5A 3RGGA 4HZUB 2PV7A 3KJXA 3CNNA 4GX1A 2CFSA 3N05A 1K7CA 1BW9A 4H1UA 5FI0B 2NGRA 4YRLA 3I5UA 1DJLA 5BSEA 1PP4A 5FTLA 1IG3A 3RIMA 4G4GA 2DFTA 1IEXA 4AMGA 4GBJA