4HNSA

Crystal structure of activated chey3 of vibrio cholerae
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
124
structure length
124
Chain Sequence
ANKNMKILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGDFDFVVTDWNMPGMQGIDLLKNIRADEELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLKEKLDKIFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chemotaxis protein CheY
publication title Conformational Barrier of CheY3 and Inability of CheY4 to Bind FliM Control the Flagellar Motor Action in Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 39
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hnsA00
3IP9A 1CEYA 4XLTA 1Z18A 2JBAB 1QQAA 2QV0A 4G0YA 1SD5A 1DCFA 3CG4A 3BBLA 5KQLA 3QELA 4S04A 1QMPA 2JVJA 5PNTA 4RK7A 4W5TA 1ZGZA 5FBKA 4YP9A 3SY8A 4WT7A 1TVMA 4MRMB 3RVOA 3GV0A 2PMCA 2QW1A 4KK4A 2QVGA 4MAAA 3GA5A 3RVLA 3T6KA 5HSGA 1FFGA 4HYEA 2BGGA 4H3HB 5IBQA 4PYRA 3LUKA 4HNQA 1W9HA 5KWSA 4Z4IA 4EVSA 2FMIA 1I3CA 3N0XA 4QPJC 1YMUA 1K68A 2HPHA 3CLKA 3KHTA 4G0QA 1DJMA 3QX9A 2GX6A 4RXTA 2Q5CA 3IP7A 4YRZA 3RVMA 3CKMA 2NT3A 5FWYA 3HCWA 4L85A 3NHZA 1SRRA 3LUCA 3M9XA 4G0MA 1L5YA 1JHZA 1DCKA 3LMKA 4F3TA 3QEMA 2AYZA 4O1IA 3E3MA 3SNKA 1WETA 1KMIY 3IPCA 2M98A 2CHFA 4H3KB 3OLXA 5TQ2B 1KRXA 3HXMA 1EFAA 4OBBA 3UKJA 3BREA 3QLUA 1DC8A 1BVHA 4NQRA 2MYNA 3GL9A 1FQWA 4MRMA 4W5NA 2OENG 3Q9SA 3O75A 1RZRD 8ABPA 5EWMB 2E4WA 4MLDA 4NICA 4RKRA 1DRJA 2E4ZA 2A9OA 2NT4A 3GYBA 4WXMA 5JNSA 4KPYA 1ABEA 1DBPA 1JBEA 1MIHA 2GI4A 3A10A 3C3WA 5CNKA 5HKOA 2WJWA 1U2QA 5JNWA 3GT7A 3C3MA 5EWJB 3JPYA 4HNSA 1D2AA 4LZLA 4YO7A 4LDAA 2PUFA 3CFYA 6ABPA 2A9RA 3HVRA 4KREA 4LRQA 1CHNA 3C6QA 4ETNA 4RXUA 1M5UA 2L2QA 1URPA 4Z4FA 3C3KA 1BAPA 3RVPA 4XAQA 3DZDA 1D5WA 1MVOA 4ML3A 1A0OA 2MSWA 5HQJA 5TQ2A 5ED4A 2PE5A 4KV7A 4RXMA 4CBVA 2FLKA 3FFTA 3H5OA 2PUDA 3KYJB 1XHEA 2B1JA 5TQ0A 3NNSA 2JVIA 3LUJA 3VNAA 5EWMA 1QNLA 4IRXA 4ZYLA 3N75A 3H5LA 2ZAYA 3HZHA 4D6XA 3EULA 2YHBA 3HDGA 1NXOA 1NXPA 2V0NA 1JWLA 3H1FA 3HUTA 1JF8A 3OQNA 2E4YA 3UK0A 3H6GA 2JB9A 3H5VA 4IILA 2A9QA 3Q41A 1DRKA 1MB0A 2FMHA 2QXYA 1MAVA 3KKEA 1RXIA 4N0QA 2W42A 3MYYA 4MPTA 5JS1A 4OG2A 1FFSA 4KK3A 1AB6A 2E4UA 3L49A 3LFTA 2IDMA 3NNNA 5FWXA 2WY2D 4EYKA 2VK2A 6CHYA 2IPNA 1VPWA 4FE7A 4YLEA 1M2EA 3LTEA 4P98A 1QKKA 3LUGA 4LE0A 2X7XA 4ZPJA 4Z4CA 1ZVVA 3A0UA 3MA0A 2QU7A 1SXGA 1LJLA 4Z4EA 3I45A 2FVYA 4WXEA 4EYOA 4OLBA 4MQFB 2F8SA 3F73A 3RVNA 3T8YA 1QP7A 4KQ9A 1BA2A 4G0OA 3KJXA 2QZJA 2WB4A 4JASB 3RVQA 4O5AA 5JNTA 4RK6A 5TE9A 4YWHA 5KC9A 3JTEA 1GUDA 2N9UA 3QLVA 4HNRA 2GWRA 2MSLA 3N0WA 4QYWA 1DBQA 4MR8A 1JFTA 2GKGA 4G0XA 4GPAA 1RNLA 1XHFA 1ZH4A 3RVRA 4N47A 1GLGA 3F6CA 3O21A 3OLYA 5EWLB 3JS5A 1U04A 1USIA 1JDPA 1GUBA 3LUDA 5DGCA 1USKA 4TN5A 5KQMA 2FLWA 4MR9B 4EUKA 2FEPA 4TLMB 1TJYA 4XFKA 2PLNA 3LKBA 2QR3A 3O1JC 4IF4A 1OXKB 4EYGA 1NXWA 2XDYA 3KG2A 4FE4A 3O2JA 1GCGA 3D8UA 5CNIA 1E6LA 3HJFA 1OXBB 4UHKA 1DZ3A 5FBHA 1F51E 2NZUG 2GBPA 4LX8A 4ETMA 1RZRA 5JNRA 1B00A 1KGSA 3ROTA 4KRFA 3F6PA 4NCBA 4FB4A 2FMKA 3N0RA 4KVFA 3H5IA 1NTRA 5KQPA 3OLWA 2JBAA 5IEJA 4RU1A 4RS3A 2IPAB 2FEKA 3FGZA 3RVSA 1Z12A 3BRSA 4MYRA 1JFSA 3EQ2A 3KLOA 1H9CA 1J56A 3JVDA 3HM9A 4F11A 2WRZA 1YS6A 3EAFA 5CNJA 5DLEA 2IPLA 3CNBA 3KLNA 4MQEB 4Z9AA 4OLAA 3SAJA 3LUFA 4GNRA 4JB0A 3T38A 2PL1A 2RJOA 3CTPA 3SQNA 5BR1A 5T3YA 4RV5A 5BRAA 2H0AA 3GBPA 1C0EA 7ABPA 2FEWB 1T34A 3G1WA 4MR9A 4LDZA 1EWVA 2IPMA 1TM2A 2HQBA 5F64A 2YHAA 4YV7A 1YVUA 1ISRA 4G0PA 4TLLB 4L4UA 3LOPA 1UDRA 3KTOA 2LUOA 3ILYA 4E7PA 4ZMSA 3C97A 1U8TA 1VRVA 3MIZA 4YCSA 3H1GA 4PZ0A 4MR7B 2CWDA 3GBVA 3OMXA 1DBWA 4F06A 1AB5A 2QVCA 3NHMA 2OQRA 3A3KA 3M9WA 4JAVC 1USGA 2MYPA 4EVRA 2CD7A 3NBMA 3TO5A 4YS6A 3H75A 5CNMA 2PUEA 3I5AA 3TX6A 2B4AA 3KSMA 4MGEA 3Q15C 3QLVC 4D74A 1C4WA 1HEYA 3Q7RA 1DC7A 2E4XA 2PL9A 3S99A 1QO0D 2F8TA 1W25A 5IEBA 5IUKC 1A04A 1RXEA 2PJUA 4EYQA 1MB3A 3M6MD 3HDVA 5B3JA 3OO0A 5ABPA 4MS3B 2MSKA 1DP4A 3KYIB 3OLVA 1JH9A 3ROFA 3EGCA 3CZCA 2FQWA 5BQ3A 1ZHHA 1BDIA 4W5RA 4YR7A 3B2NA 5KC8A 2LP4Y 1ZH2A 3DGEC 4RK5A 4TMYA 2H3HA 2M1ZA 3K4HA 3NNDA 2NZVG 4W5QA 1TMYA 2PUBA 1VLZA 1F4VA 1Z2EA 1EWKA 1PNRA 1JYEA 2P4UA 4RY0A 5EWJA 3EODA 5GQSA 5C5EA 1Z25A 3DGFC 4G0ZA 1YS7A 1JDNA 1PEAA 3O2SB 3IDOA 2LIVA 1Z15A 1JFVA 2ZWMA 3OMWA 9ABPA 4YGXB 2VYCA 4ZMRA 4RKQA 4XXHA 5IX8A 2PAFA 3W9SA 5C5CA 1Z26A 4WUTA 3D02A 3IP6A 3QELB 4QYMA 4RZSA 4RDCA 4KZKA 4XASA 3QK7A 4KFCA 1DG9A 4B09A 2RDMA 1D1PA 3GWGA 4Z0NA 2VUIB 1CYEA 3CU5A 2MYUA 1PHRA 3N53A 5IUNC 2WJAA 3TD9A 1L5ZA 1U2PA 3A0RB 2A9PA 2ID9A 3RVKA 2J48A 4Z4GA 2DRIA 5DKFA 4PEVA 2VUHB 4Q6WA 4LE1A 5FWYB 4RK1A 1QPZA 2WWVD 2MYTA 2JVKA 3RH0A 1ZDMA 4QICA 3QEMB 1ZITA 3I42A 3H5WA 4JOQA 2PUCA 3G85A 1APBA 4E7OA 3QX8A 1D4ZA 3HUUA 4IMJB 5CHYA 3L6UA 1Z2DA 3FFWA 4Z4HA 1Z16A 3MQ4A 4OTZA 3T95A 4JP1A 3HK2A 4WWHA 2PUAA 1JL3A 3HO1A 2RJNA 5TPZD 3URMA 1Z13A 3TB6A 3KCNA 2L17A 2FKAA 2P9HA 1QP4A 1ZY2A 3H6HA 3HV2A 2FQXA 3LKVA 2JCGA 3N6VA 3Q7SA 4MQFA 5B3JC 3Q7TA 4F8JA 1ZN2A 2HQRA 3KS9A 4MS4B 4WZZA 1DCMA 4Q6BA 3R0JA 2R25B 3OLZA 4DADA 2IYNA 1NATA 2L19A 1D1QA 2FN9A 4RK0A 1GCAA 2FXIA 3H1EA 1KRWA 3JPWA 3JVIA 3QLTA 4ETIA 1EWTA 5HM6A 5JS2A 2I6FA 3OM1A 1PNTA 2FTKE 1A2OA 5E3JA 5EWLA 3GRCA 1ABFA 2R4QA 3OQOA 3HS3A 3CG0A 4N03A 1Y1LA 1PUXA 3OQMA 1JLKA 3N8IA 4LE2A 5DTEA 3DLHA 1IIBA 1NXTA 3H5TA 1JX6A 1Z17A 2QSJA 4DN6A 1ZESA 1NXSA 3FDFA 1QO0A 4ZJPA 2FW0A 1TLFA 1M5TA 5TQ0B 1BDHA 1BDJA 5BRJA 3BRQA 3MM4A 3SM9A 4EGSA 1JYFA 3TMYA 4MS4A 1XWWA 3VNBA 4RWEA 2PKXA 4JA2A 5TPWB 4W5OA 2WMYA 3EDCA 3O74A 3OO1A 5JNUA 1LK0A 1P6UA 3EQZA 1YIOA 4RSMA 4OATA 2R48A 4RY9A 5TQJA 3O2QB 3DLBA 3CHYA 4MS1B 2TMYA 4NV3A 2AYXA 1P6QA 2FSPA 3LUAA 4RY8A 4G86A 3F7NA 4MQEA 4MLCA 5KI6A 4P1ZA 4N0PA 4EVQA 1P8AA 1U0SY 3CZ5A 2HSGA 3E61A 4IGAA 4M88A 4JB2A 1NXXA 5FWXB 4Q7EA 4KNYA 1FFWA 1ZAYA 5T7BA 3OM0A 4S05A 1YK1A 1ZGGA 2JK1A 3K9CA 4G97A 4D6YA 4KMRA 4N41A 1E2BA 4O1HA 5D2CA 4Z9BA 3CS3A 2ID7A 5KQGA 1M2FA 1YTUA 3DBIA 4MR7A 2IKSA 2R47A 1LBIA 3EJWA 4PICA 1S8NA 1NY5A 5TPWA 3CRNA 3O1HB 4NCAA 3IPAA 3IP5A 4EY3A 3MF4A 1E6KA 1YK0A 2HJ9A 2FQYA 4MR8B 3HSYA 4H60A 4Y9TA 4N76A 1NXVA 3RVJA 1E6MA 4UHJA 4MS1A 1R8JA 1LJUA 3BILA 2L18A 3UUGA 1EAYA 2FN8A 2LBPA 3MMNA 4XARA 2LPMA 3SG0A 2HQOA 4MS3A 1EHCA 2RGYA 1QP0A 4KQCA 1RPJA 1P2FA 3QEKA 4DQDA 1ISSA 2E4VA 4PE5B 3FMVA 2JRLA 2FMFA 3FFXA 3P9YA 1K66A 5GOTA 1SXIA 1YMVA 5JNVA 4IMIB 1LBHA 3QLUC 2O20A 3HEBA 1SXHA 3O1IC 3LUHA 1VKRA 3ILHA 4Z99A 5TPZA 5I4CA 2CHEA 3RQIA 1QQBA 2KYRA 5IULC 2PUGA 2IOYA 1FSPA 4RK4A 4F12A 3I09A 1PEYA 5IC5A 3JY6A 2NUBA 5DCLA 5IUJC
chains in the Genus database with same CATH superfamily
2Y1GA 1WHTA 4CQLA 4IYJA 1QFYA 3TXAA 4DZTA 5AVJA 4JT8A 4C07A 1JZQA 4MI1A 5FJJA 3HFJA 5TB5A 1T5BA 2MDTA 4GX2A 3D3WB 1OBFO 3NHWA 1X1BA 1I80A 4QAJA 3ZZUA 2D0DA 2P67A 4W5WA 4LF4B 1JFFB 1UZMA 4N9QA 4JSRA 4C04A 4JBYA 1UEIA 4L15A 1M34A 2G36A 3D6MA 4C6HA 3ZLTA 2YC4C 1ZOOA 2PX4A 4HYEA 3I6YA 5IKPA 1U02A 3ANLA 2FFAA 3FLMA 5DK6A 5JANA 1P1CA 3PUYA 3JATA 1RSZA 2ACEA 3IBCA 4UPVA 2B61A 1NVTA 4I99A 4LZAA 4QGBA 4N5NA 5DH9A 5E7IA 3ZHOA 4JDUA 4B6FA 3WK9A 2HEIA 4B75A 2WYVA 4DMHA 4DR3B 4P33A 2ZJOA 5F9FA 4G0QA 3ETEA 3N8GA 1A97A 4MV5A 1JKMA 3QX9A 5E1DA 4D44A 3DFIA 4DKJA 3F74A 3PXGA 4B2PA 2ODBA 3ND5A 4D80A 2G8NA 3RVMA 2QMOA 3GIDA 1GCOA 1ZW6A 4NULA 1OWPA 3M9XA 3EQ8A 5AYVA 2BONA 2VHZA 3BMOB 2A33A 2JHAA 2W58A 2ZTLA 4QGHA 5DFAA 2QXUA 2CUKA 3P26A 2AYZA 3FF1A 3RSQA 3MUNA 4YJ2F 2F9LA 2WLSA 4HATA 4M9SA 5BSMA 3CLSC 2CE2X 3ONEA 2Q6OA 4HL6A 1F9EA 4H3KB 5C52B 1DX6A 3OVMA 4LC1A 4MKXA 2ECFA 2P3SA 4OBBA 4MA5A 5E95A 2ANCA 4ZZIA 5I7OA 2A5YB 1YS9A 1E3IA 2FSSA 4G85A 2XYQA 3T3HA 3UB2A 5CXUA 4AY2A 1Q14A 2A0KA 4MRMA 4JB8A 2W2XA 3ZXIA 1TIKA 1H42A 3A2NA 5FLYA 1CQIB 5K8VA 1Z2PX 4NNJA 4YECA 1Y1QA 3L7AA 4P35A 2H92A 3Q0IA 1DZIA 1DRJA 5AJWA 2WM2A 4YQEA 1RYEA 2IDJA 2ZIGA 1NFQA 2IUEA 4UMFA 2ZR0A 4UUPA 4QX6A 2B98A 1GG2A 1KARA 2BGJA 3DEIA 3O8QA 3PR1A 4RVNA 1P0MA 4GFDA 2VP0A 2PU7A 1FUIA 2XWBF 3KPUA 2GPWA 1J5EB 4R8LA 4EB8A 2WIKA 3NI2A 1ESMA 3QVKA 1A1VA 2GBCA 1TGYA 5I4KA 3D7RA 1HYHA 1T1RA 3LGAA 2AGVA 3D8NA 4B17A 4KREA 4HGQA 3RS8A 2YYZA 3D8BA 1J33A 1XXHA 2XA2A 4B9AA 4J94A 1UFOA 2LCIA 1GNRA 2IWRA 4Q02A 4UHDA 3K70D 4LJRA 1A69A 1SXJA 4FHZA 3VPSA 1M2OA 5TQ2A 2WG2A 1M6VB 3NAMA 4B3FX 5BOSA 3KQKA 4KV7A 5B2FA 3GA7A 3Q10A 1THTA 1FVHA 3F2VA 1OE0A 4ZJUA 1NQXA 1KQGA 4YCMA 1ZCAA 4CIYA 2QUJA 3NORA 1KMCA 3WBFA 1OB2A 3G2JA 1JECA 4PFJA 1I0IA 4RHXA 3R9XA 1RLTA 1XCJA 3JASA 1DU4A 3DP9A 1KIFA 4AY4A 2V7BA 5HJ7A 3AYXB 2HLHA 1KNQA 2X76A 4LFAB 1EM6A 1J21A 4ZREA 4XUCA 4EFLA 1TO1E 3A4LA 3HUEA 3PTAA 3HA7A 1WB4A 4GKKB 4GSLA 4O4HF 2EJWA 3GOHA 1E62A 1VLMA 3GDGA 5F7ZA 1XDZA 3H9UA 3W6NA 5JSZB 2WWHA 5KAPA 2B78A 4Y8VA 4ZO8A 1DS6A 2IEGA 3G8DA 1VE1A 3Q1LA 2QXYA 4JGGA 3ZHBA 5E6RB 2GN8A 5EIHA 1XFAA 3WJ1A 3NAGA 4JLDA 4CKXA 1GPJA 1W5SA 2YKGA 5KYGA 2WY2D 3BWXA 3HYNA 2X7HA 2M6SA 1RWPA 2P6UA 2QRQA 3FBTA 2A5JA 5DM4A 1NDHA 1JLSA 1QKKA 2X0FA 4CF6A 5KO2A 2IDKA 2Q4BA 5AKHA 3ORRA 5A9SA 5H3CA 2WF8A 5FUWA 4JLPA 3U7QA 2FP4B 2I2XB 4ZVNA 2G88A 4FOPA 4EK9A 1KR2A 1TAQA 1ZM4A 4WXEA 2O8BB 5GTDA 4WTOA 3F73A 5KHLB 2ONZA 3W78A 5DEIA 4QD3A 4WJLA 4FNOA 3VR1A 3P4YA 2DOKA 3VHXA 4DV4B 2HL6A 4EH1A 3CVWA 1H0HA 3T3IA 2VHYA 3N2GA 4TLAA 1W76A 1G4UR 2R1ZA 3GFVA 3BH0A 4BKOA 1JDJA 3D6TB 4HN4B 5KC9A 3RT9A 3QLVA 4Q9NA 4DV7B 1CUWA 1XU7A 4O4IA 1R0KA 5J47A 2PXHA 1YQTA 2ZIZA 2GCOA 1GARA 1NBWB 2FRDA 2QGZA 3CBQA 1XEXB 3QFRA 2RI1A 5FBRB 2VK1A 2C5SA 1Y8QB 5E1MA 3LO8A 4TN5A 1U9IA 4OP2A 1V8BA 2VAXA 2JDIA 1WXDA 3EXG1 4PINA 4LGYA 3G17A 1MB4A 1N2EA 3H05A 3RHZA 4E14A 2WMDA 3OFJA 3U1VA 2UXBB 1G8SA 3V7NA 2B36A 4X71A 3WICA 3WGUA 3QY9A 3RUCA 1PJAA 3L7IA 3TECE 4BP8A 3HJFA 3HGQA 2QN7A 1SD2A 2WUEA 4BKQA 4PYOA 1F51E 1RP1A 2X2PA 2WUDA 3JALB 4GRIA 4LOLA 3RSZA 1XZCA 2PSJA 2XYGA 2ZJ1A 3GGOA 3N0RA 4PAWA 5AW7A 1J06A 3KOOA 3T5PA 1CRWG 2EATA 3NH6A 3OI7A 4UVHA 2Q5QA 2VZ0A 5KYXB 1KJ9A 3K70B 3D6HA 3R2JA 3WWPA 1DLJA 3IP1A 4RKWA 1EUQA 2PUJA 1KO5A 5AXBA 3IKJA 2ZRPA 4KSCA 1KSGA 2RHOA 1OU4A 1E2JA 4JP8A 2WRZA 1YS6A 4FCVA 1LWNA 4WE3A 4OLAA 3OKFA 1E0SA 1S4QA 2CMFA 4BGVA 3SAJA 2C31A 4Z2AA 3BXPA 2W0MA 3AXTA 5F23A 3CLVA 4TOIA 5A0VA 5HE9A 2G17A 3BYZA 3PFIA 2RCNA 3PV0A 1W36D 2AOTA 4AG3A 5JCZA 1D5CA 1ADGA 2LRHA 4K26A 5HJEA 1OBCA 4BUCA 4I5DA 3UMVA 2GHIA 2JH9A 4GP9A 2EQBA 2IH5A 2J0QA 1OR8A 1GKKA 1I01A 1XSEA 1A8SA 1Z8HA 1VPDA 2PJZA 3A11A 3ED5A 4MQ4A 1RLUA 1L5HA 5IDQA 3B12A 3E0QA 3IRVA 2ZCVA 3K31A 1U81A 3MIZA 4FYKA 4EF4A 1TVCA 5IZCA 2Q0QA 2CWDA 4D0LB 4DMFA 1YL6A 5K0NA 4GZ5A 1H2WA 2ZBUA 2MYPA 3TLXA 2D62A 2FGJA 1TZCA 3KVNA 4KRGA 4JC5A 1SKUA 2ZYIA 3FYDA 5B2ZA 5CD9A 1NMZA 4ARZB 1TQDA 4PCAA 4PG8A 1YRQA 1TIPA 4ON9A 4BNMA 4E1AA 2O57A 4R16A 1J0CA 2XUGA 5JAIA 5TT1A 1A95A 3PQ7A 2E4XA 3K92A 1QO0D 5ALRA 3KKKA 5ILGA 4QQFA 3IV6A 3W6OA 2R5FA 3MTDA 1ZMXA 4A8JB 1EB8A 1JJBA 1IHUA 2EBWA 3G0IA 3IA7A 1NMSA 9LDTA 4UJ3A 2PSDA 5KYUB 2XMZA 1XT6A 4HUJA 2ZYDA 4B31A 2AWNA 2E1PA 4YR7A 1JPNA 3GGPA 3DGEC 2G67A 3A4VA 4V0SA 1EGVB 1Q0SA 2Q7XA 2NZVG 3LY9A 2HA3A 3ANTA 5EUQB 1J20A 3FBWA 3OQIB 4ER6A 5REQA 4UMEA 1ADCA 2OG1A 1VI6A 2DFPA 3G6KA 2FZEA 3KALA 1NQOA 3N6XA 4G0ZA 4XTRA 4YJHA 5JNLA 2WU3A 4KEAA 1PEAA 3IDOA 2LIVA 3ZD8A 2P2YA 4XDGA 4X7BA 2PM8A 4MI9A 4CQLB 4L4XA 2PAFA 5SZIA 2GXUA 4QUDA 1QK5A 2VHJA 4KQ2A 2OO7A 5LOVA 1BG6A 4URZR 2R44A 1CRZA 1Q57A 3ER8A 1CF9A 3BGIA 2X4DA 4JCOA 4PY2A 4RVSA 1M34B 2E1RA 3I6BA 3ISJA 4TMKA 3TGLA 1VHLA 4QYIA 5IT9A 3SVTA 1X92A 1PGQA 2IS1A 3OJFA 4DCOA 1M6WA 2PRSA 3GJZA 2C1EA 3DDHA 3JATB 1Y5RA 3WY9A 2FPGA 5FFMA 1Z5ZA 3I0ZA 1L5ZA 1NL3A 3HWRA 2A1TS 5BYJA 4A10A 4QZVA 3E9NA 5EKSA 4NTZA 2YZGA 4KP7A 1FFHA 1G2OA 2BIFA 2NM0A 4G26A 1LA2A 2ZZKA 3TFQA 1A9TA 1LRLA 3RF7A 4LECA 4I1IA 3BSFA 1M2HA 1QHGA 3UWPA 4C7JA 5G1OA 3UV3A 1ZWKA 4TSRA 5ALOA 1BS2A 2V7XA 4CTNA 1X0VA 4AF6A 1RI1A 3W8EA 3BGWA 2AEMA 2GNPA 5CBPA 5JSFA 4H1HA 1U5AA 2Z8YM 1X38A 4MICA 4CV0A 3DAPA 2WAXA 4QICA 1ESNA 5G41A 3WB2A 4N7RA 4U2DA 3L4SO 2F1HA 4O4JA 2BBSA 1Z0ZA 4RFVA 1CF4A 1GZ6A 3JRWA 3G85A 1K3UB 4F2WA 1Z08A 2XDAA 3HQ4O 4IQ4A 2IZ5A 2VJBA 5CHYA 4EKYA 1UINA 4NOMA 3H19A 4ZOEA 3IKTA 4Y6GB 1Z16A 3IL2A 3WOHA 2AG6A 2FFHA 4NV0A 4F8YA 3HK2A 1Q1ZA 3PC7A 2EKLA 3K1TA 3TVTA 3A31A 1Z13A 4WNCA 3ZGVA 2JJ8A 4CGYA 1KPIA 4D43A 2A1IA 1U8ZA 1ZKMA 4IHAA 4Q7MB 4CMCA 4N65A 5BWCA 2C99A 3B3GA 1GDHA 2Z57A 2YWHA 3DE2X 4JLMA 1C81A 4PRLA 1YAHA 3RWBA 1MJHA 1KY5A 3KEGA 3LJKA 1N0IA 3RB8A 3W7AA 5CFQA 1HTTA 2Q4RA 4FXPA 4H1UA 4EABA 5EJ7A 5AM5A 2FSFA 2FN9A 3O8QB 4KPUA 2XCIA 4ZV9A 3MWYW 1T0JB 2C5GA 2C3YA 4ETIA 5ERYA 3P0FA 3JZDA 3W4IA 3I5UA 1V7ZA 1PNTA 3AHIA 4GL2A 3QEJA 1CPYA 3HVHA 4R6WA 4A5SA 1DHRA 2OHIA 1TEXA 1XXHB 1L4LA 1Y1LA 2P9FA 1I0ZA 3D7NA 4K2HA 5FX2A 2VT2A 1SCDA 5E6UA 3F47A 3VJRA 3OQMA 4NENA 4HBZA 1P1HA 3WNZA 3ZZ1A 2PIAA 1SXJB 3DL0A 3DD5A 5HM8A 1PKEA 1M2OB 4PWYA 1KPGA 3PCTA 4J75A 4S2UA 5AVWA 1QZXA 2CDCA 1NUUA 3MINA 1G20A 5B1HA 1EK2A 5JECA 2I2WA 1VIDA 1A88A 2XMRA 4K5QA 5C3MA 3EGWA 3BPSA 3CVUA 4FPXA 1F7UA 2M6LA 2VOJA 1H85A 5AOCA 2R65A 2HNBA 3R9XB 3IUJA 4JI2B 4GLLA 3JASB 1C4OA 2BHTA 1FDVA 1SC4A 2DPYA 3GXOA 1WZIA 1ZNQO 3OMLA 1GEEA 5BUZA 2WMYA 1E9EA 3UW1A 5ESWA 3PUHA 1N75A 1U8AA 5EHZA 4D79A 3IJEB 4J7XA 4JUDX 5AI8A 5C80A 3OQPA 2ETVA 4G4JA 1CK4A 4IFEA 4PTZA 3EJ6A 3NHBA 4TMFA 3AL0C 2P75A 2BE9A 1S2LA 3KDAA 1J2TA 3MS2A 4Z0HO 3USZA 1EE9A 4FWIB 4D96A 3BERA 1Y7IA 1IE3A 3QWFA 3MD0A 3WRXA 2BJVA 1FP6A 2VP3A 4MXDA 3GLGE 1GRCA 2OCXA 4DQXA 3N5KA 4N4AA 4ND8A 4MYTA 3MTGA 2DKFA 1Y6FA 5KSWB 3RD5A 1L4GA 3ZLVA 4K9NA 3I1IA 4QLOA 4DDTA 2HJVA 3DEHA 3DKPA 3QHPA 2D59A 4MW1A 3C43A 4KN9S 1A9ZA 1F8GA 2ASVA 4IPTA 5D51S 5GAJA 1L5NA 2ID7A 3O38A 3SR3A 2IGBA 1LK5A 2E7ZA 2JIQA 2PMEA 4CTKA 2VNKA 1ZZGA 5JD3A 1KYZA 4JI6B 1YTUA 3TXXA 1V4VA 1AVTA 3VHXB 3CURA 1FNSA 1NBHA 3D6UA 4W5JA 3AIIA 4G89A 1Z4LA 4KQIA 2CVPA 3N2GB 3MLAA 2NO9A 3LUPA 3MJSA 3QF4A 4U7GA 5TPWA 5ALZA 3U49A 1YZHA 2A92A 2EIXA 4L8LA 3RNLA 4D5EA 4DLXA 2AH5A 5CLQA 4E2XA 2A88A 4FEEA 3N2EA 2P3LA 3X1WA 1EDDA 2JFBA 2FDRA 3E9EA 1DJQA 4MEJA 2OMKA 1E4OA 1LJUA 4GI7A 4OIMA 4PSVA 1CETA 4RIFA 3T1NA 2Q3HA 1UOOA 1D2GA 3OEWA 3RGGA 1LK7A 5KVVA 1WPGA 3VR6A 4FFWA 4MOWA 4DC9A 2ACVA 4IKEA 1UC4B 1WDMA 2CBGA 1AG9A 3N3BC 3REOA 2FMFA 5IXYA 2P68A 4FSDA 1ONSA 1RI2A 2QRKA 2Z04A 3VU9B 2IJGX 3DHEA 1C3JA 2OV4A 2O20A 4C3UA 3O1IC 2QYOA 3WRWA 1OBOA 4DXHA 3DKIA 5A03A 1MA0A 4N18A 1OKKA 3DMTA 3CO0S 2VP4A 3ZQ6A 3C3YA 4P22A 4U4AA 3VU3A 3ZS9A 2NVWA 4I66A 5ADVA 4OOEA 4R9VA 1T0PA 1P1RA 4LAFA 4WXRA 2QP4A 1TRKA 3ZK7A 1GO2A 2YY7A 4TGLA 3RAJA 2I1QA 4QO7A 3WAJA 2JFXA 3HGTA 5PNTA 1GG5A 1K88A 3GRKA 4YH1A 3SF0A 1LRKA 3N8NA 1V7QA 3L6EA 4RD1A 3W34A 4OQPA 5I7FA 1E0JA 3ZQUA 2ARKA 1YDHA 2WG1A 1PZEA 3RJTA 1O97C 1P1BA 3LWBA 1VLJA 4PU0A 2VDWA 3ESQA 1PK7A 3PJFA 1I1NA 1Y6JA 1CJTC 4BO3A 3EIQA 3LX4A 3LQ4A 1UQUA 4HNQA 4FCTA 4ZV4A 5KWSA 4EVSA 3RBXA 4LK2A 5DX0A 3ZE9A 3CLKA 1H65A 1KHHA 3FRJA 4QT0A 5F76A 5C1BA 2Z1NA 2GX6A 4ZI7A 5EHIA 3GHYA 5HTKA 1QS0A 1RI4A 4HRXA 1WE2A 3RR2A 1JHQA 1L5HB 3O3MB 3R74A 4C03A 1WA5A 1PZHA 1ZCZA 1QOQB 1QV7A 1SBQA 3OFSA 4QRDA 5AKJA 4LYHA 2H17A 1XLTA 2AD5A 4TSFA 3RBZA 1SQ0A 5EC8A 2R6JA 3P2YA 1JUDA 5B4UA 5KNCH 1I24A 1JHVA 2ZP1A 2ZBGA 3G8CA 1WETA 1DRWA 2GR9A 1KMIY 3OA0A 3LOQA 2Q0HA 3DTTA 4G0WA 2PUHA 3R3SA 1EDOA 3CR8A 3GCXA 4U39A 4CGZA 3K0CA 2OY0A 2UZAA 1SCIA 2IS6A 3QX3A 4TL6A 3VVCA 3AIMA 4LK3A 3W05A 4POOA 5AUOB 4J7CA 2PMFA 2SCUB 2GK4A 2JHFA 1SG9A 3Q3VA 3HLKA 2BGLA 3IHWA 3OHSX 4QC2A 4ZQHA 4DDWA 1H5QA 4RBNA 1E2FA 3KKNA 4Z9FA 1T4DA 2IE8A 4B8YA 2QJWA 5IU6A 4K6CA 1U90A 5G3YA 1GA4A 5HFAA 2NZ8A 4MW6A 3V8QA 4QOGA 3E7DA 1WQ1R 1GZ4A 1QB8A 3GYBA 3ZXSA 2H07A 5JNSA 3AB7A 2Q0XA 1Z2NX 3QSYA 3T52A 4F91B 3GK3A 4KRXA 4J6EA 4Y18A 1DIRA 2BFCB 3QTBA 4FLFA 3SJCA 5FWNA 2G80A 2HK6A 4HNSA 1GZDA 2JFNA 2OGZA 3IR5A 2CYCA 1WS6A 3CFYA 4P5DA 4R1SA 4YJHB 4DY4A 1UC9A 4FR0A 2XNSA 5JZSA 4ZJYA 3AONB 4Q9JA 5K05A 4RXUA 3FWNA 4E88A 4NRDA 1T5OA 2JLSA 1GOTA 4Z7JA 2KBEA 2ZWVA 1KAOA 3M7IA 8LDHA 3S8MA 4TYNA 3L7OA 2VQEB 4X6UA 2HT6A 3GRAA 4FN5A 5D87A 4DEYA 5A5EA 5LOVB 1O94C 5DX8A 4FNAA 4KDEA 2A59A 4CU2A 5DGXA 4KSYA 5GM1A 3EH1A 5C7LO 1TL7C 3H5OA 4TLCA 2I9KA 1OGIA 3R3YA 4ALJA 2B1JA 2CXUA 1LDEA 2EFEB 3H11A 4QYIB 5J5VA 5EN4A 1K6IA 2WVHA 3CZ4A 4QUIA 1CU1A 1HH4A 1I10A 2A0XA 3FPAA 2FPGB 1D4AA 2JIMA 3I9OA 4MVJI 2XXJA 3UUFA 1X94A 3NCTA 3MJHA 1QC5A 3I53A 3NBKA 3PGVA 1V8PA 5GJWC 5I9SA 3ZY4A 5FULA 2XIJA 4ZYVA 2I3AA 3PDWA 3M3PA 3UJNA 3THOA 4PTYA 4P8RA 1ELOA 1HZZC 4EYSA 2PMDA 4HOYA 1YCFA 1VL2A 1E9BA 1IY2A 2EL9A 2R6GA 5E7QA 4LRWA 4ANFA 4JN6B 2N75A 3QZUA 2GJ9A 2DQYA 1Q7RA 3DS8A 4Q34A 4R2KA 2CMGA 4BRZA 3SFZA 2W42A 1IVSA 2IZOA 4O4JB 5F3RA 3ZDRA 4F92B 2NU6A 4OU5A 3RE1A 2E4UA 4GWKA 3NIBA 4R3NA 5HZGA 4XFJA 3K96A 2HWWA 2VK2A 4GR4A 4KXWA 4FE7A 4MIYA 2H00A 3LTEA 4AYWA 3DKRA 5KSZA 4R9NA 1HMYA 4WOPA 3K4PA 4R1TA 1GPYA 1TMKA 1SNYA 3OZXA 4Z4CA 2BI7A 1KOLA 1O8CA 3U7IA 3IOMA 3NDRA 4LMPA 5DBFA 1Q74A 1SMKA 3EGVA 3GJ7A 1KP2A 3IEKA 1RS0A 2AOVA 1TCAA 2ICAA 2VT6A 4FEAA 4D3DA 5D01A 1QJ4A 4FDUA 5AVVA 4YV1A 2Z5LA 3ZXUB 3TW8A 1D04A 5F1OA 5KTNA 3ZWPA 1W35A 2ZI7A 3LWDA 4UDOA 5IBCA 5JRJA 4DXDA 2YN4A 3WHLA 4PYLA 1RNLA 3DAYA 3HCRA 3BA6A 4WBNA 3HSKA 5BWNA 4PGFA 4G0VA 3VDMA 3N86A 1Q7BA 4UAGA 4F9EA 2TMDA 2X2FA 2QL9A 5GWXA 3DONA 421PA 2G5TA 5G0WA 1AY0A 4YUZA 4EGFA 2ZXEA 5E6UB 1R0YA 2H0QA 2QY9A 3FHJA 2Q9AA 3C3XA 4MR9B 2GAJA 3L06A 4NENB 1GFWA 4J4BA 4R7ZA 1RT9A 3QE3A 3SS9X 3IVCA 4GGMX 4WFJA 1Q12A 5LPNA 4NF2A 2I80A 3MINB 1PV4A 2PO5A 1G20B 1H66A 1WMAA 1XL1A 2AZXA 1G3MA 2WWFA 2ISCA 4BX9A 1NLUA 3KAQA 2H0RA 4A6EA 4PAOA 1K8RA 3H97A 2I7XA 2EC5A 4RTOA 2D2VA 1H5NA 2FMKA 3PD7A 1JVNA 1M8JA 5SYAA 1QH0A 1R7RA 3RTCA 4CMIA 1WDWB 3O4RA 3Q1KA 5EPEA 3M3DA 1IFXA 4AO6A 5AHOA 4YMHA 4DLSA 1Z12A 3GCZA 4TUYB 1G9TA 4BMDA 1U3DA 1P7PA 2Z2IA 1JRLA 4K9OA 4WL0A 4CKBA 2J9YB 3IEIA 3OESA 1H9CA 3QMPA 4Z54A 1GFIA 1L5MA 3PX3A 3FWYA 5FTMA 2NOAA 4MMXB 1BKDR 2DE0X 5JO0A 1QXSA 3K0AA 3SZUA 1BDBA 2PLAA 1O95D 1BHSA 4HT3B 1IOWA 4HAUA 3VV3A 1PWHA 4HADA 4AJLA 2O0JA 4JVLA 4BATA 4YV7A 1HRDA 1FSSA 1OGJA 2I2FA 1AHIA 3K72B 4CDMA 4BBAA 1KJNA 4I1UA 1E9AA 2LUOA 2QX9A 4OV6B 4C3ZA 2COUA 5DISB 4E7PA 1X7DA 5DI3A 4NZNA 5KMGA 2DLNA 2C58A 1GTJ1 2DSTA 3GBVA 1UF9A 1LUAA 4HPXB 2Z1DA 4JLOA 4WY5A 4X1IA 1UR5A 3DP7A 1X42A 4G1UC 4ZIRA 1KPHA 2P40A 3EIUA 1X1AA 3TOZA 3AW8A 1IHOA 3PXAA 3O8OB 3NWBA 2LCFA 1XEAA 3AL3A 3QF4B 1CHDA 1JAHA 4QQRA 4BDSA 1CR4A 2P1DA 3KVYA 1EWQA 3QLVC 1PHPA 4HDNB 1NN1A 2Q6TA 4D74A 3FTQA 5D5PA 2DCUA 2JNWA 5DB4A 3SBOA 3A6EA 3HPRA 2ZUFA 3OCWA 1YKFA 3AVUA 1A3CA 1KC1A 1VDZA 4LW8A 4EATA 4C3VA 2RHWA 4R7GA 2R8YA 4BC0A 2JGEA 4BQEA 5LOVF 2JS7A 5IM5A 2J4FA 2FRDC 2Q2VA 1GGJA 1DOAA 1FDIA 5TGDA 1U7DA 4IOLA 1KJ8A 4CCYA 3GNQA 5U9CA 3EGCA 1M73E 2ZG6A 4L0CA 3C5CA 1SY7A 4U3JB 4I9HA 1DPFA 4CTOA 2E48A 2FSHA 3D3QA 3RFVA 4N40A 3VYTB 5C7IO 5K0ZA 3DMHA 4DFDA 1VLZA 2WD9A 1SK8A 2C57A 1SZPA 2QG4A 3RROA 4A0FA 4DC0A 1JYEA 5EIFA 3O31A 2QEQA 1N1DA 1Z25A 2TS1A 1CQPA 5J4HA 1YZYA 4YONB 1FE8A 1CRQA 1P2GA 3RSCA 4BMVA 3LCJA 3Q85A 3DEFA 3G1UA 1KIAA 3RS4A 4C88A 1JHDA 1W48A 2YWBA 2I3DA 3DPSA 4K6MA 4X8MA 2IUSA 2QJOA 2I87A 2X5XA 4KQMA 1EXNA 4O4JF 2J5RA 1EHIA 2OZVA 3GFFA 1E5QA 4LMRA 2ORYA 4MTLA 4AXXA 4EX6A 4IH1A 2X6RA 3NANA 3OX3A 3WK5A 4HMQA 4YALA 3OKPA 1G2IA 2VDWB 2H1HA 1FFAA 2VJAA 4O3MA 3HZZA 1WNTA 4NYMR 1PHRA 1V0JA 2B2XA 2QJFA 3CH7A 4LQCA 4U8HA 3WI7A 4B3DA 4YMUA 1ZK1A 2VDPB 2R9VA 4YIKA 2V7EA 2YVLA 1KYQA 2LGJA 4XGIA 2V9ZA 5DTRA 4D9FA 1U2EA 1QX3A 2VHXA 1L5RA 1LBTA 1LPBB 1Y6RA 1HT1E 2I33A 3GR6A 2QLBA 3NHSA 4XYBA 5FJIA 4WJKB 3RYFB 5B58C 1QS0B 1LDNA 5EJEA 1JAYA 1XA4A 3OD5A 2D7JA 4R9RA 3FOCA 2IOFK 4PSKA 1HE4A 2WTXA 3PXUA 3M3HA 5IS2A 3HR7A 5IZCC 1XWFA 1BD3A 2R8PA 4NLLA 4FD3A 3CONA 3UCFA 4L9SA 1H2BA 2WR8A 4L3VA 1YTLA 3QVJA 5K3EA 2GYWA 4B0OA 4XWTA 4JT9A 1JKJB 1DDOA 3TNFA 1JJAA 2VT3A 3G8YA 9LDBA 1CY7A 2AN1A 1C0LA 5JWOA 4Z4HA 2IY9A 3MQ4A 1DQSA 5DYYA 4JP1A 1IUKA 1J2RA 1K4YA 4IVNA 4WWHA 4DBLE 3U0VA 1M1UA 2VP9A 3DEKA 4EKGA 3KDSE 3KCNA 5FA6A 2FKAA 4BQSA 4FONA 4YX9A 1X8KA 4H2DA 1LBEA 4JI1B 1ADYA 5T3YA 2BL4A 3FCAA 1KZ4A 3KS9A 1UWCA 5IASA 1B0ZA 2PA3A 1JQKA 1S7GA 3ER6A 1E1YA 4HVTA 3R3HA 3IUPA 4MUEA 3TN7A 1YF3A 1N36B 4AVYA 1G18A 2J3QA 5I9LA 4RK0A 1GCAA 2FXIA 2QD3A 3B38A 4Y6OA 1EB9A 3HA5A 3M5DA 4QOFA 2KHZA 4K81B 3F7TA 5AKYA 4ZYUA 2BR5A 3TL3A 3H16A 4V1CA 4UTVA 5KZMB 3ANSA 1YCGA 4HB3A 1ADJA 2JKYA 4TUYF 4ZARA 3UHPA 2C94A 4KR7A 3DFFA 2F17A 4M1OA 4O0MA 4OQZA 4XGKA 4HWGA 3AH8A 5AXCA 4RLSA 2BZSA 1GL3A 2J3HA 1W19A 4DMGA 1YRBA 3RT7A 4NOJA 1T5IA 5AQEA 3M1AA 3RFTA 5J1SB 1R4MB 1FDTA 2ZJ0A 3A05A 1ISJA 2O23A 1H8HA 2Z08A 3LLSA 4YRGA 3S3TA 4ARAA 2BCEA 3L01A 1MD9A 3BZUA 5FBZA 1YD7A 3KT3A 4M89A 3FMPB 3H99A 3M8KA 2JLUA 1PO7A 1ZUWA 4LMAA 5INTA 1I9CA 1XDSA 2AC7A 2I6GA 2QV7A 2GERA 1QC5B 3CJTA 4K0KB 2FF5A 5AO9A 2B94A 1SHJA 5K2MA 3VNQA 4BEWA 1Z6GA 2C9OA 1XVAA 5ALSA 2W2MA 4U7FA 1M33A 5H3LA 3IR7A 2CC2A 3HY6A 4K3VA 3PS9A 1K75A 3JWIA 3PG5A 4BN5A 4JXKA 4MQEA 4OHOA 5LZ7A 4CUJA 3L7KA 3A6JA 2PVCA 3A28A 2R1VA 5KI6A 3J81A 1VLVA 1I13A 1M66A 4F4CA 3GRPA 4OL0A 1R6AA 2HJWA 2IYYA 2PUVA 1FJXA 1NU6A 1K5GA 1NXXA 4XGQA 3W2IA 3R9WA 1KDYA 1BOOA 3OQVA 4OB7A 4AP6A 1K7XB 1L1FA 3PC3A 4N82A 5AI9A 2VXBA 1GKUB 4ZWNA 4BHTA 5I45A 3IKLA 2P79A 3RSFA 1PEKE 3DBIA 2BGMA 2CBZA 3L0ZA 5GM2A 3HYTA 2BMDA 3HNPA 5IHXA 3U13A 3UJ6A 2JAOA 4CTMA 3LOUA 4DCJA 4MUAA 1GGKA 2X4GA 3IPAA 3QENA 3TW8B 1XPRA 3MF4A 1AOXA 1Z62A 1QIJA 1E6KA 2VPIA 1ZINA 3AB3A 3NDIA 4G1CA 4P93A 1X19A 4TTPA 1RYNA 4F93B 3KQQA 3VR5D 4Q3CA 3UB4A 2O8EA 1JJIA 1NXVA 5JY1A 2DTXA 4WBNB 3KKOA 2W00A 1JDBB 5IT5A 1U0GA 2C07A 2JAHA 4M7OA 4PHFA 4OP3A 1GPLA 1E69A 1UBHS 2LBPA 2VAVA 5C1DA 5T4EA 3X1DA 4XD2A 3TQRA 2RGCA 2F1JA 4DCUA 2RKWA 1P2FA 5HRAA 4X61A 1Z5VA 1ZN9A 2PZ8A 3DDCA 5BRNA 2IPXA 4OQMA 4CDNA 3WMFA 4MW9A 3DAOA 1M1XB 2W2PA 1YQXA 5CVCA 1YMVA 4IRUB 3ETCA 2F3RA 4FEGA 3JAMA 3Q2IA 4V38A 5EJFA 2AYYA 1NUQA 1U2DC 3H9QA 2C3UA 1SVSA 2C1XA 4REQA 4ZI7F 2PUGA 5KCZA 3OIWA 3VR4H 2NUBA 4AT1A 2EW1A 3INTA 4A6XA 2XQKA 3VC1A 4EYEA 3HKCA 4W9NA 4A6DA 3G0BA 1J8QA 3GVXA 2QV0A 2ZULA 1QO7A 2CXQA 4P4GA 2VJKA 4C6TA 3UXEA 2ZUTA 2HN9A 3N7TA 4EG8A 4ZHQA 4RK7A 5KQLA 1FW6A 2RGWA 1T5DX 2IELA 4CKBB 5K0JA 2O2YA 4ADSG 5CUQA 3PF9A 2G82A 3ORFA 1C9DB 3RW9A 2GRUA 4LXUA 1NJSA 4KO2S 2A57A 2QD5A 4H3HB 3DA8A 2XRYA 1ORIA 3A14A 5DGHA 1NBEA 4K9SA 3BULA 3B2EA 4M21A 4DYDA 3U7HB 3DWFA 1JDUA 1RHRA 5CT5A 4J03A 4YNBA 5FNVA 2ZIFA 3O92A 4YXWD 1DX9A 4G4SP 3GJ3A 4GHWA 3GOQA 2X42A 4KIGA 4QFBA 5CW2A 3KWJA 4HNVA 3TDKA 5HIIA 5CMLA 3SR0A 2HU5A 5BORA 2QQGA 2QSYA 1OHHD 4JD5A 1SQSA 1N6OA 1EXVA 5JSKA 3AF6A 3KZOA 3C7DB 5CTJA 1XAIA 2ZI6A 3LUCA 4G0MA 1YJCA 2CMHA 1GXSA 2WSSD 1OWOA 4X1IB 3GELA 3LD9A 4CIDA 4YV2A 3TK1A 3TQSA 4J91A 3SYNA 1MENA 4BNNA 3KPYA 1VGVA 2PV0A 4BQOA 1CS0A 1CFJA 4AN4A 3GLFE 1VE7A 1E1RD 2YDXA 1Y3FE 2KLBA 4UFOA 4KLCA 3WRVA 2VYQA 3G82C 1YULA 3P9IA 4HFJA 1IB0A 3EF3A 2BFWA 3R5HA 3GLIE 4DLNA 1QG0A 1FXUA 2FX2A 1JMVA 4EMTA 1NR5A 4YGYA 4ZQIA 5KYNA 3PEFA 3V48A 5DYTA 4Z7OB 5JD4A 2NO0A 4M86A 2N1BA 4A8TA 3QKWA 4C4RA 2YFKA 4Q82A 1QIDA 4MPPA 4B6QA 2FOIA 3K1YA 4FR5A 1SCNE 5CFZA 3GC6A 4WOJA 4X54A 1SVMA 4NICA 3CXUA 4ZVTA 1KQNA 3E18A 4F6RA 5KTYA 3LGXA 5EJ8A 3RWMB 4RY2A 4Y1RA 1IXZA 3FMOB 5LIRA 2XW6A 2AR7A 4MUMA 3COPA 2B92A 1WMDA 2CNDA 3D3NA 4ZGGA 3IAM6 1BWSA 1WHSA 3C3WA 2FPWA 3IBSA 1WG8A 3TW6A 3UOGA 2IYLD 2GFHA 2NPFA 4Z1OA 1MUUA 3G5MA 3PNQA 3GT7A 1SKAA 4AKSA 4DOMA 2WSIA 1XQYA 4RPJA 2G77B 5HS6A 2XMSA 4O25A 4JUIA 1W46A 2WBLC 5KNCA 3KD2A 2QUKA 1HY3A 2BN4A 2PSFA 3EZ9A 3CYFA 4HAXA 3EVBA 4NL4H 1YZLA 2XGOA 3OT1B 3W5UA 2VNHA 1VSQA 3HCAA 3UJ7A 1WABA 2QX7A 4MVXA 3KZCA 3SIRA 3LRTA 4ZGWA 3WLLA 3ZVLA 2MSWA 5DO9A 3NTVA 2ZQZA 1QR2A 4QSHA 1PTKA 4AKGA 2HC9A 1JEOA 3JYOA 1E4EB 1T2FA 1ZRSA 4NYMQ 2J32A 3X1MA 5BMVA 4RTNA 4WESA 4ER3A 1QH8B 2JAQA 2H4FA 3TLKA 3BXHA 5ALMA 5BN3B 2C2HA 5JJBA 2AOUA 2PMBA 5DXAA 1P7YA 5HIAA 1JHOA 1XRJA 3THWB 1CQXA 1KMHA 2X5KO 4RA9A 3PNBA 3RK4A 1S2OA 1HDXA 4GE3A 2WQZA 3H1FA 3ONWA 4X85A 2ZSKA 2O2ZA 2OCAA 4GMFA 3KPVA 4US0R 2V6MA 4K9QA 3OQNA 4DB2A 4F5EA 1EFPB 1O3YA 2IW1A 4AMYA 2IXBA 3EXFA 1VPVA 3PGKA 4CG1A 1T2CA 1JVBA 2D6FA 5KIAA 2MINB 4GEKA 4QU9A 4WNYA 2JD0A 3G2MA 1T8YA 1KMQA 4MPTA 2W0SA 1JE0A 2H9IA 3E03A 1KP9A 3EWAA 4HZGA 4Q9IA 5E8JA 4WBNF 2C59A 4MJXA 3LE8A 1A5SB 1AB6A 1D4OA 4MW7A 3LKDA 2H5EA 3Q0TA 5FB3A 2RBEA 2BFBA 4L6IA 4ZVVA 5JRDS 3I9LA 3L1KA 1T2UA 4EKNB 2X7XA 1A4RA 1EGHA 5AKXA 2WILA 3PPWA 4GIBA 3THYA 3W5JA 4GRDA 3RNOA 3X1KA 5L6MB 1YRLA 3ET4A 1KO7A 2PANA 1FA9A 3ZCPA 2FJUA 3RJZA 2JJ2A 3QPAA 3ZWBA 4G9EA 5J4KA 5I51A 4PGGA 5TE9A 2OXCA 4G24A 3ZG6A 1B15A 1DLIA 2I8LA 2N1MA 4JK3A 1OXUA 3V33A 4D4KA 2NSJA 4CKCA 1JQBA 1AK9A 2JCSA 3WGQA 3BBPA 2WM3A 1HFJA 2Z9CA 6YASA 3RJMA 5AJXA 3H04A 4G0XA 7MHTA 5EOVA 1W93A 1AUOA 1D0IA 3RSSA 4A2QA 4ICIA 2ATCA 4R8KA 3AR3A 3BQMB 4W1PA 3N8DA 4BC1A 5HK9A 1Q1QA 3ZIUA 1ZLXA 1GZ5A 1ZGCA 1B8NA 1KI9A 2HA7A 2WFAA 4KN6A 3SBEA 1WJGA 3UAXA 3N87A 3W1VA 4YR9A 1GG9A 2VL7A 1S6YA 1ECBA 1USVA 1BMFA 2HMAA 1CDOA 4G63A 3EQ7A 3FCSB 3OEED 3ENWA 1RQLA 2I8CA 4KITB 5IKEA 1YZVA 1X7HA 3GD5A 3TKYA 2YMPA 2BH9A 1LXCA 1OJ7A 5HDBB 3O8RA 3L93A 1YIAA 5LLDA 3AETB 3HH8A 3L6CA 4LN1A 3IE2A 2FWAA 4DNOA 1GAWA 4WKNA 4NCBA 2CNKA 4Y2XA 4KBFA 1OLSA 2VDQB 4B3HA 1FFXB 3H5IA 3UT0A 4TWBA 4M7WA 3VKUA 4GX5A 1J22A 1JHPA 4IXTA 3RVLA 3KAKA 3T5MA 3VYRB 3OAAD 4G37A 5BQXA 3ZWKA 1OUMA 1SVUA 3MT9A 5C2JB 1Y4DE 2DFDA 5HGXA 1GR1A 3LTNC 4E3WA 1C14A 1V1JA 4DV2B 3MTAA 1E58A 1P0FA 3PEVA 4ND5A 5CVDA 3GUZA 1T8PA 2P35A 2XKBA 4UARA 4D9NA 2VWQA 4DLYA 1UBNA 4MQEB 3KE8A 5A02A 2YMLA 2WF9A 3L40A 2RB5A 2QL7A 2R1VB 4AZ0A 4O63O 5BV1A 1M1YE 2BV3A 2GLTA 2X14A 4C7MA 4EDHA 3EF0A 1SULA 2JLBA 4PR0A 2ZB3A 4ZT4A 3UWDA 3PFHA 2IOQA 2HAEA 4OHKA 7ABPA 4QEDA 5HUQA 2XYRA 1TKRA 2QTWB 5KTOA 2PA0A 2VK4A 3AF5A 4A0RA 1MHPA 4B8WA 4D46A 4F4IA 5FF9A 3PR3A 5JAZA 5LD2C 4L4UA 4XRRA 3OZAA 1N9ZA 1YZKA 3QI7A 5JCXA 5IK2D 4XFDA 4ZMSA 1UBKS 1ND5A 4DIKA 3GLGA 4MAMA 1ID1A 3B9PA 3H1GA 5TVKA 4ROSA 3SHWA 1DBWA 1AB5A 2YWFA 3L8EA 2AZDA 1FMLA 4UHCA 4AKIA 5JALA 2VPTA 3WIOA 1OTHA 4J0FA 1VG0B 1D2RA 2PUEA 1W0KD 3QFFA 4JODA 2R6ZA 3KSMA 5M04A 5KBYA 4YJDA 2M6KA 1C0KA 3DC7A 5F1YA 2YNMD 4LTMA 1HEYA 1GSIA 3VM6A 4LCBA 1E5DA 2RHGB 1PVOA 3DZHA 1DELA 2V6IA 1OVGA 3I34X 3V3TA 3GJYA 5AT1A 1BFDA 1TDJA 1Z33A 2GFQA 2HIAA 2OB2A 5IEBA 4ZCRA 3L0CA 4Q16A 5L4NA 5LKRA 2G6BA 4BGIA 1T24A 2C9BA 3M6MD 4EYQA 1HFKA 4G0UA 2MSKA 4F4UA 4YJFA 5FV4A 3TQIA 1TTHA 1MB2A 2OLKA 3ZH2A 2PSHA 1B8UA 2WYWA 3U4GA 1O1YA 2OAQ1 2VATA 4GPEA 3NNDA 2BSAA 4G8CA 5DW3A 3VX3A 3COWA 1CXZA 4CM6A 5HX7A 3FYUC 1EVEA 5CXXA 4Q7LA 4UVEA 3F8WA 3NVDA 1E4YA 1DDIA 1SCJA 1ZN8A 1ZIXA 1IQPA 1UBSB 2C3PA 3ONFA 4KQGA 3WX0A 1XMSA 3KSBC 3QUAA 5ETJA 2I66A 1PJCA 1ZXXA 3WIVA 4NI5A 4NZPA 2WW8A 3I9V6 4FBGA 4KKVA 1U2RA 1ESCA 3HKCB 3V7FA 3AU8A 5IX8A 3A3YA 5B1EA 3SC3A 4Z86A 1L4EA 2HA2A 2CNWD 2PLWA 1TZBA 1YKGA 3CGWA 3PC6A 2OOKA 4R1QA 4C6TB 2CJYA 4L5YA 1PSZA 2MTBA 2WHYA 3R5FA 3W3AA 3KWLA 1GPAA 2Z2KA 4QG7A 4QQKA 5BY2A 3BFKA 5HBRA 1X80A 4R71A 1XMPA 3QUBA 1XELA 4K40A 1TI7A 2OC9A 3EFHA 5ELMA 3BGDA 1RHQA 5F2NA 1CYEA 1EG7A 4W8GA 3N53A 5DZSA 4WZBE 2HWXA 4DLZA 2J3LA 3ROMA 2A9PA 2VDJA 1CUXA 3RVKA 1UZUA 2H65A 1M0TA 4KO3S 1UBMS 1O5OA 4YROA 1RQNA 2ID8A 4D2IA 2WT4A 2VYVD 1TM7E 1C0PA 4IQ8A 4PEVA 3V4RA 1BEEA 1VHJA 4GQIA 4F97A 2W2TA 3OQ1A 5FOWA 4DV0B 1E7WA 4GVXA 5C51B 1CERA 2XPCA 1NXQA 3UHFA 1NSYA 3BSWA 4EQZA 4C0JA 1GXSB 1O8BA 2GUWA 2UYHA 5CIWA 5EGSA 3I42A 3P27A 1ZM3A 5FTWA 1CS0B 2BEJA 3W4JA 4DG9A 2C4WA 3U3XA 4HMOA 4KR6A 3TBKA 1QK4A 2HJRA 2G04A 2VUUA 2X8BA 4PVDA 1IJEA 5FA8A 1NE7A 4MRSA 2NZWA 4YASA 5HS4A 2OYSA 3KTAA 3OTIA 1XR3A 3FE2A 1GPBA 3QFCA 1R3DA 5C34B 1IM8A 1XRRA 1SKYE 4HS9A 4UZFA 3IPRA 4NMMA 1H4QA 1N1GA 2P9HA 2QP3A 3PIIA 2PKCA 2D2FA 1KYIA 5E2AA 4ZT3A 3PQ5A 2J07A 3FKSD 4HUQA 2X13A 4DUGD 1I6KA 1C8BA 4MW0A 3R0JA 4F6RB 4NZYA 2ORWA 3F4KA 3EAGA 4NBUA 4Y1RB 2NQ8A 3AVOA 1P2DA 5H59A 4CL3A 1M1NA 3GVHA 3WP1B 5KWEA 1XD9A 2GT1A 1WHSB 2BHNA 3CA8A 4KO8A 5IAAA 3IBFA 3P2JA 3JVIA 2NXCA 3URKA 4UDXX 3E3OA 1J24A 1IXSB 2C20A 2A9FA 1M76A 4OUDA 3K5PA 1T9GS 2HD4A 1EP9A 3P52A 4FKZA 5A4JA 3GRCA 3IDAA 4I6GA 4LF8B 1GGMA 4FMCB 4JQCA 2R6CA 2R8ZA 4C7OA 5A4DA 1EPUA 2V54A 2XQGA 4WKBA 1S96A 4ARIA 4MCIA 4GPIB 1HURA 3U16A 2H1VA 1IIBA 2DFTA 1L4NA 3OPVA 1BD4A 1C7QA 2GGSA 4IDPA 4HMPA 1XZFA 3LP6A 1JX6A 2G9ZA 3EMKA 3LG2A 1LFAA 2VC2B 3PJEA 4KACA 4DPMA 1OYYA 4IVQA 3WOVA 1AHHA 1S2IA 4KQFA 3PXCX 1TO2E 1HOXA 2AMVA 3PQCA 4TPKA 1QVAA 1CR1A 3DZJA 2AOUB 2B7LA 1D2NA 2HMWA 4CL0A 3SYRA 1KO4A 1IK4A 1KMHB 1YZFA 2GD6A 2CZGA 4N5DA 4RA9B 3RFXA 3BN3A 3EEIA 3GO4A 3IVMA 2GRJA 4JNCA 2AN4A 3X2FA 3EXFB 1FX1A 2OZPA 1THMA 2VQ6A 1TT7A 3DB1A 4MWCA 2HMYB 1DC4A 2W9XA 1XKLA 1RJFA 4IO0A 4WV3A 2EVWX 1IHYA 4RPGA 2VHQA 2PZJA 4N0PA 3Q40A 4HZIA 4EVQA 1ZD4A 3FB1A 3MCUA 4I5GA 2FCAA 1F5NA 1SZCA 3N2IA 1Z07A 1MVLA 3KJHA 1SUSA 4GXQA 3KSDO 4NE2A 4Q9LA 3IAM1 4FM9A 4BTLA 2A0UA 1PLLA 2JK1A 4WCFC 3MCZA 4YUYA 4U6QA 2QG9A 3PVCA 2AXQA 4N5IX 3THYB 3EIFA 4NCXA 2KWIA 3LSYA 1E8DA 3R3XA 4IRMA 2XRFA 1GY8A 4R1UA 4CMGA 4WW0A 2P2SA 1J7KA 3NBYC 2Y0DA 4W8OA 2C00A 1XZNA 3WIDA 3NM4A 1NY5A 4IDFA 3AF4A 1XALA 4LSMA 4B3CA 1OV4A 4NC9A 3OZRA 3VPHA 3VNVA 2CMDA 2IEBA 4JFAA 1EFKA 4EY3A 3KWFA 2I76A 4ZAFA 1MOPA 4CKCB 1YA6A 1UK6A 2I7TA 4WUVA 5K8TA 4I1OA 4MV6A 1XNHA 3VO9A 2VF4X 4EHKA 4Y9TA 3TZEA 1ZU5A 3AU9A 3QUCA 1AH2A 3ETJA 1R8JA 2GXSA 2A9JA 4QDUA 4ER7A 4MDFA 4MARA 2GDZA 4YAWA 1Q83A 2W48A 4D4GA 3WMGA 4M8IA 4WEOA 1JBQA 5C4GB 5LIPA 3NVMB 2CMKA 2H7CA 4KWCA 3SX4A 2BEUA 1FYWA 4MVCA 4HI0E 5HIJA 2WTAA 3CLSD 4QHSA 5ESRA 2FWNA 2V6JA 4GLJA 4LDRA 1YI8A 3ADOA 2QI9C 2WTMA 4Q0MA 2F3SA 4NBLA 5F2KA 1VPLA 3BZWA 3FCOA 3EDQA 3TG2A 1EFRD 2CHEA 3DXXA 4PHGA 4RLFA 5DYNA 2W83A 2Y05A 4DCSA 1Q2XA 2LDBA 4E5MA 4F12A 4FX5A 4HAIA 4JI5B 3ZIAA 4EEKA 1L3CA 1CEYA 4P36A 3JR7A 1JQ3A 4FEYA 1PS0A 2BMAA 3JAKB 4A27A 1TD1A 2XBMA 3FMFA 1Z2CA 3CG4A 4M0FA 2J7PA 2XJ4A 1VBKA 1JB9A 4C4OA 4I1YA 4FFRA 5FBKA 2WC1A 2P2NA 3TRKA 2CZQA 2R2GA 2V7UA 5K3SA 1RC0A 1GSAA 2I1WA 4KK4A 1ZRNA 3RVOA 3Q9LA 1MNQA 1ST3A 3DTNA 4OXNA 1GKIA 5B1SA 1NHGA 3JWEA 2DBZA 3IALA 3ZQ4A 4AZ0B 4I6JA 3LUKA 1Y6GA 4U8GA 4LBZA 1QYWA 3AESA 1DKLA 1GNLA 3IQZA 1I7PA 2D3WA 1PR3A 4QPJC 4HXGA 4BX8A 1FDUA 2O9JA 2XUKA 1Y3DE 4WGGA 4BMXA 1D07A 1HNZB 2Y71A 4WK4B 1IQRA 1B3BA 5H70A 3LIPA 2EYUA 3PLNA 3T0FA 4ENRA 5CPBA 4EY5A 5AQ1A 3VH4A 2C61A 2AOWA 4E03A 4HGYA 5ALYA 1LS1A 3P5SA 3GLGB 3K0EA 1ESZA 2VIIA 3P9NA 4GOKA 1T8TA 3Q7PA 5GGYA 5ALJA 4AULA 1U7PA 4TVOA 4WQMA 5L7TA 2XUDA 4BOYA 2GZ3A 221PA 4OM7A 4BN0A 1KU0A 2ZB2A 4C7OB 1KK2A 3HN6A 4FMCF 3SQDA 1JKFA 1IATA 3UKJA 1P61B 4A7PA 1FTGA 3AY0A 1R6UA 4DLBA 1DQRA 1H0KA 3B5JA 3D2LA 1H69A 2B8TA 1QUEA 4LVOA 3PFNA 2FSVC 4P3XA 3U37A 1XRLA 4D8UA 8ABPA 3PEYA 2BYTA 3F3KA 4CZ2A 2OAEA 1Z88A 1OYOA 1U5BA 4YJFB 1E6UA 1SUCA 2HX1A 2R00A 2WF6A 1BX0A 3B5IA 3E22A 2MR5A 3X1YA 1E3EA 1E5VA 1MC1A 1MJGA 4KPYA 4UEQA 5H82A 1XZAA 3A10A 1H2FA 4EW1A 4R81A 1O54A 3BJZA 4FQ7A 4L0MA 2WJWA 1NW4A 2MIIA 3I9NA 1DAGA 2Q21A 1GNQA 1KFKB 2ZYUX 2ILTA 4UUOA 5LFAA 3SQXA 3H2JA 2OT3B 5CXQA 4QJIA 2ZUBA 1M5UA 1FMCA 4W9NC 13PKA 2WZCA 4QVGA 1CNMA 1X77A 3C8UA 4L51A 3RIGA 4R1PA 1UFRA 2ECOA 3OPYA 3QPVA 4QKQA 3ZI4A 3I4LA 1ZD8A 3ZYZA 3W5AA 2B30A 5A5FA 1G6Q1 2VHUA 3FTPA 4NMLA 3ZV3A 3RAPR 4DB4A 4BVGA 1TCCA 3MTIA 1X80B 2AZTA 1BS1A 4E51A 4YRCA 2X0DA 3NNSA 4JXZA 5FYDA 4KIUA 2B25A 1E77A 4HYQA 4B7UA 4UOZA 1EYZA 1EFDN 1MQAA 2XVXA 1VG1A 1RFLA 1Z82A 2B34A 2PRZA 3I6QA 5HQ3B 4DV6B 3KRTA 3H5LA 3HY3A 2JIOA 1GAEO 4HDRA 3O90A 1A82A 1GT6A 2J30A 2NVOA 5LSAA 2WUVA 3JD1A 2EAUA 1WM1A 2I29A 3MCTA 1KJWA 2VDRB 3R3WA 4XWWA 1OF1A 1M1ZA 2A84A 4L8FA 3VC2A 3BFVA 1K7SN 1QVVA 3Q41A 1FOEB 4MYSA 1MB0A 1KE1A 1MO4A 1Y9ZA 3AKYA 4K3UA 4OY3A 3SC4A 3AV3A 2UUPA 2ZIWB 3H9JA 1X86B 2PAAA 3N74A 4B6EA 5FKJA 4TWAA 2Q9BA 2NU7A 4JBLA 3KB8A 5DTMA 4ND6A 2O2EA 5JXIA 3NNNA 3X2SA 3G88A 5FWXA 4Z2YA 3LV8A 1EQUA 2ZFUA 3D4LA 3HA3A 3K8ZA 3VJLA 3T12A 4QTYA 1ZRHA 2FCRA 3KTAB 4P32A 5C8DA 2ERXA 4QUHA 5EZQA 4BFXA 5GVSA 2B4YA 1OIVA 4IX1A 4BL5A 3D7KA 1MJ5A 2AQ8A 1K9SA 2AV6A 3RYCA 3UTCA 1IVYA 5JXWA 1ORRA 2O7RA 3I9V1 5K3FA 3RVQA 3ZWXA 4W82A 3B3QA 1PWZA 3ENKA 4M1EA 1M1NB 1YMQA 2GPAA 2VPXA 2IV2X 2ZYVX 1G8YA 2F67A 2QK4A 3KXKA 3TLCA 4QTZA 1I3NA 2ZIXA 3H2IA 4YJKA 5KWIA 1IN1A 4OUDB 2KW5A 3GPLA 2SKDA 1UKBA 3OECA 4HAWA 3AOGA 3RVRA 2D1FA 2ZAMA 1E66A 3QTLA 4IHKA 3TDMA 3CKYA 3JS5A 4MHOA 5TVGA 5KNDH 1NUPA 1SZDA 1SU6A 1QU2A 3SZLA 5E6SB 1PQWA 3VPBA 1DC3A 2P69A 2J3KA 3SX2A 3CQ9A 3NW9A 4D97A 5I3CA 4D26A 4KGDA 4B80A 2Y1FA 3EY4A 1F2TA 3HCCA 3IUNA 2PLNA 2QE6A 3SC2A 3W77A 3ASYA 2F3TA 1ST2A 3F5QA 3OM8A 3UJDA 1AKTA 3VPAA 1P9OA 2ZYSA 1GCGA 3V4FA 1E7RA 1W88B 1RLIA 4L76A 1WXWA 4LISA 1P4RA 4MEBA 4P81A 3SN6A 5KNBA 1Z39A 1IBLB 3ETNA 4LGMA 5DWQA 1D8AA 3OCCA 5BSWA 1FQKA 2BBOA 1YBVA 2FUNB 1F0YA 3CW2A 3K2IA 3TRIA 3WGNA 1WZNA 8AT1A 2WTBA 1NVEA 2C42A 1EXDA 4A26A 3QXXA 4OQLA 4P3PA 5AXAA 1MEJA 3EEQA 2C4TA 2P9GA 3LA8A 3MELA 2AVDA 5K4HA 3ELDA 4FHDA 5IDVA 3VR3D 3VI4B 3KQMA 4QECA 2PYZA 1AXGA 1XJQA 3U1TA 4W5HA 2FX5A 2J9FA 3RREA 2EYQA 4WA8A 3NZEA 4ACAA 3CNHA 1G7TA 4X9XA 4F5YA 4D25A 3N28A 3C98A 4KDRA 3UICA 3LUFA 4F1WA 3KHKA 4NHOA 1Y98A 1VGQA 2E55A 2G08A 5HGJA 2EDCA 1WO8A 5K8CA 4FS3A 4JQSA 4RHYA 2F8LA 1UBUS 5DBGA 3F9IA 1E99A 4IDAA 3W7VA 2RH5A 4JLVA 1NNUA 1R37A 1U0RA 2OWEA 4IUCS 3UXHA 3ZGLA 2QVYX 2HSZA 3FWKA 3KTOA 4MRVA 3M5PA 3EXEA 3WKEA 3UW3A 4J2OA 3DDZX 1BN7A 2HF8A 2QOEA 5LQMA 3QVTA 4OJTA 4MYCA 1NJGA 2VH1A 1V3VA 1TEVA 2HSJA 3IAUA 3U3JA 2PXXA 2OCBA 1H94A 4JBGA 2FR1A 4LHVA 3W2TA 3A3KA 4LNAA 2CCJA 3H4IA 3BJEA 5JSHA 1A5BB 1W52X 3TO5A 2XCUA 4GZ3A 3M89A 2ACWA 1NRWA 2WSLA 3EC1A 5D7BA 1WMSA 4MUGA 4PXYA 4YLYA 3ZY2A 5A4MS 1KORA 1R5OA 5CM8B 1FMJA 2WVGA 1UXHA 4PS1A 3AEUA 4F2HA 1SWVA 1NRJB 2YQ5A 1JI0A 5LBUA 1VJTA 2PGJA 2NXJA 1HNXB 1AV6A 2HPZA 3OJEA 1REQA 1ZGHA 5B3JA 3D31A 4KE6A 1U8CB 1HMPA 4TYMA 1PFQA 3BJIC 2VP5A 3MWDA 3ROFA 3BDVA 2FQWA 2JHCA 3CZAA 4LWZA 2OCYC 1G5TA 1GQYA 1P5JA 1N7IA 8ATCA 3O47A 4YQFA 4RK5A 1N34B 2EQAA 2C8KA 3WGLA 1VE5A 3ITDA 3NDPA 3KOZA 1U7HA 3CGGA 3IEUA 1J5XA 1R9MA 1UDBA 2QAJA 3EPPA 3PWSA 3TVDA 3WL6A 2ZAGA 1Y7PA 3NGXA 3BH7A 1XLVA 3KWMA 3DKVA 4W1QA 3TUJC 5HUJA 1KYXA 2BUAA 1JHXA 2Q3FA 5J2TA 1H1DA 3EEBA 4OQXA 1PLKA 4LZWA 2BEVA 3KX2A 1TIBA 1CP3A 1XVLA 4B9EA 2V03A 4RZSA 2X4IA 2Q9UA 3AM5A 3KB6A 1PTJC 2FW6A 4ZAYA 2JG3A 4CI0B 2HDHA 3FLEA 3M81A 1FVFA 3OSZA 4R2IA 3ITEA 4KMMA 4XX0B 1Y9AA 1SC9A 1ISMA 4KL8S 3O6VA 1HFWA 4MWEA 1IWPB 2GEBA 5DTIA 4Z0NA 3D1JA 3W9UA 2VUTA 1T2VA 2GJ8A 4J1QA 3FTEA 3SKYA 2PIDA 2YYYA 1XDUA 2FR0A 4H59A 3JD2A 4I8XA 4MNTA 4NABA 5EEGA 3DT9A 1VZ3A 2XTAA 3UG7A 4C4AA 4C7XA 1W30A 3AESB 1AIPA 2Z4SA 4D3ZA 3L7DA 4PZCA 5IARA 3RCBA 2OK7A 2H2WA 3IBGA 4HFMA 3USCS 2R79A 1MW9X 1R6XA 1T4CB 2Z56A 1ZW1A 2IVZA 1ISIA 3OJCA 3HADA 4UCXA 4FNGA 1CS4C 4OJQA 2IYAA 4DA9A 3ZLUA 1FC0A 4JR2A 2PQ2A 4OHCA 1PT9A 3MVEA 1RACA 4KMSA 4LUCA 3GF4A 2ECKA 2IBMA 2XWQA 3E58A 2IP4A 4HN2A 4QNMA 2HOQA 5IYZA 1Y3IA 2H51A 1N2HA 4IJMA 1IZ0A 2VHVA 2PSEA 1BRMA 1C7JA 5JV5A 4AF7A 2Y4NA 3GFOA 2P0EA 4DSTA 2X9VA 2BDUA 1BWPA 1WNFA 2VTKA 4GD3Q 3CW9A 5JFTA 5DSZA 1V45E 4TYQA 4Q3AA 3TTYA 4B33A 2JEYA 3UA4A 1KOJA 1R4NA 2V9CA 4HDAA 3EPRA 3L5OA 4EB3A 4RL6A 4Y3UA 2JCGA 2NU8B 1KC3A 2QD2A 3GLFA 1Y8AA 1Z0JA 1U5BB 2ET6A 1FTSA 1H1TA 2CK3D 2ZJAA 4BKUA 3E22B 5A0FA 2AE1A 3MLEA 1UBFA 3LF1A 2OYCA 5JOQA 3ENVA 4LYAA 3GLIA 2IXGA 1ZM2A 4ZOLA 5J9FA 2IYVA 4ZYXA 1YZUA 2PL3A 4AK9A 3B53X 4W1SA 2IYFA 2JLZA 2PJRA 4WLNA 1Z5OA 2O2IA 5T57A 1J2YA 3PGA1 4JQYA 3WK4A 9MHTA 2PRKA 2EIHA 4NPAA 5FHRA 1CZNA 3RHTA 3AY7A 1LI4A 4BMSA 3I01M 3EC2A 5K8LA 3U81A 1M54A 2Q5EA 3FIUA 3LY8A 2BFPA 1GSHA 2WE7A 1VFNA 5DHAA 4P7JA 2C92A 2Y66A 3R3ZA 2ZU0C 5G0TA 1QVRA 4I5FA 4GC5A 3ES9A 3OF2A 2ZI4A 3VMFA 1HA3A 2CUNA 2WHPB 5I8ZA 4E70A 1G4AE 1F14A 2GF0A 2HA5A 2OKGA 2P9BA 2P7IA 3AUKA 2P9YA 3FPEA 1MU0A 4DVGA 5LWQA 3BRQA 4P7GA 3WL5A 2VAMA 4L4RA 1DPGA 1E5XA 2C9CA 4JA2A 3VNBA 5SV2A 4HDRB 3EDCA 2XZPA 3JRXA 2ZDHA 4F21A 1V71A 3AP2A 1GYQA 2VSNA 3SD7A 3NTXA 2D5LA 3VC7A 1I4TD 3L77A 5JH7B 1L5SA 3RLIA 3L0OA 1LLFA 4G9BA 4N7MA 5AVKA 1GDTA 2JI9A 5FPSA 3R8XA 2DZDA 1VSTA 3FMIA 3M5CA 4RS4A 1TPZA 2EGGA 2GN6A 3FHLA 3PKJA 4IZ6A 4MWGA 5A3VA 1P8AA 2NU7B 4R4JA 5T8KA 4C4YA 3RS2A 3T7SA 3VVMA 3UFXA 5FWXB 1KEEA 1XRPA 1IM5A 2PZMA 1VJCA 3RRXA 3HJRA 1Y7LA 4GOOD 4U2FA 3RC7A 2C2MA 1ZK4A 4MO9A 5JAUA 1XZJA 1ZCBA 2BUBA 3H13A 2I3GA 3H6KA 2GMWA 4IR7A 3BHMA 4RMGA 1U0LA 3UHAA 2ZRDA 4PSDA 3RYCB 1JTEA 3AJAA 3TL2A 4DSNA 1KI8A 4E12A 3PC2A 3IMGA 4BAGA 2RHCA 3ECSA 5K3FB 2CXTA 1DKRA 1NVVR 1T35A 2BFDB 2NV2B 3IMCA 1OX6A 1LSSA 3N0VA 4PICA 4Z8XA 1BXZA 4XA8A 1JEDA 3HTXA 4IG9A 4G0NA 4CIAA 4RTPA 1MRZA 1DB3A 1Q0RA 2YZNA 2ZIXB 2XWSA 3HVKA 4IXNA 1E9VA 1YS4A 5KYVA 2CJXA 1WPRA 2Q2NA 4H60A 4I50A 1N5IA 4EITA 4QQ8A 2G5GX 2YR0A 5CJPA 4PBRA 5LZ8A 1GTVA 1C80A 3I32A 1WDTA 3F5DA 1EAYA 1U0EA 3EGXA 4NXNB 2WD8A 1VMDA 1L1EA 2W6QA 4KDCA 1RBMA 4NOLA 1RRVA 4P53A 3OFND 4EHIA 3BXZA 1F2TB 2JRLA 3CUYA 2OGWA 2ZR8A 3SC2B 1P7ZA 2MJLA 4AF8A 1VJDA 4JB3A 3ST7A 2O7SA 4CLXA 4S35A 3VU0A 1QUFA 3I6IA 4R0NA 1JIUA 1TU4A 3I2GA 3MCAA 2HF7A 4K6OA 4AO7A 5I4CA 3UF0A 5C8XA 3T06B 2QD1A 3L07A 2OORA 4LNHA 3S40A 1K7YA 2F1RA 2CLHB 1KI4A 3QITA 4A36A 1NHWA 3GFGA 1KWKA 2ZRAA 1VMIA 1JA1A 1KY4A 1QQAA 1JAIA 1VXOA 4NMWA 2HA6A 1OJLA 5LN1A 1SD5A 4MKZA 4NQZA 3QELA 1VL6A 2HMVA 1KI3A 1R88A 1U3TA 2I1LA 1B7GO 2Q45A 1P9RA 2RMKA 3FTDA 5SYMA 3UT5A 3VH1A 5HR5A 4YP9A 5E1OA 1EJ0A 5FP0A 1WV1A 4YAIA 1EJBA 1FU7A 1NPYA 4BLQA 1MQSA 3PDJA 1SOUA 2QVGA 4GPBA 2RBKA 1S3FA 2OXRA 2H29A 5IBQA 1ZA1A 3KFLA 5A9RA 1QWSA 1VMKA 2R7AA 2A35A 2HUPA 1TKAA 3QE9Y 2GZSA 4P4TA 1UK8A 1U0NA 1FBNA 5HKAA 3ED1A 3CLTC 4QARA 3QTTA 4RZHA 4M9CA 3QXSA 4L27A 3KZMA 3IP7A 3C4QA 1O94D 1M10A 4KVGA 1INLA 4PHCA 1B1AA 2D2XA 3EXEB 4BBPA 5AVQA 5FWYA 4OXQA 4L85A 1XD2A 5M34A 2QBYA 1Q3KA 5DRYA 1CNFA 3NBXX 1CV2A 1KOFA 1DCKA 1TZKA 1M1YA 1WDLA 1EUDB 2OR3A 2Q3JA 2W8ZA 4X20A 5B4VA 5M7EA 5A04A 5MHTA 2PKQO 3M6UA 2W11A 4CU5A 3EXG2 3DZKA 1KY3A 3ANXA 3ULKA 4ED9A 4S1VA 4AC9A 4RD3A 4DW8A 4NH0A 1B0PA 3A1NA 3DHVA 5YASA 1EFAA 3SSAA 4MGYR 5DHPA 4IP0A 1K2WA 5EXSA 2I54A 1BX1A 1D6SA 2BTEA 2BW0A 1XA3A 3AEUB 4XJSA 3DMRA 4FR2A 4D9BA 1Y5MA 1Z0FA 2PKYX 3RDPA 5JRZA 4IDCA 5K7SA 3C1UA 3FR7A 5I3ZA 3OZDA 1REQB 3NYIA 1IPEA 1NONA 4JOSA 3U17A 4BRWA 2Y6UA 2ADMA 3EVNA 1IBMB 4GGPA 1OD6A 3MWDB 3EISA 4JBXA 1ZNZA 4BFZA 1XG5A 2VF8A 2J0VA 4XIFA 1DO2A 1DAEA 1I9GA 3JCZA 3I04A 1BJRE 4UOEA 4YMWA 5CNKA 1MIHA 4BLPA 1KO1A 3HXQA 2GH1A 4ZAZA 4HCJA 3SSNA 3EH2A 3K9BA 2R8XA 4GH5A 5K0TA 5JNWA 1KI2A 1H6CA 2CVOA 2AJBA 2YJ6A 3EZLA 3SE7A 3VTFA 5DPMA 4E3ZA 2B99A 1VHQA 4DJ5X 3BWBA 4XDYA 1L4UA 1MJNA 1JIXA 1EGQA 1QCDA 1EVIA 1UPCA 1XAGA 3FTCA 3INNA 4MK4A 2OHFA 3WK7A 5B6JA 3IILA 2Y1LA 5JCOA 3MTJA 2IU3A 2A5LA 1CLEA 3KTDA 2FFQA 1GEGA 2GQ0A 1D5WA 2YVUA 3ML1A 1DRVA 3MN1A 1YE3A 3QMMA 1CP2A 4D3YA 5HKKD 1WXGA 1GGFA 4WY2A 4BNIA 3WBKA 2A5GA 3U5TA 4D9KA 3FZEA 3KYJB 2B37A 4RJJA 5AVZA 3WS7A 5TQ0A 4KG7A 4S2EA 2YJGA 3U7GA 5F3DA 1BEUB 4LFCB 2WSMA 6ADHA 3CXRA 1ML3A 3SEQA 3VOSA 4YMVA 3CRMA 3I2HA 1DEAA 1TFUA 1ZK0A 3H2GA 2A5FA 3ZZMA 2HRDA 2Q5IA 5FO0A 3HZHA 4D6XA 1JG4A 5AVOA 4RHEA 3FUXA 4R8MA 4BNDA 3ZDCA 1ZUD1 5EMHA 3EG5A 1VOTA 4A0GA 3IOBA 5DOVA 1U99A 2AMJA 1Z6ZA 5U4XA 1GZUA 2GXQA 1VE3A 1C9MA 3A1CA 2NPIA 3K9LA 1N6PA 3B1KA 4QYTA 4O4LA 1JXOA 3RO7A 4OQFA 1USUA 2G1AA 3A1DA 3IQFA 4WZBA 1RWOA 5CVUA 3EY9A 5ICGA 1BMDA 2QTGA 4B4KA 4BZWA 3FF4A 3I62A 2IODA 1V1RB 4YP6A 5IWCA 2CFCA 1CR2A 1Z8DA 4P98A 4RYDA 3PKZA 2C9DA 5K8UA 1S3IA 2ZZMA 2XGGA 1IRXA 1USWA 2C04A 2BJHA 2ZJFA 3A0UA 3AI2A 1R4NB 3PNVA 1ECCA 4MUXA 4PX5A 3T1TA 1Z6PA 1E2QA 3GLFB 4FK8A 3QKUA 4KQ9A 4JASB 2NSHA 4J1SA 4R7TA 5AKLA 4O5AA 5KJEA 3I58A 4JH0A 4BWVA 5D6NA 2I3BA 4DLUA 4B7XA 4BFSA 3GLIB 5IVIA 1NI3A 2Y27A 3RTAA 4JIMA 2N9UA 1JIVA 4RJ2A 3ICOA 4JJAA 4V1CI 2MSLA 5C0OE 4P38A 3P0HA 1MOQA 2EZUA 2HU8A 1Y48E 1HYQA 3QU7A 4G1BA 4QL3A 5H16A 4CMHA 4E4TA 1TAUA 1W29A 1T5TA 2PUTA 4L73A 3D0RA 3O21A 4CXMA 2X8WA 4N12A 5ALHA 2XLCA 3AFOA 4PO3X 2FUG6 3HM2A 1USIA 2XUJA 2WTUA 3UQYS 1BW9B 3ADKA 3BA1A 4N8EA 3CKKA 2OFFA 1NR7A 3GPDG 1FSFA 3KUCA 4L22A 3RU9A 2WYOA 1YONA 1F60A 3OIYA 3FETA 3GEIA 4YRLA 4DARA 1YE5A 4AMUA 1F7VA 1XN1A 2D54A 1RXUA 4UC0A 4FHGA 3OKAA 4PGHA 4FMBB 5KQRA 2IH4A 1WDKA 5E1BA 3KYCA 3QKRB 4MQMA 3VOBA 4TXHA 3RC1A 1J8YF 4Q4CA 5AW6A 2QHXA 4ZRMA 5JHGB 3TIFA 4EP1A 4OSEA 4JLKA 3ROTA 5B7PA 2FEAA 5I4IA 1W34A 1P2SA 4LQDA 1NVMB 1W94A 2XQVA 4GM4A 1EK6A 2D7CA 4Z4IA 1NVUQ 3C5EA 1MC8A 3NIGB 3NHLA 1XVVA 4C7VA 5BWMA 3RAFC 1XZHA 2PD3A 3JAWB 1RM3A 3M9LA 1NOJA 2CLIB 2QPAA 5G0UA 2YWCA 4YJ3B 2OP0A 2VA8A 2ZTVA 3CKLA 3IR6A 3CVYA 2NU9A 3GMIA 3E81A 4F11A 4PXSA 1MZVA 1R8SA 1L8AA 4IYRA 4Q4HB 4JB0A 3J81k 4MCJA 2QQ5A 1X9IA 4ZEOA 1JIJA 4FOLA 4WFQA 5H83A 2DKOA 1MG0A 4OBXA 4B6OA 3ETDA 4JL8A 5DYWA 5DXFA 6AT1A 3KXIA 2FEWB 1KEEB 4IIVA 3HLTA 2QROA 2F1IA 4XSVA 5ARDA 2GFIA 2GJ4A 5F64A 3DVQX 3OTGA 4ATNA 3BK2A 2IUUA 1BU5A 2A94A 4OJNA 2HCRA 3IUSA 1NVVQ 5EHXA 1WWKA 4W6QA 2D4AA 4FJ0A 1B23P 1AM4D 3QA9A 3OMXA 4B76A 5D7NA 5G1PA 2BJWA 3DFUA 3BL5A 3S70A 3VR4D 1ACJA 2LWIA 2BFEA 1B6TA 3T3OA 1TAHA 4TMZA 2R6AA 1HSOA 1HYBA 2WABA 3V1MA 3O91A 2HRQA 3I5AA 5J2TF 1EXWA 2VHWA 1Y6ZA 4G9GA 3I8XA 5C8YA 3U3OA 3EXHC 4JQZA 2W2KA 4I50B 3GLVA 4B7AA 2BFNA 1AE1A 2R8OA 2ATEA 5KDOA 1YWGO 1I7QB 4L16A 1AGYA 1QHSA 2V0CA 4I4NA 2JZOA