2X19A

Crystal structure of importin13 - rangtp complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
172
structure length
172
Chain Sequence
b'GEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGLEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-BINDING NUCLEAR PROTEIN GSP1/CNR1
publication title Nuclear Import Mechanism of the Ejc Component Mago- Y14 Revealed by Structural Studies of Importin 13.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Nuclear transport
total genus 45
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2009-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2x19A00
1XZQA 3K09A 2PMDA 4Q21A 2VH5R 3K9LA 4KSCA 4CDGA 1G3UA 1KI4A 1G3IA 3WMEA 2DFNA 2ZI5A 3QPVA 2IUUA 2H7VA 2WIAA 1NG9A 3E2IA 1AA9A 4AYXA 1ZM4A 4JKYA 3Q7QA 3GLFE 4JS0A 4FXPA 2Z5FA 2V1XA 4MKGA 4XIGS 2ZITA 4TTRA 3B7GA 2HDNB 3DL0A 2G77B 3QQ5A 4Z8YA 3RSLA 4KSBA 1O87A 3QF4B 2HXYA 3QKRB 4OI1A 1GNPA 2WAXA 1YZLA 1XEWY 3RRZA 2A7QA 4TLDA 4ZIRB 3AKCA 3BXZA 3HU2A 3IKJA 4W5HA 3GLFB 3R9WA 2IYZA 1R2QA 3B60A 2IWRA 1XPRA 3IGFA 1C4OA 1N6OA 4Q4HA 1JECA 1KK1A 1T0JB 2O5VA 2A5GA 1ZJ6A 4IDPA 5JJIA 3U2QA 1OH5A 3ZVMA 3KUCA 1FQKA 4NMMA 4ARZA 1XRJA 2WZQA 2WMNB 1SQ5A 2FU5C 4GFDA 3O8RA 3ZS8A 1M8PA 1XCMA 5JBQA 4DLVA 5EXPA 4QHSA 1SXJA 2CCJA 3NBYC 3AF1A 4DEYA 5JJKA 4NCHA 1GDDA 2Q3HA 2YINC 1YE8A 3LVRE 2A9KA 3CRMA 2J0QA 3C8UA 4S2EA 4DCNA 4KFRA 5DYIA 4BFUA 1GITA 2GJSA 3LW7A 2OCPA 3UWKA 4KFUA 4Q00A 2AD5A 4I4LA 2ZRDA 4C0KA 5LD2B 1KIMA 2XX3A 2ORWA 3ADBA 3PEYA 4QOSA 3TW4A 121PA 2G6BA 4ON9A 3K0CA 4Q7LA 4TL6A 3GLIA 2JJ8A 1G5PA 2WJVA 2GK7A 1KJYA 4B73A 4ACAA 4E22A 2E87A 3CLVA 4PSVA 1W0JD 4A8JB 5CB8A 5M04A 2C99A 3C4JA 4IOKA 4DRZA 4YXWD 1HT2E 5CLQA 1CR2A 1IJFA 2JLZA 2ZRPA 3RVBA 1U98A 2JDIA 2ZRIA 3C41J 3ETLA 3KDSE 4B33A 2XJ4A 2ZRAA 2WSSD 3CO5A 1DO0A 1ODFA 2B8WA 2XEXA 5DH9A 1X86B 1VYVA 2RGAA 2ZR9A 1OFHA 3RS7A 5AUNB 2QQEA 1S3SA 1P4SA 3A1WA 1KDPA 4GSYA 5FUWA 3ZVRA 4EPXA 2PJZA 3PUXA 4LWZA 1J7KA 2VQSA 5DGXA 1HQYE 4OI0A 1JPJA 2IWHA 1W5SA 3A8TA 4P4SB 3TUZC 3FGNA 1IY0A 3I32A 1XX6A 3K0FB 2ZSEA 3G5UA 4ILEA 4AY2A 1JALA 5KYKA 2ORIA 4JBWA 3HPQA 4ERNA 4M1MA 4QGHA 4AI6A 1XEXA 2JGNA 3ADDA 1ZUIA 1TF2A 3BWDD 2QPAA 3W5JA 4CEHA 4M21A 2ZE6A 1GL9B 3LXRA 4KAXA 4TLBA 1Q3TA 4G1UC 5HPYB 2HJGA 1YZNA 3GJ3A 4G01B 4PZLA 4Q9IA 1W44A 4ZDIA 3H84A 4CEIB 2VYFA 1J2JA 4YONB 4UJ5A 2VP4A 3B5JA 4MDEA 4FN5A 4NONA 2GDJA 2OBMA 3EZFA 3WHLA 3OHMA 3E70C 3EWAA 2H16A 1DO2A 2ZU6A 2R6AA 4IDNA 5CIWA 4HAVA 1T91A 1TUIA 3BJIC 2ZJ8A 2ZYWX 4M1KA 2IK8A 4O2RA 4A36A 1SKYE 3CPJB 4QM7A 2XSZD 2ZJOA 3Q7PA 1N6NA 2D06A 4U00A 3TJZA 2QGNA 2ZSDA 4DB4A 1T9HA 4QBIA 4Q9HA 3K0EA 1O3YA 1GRNA 2ZRCA 4C30A 421PA 3PR1A 4CZ2A 1W0JA 4EDHA 3VKWA 4CGZA 1OH6A 4YXWA 1Q12A 4D4KA 4QRHA 5H1YA 1A2BA 3Q85A 1SKYB 2W2XA 3MJHA 1Z0FA 3PXGA 3M0EA 2AL7A 1JB1A 3IDQA 1NN0A 3NHBA 4TLCA 2ZAMA 2G1JA 2Y8EA 1M7HA 3C16C 4ZI2A 2DPXA 1G4UR 2JJ1D 3TUJC 3NC0C 4QC2A 5JWHA 3KKOA 4AG6A 4BFXA 6Q21A 3P26A 2BHRA 2PH1A 3VHXA 1NMXA 4JLBA 4U5XA 1C1YA 2UKDA 1HH4A 5G41A 1TQ6A 4ZCLA 5FUXA 5TMPA 4DWJA 1E9EA 1KSFX 1ZU5A 5A4JA 4B43A 3ADKA 2ZRFA 4DBLC 2VP0A 1N5LA 2DWOA 1OT3A 2J0UA 1UDWA 4BFSA 1L2TA 1JR6A 1IAQA 2ZANA 1S2MA 2JLXA 1AQYA 1ZW6A 3EZ2A 4Q1EA 2R65A 3U61B 1DELA 4XVRA 3WNCA 3Q5DA 1RRPA 3BFKA 4TQAA 1LF0A 1Q22A 2WJJA 3H1TA 4PFSA 2O8CA 3GJ4A 1XTKA 3QUSA 1GILA 3MJRA 4IDOA 1UDXA 1QBKC 1B0UA 2A3RA 3VU9B 4TMVA 3T1VA 1S96A 1KO4A 4IVPA 2XOKD 1XD2A 3EZ6A 1K8RA 1E2JA 5JRZA 5J4KA 5KDDA 1GP2A 1XB2A 2V54A 4LYJA 3SR0A 2XSZA 2NPFA 1HYQA 2ASEA 2V4ZA 4RKEA 4A0GA 1CJVC 1E9DA 2IEYA 3EW9A 3U7FB 4LJ7A 2J46A 4UJ3A 1E0JA 1XWIA 5FBLB 3BOSA 5KSZA 2IYQA 3VNVA 4M1YA 3KXIA 2NQ2C 3GEIA 3Q5EA 1D9XA 1W2GA 3UWOA 1V5WA 1QZXA 3FFAA 4D4MA 1E2IA 1VG0B 3W8NA 4G5OA 2CK3D 4Q4JA 4Q9LA 2CEAA 2CVHA 3P27A 4IVRA 1JBKA 2IYLD 2ECKA 1KO1A 1RVDA 5B30A 3H86A 4HB2A 2Z6VA 4WZ6A 5FOWA 4URWR 1KK3A 5AWFC 1UF9A 1US8A 4II7A 4B3BA 2YWFA 3EC1A 3VHLB 3PV0A 4E5UA 4NCJA 5BYKA 4ZI3A 3LV8A 2IT1A 4B6EA 3R7WA 5FL7D 2Q9CA 1S1CA 4LV8B 1XMJA 3BE4A 5EP1A 4D25A 2Z4RA 2NO0A 3SFVA 4O3MA 4BLQA 3RYTC 4LJ5A 4NHOA 2REBA 5JZVA 3BH0A 3SOPA 1DG1G 2X77A 5GVRA 3THXA 4FCWA 3PEVA 2I4IA 2CJWA 5SZIA 5EZ6B 4FCVA 4Q1AA 3A1UA 1JI0A 2CMKA 5P21A 5J4HA 3PG5A 4NL4H 1XMVA 4A0HA 3ECCA 1MRSA 2YNMA 2XOKA 3PVSA 4JZKA 1NLFA 2NGRA 1QG2A 3NH6A 1G16A 4HLUA 4OQLA 2ZJ5A 2DYKA 3OE7D 3MWJA 3B1XA 2ONJA 5LB2A 2JLQA 4NYMR 4WW0A 4TMTA 5K8LA 4B75A 5FL3A 1W36D 5EXTA 4M1OA 2ORVA 4B3FX 5EE9A 2WBLC 4DJTA 4V0KA 1S9DA 2IC5A 1H8HA 5IHPA 1RRFA 1VIYA 3T06B 5JSZA 1T8TA 4LJ8A 4Q03A 1KI8A 4LHYA 1E2MA 4KITB 5AJZA 1E2EA 1GKYA 4HUQB 1UKEA 1Y3AA 3GJ0A 1AN0A 2AX4A 5KPJA 2C9CA 2GXUA 1QHHB 3QXSA 5B57C 2NIPA 3TNFA 4MGKR 1VECA 3KXLA 3U5ZB 1II8B 4LV6A 1VHLA 3WNBA 1P60A 4OKSA 5L3QB 1Z5ZA 2J0VA 2WIBA 4EKDA 2P0EA 4PANA 1D6JA 2ANBA 2C03A 1XZPA 1S4QA 3NTUA 5FL7A 3FMIA 5GJBA 4IVQA 1P2UA 3VR5A 2FPKA 2W2VA 1ZM3A 1GKUB 3N5CA 3AF2A 1L7VC 2KJQA 1NVXQ 3I73A 3WBKA 4F4JA 1MO6A 2JA1A 2XZOA 5HE8A 4AKGA 4DCUA 4DXAA 3TUIC 3OEED 4XSGA 2IW3A 2R6FA 2VO1A 3NIBA 4Q5IA 4B71A 2V3CC 4UQOA 2P2LA 4OQMA 4DLUA 1FP6A 2VP5A 3LD9A 1Z0KA 1IHUA 1E2LA 1IOZA 4C9BA 1E9AA 2WV9A 5IK2D 3X1WA 3IIMA 3AKEA 3AP2A 3ZLJA 3QVVA 4IXMA 1E32A 4Q4AB 2ZRJA 2W6JD 5C2JB 2IF2A 3O47A 4GRAA 1UAAA 1YZQA 1GG2A 2CNWD 1KMHB 2ZRLA 5TY0A 5JI3E 3EARA 1MO5A 1Z8FA 1CF4A 2QROA 2GILA 2ODBA 4TN1A 4JT2A 4F4IA 2RHMA 3EG5A 3EA5A 1ZCBA 1DPFA 1E2HA 1S1MA 1HV8A 1P5ZB 2WMOB 3OF5A 3PEUA 5B58C 3KTAA 5FI1B 3U6KA 1G5TA 4LPSA 5FR1A 4JVLA 2GXAA 2IYUA 2JCSA 3A37A 2W2TA 2XZPA 2GWHA 4Q01A 1TF5A 2Q9AA 1GTVA 5CJ2A 3U3OA 3ZD6A 1ZNWA 4M4SA 1KOFA 3QBVA 2FG5A 4EFLA 1QHNA 4JL8A 4TT3D 1G7SA 3IILA 3DMDA 2GTPA 3I8XA 4OHXA 4BFWA 4EJSA 3U3MA 4I1VA 2DCUA 4TQUS 4A0RA 4JSYA 1JPNA 2C98A 1A82A 2LKDA 4LC1A 4DCTA 2GBLC 2ZREA 2WAYA 1KNXA 2ZM5A 2GAOA 5E4FA 4WA7A 3W34A 3T1QA 3FTQA 3EPJA 2GF9A 2YV5A 4Y0AA 5DYGA 2NZ8A 1OB5A 1Z83A 3OEEA 2D2EA 5FOTA 1DOAA 2ZRHA 1IN4A 2GK6A 3U7GA 3QF4A 1KAGA 4LBVA 3Q9LA 1XU4A 3QKRA 4RZXA 1LVGA 4Q18A 3MFYA 5IK2A 4NE2A 3UMSA 2BV3A 4D0LB 1XXHE 3CIOA 4ZIRA 5BN4A 3LLMA 5J47A 2FEMA 3GLFA 4BWYA 2LKCA 2W6JA 3KQKA 4JLAA 4QKQA 1YVDA 2OAP1 3C5HA 1CXZA 1FMLA 3BS4A 4GP7A 1LFDB 1W4CA 4C4PA 1X8JA 4R9UC 1OW3B 3AQ4A 4UKDA 1N0WA 3LX8A 2OESA 2JIZD 3D3QA 5E3HA 4DIDA 1VPLA 1KI2A 4F38A 5L3SB 1XXHB 2V9PA 1DAIA 4AIIA 2GRJA 4OJQA 1N6HA 1GFIA 4WXPA 3UPUA 2ZRGA 5E7MA 3K8YA 5AJXA 4OJKA 4JIMA 4PAMA 2ZQ5A 4RD0A 4FWIB 4UNPA 2D2FA 5TARA 3SC3A 4UXHA 3SNHA 2WOOA 3R8FA 4GZLA 4RD2A 4DCSA 1W49A 3TH5A 2PLRA 5DI3B 4R2HA 2WWHA 3C15C 2WHXA 4RZ3A 1GVNB 4KYUA 3SEAA 3TLXA 1VCOA 1M2OB 1L4UA 4M9ZA 3JZMA 1F48A 4HUTA 4TYPA 4AC9A 4V0OA 3EAQA 1N6PA 3E1SA 3ZZ0A 4F4CA 4HAXA 4NYMQ 2OLKA 2QG6A 4LYHA 3KKMA 4JSTA 4PQRA 4RD4A 4DLTA 2J7KA 4L16A 5D3MB 1DARA 1XTIA 4A8JA 4DT1B 3VMFA 1NLZA 1CBUA 2KB0A 2OV2A 2XB2A 1P73A 1OXTA 1VYUA 1EESA 4KI0A 2AFHE 2CBZA 3DO6A 4PAOA 3KZ1E 1HA3A 5E7JA 3VR3A 3X1YA 4K81B 2QEQA 1NMZA 2GXSA 2HF9A 4B3CA 1ZVQA 2WVJA 3K0FA 5FPHA 4AKIA 3R20A 3F8TA 2NTYC 1E9SA 2IHYA 1AIPA 1OXSC 1EG7A 3EPKA 2L0XA 4DB2A 1D2MA 4M22A 1P9NA 4Z1MD 4KODA 4F92B 5FUVA 2UZIR 4N0EA 2ATXA 4JVSB 3Q72A 1II9A 4EFNA 4XH9B 1KJWA 1XDBA 2ERYA 3HU1A 2GCNA 3ZDQA 2XXAB 2HEIA 5FPYA 4D0GA 4PX9A 2OFWA 3KFVA 3T34A 1JNYA 2FGJA 1Q44A 2GVDC 2MMCA 3MMPA 1SGWA 3CX7A 4DCVA 4M0LA 3WHKA 3GEEA 4QBHA 3PUVA 5GVSA 3UATA 2WTUA 4XVQA 4CEIA 4HYYA 2C2HA 4QNRA 3BRWD 2FA9A 3BORA 1W36B 4MYUA 3RWMB 4Q02A 2C77A 4EPRA 1E96A 1SVWA 1Z0AA 4YMWA 2JAQA 1RZ3A 1W48A 3WP1B 4B2IA 5KO2A 4OI2A 1IY2A 4HDQB 1CJTC 4N0DA 4BFZA 4V0ME 2GJ9A 4RY2A 4RCYA 2CCGA 3Q8XB 3KX2A 5F3WB 3WRYC 4Q7MB 4HATA 2QMEA 2QP4A 3WXMA 1W0KA 2F1IA 5DSZA 4H9GA 1DVRA 3DMNA 3U6BA 3MWLA 1OV4A 4BZPA 1EX6A 2BEKA 4QG7A 4TLEA 1M34E 1CR1A 4MDFA 2ZVPX 4TL7A 3F3YA 4YLGA 4B76A 1Z0DA 3LDAA 1TL7C 2J87A 3GJXC 1T3SA 2FSIA 2FSHA 5TVKA 1N6IA 3TSZA 1KYIA 2ZJAA 1Z6XA 3L0OA 1FNNA 2BM0A 4B74A 4L15A 1BO6A 3I8SA 4EFMA 1X1RA 1ZAKA 4PO1A 1ZYUA 1KDOA 2C04A 2WICA 4Q7JB 4W5JA 4UNQA 3TBKA 4A6XA 3AVYA 4A0FA 1F2TA 1GOTA 2XITA 4TWZA 4G5RA 1G20E 3AGPA 2ZROA 4Z1MA 3SQWA 3EWSA 3RRNA 4QBGB 5DI9A 3ND9A 2ZS7A 1EXMA 2A5DA 4HZIA 3H2YA 1HY3A 4JBXA 2O8BB 3W90A 1CJUC 3GLHE 4GP6A 2P65A 1BYUA 2REOA 2OXCA 5JS8A 2TMKA 3B9PA 2YOGA 3A58B 3FWYA 2I3BA 4DIEA 3RRMA 4YMVA 2P6RA 221PA 5BYJA 1A7JA 3LNCA 3P4YA 3ZZTA 3OIVA 1KMQA 1YJ5A 2KSQA 4LBWA 4HI0E 2N1BA 4XD7D 3VU9A 5KUTA 4D26A 3ZJYA 4D82A 4RVCA 4BLTA 3AVUA 2FV8A 2PEZA 3GLHB 1LB1B 1MABB 2DR3A 3ONWA 4A2WA 2WJHA 4QHYA 1JEEA 1J8YF 4KVAA 1IN7A 4O0MA 2EFEB 3K09C 2YC2C 1E2NA 3ADCA 1X3SA 2XZLA 2VSXA 2VSOA 3A1VA 4HAZA 4JLNA 3IPXA 4EIWA 1U0HC 3B78A 2QTFA 1Z2AA 2CHVA 2AWNA 4YQFA 2FX3A 2PL3A 3THWB 3CR8A 2DWPA 1G5RA 3T5DA 3CWQA 4Q9JA 2IS1A 5FR2A 3QE0A 1KI1A 2G1KA 4QXAA 1D2NA 4C0JA 1ZD1A 2ZYTX 3DPUA 3SFZA 1CRQA 3OAAD 1KSGA 2YWGA 1R5OA 3CX8A 1WXQA 4GT1A 5JJLA 2JLYA 1G1MA 3TSWA 2ZRKA 4GI7A 4Q66C 2QU8A 3VX3A 4DDUA 4DEXA 3GFOA 3NDPA 2A30A 2A5FA 4KXFB 4NU0A 2Q3MA 1N6RA 4TMKA 1G7CA 1F6BA 1X8LA 3AF4A 4URZR 1Q20A 4JJZA 5G3YA 1Q21A 3L43A 1UPTA 4C0BA 2AK3A 5DHFA 1KKMA 4P4TA 2XJ9A 1FFHA 5K8UA 3T5GA 4BZQA 1LS1A 3VKHA 4F91B 1OKKD 1TEVA 4PHFA 4DSOA 5EUMA 2W0SA 1TEXA 3J81k 1R0YA 1KI9A 1I2DA 4L9WA 4OHWA 5BQ5A 2QAGC 4HZUB 1QHGA 3TMKA 2BJWA 1FUUA 5KNBA 2OILA 1XCGB 4D81A 1U0JA 3KL4A 4HLQB 4U02A 3REFA 2CL7X 4IOMA 3U3KA 1RRCA 2YOHA 3GFPA 3SZRA 1XD9A 1N6LA 4IRUB 2EWVA 1FOEB 1Q1ZA 4AWXA 4MRVA 2QGZA 4LJYA 1E9CA 5FBRB 4ZCIA 4US0R 3KJIA 2MSEB 2B92A 4TTPA 3KFXA 2ZJBA 1YZGA 4IJMA 1VIAA 2QI9C 4EPWA 4W7SA 1GUAA 8OHMA 1N5KA 2RGDA 1HUQA 1R4AA 4BZXA 1IXSB 2CDNA 3K70C 1DS6A 2QPTA 4GOXA 3MWKA 4PHGA 2JLUA 1RIFA 1JXOA 1G64A 2H8KA 1KDTA 2J9RA 1W7AA 3EC2A 1ZM9A 2HV8A 1NIJA 2HT1A 1E79D 1L4YA 4LV5B 5F9HA 2ZE8A 3BC1A 1J99A 3EPLA 5FBVB 3OAAA 1AM4D 1BKDR 1G17A 1E1RD 2JLWA 2GZAA 1GRRA 4HUQA 1JQLB 1NY6A 1AS2A 4CT4B 4NYIQ 5GADl 2IF0A 2X19A 3QIAA 5FI0B 1QHHA 4A82A 4H1VA 1P6XA 4NKRA 1NNEA 1FW6A 1CJMA 1IXRC 3I4LA 5JWOA 1II8A 4C0QC 1WBDA 1PZNA 1S8FA 5L3QA 2WSSA 3K1JA 5IF9A 5AUQA 1P9RA 2H92A 3ASYA 1HE1C 3RS3A 4GDFA 1CIPA 4C0HA 3JVUA 5SZJA 1R0WA 5SZHB 1MO4A 1P61B 2GA8A 4AYWA 2FGKA 2VHTA 4HDOB 3ZGXA 2GHIA 4TSFD 1N25A 1G41A 4MGZR 1KHTA 1W2HA 1Z22A 1R0ZA 3I3SR 4DSTA 3DM5A 2EYUA 4B48A 2NO9A 5DN6D 5JLJA 1AKEA 1FTNA 2QPOA 3BB4A 1T3LA 2DWQA 2YWEA 3WMFA 4TL9A 1G9XA 3AGQA 1NY5A 3TIFA 5J4VA 1RYHA 1EFTA 2F7SA 2N42A 3B1VA 1U9IC 3QY0A 4MITA 3FB4A 3CRQA 4DUGD 4NP6A 4Q7KA 2ZUBA 4ZV4A 1TQ4A 4Q4AA 1F3OA 2QN6A 4MQBA 4JLVA 1XTSA 5LDDC 2VRWA 1F2UB 1J90A 2H1LA 3QKSB 5HCNA 3S1AB 4IFBA 1H8ED 4ZCMA 3EASA 1E2PA 2BVNA 3WBJA 1DADA 2BMDA 4WXRA 4LX0A 1EX7A 4DDTA 5FPKA 1RJ9B 1FTSA 1J70A 1RE0A 3ASZA 1E79A 3W8RA 3KJHA 3BH7A 3KB1A 2CE2X 2QT0A 2ZR0A 2JLSA 3IBYA 3K9NA 2IUTA 3KXKA 1R7RA 4MRRA 4P33A 1WB9A 4FCTA 3HWSA 3KKPA 2P3SA 2CVFA 4RD6A 3P20A 5JS7A 4C0AC 4PO9A 1KZGB 3LX5A 1MV5A 2QSZA 1AQUA 1NLYA 3N70A 2QMOA 1ESMA 2QZ4A 3TR0A 4A2QA 4A92A 4IW3B 2OZEA 4C3ZA 4KV9A 4TYNA 4BLRA 2ZEJA 2IXEA 1NBME 2BBSA 2JJ1A 4UNRA 3U4QB 2O8DB 4RCZA 1VG1A 2IA5A 3PITA 1R6BX 3QEJA 5FH9A 1TADA 2KWIA 2QAGB 4Z54A 4TZ6A 2PX0A 1UEJA 1Z28A 2GEVA 2YZ2A 4YMSA 4B2PA 2VF7A 2ZRBA 3BK7A 1NKSA 3R9IA 4ZDJA 4QJ4A 5BN3A 3NKVA 1Z07A 2GZHA 2ZI6A 4BEJA 5DN6A 4GL2A 3VAAA 3T12A 3GLIB 1E99A 5CITA 4CYMA 3A4LA 1ZUNB 1PJRA 3CZPA 1VCIA 2VBCA 1CTQA 2WWGA 1K5DA 3W3AA 1G6OA 4XTCS 4BLSA 1M1YE 1SKQA 4DUGA 1VDZA 1KI6B 5KSYA 3B9QA 1WP9A 2OUKA 1YRBA 1VCNA 1QHXA 2IYXA 5TXGA 3ICEA 3OESA 3CF2A 5KDLA 1FMJA 5DE3A 1ANKA 5H68A 1H8EA 5G40A 2VEDA 3VR1A 3NXSA 4RD3A 4AKHA 1JR3D 2XAUA 1Q57A 3I1FA 3QXXA 3UXMA 1TUEA 5JHGB 3AVWA 5L3SA 1XXHA 1LS6A 5C18A 3CX6A 1KSJA 3NHAA 3DVLA 4Z51A 4DC9A 2FEOA 1U8ZA 3L0SA 5HE9A 5KSOA 2OT3B 3PUWA 3QEOA 1ZIPA 2H18A 1Z6AA 4KVGA 2XTNA 4M1SA 4B44A 3PCRB 2C78A 5CM9C 4P0TA 2EYQA 3EIHA 4PC6A 5K8IA 1ONBA 3QOFA 5AJWA 4CEJA 2ZR7A 2RGCA 2W6ID 1D8TA 2HLDD 3KKNA 5BWMA 2HF8A 4LZZA 2FSFA 5DI3A 3SYNA 1KTVA 4LCBA 1PLLA 3MG9A 3SJZA 2QQ0A 1CULC 2E1RA 3OIUA 5EE1A 4LPKA 2V7QD 4G5GA 1RRGA 2F3RA 2C9YA 1XPOA 1VMAA 2CK3A 4G3XA 1NSTA 2HYDA 3DKVA 1MO3A 5HTKA 4C0SA 4D4JA 2C8VA 2JLRA 2GJKA 2XNSA 1P9WA 2GAAA 4JL6A 4AK9A 3X1XA 3HDTA 1T5LA 5D3MA 4HAUA 1N3BA 2GF0A 4DT1A 2F9LA 4CRWB 2R6DA 3GFTA 3C5CA 1LF5A 2CE7A 2IYRA 5H8WA 2QTHA 3LH5A 2RGNA 4PC7A 1NP6A 4TL8A 1G8PA 3I92A 1T6NA 3GJ7A 2RGXA 2YJTD 1BS1A 4GBMA 1VCMA 4TMXA 1R10A 1TU4A 3LQRA 5E7IA 4XSHA 2Z4SA 1KY3A 1OYWA 1WRBA 3IIJA 3ZH9B 4LC0A 5CDFE 1N2CE 1E2KA 1ZM2A 4A9AA 621PA 1TMKA 1R0XA 3CW2A 1KDRA 3SJBA 1T8UA 2E9SA 2KBEA 5F2EA 4QJ3A 4PQFA 2AN9A 1T0HB 3TRFA 4TYWA 2Z83A 2NPIA 3C14C 1YR8A 1E9RA 3AVOA 4D4LA 1F5NA 5LPNA 4FMCB 5UKDA 4C0LA 4LBYA 4DLRA 2PZEA 4NCNA 4MYTA 4ASUD 3NWJA 2UVQA 3RANA 3ZVNA 2XXAA 3SHWA 1U8AA 3NVAA 4MRPA 2VP2A 2PLFA 2WOJA 4N1AA 1SHKA 2B6HA 4R2IA 2B7CA 3JZAA 1WA5A 2RMKA 2F3TA 3SI7A 4ZDKA 3OE7A 3AM1A 3CRRA 1TPZA 2IL1A 1GM5A 4IXNA 3EPHA 4BRUA 1ZD8A 1ZINA 4JVNA 2BCJQ 1HQCA 2HLDA 2ZSBA 4WIAA 4EAQA 2RKOA 3I62A 2Q3FA 3KQLA 3QSYA 1N6KA 2R8RA 5G3ZA 5KOYA 3TQCA 2PJRA 1WCV1 1P7CA 1G8FA 1ZMXA 2V7QA 3HYRA 4JLKA 4QJ5A 4QGAA 5EP4A 4AG5A 2QTVB 1FX0B 1TQDA 4LRWA 4PC2A 1TF7A 3BB1A 4MRSA 2ZTSA 2BIFA 3BB3A 3FFBA 5EE3A 1OHHD 4L9SA 1NN5A 1JJ7A 1VYTA 2QORA 1MOZA 1M74A 2CLDX 3D8BA 1CJKC 4YMTA 2DFLA 2X2EA 3QF7A 2V1UA 5L3VA 2KBFA 5EZ5A 3I5XA 4MKHA 4FWTA 4V02A 1SULA 4IEIA 4V0MA 2WKQA 3GCGA 1UEIA 3BGWA 1WMSA 2G83A 1PUIA 3CPHA 3HYTA 4QHTA 3QXJA 1ZP6A 1E1QD 5SZKB 2PEYA 3PFIA 2VIIA 1XTQA 1GRQA 4NPHA 4HLCA 4TYQA 5JECA 4PTLA 4BFYA 3LBIA 4OHYA 1Z6TA 4W9MC 2F55A 2GJ8A 4AD8A 2YC4C 3DZ8A 3RWOA 4BEBA 2BOVA 2IHBA 2W00A 3EXAA 5AR1A 5JHHB 2BJVA 2GKSA 1XEFA 2FZ4A 3GP8A 1SVKA 3QPWA 4Q4JB 1KO8A 4ASUA 2GVZC 1T4GA 2EFDB 1E4VA 2O8BA 2J41A 4HEJA 2VHQA 3UANA 4HB0A 3ND8A 3TSOA 2ZAOA 2QM7A 2QUZA 2OBNA 2V6IA 2PX3A 2BMFA 2IYVA 2OFOA 3T1OA 1MR3F 4QBFA 3D31A 2CNWA 1EFRD 1EFHA 1IXZA 3MSXA 2QP3A 4NYJR 2A2ZA 5CLLA 4NBSA 3PEWA 4PPGA 1W4AA 3SBDA 2BCGY 4OQXA 2HCJB 1SZPA 3GLHA 1MABA 3V00A 1YZKA 2VA8A 4KBFA 4KU4A 1XJ0A 3W6PA 3R9XA 2VLIA 4X8MA 2W83A 3M1IA 5FFMA 2I1VB 3GD7A 5CIQA 4N3NA 1OFTA 4MYCA 5HCIA 4M9XA 1W4BA 1GL7A 1OHHA 2O52A 2PMKA 4ZPXA 4NTZA 2EU8A 5G53C 3WY9A 4LSGA 3THWA 1N0UA 2GZDA 1CEEA 1HT1E 1FZQA 1D2EA 3SYKA 2P5SA 2ZE7A 5BXQC 3KQUA 4URYR 1UBGA 4TT3A 1FP7A 1I4TD 1LV7A 2GNOA 2WM9B 4A6PA 2ZI4A 4TMZA 4QGGA 1KZ7B 3B2EA 1TU3A 5EUQB 2FPMA 3RDPA 1OF1A 2QL6A 3UMRA 5ELXA 2QBYB 2QNRA 1E1QA 3RABA 4RSGA 2WPDD 4I1OA 2R62A 4ZKDA 3O8CA 3REGA 4JT4A 5EJEA 3LW8A 1XF9A 3ZS9A 4WBSA 1UKYA 2GEUA 4PHHA 2J7PD 721PA 3AKYA 1KO5A 3LRPA 3M4YA 3GJ5A 2J59A 3VR4A 3CRVA 2ZSFA 5EXSA 1X6VA 1NL3A 3T1TA 1RKBA 4TYYA 2BMEA 1JR3E 1WF3A 4PAQA 4JJKA 2EFHB 1MKYA 2N46A 4P4SA 5EP2A 5AUOB 2F1JA 1G7RA 2H5EA 3FOZA 3X1ZA 4D80A 2IS6A 3IQXA 2ZVQX 1DTSA 4HZUA 4Z8XA 2EFGA 1XNJA 2G0TA 2GESA 3ZQ6A 2ZXUA 1D9ZA 2JIZA 5D3QA 4JL5A 4F7WA 1G7TA 1PVOA 1LNZA 1G3QA 1P2SA 5JEEA 4MUAA 3TAHA 4V0LA 2B7BA 2IYTA 4Q47A 4POAA 4DLXA 1V43A 3MCAA 3AP1A 3PIRA 4YMUA 5B2ZA 3SE0A 4OQNA 1B23P 4AYTA 2WWXA 1KI7A 4BRWA 2RAPA 3F0TA 4LUCA 3CKLA 1AKYA 1EK0A 4Q1FA 3N2IA 4NYIR 2XGJA 2G3YA 1M7BA 5TV2A 3CR7A 1TQ2A 3BERA 2DFKB 1IN5A 1QHSA 2EVWX 3QJYA 1VTKA 2WJYA 3EZ7A 4Q48A 1K6MA 4ESVA 1CLUA 3VR2A 3DOEA 1W1WA 2QAJA 5A5GA 3QI2A 1CKEA 2HCBA 2VP9A 5FBQB 4YC7A 1IY1A 3A4NA 3K0AB 4ESHA 2ZI9A 3GMTA 1Z63A 2OXRA 1U0LA 3CNLA 4H1UA 4DVGA 4M9SA 4TMWA 4PZYA 5J4YA 3WP0A 4OK5A 4K8OA 4G5SA 1JAIA 1S9HA 2WPDA 1JEDA 3MLEA 2JJ2D 4O25A 2J7PA 1E3MA 3WYGA 3K0SA 4WZBE 3K9HA 3B1WA 4IOJA 1OXUA 3QKTA 1P62B 2G88A 2WSMA 2D62A 3VX4A 5DNYB 4XTRA 3GPLA 2F9MA 2O0HA 2QY9A 2WJIA 4GPTA 1GNQA 1W4RA 1XD8A 1PLKA 3K53A 4Q1DA 1CR0A 4JYBA 5KDOA 2XNDD 4KLZA 1AK2A 2Q9BA 4C7OB 2HJVA 1SVLA 2GCOB 4Q1BA 5J40A 2X8AA 2ZSAA 1NBMD 4OI4A 3FHTA 4LHVA 2VF8A 3WRXC 1E0SA 4DLYA 4BPBA 1JJVA 2LWIA 5CM8B 2EFCB 5JCPA 3THYB 2ZYVX 1N5IA 5GJWC 1DAKA 1ZIOA 3VTKA 1WE2A 4NDZA 3IIKA 3FPAA 4JLDA 1DBSA 3U44B 3B1ZA 1SVMA 4EQ6B 1E2QA 1ZNXA 4JBYA 4G0NA 1ZNZA 3K70D 1XTJA 2JDID 2OCBA 5F98A 1F2UA 3CNNA 3QKSA 3FMPB 3S1AA 1PUJA 4B2LA 2ONKA 3EIQA 4JVMA 4FMBB 1NKTA 1UKVY 1U81A 2SHKA 4FW9A 4R71A 5HKKD 4M1WA 3G0HA 3DKPA 2FOLA 4HB4A 2ODEA 5J5CA 3T35A 1KKLA 1R8QA 2GCPA 3CONA 2VHCA 1RJ9A 3DEFA 4FD2A 2DFTA 2J5XA 2VTKA 1AS0A 2CLSA 3PENA 1UM8A 2A5YB 4BE7B 4NYJQ 3FHCB 3ZZUA 3KQHA 3B85A 2QSYA 2JASA 3G82C 3KJGA 5JFGA 4GOJA 2FFAA 2WWFA 1OPXA 2IS4A 2JJ2A 3RNLA 3FKSD 4DLWA 1YU9A 2JLVA 2CHGA 4LHWA 2F1RA 4UXIA 5DIFA 2AK2A 2O0KA 2O8DA 5CK4A 3U4QA 4E03A 3DHWC 3C7KA 4LDJA 4A4DA 2CXXA 1M6NA 1R8SA 2D74A 3CRW1 3MGCA 4OQFA 2VL7A 3THOA 2QAGA 3TK1A 4QM6A 1CU1A 3U60B 1ZCAA 3BAFA 3FVQA 2RGBA 2V55B 1KI3A 2VPPA 3FKQA 1OLOA 3BFVA 1ZUHA 4JKIA 4B3XA 3SJAA 2XNDA 4PHTA 1E98A 2NO1A 2QE7D 1G18A 5KU1A 3JVVA 4M9QA 5AK0A 5EE0A 1Z08A 4GMDA 2D4HA 1NBMA 2W0MA 3KUDA 1P2VA 2NO6A 5KPDA 3A36A 1YZUA 5FBWB 2ZRMA 1SXJC 1T3HA 2OBLA 1ZC3A 2AXNA 3MUFA 4GNKA 4JYCA 1A5TA 1UBFA 1E2DA 4Q19A 1Q0UA 2RHDA 4DHEA 1VKJA 1IN8A 4US1R 3SYLA 1KI6A 1GKIA 3RC8A 3HPRA 4K46A 4IOLA 3ZQJA 2WKPA 4FMCF 2OO7A 3QG5A 3KQNA 2AFIE 3AV0B 1Z29A 1QRAA 3D6TB 3NEJA 2IUSA 4XD7A 2UZ3A 4UXJA 2FPLA 1BMFD 1P72A 5L8VA 1J8MF 5HKKA 4JLPA 3U3JA 4LY6A 2BWJA 3K0CC 2PZGA 3MRSA 4OHVA 4YDHB 1OH8A 1DAGA 1DAEA 2AR7A 4LBZA 1IBRA 2C9OA 4LYFA 2RB4A 1UFQA 2Z0MA 2Z43A 2FWRA 4RFSB 4A2PA 2FF7A 1UJ2A 4BGDA 3NBXX 3AUXA 3SU8A 4LJ9A 3X2SA 5AUPB 4RJLA 2A5JA 4LJ6A 1NN1A 3WYAA 3CZQA 3IEVA 3TW8B 2NZJA 4LYAA 1KAOA 3P4XA 1PLJA 1P75A 1JQJC 2WWIA 2O8EB 3CF0A 2AD1A 3FKSA 4GMXA 1OB2A 1ZD9A 2X2FA 5CYOA 4UNNA 4HDCA 4B32A 1Z6GA 5E95A 2WWWA 2P5TB 4IHQA 2QMHA 5GJCA 1GZSA 4KBGA 4I81A 1ZNYA 2D7CA 1SVOA 4RD1A 3QENA 4F93B 1FQJA 5AJYA 5C1BA 2DY1A 1N5JA 1EWRA 4FIDA 4J0QA 2C5LA 3I5YA 2QE7A 1U9IA 4E07A 3NDBB 3GLGE 2P6UA 1XCPA 2RCNA 1COWD 1XEWX 5CB6A 3IPYA 3RSOA 1CR4A 2MMGA 3GEHA 4I1UA 3RC3A 2KI5A 3X1DA 3PUYA 2KE5A 1DE0A 3B1YA 1OKKA 2V8OA 3AF0A 2IX3A 3HU3A 2P6NA 3NBZC 4EPVA 3KB2A 1KO7A 4PZZA 3QNUA 3GLGB 2O8FB 2HT6A 2F43B 1Z47A 4IDHA 4PPFA 1QHIA 4HB3A 3FYHA 4OK6A 1RYFA 4X8LA 3WYFA 2GETA 4LK2A 4FINA 3VNUA 1BMFA 3B13B 4XJXA 1A1VA 4M1TA 5CDFA 521PA 1R5BA 3ZIAD 2IYSA 1G21E 5JI2E 1F2TB 2I1QA 2WWYA 2OHFA 4A15A 4PC1A 4RZUA 3W3ZB 1KMHA 1TAGA 2R44A 3SHFA 5JWRA 1Q1QA 2Q6TA 1IONA 1Z3IX 4P31A 2QP9X 5LB4A 1EFCA 3M6AA 3UG7A 2ZETA 3P32A 4I99A 4A1FA 2EWWA 1Q1EA 1BOFA 3P1JA 5FTJA 5C46F 1H65A 1U90A 3LXXA 4LHXA 3VFDA 1G8YA 4ZO4A 1FUKA 2IXFA 2ZUDA 3CNOA 2EW1A 1SXJE 1NN3A 2BDTA 1ZM7A 4Q4HB 4D2IA 4IDQA 4FMDB 4DDVA 1E1RA 1G291 1QVRA 1FX0A 4DSUA 4B3DA 1GWNA 4B3GA 1R5NA 1TTTA 4ARZB 2RH5A 3FHOA 1E94E 2ODWA 1DAFA 4QL3A 3CH5A 3NH9A 1SXJB 1JXMA 1XP8A 3AUYA 5FTMA 2VP6A 3DDCA 5JMTA 4JLOA 3AVXA 1PV4A 2ZPTX 3BH6A 1QHYA 3OFND 821PA 1BIFA 1COWA 3GLIE 4L5BA 4WAUA 1LTQA 3RRYA 5BN5A 2VSFA 4WVFA 1II0A 1S3GA 2BBTA 2R9VA 1G19A 1NJGA 1YR7A 1UADA 1OSNA 5FPSA 2OLJA 4Q4LA 2CLCX 1UBCA 5JEDA 2YYZA 2BBOA 2DBYA 4TSFA 3LO5A 4EPTA 2H17A 1H8HD 1QG4A 3KJEA 4L4UA 4XOIA 1E2FA 4KHZA 2B21A 1YR9A 1SHZA 1RC8A 4NH0A 2ZJZA 3WMGA 1RFLA 4X8OA 4X8HA 2NMVA 1AGRA 4O2LA 1NF3A 3B82A 2OCYC 2G9NA 1XMSA 3K9GA 4MRNA 1UBEA 5JCZA 2XTMA 1XJQA 2FSGA 4OBEA 3ZIAA 1XTRA 1MRNA 5FOUA 3K70B 1ZRHA 5GJVC 2DHRA 3BFXA 5FOSA 2LCFA 5FTKA 1HE8B 2ODNA 4PC3A 1WBBA 2CCKA 4DDWA 1ZC4A 4XWOA 1OJLA 4R98A 3SJCA 2G0NA 3WNDA 1KK2A 1XMIA 5KHOC 2QMUA 1ELOA 4R7ZA 2ZYUX 2PBRA 3E5HA 3FMFA 3QVUA 4URXR 3VKGA 4M53A 2PZFA 5BW8A 5C4GB 2IYYA 3MAAC 1XEXB 5IRCD 3BIFA 3TQFA 4KFTA 1IQPA 4UNSA 4CEHB 3U7HB 3NBFA 2CL6X 4PXAA 3PQCA 2C96A 5TDHA 1OIWA 2HUPA 5C4MA 3DM9B 1NVUQ 3B6EA 4C2TA 2BC9A 2HXSA 4OHZA 3L2OB 4MGYR 3OFNA 3UK6A 4AKEA 4OK3A 2BMJA 2FFHA 4L8GA 1TNDA 4LI0A 2QA5A 3AEZA 4LOAA 4MUBA 1FL9A 1QVAA 2QBYA 1MH1A 4E09A 1Y63A 3A4MA 4MKIA 2NO7A 1NVVR 4C2UA 2J1LA 4BFVA 1YRAA 2OFXA 3Q3JB 2J3EA 2RGGA 2ZUCA 3TGPA 4CVNA 2PT5A 1OXXK 1NI3A 1UKZA 1NG1A 3A6PC 1VHTA 3AVPA 3L0PA 3A1SA 4HLUC 3QXCA 4KCGA 2NG1A 1D5CA 2IYWA 1GNRA 1G6HA 2MSDB 3GQBA 3LQQA 3VR6A 4CT5A 1KY2A 4XWKA 1IM2A 3NEYA 4PR0A 1AZTA 3T61A 2CL0X 1JR3A 1HURA 2ANCA 2MSCB 5B64A 5HZHA 5FPTA 4RFVA 1GL6A 4BLPA 3AB3A 3EZ9A 4ITRC 2OE2A 1DEKA 2AWOA 2FFQA 3V4FA 3QPUA 3H0KA 1Z6YA 4LGMA 3SQXA 2ZJYA 2OAQ1 4GZMA 5FOVA 5TB5A 2HYIC 4GOKA 4HAWA 2BEJA 3RLFA 1CS4C 2J0UB 1AJEA 3QG1A 5FOXA 3R8CA 4D0NA 3EX7C 3A1TA 2W6IA 4IKEA 4MGIR 4NCKA 2FH5B 1L8QA 2PCJA 1WDTA 2RGNC 4Q1CA 2GBLA 3LLUA 3OZXA 4WZAE 2ZJ2A 3TKLA 5CJPA 4JMPA 3AH8A 3QXHA 4NZYA 4KFSA 3BD9A 1QDEA 2O8CB 2YVUA 3CUEF 4IFEA 4XVUA 5HZKA 1U2RA 1GAJA 1YHNA 1Q1BA 3K0AA 2WKRA 2P67A 4G5QA 4LJ4A 4TQ9A 3IHLA 4WOPA 5DLQC 2YHSA 4BLOA 2ATVA 2R6CA 3TAUA 3OIWA 2BBWA 2ZI3A 5DO9A 3O8DA 1X8KA 3IUYA 1XD2B 3LBNA 2DB3A 3AVTA 2OG2A 1P3JA 1Z0IA 3L0IB 2D3WA 2YOFA 3QKUA 1YQTA 4DSNA 2ZE5A 4TTQA 1M7GA 2GJAA 4B35A 2XTZA 1KNQA 2AKYA 4MH0R 2FDCA 3UMFA 4JLMA 1A2KC 2BM1A 2ZIAA 1E0KA 2BKEA 2F6RA 2F1HA 4DKXA 4CF7A 4MA4A 3D7MA 1DAMA 5EE5B 5LBIA 1Z0JA 3BBPA 4ACBA 1E9BA 4JLJA 4P4UA 2QT1A 1RPZA 4LJAA 4C7OA 1G8GA 2GCOA 3OEHD 2AXPA 1OFUX 4IEEA 3TR5A 4KYIB 1IJEA 5AJVB 1W46A 1OH7A 1W36C 3CF6R 4QNMA 1XJCA 1FNMA 1RW4A 2A78A 2Q0HA 2QRNA 1OFIA 3CBQA 3HP1A 3THYA 2PCLA 3PUZA 4RKFA 5IT5A 2Q21A 4HLDA 2W58A 4OYHA 4DZZA 3AVVA 1HEIA 3I61A 3U44A 4KJZA 4EQ6A 1KSHA 1US8B 2V6JA 4HAYA 5F9FA 1K5GA 5KSPA 2FNAA 3RS2A 1SVIA 3CH4B 1C9KA 1XPUA 3R7WB 3AF3A 3DOFA 5EXXA 2GXQA 1VG8A 2R2AA 1KGDA 1E69A 3LY5A 3U3RA 3W6NA 4EJSC 3IQWA 2IEZA 4I1SA 3W6OA 3B8HA 5HR5A 4YDSA 3ZD7A 1ZU4A 5L3RA 2QRZA 5EP3A 3THXB 2EQBA 4FI3C 1Z2CA 2FMXA 1I4LD 2CJWB 1NSFA 1OYYA 3CM0A 2REXB 4PSAA 3MWYW 3UG6A 1CP2A 1F60A 1MT0A 2QENA 2C95A 4Q9KA 1KK0A 3AKDA 2IS2A 2FJUA 2IXGA 4EUNA 2WJGA 3ZVLA 2J45A 3IEUA 5J4LA 2O0JA 3AP3A 3LVQE 1FPMA 3FMOB 4W5WA 5FTNA 1G8HA 1JAHA 4B6FA 5K8TA 3N2EA 1T5IA 3U7EB 1ETUA 5JRJA 4U7DA 4BFTA 1AGPA 3IO3A 2RGEA 3IO5A 4CEJB 4PO8A 1AZSC 4B34A 1Q3HA 4XWAA 4ZDWA 4V0NA 3FE2A 1GIAA 1NVWQ 3NG1A 1TX4B 4AURA 1QF9A 2K5UA 1WQ1R 2FZLA 3L8YA 3I72A 3LWNA 2J0SA 3O8BA 5JSZB 4NCIA 1S0UA 4CW7A 3OEHA 2YWHA 1OE0A 1W5TA 3LFUA 3OIYA 5KNDA 1E0AA 1EWQA 1NIPA 5CYPA 1E9FA 2OM2A 1YKSA 3GJ8A 3H4MA 3F5FA 3SS8A 2ZRNA 1W0KD 4ABYA 3CPEA 1OIVA 4DLZA 4V03A 1NVVQ 3NC1C 4BQSA 3CWZA 3RS4A 4DLSA 3GJ6A 3TVTA 1G3RA 3AVQA 3L8ZA 5KNCA 1EFRA 1EFUA 1I2MA 1YR6A 2ZU0C 5DHAA 3HR7A 3LA6A 4BASA 5LD2C 2FN4A 2OSBA 2XB4A 4P3YA 1NRJB 4CIDA 4URUR 2D7DA 4BECA 3SDZA 4B47A 2NOAA 1N0VC 3VQTA 1G3MA 3HR8A 3ICQB 1CRPA 1W47A 1E2GA 1YZTA 3CB4A 1BH2A 3SN6A 2IBMA 3T15A 1ZBDA 3V9PA 2BKUA 1P2TA 4RFSA 4QGFA 1G4AE 4KO8A 2OCAA 1I4DD 3FDIA 4A8JC 5CK5A 1A4RA 3DZDA 4PSKA 4Y0VA 3LAWA 1DG3A 2H57A 4US2R 4RZ2A 5EQTA 2ZI7A 5FUYA 5DISB 1LW7A 1E4YA 2R6GA 3W9YA 1X1SA 1OIXA 1VG9B 2AKAB 4BUJA 2X1VA 1U8YA 1DAHA 4M8NE 1EGAA 4FMDF 1HTWA 1E6CA 4TLAA 2O8EA 3IBGA 1KJZA 2GEDA 3QBTA 4D6PA 3RAPR 1AS3A 4QFMA 3V4RA 4KLNA 3L82B 1IN6A 3MD0A 2B8TA 4MYHA 4PPQA 1NJFA 2ZS9A 4PQYA 2QM8A 2OEPA 2FFBA 3IHWA 1GSIA 4MKFA 3RHFA 3KTAB 3TE6A 1XBTA 1SXJD 2JEOA 4OL0A 4PPNA 4URVR 3PJRA 3UKDA 3EA0A 3RS0A 2PT7A 2ERXA 1Z06A 4EPYA 1U94A 1SVSA 3SBEA 2JATA 1OXVA 4LHZA 3LBHA 3UIEA 5IDVA 1BYIA 1ESNA 2YKGA 1NMYA 2CHQA 5H70A 5A0FA 4M2LA 5FTLA 4S35A 4ZKEA 2VHJA 5ANRB 2VHUA 3HJNA 4HSEA 3ZYCA 3KKQA 5KTYA 3W5IA 2ZS8A 4P32A 3RS5A 4EJSB 1U99A 2AHOA 3GLGA 1LY1A 4TZ0A 2O8FA 2FE4A 2F43A 1XFAA 3EIEA 3TVDA
chains in the Genus database with same CATH superfamily
4DR1B 2PMDA 4Q21A 3G9XA 2VH5R 1M2VB 2SKEA 3PL1A 4RMNA 3WMEA 1G3IA 4CCYB 4CDGA 4QOHA 2ZI5A 3H2HA 4UOEA 1D07A 1J0BA 5TQJA 5EIXA 1P91A 3ZHOA 2WR8A 1VJ0A 1AA9A 3KKKA 3LBYA 4AYXA 4JB2A 3ILHA 4E1AA 5LYJF 3RQIA 4MEBA 3H9UA 2Z5FA 4MKGA 2G06A 1GKKA 1N2CB 3MC1A 4TLLB 4GXNA 4FFOA 2NV0A 5EZYA 1V3VA 4N5NA 1DC3A 4OA5A 4AZ0A 4F9GA 4Z53A 2BZGA 5AHRA 1ZG3A 3C8ZA 3WIDA 3QKRB 4QGSA 2CYCA 4KH1A 4AJJA 3RRZA 4TLDA 5JROA 2J9FB 4U6NA 2ES4A 4W5HA 2H2FA 2FUNB 1AXEA 3UVEA 3SGLA 2HL6A 2C2BA 2IZOA 4GPBA 5DHSA 3P0IA 1C4OA 3G2OA 3NWOA 1MXHA 2B4TO 3A6JA 2A94A 4QVKA 2A4KA 3EPPA 4YROA 3ZY6A 4E30A 1JECA 3HHEA 2ID4A 4GBGA 4IDPA 2A5GA 4CPDA 4UAVA 1OH5A 4FFDA 4TKMA 1SK8A 5EFOA 4I9GA 3TR6A 3ZLBA 1LLQA 4AVYA 2F90A 1VL1A 1Y8ZA 2VYND 1SEPA 2YDXA 2I6FA 1XRPA 3ZS8A 1CDZA 3VSBA 3A6GA 4QHSA 1RLMA 1U6IA 4NIMA 4DEYA 1GGJA 5BRAA 5ISMA 1T9ZA 4YP5A 4NCHA 3LVRE 4X1KA 4GMGA 2A9KA 1DRKA 3WRVA 3CRMA 4DA8A 1Y6ZA 3SZLA 3F4BA 2ZSJA 4BCDA 1CY4A 5DYIA 3R2JA 5LA6A 4MVJP 4KUEA 5LZ9A 3UWKA 1Y5LA 3GB9A 4YAWA 2EJUA 3OM1A 4UUBA 4FR5A 3V48A 2XX3A 4AJNA 4FD3A 1JQEA 4LOHA 5IEBA 4GI2A 5IX8A 1QPBA 1GQOA 3PJDA 4FZRA 3VPGA 5JOQA 4G63A 3IP7A 4MR7B 3WMWA 3B1FA 5F64A 5IZCC 3K0CA 3VPSA 1MX1A 1WLSA 5IFKA 1G55A 4KWHA 3U7RA 2GK7A 4PSDA 1O6GA 1KJYA 5DTRA 3OIDA 1NNLA 4RHEA 2QVBA 1WTAA 1MB2A 2IUFA 4JQYA 3CLVA 2C5SA 4P4NA 1W0JD 1UT6A 1MOPA 4FEGA 4KAFA 4RO0A 4YFYA 5A7GA 2C99A 5CB8A 4IOKA 1L7QA 1YI1A 4UTVA 1HT2E 5JD5A 5CLQA 4OBWA 2ZRPA 3IPCA 1PR5A 2ZRIA 5IXJA 3C41J 1C7QA 4B3RB 3M1LA 4MQUA 3WHPA 2ZRAA 5T4FA 2Z2JA 3F9IA 4X60A 5INTA 1DO0A 3OT1B 4AB1A 4L9RA 4X6XA 4ZVRA 1HR0B 4E4TA 1P4SA 4ZJUA 2JW5A 3PUXA 5DGXA 3GT0A 5ADUS 3C1UA 1KXZA 4OLJA 1JPJA 4CG3A 4B87A 1B7GO 2W9XA 4P4SB 4WTOA 3TNDA 2HD4A 1RYMA 2VT2A 3FGNA 2G40A 3I32A 4GE3A 2ZSEA 3A2LA 2OHJA 5GP1A 3ZGZA 3SVTA 2FKAA 5K2OA 4AY2A 4PGGA 2CZQA 4B6SA 5G0UA 4ONEA 3UGTA 4M1MA 4UUPA 1TJYA 1LNQA 4OA8A 1TCVA 1IU9A 2GBGA 2XA2A 4UEQA 1XEXA 4GVXA 4HS4A 3S5JA 3VU3A 4D3YA 1UFVA 3TDMA 4C01A 3ADDA 4OHRA 2VF4X 2XWPA 1WB6A 2C4NA 3KFLA 3NDJA 2XVXA 4G1UC 4WGFA 2HJGA 1YZNA 3FROA 2YR0A 1OA1A 3GJ3A 3M82A 4MVJF 2MYNA 2PX2A 5DXAA 5IJZA 5LM3A 4F12A 4G01B 4ZCQA 4KPEC 2JC3A 1KEPA 4MVJD 1N1MA 1GNSA 4F9FA 3PK0A 5F51A 2QGFA 4RVSA 2XUAA 4UOQA 3ZIDA 1ZESA 1K7SN 1QZTA 2CT8A 4FX5A 2GDJA 3T7IA 2FUKA 4QBKA 3GEGA 1GPMA 4OGKA 4K9MA 4GPD1 1PFVA 2IEAA 1CP3A 5CIWA 1R4ZA 2V7BA 2X0NA 2AC7A 5KNLA 3DTYA 4O2RA 3TGLA 4A36A 1ZVKA 5TVGA 1K98A 1Y48E 4QM7A 1PJ4A 5C4IA 3WLFA 3ZY4A 1DIGA 1H69A 2ZJOA 3VDNB 1AQIA 1YZVA 2NX2A 3R5KA 3SE7A 4U00A 1NOJA 4PG6A 2QQGA 1NR1A 4DB4A 2DR0A 4AMYA 2F62A 5EINA 2Q3BA 4UE3S 3EDCA 5HS6A 3E3OA 4BB0A 1FTWA 3OIFA 4MR9B 4RUKA 1Q0SA 2VDWB 3CLTC 4R9VA 1Q12A 1BAPA 4Y1RA 4CFSA 4HH0A 1U02A 1KMIY 1SKYB 4U9UA 3QVTA 5CBKA 3M0EA 5KTMA 4YQZA 4CKCA 4MWEA 5FULA 1M7HA 4ZI2A 4KQGA 2DPXA 1G4UR 4ARVA 3NC0C 5JWHA 2OYSA 4BFXA 3OU7A 1KP9A 1MFZA 4ML3A 1C50A 1OD6A 1VZ2A 2WAOA 3P26A 3UJDA 1KRXA 4JLBA 4J6EA 3V1TC 4AULA 1APBA 1HH4A 4KG7A 5G41A 4OU5A 2QIPA 4ZCLA 5HGXA 4L4SA 3LQ4A 3WIUA 2EC5A 4WPGA 2EF1A 1ZU5A 4Q3LA 3RTBA 3ZKWA 4XFKA 3COZA 1YH3A 4ZN6A 1TTPB 2E0IA 1WS6A 1OT3A 1CW2B 3N05A 1S8OA 3BWBA 1C41A 1TU0A 4BVKA 3E27A 4FFBB 1JR6A 1S2MA 3QUAA 2XB8A 1AQYA 3AIKA 4DF3A 2JIQA 1ODSA 3L40A 2VRNA 1JJAA 1Q15A 5C52B 3A06A 1FYWA 4WK2B 3EXG2 1KC1A 2HJWA 4KN8A 3GH1A 5HIKA 3EXHA 4FOPA 4TQAA 1RZRD 1LF0A 2XAAA 3ROFA 4ENWA 2WJJA 3H1TA 2O8CA 1XTKA 1RKUA 1YB7A 3SIPA 2YMPA 4IDOA 5H1YA 4Y2UA 2BMAA 3CGGA 1VMIA 3RRBA 1IUKA 4KIGA 4O0LA 2WB2A 1PZFA 2BP7A 4NFHA 1TC1A 5JT1A 4WZAA 2HZ7A 3HRIA 4I4NA 4OUKX 1Z6PA 4U7PB 3EZ6A 1G6Q1 4O4HA 1K8RA 4ZQBA 3ICCA 4O4IA 5C80A 1JLKA 5KDDA 5H81A 4AJHA 5JXIA 1GP2A 3W9SA 3V8PA 4D6YA 4LYJA 2XSZA 2JI9A 2IU4A 4S24A 1WUJS 1P1RA 2ZAYA 3DO8A 2W37A 2RBGA 3OPQA 1MXFA 1U4NA 4A0GA 4BNWA 3ZWXA 4TM8A 3U7FB 3HCRA 5REQB 4FXOA 4EHKA 4P58A 1XWIA 3D8NA 4QUBA 3TTTA 1DC4A 1XLWA 4RANA 5U9CA 2PBLA 2FUG1 5IAKA 4M1YA 2FW7A 4TS1A 5IDWA 2HZBA 3SPXA 2I4LA 2NQ2C 2QL7A 1SIOA 1GZHB 1RXYA 1UXJA 2R8YA 2H07A 1A7AA 5J9FA 4CM9A 1U2ZA 2QX9A 2O5CA 3VNQA 3P19A 1E6EA 4G5OA 2HDHA 4WN9B 9LDTA 1ZOSA 1U2EA 2OCGA 4OQ4A 1TVKA 1XYVA 2WF5A 3T0FA 4EMTA 1BCRA 1XOIA 1T2DA 3UMJA 4TYPA 2Z6VA 5DNDA 1WCWA 1KJIA 3LNTA 1KK3A 3PC2A 2G4CA 3A1FA 3PXXA 3QVXA 5DYNA 3CN7A 3H2ZA 4HPXB 4QRIA 2YWFA 3EC1A 4B3BA 4E5UA 4IIJB 4AQYB 3LV8A 3ZV6A 1E58A 2Q9CA 1S1CA 1I4WA 2OXFA 3FRIA 3E18A 3HZOA 4NMXB 4NEHB 5AI6A 1T4CB 2GEFA 5IBCA 3KLMX 2JCGA 3PZRA 2CKMA 2Z30A 2Z4RA 2CNLA 3AY0A 3FF1A 4MV0A 1R66A 3RYTC 4HGYA 5JQGB 1YHYA 3V2GA 2E4UA 2REBA 5MF6A 1O8CA 3BH0A 3SOPA 1SZJG 3UMBA 1SR8A 2J07A 3PEVA 5T6BA 5C51B 2CJWA 2MINB 3F6BX 3KQYA 3ESYA 4LC9A 4H7IA 5EZ6B 1LNSA 1VL6A 3E9MA 1FVFA 4Q1AA 5KJEA 3TCNA 3DBHB 4BN4A 1S7GA 2RHRA 4BO9A 3KDAA 2IHJA 5J4HA 2AEJA 2Y67A 1N2ZA 1RP7A 3FR8A 3HDQA 5F5NA 1MA0A 2YNMA 2XOKA 3NTVA 1NXWA 3FIJA 3C2QA 4R01A 1A71A 1Y5IA 3PVSA 1LW6E 1QVWA 3V3TA 1S3FA 1UFKA 2NGRA 1ULSA 4JZKA 4OXRA 2C3PA 1L5YA 4X5OA 3SOZA 4CBVA 4HX9A 5C5IA 3MFQA 2WD9A 5FWYB 3M34A 3DLAA 1AVTA 4GR5A 5AJHA 4EKYA 4BKUA 1D4AA 4BO3A 1Y42X 5EESA 3CEAA 3MWJA 3NRJA 1U0TA 5LB2A 3FBGA 4G5YA 2JLQA 4NYMR 2QD4A 4IMJB 3STTA 5C8YF 5K8LA 2VK4A 1W36D 5EXTA 4DBLE 4B3FX 2ORVA 2QQ5A 4X92A 2WBLC 4OXIA 5I9SA 4BZWA 1NW7A 2OV6A 4A8HA 1SIUA 1Z5WA 4YRDA 1S9DA 5JZSA 1H8HA 2G71A 2IC5A 3ZQUA 4HJXA 4DG8A 5JSZA 1T8TA 4P5DA 1JG3A 3T95A 2NV6A 4YRMA 5ED0A 4M8IA 2IQ5A 1IVSA 1UQRA 4V1CB 1EWTA 4IFIA 3QWFA 5AJZA 1E2EA 2PLNA 4HWKA 2O1EA 4HUQB 1TLTA 1UKEA 2CLIB 4KRGA 1A8PA 3I52A 3HKEB 1T13A 1VC2A 2GXUA 3P2YA 3W2TA 1VXRA 1GUYA 2IOHA 3HSSA 4XCQA 5I8ZA 3SP1A 3TNFA 3ZHBA 2IH5A 3NOOA 2I4TA 5CNIA 4EP1A 3WNBA 4KXNA 4OKSA 1UK8A 4NULA 1UXHA 2FRDA 3K0HA 4A7PA 4EKDA 1VBFA 1QVVA 3TZ6A 1D6JA 2E18A 5HIIA 1DIOB 3PDCA 1QFMA 2Q8PA 4P1ZA 3BM5A 1SNYA 1TK3A 5GJBA 1SWWA 1P2UA 1EM8B 1GKUB 3N5CA 5JDCA 3MSCA 1A8QA 4JHXA 2QYTA 4RZHA 1OFGA 2KJQA 1NVXQ 5ALLA 2XA1A 3K2QA 4JD5A 2Q2WA 5I9BA 3RR2A 3FJOA 5I9MA 1FZTA 5EKXA 4DCUA 2I87A 3HCBA 2R6R1 3QM1A 1SKUA 1XJ5A 3TUIC 5CDYA 4TS9A 3D3WA 3H3FA 1N0HA 2WAAA 3JATA 3QEMA 4YTEA 5LQCA 2K2WA 2YYAA 4Q5IA 1QQTA 4ND3A 4QREA 4UQOA 4AY3A 4ETWA 2EBHX 2IDZA 3M89A 1FP6A 4DLUA 4OQMA 3TJMA 4C5AA 1E2LA 2B9EA 4HADA 3AEKA 1I30A 3EQ9A 4S12A 4WJZA 1Z25A 5JVDB 1JDJA 4D97A 4QJIA 1G8AA 3IX7A 4JYMA 3BTUA 1DLJA 4COOA 3IIMA 5IK2D 4M83A 3AP2A 4F2GA 1GKLA 1LJUA 1EDEA 3H2JA 4AM8A 4X63A 4Q4AB 2I66A 2ZRJA 4KK3A 3K73O 1D2HA 1E8MA 1GFWA 2IF2A 3HVKA 1SOMA 4YJ3A 3O47A 5BNFA 2PGJA 5BMVF 1RADA 4XYMA 4WXYB 1YZQA 3BK2A 5F12A 1I0ZA 3ESQA 3JR3A 4J0IA 5B3KA 3P52A 4XW2A 5I45A 3FHJA 4BU1A 1YOVA 4QU8A 3N2KA 4X41A 1MO5A 2I65A 2ODBA 4FGWA 1Z74A 4JT2A 4TN1A 1E2HA 1E8DA 4HRVA 1ZOPA 4UD2A 2DZDA 2H2DA 1V11A 3U6KA 5KKAA 4RMGA 2PSFA 3HVIA 1K2VN 4FLFA 5I4CA 3DOCA 3WQRA 2R84A 5B3JA 3A37A 5JADA 4FYWA 5CR9A 2YRXA 2GWHA 3CSUA 4DMMA 3D3EA 1C7FA 1M8FA 2X5NA 4UUAA 4YBRA 5CA1B 2UUPA 3U3OA 3V7NA 5F23A 1ZNWA 2I3GA 3ZD6A 2BHTA 1KOFA 1YTUA 4N49A 1T9GS 1O08A 2QLMA 3UW1A 4A27A 4Z49A 2PUFA 2C2XA 4JL8A 3IP9A 2Q4EA 4IWNA 3ZNPA 2YJ5A 4HH3C 5D01A 4G6ZA 4BFWA 5IJ0B 3FTDA 5I7AA 4QUIA 3PC7A 1JPNA 3TOZA 2C98A 1YB1A 2YIJA 1OYOA 1Q91A 1M2VA 3C24A 2GBLC 2W7TA 3DWEX 4UEKA 4CCYA 5J3JA 4XR9A 4WFKA 1KNXA 2ZM5A 2YV2A 4MVCA 4CKYA 4WJLA 1O4VA 4QDXA 3N0VA 1FNDA 3FTQA 3ZDCA 2A33A 4IGAA 1ENZA 2HA7A 1X7ZB 4GX2A 4KQ2A 2NZ8A 4Y0AA 5DYGA 5BN3B 5KQSA 4QFDA 2PZMA 1N2CA 2H4HA 2OZLB 2D2EA 4PM4A 2BGMA 5FOTA 2HK8A 4BNDB 4MI3A 1JJIA 2QMYA 2AW3A 3C8MA 1Y8CA 3IDSA 5IMBA 1XU4A 3QKRA 4QTZA 3DLTA 4GGMX 1X15A 4OB8A 4YP1A 1LVGA 2DKOA 2XUKA 1PNOA 3OX2A 3I8OA 3IE2A 4JGBA 1R3UA 4JP3A 4BP8A 3EXEB 1T9GR 3UMSA 2BV3A 1YJXA 1XXHE 1GGMA 2I2WA 2J9FA 3IJPA 3LLMA 2FEMA 3IKVA 4KO1S 3EIOA 4OY3A 4U2EA 1MFPA 2SKCA 3DGFC 4UD6A 5ESWA 2D1SA 3C5HA 1CXZA 2IHNA 4GP7A 1D0IA 4KXXA 1PHRA 1ZFNA 1X8JA 2XRMA 4R9UC 4Y30A 2H2IA 3FLEA 3TN7A 3AQ4A 4UKDA 3OPXA 3M9WA 3DD5A 2GPBA 1M6YA 4ZYVA 1VPLA 1E5DA 3L04A 1KI2A 2O3TA 4HYEA 4J7AA 4WWHA 1YVUA 5LIRA 2GRJA 3C6QA 4JU9A 1PFGA 1XWFA 4KRFA 3UPUA 4FR0A 2ZRGA 4P53A 3K8YA 4JI8B 3LUGA 4OJKA 5K45A 4ZCRA 2AMJA 1RLTA 1OC2A 4A23A 4K6GA 3Q1KA 3MS4A 2PBZA 3RTDA 3WQHA 4F9EA 2PQMA 2JIDA 2D2FA 2YZGA 3AUAA 3NORA 4NV1A 4GXQA 4TWJA 5DM0A 3SNHA 1XZCA 3T99A 2WP0A 3K1AB 4DCSA 3RRXA 4JBNA 2PLRA 3VO9A 4LOIA 4R2HA 1ONOA 2FN7A 5B4UA 5JZMA 3C15C 1FVXA 2WF9A 3LGXA 2WTEA 5CNKA 3R40A 1TA9A 4QLAA 3LUAA 2P68A 3DAFA 2Y77A 4MR7A 3VU8A 1VCOA 2VHEA 3ISVA 4RYLA 4BNKA 3KM0A 1N2HA 4PGMA 1NAIA 2E5FA 1XE3A 2L17A 2V7GA 3EAQA 1N6PA 3D6UA 3LGAA 3O91A 4HAXA 3RYFB 1XZBA 2OLKA 2Y1FA 4ZTUB 4RORA 4RD4A 1QDUA 2BPOA 3KELA 4L16A 3UMYA 1DARA 3AY3A 1J5XA 3ITDA 1DDIA 1X9GA 4M8SA 3VMFA 1TFUA 2V98A 5G02A 3MLBA 4EHJA 5B1EA 4CIWA 1SBQA 2J08A 3Q9NA 4MMXB 2HQBA 3JQ9C 1RWMA 1L5GB 3OT1A 1A9PA 4WI1A 2CBZA 1PWEA 3IXMA 4COKA 1XLTA 3QYFA 2Z08A 1MGPA 1HA3A 3W5DA 4FN4A 1B1AA 3VR3A 3X1YA 2I33A 4C78A 4UHHA 4K81B 3THSA 2VXYA 4YCDA 3ESRA 3LOUA 4J1TA 1BROA 2N47A 1K7YA 3BD6A 3CLRC 5FPHA 5B1DA 5BYAA 1E61A 2NTYC 4NG4A 3D64A 4DB2A 4J94A 4M22A 1O6CA 1A7UA 5AKZA 3S68A 4HN9A 1X1BA 2IYOA 2PQ2A 4DQVA 4PS1A 2H9IA 5BSEA 3E58A 4X93A 1V1MB 1ZAYA 7REQB 1II9A 1SC6A 2JVJA 1RHRA 2QVGA 1BWSA 2ERYA 3R0VA 2J3HA 3HU1A 4BV2A 5GPBA 3ZTWA 4D6XA 2GCNA 4F2HA 4D0GA 4PYKA 4RC9A 1IMJA 2OFWA 4ZEVA 1MB9A 3LS2A 1IZYA 1NW9B 1Q44A 2GVDC 2MMCA 1KYTA 3MMPA 4UDXX 4DCVA 3S44A 5HJ7A 3BD7A 4LECA 2DERA 1CIJA 3L7IA 2YASA 1XZDA 4YPVA 4XVQA 2HJSA 5I48A 3NYIA 4HYYA 2GNPA 2QTGA 4PW0A 4GWLA 2BH2A 1U8EA 3R5JA 2GPSA 2QD3A 2VZ0A 3IL2A 1Q1AA 3FWNA 2PKEA 4RS4A 1TK9A 1E3WB 2Y92A 5SV2A 4EOGA 1WZNA 4L27A 1A76A 4Q02A 5JMOA 2DOKA 2W2MA 3ML1A 2O5RA 1CDOA 2R11A 1VPDA 1W48A 2V96A 4MUYA 1IY2A 1CJTC 4KXYA 2O2DA 3VJRA 3UWMA 1PAUA 3DG9A 1V5EA 3TL2A 3ZWYA 3ZW9A 2NM0A 3KX2A 4QQNA 5LMZA 1RAFA 2BGRA 2QV0A 1QIEA 1T4MA 4HATA 4JEUA 3VZDA 3WXMA 3ZJUA 3FRHA 5JD4A 4UU1A 5D6NA 5DSZA 2JPDA 4IIXA 4H9GA 3CQ9A 2RBKA 4MVJI 3U6BA 4LF4B 2VDWA 1AOXA 3VM6A 1OV4A 3F8SA 4NBKA 3N0TA 4BZPA 4BCCA 3VR4H 4BNTA 2R1ZA 2HLNA 2C1EA 2DCMA 5JNUA 1K8XB 5B6JA 3LC1O 1CR1A 4Z9AA 2NU6B 5CEFA 2ZVPX 4MDFA 2J09A 3ICVA 2X3FA 3PQ8A 4YLGA 3VAYA 3LDAA 4HN4B 1PD1A 3KJQA 2BRUA 6LDHA 1T3SA 4MGEA 1WKBA 3LL7A 4GL4A 1XN1A 1Z4QA 2M6SA 5TVKA 3TRHA 1KORA 1A0OA 2WUFA 3E9ZA 4V39A 3L0OA 4XIYA 2BM0A 5AHKA 2PYIA 5ALPA 3U26A 1MN6A 4B74A 4L15A 4Z4EA 1KERA 4GR9A 4N5DA 2WRZA 3DDWA 4PO1A 4HYQA 2D00A 3E5RA 3RAJA 3ZHVA 4O5OA 4TTVA 1M34B 1E1KA 3C74A 3NJ4A 4PIVA 3ZZ1A 1NXSA 4FNOA 1GOTA 2QLLA 3C3XA 2FW9A 4R8KA 2OMEA 1CRZA 1AKRA 2C9MA 3AGPA 2RJ3A 3PTLA 3AR5A 2W8ZA 1A5ZA 1WXFA 4FEEA 4PS0A 5AICA 4N82A 5CT8A 3L4JA 2VH2A 2ZKLA 5LMCA 1IH8A 4FFBA 2YXLA 1GG9A 2A5DA 1PDWA 3QZUA 2Q6VA 4L7QA 4QLBA 4D98A 3EIFA 3H2YA 1PZGA 1WMBA 3HP7A 1XIVA 3W90A 2PX5A 4TYMA 1HT3A 2P65A 2FJ0A 1QFYA 2OGWA 1BYUA 3F49S 1QRSA 2H4XA 2OXCA 5CLJA 5LSAA 3JYQA 1T1JA 3OE5A 3TL6A 3IPLA 2P6RA 221PA 4PRYA 2DQKA 3DMGA 3HYNA 1WXEA 3IA2A 3P4YA 2F64A 3ZZTA 3OIVA 3GG2A 3KTOA 4LBWA 4NMHA 1Q0RA 2LD4A 2VZEA 1G0OA 1JQAA 3AVUA 4RVCA 3GLHB 5CLHA 1LB1B 1DFHA 4FGSA 2P5YA 1Y4AE 1WMDA 4QHYA 4FBMA 1J8YF 2I62A 4KVAA 1IN7A 3BSYA 5CVDA 1QYIA 5LXTF 3WICA 1E2NA 4DR7B 1YMVA 1FJHA 1XCLA 3KUXA 3CLTD 3ADCA 3LDHA 4IZ6A 5M34A 5IXSA 3A1VA 2VSOA 3QFFA 1CY8A 5CX4A 4A91A 3QBJA 4Q7QA 5M04A 2ZYSA 3B78A 2QTFA 1Z2AA 4OLAA 4G5HA 3RM3A 1NQXA 4YQFA 5REQA 2PL3A 2Q5QA 3DTNA 3FD8A 4GRIA 5HMMA 4F7DA 3N7AA 4NOLA 5IN4A 1MO2A 1LKZA 1Z8DA 3OETA 5I7SA 1UQTA 3JWJA 3SS7X 1ZMOA 4M98A 1BJKA 3UPDA 2ZTUA 2Z1DA 4FFNA 1KI1A 1M75A 3G1TA 1T36B 2WI8A 3RE1A 3DPUA 3GCXA 2IJGX 2R3SA 4WN9A 2Y6VA 4YCNA 3PF9A 2YWGA 3R6DA 4B7XA 3DE2X 3RKRA 1EUCA 3QNWA 3S1AB 4Z4CA 4IJQA 5A1TA 3JPYA 5A4FS 5CFNA 1KVSA 4GI7A 2E5LB 2JIMA 5ICFA 4DEXA 2RK6A 3NDPA 1X7WA 2QD1A 3I01A 3LPCA 5D1NA 1V8BA 4WADA 4J2TA 1TYDE 4IH4A 1YJ8A 2PM8A 2Q3MA 1N6RA 3HUTA 4M36A 1F6BA 2FVXA 2VJMB 2GEJA 3BHMA 3ZXUB 4H1WA 1VE5A 2DHEA 4IIJA 4URZR 5ARCA 2X15A 3NBUA 1Y3BE 3S81A 4YRCA 5A9TA 4UMFA 2P7IA 2R5FA 2XKAA 1KKMA 1MZVA 1W87A 4PZ0A 2QR3A 4AWAA 4EMUA 1FFHA 5JH7B 3KV1A 1T4CA 1HETA 2YZKA 1XDWA 4DVJA 1R4NB 4AJ9A 2XCTB 3DCNA 3LWBA 1EM6A 4Q93A 4XASA 2I9KA 1L7MA 4HQNA 2CXSA 3ZJVA 2C7QA 5JQGA 1IEXA 2E89A 1YRHA 4EHIA 3F6EX 3FAZA 3HDHA 1EWKA 3J81k 4L9WA 3A10A 3RU7A 3J7AC 1QHGA 3PHHA 3NR2A 4UBLA 1ESEA 4GQIA 4ZDJA 5KNBA 2KPOA 1RWWA 2MINA 3L0BA 1T9CA 4D81A 4EB8A 2OGSA 3HB1A 1KH3A 3DBHA 3OMLA 2Q5JA 1AKWA 4IXTA 4P3KA 3BDAA 4R1UA 3ELDA 3LKBA 3SZRA 1FYDA 4ZOLB 4D3DA 4X7RA 3MOGA 1N6LA 3DAOA 3HDYA 4IRUB 4BB6A 4D3FA 3UXEA 1GO2A 5KQRA 1PK9A 1Q1ZA 1MGOA 3Q0EA 5FBRB 3TJRA 1OWLA 1RIIA 2MSEB 3PUIA 3QUCA 1ES9A 2ZAGA 4G9GA 3UHPA 1GUAA 8OHMA 3GPIA 1FSZA 4TRNA 2PXXA 3NHSA 2RGDA 4CR7A 1EHCA 3RF7A 4FHZA 1E7QA 4HVLA 1HX7A 2GSWA 3GDWA 3U49A 2CDNA 4I9NA 3QX9A 2JLUA 1RIFA 1JXOA 2H8KA 3P9PA 4F0JA 1H4VB 3QHAA 1W7AA 2Q6KA 3EC2A 1ZM9A 2HV8A 2HT1A 5AK4A 2QW1A 1AT1A 5TGTA 4BLVA 5HXAA 5F9HA 2ZE8A 1NHWA 1OBOA 3BC1A 2IV7A 4OGLA 1KEEA 3OAAA 1W5BA 4V1CA 1UL1X 1E1RD 1TCCA 2PH5A 2QD5A 1SD2A 2XE4A 1CNEA 4M8KA 5CT4A 2JLWA 4HUQA 3WLHA 1JQLB 5CVJA 1EVEA 3D2AA 3ZY5A 2QRGA 1UH5A 1VM6A 3HKEA 5B1YA 1RWVA 2IF0A 2C1XA 3C48A 2AJ8A 2HDOA 3W8EA 5LZ2A 3S2UA 2FX2A 5AIBA 2RH8A 1RQRA 4BNZA 1IXRC 5JWOA 1Q7CA 1QSGA 4OQPA 4TTAA 4H7PA 5SYAA 1S8FA 2WSSA 2DSNA 4JMLA 5IF9A 1L0BA 5HIJA 3VYTB 4TGLA 4D74A 1I7QB 3RS3A 1P9RA 2H92A 4BB9A 1QP7A 2UXCB 1UZAA 1VXOA 5CA0F 3V7WA 4DV7B 1CIPA 2WAMA 3N2ZB 1XMOB 3JVUA 3KUUA 4XOUA 4BNGA 2JGEA 3F5QA 2Z04A 2HC9A 3IERA 2MCFA 4CM5A 1EM8A 4FSHA 4PLWA 2QB5A 4ED9A 5HQ3B 5KQLA 4YV1A 5KNBH 1JQ3A 1HO3A 1TM4E 3GARA 2C0CA 4OSEA 4ZICA 1EUDB 1EWVA 1N25A 4TSFD 4RULA 1G41A 4MGZR 2MSNA 2C83A 1R0ZA 2VUHB 1CUHA 4GECA 5TEVA 1KMNA 3ESBA 5E2IA 1IK6A 1AKEA 1FTNA 4B3JA 3SLRA 2YWEA 5BMOA 2XRZA 1GPWB 2OB1A 4KGXA 2O1SA 3TIFA 4J2OA 5JVDA 1B8UA 1L1RA 2IOQA 1EFTA 2F7SA 2N42A 3JQGB 3PSHA 3QY0A 4ZODA 3WR5A 3HZHA 4FGJA 4RQUA 3GJQA 5TPWB 3W3AD 1TEZA 2CYBA 2R85A 1VL2A 3OTQA 4NCXA 4AKTA 4MIKA 5AVQA 3DE3X 3QVJA 1F3OA 1WSAA 3LQ1A 2EZUA 4Q4AA 1FPQA 1T2FA 2FWMX 2AJTA 2NSHA 1IUPA 1J90A 4FE4A 5HKOA 5IPFA 5HCNA 4OB7A 2OHIA 4JUDX 4FNAA 4Y6LA 5FTWA 1FMCA 4Y6OA 3IRUA 3ODGA 5G0SA 2PGLA 1VHDA 1KQNA 1J56A 4ZCMA 2IIPA 4UTNA 3EASA 4J90A 1ITZA 3DAPA 4ALJA 1JHOA 3L6RA 4WXRA 3I5MA 4I8DA 2JHCA 3TLJA 2ZB8A 3BYZA 5FPKA 4RABA 4DQKA 4YRLA 3UAVA 3OI7A 4ZHQF 3KT6A 1RE0A 3EGCA 3ASZA 2EWMA 5E3JA 2HY7A 3H1BA 5FHRA 5JISA 4MKZA 3IBYA 4FBLA 3UT6A 4O2BF 4MDHA 4DPLA 2OGZA 1JVSA 4FCTA 1MNQA 1XZNA 2Q1UA 3HWSA 3KTFA 4QUGA 3W4JA 2FUEA 3A6LA 4FOOA 2XUHA 5CA1A 3LX5A 2CUTA 2FTKE 2QDXA 1MV5A 1RAHA 3UV6A 3ABSB 1NLYA 3G02A 1E1CB 3JQDA 2QMOA 1ISJA 1ESMA 4N03A 4MW0A 3TR0A 4EYSA 2NXCA 1P17A 3G0CA 2P0YA 2CFRA 4JEHA 5CT6A 3LYLA 1NXTA 4A92A 4IW3B 4BBJA 2VUUA 5KC9A 4C3ZA 5IJ0A 4NENB 3NGXA 1GVHA 3QWAA 4BLRA 2DUUA 1NBME 2JJ1A 4Z9XA 4NOKA 4YCAA 5AYVA 3PITA 4ZQGA 1TADA 2E3JA 4F8YA 4BL5A 3UMCA 2ZW9A 3OIGA 3QMMA 1Q7BA 4D8WA 1JTVA 1GCUA 1OI4A 2YHAA 3FRJA 4U9IS 3T0GA 3V1LA 1Y82A 2QZZA 2P2YA 1X7ZA 2I80A 4QJ4A 5CHYA 1U1DA 4EKEA 1Y9AA 1ZITA 1D6NA 3FJYA 5BN3A 4GICA 1JG1A 1TT7A 5B3AA 1UJNA 2GBPA 2X5XA 4BNDA 3T12A 2Y68A 1IHOA 2XODA 2BMVA 4IDAA 4F3KA 1JE0A 5AKYA 3NMUF 3HCEA 3SHQA 4LVOA 2N1MA 4GSKA 3RASA 1U7UA 2WWGA 4QUJA 1K5DA 3RI3A 1G6OA 4B3IA 3SK0A 1M1YE 1PT6A 1SKQA 1JDPA 2I8AA 3EVTA 4DQDA 1NZJA 3NPMA 3HJGA 2OUKA 2VATA 3CTMA 1AA6A 1E3DA 1QHXA 2IYXA 2VZ8A 2DQSA 3ICEA 2N75A 2WG1A 3OESA 1DBPA 2YCBA 3CF2A 3KOXA 3VR6D 3UPTA 3S5UA 5KDLA 3V46A 1ZK1A 2A84A 5EPOA 3G89A 3FOEC 3EFBA 4M6WB 1ZZGA 2VEDA 3R75A 3FFXA 4AKHA 3I1FA 2HRBA 4RYDA 1TUEA 3L8MA 2Q1WA 2L82A 1LS6A 4NECA 4RETA 5C18A 1KSJA 3GUCA 2AEFA 3B48A 2GM9A 2WNIA 2XY4A 3L0SA 2A5LA 5EQFA 3IVMA 8MHTA 2YRWA 1Z6AA 1RMYA 2X86A 3F47A 3V8NA 1VKRA 1BGXT 4YMHA 5CM9C 1W8IA 3LCCA 3DHVA 2KQUA 2ID7A 2XWBF 4P0TA 4RACA 4RSRA 4RW0A 4UZFA 4Y2PA 1ONBA 2L18A 3QOFA 1ZIXA 2VQFB 4JC8A 1QIKA 2CXTA 4I1PA 5DMXA 4CEJA 2RGCA 1D8TA 2HLDD 3HN7A 1VKNA 4B0PA 1HDRA 3K1AA 3C6BA 8ABPA 4C6SA 1DX6A 2Z3WA 3MMXA 3TNYA 1BX0A 1U0GA 3AL3A 1RKQA 3ZCUA 4W8OA 3SJZA 4N5LA 3CUSA 5U1PA 4EGQA 3I83A 1ZWKA 3LX6A 1X38A 2O3SA 2POQX 2V7QD 4LPKA 3WLEA 2C9YA 2WSLA 1CK4A 4EUFA 3RAEC 1U6JA 2P90A 3D7KA 1I2AA 1U3UA 1NSTA 3PGKA 1PFQA 4DZTA 2N0SA 4UCXA 5FLYA 1U0RA 2GF2A 2C8VA 2HFJA 3RYFA 3WDMA 1I3NA 4AZ3B 3T7CA 2GJKA 3KJXA 2NZXA 4S1PA 5TEWA 3X1XA 3TFOA 2P2CA 4D8VA 3CV3A 1OBHA 1SBYA 5HBRA 4CRWB 4QVGA 1DDGA 1JS1X 3AHEA 1GHTA 2CE7A 4RTSA 3OPYB 2FRVA 1O6ZA 1UBHS 3BJMA 4X20B 3I92A 3MJ4A 3V6MA 4JC0A 5CT5A 1T6NA 2RGXA 4KRYA 1TLLA 3DTVD 3UMGA 4XZ3A 4LN1A 5E7IA 4RWEA 4Y8VA 1ENPA 4E33A 2RARA 2NYRA 2NADA 1JEQA 1WRBA 4YJ2B 5H02A 4LC0A 5PGMA 1PSDA 4JJFA 1E2KA 1ZM2A 2VQ6A 4FHCA 3AY6A 4RX1A 2XNCA 3SJBA 1SU7A 2JGLA 3DHNA 2BKXA 2Z83A 4M88A 2DUMA 1XKTA 2CC2A 1E9RA 4D4LA 4FMCB 4LBYA 4PYNA 4NCNA 2H4WA 4RF4A 2N3ZA 7REQA 3NWJA 1WHTB 3JZFA 1KDYA 1KA9H 3OFKA 3SICE 5H4GA 2AG5A 1S3IA 3DYIA 3RUFA 4XI9A 4EG5A 2HHCA 3PTAA 1SUIA 1JIJA 2VYVD 3A2NA 3AUFA 2IP1A 2HX1A 3QFHA 4YJFB 3OC0A 4I9UA 1ZK2A 1QJ4A 4N1AA 2QVLA 3ZH2A 1QJCA 4JYZA 1QOZA 1WTCA 1TPZA 4PZPA 3HZZA 2IU0A 1NF9A 4BRUA 1WNFA 4QUKA 1ZD8A 1T9DA 4O8CA 5IT0A 3C98A 4JVNA 1E3WA 4OOFA 4X9XA 2ZSBA 4EAQA 5ALSA 1E20A 1M8JA 3I62A 3WLAA 3KQLA 1N6KA 4EI8A 3QV2A 2CJYA 2JHAA 4BKMA 1YDFA 3LLSA 3VPDA 3TQCA 2ZJ4A 1BDMA 1KU6A 4C4TA 1EFLA 1G8FA 3GZNB 1ZMXA 1ZGBA 1VJDA 4HX2A 2BN4A 4IMIB 3TFWA 1NUPA 2CLLB 3D2BA 5SZIA 4ZI7F 3PVZA 4PC2A 2HU5A 1TF7A 1E1YA 2E48A 2ZB2A 1GGNA 5T6MA 3A9WA 3BB3A 3FFBA 2AEMA 1T6ZA 1TXGA 1B00A 4LTMA 4WBNB 3B6ZA 2O3RA 3EAGA 1GT91 1MH9A 1XCBA 5EGNA 2QORA 4PWYA 3VC1A 5KJ1A 1M74A 4NZZA 2QM3A 2XUFA 3ILSA 2DFLA 2VPWA 5JYBA 5TR9A 4OMUA 4MKHA 3V7FA 5J5VA 3I9MA 3MTBA 3IEPA 2NU6A 2OV8A 4PPYA 3BGWA 3QLTA 3CLRD 4I50F 3KVNA 1FNCA 2YIDA 2J30A 2CVOA 3FCSB 4QHTA 3HYTA 5BN5B 1SA0B 3DOJA 3QXJA 1G59A 1E1QD 1WVGA 5SZKB 2PEYA 1FFEA 4Q3DA 4JODA 3IUSA 1GRQA 1P9OA 4HLCA 4TYQA 3G5MA 4IV8A 2Q4RA 3LBIA 4RVGA 5IWAB 5TT1A 1M34A 4MCIA 3BTSA 1XMXA 3NIWA 1L6IA 4AD8A 2X23A 4LG1A 2QNIA 3ETEA 1UUFA 2G17A 3EXAA 3IAUA 4HS9A 5EIBC