2X19A

Crystal structure of importin13 - rangtp complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
172
structure length
172
Chain Sequence
GEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGLEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-BINDING NUCLEAR PROTEIN GSP1/CNR1
publication title Nuclear Import Mechanism of the Ejc Component Mago- Y14 Revealed by Structural Studies of Importin 13.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Nuclear transport
total genus 45
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2009-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2x19A00
5FUXA 1TADA 5LB2A 2V1XA 5DO9A 4A4DA 4DCTA 1F2UA 2RH5A 3U3OA 2FSFA 1VPLA 2X8AA 1OXVA 5KU1A 1AGPA 1UKYA 1FTNA 5FOXA 2VSXA 5JFGA 3R9WA 1PZNA 1SVIA 3IPYA 1G8HA 1G17A 2HUPA 4NBSA 3SHFA 3CLVA 5FBWB 5FBLB 5AJYA 1D6JA 2XJ4A 3KJEA 1NP6A 2OZEA 1XB2A 1W48A 2OXCA 3EX7C 3AF0A 2JJ2A 3T5DA 1CJUC 2NTYC 4PQRA 4BEJA 1NBMA 3A4NA 5HTKA 2VF8A 1UDWA 1QHHB 1CXZA 2P2LA 3KKNA 4XSGA 3RANA 2EWVA 3VU9A 3B60A 4KYUA 3B9PA 2ORVA 2ZYVX 4I99A 4BLQA 5FBVB 4P32A 1TPZA 3F3YA 3Q7QA 4BZQA 5BWMA 2O8BB 3GLFE 3B1XA 1KO8A 3BFVA 1SXJA 4MA4A 5TVKA 2GZAA 3T1OA 3RC8A 5L8VA 3WBJA 4IRUB 3OF5A 5TB5A 2QMUA 3B1VA 4R9UC 2ZSEA 4W5JA 4M1KA 2J0VA 1T3HA 2XSZA 4KHZA 2BBWA 5L3SB 1KSHA 4E03A 1T0JB 2AHOA 1KGDA 3VTKA 1KZGB 1NIJA 2JLVA 2UVQA 4V02A 1RC8A 2ANBA 1PLKA 1OPXA 3TW4A 4RKFA 1G8PA 4A92A 2FOLA 2ZR7A 2E87A 2W00A 1J8MF 4OHWA 4A8JC 1MO5A 4PPQA 3IO3A 2LCFA 3PEYA 1KSFX 521PA 1IHUA 4KVGA 1Z6AA 2J7KA 3IBYA 4JBYA 5KOYA 4K8OA 1MO3A 2J0UB 4AURA 3BWDD 4DT1B 1G291 1E2QA 2RHDA 5TXGA 4M9XA 4ZCMA 3OFNA 3CO5A 1YU9A 1YZNA 4UXHA 3TH5A 1TEVA 2ANCA 2O52A 3QSYA 4ON9A 4OJQA 1RRFA 1ZC4A 4TTRA 3VAAA 1S0UA 2NO1A 4HLCA 5H68A 3ONWA 3WP0A 4MITA 1Q1BA 2GXSA 2LWIA 2ODEA 1TTTA 5HE8A 1P61B 2NPFA 2P0EA 5SZHB 1EFCA 4PPFA 1XMVA 4Q9LA 3T15A 2VIIA 1XTIA 1MABA 1KMHB 2YWEA 4LBYA 3QBVA 5DN6A 3A1TA 4QXAA 1II9A 1HE8B 3RHFA 5GJVC 4JVSB 2A9KA 2P6NA 4DUGD 2WPDA 5EUQB 2VL7A 1P5ZB 2G1KA 4GL2A 4L15A 1N5IA 2QAGB 4OL0A 1G1MA 3CM0A 3TQCA 4JLVA 2GETA 2R6FA 3I32A 1PUJA 4G5GA 3KQNA 3GCGA 4HZUA 1ZNWA 4QNRA 2V3CC 4D6PA 5FTLA 4US0R 3ZVRA 2VP5A 5DSZA 2FV8A 4NE2A 4KAXA 1CR1A 4WA7A 1TU4A 4FN5A 1E9FA 1D8TA 2XXAA 1W36D 3C15C 4HLQB 1HE1C 4B71A 1DS6A 1US8A 3KDSE 2A7QA 2C04A 3GFOA 3LW7A 5EQTA 3EPKA 4QBIA 3IHWA 1F6BA 3QG5A 1KI6B 3RVBA 4GNKA 2JATA 3ADKA 4M21A 3THWA 1G7RA 4W9MC 1X8KA 3PUWA 1GWNA 3W6PA 1AIPA 2QMHA 3KFXA 4P4TA 2JLZA 3K0AA 1K5GA 4PPGA 1ZM9A 3KL4A 4KSBA 1KJYA 1YE8A 1W1WA 1R6BX 3B2EA 2FFAA 2BJWA 4DXAA 5IF9A 5FUVA 3CUEF 2IYTA 4GP6A 2Z83A 3SFZA 5K8IA 3GJXC 4TLCA 1ONBA 1LB1B 4MRSA 2C96A 2YVUA 4D4LA 4A8JA 3LW8A 3G82C 2MSEB 1XTKA 4OQLA 4KFUA 3AKDA 4ZIRA 1AKEA 1ZIPA 4FXPA 4URXR 1OB2A 1DVRA 4DCSA 1J8YF 4LY6A 4B2IA 2VP2A 3B7GA 3K53A 2ZRNA 1IN7A 2ZETA 3MLEA 1O87A 3CNLA 4B35A 4CEHB 2AX4A 2BMDA 1OIWA 4F38A 3ZZ0A 1GUAA 5FBQB 5JWRA 1AJEA 4XWOA 3QENA 2RKOA 4URVR 1KO1A 4RCYA 4YMSA 1RW4A 4OK3A 2CNWA 1J2JA 3AGPA 1XU4A 3LQQA 4JT4A 3U3JA 1VTKA 4PC2A 2DY1A 5JMTA 3CPHA 4TL7A 5EXPA 1Q44A 5JI3E 4CEJB 1M34E 5E3HA 1PV4A 4EQ6A 5LDDC 1YR8A 3W90A 2AN9A 4CRWB 5DH9A 4MRPA 2YINC 1W0KA 2F9LA 3PEVA 1Z0KA 2J59A 3OEHA 2WMNB 4NTZA 1S4QA 3GJ5A 3AEZA 4JLAA 4ITRC 2NO9A 3TNFA 2XOKA 3L43A 3K0CC 1XXHB 2OCYC 2IK8A 4AG6A 2ZSFA 3NKVA 3SEAA 3OIUA 4PSKA 4JLOA 5B64A 1FFHA 2KE5A 1U94A 2G3YA 4OBEA 3RS7A 4RZUA 4QL3A 1TQ4A 1AK2A 4RZ2A 3QF4B 4LYFA 3K70C 2XNDA 4LOAA 1P2UA 2BM1A 3RWOA 1QDEA 2J0SA 3WNBA 1PLLA 3U44A 2A5DA 2UKDA 3HYTA 1NN1A 5J47A 1S96A 1E2HA 2F43B 4LHVA 4MRRA 4LHYA 1ZBDA 3K9LA 5SZKB 4IOJA 1P9NA 3DEFA 2CK3A 1RKBA 3DKVA 1E1QA 3EC1A 4PQYA 2QZ4A 2IA5A 4RFVA 4MYCA 2R9VA 4AK9A 3UMRA 3MAAC 1I4DD 1A82A 4CYMA 1YHNA 2GNOA 1W36B 4QOSA 1NJGA 1N5KA 1ZCAA 3P20A 3TUZC 4AYTA 1ZRHA 4LJ8A 3N2IA 1VMAA 1FX0B 2GILA 4BRWA 5HR5A 4JLDA 1QHYA 5CK4A 1Q1QA 2WWIA 3KKPA 1E2DA 2GEDA 1GRRA 3NHAA 1XPRA 1G20E 4TYQA 5F2EA 1IXZA 4HATA 4LBWA 1E2IA 4I1SA 4BLRA 4DCVA 4F93B 3GLHE 5F9FA 4R98A 3E2IA 4HAZA 1Z2CA 3OEED 1KAGA 3NBZC 1Z63A 3VNUA 2PCLA 5E7IA 3ICEA 2O8DB 1AKYA 4NYIR 3CZQA 3BB4A 3MWYW 3EAQA 3CW2A 3VX3A 2IXGA 1W4RA 4XTCS 3T35A 1LS1A 4JVLA 3PV0A 5EP1A 4DSUA 3EA0A 1W5TA 4N0DA 3V4FA 2N42A 2K5UA 1XD9A 2JDIA 3AVTA 1GP2A 2BKEA 2J87A 1FUUA 3AVUA 2P6UA 3SI7A 3RNLA 1P6XA 3C5CA 3N5CA 1ZAKA 1E9RA 4PO1A 4V0ME 4XSHA 4PC6A 5TDHA 3V00A 4JLMA 4N1AA 5GVSA 1UFQA 3QXXA 1IN6A 5DI9A 3SN6A 6Q21A 1XBTA 4GZLA 1P73A 3BK7A 3QEJA 3K0CA 3GLFA 4BLPA 5H70A 1FNNA 3LAWA 4B2PA 4DZZA 1ZU5A 3Q85A 2ZJZA 4WW0A 2IHYA 3PUZA 2BM0A 1EX6A 5FPHA 1WBDA 1G8YA 2BMEA 3UPUA 1Z47A 1S3GA 2Z43A 4C0SA 1W7AA 3SYLA 2EYUA 2LKDA 5BN5A 2H1LA 5FH9A 1XPOA 2GBLC 4M1TA 2Q9AA 1U81A 2ZIAA 3L8ZA 4MGZR 4F92B 1JR3D 1Q3HA 3C7KA 3T34A 5FTKA 1A2BA 4QM6A 1DARA 3LWNA 2FSHA 1F5NA 2JEOA 4Z1MA 5JJKA 4RZ3A 3EW9A 4HYYA 2CCKA 2P67A 1DAEA 2F3TA 4C9BA 2VSFA 3Q7PA 4F4JA 4Q7JB 1F3OA 1Z0FA 1BMFD 2ZE8A 2ZREA 2AFIE 1JJ7A 4TSFA 1JJVA 2LKCA 3EC2A 3ZDQA 1XTJA 4IEEA 2BMFA 1N5LA 3P27A 4H1VA 3MWKA 4IW3B 1MR3F 4JVNA 221PA 1QHHA 3D8BA 1NBME 3THYB 1YKSA 2QG6A 2ZTSA 1P2TA 1SGWA 2F3RA 3E1SA 3ZGXA 2HT1A 2OO7A 2XX3A 4M1YA 4OHVA 4NKRA 2ZRBA 1AS2A 2YHSA 3U7FB 1J90A 2O8BA 2E9SA 2CLSA 2QNRA 4HZIA 4QBGB 4ZO4A 3W5JA 1XMIA 2FJUA 4TL9A 1R5BA 4JMPA 5G3ZA 4B3XA 1SXJE 5KTYA 5D3MA 2QY9A 2MSDB 4IOKA 4O2LA 1OKKA 4TMKA 3NDPA 5CB8A 3HR8A 3GPLA 2F1RA 4M8NE 2ASEA 4Q21A 4Q1CA 2V9PA 4DHEA 5L3SA 3MFYA 4US2R 3L8YA 5BXQC 2IYZA 3IIKA 3ASZA 1AS0A 1PUIA 1JAHA 4EKDA 1SULA 3U3KA 1OXSC 5EE1A 1E0SA 2R6GA 5FFMA 4WOPA 3NBYC 1B0UA 2HXSA 1G5PA 4OK5A 1NVVR 5G3YA 4O0MA 4DC9A 2O0JA 1N6KA 4A15A 5HE9A 2WJHA 1COWD 1DEKA 2AWNA 2OG2A 2FEMA 4JLBA 4Q4HB 4BFSA 2RGCA 1E2PA 2ZI9A 1J70A 1JECA 1XTQA 2B7BA 5AUNB 2ZSDA 2J0UA 4DT1A 5BN3A 2R6CA 3NTUA 3MRSA 4DSTA 2L0XA 4URYR 5CK5A 5EZ6B 4IDPA 3A4LA 4JJKA 2OCAA 1CJKC 1CS4C 3RDPA 5JJIA 2J9RA 4KV9A 1DAGA 3ZH9B 3W8NA 1XEWY 4C0BA 3U61B 1XP8A 2OLKA 4PANA 5D3QA 1YR6A 1AZTA 4DJTA 1SVSA 1KZ7B 3BXZA 3L0OA 3IKJA 1ZM2A 2ODWA 2WWWA 4JVMA 3O8CA 2NO6A 3VKGA 3RS2A 1T5LA 1UEJA 4R2IA 2WZQA 1M7BA 3DMDA 4EPRA 2GAAA 2GBLA 2IYYA 3I8XA 3IHLA 3MCAA 4HDCA 4LV5B 3RYTC 2V6IA 1KSGA 1UKEA 2OUKA 3JVUA 1KNQA 2D62A 4QFMA 1GZSA 1II0A 1VIYA 3B1WA 1KI3A 2NO0A 4CIDA 1ZNZA 1E79D 1OT3A 3ZQ6A 1YZGA 3Q9LA 4ILEA 5LD2B 2ZRIA 2A3RA 1H8HA 5EE0A 2HJVA 3KB2A 2OBMA 4CT5A 1N6RA 1Z0AA 4EPTA 1DAHA 5C18A 3T12A 1U99A 5JECA 4IVPA 4RD3A 4NCHA 1W4CA 2ZRKA 2YWHA 4Q9IA 5BQ5A 1S9HA 4PAMA 2PX0A 3I8SA 1N0UA 2CL0X 2XGJA 1GILA 2D3WA 2VP9A 2Q6TA 4IXNA 5H1YA 4EJSB 3TE6A 4IDOA 4CEIB 1QHNA 3TLXA 3OHMA 1G5TA 1TEXA 1UBGA 2FWRA 1YZKA 3KQHA 4UNNA 4QGGA 4W7SA 2GXUA 2ZJYA 5AK0A 1GL9B 3IPXA 5C4GB 2YYZA 4CZ2A 4B73A 3K0SA 2CXXA 3RWMB 4D82A 3KTAB 5IT5A 3M4YA 4DDVA 1ZINA 3OE7D 4Q00A 1F2TA 1N5JA 2W83A 2CJWA 2PLRA 2ZUBA 4LCBA 4M1OA 1Q3TA 2GK7A 5LBIA 3THOA 2HEIA 5G41A 1TQ6A 1KY3A 4C7OB 5TMPA 2YOFA 4L8GA 1R8SA 3GLGB 1TL7C 4IFBA 1G16A 1ODFA 2HLDD 1GSIA 1SHKA 4M9SA 1O3YA 1BYUA 4MKIA 2WIBA 1ZM4A 3I4LA 1L2TA 1FOEB 3RS5A 3ZLJA 2IC5A 1X6VA 3L0PA 4B3GA 2ZRHA 1P60A 3A37A 4JYBA 2QGNA 4I1VA 4CEHA 4RFSB 2EFDB 1LVGA 3PG5A 3SQWA 4AY2A 3RLFA 4D0LB 4FMCB 1Q0UA 1G7CA 4BWYA 3EASA 3VR5A 5JSZA 1Z6TA 4L9SA 3ZZUA 2YOHA 4Q48A 4QHSA 2GZHA 2DFTA 3NXSA 3U60B 5FL7D 4PSAA 2FFHA 4L16A 3FMFA 3CB4A 5JHGB 1U0HC 2BHRA 3IIJA 2BBOA 3H84A 1ZVQA 1W4BA 4JLJA 5DYIA 1I2DA 2R2AA 2WOJA 1XRJA 3CRQA 5KPDA 2C77A 4BFUA 1BOFA 3GLIA 1RYHA 1ZU4A 2VLIA 4QC2A 1FP6A 1HA3A 1P7CA 2KBFA 2ZYUX 2GJ8A 3DVLA 3IGFA 4NYJR 3RRZA 2QUZA 3RRYA 5JCZA 3U6BA 4UXJA 4B2LA 4PC7A 1QBKC 2GKSA 3RRNA 4NL4H 1JI0A 2PCJA 4WXRA 1F48A 3TJZA 4IDHA 3ZD6A 1SXJC 2DWOA 3LBIA 4TTQA 2CHVA 4OHZA 3U4QA 5J4VA 3QXJA 2QRNA 2ZRLA 4IDQA 1NMXA 2CL7X 1RIFA 1JEEA 1HURA 3CH5A 5DHAA 2FX3A 2GF9A 2PZFA 4JSYA 4D4MA 1DPFA 2KBEA 3BH6A 4DUGA 1YRAA 4A0GA 1ZUHA 3CF6R 5DNYB 3ZVNA 1G19A 1PLJA 1L4UA 2F43A 1QHGA 1MO4A 5AJVB 3IQXA 4ABYA 2B21A 3QKSB 2FSGA 1OLOA 4PZZA 3NEYA 4MUAA 3K09C 2YOGA 3D3QA 4GPTA 1LV7A 1G64A 1ANKA 2XEXA 2O8EA 2IF0A 2N46A 1NY6A 4JT2A 2HF8A 1FX0A 2JLWA 2KSQA 4A6XA 2FE4A 4LPSA 4XIGS 4DB2A 1J7KA 2RCNA 3GJ0A 4A36A 3SDZA 4B3CA 4POAA 1GFIA 2F1JA 4RJLA 1D9XA 4MYHA 4TLBA 3NHBA 4ZI3A 4ZI2A 3MSXA 4HUQB 3UG6A 3OIWA 2F9MA 3AUYA 4FMDF 4II7A 5DIFA 1BH2A 2PH1A 1RRCA 4GZMA 4DLRA 4TLDA 3BE4A 2OAP1 1OHHD 2GAOA 1JAIA 1VHTA 2FPLA 5AJWA 3W3AA 4A9AA 4U7DA 2QBYA 1G5RA 1UBEA 3U3RA 4WZ6A 3GFPA 4LI0A 4DLTA 1WDTA 5FPTA 3W3ZB 3ZIAD 1X86B 3PITA 2OEPA 4F4IA 3TQFA 1FQKA 1WP9A 1IQPA 2ZI4A 4Q4JA 4BFYA 2D7CA 4YXWD 4LC0A 3TBKA 1G18A 2PL3A 2ZRMA 3QEOA 4L4UA 1GOTA 1Q57A 1VYVA 5EUMA 3S1AA 1PVOA 3LBNA 5FBRB 3FHCB 2W6JD 4I4LA 3LVRE 3PXGA 5J4YA 3UXMA 3FWYA 3SJZA 5SZIA 1S1CA 3QPWA 3EZFA 5CLLA 2EYQA 1YJ5A 4S2EA 3JZAA 3TVTA 4GI7A 1GG2A 1XD8A 5JLJA 2QP3A 4PO8A 4UKDA 4TMWA 4XVRA 2ONJA 3PUVA 3SOPA 1OSNA 1CR0A 2BEJA 4CF7A 4ZDKA 3DOEA 1EWRA 2QP9X 1QG2A 3QKRB 5DHFA 4DWJA 1E98A 2ZRFA 1CF4A 2PEYA 3BGWA 1XMSA 3H4MA 1KDRA 4PPNA 3VX4A 621PA 3NBFA 3F5FA 3QPUA 1Q20A 1P2SA 3SR0A 4NH0A 4U5XA 1E9BA 2ZRCA 2ZJAA 3K09A 4MKHA 2AKAB 2G0NA 2IYSA 4DLYA 2GVDC 2WJYA 1IY1A 4K46A 2ZS7A 1XTRA 4PHTA 4B6FA 3AVOA 1Z6YA 2IYUA 3JZMA 1PJRA 4JL8A 5FL3A 1XD2B 1NY5A 2QL6A 3EPHA 1KK1A 2VHCA 1H8ED 1KJZA 1VHLA 2VBCA 2D2EA 1SVMA 1U90A 4H1UA 2YZ2A 2BKUA 2R65A 3RSLA 5L3QB 2O8CB 2ZJOA 4BZXA 4B33A 1Z07A 3CX7A 5FTNA 3CWQA 1ESNA 3HYRA 3EWSA 5FI1B 1N6PA 2ZRAA 3FKQA 3TRFA 5ANRB 3A6PC 3LO5A 4MGKR 4ACBA 4YC7A 5BW8A 3EIQA 3L82B 4OHYA 3UK6A 2DFKB 1E4VA 1Z2AA 2KI5A 2NQ2C 2P5SA 4BRUA 3SBEA 2XNSA 4YMVA 3RAPR 1QHXA 1AGRA 1T8TA 3EZ9A 3KUDA 4QG7A 3EA5A 5JZVA 1OH5A 1FW6A 2GA8A 3RS4A 4QM7A 3U7GA 4TZ6A 2ZPTX 2GVZC 5J5CA 3CPEA 5CB6A 3FPAA 1R0YA 1N6NA 4FD2A 5CITA 2JASA 4QGAA 5C1BA 1RZ3A 8OHMA 4JBWA 4BFXA 2QP4A 1YRBA 1TQ2A 2NGRA 5B2ZA 4M53A 2ZITA 4JS0A 2OXRA 4D25A 2QM8A 4WAUA 2IYVA 5FI0B 3OEEA 5ELXA 4Z54A 4Z8XA 4R7ZA 3DPUA 2NMVA 2AXPA 3FB4A 4Y0AA 3K9GA 2HT6A 4DVGA 5HKKD 2QT0A 5J4KA 1LS6A 2MSCB 4ARZB 1HT2E 2ZRGA 3TW8B 2XTMA 1VCIA 2I1VB 3H2YA 4IEIA 3O8BA 1E2LA 2I4IA 3RSOA 3BRWD 2V1UA 1DTSA 4RD6A 2JIZD 1A7JA 1CJTC 2GF0A 4GDFA 1NKTA 2Q9BA 2ZJBA 3AGQA 5CLQA 3RC3A 4C0HA 1Z22A 3LFUA 1R4AA 1WMSA 4TT3D 2HXYA 4FCTA 4B76A 3A1SA 2ZYTX 4QBHA 2QMEA 3SE0A 2Q3FA 1E1RD 2HDNB 2OV2A 4WZBE 1U8ZA 2GZDA 4R71A 2YV5A 4RVCA 2UZ3A 3QJYA 2GCOA 1KI7A 2ZRJA 4HEJA 4LV8B 2OSBA 2W6ID 3VR3A 4LDJA 4R2HA 1E9DA 3HJNA 4Q9KA 3QVVA 1M6NA 1YZTA 1CRPA 2F6RA 5G40A 3K0FB 3VMFA 1DE0A 2NO7A 4LJ5A 4C2UA 5EZ5A 4D4JA 3M6AA 4B74A 3I5XA 1E9CA 4P33A 5CDFA 1BO6A 2QENA 3D7MA 4CEIA 2IT1A 1JR3A 1T0HB 2I1QA 4LJ6A 2FH5B 4LYHA 3BFXA 2YC4C 3GJ8A 4QRHA 4UNSA 3L0SA 4AKHA 4LX0A 4G0NA 4JJZA 1EFRD 1U0JA 2J7PA 4O25A 4A2PA 4U00A 2WKQA 1U2RA 3A1VA 2RB4A 2CE2X 1YQTA 1BMFA 2ZVPX 3W9YA 4EPWA 2IX3A 4PAOA 1EESA 3CKLA 3W6NA 3HPRA 2VHTA 5AUPB 2JA1A 4RSGA 1DOAA 1G21E 2QA5A 4BPBA 3OAAD 4PTLA 1QG4A 2EFEB 3DHWC 3PVSA 3K8YA 3GLGA 4RD4A 3AKCA 5DI3B 3MWLA 3TK1A 4NDZA 4QJ5A 4LGMA 5KSOA 4I1UA 2PX3A 1XEWX 3ETLA 2HV8A 3ASYA 4GOKA 1BKDR 3PENA 3T61A 2BIFA 3TGPA 5AJZA 3CX8A 2GWHA 2XSZD 3SJCA 3T1TA 4ZDIA 3B6EA 3QXSA 2E1RA 4NYIQ 4OQFA 4D26A 1Z3IX 2W2VA 1NN3A 3A1UA 3CX6A 1HH4A 1W44A 3WBKA 3EZ7A 1JQLB 2FMXA 3KJIA 5GADl 1ESMA 1EG7A 1COWA 3PFIA 1IJFA 3U7HB 1AQYA 1R5OA 3GLHB 2J0QA 2REBA 3C8UA 2WKRA 2QQ0A 3BAFA 2ZS8A 2BVNA 4NZYA 4URUR 5FPSA 1Z8FA 3X1YA 2W0SA 4X8MA 2WMOB 4KITB 4TYWA 2REXB 2R6DA 3AVWA 2OFXA 4HLDA 3GLIE 3K0EA 3V4RA 4KFRA 4JYCA 2IS6A 3UATA 4PZLA 3LLUA 2OLJA 4OI2A 2WJJA 2G0TA 1OE0A 2OCPA 3ZS8A 3CRRA 2O8FB 4Z8YA 3ZD7A 5JS8A 5IHPA 5TV2A 1XEXB 2ZRPA 3QUSA 1Q12A 2FZLA 3TAHA 5DN6D 4XTRA 2V8OA 1N25A 3B9QA 1ELOA 1E6CA 1L7VC 1CU1A 1ZCBA 4IFEA 1ZD8A 4XWAA 4OK6A 3LNCA 1UM8A 2VEDA 1E32A 3DZDA 2GJ9A 5KNBA 1C4OA 3EXAA 2FA9A 2OILA 4Q19A 2EW1A 5KO2A 1KNXA 3L2OB 3FVQA 4AYXA 3QKSA 3KB1A 3B8HA 2ZYWX 2Q3HA 1OIVA 1G4UR 2IL1A 4NP6A 2P3SA 4P0TA 4JL5A 2OFOA 4JBXA 4JLNA 1EX7A 3I3SR 1FPMA 4URZR 4LPKA 1ZNXA 1VCNA 5BYJA 5KSYA 4LK2A 4Z51A 1WBBA 1K8RA 5JEEA 1R2QA 2XB4A 1OB5A 4S35A 1NJFA 5EE5B 4PHFA 1F2UB 3LH5A 5L3VA 1TU3A 2CL6X 3KUCA 4ZDJA 5FPKA 1CTQA 2HYDA 1HQCA 4K81B 4NCIA 3NIBA 2C9OA 3NEJA 4MDEA 3HWSA 3BB1A 1NG9A 3GJ7A 3N2EA 4NMMA 5CJ2A 2QSYA 3ZJYA 3THXB 1U9IA 3RS3A 2ATVA 1P2VA 1IXRC 5FPYA 4C3ZA 3AF4A 1MRNA 1DELA 2GEUA 5EE3A 5A0FA 4TZ0A 2QAJA 3ZVLA 3PUYA 3QVUA 4BLSA 2RGEA 1NVUQ 3DOFA 5JCPA 4C0KA 4PXAA 4C0LA 3VU9B 3IEUA 4PC1A 2DPXA 2QAGC 4HUTA 1NVVQ 1XEFA 3I72A 3AVPA 1OV4A 2ONKA 4HLUC 3Q3JB 1GRNA 3NG1A 3O8RA 3NVAA 5AUQA 2RMKA 1X8LA 1UBFA 1A1VA 1W2GA 1UEIA 2C5LA 1HQYE 1Z83A 4B43A 1Z0DA 5KNDA 4Q7MB 5GJCA 2IWHA 4B47A 1E2JA 2RGBA 4V0KA 3KQLA 4Q18A 4Q1EA 2WJVA 2N1BA 1X8JA 5GJWC 4LWZA 3GD7A 2WV9A 2CHGA 4Q5IA 2EVWX 1N0WA 2IBMA 5FOSA 2C98A 1D5CA 4D80A 4C0AC 2A78A 3K9HA 3CNNA 2Z5FA 1VYUA 5BYKA 1GDDA 3BB3A 1P62B 1SVOA 1E94E 1KOFA 5DYGA 3X1WA 4BFTA 4M9QA 5FOWA 3SBDA 1CBUA 3A4MA 3C16C 4A6PA 4DEYA 3B82A 3GEHA 4M1MA 3IILA 1W0KD 4C30A 2W2XA 1MOZA 2F55A 1E0KA 2HYIC 1N2CE 4AKGA 2ODBA 4JIMA 2RAPA 3FFBA 2J45A 2O5VA 2IYLD 1T3SA 3KFVA 3NH9A 3EG5A 1LW7A 3TR5A 4EFMA 4UNPA 1E69A 3MUFA 3QIAA 1FP7A 2D06A 2PJZA 2G9NA 1QVAA 5FOVA 4EUNA 4MYTA 4ERNA 2F1HA 5LB4A 3KX2A 3I61A 1MABB 1DO2A 4W5WA 2NZJA 3IQWA 1CR4A 1ZNYA 4LJ9A 4AD8A 2IWRA 1HT1E 3PQCA 2JLUA 1XD2A 3MG9A 3UANA 2XNDD 3OESA 4HI0E 4RKEA 4UNQA 2J3EA 4ACAA 3ICQB 4CT4B 3IUYA 4UQOA 5EE9A 2ERXA 4Q9HA 4HDOB 3LVQE 2ZI6A 4OYHA 5F3WB 1DAIA 2VQSA 3CIOA 4ZKEA 3LXRA 1KJWA 1Z5ZA 2Z4SA 4OI4A 1D2NA 2SHKA 3QKTA 4PO9A 1Y63A 4V0OA 3HU3A 4A2WA 1KMHA 1T6NA 4Y0VA 1XJ0A 4J0QA 4DSNA 4NU0A 1E2FA 4UJ5A 3QNUA 2V54A 3DM9B 3LBHA 1US8B 2IYWA 4MRNA 3AF2A 3VQTA 1KK2A 1GNRA 5DGXA 2H8KA 2Q3MA 2QAGA 1WA5A 5IK2D 2V7QD 5KSZA 1E4YA 4Q1DA 2J1LA 4HLUA 3VKHA 5AWFC 5KHOC 1ZIOA 1ETUA 3CWZA 4W5HA 5UKDA 3UWOA 3EIEA 5E4FA 4OI1A 3Q72A 5C46F 2QM7A 1SKYB 3R9XA 5KDOA 4GSYA 1OHHA 1T91A 2CVFA 3GEEA 4XVQA 4WVFA 3FHTA 4ARZA 4HAXA 1M7GA 3BOSA 3CZPA 1W0JD 2WWXA 2D7DA 1L4YA 1KI6A 3R9IA 1OW3B 1UF9A 2QT1A 4OQNA 4TQ9A 3U6KA 3DO6A 2Z6VA 2AKYA 2FGJA 2VTKA 4BLTA 3SC3A 4TN1A 4A8JB 4TMVA 2ZI7A 3UG7A 1Y3AA 2DWQA 3QI2A 4G3XA 3MMPA 4ZIRB 3VR2A 5TARA 5FOUA 3JVVA 2NPIA 3A1WA 2CBZA 1CRQA 5C4MA 3QPVA 1GTVA 4GOJA 2AK2A 1W36C 2AD1A 1KK0A 1U8YA 1VG0B 1G3MA 4JSTA 2CHQA 5K8LA 2NG1A 2BDTA 3AB3A 4NYJQ 1ZM7A 2NOAA 1GNQA 2YNMA 4US1R 5FUWA 5KSPA 4ASUD 1GL7A 1KMQA 1UKZA 2VSOA 2GJAA 1RVDA 1KO7A 2QEQA 1I4TD 3DM5A 4KCGA 2GDJA 3V9PA 4RZXA 3O47A 5KPJA 3FMIA 2X1VA 4GP7A 1YVDA 3W34A 4EQ6B 1OH6A 1Q22A 3WHLA 3G5UA 2C9CA 3ZYCA 1JEDA 1BIFA 2YKGA 3K70D 2X2EA 3FE2A 3GJ6A 3A58B 5CDFE 1P9WA 2XB2A 4RCZA 4ZKDA 1B23P 3BH0A 2P65A 1JR3E 1G3UA 3E5HA 1ZUIA 4XJXA 1GVNB 1XDBA 3KQKA 1MH1A 2FGKA 1P3JA 3MGCA 4N3NA 2GK6A 4HAUA 5A5GA 5GVRA 4YDSA 1BS1A 1DAKA 4HB0A 1TX4B 5A4JA 1Z28A 2NIPA 1F60A 4CEJA 4BECA 1CEEA 1Z06A 1I4LD 2B8WA 2QPTA 5EXTA 3R8CA 3CF2A 1JPNA 2GCPA 1IY0A 1R5NA 1KY2A 2P5TB 1SVLA 4TTPA 3AM1A 3AUXA 3F0TA 3QG1A 2AR7A 2QSZA 2PBRA 1GAJA 1RE0A 4LC1A 1H8EA 5DI3A 3GLGE 1T9HA 5HCIA 4TYYA 2IW3A 1JNYA 5CJPA 5J4HA 1XXHA 2KJQA 4DRZA 1P9RA 4EFNA 3A8TA 2DCUA 3BJIC 1G3RA 4TWZA 3GMTA 5EXXA 2ZAOA 3KXIA 2A5JA 1VECA 2IYQA 1YZQA 3VNVA 1LF5A 1TUIA 2CLCX 2XTZA 1XPUA 2ATXA 2A30A 3QF4A 1IM2A 1X1RA 1TUEA 3TVDA 2PMDA 1U8AA 1OFUX 3AF1A 5SZJA 1N0VC 4KLNA 3WMFA 2QMOA 4PHHA 1DBSA 4Q47A 4Q7KA 1OFTA 1NVWQ 4M9ZA 4RD1A 3TSOA 3CR8A 5F98A 4M22A 3FTQA 5CIQA 3LY5A 5E95A 1XCGB 1EGAA 2BBSA 2CDNA 2H5EA 2F1IA 1M8PA 4GMXA 2HJGA 4NHOA 5HKKA 4C0JA 3UMSA 2ZANA 1NSFA 4JL6A 4X8LA 3CF0A 1ZMXA 2DHRA 1QHSA 1G6HA 2WICA 2FFBA 2DWPA 2J41A 1Z6GA 4A82A 2FNAA 2JIZA 3T5GA 1XEXA 3EZ6A 3C14C 1G8FA 5HPYB 2IS1A 2ZR0A 2Q21A 2O8DA 3NH6A 3FYHA 2R62A 3LX5A 2H92A 2VF7A 1A5TA 4TT3A 4UXIA 2A5GA 5E7JA 4B48A 1TNDA 1E9AA 121PA 2HCJB 2WVJA 3WHKA 1G7TA 3K1JA 5P21A 1E1RA 2FN4A 2IYRA 3W8RA 4Q4AB 4DCNA 2WSSD 1ZJ6A 2DB3A 1NRJB 2FEOA 4PZYA 4B44A 3GLFB 4TMZA 5BN4A 2W6IA 2VO1A 1H8HD 1OIXA 3BFKA 3BH7A 4G5QA 1MT0A 1P75A 4NCKA 5EP2A 2Y8EA 1DAMA 3VKWA 1G41A 2W0MA 4B6EA 4HB3A 3B1ZA 3C4JA 2WAXA 3TUIC 2BCJQ 1ZD9A 2BMJA 3X1XA 4BFZA 3NWJA 1NLFA 2B92A 2HCBA 3K70B 2FG5A 3KXKA 1E2KA 2G83A 2WBLC 4KBGA 1DADA 1R0XA 1EFRA 3ADDA 5CM9C 4LRWA 3SHWA 3WMGA 1E0JA 2C95A 3T1QA 4LJ4A 1VCOA 3THXA 3KKMA 3M1IA 3TSZA 3WNDA 4HB2A 2IUSA 1NNEA 2WWGA 1E99A 5AUOB 3U2QA 1OYYA 2ZS9A 2D4HA 2IF2A 5K8TA 1FQJA 4DDTA 3OAAA 4FIDA 2ZQ5A 2ZSBA 1KI1A 3WYGA 3IEVA 2AD5A 4DSOA 2XZLA 4EPYA 4GT1A 1XZPA 1G7SA 3CRW1 3KXLA 1FMJA 4E09A 1VG9B 4ZCLA 3EPJA 5LD2C 1KI4A 2JLYA 1XMJA 1KSJA 3TAUA 2C78A 4WZAE 5D3MB 4YLGA 4AKEA 4OI0A 1QF9A 4PSVA 1NLYA 2B8TA 1LNZA 2FPMA 5CYOA 5B58C 3SJBA 3PR1A 3QE0A 4NYMR 4FINA 2EWWA 3L0IB 1AA9A 1C1YA 3A36A 4M0LA 4BLOA 3THYA 3NC1C 1E9EA 5E7MA 3VHLB 1XNJA 4IXMA 1A2KC 4P4SB 421PA 4BEBA 4EJSC 1L8QA 2ZVQX 4LZZA 5B30A 3PCRB 5EP3A 3KJHA 3IIMA 1E3MA 5JRZA 2ZJ2A 2GJSA 3W6OA 2CLDX 2QI9C 4TYPA 3VR6A 2ZE7A 1UPTA 3QY0A 1IY2A 1RJ9B 4WXPA 4PHGA 1X1SA 3LX8A 4KO8A 1M1YE 3FDIA 3TR0A 1E9SA 1LFDB 2OBLA 1NLZA 4XD7D 2QE7D 4FWTA 2FDCA 1KDTA 2ZU6A 1AQUA 2RGNA 2OHFA 5J40A 1XF9A 4AYWA 4JLPA 4BGDA 1G9XA 4LV6A 4Q01A 1R10A 2IHBA 2AXNA 1K6MA 5FR2A 2PZGA 4IKEA 3X1DA 2AWOA 2FU5C 2OFWA 4IDNA 4TLAA 1Z6XA 3QQ5A 4EPVA 1KDOA 4Q4HA 1KI9A 1RPZA 1ZYUA 3FKSD 4WIAA 1V5WA 2XTNA 4E5UA 3E70C 3KKQA 3BBPA 3BIFA 1GRQA 1Z08A 4X8HA 2WJGA 2D74A 3AP2A 3PEWA 4YMTA 3X1ZA 1XZQA 2WTUA 2QTFA 1P4SA 3ZS9A 5JJLA 4FMDB 5FUYA 3DDCA 1UJ2A 4EAQA 4L9WA 3B1YA 2DBYA 2ORWA 2YWGA 2FFQA 2NZ8A 2R8RA 2TMKA 4DBLC 2B7CA 1GKIA 1I2MA 4DDUA 3CPJB 5B57C 4OQMA 1HEIA 2ZROA 3REGA 4P3YA 4CVNA 1CP2A 1DG3A 2GJKA 4TL6A 1IBRA 4A2QA 1AZSC 1NMYA 2VH5R 5CM8B 2ORIA 2C03A 3P4YA 2XAUA 1QZXA 4LHZA 3HR7A 1SQ5A 4L5BA 4Q9JA 3R7WB 3ZQJA 2YJTD 4D4KA 4A0FA 1EK0A 1YZLA 2JLQA 2IUUA 2QRZA 4HAWA 2H18A 4EIWA 1FZQA 3WY9A 1XJCA 3WRYC 4DDWA 3EWAA 4XWKA 3AVQA 4MGYR 2JCSA 2JJ1D 2WWFA 2EU8A 2G88A 1F2TB 2QORA 3AF3A 2CJWB 1VG8A 4AI6A 3GQBA 5HCNA 4O3MA 1SVWA 3LQRA 3D6TB 1ZC3A 1JQJC 4EJSA 5EP4A 1NL3A 1OXTA 3F8TA 4QBFA 2QN6A 3OZXA 4D0GA 1NIPA 2RGAA 4M2LA 4GFDA 4MDFA 1P72A 1SKQA 5KYKA 1II8B 4TL8A 3QKUA 3LV8A 4DLXA 4V03A 4F4CA 4DLUA 2ECKA 3KTAA 3X2SA 2C9YA 2W2TA 5AR1A 3M0EA 3LA6A 4BZPA 1EFHA 2JJ2D 5FOTA 3DMNA 2KWIA 1NBMD 4C7OA 4YMUA 1XJQA 4EFLA 3K9NA 3RABA 3FGNA 5EXSA 5JSZB 2BV3A 4CGZA 2WWHA 3TKLA 1RRGA 4FW9A 3NC0C 3SQXA 1SXJD 2JJ8A 1W2HA 2Z4RA 3LLMA 5CYPA 4IOLA 4YQFA 2H7VA 1IONA 1N6OA 3GJ4A 1QHIA 3AH8A 1U9IC 4Q7LA 3H1TA 1IXSB 4DLZA 4RFSA 2OCBA 4B34A 4LYAA 3EPLA 1YR9A 3OIVA 1MO6A 5JRJA 1W5SA 2IS4A 1EXMA 3GLIB 1NSTA 2JLXA 2O0KA 1R0WA 2EFHB 3WYAA 2FZ4A 4N0EA 2WOOA 3CRVA 3KQUA 4DCUA 2VP6A 1YZUA 4TMTA 4OHXA 3WMEA 4Q02A 3CNOA 5CIWA 3U3MA 1RFLA 5L3RA 3BC1A 4DLSA 3KZ1E 2JGNA 4B75A 3U4QB 3DKPA 3HP1A 1G3IA 3EZ2A 5KDDA 1W4AA 3KJGA 2BCGY 4DB4A 2CE7A 4Q4LA 3AVYA 3OFND 4C4PA 3AKYA 2W58A 4NCNA 1WCV1 3RS0A 5JEDA 2ZE6A 2ZJ8A 1FNMA 2GHIA 1LF0A 3H0KA 4V0LA 5IDVA 1S9DA 1WRBA 1XXHE 2GTPA 4KVAA 4YMWA 4CDGA 4HDQB 2IEYA 1CR2A 2YC2C 2BJVA 3Q5EA 4QNMA 3ADCA 4B3BA 1CLUA 3G0HA 1VYTA 4BE7B 2H57A 4MQBA 1V43A 2IXFA 2XJ9A 1JPJA 3ADBA 1IOZA 4TQAA 1Z0JA 3B13B 4D2IA 4G5SA 3VFDA 2F7SA 2A5YB 2H17A 3IDQA 2O8EB 1KK3A 3AQ4A 4OKSA 1XFAA 2WPDD 4QHTA 1ZUNB 1CJMA 4KODA 3KKOA 1OXXK 5IK2A 2V7QA 1C9KA 1E79A 2ZXUA 1G8GA 4BFVA 4JKYA 1E2GA 1JB1A 2C8VA 1LY1A 2FPKA 2AL7A 2R6AA 1GIAA 5TY0A 4U02A 3R20A 3VR1A 2O0HA 1GM5A 1HYQA 1OXUA 2QTVB 2KB0A 2Q9CA 2IUTA 4TMXA 1VKJA 2G77B 2GESA 5DISB 4DLVA 5H8WA 3BORA 1T5IA 2D2FA 3B5JA 4GMDA 1W0JA 2QGZA 1CIPA 3EARA 2ZE5A 1NKSA 2QBYB 4AWXA 3TSWA 1WQ1R 1HTWA 1OFHA 1KI8A 2CMKA 1FUKA 4Q1AA 4B3DA 3AVVA 1Z0IA 3BS4A 1UKVY 2ZM5A 4MRVA 2PT5A 1XCMA 4HUQA 2ZI5A 5AJXA 2OT3B 1WB9A 1OFIA 3OE7A 4ZV4A 4KYIB 4Q4JB 1WE2A 2WKPA 1CJVC 3SNHA 2PMKA 2FSIA 2WJIA 1KHTA 3I62A 4KFSA 2AFHE 5F9HA 3P32A 4Q4AA 4LJ7A 2CVHA 2ZAMA 3S1AB 4M1SA 2VRWA 1S1MA 2REOA 4URWR 4ASUA 2HLDA 2VPPA 3B78A 2MMCA 5FR1A 1UADA 4PFSA 4QKQA 4KU4A 4PQFA 2WSMA 2VA8A 3OIYA 2DYKA 1CULC 1SXJB 3I92A 2PZEA 4A1FA 4GBMA 3IO5A 4KBFA 1M7HA 4LBVA 3Q8XB 2QPAA 2ZEJA 3FOZA 4I81A 2ZRDA 3LD9A 4KI0A 3C5HA 2PEZA 4LHXA 3VR4A 1E96A 1GL6A 3AV0B 3CBQA 1JR6A 4HAVA 1DG1G 4LHWA 1OH7A 4F91B 2J7PD 2CNWD 5FL7A 4AC9A 1KO4A 3R8FA 2VP4A 1KIMA 1QVRA 2UZIR 4P31A 1OJLA 4KXFB 1R8QA 2A5FA 2WIAA 2ZJ5A 1N6IA 1GKUB 4TYNA 4HAYA 1N6LA 3W5IA 2OE2A 2FF7A 1Q1ZA 2HF9A 5KNCA 1ZD1A 5KUTA 3CH4B 1UDXA 1D2EA 1E2NA 3PIRA 4IJMA 1JXMA 4ZPXA 4I1OA 3UKDA 721PA 1D2MA 2GCNA 2JLRA 3QKRA 3OEHD 1J99A 4BQSA 2RGGA 4C0QC 1E0AA 2XOKD 3CR7A 3ND8A 1S3SA 2V55B 2X2FA 4ZDWA 5FTJA 1DAFA 3WRXC 4OJKA 3AVXA 1N6HA 4FMCF 2X77A 2C99A 1KI2A 2QPOA 2JAQA 2GXQA 4MGIR 1UAAA 1OH8A 5HZHA 4P4SA 5IRCD 2ZUDA 4MKGA 5GJBA 3PJRA 1S2MA 1GITA 2OBNA 1H65A 3SYKA 1NVXQ 1KO5A 1Q21A 2G6BA 5M04A 1RJ9A 4E07A 2GRJA 4RD0A 5L3QA 4G5RA 2O8CA 1FL9A 1IN8A 3TIFA 4HZUB 3MD0A 4TLEA 1XWIA 2CK3D 4KJZA 5C2JB 4P4UA 1E1QD 4PAQA 3ZVMA 2ZU0C 3EIHA 2WM9B 4RD2A 3HDTA 3D31A 2XXAB 3ND9A 1EWQA 2VP0A 4F7WA 4IVQA 5FTMA 4ZCIA 5HZKA 1RYFA 1HY3A 2XZOA 3NDBB 3FMOB 1RRPA 3HU1A 3MWJA 1Q1EA 4QHYA 1NN5A 1HUQA 3FHOA 3UWKA 1NG1A 3QXCA 3THWB 1JXOA 2YWFA 4M1WA 4AG5A 3BERA 4Q1BA 4FCWA 2ZR9A 3K0AB 1BYIA 1NN0A 2DFLA 1N3BA 3REFA 1S8FA 4QJ3A 4LUCA 1VDZA 1KTVA 2PJRA 3SU8A 2J46A 5JS7A 1U0LA 4PX9A 4BFWA 3WNCA 1NMZA 1OYWA 1TF2A 3SFVA 4D81A 2BC9A 3WYFA 2WSSA 2C2HA 2BEKA 3HPQA 4XOIA 2VHQA 4KLZA 4WBSA 1T3LA 1U98A 3ZIAA 2RHMA 5JI2E 3CRMA 2JDID 2GCOB 4Q1FA 3ECCA 4FCVA 1Z29A 3AP3A 4MYUA 3SS8A 2B6HA 3PEUA 4EPXA 1SHZA 2IS2A 1KYIA 4MH0R 2AK3A 4KSCA 4YXWA 4MUBA 2VHJA 4NONA 1DO0A 1HV8A 4XH9B 1EFTA 2VYFA 3WXMA 4QJ4A 3R7WA 4ESHA 2OESA 4ESVA 1KDPA 3AP1A 2CEAA 2IYXA 2W6JA 1VCMA 2G1JA 1XX6A 3DL0A 4IVRA 1R0ZA 1TMKA 2I3BA 2DFNA 3I73A 3RRMA 3T06B 4GOXA 4G5OA 3N70A 4YDHB 3MJRA 1W46A 4DLWA 4IOMA 3U5ZB 5G53C 4A0RA 3UIEA 3QBTA 3K0FA 4M4SA 4QGHA 2EQBA 1VIAA 1SKYE 3LRPA 4DIDA 3PUXA 2CCJA 4NCJA 3GJ3A 2QROA 1JALA 1FMLA 4FMBB 1TAGA 3J81k 3FMPB 2Q0HA 1AS3A 2RGDA 4PC3A 3QXHA 3T1VA 2QU8A 2JLSA 4HSEA 1W49A 4AKIA 2GEVA 1EFUA 2DR3A 1II8A 4CW7A 1T8UA 2EFGA 1IN4A 2EFCB 4Z1MD 1MRSA 3VHXA 4DKXA 3WP1B 4DIEA 4XVUA 3GEIA 1K5DA 2BBTA 4D0NA 3DZ8A 2PLFA 2GXAA 1AN0A 4TSFD 5JWOA 1T4GA 3P1JA 5DLQC 2PT7A 1AM4D 3CONA 4RY2A 2QQEA 2VHUA 1NI3A 2ZI3A 1VG1A 1M2OB 4TQUS 1SVKA 4LBZA 3U7EB 3U44B 1QRAA 1G4AE 1WXQA 3LDAA 4NPHA 4BUJA 4QGFA 1UBCA 1ZW6A 1D9ZA 3Q5DA 1OKKD 1NF3A 1M74A 2ODNA 3IBGA 4V0NA 2QE7A 2ERYA 2RGXA 4XD7A 4B3FX 2WAYA 1TF5A 1MKYA 4E22A 2V6JA 2Z0MA 3QF7A 3SYNA 4EDHA 3TUJC 1A4RA 3O8DA 4IHQA 3P4XA 1OF1A 1IN5A 2XITA 4X8OA 1MV5A 4GRAA 4JLKA 2MMGA 3C41J 3LXXA 4KFTA 3FKSA 5LPNA 3B85A 3GLHA 2R44A 3AKEA 4FI3C 4G01B 1FTSA 2OAQ1 1LTQA 2A2ZA 3H86A 3P26A 2H16A 1YR7A 4BASA 3GFTA 3MJHA 1GKYA 3HU2A 1JBKA 3I5YA 5JWHA 1GNPA 2CCGA 1XTSA 1KKMA 5K8UA 4Q66C 3GP8A 4MKFA 4YONB 3I1FA 2V4ZA 4B32A 2BWJA 4LYJA 4AIIA 5JBQA 3SJAA 3BD9A 1ZM3A 2ZSAA 1XCPA 2BOVA 4JZKA 5DE3A 4A0HA 3QOFA 4LJAA 1E2EA 2WWYA 5JHHB 1ZP6A 2O8FA 1G6OA 2XZPA 1TF7A 2IEZA 1W47A 4DEXA 4FWIB 4G1UC 3ZZTA 5KDLA 1WF3A 4LSGA 2ZUCA 2QTHA 4Q03A 4V0MA 4H9GA 4O2RA 1CKEA 2WHXA 3TMKA 4C2TA 3UMFA 1G3QA 1TQDA 2RGNC 3SZRA 2X19A 3NBXX 1SZPA 4LJYA 2P6RA 5J4LA 2J5XA 1E2MA 821PA 1X3SA 2JJ1A 4UJ3A 2OM2A 4HB4A 1KAOA 1KKLA 4PR0A 4OQXA 1IAQA 2IXEA 4UNRA 5EJEA 4JKIA 1R7RA 4NYMQ 1IJEA 3FFAA
chains in the Genus database with same CATH superfamily
5FUXA 5LB2A 3RK0A 1YVRA 1F2UA 1RHRA 4BVBA 1NPDA 5KTSA 3C7DB 4OLBA 1OXVA 2FETA 4PO3X 1KEWA 3U7IA 1W581 1O96A 1CUVA 5FOXA 2O1XA 3SS7X 4TS9A 3WICA 1QM5A 1QQ7A 1TM1E 1YO6A 2RIRA 3HU5A 2CMDA 2Y6VA 1Y1LA 5E2BA 2RHTA 1UPXA 3IEPA 5FBWB 5FBLB 1NUSA 5JV5A 5JYDA 2AFIA 3ZGNA 3NWPA 2FWBA 2Z8ZA 3FGZA 3BMQA 5ALWA 4YCMA 2OXCA 3EX7C 3AF0A 2JJ2A 3T5DA 4GBED 1IZ0A 1DQRA 4LXUA 2NTYC 1EFPA 4O4JB 4BEJA 8ABPA 1DC4A 1DDOA 3DMHA 5IBQA 3KKNA 1TC2A 4NNPA 2P2LA 4UBLA 2P2YA 5CCDA 3EXEB 2NQ8A 2ATEA 3FLEA 3B9PA 3S8YA 2AJ8A 2I6SA 4BLQA 1NW5A 2G04A 3KE9A 4P32A 2CB9A 4ZVTA 4FDLA 2O8BB 1MDBA 1P6QA 5PNTA 4C6TB 1GAEO 3QFTA 4KGXA 1WZCA 5TVKA 3D54D 3T1OA 4JR1A 3PRYA 1L7BA 3MOGA 1Z26A 3GDWA 3OZEA 4IRUB 3TD6A 5B3JC 1M1YB 3M8KA 3ROGA 2ZSEA 2O7VA 3JQ9C 4W5JA 1T2DA 3TOCA 2DR0A 4CR7A 4D7AA 1QANA 4ER7A 3SDBA 4S05A 1XNQB 4LAFA 1T3HA 4KWCA 2BBWA 5L3SB 5JATA 4E03A 3RK1A 1GV1A 3VTKA 1KZGB 1J4AA 1HE5A 1UP4A 4K5QA 2UUAB 3Q1KA 1JLMA 1FRZA 4YRJA 5EINA 1LI7A 1PLKA 1OPXA 1I51A 3T38A 1Z7YA 2QRQA 4RKFA 5HFAA 1G8PA 1EZZA 1K2WA 1JFFA 2BEWA 2QRGA 3B9RA 4OGKA 4MLPA 4TV8A 1NZFA 5HGJA 3W5SA 4A8JC 1PN3A 4PBSA 1AK1A 1OWLA 1XKXA 5ALZA 5LQAA 3PEYA 4AMVA 4KVGA 5DHSA 1MVNA 2J7KA 3W8FA 4BLWA 2XDQA 4FJ1A 4A2CA 4BGUA 3V7NA 1MO3A 3BWDD 4YP9A 4ZI5A 1H3EA 3E0QA 3HXMA 1JQDA 4DLSA 1X77A 2RHDA 2X40A 4G81A 2FPUA 4ZCMA 2EF1A 5JAPA 3IPRA 1VZ2A 3CO5A 5JAQA 2P41A 3ESDA 4UXHA 3K0BA 4RY9A 1M1ZA 2G7ZA 4ON9A 4DV4B 3PXAA 3KLMX 1RRFA 5C4MA 2YJ3A 1DBPA 1ZC4A 3DXXA 1S0UA 2X6TA 4EY8A 1Y6GA 5H68A 2IY9A 4MITA 2OC4A 2ODEA 4MSUA 3DLAA 4ZAXA 4MB0A 4D98A 2P0EA 2VYNA 2I66A 1EFCA 1G2IA 1XMVA 2WUDA 2H2AA 2XUAA 3H11B 4F4DA 2RAVA 1L7DA 4LBYA 1YOVB 3ZY4A 3FGPA 3C6MA 4QXAA 5DN6A 5IXJA 1II9A 3KAQA 4XDHA 3S3TA 1XRLA 1EEXB 2ZULA 3A26A 3AR4A 1IL0A 4JVSB 4B3IA 4PAWA 3WSVA 4QRDA 1XTUA 4XOUA 4DUGD 2RG1A 2V0GA 2VL7A 4GL2A 2HA7A 1G1MA 3TQCA 5AKLA 3QLUA 2PRYA 2PUDA 2GCEA 3BMNB 2R6FA 3H6GA 1PUJA 4D92A 2OOKA 2MR5A 1DQPA 3I23A 4G5GA 4HZUA 4WBXC 4CV3A 5B4TA 1PTJA 3KQNA 3C70A 2GLXA 2VCYA 4WJLA 4GH5A 1CUFA 2WLSA 4HNQA 4LDQA 3WNZA 1RBMA 2FV8A 3RHTA 3TLZA 3KT8A 1HRDA 1TCCA 2BE9A 1E9FA 1YCDA 1ZD2P 2XXAA 4C43A 4NDAA 2JFVA 5FT9A 1FNBA 3O4FA 1QJCA 2JLAA 1HE1C 2R3SA 3GH1A 1US8A 3TW6A 3TGLA 2R751 4ZZ2A 1SFRA 3EPKA 3A6HA 3F5QA 3UOAB 5JISA 2YZGA 4M21A 3R0XA 5JQGF 3S2YA 5FX2A 2H52A 2F8LA 3CKMA 5BXYA 1G7RA 2G1UA 3MT0A 2ZGVA 3RS9A 2GEJA 5MFPA 5B4UA 2HZ7A 3W6PA 1IM5A 3KFXA 4JEHA 4WFJA 5I9MA 4NATA 1UOQA 5H81A 4PTZA 3GC6A 4KSBA 2R47A 4MUKA 4OP3A 1J25A 1XTZA 3EVTA 3WL6A 1W1WA 5DRTA 3B2EA 3PEWA 2FFAA 5FKJA 2YV1A 1OOEA 4I1PA 1NYQA 1E58A 2IYTA 2J09A 2OXEA 3S68A 2Z83A 5K8IA 1QOPB 4OSEA 3ZU2A 2GNAA 4MV0A 1ISIA 3HM2A 3VKUA 1KIFA 2PYDA 1LB1B 3O90A 4MRAA 1KQGA 2J9FB 1UFOA 3G82C 5TX7A 1XTKA 3BXPA 2QF7A 4L9RA 5HF5A 4Z4CA 4JELA 4ATNA 1REQA 1XU9A 1AKEA 1ZIPA 4CMEC 5CEFA 3OUUA 3WZMA 1X0VA 2C61A 1C1DB 2GCIA 4JIGA 1MTOA 2H3HA 4HP8A 3NYQA 1T1RA 3LK6A 3RUCA 4B2IA 1FNSA 3WDLA 1A77A 1MT3A 2QX9A 3E7WA 3K53A 1D2GA 4WXEA 2X0DA 3QVGB 3CEJA 1POWA 1X2EA 2UYYA 3C3PA 2JLCA 1CE8B 2AX4A 3HO6A 3ZZ0A 1QBGA 1CQWA 2DLNA 3IP1A 2Q4DA 5FBQB 2IX9A 4EG4A 3QENA 5A0VA 4CCSA 2C4WA 2VYCA 4D4IA 1XZBA 4AJ4A 1EE2A 1KYVA 5A4KA 3RAFC 1N7GA 1ZUD1 2IZ1A 3SY8A 3WADA 4G67A 3PICA 2GEBA 2ADMA 2B3DA 2HRBA 5D01A 5CBPA 4MWCA 4YAGA 4LJKA 5CTAA 1V8DA 3PQ7A 1T5DX 3C4VA 1H69A 1PR9A 1JJIA 2YINC 1BDHA 3GOHA 3M6IA 3TF5A 4FI3F 4NMXB 4RA6A 3TZBA 6NULA 3IEMA 2WMNB 3HBMA 1S4QA 3AEZA 2PBLA 4JLAA 3QWAA 3H2KA 3ZWPA 1O03A 1K9SA 2YMLA 4B09A 1B14A 2HMWA 2PR7A 2QTWB 3L43A 4FFRA 3TM4A 2OCYC 4MQFA 2JEZA 2ZSFA 3NKVA 4E2XA 3T95A 2IUYA 4U7GA 3OIUA 5EJAA 2DZDA 2GBFA 4C5CA 5B64A 2KE5A 4CKEA 1W36C 4GQAA 1RI3A 1M2NA 2HJWA 1GTJ1 4OBEA 1PL0A 4FNGA 3LUDA 4D6YA 1RWOA 4NZMA 2N47A 3DV9A 4JHXA 3UEOA 3HB0A 1U7TA 4PCVA 4GLBA 4LOAA 2OCIA 3F67A 5THQA 3IAS1 3R7DA 4KMRA 2GD6A 3OTHA 1C30A 2CUZA 3MWEA 4IXWA 4OHUA 2J0SA 1YVUA 2Q6OA 4KTTE 3H16A 2GN2A 3DXYA 5J47A 3LXUX 1S96A 4TTTS 1FSSA 1FTWA 4EKEA 2AZTA 5SZKB 4NV3A 1W5BA 3M6UA 4ZQIA 2JPDA 4C14A 3O3NB 3REQA 3TOXA 4D9BA 4YT5A 3G0CA 3ANTA 4ZALA 3BZWA 3DL4A 4RFVA 1MOPA 1G38A 2BONA 2R9VA 2ZIUB 3GGGA 2AKEA 4CYMA 1YHNA 2GNOA 1CUHA 2N0SA 4TS1A 1LJ8A 5KX5F 1N5KA 1ZCAA 4YJHA 4MULA 3RVJA 1BG6A 2BFEB 2ZT7A 3MZ0A 3N2IA 3ELUA 4LJ8A 4ZMSA 5HR5A 4ZHQA 4MVJD 1SC3A 4ZAFA 2WV7A 3T3PB 2RJ3A 2OHHA 4MS4A 3KKPA 4D02A 2GEDA 2GYYA 3DO8A 3ZH2A 3HKBB 5F2EA 4KQEA 2JD2A 3K2EA 2YIMA 4B1FA 2WF6A 2GEFA 1MC8A 4KPUB 3H8JA 4F93B 3ZBPA 3E2IA 4UPVA 2NV2B 3TJRA 1N57A 4WECA 2ACEA 3MFQA 5EJ8A 3ICCA 4WEQA 1Z2CA 3OEED 3PNSA 3VNUA 2O8DB 2PCLA 3MRTA 5E7IA 3T7AA 2P8JA 2QU7A 4NYIR 3SX4A 4EEZA 1ZK3A 1QYIA 2VQEB 3CLUD 3EAQA 3HJCA 1OAOA 2IP2A 3VX3A 2IXGA 3KZNA 3QUTA 3NYIA 3VOTA 4DSUA 2H1CA 2PJUA 3WNVA 1KR2A 2BELA 2JFNA 4KUEA 4N0DA 3NRJA 4YASA 1M6YA 5H4GA 3GT7A 3IT3A 1XD9A 3OZSA 2QMQA 1P0IA 3FYUB 4QUHA 1MZVA 5LMUB 1FQWA 1GP2A 4RTQA 3ITNA 4UU8A 2I2FA 1WZEA 2M6LA 2J87A 2NVWA 1WXEA 2V97A 1FUUA 1UC9A 1ZN8A 1ZMOA 3SI7A 5HUHA 3HDGA 4E11A 5BQ3A 5COQA 4PO1A 4V0ME 5TDHA 3S6JA 1W8DA 4TZTA 1SURA 3TZEA 4A6EA 4EP1A 4XJSA 3L93A 5DI9A 6Q21A 3TRJA 4GZLA 2WJAA 3QEJA 5LKRA 2AXEA 2C2WA 2PUBA 3N8IA 4K8RB 3SQDA 1FLVA 1U1IA 3UJDA 1PFVA 3ETHA 4ME6A 4YT2A 4E13A 1ZU5A 1I5EA 1T9ZA 4YRLA 2IHYA 3W4KA 4FS3A 1JRLA 4IZIA 4INZA 1JHUA 4FR2A 4FZ3A 1BU8A 4S24A 2Z43A 4FFMA 2A7XA 3E3LA 3QQPA 2EYUA 6AT1A 2BUCA 2LKDA 1T4CA 3JQAD 4F9EA 5CT4A 3HN6A 3PNLA 4BIIA 4M1TA 3HA2A 1PEKE 4Y1EA 4JJ7A 1JLSA 1J2TA 1SB8A 1M5TA 1U9ZA 2PV7A 4HN4B 1JR3D 4R54A 5IMSA 4YCDA 4EHAA 4CM4A 3CH6A 4I50A 4GYWA 3V8BA 3LWNA 4LRTB 1E8MA 1W4LA 2I87A 3OJXA 3Q1LA 1AQLA 4BEVA 2R4UA 3EW9A 4HYYA 4PNEA 4ZVPA 1U5BB 4OKIA 1DAEA 1AD2A 2F3TA 1SUEA 1QK4A 3FFXA 3H4VA 2AV6A 2O2DA 2W22A 3I28A 4Q7JB 4TSFA 4DIKA 3Q41A 1JJ7A 1TW2A 1NA5A 1XCOA 3QFSA 4QOFA 4TKZA 2LKCA 1KQ3A 3EC2A 1N5LA 3PNQA 3MWKA 3QYPA 3NM5A 4IW3B 2FWMX 2GZMA 2NPOA 4JVNA 3ILXA 4MJ7A 3D8BA 4RKYA 3DV2A 2WY2D 3THYB 1WXWA 1YKSA 3BIWA 3E1SA 4OL9A 2JIQA 4CN8A 4BQEA 1WMAA 1AS2A 2YHSA 3FG9A 5CCEA 5EPOA 5TMDA 2QNRA 4HZIA 3TZ6A 3UVEA 1KOGA 4GYJA 3OM1A 5C1PA 4G9BA 4TL9A 1JMKC 5G3ZA 3A27A 1SXJE 3G2LA 3RFCA 3B89A 2QY9A 3B6IA 4IOKA 1OLUB 4TMKA 1WZ2A 3NDPA 3HR8A 1EB9A 2F1RA 4M8NE 5FHQA 4N3GA 2R66A 3FRJA 4Q1CA 5EHXA 3MFYA 4KK3A 1SQGA 2FEPA 4NFHA 1UDCA 3VSAA 1LX7A 2KYRA 2ROQA 3HSSA 1AS0A 1PUIA 3L6RA 4I4TA 4KR9A 3UWDA 2CVZA 5EMHA 3UF0A 1SULA 2BKLA 3U3KA 1OXSC 5EE1A 1IQRA 3ZHUA 5E3JA 5ICMA 3VR6H 4I8DA 1PD1A 5DMXA 2XE4A 3V7WA 4UPDA 3SF8A 4O0MA 1N6KA 4QG3A 2JGMA 3T4EA 2ZG6A 4J1QA 2W2LA 1OX5A 4DMRA 4Q4HB 5ALJA 3HBFA 1Z4LA 4BFSA 4J94A 2IIQA 3T5PA 1E2PA 4QATA 2VHXA 2ZSDA 2J0UA 3RKUA 2PHZA 3PB3A 2GEKA 1D04A 1SHTX 4GE0A 3NTUA 2XQGA 1GFZA 4JUIA 3NI2A 4UBJA 4ZPJA 4PCUA 5CK5A 2I2XB 2OFPA 4IDPA 2I22A 4JJKA 2OCAA 4TV9A 4Q4CA 1ZIYA 2RGYA 4D1YA 2KQUA 3IOEA 3BMCB 3CZMA 4D43A 1XEWY 3F71A 3MJFA 3U61B 1YR6A 4MR7A 2D00A 1CUSA 1WMBA 3V2GA 4E6EA 1IB0A 4BCBA 3BXZA 1C7JA 2Y92A 3CV3A 3L0OA 3HJUA 3I2HA 3LBFA 2GZRA 4JVMA 4RVDA 4UULA 2J3DA 4M9CA 1RRMA 1XT6A 4Z3KA 4YCSA 3NVDA 1E5TA 1XDUA 2GAAA 3FI0A 3PXDA 3I8XA 2XH8A 1VFPA 3SP1A 1KNQA 1U0OC 2I4LA 3OC0A 2NO0A 1RYEA 2VDWA 3B3GA 1OFVA 4JP1A 3KJXA 3M6FA 4KQMA 4WNCA 4MEBA 4C5AA 4CIDA 1ZNZA 4OFXA 2HWYA 2B4QA 3Q9LA 4TROA 3E81A 4ILEA 3ZK8A 2EFYA 4UOEA 4KXMA 3ONEA 2HJVA 3KB2A 1BJRE 3GGSA 2HSEA 2NTJA 2WSIA 3OZWA 3U19A 2DTXA 3PF9A 3W5UA 3Q0IA 3MHTA 2HO5A 3U48A 2NU6B 4TX1A 4RD3A 4NCHA 2C2OA 3KOMA 3R3HA 1TJYA 3PDJA 3PD1A 5CU7A 3OTGA 4R1TA 2D3WA 2Q6TA 3E9QA 5MF6A 2YQ4A 4GOMD 1XYYA 3AIMA 1ZGCA 3C4QA 1RM5A 4WFQA 4KR6A 5TE9A 5INTA 1AKMA 1YZKA 3O4IA 1GPLA 2UVPB 4GUAA 5JSZB 3WO0A 2GUWA 2YYZA 1TUGA 1WJGA 4CM5A 2ONYA 1DQSA 2H4WA 5C5CA 3TCNA 4D3YA 5DLEA 4CHTA 3UJNA 1TFRA 4DDVA 3AUKA 5CLFA 1YI8A 5MN6A 2AHRA 2PLRA 4M1OA 4IF4A 1R16A 1J0EA 5MN5A 3CMCO 1F0KA 4P3OA 5EHNA 5LLSA 3THOA 1JDBB 1APBA 2RI1A 4E2YA 1MAWA 4C7OB 5TMPA 3E7PA 4M0KA 4IFBA 2ID7A 2ZXEA 1KFCB 1ODFA 4LXIA 3U0VA 3UBMA 1AN9A 3FNIA 4YECA 4WK4B 1N3IA 2GGSA 1PJLA 1BDJA 1OFUA 3CSSA 4P7BA 4HC4A 3AJDA 3D4LA 2FEWB 4PSDA 5KCMA 5LFAA 4WCFC 2IY7A 2DRIA 1WNTA 3LL7A 1X6VA 5DM0A 1QG6A 2ZRHA 1P60A 4B3GA 3PP8A 1RKQA 3A37A 3E1KA 1BRMA 1P7PA 2JGDA 4I1VA 3P5BA 4G07A 5DX1A 3UY4A 4UTVA 4CEHA 4AY2A 3VZQA 1C0EA 2P4QA 3HC7A 3CNHA 4YUYA 3VR5A 2R68A 4BNLA 5JSZA 3ZZUA 1V3QE 4L9SA 1H4QA 1DXHA 2YOHA 4QHSA 5HVNA 4PN7A 1J33A 1A8SA 2B5OA 3U60B 5I5EA 3U4AA 4L16A 1V5GA 1SOMA 3LF2A 1ESCA 4RHTA 1M6HA 3GAAA 2JI8A 2DMRA 4BVEA 4CUZA 1PW7A 4JLJA 5DYIA 4X64B 1IEQA 1RHQA 4P36A 2HBYA 1SC4A 5BO5A 4BNDA 4DNQA 3KNZA 3R5FA 2NVUA 3KFLA 4WADA 4XX1A 4KFCA 2GFHA 2C77A 1R4NB 3IDAA 2Q2NA 3R44A 4S12A 1GDHA 1N5OX 2OV1A 3DMRA 1QS0A 2OCDA 5EGSA 1HA3A 2KBFA 3IGFA 4HEA6 1EDOA 1SU6A 2CVOA 2GJ8A 2LE0A 3OD1A 4PS0A 3RRYA 1IC6A 3GFBA 3VAZA 1L3IA 1NYTA 3RSZA 4PC7A 5CFPA 2GKSA 2OVFA 5B1IA 3RRNA 1BHSA 1M54A 4E5VA 4QXPA 3FTPA 4REOA 4O4HF 4WXRA 2WEKA 2LVBA 2WPNA 3NGLA 2GPWA 4BKUA 3ZD6A 1SXJC 4LGYA 2AT1A 2Y2VA 1O1YA 3PC2A 3QYFA 3HP4A 1F3LA 3EGWA 3QXJA 2QRNA 4HWGA 2ZRLA 1UJNA 1USVA 1WDWB 4X1YB 4CQLB 3RSGA 4KH0A 1HURA 4WH0A 2XUPA 4L0QA 2ETVA 4EECA 3H8SA 2PMEA 2IQIA 1AB5A 1SCNE 5FV7A 1ORHA 4MYSA 5EJIA 4AF8A 3BTSA 4OGWA 2PMBA 2Q1WA 2YWRA 5HF6A 3NKFA 4NAHA 4DILA 4S0XA 3CF6R 3AIOA 2XUFA 3T0FA 3JU3A 1NR7A 1PLJA 3AESB 2ZBRA 4MINA 4DYVA 2W5UA 4CF6A 1UT5A 1P0MA 3IQXA 2CXPA 5AJVB 3C3EA 4X84A 3QTLA 2JFBA 4ENRA 2FMFA 3ESBA 3G88A 2B21A 4X3CA 4YXFA 2H4XA 4BJ3A 3K09C 3ZV5A 2MTBA 1PSZA 2IYEA 3BD7A 5KQSA 4GPTA 2RJNA 3WBFA 4DNFA 2CV0A 3N8KA 3G5AA 3K1YA 2XEXA 5LQJA 2O8EA 3AERB 3C7AA 5JAZA 1FX0A 1T1EA 2G6TA 3IQFA 3QVTA 2FE4A 3K1TA 4J43A 4DMGA 1MEEA 2V5AA 1EHIA 3I9JA 3C3MA 3W1EA 3M6WA 1QU2A 1J2RA 4H7HA 1TI7A 3OQBA 2Z5LA 5AXAA 2I5PO 4POAA 1CUEA 1UR5A 2F1JA 3FY4A 4JQZA 2WM2A 4RJLA 4CMIA 4JC5A 4MYHA 2F3UA 4KE9A 5EQDA 4ID9A 3SE7A 1ZHOA 1IK6A 2C4HA 3BA1A 3MSXA 2IXDA 3HNPA 1W1UA 3AUYA 4QD3A 1IY9A 4FMDF 5DIFA 2QPLA 1ZOOA 1G5FA 3Q8WA 4LRYA 2WRZA 1RRCA 4TLDA 1JYSA 4U3JB 3HXOA 2Z6QA 3RIMA 4PF1A 5AJWA 4W8GA 5A6SA 4FZJA 2QBYA 1GGNA 2VNHA 1GRVA 4JX9A 1EX9A 1V11B 1Y4UA 1UBEA 2W2KB 3HKEA 3MSCA 1RZUA 3E0XA 1WDTA 4PX5A 3UAVA 2BFAA 2AG8A 3PITA 1UBHS 4WT7A 2HHCA 3VDMA 4WESB 1FQKA 4ZYZA 2EC5A 3U4CA 5LQNA 4WZAB 5KWIA 3I04A 2B0JA 1D6SA 3DE1X 1YL5A 3MMSA 1E7YA 2BFDA 3S2ZA 2PZBA 4HRXA 3WLAA 1QGAA 4K9RA 4QPCA 4BFYA 2NU7B 4ENPA 1CSEE 4LNHA 5DHRA 4WLNA 4L4UA 4C3VA 1TAUA 1RWPA 3L8GA 1Q57A 3C8DA 3W5DA 3E8XA 1X0XA 1V37A 2NU8A 1NW3A 3IERA 4TGLA 2PKCA 3LBNA 4WK2B 1BKYA 3UW3A 1XK6A 1L7NA 3A1EA 3PNBA 4Y2PA 5C0OE 1PBNA 3QVKA 3PLNA 3RKRA 1CRWG 1W96A 2VK1A 1AKRA 3A6KA 4S2EA 4G25A 1ULSA 1LD3A 4FQ8A 2JG3A 3TCKA 1XD8A 3F5DA 3VSCA 1GTZA 2XVAA 4HWOA 4TMWA 3JSXA 4XVRA 2AFVA 1PG5A 1FS4A 2VXOA 5FO0A 1PX2A 1JX6A 3OH8A 2W4QA 1CR0A 4OJMX 5A05A 1B8NA 5EJ6A 1DFGA 1ADBA 1NF2A 3DHNA 1QG2A 3QKRB 4DWJA 3BWBA 3TOSA 1UK6A 1P80A 5JR3A 1QZUA 2H7CA 4GR5A 5EVCA 3VU3A 4PZEA 3H4MA 4PPNA 1NM5C 621PA 3HUEA 3QPUA 4R4JA 3SR0A 1P2SA 4N3CA 1BEEA 1E7MA 3F73A 2ZRCA 2ZJAA 5G0VA 5IMBA 1LZLA 1FRVA 1O9BA 2G0NA 2PIDA 1RYYA 3BZUA 4JB8A 4K9QA 3TOZA 3VYTB 2XB6A 1N2JA 4DLYA 2GVDC 3AEQA 4JT9A 2WJYA 3TKYA 1DZIA 3F6CA 4DCCA 4TMYA 4F3YA 4PHTA 4LGVA 3ZKAA 3RTEA 3QTBA 2GN9A 2OP1A 2GERA 2ATCA 2XWSA 3SM9A 1OWNA 2QL6A 4G0WA 1KK1A 3NC4A 1L1FA 3MXTA 4LYYA 3SHOA 3AYZB 2PKYX 2X4DA 5BV0A 1VHLA 4P81A 1U90A 2QMYA 3W1WA 4UAVA 3MOIA 5JAOA 1CS0B 3RSLA 5L3QB 1NDUA 1ZIXA 2DQSA 4QARA 2FUG6 5FTNA 4OUKX 3OT4A 3HYRA 3WLRA 1AKTA 3EWSA 2ZRAA 4G8BA 1RWBA 5FI1B 5ANRB 2OBBA 3TRFA 4C4AA 5JBIA 3A6PC 4W7IA 4GEKA 3L82B 3UK6A 1E4VA 1Z2AA 4K0KB 3SBEA 4B40A 4UZFA 4YCBA 4AMYA 1F20A 2FTKE 1TJPB 2HRCA 1OBCA 1VJ1A 2HEGA 3EK2A 3NHKA 3VBCA 3G17A 4QM7A 3WGQA 1HQDA 2SKDA 5J5CA 4I5FA 2IELA 4HFRA 5DHUA 1N6NA 4RJKA 1NNI1 4JWTA 2JASA 4OXQA 3DTTA 4Y2YA 4ARUA 4CFZA 1AKUA 1F12A 3RIXA 3KKKA 4RENA 3OTIA 4NG5A 8OHMA 1YRBA 2F59A 1PEDA 2Z58A 2A57A 3FPCA 4UCFA 1VE3A 2ZITA 5B2ZA 3S28A 1IY8A 1I14A 2A0UA 2G1AA 2J4CA 3RB8A 1FMFA 3GQVA 1U28A 4Z8XA 3ZDYB 3CURA 3EH1A 3VO9A 3W0LB 1EDEA 3ZQUA 3F7TA 2HT6A 3K9GA 4J1TC 4EELA 5HKKD 1SCDA 1LS6A 3K8OE 1SXPA 1VOTA 2ZRGA 4UMVA 4K87A 4JI1B 4DV0B 3OF3A 3O8BA 1THGA 1E2LA 4NENA 1VJ5A 1DTSA 1XG5A 4HNRA 5ADWA 1GCIA 2VJMB 4RD6A 3L1IA 1RQNA 3KVYA 4KRXA 4GDFA 1NKTA 2IXAA 3LL4A 1T2VA 5ALFA 1PS0A 3UTDA 5CLQA 3ZUPA 1ILEA 4JJ6A 3N0VA 4C0HA 3R40A 2JIOA 1ARZA 1Z22A 3K35A 4HX9A 3LFUA 4ZJZA 5JY1A 5K0CA 2DXIA 3TBHA 3H5LA 3TW4A 1KF0A 3IKTA 2ZYTX 3V8EA 5DNCA 4QBHA 1QC5B 3LKDA 4DGQA 1W5EA 5DO9A 3IFSA 2O5RA 1AHNA 1CUZA 1QR2A 4L5CA 1U8ZA 4YPOA 3SX0A 3NNSA 4MMYB 1F7UA 3SLGA 3UHPA 1KMCA 2YV5A 4RVCA 5TQ2A 3QJYA 3CVJA 1J2EA 5BVHA 4HEJA 5FA5A 3CUYA 3Q2KA 1E9DA 2PH3A 4R16A 1MW9X 1C2TA 1XHLA 1YZTA 4LZLA 3VNQA 1RJWA 3RF7A 1DE0A 3V3KA 3NS7A 5EZ5A 4R2JA 2CXNA 2M1XA 1FU8A 5KSWB 1Z5GA 1E9CA 2FR0A 3M5CA 4LCJA 5LOVB 1NVAA 5BSVA 1BO6A 2QENA 1EWTA 4FP9A 4IUCS 3WV5A 5H59A 4DV3B 2WU0A 1NVTA 1LDMA 2C57A 5DNAA 2HQRA 2W2NA 4A5OA 1PJZA 4ZO7A 5BSEA 4G0NA 1DAOA 4J0EA 2JNWA 5BRJA 1ZZGA 4ND2A 4O25A 3RYHA 1HMYA 1CZNA 3H9QA 1WB9A 1WIWA 2Q5HA 3G1TA 1U4OA 3GDGA 5AW7A 5F3RA 3FWHA 2YVKA 1L1QA 1UWVA 3VYRB 1C3OB 1BMFA 1U0TA 1ZCFA 3F47A 3W9YA 1ADFA 3OU6A 1GUYA 3CKLA 1TKAA 1BXGA 3L6CA 2A35A 3N3AC 1GZUA 3P4UA 1DOAA 1SH7A 5IEJA 1UMCA 3NIGB 5I7WA 1QG4A 4JOQA 3DHWC 3PXCX 1K7SN 4J90A 5A5DA 2HHHB 1GY8A 1Y82A 1P5FA 1OBHA 2Z3WA 3JAWB 5DI3B 1YB7A 5IJ9B 1O4WA 2JCVA 3R7BA 2W48A 2FF5A 1ESDA 3CJTA 1OX4A 4EEKA 1O9HA 1KFJB 4FYIA 4I2VA 4BO6A 1XEWX 3RK4A 3ETLA 3KVNA 2A1IA 4NH4A 3PENA 3T61A 5EOVA 4NICA 4V0SA 3ZG6A 1H5NA 1QR6A 1EE9A 3TGPA 3FNRA 5AJZA 4DA4A 5BNIA 3HL4A 3AUSA 3ND7A 1PWXA 3EOAI 2BEVA 2E1RA 4DAOA 3K32A 4D26A 3AKZA 4LNUB 5K6TA 5LMNB 3PDIA 3SICE 3A1UA 2VRCA 3Q0TA 1PQPA 1HH4A 1W44A 3CXUA 2HIGA 2DP4E 1K08A 2AI3A 1YSCA 1RZRA 1JQLB 2NN3C 3JQBC 3KJIA 1ESMA 4JBIA 1EG7A 1COWA 1J5PA 2G5PA 4R3NA 3MVEA 5GADl 4BKQA 1IJFA 4UDOA 5REQA 1XJ5A 2CXSA 3W5HA 1E2BA 4XAQA 3C6YA 3GLRA 4KQFA 3VHRA 3DWFA 3ZYZA 2J4FA 1UFRA 3HI6A 1WXFA 2QQ0A 1DOZA 5IM4F 4RMNA 5IVPA 4I1RA 1LRLA 3G7UA 5FPSA 4AJEA 3X1YA 4A27A 1QLHA 1U0BB 3LZCA 3RUIA 4F4FA 3HRIA 1MIOB 4HLDA 1R1DA 1LEHA 2BMVA 4ZOCA 5LMZA 2Z8YM 4I5DA 2AOUB 2E4YA 4OHOA 5D6NA 1JDJA 3ITEA 3UATA 5LQCA 4PZLA 3FZEA 1MNQA 1N5DA 3R7AA 2OLJA 4OI2A 2CF5A 3CRRA 1ZFNA 3QXGA 4Z8YA 2O8FB 3ZD7A 1N2OA 2LPMA 3N07A 1ZVJA 4MX8A 5TMBA 4EO4A 3S1LA 2ZRPA 1PSWA 1Q12A 3AEYA 3TAHA 5I9NA 3U4HA 5DN6D 1E6CA 5LLTA 1CU1A 1IHDA 4HQ6A 4IFEA 1ZD8A 2Y0EA 4IJWA 1K3TA 4LZWA 1G42A 1E3JA 1OBVA 4B45A 1Q15A 3R3SA 2H4ZA 2R6HA 3AXTA 4K26A 3MUNA 2B78A 2FA9A 2OILA 3H4TA 1CJBA 3HCCA 1UQTA 1KNXA 2JHFA 4G5HA 4BQIA 5KO2A 1CV2A 5AO9A 3E84A 1CK4A 4AYXA 4M0MA 1SQ0A 3PT9A 3MGGA 3QH4A 4JBXA 5G4KB 3I3SR 2I65A 1GGKA 3KAKA 3O26A 2ID4A 4LPKA 1ZNXA 5JAHA 3I2FA 2NSLA 1KY4A 3D5QA 3WHIA 1K8RA 1ECBA 2O8VA 3V4VB 5JEEA 1BAPA 3G13A 1F2UB 3LH5A 3IMCA 3MQ4A 3A04A 4UBMA 3KXPA 2GARA 5F1OA 5FPKA 3RUHA 1CTQA 1O96B 5COBA 4K81B 4YFYA 3T7TA 1EU1A 4F85A 3NORA 3NEJA 4NU6A 3I9V1 3N0XA 4HGQA 1NG9A 4GR9A 5CJ2A 3ZJYA 3RS3A 1NPTO 1GPUA 1P2VA 3UPTA 1MRNA 1J2UA 3BMQB 2XUKA 4H2DA 2XGOA 1AQJA 1GYRA 1ENOA 4Y2SA 3B52X 5I9SA 2EKDA 2RGEA 5JCPA 4EG8A 1JIJA 1L4FA 2B98A 5DK4A 1JFSA 4MICA 5G0UA 3VRHA 1Z7BA 1TW3A 3E9DA 4PC1A 2P9FA 5IH7A 4X6LA 2QTMA 1XEFA 3DEYX 1UOEA 1ODIA 4OPMA 4D4GA 2Q3EA 1OV4A 2ONKA 3Q3JB 1H5UA 3NT2A 3RBZA 4UM5A 1ONPA 3NVAA 2RMKA 3GRKA 4N8EA 3ZBQA 1QIFA 1UBFA 4NZZA 1W2GA 2G9ZA 1A1VA 3D3NA 1PJSA 2C5LA 3KQSA 1Z83A 1RLIA 2DUJA 1MG5A 5KNDA 4NFLA 4FGKA 4QQFA 5J1SB 2CUTA 3DOJA 3JRXA 1GTMA 4Q18A 2P77A 2WJVA 4FOTA 5KKAA 3SVTA 1SIWA 2WV9A 4M37A 3UV7A 1D7AA 4KSYA 2EVWX 3ZNQA 3DFZA 4I9FA 4BO7A 4OB8A 1P17A 1ISPA 3VNRA 3S8MA 1L5SA 5EIBD 3T7EA 4E6PA 3KSZO 3K9HA 1JFFB 3CNNA 5H0IA 4RTNA 2I71A 3JQFA 3OZBA 1SVOA 3R3WA 1H0HA 1E94E 3GZJA 1PKEA 2QDKA 4DDKA 3FDZA 1U63A 4OIFA 5JD3A 1N7HA 3FUUA 2ZUUA 3HUDA 4YTEA 3SBDA 4AJOA 2DCMA 1UZUA 2XDQB 1SC6A 1CBUA 3CZ9A 3E15A 4JYAB 1YDGA 3A4MA 2BI7A 3FOAA 4L50A 4M1MA 1TO6A 3IILA 1O8CA 3BWCA 5BUQA 1BXRA 2F55A 1MOZA 2V7PA 1E0KA 2EZTA 4HH4A 3O1LA 2Z6AA 1YI1A 5CLIA 5CM2Z 4DR7B 2ODBA 2RAPA 2F64A 2QTNA 3NU1A 4PXSA 5HFNA 5EPUA 2YNMC 3NH9A 1T3SA 2RKBA 3KFVA 3DDOA 4PBRA 4AZVA 5IAOA 4XYMA 4QU5A 3QIAA 2QRVA 4RZIA 5E1DA 1FP7A 1LVHA 1PUXA 1WHSA 3NIDB 4MAAA 2G9NA 2NUPA 2WF5A 2NYVA 2XYHA 4ZQCB 5I47A 3N2YA 5CA0F 3CLHA 3DZFA 1FVOA 4C4RA 4W5WA 2Q3LA 1FVXA 4CQMA 2IWRA 4R2XA 1MOSA 5EZQA 1GPMA 1XD2A 2WF8A 3MG9A 3PSAA 4HI0E 2GVNA 4UNQA 1CHNA 1U3CA 1AKWA 1HR0B 2FP4A 2YUIA 1RBQA 4CT4B 3IUYA 1ZK2A 1T24A 2WD9A 1JDTA 4DSAA 1Q74A 3JZFA 1XDSA 3B6ZA 4KXQA 5FFNA 4LGCA 4OG2A 1FPQA 1DAIA 3ROTA 5BOSA 3P0JA 2X86A 3IUNA 3LXRA 4GVPA 3V80A 1XQ1A 1Y63A 4TYMA 1PYGA 3YASA 1T6NA 1XMPA 1H22A 1XJ0A 2FW0A 2ZTVA 4NU0A 5FLKA 1SOWA 1T29A 2WUWE 4X91A 3PX3A 1GFWA 2V54A 2XQIA 2YVAA 1M9NA 3DM9B 2CC2A 1US8B 1EYZA 1SAYA 3GK3A 4L1KA 1YA4A 1M0SA 1BQEA 1GNRA 3AI1A 1OLXA 1T10A 2YW2A 4JXKA 5KSZA 2V3VA 4MVJE 3QSYA 1FDRA 3VKHA 4G0XA 1YQDA 2Z2IA 5EZYA 4W5HA 4F6RB 1JE0A 1QO7A 2AVNA 4OI1A 3KE8A 1ES9A 2PGDA 3ET4A 5K0SA 2VBFA 2WFZA 5BOVA 1RYBA 4GSYA 3NWBA 4OGFA 3SZ3A 3FHTA 2HBQA 4M98A 1M7GA 5HILA 2GX6A 2XXBA 3I6BA 2D7DA 1F51E 3R9IA 2Z2ZA 1O0SA 1PYOA 3MJ4A 4CFSA 1OI3A 3SMVA 3T3DA 2FGJA 1JIKA 4TN1A 2Q29A 3AR7A 1QVVA 1YIDA 2QW0X 2C5SA 2ZI7A 3UG7A 1CVRA 1MAVA 1V35A 1Y3AA 2DWQA 1H1LA 1P4RA 2Q5OA 1IXYA 5FOUA 1RZVA 2FR8C 2G36A 2IPMA 2XNCA 3LT1A 4E7OA 1N92A 2GF2A 3FSGA 1E3WA 1ECLA 3OWXA 1IUOA 1ID1A 2AK2A 2C5EA 1SZDA 4ZREA 1N36B 1U8YA 1VG0B 3CSDA 5DULA 1G3MA 1U2QA 2XKAA 1VP9A 5K8LA 2BDTA 3A9CA 1J09A 1O0BA 1K5HA 2VG8A 1JR2A 1GNQA 4C4XA 4US1R 5FUWA 1O54A 3CZ5A 5EWJB 3DWIA 3C3XA 5HEKA 3WVNA 3LQYA 1JP7A 4EF5A 5C32A 2VSOA 3DW1X 1GQQA 4HY3A 2W6MA 1VHJA 1LBEA 3DM5A 3PHGA 4R5HA 4KCGA 4R1PA 3V9PA 3JTEA 1P4AA 4IV0A 4RZXA 3KOYA 4EF4A 2ZAIA 5KPJA 5C35A 2X1VA 4QFCA 1XTBA 4FT4A 4BVKA 1Q22A 3ROKA 4DG5A 1SUSA 3G5UA 1RTTA 1I36A 1BIFA 3TZCA 2H5LA 2X2EA 3NWEA 5ULLA 3C87A 2Q7XA 2F4NA 2QVCA 1NP7A 3A58B 1QFXA 3ECAA 3GJ6A 2D59A 3GPCA 4HFMA