2X19A

Crystal structure of importin13 - rangtp complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
172
structure length
172
Chain Sequence
GEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGLEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-BINDING NUCLEAR PROTEIN GSP1/CNR1
publication title Nuclear Import Mechanism of the Ejc Component Mago- Y14 Revealed by Structural Studies of Importin 13.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Nuclear transport
total genus 45
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2009-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2x19A00
2Z6VA 2OESA 3E2IA 4XOIA 1QDEA 1G8PA 1VHLA 5DE3A 3K0CA 5HCIA 4PSKA 3RYTC 3WRYC 4L4UA 2HT6A 4LSGA 5FL7A 2GF0A 1S9DA 3BORA 2ZU6A 3WY9A 1CRQA 4F93B 1NBMD 2UKDA 4OL0A 5CM9C 2NGRA 1HURA 1KNXA 2VH5R 2ZJAA 3ASZA 4NONA 5FI0B 2OLJA 3IPYA 3VNUA 4E09A 3P27A 2CNWA 3KQHA 3BFKA 1AS2A 1ZM3A 4O25A 1GIAA 5DGXA 1GZSA 3NHAA 4FMCB 2OFOA 1VKJA 2N1BA 1R0ZA 4YXWD 2CEAA 3K70B 2BBWA 2OCPA 3AGPA 1E94E 4LPKA 3SDZA 4ZKDA 3EZFA 1S96A 1W48A 2Q3MA 3UMRA 4WOPA 3FDIA 3GJ5A 3BH0A 4TT3A 1GNRA 5DHFA 1W2GA 2IYLD 5KO2A 1ZNYA 4MITA 4R2IA 5BN3A 1AZTA 1Z83A 4D4JA 3AVPA 2GDJA 4TL8A 1C1YA 3MG9A 2GJSA 4GT1A 1E1QA 2QMUA 3B1XA 5K8UA 1J2JA 3T15A 3ZD7A 4ACAA 1AS0A 1FUKA 1N25A 3LV8A 3QBVA 4DWJA 2JLSA 1ONBA 1KI8A 3P4XA 3W34A 1Z3IX 3SNHA 1TQDA 3A1SA 4ZDKA 4TYWA 2WMOB 4LV8B 3R8CA 4OK6A 2KBEA 4TN1A 1IN6A 2REXB 4QNMA 4U02A 3RLFA 3K09A 3P26A 4DLRA 2FGKA 5J4VA 5JWOA 1IN8A 1IQPA 1KI6B 1ZM4A 2QAGC 3CR7A 4DT1A 2WAYA 5HPYB 4F91B 3NWJA 2O8CB 4P4UA 3DM9B 2F3TA 4WAUA 5L3RA 3LXXA 3VR4A 1Z0AA 1VHTA 1XTJA 2WWGA 3LDAA 3O8DA 4DLVA 3ZZ0A 2AX4A 2CJWA 3TE6A 2XX3A 3QE0A 1G6OA 1G3QA 4B44A 1H8EA 5K8IA 1G19A 3PR1A 4LUCA 1KKMA 2WJIA 2ZE6A 4PO9A 3AKCA 4GMXA 3KB1A 5KSYA 4EFMA 2F9MA 3C41J 2ZE5A 1T8UA 3RC3A 4IXNA 3CKLA 3A6PC 4LHWA 4JVNA 4DB4A 1JEEA 1EWRA 1NMXA 4D26A 4RD4A 3DEFA 4PPFA 4ZI3A 2IYRA 1KAOA 1YZKA 3FVQA 4Q47A 2OCBA 4A0FA 4US2R 2IYYA 5BYKA 2AKAB 4ON9A 2FN4A 3FKQA 1K6MA 4OHXA 4QHSA 2AN9A 3L43A 2IL1A 4BPBA 1JI0A 4A2WA 2ZRFA 2PX3A 2GWHA 4BWYA 1G3UA 4Q1CA 1AQUA 4MGZR 3GFPA 2ANCA 2J0SA 2GAAA 2GEUA 2J0QA 3I1FA 1JQJC 1US8A 2AFIE 2F43B 4N1AA 1WBDA 4PAQA 2QG6A 2XNSA 5IF9A 1UKEA 1R0YA 1JAHA 1MT0A 1FX0A 2MSEB 4NP6A 2C95A 4PFSA 4OHZA 1IN4A 2DPXA 1A1VA 5KYKA 4Q7KA 3SFZA 1QHIA 2FU5C 2IBMA 4RVCA 4EQ6B 3BC1A 3P20A 1KMHB 1U9IA 4HSEA 4AK9A 1A7JA 5KTYA 2ZRMA 1FNMA 2ZS8A 3HWSA 1KMQA 3RSOA 1M2OB 1DEKA 2ZANA 3SJAA 1BMFA 1Z0JA 4M1KA 4UJ3A 4UNRA 2XZPA 2BVNA 3EPJA 3OEED 3OAAD 4N3NA 5JLJA 2CK3A 2K5UA 1LNZA 3D8BA 1J90A 3CW2A 3K9NA 3U7HB 4FMBB 1CJVC 4HAVA 1HEIA 1NIJA 1NKSA 2CXXA 2UVQA 4I81A 4Q66C 4WIAA 1NNEA 4JSYA 3ONWA 2VSFA 4ERNA 4IDQA 5IRCD 3MWJA 3K0AA 3ZLJA 4QKQA 1CULC 4DXAA 4OI2A 1IBRA 3JZMA 3K0FA 4MDFA 2IS6A 3NVAA 4Q00A 1ZM2A 4JIMA 1KTVA 1XZPA 3EAQA 4CYMA 1XJCA 1TADA 3LBIA 1L4YA 1OYYA 2QQEA 4JVSB 4D80A 3L8YA 5AJVB 4RZXA 5JECA 2J5XA 1XD2A 4LC1A 4DCUA 2IEZA 3SYKA 2QP9X 3GD7A 4L15A 2VHCA 2ZRJA 5TDHA 1W5TA 3KTAB 1N6OA 1ZIPA 2JA1A 1DTSA 1GOTA 4EKDA 4LWZA 3RS7A 3ECCA 1B23P 3RDPA 2D3WA 2ZE8A 1XTRA 1NN1A 1KHTA 5E7JA 4RZUA 1NLYA 3D7MA 2OE2A 1U81A 5IDVA 5BWMA 4MYCA 3LQQA 2RH5A 2KE5A 3IUYA 5DI3B 1MO6A 4XH9B 5SZIA 3MUFA 4DHEA 2OSBA 2QMEA 3CM0A 3L8ZA 2IWHA 1FPMA 1EXMA 3OFNA 2EFEB 1PZNA 5E4FA 2JLRA 3DKVA 1SXJE 3X1XA 4HUTA 1E2LA 3VNVA 4KLNA 4MH0R 4D82A 3Q7PA 3GLHB 4LYJA 1Z07A 2DCUA 3I32A 4RJLA 3W5IA 4HLQB 1G3IA 2VP6A 2EU8A 3I8XA 4RFVA 2JLZA 4CEHA 2R9VA 1PJRA 3S1AA 3T61A 2G88A 4V0KA 2DFKB 3GFOA 2BEKA 1R8SA 2QY9A 3EPLA 3MJHA 3GLIB 4ABYA 5KHOC 1IM2A 3K0SA 1ZUNB 3B7GA 5KPDA 4D25A 1WP9A 4BGDA 3FPAA 4HB3A 1NF3A 4EPVA 4IVPA 3VR6A 1GKYA 3Q3JB 4C9BA 3V4FA 2G0NA 3KKOA 3QIAA 3TKLA 4LJ8A 1NJGA 2DR3A 4WZ6A 4DSOA 3EW9A 3ZZUA 3B5JA 3U6BA 5TB5A 3NDPA 4HAZA 2X8AA 2GVZC 3OIWA 1TNDA 3X1DA 2AK3A 4HAWA 1IJEA 4BLSA 2WSSD 2ASEA 5DN6A 1AKYA 4JLPA 1GWNA 2EYQA 4O2LA 4EFLA 4HAXA 4V0NA 3Q8XB 5JJKA 4AY2A 1WF3A 4AYXA 2OO7A 1ZC4A 3REFA 3RNLA 2O8EB 4Q1FA 4B76A 2N46A 4A82A 5EP4A 3UG6A 3KQNA 2HYDA 3CNNA 3D31A 2YJTD 4KYUA 4A9AA 2XNDD 1OB2A 1SVWA 1VDZA 2GXQA 4OHVA 4HLUA 4W5WA 4CEIA 2ZIAA 2ZEJA 5BN5A 3VX4A 1E9FA 4GOKA 4HAUA 3AF1A 1DADA 3DKPA 1ZUHA 2BCJQ 1QG2A 2W6JA 3T1OA 3LBHA 3FOZA 1RW4A 1COWA 1UFQA 4C3ZA 3O8BA 2O0HA 2CL7X 2C5LA 1R0WA 2MSCB 1OXSC 1EFRA 1HH4A 2ORWA 4DDTA 3Q5EA 3OIYA 5FOVA 3W8RA 3H86A 2YWHA 2NQ2C 3PCRB 2IYWA 4FI3C 4B74A 4BLPA 3AM1A 4NCKA 2QL6A 4QHTA 2FX3A 5JJIA 1ZU4A 2Z83A 2VSXA 3HPRA 4XVQA 4PQRA 4M1MA 4AC9A 1G16A 3AH8A 1W36C 3VU9A 3QOFA 1XMVA 1E9RA 1I4TD 2OHFA 4QGFA 1U90A 5L3SB 5LD2B 2GHIA 2F1JA 2JEOA 2RHMA 1G5TA 3Q5DA 3BB3A 2VBCA 2FFHA 4QJ5A 3T34A 4XWOA 5C4MA 2EFDB 5GVSA 4MGIR 4RCZA 1E0AA 3NDBB 5GVRA 2V3CC 4E07A 2QSZA 3VR2A 4HB0A 1E0JA 3QNUA 4TLEA 5TV2A 3GLIE 1I2MA 2JJ1A 2FZLA 3U2QA 2O8CA 4KBGA 1N6NA 3B1VA 4BASA 1B0UA 1Z0IA 1W5SA 1QVRA 2ZI9A 2GNOA 3RRMA 3SFVA 4DDUA 2QRNA 2X19A 1IXRC 3AP1A 3GJ3A 3NC0C 4XWKA 3EXAA 4AYWA 4XD7A 2QM8A 4ARZA 1II8A 4P33A 3TLXA 5B64A 2QBYA 2XTZA 4IRUB 3MRSA 1U99A 1WBBA 3I92A 3IBGA 4ZV4A 1YZTA 2YZ2A 1E79D 1ZC3A 3TSZA 2YOFA 4C0BA 4ZDJA 2QPOA 1EWQA 1TL7C 5BXQC 1NLFA 2P6UA 4Q9LA 4JYBA 1F5NA 3VFDA 4LK2A 4BRWA 3BERA 2O0KA 1E99A 2WKPA 3SQXA 4A8JC 3BH6A 3CR8A 1E3MA 2PCJA 1QRAA 1G4AE 2RGEA 3PUYA 1EFTA 1U8YA 4DSUA 3TVDA 3F3YA 1Q12A 4M9XA 4TWZA 2ONJA 1G5PA 5KDLA 5KPJA 4Q03A 1KSHA 4MGYR 1KZ7B 4TL7A 5GJVC 1KSJA 5D3MA 3AVUA 3ND9A 1I4DD 3PEWA 1JEDA 5SZKB 4K8OA 4A0GA 4F4JA 1W44A 4PPGA 2W0SA 4JLNA 2R6CA 1ZINA 1BOFA 1UM8A 1BIFA 1CS4C 1XWIA 4B2IA 2NO6A 1SXJA 4O3MA 2C8VA 4MDEA 2O8DA 1Q3TA 4MUAA 2WJYA 4DT1B 1N6PA 1MABA 3RWOA 4BFVA 4Z1MD 2F55A 4YONB 5AUOB 2PEYA 2VLIA 1CF4A 1DS6A 4DEXA 2QGNA 4R7ZA 3GLGE 5KSOA 2CJWB 3ASYA 1ZUIA 5J47A 2OBLA 1W2HA 5FTNA 4X8HA 4N0DA 4QM6A 3ZVMA 1Z6XA 1R10A 3CRQA 4G5RA 3BAFA 3CPHA 3CZQA 3L0IB 5J4LA 2J0VA 1QF9A 4IEEA 1AQYA 3OE7A 4M8NE 4H1VA 1W4BA 4OYHA 3KQKA 1SVIA 1D8TA 3AKYA 2ZRKA 3BB4A 4LHZA 5CLQA 4S35A 2JIZA 4F7WA 3L82B 4B6EA 1ZIOA 1RZ3A 5JEDA 1Z08A 2J41A 2ZI7A 3FHTA 4AKHA 1AA9A 2PZFA 3X2SA 4CVNA 1E4VA 1R0XA 1KNQA 3T06B 4ZDIA 3VKWA 4DC9A 3A8TA 3A58B 3PJRA 1IY1A 3QG5A 4PXAA 2GK7A 2DYKA 1E32A 1JJVA 4PZLA 3QSYA 1US8B 1KIMA 1N6KA 3WYFA 3QXSA 5CM8B 4EPXA 4FWTA 1V43A 5DSZA 4RKEA 1FX0B 1N5IA 3SEAA 1Z29A 3PEVA 4TYQA 1KI3A 1FFHA 4B2PA 1RE0A 1ZM7A 3AKEA 2QA5A 2JLQA 4NTZA 5EP2A 3WBKA 2PEZA 5L3QA 2Q3FA 4H1UA 1G21E 4LCBA 2H92A 1R4AA 2JJ2D 3E5HA 2QT1A 4K81B 1I2DA 4A6XA 2JLYA 2GZAA 2JLVA 2J3EA 2CBZA 4DLWA 3EIHA 3BD9A 2NPFA 2W0MA 3WMGA 1OXXK 3BS4A 4KU4A 2PX0A 3H4MA 2R62A 1HT1E 2ZU0C 4HB4A 1P2UA 3QVVA 1HY3A 2RHDA 2GJAA 5FI1B 4LJ6A 3AVWA 1TPZA 4MA4A 2CVHA 2OM2A 2PJZA 3VR5A 4B3FX 2J7KA 4TZ6A 1AKEA 4OJQA 4URZR 5CB8A 2PL3A 3FYHA 3H0KA 1GNQA 4Q01A 1Z22A 3LW7A 2I4IA 2A5GA 1E1RA 1H65A 3N5CA 2ZJ5A 1VG8A 1BS1A 3GLIA 1XX6A 2REBA 4OI0A 1T8TA 5JRZA 3I8SA 2W00A 1UKZA 3K0AB 3W6NA 3O8CA 4KV9A 4YLGA 4XVUA 3K0FB 1TTTA 4B2LA 1DAFA 1XD8A 4Q48A 1PLKA 3LO5A 3MAAC 4M2LA 1XF9A 3FHOA 4OQXA 3SC3A 4YMSA 4ASUD 1J99A 1ZW6A 4MRVA 3TIFA 4JT4A 3IHLA 1NVUQ 1UPTA 2XITA 3H2YA 4QFMA 1XD2B 3T1QA 1ZNZA 2B7BA 1DO0A 2H1LA 1S9HA 3H84A 4O2RA 1D9ZA 4W7SA 1SHZA 4Q1EA 3B78A 3GP8A 4JZKA 1Q3HA 4LRWA 1AGPA 3QF7A 3HJNA 1QHYA 2DHRA 5JCZA 2V8OA 4B6FA 4G1UC 2XSZA 2G1JA 2J7PA 3OIVA 3I5XA 1CKEA 3TAUA 1WCV1 1WXQA 4P32A 3CF0A 2FZ4A 3ZQ6A 1P9RA 4Q1AA 1Z0KA 3BXZA 2G0TA 3U44A 2CVFA 4UNSA 1HA3A 3SI7A 3Q9LA 2XZOA 2O0JA 4EPWA 2CLCX 2ZS7A 3RS0A 3LVRE 4A0HA 4B43A 2VL7A 1H8HD 4BFXA 5EXTA 5G41A 5CYOA 2IT1A 5FPTA 3B1YA 2BBSA 1F2TB 2VIIA 4AYTA 1OJLA 1W0JD 3ZVNA 3OIUA 1U94A 3CX8A 2WWXA 3SE0A 1QHNA 4NMMA 2OG2A 2DFTA 4M4SA 2IYVA 3SU8A 4P31A 2C98A 4OKSA 1RYHA 1A2BA 5EXPA 1YZQA 2WWHA 3WHLA 3KZ1E 1G7RA 4FCWA 2XOKD 1WRBA 2RGDA 4NCNA 2GAOA 1FP7A 4KFTA 1YZNA 2CHVA 3CWQA 4HDOB 4XTCS 2GBLA 3W3AA 5G53C 1E9CA 2VRWA 1OFUX 4R9UC 1GVNB 3FHCB 2VYFA 4DZZA 2QPAA 3GJ0A 4DLTA 2NMVA 3GJ7A 3GLGA 2BIFA 4HI0E 5FPHA 5FTJA 2GKSA 3OAAA 1JXMA 3Q72A 3VHXA 1E96A 1SKYE 3NKVA 3FMIA 3I61A 4JL6A 1Z47A 2ZSBA 1Z5ZA 2FFBA 3P4YA 4IOLA 4Q21A 2TMKA 1ESMA 2OEPA 2UZIR 3A37A 4LHYA 2BBOA 2VO1A 1ANKA 2DWQA 4DLXA 2IS4A 3FKSA 5AJZA 4TL9A 4WXRA 3IIJA 5G3ZA 1R6BX 1W36D 3U3MA 4A4DA 3GEIA 4CZ2A 2FJUA 3DOFA 4LGMA 3LH5A 2J87A 1E6CA 3PUWA 2QGZA 4OI1A 2KI5A 1L4UA 4B75A 2QU8A 3LXRA 1NMZA 1QZXA 3NG1A 4CEIB 1JAIA 3M4YA 4J0QA 5AR1A 2CL6X 4A2QA 1W0KD 4OQNA 3VQTA 4JLKA 1T9HA 4JBXA 3RVBA 1LVGA 2XAUA 1G3RA 1XZQA 3R20A 4D4KA 5DH9A 3I4LA 2H16A 3L0PA 1OYWA 4PC2A 3RABA 1MRSA 3GJ4A 3K8YA 5TMPA 2W6ID 4Q4JA 2A78A 1JB1A 2GK6A 4U7DA 2OCAA 1S8FA 3I72A 2ZVPX 4Q19A 3A36A 2WAXA 1KSFX 2RGBA 4D0NA 2OXRA 4IOKA 4MYUA 5LB2A 3K53A 3VU9B 4HZUA 4LZZA 5FBLB 2HEIA 5F9HA 1XTSA 2W58A 1E2EA 4HZIA 4Q5IA 1RC8A 3RS3A 1QHHA 1ZNXA 2CLSA 2YKGA 1G41A 3B1WA 3AP3A 1T0JB 3JVUA 2G6BA 4DIDA 5C46F 2ZI5A 3ZIAA 1XPOA 2JATA 3SJZA 1G8FA 4QBHA 3U60B 3GMTA 4NYIR 2NO0A 4PAMA 2JAQA 3C14C 4ARZB 1II8B 4TQAA 2ZM5A 2YOGA 1YE8A 4PTLA 4R98A 3PXGA 2QBYB 3CNLA 2ZXUA 3LA6A 4QRHA 2C9OA 2C04A 3LBNA 3TUIC 2ZR7A 2PT7A 1GKIA 2IUSA 5F2EA 2JLXA 1JJ7A 3LNCA 2P2LA 4FINA 4G3XA 2FPKA 2A5YB 2ODWA 2R8RA 4HLDA 2YVUA 2A5FA 1UDWA 3NBFA 2ZRCA 3THWA 2BM0A 4FN5A 2BJWA 3QPUA 1RRCA 5K8TA 3U7GA 4DB2A 3KXKA 4LJYA 3QEJA 1E98A 2B6HA 2GF9A 4GZMA 4LY6A 5AUNB 1CJUC 3AVQA 5DHAA 4D0GA 3ZQJA 1P62B 1NP6A 1GSIA 5EJEA 5JFGA 2ZUDA 4GNKA 2QMOA 4JVLA 1OFHA 4GOJA 1T5IA 4DLYA 3TJZA 1BO6A 4QJ4A 2J0UA 4QBGB 3AF3A 3OEHD 3CWZA 1BH2A 2CE7A 3EA5A 3VKGA 1Z6TA 1XP8A 3M6AA 1D6JA 4AKGA 1Q1BA 1G1MA 1EG7A 4QG7A 4RY2A 4ESHA 2KB0A 1YZLA 1ZBDA 2F7SA 2WPDD 5KNBA 5D3MB 2F1IA 1VYTA 4FMDF 2RGCA 4IJMA 5KNDA 3HPQA 2FPMA 1JXOA 2E1RA 1FOEB 3THOA 2VSOA 1KI1A 1NSTA 4L16A 3F8TA 1M7GA 3NXSA 1AM4D 1KKLA 4JLAA 5TXGA 4GZLA 4TMXA 1TF2A 5FOXA 4B3BA 1SXJB 2Z0MA 3SS8A 5KSPA 1MO4A 4TLAA 4QC2A 4PC1A 5L8VA 1NY5A 2O8DB 3IDQA 1UBGA 1P9NA 4DIEA 1W4CA 1XBTA 2V6IA 1MABB 3BGWA 3SOPA 2O8FA 5JSZA 1F6BA 2Z43A 1LY1A 1OT3A 3JVVA 1OFTA 1QG4A 2MSDB 1G9XA 1LFDB 1M8PA 1CP2A 1J7KA 3OZXA 1E0SA 5L3VA 1IOZA 1JPJA 4RSGA 3N2EA 2GCOA 2W2XA 2XB2A 3UG7A 3OESA 1E0KA 1Z06A 3RS4A 4AKIA 4WZBE 5EXSA 3UK6A 1FTNA 4GP7A 2ORVA 1OHHA 5JMTA 4CT5A 1AZSC 2N42A 1A82A 5AJWA 3CBQA 4IVRA 4A0RA 1MKYA 5FPYA 3F0TA 2OILA 1YRBA 1N6HA 1T0HB 5TY0A 2NO1A 4ZIRA 2BKEA 4LOAA 5B30A 3PFIA 2A30A 5FOUA 4HLUC 4TYPA 1R5NA 4KCGA 2R65A 3AUXA 2XTNA 4GPTA 1Z2CA 3WXMA 3ADBA 1CTQA 2AR7A 4Q4AA 1HQYE 1DPFA 1N0WA 1VECA 1SVKA 3X1ZA 4BZPA 5C18A 2EWVA 1E79A 3K70C 1VYVA 5G40A 2NIPA 3B6EA 3O47A 1LW7A 2V54A 1SVMA 3U61B 4PANA 3A1TA 3LQRA 1E2MA 4W5HA 5FBVB 2C2HA 1F2UA 4JL8A 2HJVA 3UANA 3FGNA 1TQ6A 3UXMA 2Q9CA 3FMOB 5H8WA 5CYPA 4FD2A 4DCSA 4AD8A 521PA 4TMKA 4QM7A 4B48A 1KJWA 3UWOA 2BMFA 1RIFA 1YR8A 3D3QA 1F3OA 1QHSA 3RS2A 5KSZA 2IA5A 4KITB 2CNWD 2GEVA 3RWMB 3VMFA 5L3QB 2ZYUX 2A9KA 2MMGA 5UKDA 3RS5A 3CPEA 2OBNA 1XEWY 2NO9A 3QJYA 3C5HA 5JI3E 4MYTA 1EFUA 1Q57A 3QQ5A 3QPVA 5IT5A 1XPRA 1F2TA 5JRJA 2A5DA 3GPLA 1N3BA 1HTWA 3Q7QA 3C16C 2BC9A 5EXXA 1Y63A 1HE8B 5CITA 421PA 5JS8A 1Z0FA 2WM9B 1AJEA 3LFUA 2FSIA 1E2IA 4DSTA 3KUDA 2FG5A 2FGJA 1U0HC 2W2VA 3NH9A 3HYRA 2ZS9A 4RFSB 3C15C 4EFNA 3ZJYA 3C8UA 4KJZA 3NIBA 3E70C 3ZGXA 1TU3A 2PCLA 4CRWB 2Q9BA 4H9GA 2QP3A 2FEOA 1OH7A 1TEVA 4Z1MA 2PT5A 4BUJA 4Q02A 2D06A 1F60A 1JPNA 3AEZA 1PUJA 1WQ1R 1ZM9A 3FE2A 4I4LA 4MUBA 4PSAA 2EQBA 1FW6A 1YVDA 2BM1A 4C30A 5FBWB 3FWYA 4DKXA 1FQKA 5IK2D 1Q20A 2QAJA 1SULA 1IHUA 5H70A 2RGGA 2IUUA 1MR3F 3TUJC 3HR7A 2IYQA 1GRRA 3CRRA 2Z4RA 2FFQA 2PZEA 2W83A 1RYFA 2AL7A 1NBME 4TQUS 5DO9A 2V9PA 3HP1A 2ODBA 1WDTA 5F9FA 5AUPB 1G5RA 1G7CA 4M9QA 4QHYA 4F4CA 2ORIA 4N0EA 1JR3D 4PC7A 1IXZA 2QPTA 3M1IA 4B47A 3EX7C 4PZZA 3ADDA 1NI3A 2VPPA 1L8QA 3CONA 4LYAA 3N70A 4W5JA 3WMFA 2HUPA 2BJVA 1SVLA 2IUTA 3B1ZA 3U44B 1RFLA 5BN4A 2ZJ2A 4KFRA 3AF4A 4G5OA 3AB3A 5H68A 1KGDA 2WICA 4YDSA 1SXJC 1NMYA 2HDNB 2VA8A 2DWPA 3DL0A 4LJ4A 4F4IA 3K9GA 1XCMA 4PAOA 3TW4A 3IIMA 3QEOA 3QF4A 1Z6AA 2GILA 3GEHA 2WTUA 1KK0A 2OV2A 4LV6A 4EIWA 1EX7A 2ODEA 1O87A 4XSHA 4WXPA 1LB1B 5FOSA 1KZGB 2H7VA 2JJ2A 2DY1A 2P5TB 3LVQE 4B3CA 4BQSA 3EZ7A 1NVWQ 4KBFA 1ZD1A 4NPHA 1FP6A 4DCNA 3NBZC 1NG1A 3TQCA 1ZAKA 4QNRA 2LWIA 3CUEF 4S2EA 4HDQB 2EFCB 2C99A 4X8MA 2ERXA 2R2AA 5SZJA 2AHOA 3HYTA 1ZVQA 2XGJA 3NTUA 4M1WA 1QHGA 3GLGB 2QE7D 5CJ2A 4EDHA 1JNYA 2H5EA 2VEDA 4PHFA 2DB3A 4PHHA 1E2QA 1GTVA 1OLOA 1OXVA 1VG0B 2QMHA 3BB1A 1JBKA 2I3BA 2D2FA 4RD6A 3Q85A 1S1MA 4BFWA 2GCNA 4X8LA 4M1SA 2H17A 4PPQA 1BMFD 2E9SA 2WKQA 1UKVY 1VYUA 3TK1A 3ZYCA 5J4YA 3DZ8A 5J4KA 1CR2A 2X77A 2ZYWX 4U5XA 1M6NA 1CLUA 1SGWA 2REOA 2YC4C 5CK4A 4ASUA 2IYSA 4TL6A 4NCJA 3N2IA 2CCJA 2J1LA 4JLJA 5EUQB 3SHWA 5A4JA 2FV8A 2OAQ1 2ZRIA 4ZCMA 1DO2A 1TUEA 5FFMA 4Q9IA 1OH8A 4UNPA 4DBLC 3KKNA 1J8MF 2IYXA 4IFEA 4BECA 2VP2A 4HLCA 2C77A 2QN6A 1YR7A 3AVXA 1NIPA 2BV3A 4JBWA 2H8KA 3VHLB 4Q4JB 3IO3A 3LAWA 3DZDA 3GJXC 3KX2A 5JWRA 4DVGA 4OJKA 4B34A 2XJ9A 1CXZA 4HZUB 1MO3A 1Z6GA 2HF9A 4UXJA 1T3LA 3UPUA 1TU4A 1XB2A 1G17A 2AD1A 3VX3A 4BE7B 3GLFE 2WJHA 2WOOA 4E22A 1QHHB 3LW8A 1OXUA 4KODA 4YC7A 3PVSA 1XMIA 3QUSA 2QZ4A 2Q0HA 5FOTA 1E9BA 4JLVA 4IKEA 4URYR 3U3OA 1NG9A 1G4UR 2V6JA 2WWIA 2XOKA 4JVMA 2ZI4A 4PR0A 1XPUA 1ZJ6A 3MWKA 3WRXC 3WNDA 2JCSA 2NZ8A 2R6DA 3OFND 1X8LA 1FMJA 5EE5B 4UXIA 2A3RA 4MQBA 5GJBA 1CEEA 3KFVA 5B2ZA 1W4RA 4CW7A 4M1OA 3LX5A 1KJYA 2BMJA 4WZAE 4TMZA 1XCPA 1K5DA 1TQ2A 3B13B 4YMVA 3U4QA 3TSWA 1DAIA 3NC1C 1UBFA 5SZHB 2CL0X 3DDCA 3RANA 1RJ9A 1XFAA 4QBIA 5IHPA 4PO8A 3EZ2A 4G5SA 1E69A 3IHWA 2B8WA 3DPUA 3C4JA 3THWB 5EQTA 3FTQA 3DMDA 1GUAA 4QGAA 2BKUA 4QGGA 1YR9A 2D4HA 1NBMA 3TMKA 1OXTA 4P4TA 1LF0A 4LBZA 3THYA 2F9LA 5D3QA 1UF9A 3QI2A 1QHXA 2QSYA 3SQWA 2VHTA 2J0UB 3IQWA 2BOVA 1XD9A 3U5ZB 5LPNA 3IILA 1L2TA 4TSFD 2GCPA 4Z8XA 3MD0A 4MGKR 2WJGA 3TBKA 5FH9A 5GJWC 2V1XA 2OAP1 5DN6D 2QEQA 4LJ9A 4YXWA 5E3HA 3LLMA 4A36A 1U8ZA 5FBRB 2Q6TA 1GILA 2WOJA 1VCNA 2V7QD 3AQ4A 1VCMA 1DAEA 4HEJA 3TAHA 5CLLA 3PUXA 1RKBA 2W6IA 2D7CA 1OB5A 5LD2C 5E7IA 3HU2A 2LCFA 3A4NA 1LF5A 2GBLC 2RAPA 3NBXX 5ANRB 2ZRGA 1TAGA 3NH6A 2HYIC 3W6OA 4Y0VA 4MKHA 3I5YA 2O8FB 4JS0A 3K70D 3EIQA 4QBFA 4R2HA 5JSZB 2ZRDA 3ZVRA 4ZKEA 1YZGA 3K0EA 4IOJA 4LV5B 1OFIA 4JJZA 5AJYA 3C7KA 4GOXA 1KK3A 1EX6A 2BMEA 2H57A 3P32A 4RFSA 2Q21A 4LC0A 2HF8A 2GCOB 3K0CC 5DNYB 1CJKC 1GKUB 1FL9A 4LBVA 5GJCA 5M04A 4FMDB 5CJPA 3TNFA 5E7MA 2HXSA 5KDOA 2P5SA 2ZYVX 4C2UA 4TLCA 2R6AA 4HUQB 1SKYB 1V5WA 3D6TB 5JEEA 4PQFA 2WJJA 5JHGB 2EFGA 1PUIA 1G291 4ZIRB 4LHVA 4BZQA 1EESA 3PITA 4OHWA 3WBJA 2ZJBA 3DOEA 1E2JA 1UJ2A 5JI2E 1ZD9A 2X2EA 2BBTA 4DLSA 3TGPA 1VPLA 3G5UA 1OV4A 1E2PA 4C0JA 1ZYUA 3BOSA 2WVJA 2GTPA 1JQLB 2R6GA 4TYNA 4Q4AB 2GXAA 2A5JA 3IIKA 1Z0DA 1GP2A 1G8GA 4G01B 4QJ3A 3ICQB 4LJ7A 2GETA 5DYGA 1VG1A 2VQSA 2ZE7A 1A5TA 2R44A 2ZJZA 2ZROA 4JLDA 5FUXA 1F2UB 2NPIA 2QNRA 4KVAA 5FPKA 3SBEA 2FE4A 1DAMA 1JR3E 1S2MA 1VMAA 2G3YA 1JECA 4GRAA 4B33A 3R9XA 4ZO4A 3IBYA 3CLVA 1N6LA 1II9A 1NN5A 1DOAA 3QKTA 2YV5A 3VAAA 2VP0A 5DYIA 2CCGA 2Q3HA 1GAJA 1KO7A 5E95A 3UATA 5KDDA 3MFYA 1UEJA 2GXUA 3OEHA 5ELXA 3AVTA 3B60A 1M34E 3ZDQA 2AXPA 2OFXA 2WPDA 2ODNA 3C5CA 3B85A 3K09C 4C0HA 2LKCA 4O0MA 1Q0UA 2AFHE 4IFBA 4YDHB 1K8RA 5FBQB 4B3XA 1W1WA 1AGRA 3EWAA 3OF5A 4ILEA 1TEXA 3GLFA 4G5QA 2FNAA 4I1VA 2NG1A 3KJGA 1OH6A 3LRPA 3IPXA 4M1TA 4FWIB 5DIFA 1NVXQ 2VF8A 2IK8A 3SN6A 1DAKA 4PSVA 4XIGS 2WJVA 4HAYA 3EZ6A 5B57C 1CR4A 1DBSA 3TQFA 3ZD6A 4B3GA 4D4LA 1VCIA 2CHQA 3PUZA 2SHKA 2ZR9A 3NBYC 1M1YE 1E4YA 1R2QA 3BBPA 3TR0A 1TX4B 4XSGA 3BE4A 1G7TA 2FSFA 3TVTA 1MRNA 4CEJA 2FH5B 2IS1A 4RZ3A 1PLLA 3PIRA 2QM7A 3OEEA 621PA 1X3SA 2HCJB 2ECKA 3KUCA 4GBMA 1E2NA 3U3JA 4GDFA 4JJKA 3AVVA 3WP1B 4LPSA 4GP6A 1LTQA 3PEUA 3TSOA 3A4LA 5FTKA 1JR6A 1GL9B 4LHXA 1M7BA 4NYMR 2WWWA 4C0AC 2G77B 4TLBA 4DLZA 2GJKA 4QXAA 2RCNA 1CJMA 2BMDA 4IHQA 3ETLA 4Z8YA 4EJSA 1ZMXA 3VR3A 3OE7D 1U0JA 1OF1A 1SKQA 5HR5A 2PMKA 2UZ3A 1ZD8A 2ZUCA 1GG2A 2CMKA 2GZDA 1XCGB 5F98A 4KSBA 2JIZD 4UKDA 2ZYTX 1DG1G 3CH5A 4L5BA 4P0TA 4KFUA 3B9QA 1P2VA 1KDPA 4FIDA 1G64A 1XXHA 1U9IC 2C9YA 5FR2A 2ZAMA 3HDTA 2KWIA 3QF4B 4NKRA 2KJQA 2IS2A 4QGHA 3SYLA 2ZJOA 1GRQA 2YNMA 2QORA 4NYMQ 3UKDA 1SHKA 4LYHA 3NEYA 1P75A 1J70A 2CCKA 2DWOA 1ZCAA 3ZZTA 2ZSDA 4RD0A 4P3YA 3PG5A 3NHBA 2AD5A 2D2EA 3RRYA 1EGAA 1NLZA 4NU0A 2IXEA 2AKYA 1SVOA 1P9WA 4HB2A 4IXMA 4P4SA 1AN0A 2YWEA 3AF0A 3ICEA 3KJIA 1TF7A 3HU1A 1W4AA 4BLRA 3A1WA 2WWYA 1WB9A 4PZYA 2V1UA 5EP1A 1E2KA 4TMWA 5F3WB 4JLMA 2ZI6A 1Q1ZA 4I1SA 4IEIA 4KHZA 2CHGA 2RGNA 1GNPA 1S1CA 4WA7A 5FUWA 4Q9JA 4Q7JB 4XTRA 1OW3B 4Q7LA 1G7SA 2IF2A 3G82C 1X1SA 2QRZA 3T1VA 1OPXA 2JDID 2ZRAA 2G1KA 2EYUA 2HLDD 2GJ9A 2LKDA 3B8HA 2VHJA 4JLOA 3TR5A 1VIYA 2ZI3A 1WA5A 1KDRA 2CDNA 2KBFA 2NO7A 3FFAA 5IK2A 4AG5A 4A6PA 4PPNA 3QG1A 2IEYA 1GL7A 2QT0A 4B71A 4D0LB 3B9PA 2G9NA 1DAGA 4IDNA 4MRNA 1LS1A 3GJ8A 4BEJA 2XXAA 3QPWA 2WMNB 1E1RD 4PX9A 1IONA 3W8NA 5EE0A 1PLJA 1D9XA 2WV9A 2PBRA 1ZNWA 1FTSA 2WSSA 3K9LA 4BFSA 1VIAA 2E87A 3L0OA 5EUMA 3LD9A 4KYIB 5JZVA 2JLWA 2IW3A 8OHMA 5AWFC 1R7RA 3V4RA 3EZ9A 3EA0A 1JR3A 1WE2A 2B7CA 5CIQA 2VP4A 4NYIQ 1RVDA 4ACBA 1RRGA 3GQBA 2XNDA 1E2HA 2ZREA 4TTRA 2XB4A 2ZVQX 4DEYA 4AKEA 2B92A 4Z54A 4RZ2A 4C0KA 2AK2A 2IX3A 1RRPA 2ZRNA 1X1RA 3A1VA 4IDOA 5HE9A 2EVWX 3ZS8A 6Q21A 2NTYC 1XDBA 4M1YA 2V55B 4RCYA 1Z63A 4OBEA 3V9PA 1C9KA 3GJ6A 3MWYW 1W49A 1N5JA 3AGQA 1E2DA 2AXNA 3NEJA 5LDDC 2XSZD 4US1R 3W3ZB 4ZCIA 2J7PD 5CB6A 1II0A 1TUIA 3DM5A 4M0LA 5HKKD 3PEYA 3DHWC 1XEXB 1NSFA 1FQJA 4BFZA 2QTHA 1UBEA 1KOFA 5EE3A 2JASA 2Z4SA 2IYTA 4X8OA 3X1WA 1KY3A 2DFLA 4Q4HA 3QXJA 1OH5A 4L8GA 5A5GA 1EFCA 4AWXA 1OIXA 1XJ0A 3U7EB 2FA9A 4DUGD 2IYZA 1NN0A 3EG5A 1DAHA 2GJ8A 2IC5A 3U6KA 1Z6YA 1OKKD 1T5LA 2EW1A 3AKDA 2QE7A 3ADKA 3U4QB 2YYZA 3MLEA 1TF5A 5HE8A 5JCPA 2OCYC 2PMDA 2P3SA 4XVRA 4NH0A 1RJ9B 3V00A 2PH1A 1KJZA 4HUQA 3OHMA 3CPJB 4JYCA 1C4OA 4HDCA 1T6NA 2ZETA 1BKDR 1N6RA 2ZITA 4MRSA 3BH7A 4PHGA 2YC2C 2O8BA 2WIBA 3KQLA 1ETUA 2ANBA 1YQTA 3PUVA 5DISB 2ZUBA 2PJRA 1W36B 4G5GA 1NN3A 3H1TA 4V02A 5FL3A 4HYYA 1X86B 4V0LA 3THYB 4TLDA 4KLZA 2OXCA 1RPZA 4BZXA 5JJLA 3QXXA 3I3SR 2A7QA 2NZJA 2ATXA 2OUKA 4OI4A 3IEUA 2J9RA 3SZRA 4M21A 3UWKA 4GFDA 4JSTA 4C7OA 4Q1BA 3EPKA 2YWGA 1DE0A 3FKSD 2P6RA 2QAGA 1BYUA 1G6HA 5FL7D 5LB4A 2ZRPA 3MMPA 1D5CA 1S3SA 1EFHA 2IHBA 5FUVA 2FSGA 3WP0A 3U3RA 4D81A 2XZLA 3R7WB 3SJCA 4TZ0A 1YR6A 5TARA 5A0FA 4RKFA 2I1VB 3IQXA 1R5OA 1ZP6A 3B82A 2MMCA 3BK7A 1OIWA 1IN7A 3ND8A 2ONKA 1HT2E 3DVLA 4ZI2A 4BLQA 4EAQA 3W9YA 4EPYA 1X6VA 1N5KA 2IYUA 3FMFA 1E2GA 4NCIA 2ZRBA 2ZSEA 3THXA 3X1YA 4CIDA 1IN5A 2OBMA 2F1RA 3LY5A 4G0NA 3IEVA 1KAGA 2PZGA 1JALA 2ZTSA 1FMLA 2EWWA 4TT3D 2JLUA 4FCTA 1ELOA 4A8JB 3QKSA 4BLTA 1P60A 3QKRA 1WMSA 1GDDA 1HQCA 2IXFA 3EARA 3A4MA 1E1QD 1XEWX 1DARA 2VP9A 5EE9A 3RHFA 4OK5A 5KUTA 1BYIA 1FNNA 1NJFA 3VR1A 1T4GA 3KXIA 1UBCA 1N6IA 1KI4A 1XU4A 2FEMA 4PQYA 4EUNA 1N2CE 2FMXA 1XMJA 2A2ZA 4IVQA 3W90A 2BWJA 3QBTA 2HXYA 2QUZA 2OLKA 1HYQA 3CF2A 5AUQA 2XJ4A 2HT1A 2QQ0A 3QXCA 1MOZA 1FUUA 1ZU5A 1U98A 2KSQA 4M53A 3PQCA 3ZIAD 3IGFA 3PENA 1T3HA 3BIFA 4RD2A 3BWDD 5DI9A 4B32A 1XEFA 3AVYA 1QVAA 1Z28A 4WVFA 3IKJA 1AIPA 2YHSA 2P0EA 2RKOA 5C1BA 4BRUA 4C4PA 3I73A 4BLOA 4LX0A 1H8ED 1XNJA 2WIAA 5CDFE 1KYIA 2G83A 1R5BA 4FMCF 3T35A 4JKIA 4URWR 3F5FA 4F38A 2O52A 4PO1A 3CX6A 3GFTA 2C9CA 4KSCA 1YRAA 4GL2A 2FWRA 4TSFA 3KDSE 2P65A 2X1VA 4NBSA 2C78A 3KKPA 4DCTA 1YU9A 2BDTA 3RSLA 4B3DA 4IDHA 1LS6A 2YWFA 3WMEA 2Z5FA 2V7QA 1R8QA 4BFUA 2GESA 1KO4A 4IW3B 2VTKA 4LJ5A 4A2PA 4UNNA 1KI2A 2GEDA 3GLFB 4M9ZA 2ERYA 3QENA 1Z8FA 4JBYA 5J40A 1G18A 3P1JA 4UNQA 4WW0A 2OZEA 4MYHA 5AK0A 4C0QC 2VF7A 2F1HA 2XTMA 3EASA 4US0R 5BQ5A 4AURA 3QY0A 3HU3A 4CGZA 1G3MA 1IJFA 1P61B 1A2KC 3T5DA 1X8KA 1J8YF 1XTKA 2ATVA 3KQUA 1SVSA 5J4HA 2FFAA 4CEJB 1OE0A 1EK0A 4NL4H 3CH4B 4BFTA 1FZQA 1M7HA 3KXLA 4M22A 4MKGA 4D4MA 3G0HA 1Y3AA 4D2IA 3SYNA 2NOAA 3GCGA 4M9SA 2X2FA 3AV0B 3CRVA 5CK5A 3CZPA 5HCNA 3BRWD 1P73A 1CJTC 5TVKA 4NYJR 2WBLC 2CE2X 2CLDX 3KL4A 4NDZA 1F48A 2QROA 3GLHE 4A92A 2H18A 4ITRC 4Q4LA 3UMFA 1CR1A 1MO5A 3RC8A 5HTKA 4QOSA 2VHUA 721PA 3HR8A 4DJTA 5GADl 2GA8A 2CK3D 1N0VC 3FFBA 1G20E 1KI6A 2W2TA 4LDJA 4YQFA 1TQ4A 4DCVA 3J81k 2JGNA 5LBIA 1NRJB 1OHHD 5EE1A 1Q44A 1VCOA 3AVOA 4U00A 3BFXA 2IWRA 1U0LA 1Z2AA 1VTKA 2QENA 4PHTA 1DELA 1P6XA 1S0UA 1Q1QA 4B35A 2HJGA 2L0XA 1XXHB 4LYFA 3ZS9A 4IOMA 1HUQA 2FOLA 4NYJQ 4QL3A 4URUR 5BYJA 2D7DA 1GRNA 5AJXA 1SQ5A 4OK3A 3EPHA 4FCVA 3LX8A 5C4GB 1W47A 4BEBA 2FF7A 1XTIA 5FTLA 1H8HA 4I99A 4JLBA 4TTQA 1W7AA 5JBQA 3KB2A 4OQFA 4JMPA 1W0JA 4OQMA 1KK2A 4WBSA 4P4SB 3VKHA 3TH5A 3CRMA 1UEIA 2RGAA 4NHOA 1XEXA 2OFWA 2BHRA 3K1JA 4W9MC 2FSHA 4V0ME 1YJ5A 3BJIC 4L9SA 2V4ZA 4V03A 2O5VA 4CF7A 3UMSA 5KOYA 3KFXA 2F43A 1KSGA 1KY2A 3TUZC 2ZSFA 2J59A 4Q1DA 4BFYA 1MV5A 1KK1A 2EFHB 1NY6A 3DO6A 4L9WA 3SR0A 1KO1A 2DFNA 5K8LA 3U7FB 4JL5A 5JS7A 1OSNA 1KDOA 2VHQA 4TMVA 1KI9A 4E03A 121PA 3CB4A 3LLUA 1E9EA 3CO5A 4EJSB 1D2EA 3WYGA 3T12A 3T5GA 5B58C 3FMPB 2GXSA 4GSYA 1TMKA 4EQ6A 1KDTA 1KMHA 3A1UA 3UIEA 1PVOA 4JT2A 2XXAB 3R9WA 1UKYA 1Q1EA 3CF6R 2RMKA 4LBWA 4UJ5A 2F3RA 3EC1A 1SZPA 4HATA 2QI9C 2ZAOA 5P21A 3CNOA 1UADA 3WNBA 5EZ5A 4ZDWA 4DDWA 4CDGA 2OT3B 2I1QA 3AF2A 2DBYA 4RD3A 5CDFA 3B2EA 5BW8A 4K46A 4A15A 1CRPA 3I62A 4AIIA 3KKQA 2IXGA 3PV0A 3T1TA 1U8AA 2JJ8A 821PA 5HZHA 1S4QA 1UDXA 5H1YA 5KNCA 3QKUA 1IAQA 2ZPTX 1W0KA 1DVRA 1XXHE 2WHXA 4LBYA 2ZJ8A 3EC2A 5FTMA 5JWHA 3W5JA 3WNCA 2FPLA 1T3SA 1KI7A 5FOWA 3R7WA 1HE1C 4YMWA 4DRZA 4OHYA 3R9IA 1E9AA 4ZCLA 4DDVA 3KJHA 4JKYA 4KI0A 3AP2A 2HCBA 1P7CA 2QP4A 2BEJA 4PC3A 4Q4HB 1X8JA 1G8HA 2IHYA 4KVGA 4NE2A 2W6JD 3TW8B 4I1UA 1COWD 1KO5A 3KTAA 5DLQC 4NCHA 4D6PA 3JZAA 3LWNA 5KU1A 3MWLA 1W46A 2GRJA 3E1SA 3MSXA 3ZH9B 3O8RA 4C0SA 5FPSA 1EFRD 2P6NA 3K9HA 1D2NA 5G3YA 2J45A 1AK2A 3KJEA 3CIOA 4KAXA 4UXHA 2RGXA 3SBDA 5HZKA 1ZRHA 3BFVA 4A8JA 3M0EA 2WZQA 1MH1A 1OIVA 3GEEA 1XTQA 4C0LA 3ADCA 3MJRA 1P4SA 4Y0AA 5DI3A 1XJQA 5JHHB 1T91A 3RRZA 1I4LD 5CIWA 2ZRLA 2GZHA 3EWSA 3ZVLA 2B8TA 2IF0A 1NVVR 2ZRHA 4MRRA 2YOHA 3SJBA 2JDIA 1DG3A 4YMTA 4GI7A 4PC6A 2O8BB 4KFSA 2HLDA 4Q9HA 2J46A 2Q9AA 4MKIA 2RB4A 2YINC 4FXPA 3MCAA 1P72A 1GM5A 3REGA 3GLHA 4R71A 4EPRA 4I1OA 4LI0A 2B21A 4OQLA 2JJ1D 4Z51A 3RAPR 1S3GA 4EPTA 3L2OB 1CR0A 1M74A 4UQOA 1YHNA 4C7OB 2C96A 4XD7D 2ZR0A 4XJXA 2QAGB 2VP5A 4KXFB 1HV8A 2R6FA 4AG6A 3SHFA 3U3KA 1ZCBA 3FB4A 1P2SA 1E2FA 2D74A 4ESVA 1GFIA 2D62A 2XEXA 4Q7MB 2GVDC 1NVVQ 1XRJA 4MRPA 5EZ6B 4IDPA 3CX7A 2PLFA 4RD1A 1P2TA 3CRW1 1AS3A 1UAAA 3KKMA 4V0OA 4GMDA 3THXB 1O3YA 2O8EA 4TQ9A 1IXSB 4XWAA 2WKRA 2WWFA 1KO8A 2RGNC 5FUYA 5FR1A 5HKKA 1IY2A 1G8YA 2QTFA 4TYYA 1D2MA 1CU1A 4E5UA 3L0SA 2ZQ5A 4DSNA 3QKSB 4POAA 3EIEA 4URVR 3QKRB 3W6PA 4YMUA 2AWNA 2HV8A 4EJSC 3DMNA 1IY0A 4KO8A 1YZUA 3RRNA 1NKTA 1P3JA 2AWOA 1GITA 4F92B 2Y8EA 4V0MA 1A4RA 3QXHA 4URXR 1N0UA 4DUGA 3MGCA 4TTPA 1PV4A 1ODFA 2FDCA 4CT4B 1L7VC 1OKKA 1E9DA 1P5ZB 1Q21A 4DLUA 1E9SA 1RRFA 2QTVB 1SXJD 1XMSA 4AI6A 1LV7A 221PA 4MKFA 4C2TA 2BCGY 4NZYA 4Q9KA 1CIPA 3QVUA 4ZPXA 4A1FA 3AUYA 4CEHB 1ESNA 3S1AB 4LJAA 5L3SA 3WHKA 5EP3A 3IO5A 1N5LA 2P67A 5J5CA 2F6RA 4B73A 4FW9A 3R8FA 5C2JB 1VG9B 2PLRA 4Q18A 1U2RA 1Q22A 4TMTA 1GL6A 1CBUA 2ZSAA 4II7A 1K5GA 3WYAA 2WSMA 3VTKA 1QBKC 2ZJYA 3TRFA 1NL3A 2C03A 1YKSA
chains in the Genus database with same CATH superfamily
4FDUA 2ZQYA 3L8EA 4AX4A 2ZT6A 3FNFA 1ZR2A 3GDOA 3PUHA 2WG2A 3JD3A 2CLOB 3K0CA 4LDZA 4MQMA 1Q84A 4Q39A 3RUPA 3RYTC 5CG2A 4LSGA 2HT6A 2ZZNA 4D3DA 1VGQA 2GF0A 1S9DA 3KOXA 1PR3A 2ZU6A 4KRXA 3WY9A 1WMEA 3I1JA 4OL0A 2QL5A 4QYIA 1NBWB 4GLFA 3PX7A 2GCGA 1YDFA 3UMJA 3IPYA 1QE5A 3DBOB 4YGYA 3VNUA 2FHSA 1B16A 3P27A 4YP7A 2PA3A 4WASA 2LCIA 5LA6B 4BBJA 3KQHA 3T7SA 3I2FA 3C3MA 1AS2A 4OUKX 5ILGA 3PT9A 4FQ8A 4O25A 1CY0A 1GIAA 2Y3IA 5DGXA 5FKJA 1CE8A 1D0VA 4LFAB 2I80A 4HLNA 1U3FA 2HNAA 3EFOA 4E6EA 5I8PA 1IDOA 2CEAA 3WL8A 2VDRB 2OCPA 3PIDA 1QSGA 4WXMA 5FNVB 4CV3A 3SDZA 4ZKDA 5F64A 3IULA 3VPCA 1M76A 2G4LA 3MQ4A 5JAHA 5EFZA 4PLGA 3LXMA 3HCOA 3FDIA 4MLCA 3UMRA 4Z7QB 1E8DA 4EFDA 1GNRA 1A5ZA 1EWTA 1XI2A 4FOOA 2AYZA 4JJAA 3VNSA 2ZP1A 4B17A 4MS1A 2Q0XA 2YRFA 3EFBA 4JP1A 2H1VA 5BN3A 2X9GA 4OAPA 1K08A 1RQPA 4JI3B 2C2XA 2FPRA 2R68A 1E1QA 2QMUA 4V3CA 4GX2A 1J2JA 4EVQA 3T15A 2V03A 5F35A 5K8UA 3ZD7A 1AS0A 1G21A 2HL6A 3QBVA 4UTOA 4C2AA 1MVOA 1U4OA 2RFLA 4GKBA 5HF6A 4D3XA 2Q5HA 1CY7A 1Y8QA 3EXIB 3P4XA 1KZYC 1WZCA 3H1BA 3KYCA 3M89A 3SSOA 1LBQA 4UTNA 2HRQA 1TQDA 4LOIA 3TL2A 3E7FA 4RPCA 5B5SA 1N33B 4QNMA 2R1UA 3P26A 3L8FA 1W88A 4I0WB 5J4VA 2H6EA 3DWIA 1IN8A 1JT9A 4E2WA 3GLVA 4BNMA 4DT1A 2RK4A 4NENA 4TRJA 5IAKA 5HPYB 4F91B 5K0NA 1Z7WA 3NWJA 3W5UA 4CLOB 1ZD4A 5L3RA 5ITSA 4QJBA 4J07A 2M32A 3SY8A 1Z0AA 3DSRA 3O8DA 5C4IA 3LDAA 1FRQA 3ZZ0A 3DYIA 1Q7TA 2I3ZA 1EK5A 3V8BA 1G0OA 5EWLA 2PUCA 2XX3A 2V7PA 5DP1A 2BHTA 1S8OA 4QEKA 4LY3A 4PRKA 4LUCA 3LE8A 2WJIA 3UUGA 4UHHA 2PSHA 1W9HA 1H2WA 4DABA 3UPTA 5BSRA 2Q46A 3FPLA 5T57A 1MEOA 2XMSA 2EHJA 3EXG2 1SXQA 1T8UA 4MQ4A 3VH2A 3QWHA 4FR2A 4UE3S 4JI8B 1TJYA 2P62A 3MUEA 5BRJA 1UDRA 2EGHA 5LIPA 2HCRA 4YFVA 4D26A 3NHPA 2IHKA 1YIAA 3G59A 3KOYA 3DEFA 4PPFA 3TWOA 4BNZA 2WIDA 1XO1A 4ZI3A 2IYRA 1C4WA 4IQ4A 1RVV1 3RU7A 1GQQA 4OQZA 3UBMA 2WT9A 4J3NA 2OCBA 4ZXPA 3SF0A 3DOCA 1NW6A 5AKGA 4AQYB 5GTDA 4F3CA 3EGDA 4YWHA 2IYYA 3MT0A 4ON9A 4REQB 2ZBPA 4QX6A 5I4IA 1AHPA 1TT5B 3EOZA 2VXYA 4FLFA 3UH1A 2AN9A 1WM1A 2R4UA 3G8CA 1KMCA 2W2KB 3I6QA 4J6FA 4HADA 2VJMA 4CKEB 5T64A 4YRIA 3QJGA 4JJIA 3MXTA 4LVUA 3O1IC 1P1HA 3BCRA 2PX3A 4UVIA 2AXQA 2GWHA 4WESB 2RH8A 4LSMA 4C5AA 4IH4A 3STWA 1A9XA 1IN1A 2J0QA 2BJHA 3R6WA 1T25A 1WVGA 2I2CA 1JQJC 4IJUA 2Q49A 4FKZA 4GS5A 4RX1A 3RIHA 1C9JA 2ZWIA 1WBDA 4PAQA 3TSYA 5DCUA 2XNSA 1XAJA 2D6FA 1VC2A 4Z4HA 1RZVA 1R0YA 2R47A 1VHQA 1FU4A 1MT0A 1GT6A 2G1AA 2BDUA 2QW1A 3NIGB 4UCFA 3M6XA 3L7IA 4PX2A 1RYBA 2DPXA 4YP9A 4XASA 1IVNA 5KYKA 4YRCA 5CX4A 4D4IA 1EDZA 2PGXA 2IU3A 1KMHB 1NATA 4MMZB 4BB5A 3WIOA 2WJWA 2VHYA 1FNMA 3RQSA 4IGAA 3HWSA 2C4UA 5DXAA 5HP4A 5KPJA 1L5YA 3NTRA 2VDJA 4IY1A 3G1WA 2FZVA 1EDEA 1LPBB 2PMFA 3IV7A 3LCVB 1M2OB 4OXKA 3VPGA 3QX7A 5LP6F 1TA9A 2PD6A 1Z0JA 3FAZA 4F56A 1NXOA 2VVTA 2XZPA 4ZI7B 5LZ9A 2FX2A 1QO0D 1Y48E 4ND1A 1JEAA 5HJ2A 1T9CA 4JA2A 1CY6A 1XHFA 2H07A 4QT0A 1IG3A 3U1TA 1G8AA 1J90A 1OGIA 4U8HA 3UJCA 4YTEA 4HAVA 2BISA 4NULA 2COKA 5FEUA 3IUSA 4IUDS 3GVHA 1NKSA 1Z4QA 2CXXA 2UVQA 3SEFA 4Q66C 1B74A 4F84A 3BF8A 5JZMA 2P1RA 5EKSA 1J0XO 3LECA 2GK3A 1NURA 4IDQA 4RNCA 3MWJA 2P77A 1XQ6A 4QKQA 4UPEA 1IUOA 3ZLJA 2AZTA 1D2HA 3K0FA 1PWXA 1V4NA 1X7ZA 4BEVA 1THGA 3PHLA 4JIMA 4Q00A 1U02A 3G9QA 4JEUA 1XZPA 1L7PA 3ET4A 3JSAA 5DLPA 1GPUA 4QUKA 1KJQA 4KQIA 5M2QA 4BVGA 3E4CA 3AILA 3L0CA 3R3XA 4UM5A 4RZXA 5JECA 1XD2A 4LC1A 1ML4A 2IEZA 4X1IA 3PXEA 1RYDA 2OHGA 3FLAA 1OLXA 2I7XA 1JG6A 3IVRA 2JA1A 4XUEA 4FEEA 3HVUA 1DTSA 1GOTA 4QPJC 4EKDA 4ZK6A 2E49A 3G85A 2P11A 3DZBA 3PHBE 1OPRA 4XIFA 2ZSHA 2LGJA 2C9ZA 2ZE8A 3F2IA 4C6RA 1Q0PA 4H7JA 1K8ZB 2CKDA 3H83A 4YT8A 3OMXA 5BWOA 4PF1A 1L5QA 3A3KA 5BSFA 3AG6A 1PSWA 3LQQA 3FUCA 1LQUA 1NNI1 1MO6A 3OETA 4FBGA 1AK9A 3A2KA 4TN5A 2CXTA 2OSBA 1FPMA 5LJIA 1EXMA 3A6LA 4HSGA 3FPKA 1V11B 4HFRA 4GW3A 1LSJA 5E4FA 5JVDB 3OTOB 3DKVA 5LLTA 4RXMA 3E9ZA 4Z2YA 4JDUA 4C01A 2REQA 4HUTA 4NZ9A 4KLNA 3OM8A 1GEEA 4ND5A 1U0NA 3Q7PA 4NBTA 3HKEB 1OLSA 4RZSA 1Z6QA 5EMJA 5AYVA 1MGPA 1Z07A 2P69A 5LXTB 1H2ZA 3M5PA 2C4WA 1XDSA 2EU8A 3K1ZA 3I8XA 4L08A 1T5TA 1F6DA 4MKRA 4EB0A 6LDHA 5DYNA 5ALWA 3DO8A 2DFKB 4F2DA 3U48A 1ZLXA 3QRWA 2PJDA 3MJHA 1ZISA 1KMNA 4RPGA 2WTMA 2F3UA 4AJEA 4BEJA 4D25A 1WP9A 4CKWB 3DD5A 4BGDA 3T5MA 3FPAA 5G1NA 4EPVA 1G42A 4D0SA 4IVPA 1YS1X 2NU7B 1UQTA 2G0NA 1M5TA 3V4FA 3QIAA 1NPDA 3TKLA 1A71A 3KETA 4WZ6A 4GKVA 2HY7A 2P6MA 3U6BA 1D1QA 3MJDA 1TCAA 4HAZA 4LMBA 2X8AA 5TGZA 5JQGF 4WY8A 3MYYA 3OIWA 3GBPA 2BGJA 3A3YA 3X1DA 2AK3A 2O1EA 4XB2A 4I3HA 4R83A 4URVR 1ZOPA 3H8SA 5DN6A 3PKIA 1UBHS 4JLPA 2EYQA 1LBHA 3E7PA 5DHUA 3GP3A 3PLAE 3E5RA 3RNLA 1R9NA 2N3ZA 3JPWA 2AE2A 3INGA 4WJKB 1QO7A 2RGUA 4B76A 4BVFA 4PHCA 4DG9A 4F5EA 4QULA 3KQNA 3V2UA 2IH4A 3CNNA 3K6SA 4BLVA 1Z7GA 3ORSA 1VDZA 4OHVA 3T41A 4GQIA 4HLUA 1YB5A 3UAWA 3IMGA 1E6KA 3K4QA 3DWFA 4QUDA 1E9FA 1ZN8A 3B89A 3AHHA 4HAUA 4LRUA 4JBLA 4RHUA 5BR1A 1DADA 3DKPA 2V0GA 4HNRA 4UCWA 1QG2A 3DR5A 4EHAA 2GJ4A 1RW4A 2ADFA 1HM5A 2IYOA 2O0HA 2PZJA 2I0FA 3KS9A 2ID8A 3ZGYA 4YPVA 1DQPA 2C5LA 4NU6A 4PPYA 4AP9A 3KEFA 1OXSC 2AFIA 2M98A 1XZNA 2CBXA 1HH4A 3GHYA 1K2VN 1S3IA 1ONNA 2ORWA 2VRCD 3G0OA 4HDMA 2GB4A 4BRZA 4DDHA 1TJPB 2IYWA 1R0KA 2ZYIA 1B43A 1TZKA 4KUGA 4NCKA 2FX3A 4PSUA 1ZAYA 2GYYA 2VSXA 3HE3A 4QGBA 4BO9A 4F6LA 3TKYA 4PQRA 2AR0A 3E9DA 3H2GA 3QKIA 2IYEA 2RB5A 1HFEL 3AH8A 2DFPA 3RT9A 4KJXA 4C0XA 2IDKA 1TZ2A 2FRDC 1WMBA 2JFQA 2PSEA 3KXPA 1PFWA 1NM5A 4GWLA 3ZV4A 5JAIA 3SX2A 5KCZA 2RHMA 1N8KA 2A4MA 2J3LA 4PICA 2PUDA 4TTAA 2VBCA 2FFHA 4QJ5A 3IFSA 3T34A 3TJRA 5GVSA 3GVPA 1SH7A 1KWKA 1WXWA 2B8JA 4DN6A 4AJ9A 3L6RA 4GVXA 5GVRA 1SCUA 4A6EA 4OEHA 2WILA 4OXQA 5DW3A 5HQTA 2VA9A 2V3CC 3KKEA 1KH2A 1PJ4A 2E18A 1H0HA 1BHJA 4HB0A 1E0JA 2G09A 3FZGA 3V80A 2JJ1A 1D2CA 2FZLA 4GPZA 4B1FA 3LOUA 3MJTA 4KBGA 3GGDA 1Z0IA 4P4LA 3LCMA 5HJEA 1RI4A 1GPBA 2ZI9A 4UMEA 3RRMA 1NBAA 4W5NA 4G0MA 1EK1A 2X19A 3AP1A 2EZTA 1ZXBA 1OX5A 2ZIXB 3GJ3A 4R81A 4KPUA 4XD7A 1V8FA 3FNEA 3QUTA 4ARVA 4P33A 3CYFA 3KNZA 4YIKA 4FOSA 2QBYA 5JZOA 5L40A 2FPWA 3MRSA 4GHWA 4BBAA 1DRVA 1WXHA 3TXYA 3IBGA 3UGKA 3ZPXA 1FSPA 3IHKA 4QT4A 4P0PB 4ZV4A 1YZTA 2YZ2A 2AN4A 2LW7A 4BCCA 4DHWA 2FUEA 2RCYA 3INTA 4XCVA 5EY5B 1XVLA 3QVMA 1PG2A 2OZLA 1IUPA 2QPOA 2A59A 1NV8A 3TZ6A 1NLFA 1SA0A 3MMXA 2P6UA 4Q9LA 4JYBA 5J2TA 1F5NA 1DBVO 1PV1A 4PVCA 1T4MA 3BERA 4FNAA 3NHRA 1E99A 2WKPA 2XNCA 5B6IA 2ISCA 3OE1A 1QCCA 3GWZA 3HGQA 4PGAA 5F5LA 4X62B 1U5BA 1UT6A 2P9ZA 1UZLA 5JR3A 1ZZEA 1FYWA 2I33A 4EG4A 4ZOLB 1U8YA 3H3XA 1DV2A 4FU0A 3TVDA 1RXSA 1X70A 4TPKA 2JCBA 1G5IA 4M9XA 4TWZA 2ONJA 4GGOA 3VO8A 4BLUA 5KDLA 4Y9RA 5CA1B 3MM4A 2P4QA 3UHFA 2H2HA 4ZOAA 4OXRA 5EZYB 3L3BA 2W6OA 1KZ7B 2OR3A 2H5JA 3NHZA 3VO9A 1T6XA 3UOWA 1P6QA 3TIXB 3AVUA 3FYUB 3H1AA 3ND9A 4L9AA 4RPHA 5KNBD 1JEDA 1GGHA 1ORTA 1FDIA 1LK0A 1U2GA 3DAHA 3JWIA 4K8OA 1W44A 3USES 1BCSB 5C5EA 3KBBA 1JMVA 1ZINA 1H2EA 1UM8A 4B2IA 1CS4C 1AKQA 5H3LA 4O3MA 4XAQA 1N6PA 1P18A 3LQYA 3PX2A 1T8WA 4Z1MD 1P19A 1IYZA 1CZNA 2YHUA 3LKBA 3MGKA 3E84A 2BFDB 1DS6A 4DEXA 2QGNA 4ONEA 1ULZA 3GLGE 2QUBA 4KMSA 4E5KA 1EB8A 4RMNA 3HXOA 1B6TA 1PK8A 5FTNA 1YE5A 3VPAA 2X4IA 4RF3A 3T4EA 1M83A 1W5EA 2EOAA 1MX3A 3QOWA 4AWBA 1ND6A 2PKXA 3BIJA 3WNVA 2P91A 1AQYA 2O1XA 2GPTA 4M8NE 1W4BA 1XRLA 3G8AA 3KU4A 1NI4B 2YHIB 3PDIA 1ZN2A 4OYHA 4DBZA 5L6MB 3IUQA 4J4TA 1NU6A 5K4AA 3AKYA 5LQCA 2ZRKA 3BB4A 1VPVA 4LHZA 5C1PA 4XSVA 3ZKAA 4W1PA 3RYCA 3MT7A 1SUEA 2AF3C 3W77A 2PUVA 3WLAA 4YRAA 1PR0A 4EY7A 3LUCA 2J41A 4F5YA 4F71A 5CURA 4PG8A 4RTOA 3IAS1 3FHTA 1SHLA 1FSGA 2PZFA 3QUCA 4ZYTA 1E4VA 1YCDA 4WH0A 1R0XA 4JKOA 4B9AA 1DBRA 1I2ZA 3MZ0A 3KAQA 2HSZA 3GV0A 2FSVA 4O1MA 3FB1A 3OE5A 2B1GA 2MR5A 4Q37A 1P4AA 1JAYA 1G6Q1 2A0FA 1GTMA 2D2VA 1DKQA 4M6WA 5E7QA 1YR2A 1HT0A 3HVRA 2DYKA 1FDTA 1TQHA 1US8B 2IPXA 3L7AA 3WLKX 5KINB 4RAQA 1ZJZA 4OMFG 2XE8A 5G0WA 4MUGA 3U7IA 2Z95A 1JFSA 1FX0B 3HJGA 3SEAA 1Z29A 1ZOSA 1BOOA 3OCZA 4RPKA 2R85A 3JATB 3UAOA 4TXJA 3VTZA 1M2VA 3AKEA 2D3TA 2QA5A 3OX3A 4I55A 4EJMA 1AMNA 3KVOA 1A9SA 1MN6A 2CDAA 5FNZA 2WG0A 3H0EA 4MQFB 4LCBA 2Y0BA 1NXSA 5BWLA 2QT1A 2JLYA 2O2CA 2IVZA 3DT8A 4DLWA 5HIJA 1ODCA 1V5GA 2W0MA 3VNRA 4CFYA 3BS4A 4HFMA 1JH8A 1TEHA 4JX9A 4N9QA 5LN1A 4DA4A 2AYXA 1P2UA 4GI2A 1TMGE 3U7JA 4MI9A 4KX5A 3HYLA 1Y3FE 7REQB 3U3XA 3C3JA 1VA5A 1IK6A 3RVOA 4MAAA 2OM2A 4I5IA 4B3FX 5F5NA 4DDTA 2JGIA 3JYPA 1NRWA 1C3VA 1H1DA 2WUEA 2FMUA 3HCAA 1D09A 1PT9A 1Z18A 1LUAA 3LW7A 1H2HA 4XQ9A 5E4YA 1H65A 2PRJA 1VG8A 4EBFA 2QI9F 1LZLA 3HJCA 3UMCA 3OEWA 1T8TA 2CNDA 4IILA 3E9YA 4BNJA 5JRZA 4DUZB 2QD4A 1JDTA 3CGWA 4M7RA 1UKZA 2SICE 3ZX4A 4IPTA 2E5WA 2HRRA 4KV9A 4P7BA 1U3UA 1TTTA 2X7HA 4JLSA 1PLKA 4KQ9A 4KQGA 5EWJB 1L5HA 3MAAC 5DF1A 3TLYA 2GNPA 4ADSG 2MYUA 2K87A 4KOAA 4O4IA 5B6PA 1AN9A 2C31A 1NOJA 1ZW6A 4MRVA 1N32B 1Z56C 3IHLA 4EF6A 4E14A 1UPTA 2OCKA 2HMTA 3T1QA 1ZNZA 1DO0A 4UD6A 2A6PA 3TVYA 5A4KA 1D9ZA 3H75A 1KA9H 1SHZA 1TKRA 4PCAA 5FBKA 4Q1EA 2H9YA 4WINA 3GAAA 2WVAA 1AGPA 2JGMA 4LRWA 3T9AA 5JCZA 5DNDA 2V8OA 1ORIA 2YFYA 5AI8A 2PN1A 4NMHA 3JQ7B 2B82A 2NVBA 4KI7A 2NX2A 2G1JA 4N18A 5GGYA 3DQQA 3WO1A 3I5XA 3FYUC 1WXQA 1SPXA 2FWIA 3VDMA 1MIHA 3CF0A 3ONFA 3U4DA 3ZQ6A 4D1YA 4H31A 4F9EA 1FPQA 1LDGA 2FPGA 2VZ8A 3KXDA 3V7FA 2FG7C 3ZK7A 3AJDA 3RK0A 4BN4A 1CUUA 5ICCA 2CLCX 1RKVA 3RS0A 3GEDA 3LVRE 1T4DA 4J8PA 2WSYB 3CQ9A 4TQGA 5CYOA 5G41A 1W85B 1I6LA 3B1YA 3RUEA 4NS1A 4AYTA 1TEZA 1OJLA 2IEIA 2Q6VA 2HMWA 2H3EA 3OIUA 2IYAA 4U2DA 1HE2A 2WWXA 1JS1X 1A2OA 1Z34A 3N1UA 5CVVA 5IYZF 3SK0A 1WAMA 2PGAA 2IYVA 4M4SA 4WDRA 4P31A 3M4XA 2C98A 4INPA 3BM5A 5EXPA 3A6ZA 2VF5X 1GXSA 1OBOA 2D7JA 3OWHA 1S5PA 4AN4A 5LNK1 2XOKD 1WRBA 2BM9A 2RGDA 4NCNA 2C2ZA 1YS9A 3Q0TA 1T13A 1P7ZA 3I1YA 4PGGA 3OKAA 4ZAZA 5KQPA 3FDFA 1FP7A 3ODPA 3R6LA 4HFJA 1XTUA 1GDHA 4XTCS 2P9TA 2PFSA 1CUZA 5E8RA 1XOIA 4F97A 1OFUX 6CHYA 2VYFA 4PGFA 3GJ0A 4DLTA 4KH0A 3WRWA 3CZ4A 1FJHA 4F96A 2NMVA 3NRJA 1MEEA 1JKIA 2CZCA 4QDOA 4QXMA 4RQTA 5FTJA 5JNUA 3GJZA 1JXMA 2V9ZA 1H23A 2VOJA 1E96A 2H1IA 1SKYE 4RVOA 3NRBA 2FQ1A 1NQXA 4OXYA 2GCEA 2C2MA 3IE1A 1PG5A 5AQEA 1UC9A 5HIAA 2FFBA 3RRFA 3VYTB 1FBTA 3FD8A 2GBFA 3QLVA 3A37A 1WZEA 5JNTA 3PXBA 1Z4JA 3DUFA 2IY7A 3I5MA 3L1UA 4KDCA 3PP8A 4JD5A 4LZNA 5ESWA 4F12A 4WXRA 4F5WA 3F7NA 3I23A 3QWFA 4N39A 3FVWA 4CZ2A 4D8YA 2XECA 3D0RA 3DL7A 1ISIA 3K9BA 4DQDA 1N0HA 3NBQA 3LY8A 4ENRA 2GERA 1L4UA 4GX1A 4B75A 3DGEC 1T15A 1LSSA 1NMZA 1CQXA 2HF2A 4ZO8A 4C7MA 1P0CA 3R4VA 1M8KA 1QZXA 2WW8A 3AK4A 3ESZA 3NG1A 3D0QA 4GBGA 3WYBA 5AR1A 1V9CA 1V3VA 2CL6X 1MF7A 2VSYA 3H6KA 3FA2A 2ST1A 4FHFA 3RU9A 3EQ7A 3VC2A 4RORA 2H4WA 3ITEA 4AO8A 3VQTA 4DCPA 2MIIA 4UHDA 4YREA 5DH9A 3L0PA 1OYWA 4PC2A 3TFWA 4XUGB 1MRSA 1XK7A 4PV7A 3K8YA 1Z74A 2CVPA 2W6ID 4KAAA 1ESZA 1FLVA 1FRFS 3W5SA 4B4OA 1JB1A 2GM3A 3IJ5A 4EP1A 5FQOA 4U7DA 5IZCC 3KKKA 4YGXB 1RZUA 2HWXA 4Q19A 3NPAA 1P77A 2WAXA 5IS2A 3ORYA 2OXRA 4IOKA 4MYUA 4R68A 3O83A 4QODA 2EDAA 2BSXA 1NZFA 3K53A 1YD7A 2R7KA 1AMOA 2HEIA 5ERYA 3QW2A 2RD2A 4INAA 4PLCA 3ELDA 4HZIA 3P2JA 1RMYA 1KPIA 5AW8A 3CSSA 2FTKE 1NUHA 3RS3A 3IP1A 3Q3VA 4DF3A 1QHHA 1P9LA 2JGDB 3WGHA 1NUSA 3DF9A 5E6RB 1DJOA 3B1WA 1K98A 3AP3A 3OTIA 5K03A 3GC6A 4LKRA 2Q1UA 3JVUA 4BNDB 3V4LA 4DIDA 3H42B 1H05A 2G40A 3ZIAA 1UBRS 4QFCA 3SJZA 3UV7A 1ULTA 3EIFA 4OKIA 4DILA 3GMTA 4FYXA 5TVGA 3KOUA 3BMCA 3PCTA 4UZSA 4PCLA 4CV0A 3VJRA 4M87A 1NUUA 2QN3A 3C14C 3F90A 4FHDA 4ARZB 2H54A 1YE8A 3KP1A 1U2QA 1ZG3A 4OHKA 4C88A 3TUIC 2ZR7A 4G5FA 5F2EA 1U8UA 2JLXA 1TAUA 1CEQA 3GNQA 2P2LA 3HBJA 2ODWA 4Z6KA 3L06A 4HLDA 2BMAA 2CWDA 5IH3A 3SD7A 2BM0A 2XADA 4WHMA 5FF9A 3ZY2A 3W5VA 5JSHA 3U7GA 1RRCA 2VBGA 3GDGA 3GFGA 4HYQA 4K7JA 4G0VA 1QFJA 2CWWA 3QEJA 4Z4FA 1IULA 2JAUA 5AUNB 1CJUC 1LTHR 3AVQA 3FTCA 1TYBE 1M8FA 2ZIGA 3HWX1 5DHAA 3M6UA 5I9SA 5JFGA 3RSGA 2BFMA 2ZUDA 2QMOA 3EVEA 3HV2A 5AK3A 1ICEA 5LOVF 3TJZA 3TG8A 1YVPA 4FS3A 4XXHA 4QJ4A 5IMBA 1JWBB 2Y0CA 4B6QA 5T7BA 1XGKA 1QP8A 1SMKA 3CWZA 4XB6B 3WL3A 2VPXA 4EATA 4YAJA 1G1MA 5E38A 1HGXA 1M1NA 1M1UA 1YZLA 3BJMA 1GPJA 2OV8A 4JT9A 5FLEX 3DNFA 2GCIA 5HIMA 3Q8MA 4FMDF 3NFRA 1D0IA 1K89A 3EGVA 3ILYA 4FFPA 5T6MA 2B3DA 3HPQA 3NYIA 2FPMA 1JXOA 1QXSA 1FOEB 2BP7A 1MX9A 1SZCA 1YRWA 2A7XA 2SCUB 2X8BA 3CEHA 4L16A 3SKVA 3NXSA 4DR1B 1AM4D 3DZIA 4HPWA 4GZLA 2WHYA 4I6EA 1MOPA 3HMQA 3RIXA 4OXNA 3UM9A 3NETA 2G72A 3AHEA 3WGKA 4TLAA 1OI2A 2C2OA 2G4VA 5K0TA 5L8VA 2O8DB 2H3HA 1GYQA 2V6IA 5KNCH 1MABB 1W8IA 4D6XA 1Y81A 1MDFA 2GYWA 2ZOSA 3N5KA 4AQDA 2FJPA 1OT3A 3K0KA 1QG4A 2MSDB 4NJEB 4NVRA 4AZ0B 2GA9A 3HCNA 3OQOA 3OPNA 1M8PA 3C1TA 1BU5A 2OGTA 2CFOA 1LX7A 1QK4A 3BQ9A 2FSUA 1MC8A 4BX0A 4RQUA 4XEUA 3WA7A 3WKBA 1KEWA 2G07A 3SYRA 3V1NA 5EJAA 4BVLA 2GCOA 2JHFA 2W2XA 3IMCA 4QOIA 3UG7A 5LMCA 1E0KA 1T9ZA 1Z7YA 2XB2A 3RS4A 2XCIA 3LTEA 1OAKA 4G67A 1O57A 2DHEA 4K2AA 1FTNA 2HPVA 3VZPA 4CT5A 1YCGA 1P0FA 1A82A 2N42A 2RGWA 4B7CA 3CBQA 4XDHA 2P6PA 1Z5NA 2IPMA 5HGXA 2POCA 2XTAA 3NQ41 1YRBA 1T0HB 2ZK7A 2E4UA 3COWA 4LOAA 3M6WA 4JYPA 1AV7A 3RF7A 2UYOA 2R65A 4TV8F 1X19A 1FSSA 4N8EA 3WXMA 1SC6A 3WGVA 4YCCA 1CTQA 3B3FA 1DKUA 1C5KA 3DFFA 5CYFA 2AOUA 4KN8A 3U7QA 4BZPA 4R1PA 3VR3D 1EFDN 4R05A 3VOBA 2QRGA 4MVJE 1MH9A 1DAPA 5GZ1A 3O47A 1LW7A 5HG0A 2Y05A 3DAYA 5IH7A 3U61B 1IBMB 3N2GB 5CW2A 3WAKA 5C35A 2C2HA 4JL8A 4RDXA 4HQRA 5LP6A 1L5SA 1VI6A 1C8LA 2YN4A 3FGNA 3JR3A 3PHIA 3UXMA 2ZATA 2AOXA 1N2JA 4E08A 4DCSA 1OBVA 4AD8A 4FFDA 521PA 4F6CA 4W5OA 3OZCA 1HYGA 3FHJA 1BMTA 1ES9A 1VBKA 1WUKS 3D2BA 1BMDA 4B48A 2R6HA 4QM7A 1H2AS 1MHPA 5KCMA 1CNMA 4QDTA 1GGEA 3AR7A 3D3QA 1F5SA 1AKWA 2ALJA 4IICA 2Y71A 1KE2A 1Y7IA 1C3OB 5J2UA 4KWEA 1AURA 1PFGA 4BMDA 1HDCA 3BREA 2MSKA 3HXPA 3RWMB 2XYVA 2OAGA 2RARA 3QVLA 5L3QB 1UDCA 4HQOA 5DMHA 2A9KA 5G0VA 5UKDA 1M33A 4QOGA 5TQ2A 3C5HA 4IWNA 1L7RA 3DBRA 3UA4A 2CNOA 4IUYA 1EFUA 1DDOA 3DBLB 2V9CA 1H93A 1NXPA 1T8SA 3PPYA 4MWTA 5CEJA 2I65A 3VDNB 5JRJA 1FVFA 1IPEA 1N3BA 4V0RA 2XQKA 3RVPA 3MINB 1EIWA 5DBIA 1HE8B 3C70A 1WKBA 3Q88A 3VBCA 2FG5A 4EB6B 4XD2A 3KE9A 3AEXA 5HWSA 3NH9A 2NZYA 1XMQB 3AVWA 1YUMA 1XZAA 4XR4A 3H2KA 2VT6A 1CY4A 2R8YA 2Q9BA 5C8XA 4H9GA 4WLUA 3HYNA 1OH7A 1BH6A 3WNQA 1U0BB 1Q1GA 4C76A 4Q02A 2D06A 1F60A 3Q98A 4XGNA 5IJ0B 5KKCA 4DR6B 1KVTA 4I4LA 4MSUA 5SY4A 3S1LA 2EFJA 1FW6A 2XQVA 3UAYA 4YV0A 5DSXA 4N7MA 4MP8A 4BQEA 2VNJA 2HRBA 1A88A 3S99A 3RFVA 5IK2D 1Q20A 5KYXB 4X20A 2FN7A 1HDEA 1HLPA 1SULA 1IHUA 2GZSA 3JQPA 3DE5X 4L3OA 4P86A 5EN4A 5K3SA 1PP4A 5T6BA 1V95A 3LPCA 4E5SA 2WF9A 1F0KA 3JRNA 4XQ0A 3HR7A 1Z2EA 2V7GA 2ZCUA 2R48A 5KVSA 1GRRA 3CRRA 2Z4RA 3R0IA 1CSEE 2AL7A 4QTYA 4KNVA 1KBZA 2ZVJA 1BRMA 3H8WA 3HP1A 3HWWA 3OZIA 4L0DA 5LR6A 3CF4A 4D99A 3O4FA 2Y92A 1RXUA 1NQTA 4X66B 4OD0A 4JI4B 4QHYA 1T6BY 2RHRA 2VDOB 2ORIA 3SCZA 1BRTA 1PJZA 3GGGA 4ZO9A 3WK5A 3ENNA 4BPRA 1J9GA 3IIEA 1Q0SA 3BTVA 3AZPA 4JUCA 1VJDA 4I4IA 4LXHA 3V32A 1FYVA 1VFPA 3HLKA 3ZN2A 5EGNA 2WDZA 4BOYA 1U7WA 1I2AA 2QD1A 1L4LA 3M6LA 3U44B 2V7VA 1J0CA 4KWHA 2O1SA 1SUIA 3MWFA 1PL7A 2Q4DA 2ZJ2A 4O4HA 5AHOA 5DCLA 5HQ3A 4JUDX 5H68A 1KGDA 1C9YA 5AM5A 4ZAYA 1YDEA 4IFTA 4DIBA 1W4ZA 2AUNA 4YRQA 5LIRA 4ZEOA 1FJGB 2DWPA 1G8KA 4B6JA 4UE6A 3K9GA 1OBHA 4MB6A 4BGVA 1BD4A 4PAOA 3R0XA 4FYIA 5A03A 3IIMA 1KYZA 2GILA 3AJRA 4LZJA 2A9FA 4G86A 1B0ZA 4A3SA 3QKWA 3K20A 4EKNB 4ML3A 2WTUA 2V58A 5KBYA 5K9ZA 1JHMA 5EJMA 3EIUA 2GBCA 4XSHA 1KYXA 3MJFA 4YI5A 4F4FA 3EAGA 3MN1A 1KZGB 2KW5A 1YJXA 3TRHA 3CZRA 5DMXA 1A8UA 3EZ7A 4R0VA 1NVWQ 3SHTA 1ZD1A 3UWOA 2ZUEA 1FP6A 4DCNA 3NBZC 5AW4A 1INLA 1WY7A 1H94A 2B99A 3WGJA 3CUEF 1QLWA 4HDQB 1DP4A 3LIIA 2B0JA 3K05A 1PIWA 2E6KA 2ERXA 2Q6KA 2PRSA 4HP8A 4ZO7A 1TZMA 5I7WA 1ZVQA 2XGJA 3NTUA 4H2DA 5I5GA 5B1YA 1QHGA 3G2MA 1KQOA 1Z9BA 3DB1A 2PWAA 3D4OA 5CJ2A 4EDHA 4IIHA 1GGNA 2VEDA 3LUAA 2PX5A 2XYRA 3WDMA 5TS3A 1E2QA 2JAXA 3JVEA 5M5BA 1JHAA 3OZGA 3UNXA 1OXVA 1AG9A 1VG0B 3AONB 2GO7A 3BB1A 4Z9FA 4DIUA 3OJLA 5KYYB 4FD3A 3Q7EA 2F1OA 1TA4A 3DV2A 4WZBA 4X3PA 5H5JA 2BZ1A 3S6JA 2W2LD 2GD6A 2A1TR 3Q8KA 1E5TA 4EKIA 4F3YA 3FAKA 2D1RA 2GCNA 2JS7A 3OCVA 3PFGA 4X8LA 3RC9A 4BFWA 1AO3A 3EWIA 5AVWA 2DHQA 3MB5A 3S27A 1OXBB 2F3SA 1NE2A 2FMTA 2C4TA 5B2EA 1IY8A 1MVLA 4YBRA 1UKVY 4OB6A 4ATNA 1VYUA 4JK3A 3TJMA 3WS7A 3ZYCA 3DZ8A 3NR2A 1N34B 2HADA 1CR2A 1SBTA 1QFXA 3IQZA 1L5OA 2PSJA 3B7WA 1IRIA 6PFKA 3PQEA 1BC5A 2NU6A 4NCJA 4TL6A 1GQOA 3U26A 2H9IA 4BUCA 3M6MD 5EUQB 1EA7A 3C24A 4KZKA 1P7YA 1U2SA 3UCFA 4J1QA 1DO2A 2G5GX 4AXBA 1PV2A 2HIAA 2VH2A 4K1XA 5FFMA 1E4OA 1U4SA 5E6SA 4E5VA 2BEWB 3CO0S 5E2AA 2QTTA 4AJLA 1YDWA 2FPUA 2Z9BA 4K86A 4I4TF 2QN6A 2E0IA 5HW0A 3AVXA 1NIPA 4JBWA 3SZOA 1A9PA 1IZ0A 3VHLB 4Q4JB 4LHSA 2BKVA 4NNJA 3IO3A 4I5GA 3ND7A 1E9VA 2X3FA 4YYEA 1UJ6A 1NJ6A 2I2BA 4YCDA 5ECWA 1NPYA 1QHFA 3E4DA 1J1ZA 2ZT5A 1EX9A 1BQ3A 2GTHA 2CLMB 3RBZA 4B34A 1CXZA 5I7AA 3HGTA 4MUXA 3NJ4A 3C5WP 3TL3A 3N87A 3GT0A 4D9FA 5BSHA 2PGOA 1Z8NA 3H5AA 5TEVA 2HCFA 3ZGNA 2HF9A 1IHOA 4UXJA 4GQBA 3UPUA 3VX3A 3C87A 2NACA 4OFBA 3NAZA 4ARSA 3GLFE 1Z68A 4R6WA 2IELA 3COJA 3V97A 3G8DA 1L9KA 4BYGA 3X44A 1ACJA 4KODA 4IHJA 3GCZA 3VAYA 3A9RA 3KR0A 5AM3A 3G0IA 3QUSA 4MV9A 1WZUA 4GECA 3V1YA 1P44A 4GBJA 3U3OA 3HKBA 1NG9A 4O2AB 2V6JA 2ZKLA 3IQHX 4JU9A 2ZI4A 4H7PA 1EGHA 3F1KA 4PR0A 2A9OA 3SVZA 3K5PA 1RXYA 4AY3A 1JA9A 3T9EA 4YJGA 4DA6A 4GM0A 4EUHA 3DLHA 1E4EA 4LAFA 2JCSA 1X8LA 1IQRA 2W6MA 2Z8ZA 3CLRC 1AQLA 4UXIA 3MIZA 5B2ZA 1CEEA 1RAAA 2YY6A 4G1VA 3D2LA 4M1OA 1U1DA 4TMZA 1XCPA 4ZHQB 1K5DA 5A7FA 1VE6A 2YIDA 4DJ5X 1YGPA 4V2IA 3TSWA 2RKWA 3EOAI 2Z5LA 4Y2TA 4ETIA 4L73A 5CNMA 4H6VA 1RJ9A 2A9JA 1HKUA 1PGNA 1GQRA 1R4NB 3OFVA 3LQ2A 4G5SA 3IHWA 2B8WA 2XXJA 3C4JA 3VSEA 1HWYA 3I0ZA 5B1HA 2H08A 4INJA 3SE7A 4EKEA 1X8XA 5EMMA 5GM2A 1YR9A 3L41A 2R4QA 5DBHX 3EXHB 1GA1A 3ZEAA 1F12A 5E1DA 2I4TA 2DUUA 4S0XA 2F9LA 3OOSA 3W1VA 5ADHA 2ZKIA 4CL8A 3A25A 3QI2A 2WWTA 3QY9A 5AESA 2AZMA 1TK2A 1MOQA 2EX1A 3AFGA 2J0UB 3IQWA 5LLDA 3UAZA 2MYNA 4HGNA 1QQ7A 4IXDA 2C3UA 3N0VA 4Z8XA 3I52A 5CFPA 3NAMA 1RAIA 4TKMA 5CEFA 3CISA 4AX8A 3ZY4A 1Z4KA 1S01A 2N75A 3E9NA 3O26A 4N0PA 1JLRA 1ZY2A 4LJ9A 4BKOA 2X2PA 2JI4A 3LHKA 3SDBA 3VR0A