2X19A

Crystal structure of importin13 - rangtp complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
172
structure length
172
Chain Sequence
GEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGLEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear Import Mechanism of the Ejc Component Mago- Y14 Revealed by Structural Studies of Importin 13.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Nuclear transport
molecule keywords GTP-BINDING NUCLEAR PROTEIN GSP1/CNR1
total genus 45
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2009-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2x19A00
1KSGA 4PAMA 2GK7A 1E2QA 2ZR9A 2CCJA 2R6DA 2VHJA 4MRRA 2P5SA 1G3RA 4QM7A 4KI0A 2H17A 3VHLB 1T0HB 3HPRA 4YMWA 1Z6YA 4B6FA 4LPSA 2WJGA 3VFDA 1AQUA 4JLMA 2VQSA 3RC8A 1AGRA 1G8GA 1RZ3A 4WXPA 1XEXB 1ZCBA 2C9OA 2YINC 4QGHA 3RS0A 3LVRE 3VNVA 5SZIA 4M0LA 2IUSA 1OXVA 1E98A 4BRUA 2FPKA 3TQCA 5JRZA 3LY5A 4KODA 1OB2A 4GRAA 5BXQC 3PQCA 2G6BA 1A1VA 2GTPA 3QNUA 4BFSA 3TVTA 4MRVA 1G8YA 2IYXA 5JWRA 3P26A 1W7AA 2IC5A 2MMCA 3O8DA 2BCJQ 3BK7A 3DZDA 4DSOA 3B2EA 3RS5A 4I1OA 3GJ4A 3SI7A 1D9ZA 3IEVA 3EARA 2D4HA 3Q3JB 4JKYA 3MAAC 1BIFA 2R6GA 4KXFB 1PVOA 3CX6A 4QGFA 1E6CA 4HZUB 4MRNA 3NDPA 3N2EA 2XXAB 3IUYA 2QY9A 1VCOA 2EYQA 4TL6A 4DUGD 2RGCA 1AS3A 3BC1A 3P1JA 2G0NA 1TPZA 4P4SB 2WMOB 2H18A 2XXAA 1JXMA 4GSYA 4HB4A 2AL7A 1G6HA 4L9SA 4TWZA 4W9MC 5EXTA 2YHSA 4OHWA 3E70C 3T34A 3ADBA 1TADA 2ODNA 5KYKA 1EWRA 1XTQA 1NKTA 1NVXQ 2D74A 3MLEA 3SFVA 3VKWA 4ZCLA 3K70B 2Q3HA 2Q0HA 2E9SA 1CTQA 3IGFA 2UKDA 4G5SA 3EZ9A 121PA 2G1KA 2P6NA 2R6FA 4DLWA 1NLYA 4D4JA 1I4TD 4PXAA 4LX0A 4PZLA 5FOTA 1OHHD 5JSZA 3KXKA 3U3RA 2AFHE 1S9DA 3KKMA 1I4DD 3FWYA 4TZ0A 4A0HA 1N6OA 5F3WB 2ZSAA 4KFRA 2DFKB 1YR7A 2VHTA 5DI9A 3RC3A 1F60A 1OHHA 2K5UA 3IILA 1S1CA 3W3AA 1UBCA 3HYRA 3RAPR 2O8FA 1S8FA 4Q1DA 1G3IA 4AYTA 1KSFX 2FZLA 4O2LA 5FL7A 5DN6D 1TEVA 2PT7A 2C77A 2BJWA 1U2RA 1RC8A 2VH5R 2ZQ5A 2HLDA 4B73A 3TJZA 2BKUA 3U2QA 3VU9B 3CR7A 1P6XA 3KDSE 1M74A 2IYTA 1ZD1A 4Y0VA 4QBHA 4PQRA 5CM8B 1RYHA 5JFGA 4MYHA 4HDCA 1AA9A 1BYUA 1CR4A 2ANBA 2WKRA 2O5VA 1XTRA 3BOSA 5FOVA 4C2TA 4XVRA 2G1JA 1FX0A 4Q1CA 1WB9A 521PA 1RRCA 1HTWA 1KI2A 2RHDA 1KK3A 1DAEA 3TRFA 3U4QA 4TQAA 2DY1A 1DO0A 4V0OA 4QHTA 2C9CA 4OHYA 1SZPA 4D4MA 4DDTA 1NY6A 3CRMA 1E0KA 2FSIA 2I1QA 2ZAOA 4D80A 3JVUA 2VP0A 5IF9A 3E2IA 4KHZA 2F3RA 1E4YA 2ZRJA 1QHHA 5M04A 1EX6A 4HEJA 3THWB 1FMLA 2VTKA 1FQJA 3NEJA 1MO5A 3C4JA 3C5HA 1CKEA 1I4LD 3GJXC 4HAUA 5HZKA 1Q22A 2C03A 5L3SA 5JRJA 4MUAA 4HAXA 1GRRA 4TQUS 5G3ZA 5HE8A 3NTUA 4HAZA 1M7GA 3M0EA 2GVZC 2QE7D 3SYNA 4TLDA 2D2FA 2H16A 1JJ7A 1R0WA 4TL7A 4CEHA 1Z22A 2ZITA 4EPXA 4E09A 1N6NA 2ECKA 2Q9CA 4KJZA 3A4MA 1OLOA 1G8FA 2AD1A 1XTSA 3ZZ0A 1LF5A 1N5KA 3IIKA 4PPFA 4C0SA 2O0HA 4LBWA 5E4FA 4ZDWA 3WBJA 1LVGA 4B2LA 1ZRHA 5L3RA 4NYMR 1W36D 1T8TA 1G291 3QSYA 1OT3A 2LKDA 1F2TA 1S4QA 2C2HA 3ZIAA 3UIEA 2YNMA 4G1UC 2O8BA 4O3MA 1WA5A 2DWOA 4DWJA 4IW3B 2VYFA 3UXMA 2OXRA 3K0FB 2NO1A 2RH5A 2DCUA 4GBMA 2BEKA 3KQKA 2ZJAA 2DR3A 3N70A 3TUIC 2WJVA 2AXPA 3B1ZA 3D6TB 4BQSA 3VNUA 4K8OA 1GSIA 4QKQA 5CDFA 1W44A 3CNOA 1MABB 1NVVR 3Q7QA 5JECA 1XD2B 3QUSA 1SVWA 1SKQA 1YU9A 3DZ8A 3ZVLA 4DCNA 3B1XA 3DDCA 1X3SA 5GVRA 5JZVA 2MSEB 2XJ4A 2YC4C 3RDPA 4PSAA 1G7SA 3CM0A 5E7IA 4F38A 5IHPA 1A4RA 4B44A 1L7VC 4QHYA 2GEVA 4DEXA 2D06A 2QTFA 1IN8A 4OJQA 3OEHD 1JNYA 3O47A 1E9EA 3SHWA 5A0FA 2OSBA 3I62A 2ZYVX 2X2FA 1TQDA 3EW9A 1YZUA 4XWAA 4WBSA 1A2BA 2QORA 3PR1A 2B8TA 4Q48A 2JLUA 3DL0A 2XTMA 1TF5A 2BMDA 3M6AA 2OM2A 4RCYA 4MQBA 1SVOA 821PA 4RZ3A 4KFUA 1R6BX 1XZPA 3QF7A 1F2UA 1GP2A 4O2RA 3BH7A 5C46F 4ITRC 3B13B 3TNFA 2FFHA 3NC1C 4C4PA 1OSNA 4GZLA 2O8CA 1S9HA 1U9IA 3ZLJA 1W1WA 4EPTA 2AHOA 1KIMA 2F1IA 2GVDC 1PJRA 2WPDA 3EIQA 3FFBA 3IQWA 4Q4JB 4DSUA 3GP8A 2WWFA 3M1IA 1ZC3A 1O3YA 4GDFA 1CXZA 2WVJA 1NG1A 3LW7A 5BN4A 3TUZC 2Q3MA 4JBXA 1W0JD 2ZS7A 2NPFA 2FU5C 2RGXA 2EFHB 2REOA 2OBLA 4JLDA 2GJSA 4TSFA 3WNCA 3U60B 4C2UA 2GETA 2XNSA 1LNZA 2J0QA 3MWKA 1LV7A 2P67A 4IEEA 5AJXA 2FDCA 4BFUA 1GL6A 2AD5A 2WPDD 3U6BA 1JAIA 2WWXA 1COWA 1GKYA 1PUJA 1U0JA 2J87A 4QBFA 4C0HA 1US8B 4MGIR 5JHHB 1QZXA 3GQBA 5AUPB 3PUWA 4MKIA 1AN0A 3K1JA 2HXYA 1FZQA 4MITA 2Q3FA 2IUUA 3PEVA 4XTRA 1GVNB 3E5HA 2WWHA 3IEUA 4PO8A 4Q02A 1J8MF 3FMPB 4BFXA 2VP4A 1GNRA 3DOFA 3B60A 2Y8EA 5D3MB 3A37A 2QBYA 1JI0A 4HAWA 3LD9A 5TY0A 3CF2A 2OT3B 4LBVA 3QENA 2QAGA 4GMXA 3WHLA 2ZUCA 3RANA 2OBNA 2MSCB 5CM9C 3FHTA 1W2HA 1DAMA 421PA 4U00A 2CNWD 2RGDA 2QM7A 3GLFA 1GNQA 1XEXA 1N0VC 4C0LA 1KO5A 1T5IA 1F3OA 2BMFA 1T6NA 4LK2A 1JPJA 4BFTA 1OXUA 4KBGA 3LNCA 4AK9A 2J5XA 2CVFA 1IQPA 3S1AB 4NU0A 2BM1A 1G8HA 1FTSA 2V4ZA 2O8EB 1Q44A 2IYQA 4RD3A 5KOYA 2CDNA 1U94A 4D2IA 1Q21A 4TMZA 3MWLA 4R2HA 5AR1A 1P9NA 4A0RA 2CK3D 3HDTA 3PITA 5CB8A 5HR5A 2QP4A 1HA3A 2ZJ8A 4JIMA 5D3QA 4DIEA 3ZYCA 2XITA 4UNPA 1G6OA 5KDDA 5FBQB 2OAQ1 2V1UA 4P31A 2WWGA 1IXRC 1OXXK 1CLUA 4DT1B 1FP7A 4M1YA 4LY6A 3OE7A 2TMKA 1YR8A 4LHYA 3QPWA 4JMPA 3THOA 3KFXA 2X77A 3LLUA 3FKQA 4JVNA 3H4MA 4Z1MA 2NO6A 3EG5A 3L0SA 1KSHA 2GJKA 3R8CA 1CU1A 3R7WB 1Z0JA 4B48A 1U99A 3BIFA 4HAYA 2HYIC 2PJRA 4PSKA 4DLUA 1W49A 4NPHA 4YXWA 1E9BA 4CYMA 3BFXA 3E1SA 2IXGA 1JR3E 1IN4A 1Y63A 4C7OA 1KYIA 3QJYA 2A5JA 2W6IA 4GOXA 4GI7A 3BFVA 4PHTA 5EE5B 2VO1A 1CR2A 1U90A 3QF4B 2YVUA 4C7OB 2JDID 2CCGA 4JZKA 4JLVA 3LXRA 4ZKEA 3PENA 4DHEA 1CJUC 3QPVA 4PTLA 5DI3B 2ZE5A 1VIAA 1E3MA 1AM4D 3NXSA 4M21A 1NIPA 4HLQB 4B3XA 2XB4A 3ZD6A 2FPLA 1T9HA 3PUXA 1W4AA 1VCIA 1UBFA 3KJGA 5KSPA 3W8NA 1EG7A 1W47A 4DDWA 3D3QA 1E96A 1YR6A 1NMZA 2EVWX 2GA8A 3VAAA 3C16C 4EFMA 4A0GA 1KK1A 3NBXX 4MGKR 4PC7A 5B2ZA 1BO6A 4QL3A 5H8WA 5FL7D 2FPMA 3TLXA 2VRWA 4M22A 2W2TA 1C1YA 1G17A 1OJLA 4N0DA 1W36C 4HDQB 2HXSA 4LI0A 3SYKA 2BC9A 1IM2A 2HJVA 1CS4C 2ZI6A 3NWJA 4II7A 5J4HA 1WBDA 2ZSFA 3VR5A 3GFTA 2FOLA 4QBGB 5BYKA 2QMEA 2HJGA 4ZPXA 5DNYB 1MO4A 3V00A 5IK2A 3K8YA 1E2KA 2QI9C 2JJ2A 2REBA 2GRJA 3RSLA 2EFCB 1E9CA 2QE7A 2ERXA 4AG5A 2ZTSA 3CRRA 4IXNA 3OZXA 1W48A 2OFOA 1EFHA 4QJ3A 4RSGA 1Z2CA 3L0PA 1OFTA 5J4VA 1KDPA 1TL7C 4KFTA 2NMVA 2NO7A 4ASUA 4ARZB 4TL9A 3RHFA 3T1OA 1P72A 1QHGA 1DG3A 2PMKA 1JEEA 3OHMA 3B8HA 4Q4AA 1NBMA 4CEIB 1NIJA 3W5IA 2WOOA 4AKGA 2J0UA 3FTQA 2EYUA 1Q3HA 4ZDKA 1GRQA 1VYVA 4EKDA 5HZHA 2GJ9A 4RFSB 2WSSD 4DDVA 4WW0A 4PFSA 2YOHA 2IYLD 2G0TA 2QMHA 2ZUBA 1HY3A 2ZRDA 3LQQA 4PPQA 4R9UC 1SXJA 1NKSA 1CJMA 4M4SA 5KPJA 2ZI7A 3M4YA 3EASA 3CRQA 3ZS9A 5TV2A 5TVKA 1G7RA 3AGPA 2F7SA 1SGWA 1DS6A 2H5EA 2WAXA 2VSXA 5FPTA 1E2FA 2QENA 1OYYA 5J47A 2HUPA 1G3QA 1KO7A 2A5GA 2ZS8A 2PZEA 4Q7JB 1UFQA 2X19A 2BV3A 1N6KA 2PX0A 3SS8A 1OKKD 3EPJA 4ZCIA 4EPVA 1DARA 1PLKA 2QTVB 1XPRA 3T12A 4LJ9A 2ZJBA 1U98A 2R2AA 4E22A 4UKDA 3LW8A 1VDZA 4URZR 4O0MA 1WP9A 2ATXA 4XD7A 3W34A 1XEWY 3I5YA 1ZNYA 1WBBA 2OFXA 2JASA 2BOVA 4JLPA 3BGWA 1KNQA 1T3LA 1WQ1R 2IYRA 3UATA 1E0JA 2GAAA 2WJJA 1G64A 1JR3D 5DI3A 1WCV1 4DZZA 1IXZA 2IYUA 3DPUA 3AKDA 3Q85A 3QY0A 4GOJA 3PEWA 2FGJA 2IF0A 5G3YA 1N6IA 5JWHA 1KNXA 1P5ZB 2C98A 4FINA 1FFHA 3GEIA 2OFWA 5KTYA 1JALA 1IHUA 2EW1A 3UK6A 3AUYA 4RD1A 5FR1A 2YC2C 1E2GA 1F5NA 2Z4RA 1A7JA 2ZVQX 1OYWA 2R6AA 4LV5B 2CBZA 4MKGA 5FBRB 3R20A 3ZD7A 3Q5DA 2LKCA 1MT0A 1HQYE 3LQRA 1RJ9A 4HAVA 1GDDA 1E2IA 5B58C 4JVSB 4FI3C 3X1YA 3B1YA 1TEXA 1Q1BA 3B78A 4LYAA 2HT1A 3X1ZA 3SJBA 3ZH9B 4OL0A 2IK8A 4WVFA 3FB4A 1EX7A 3MGCA 1S3SA 4PO1A 3KB1A 1VTKA 4BZQA 3TGPA 2QPAA 4TLCA 1UF9A 4MYTA 3LO5A 4V0NA 1XB2A 1G5TA 2EWVA 1LW7A 4LJ6A 1ZNZA 3TBKA 1AZTA 4L8GA 1E99A 1WDTA 3NDBB 4Z8YA 2ZR0A 4ZCMA 5EP3A 4JYBA 2FEMA 3W6NA 1CRQA 4MKHA 4D82A 3VR3A 3HJNA 3EC1A 2WWWA 1G18A 4P4UA 3T15A 5AUQA 3CWZA 3QQ5A 4NCKA 2G83A 4LCBA 4CT4B 5JJIA 4B76A 1KDRA 1J8YF 2ZRHA 5LD2B 1R7RA 1XMIA 2C95A 1KI6A 2F1RA 5SZJA 3SJZA 3DEFA 2FSHA 4I81A 2QAJA 3P27A 1P62B 4Q7MB 1VG8A 5CYOA 4DUGA 2CE2X 5HTKA 4B33A 1KI4A 1XTIA 2CMKA 1YR9A 1P73A 2GCOB 5HE9A 1VCNA 5DISB 4UJ3A 3GLIE 2DHRA 4UXHA 3RS3A 4PC1A 4MDEA 1ZCAA 4URUR 3TE6A 4TT3A 1IJFA 2ZROA 1UBEA 4LJ7A 3SHFA 3X1WA 3LVQE 4M8NE 4OQMA 3W3ZB 3VU9A 1H8HD 4LHZA 1E2LA 3K09A 3WMFA 4N0EA 1OXSC 4KYIB 2E87A 1XFAA 2FMXA 1M2OB 1C9KA 1NJGA 2OCPA 3WYAA 3FPAA 2J3EA 2PMDA 3KJHA 1W0KA 3QEOA 1FUUA 4NHOA 3TUJC 4Z8XA 4PC6A 1QHYA 4Q1EA 3LLMA 4Q4HA 4CW7A 4DRZA 3U7FB 4US2R 2ANCA 2JCSA 2QL6A 2FF7A 3VR6A 1XCGB 5JSZB 2VHQA 1WXQA 1FP6A 1G8PA 4PR0A 4WOPA 1W0JA 2ATVA 2R8RA 2NZ8A 5C4GB 4ZV4A 2W58A 2ZI5A 4H9GA 2FFAA 4F92B 5ELXA 4OKSA 3BB3A 5GJWC 1MRNA 1JB1A 1P2VA 1Z6TA 4FCTA 1ZIPA 4ESVA 1SKYE 2CEAA 3WRYC 3FOZA 3TR0A 4RD6A 3KKPA 3WYFA 1EESA 4CEHB 2O0KA 4BZPA 5KSOA 5JHGB 2XNDD 3GLIB 3MJRA 4HSEA 1T3HA 2ZRLA 1JXOA 2WSSA 1KY2A 2GZDA 1U9IC 4MYCA 2R65A 4FMDF 4PC2A 4IEIA 4LPKA 3CLVA 3DM5A 3T1QA 2ZAMA 2WTUA 3A4LA 3C7KA 3O8RA 1OFUX 1KJZA 4JL6A 4EFLA 3GD7A 2QZ4A 4JLJA 1WF3A 1KMHA 4B43A 1BOFA 2IS4A 1S0UA 3ADDA 2GILA 3MFYA 1BKDR 1P9RA 5TMPA 2YWEA 2J9RA 3D31A 1XMSA 2H92A 4QNRA 5FBLB 4URVR 2J41A 3KTAA 2IEZA 3ND9A 3LBIA 1UEJA 1ZM7A 3AKEA 1MRSA 1DAKA 1I2DA 1QHIA 4XWKA 4B2PA 3PIRA 4KCGA 3SN6A 4F4CA 3QKSB 3SR0A 1RJ9B 4G5OA 1VPLA 2REXB 3DKVA 3B1WA 4IVQA 2JLYA 1CJTC 3GLGB 3VMFA 1VG9B 1M34E 2QMOA 5SZKB 4AY2A 2W6JD 4C0JA 1E0SA 1SVIA 4IFBA 5EXPA 4K81B 1SXJD 3CNLA 2C5LA 4CRWB 1RRPA 1G21E 4AURA 1JQLB 3H2YA 2OILA 4GL2A 4FIDA 2IL1A 4ACAA 4WZ6A 1HYQA 5JI3E 4AIIA 1GL9B 2BJVA 2J7PA 5FUVA 4V0LA 1DADA 1KI7A 1Z8FA 4ACBA 2WOJA 2XSZD 4XJXA 5LD2C 2QRZA 2VHUA 2JLVA 3KXLA 3AM1A 621PA 1E1QA 5L3QB 3KUCA 1HT1E 5TXGA 3U44A 4FCVA 4KFSA 1ETUA 1TF2A 2BM0A 3AVTA 2XNDA 1VECA 4Q9JA 3W5JA 4FWTA 1G20E 2WHXA 3P4YA 1CF4A 2DPXA 2ZU6A 3B82A 1XCMA 4A82A 4URYR 2ZRKA 4U5XA 4DDUA 4BLTA 1NG9A 3NVAA 1K5GA 4BECA 1TX4B 2CLDX 3RRNA 1E1RA 4WZBE 4PSVA 2C99A 3LBNA 4Q1AA 4CEJB 4G5GA 1YJ5A 3TW8B 2J0SA 1V43A 2FSFA 4AYXA 5KSZA 1IBRA 3UMSA 3AF2A 4M9SA 5B64A 2ZRCA 2A30A 2WBLC 2ZJOA 2J1LA 3KX2A 4OK3A 1ZAKA 4BEBA 1Q57A 1OE0A 1RFLA 4JT4A 3PG5A 2D7CA 5EXXA 5FBVB 2G3YA 1EFRD 3A36A 2GK6A 3C5CA 4EQ6B 4MYUA 1QG4A 3GJ5A 4DKXA 1XNJA 5J4LA 2Z0MA 4M9XA 1TF7A 1D2NA 3OIUA 4P32A 3L2OB 3UMRA 1YE8A 3GCGA 5CIQA 1XZQA 1KGDA 3EZ7A 1SHZA 3LDAA 4F91B 1QDEA 3FFAA 3GEEA 1LB1B 1QRAA 5FTJA 4DLXA 1XD8A 2ZIAA 3SZRA 1Z29A 1OIWA 5DYGA 3AF3A 2KWIA 1QHXA 3DM9B 3RSOA 2A2ZA 1ZBDA 2UVQA 4B3CA 3R9WA 1GAJA 3BFKA 4EJSC 1W36B 5F9HA 4NYJQ 1GWNA 1RIFA 2BBWA 1GUAA 2YV5A 3KQUA 3TQFA 1CJVC 2V3CC 2QGZA 3EPLA 3ICQB 3ZZTA 2XZOA 1VKJA 1ZU5A 2VP2A 4TL8A 2IBMA 3NBFA 4Q1BA 1XP8A 3QPUA 4D4LA 1F2TB 4FMCB 4HB0A 1UKYA 4F4IA 3VX3A 4YMVA 2NPIA 3FHOA 5CITA 3QBVA 1DBSA 5DSZA 1IXSB 1UPTA 4KYUA 1P2SA 2CXXA 3K0CA 5B57C 3AP3A 3W9YA 3QG5A 2NTYC 3CKLA 2HDNB 3DO6A 4PPGA 3B6EA 3BXZA 1M8PA 3IBYA 2YWGA 3U5ZB 2MSDB 1IY2A 3CPJB 3LFUA 4ZDIA 3CUEF 1G7TA 1JPNA 2V54A 2IXFA 1P60A 3LH5A 4DLRA 1U0HC 5TDHA 1AS2A 3SQXA 3BD9A 1DTSA 5FPYA 4DB4A 2LCFA 2VHCA 1YZTA 5CLQA 3AVVA 5CLLA 1Z83A 2UZIR 2QQ0A 3NBZC 1WE2A 4OI1A 3O8BA 1DPFA 4AYWA 2NOAA 2O52A 2AKYA 4LJYA 5KPDA 3OAAD 2FNAA 3K0CC 4GP6A 4HB3A 4JL8A 1NVWQ 3TSOA 2CHVA 1R10A 2O8DA 1KK0A 2JDIA 2QA5A 3LRPA 4BUJA 3ZZUA 5AJYA 5H70A 4CF7A 1R8QA 1NN1A 4RZXA 3I73A 3SOPA 4DCSA 2AX4A 1KAOA 2IYZA 2RMKA 4IVPA 3IQXA 3ETLA 3GPLA 1Z0AA 2C04A 3Q72A 2MMGA 4FMCF 4XOIA 2PL3A 2Z4SA 1E79D 1S2MA 4GMDA 1JR6A 2GCNA 4WIAA 1AJEA 3JZAA 4W7SA 4JLOA 1DELA 3EC2A 4P4TA 4DLZA 2Z43A 4GNKA 4A36A 4L9WA 2OAP1 1Z08A 1E79A 3AUXA 3IIMA 4C0QC 3QBTA 1G41A 5G40A 4FD2A 2WIAA 3K0FA 5EE9A 6Q21A 4OQNA 4TMKA 2GESA 1V5WA 4N1AA 2OHFA 3TIFA 2FWRA 5FOUA 1N6PA 3IDQA 5KU1A 2W00A 1G7CA 1EFCA 1G3UA 4I99A 3VR1A 2GJ8A 2VPPA 2W0MA 3K9HA 2AK3A 1SHKA 4ZDJA 4U7DA 4KVGA 2RCNA 3QXCA 1QHNA 1LS6A 1Z6GA 3H1TA 4CVNA 3VKGA 2ZRBA 1N6HA 2JJ1A 3G82C 3QXJA 4RD2A 1Y3AA 2QT0A 2ZM5A 4CDGA 1ZNXA 3KQNA 2HT6A 2ZRGA 3HPQA 4Q21A 4J0QA 1H8HA 4MRPA 4DEYA 4ESHA 3ZS8A 3HYTA 3GLGA 4LGMA 2VBCA 1II9A 2KBEA 1XMJA 4HYYA 3NHAA 2B6HA 4URXR 4TT3D 2W6ID 4BGDA 1G4AE 2EWWA 2VL7A 2CCKA 2IHBA 2YWHA 4M1SA 1II8B 3BAFA 3D8BA 3WXMA 1GFIA 3OF5A 2AWNA 4IFEA 1KOFA 1NVUQ 3CB4A 1DEKA 2WV9A 3L8YA 3MG9A 2RGGA 5JEEA 3PEYA 4DXAA 4LJ8A 1Q1ZA 2B7BA 5LB4A 4ZKDA 1II8A 1TTTA 3I4LA 5L3VA 3EA5A 5EP4A 5BQ5A 3KJEA 3THYA 1TQ2A 2OUKA 1VCMA 1RYFA 3BERA 3EZFA 4M1TA 4DJTA 1F48A 1R5BA 4F4JA 3R9XA 1CULC 2CL7X 5A4JA 3AVUA 2CVHA 4TMTA 1TQ6A 2WICA 5E3HA 4EIWA 2XOKD 1ESMA 1M1YE 4JL5A 2FZ4A 5KO2A 4X8LA 5TB5A 3MJHA 3U44B 2FFQA 3WYGA 4CEIA 5LBIA 1Z06A 1K6MA 4M1OA 2ZR7A 2YYZA 4RFVA 2ZI9A 3EIHA 2XEXA 5UKDA 1ZU4A 2CJWA 3QVVA 2WZQA 5IDVA 1U8AA 1GITA 4QXAA 2ZSEA 1A82A 1JAHA 1L2TA 2A5YB 2BBTA 1LTQA 4R98A 4JKIA 3PV0A 4JT2A 5DO9A 4LC1A 2V6IA 2GF0A 4HLCA 1NSFA 1CJKC 3NC0C 2XSZA 4QC2A 5C4MA 3VKHA 5IK2D 4QM6A 4WA7A 3U3MA 3KQHA 5DLQC 1YZGA 5EE0A 1KKLA 1QHSA 3PUVA 3F8TA 1J70A 4PHGA 1W4CA 4U02A 4A0FA 1UKZA 2RGNC 4OQXA 1XX6A 5C2JB 3NH6A 1NJFA 3GEHA 5EJEA 1FNNA 1HT2E 4RKEA 2DYKA 3W6OA 1E0AA 1M6NA 4B2IA 1SXJE 1ZMXA 2G88A 2JLSA 2OE2A 4XSHA 1B23P 4JJZA 3KKOA 1P4SA 4D26A 4O25A 5AK0A 4KITB 1ZUNB 1R4AA 3MMPA 1KZ7B 5L3SB 3B85A 3NH9A 4FCWA 3THXA 2F9MA 1HV8A 4KLNA 5FOXA 1E32A 1UBGA 2IYWA 4ZI2A 3AP1A 3VR4A 1XU4A 5KSYA 2XJ9A 4IVRA 1E2JA 1YRAA 3U3OA 1XDBA 4ZO4A 1NN3A 2YOFA 2VSFA 1E4VA 5BYJA 4ZIRA 2QUZA 1OIVA 3DVLA 2IXEA 1KO4A 3SFZA 2QEQA 4Q4JA 3PUZA 1ODFA 1UAAA 1AKEA 1LS1A 1XTKA 3U7EB 1E2MA 4M2LA 4MRSA 3FMOB 2ORVA 1SXJC 2GXUA 4JSYA 1R0XA 2WIBA 4Q7LA 4PPNA 4QRHA 2VLIA 3K53A 2WM9B 4URWR 2FEOA 1OFIA 4QHSA 2BBSA 2X8AA 1VG0B 2FG5A 2ERYA 2GJAA 1L4UA 4LHXA 2P3SA 3AF4A 2QBYB 4LRWA 1WRBA 1FW6A 4YMUA 2I1VB 4CIDA 1Z5ZA 1US8A 2VA8A 4DB2A 4EPYA 5GJVC 4DCUA 4G5RA 2A9KA 1QVAA 1ZYUA 4EDHA 2JIZA 2JAQA 1KZGB 2ZSBA 4Q1FA 1J90A 4EAQA 1G1MA 5DN6A 4FW9A 1YZNA 2V9PA 4EUNA 2PCJA 1JQJC 1C4OA 2HF8A 1OW3B 4NCJA 3SEAA 4B74A 4TZ6A 3OAAA 2BEJA 5DHAA 5EP2A 1YKSA 2W2XA 2ZI4A 2BCGY 2DBYA 2CHGA 2N46A 3FMFA 3LBHA 5E7JA 2WAYA 4OQLA 5LPNA 4NE2A 5JLJA 4Q7KA 1P9WA 1EWQA 3SE0A 1IY0A 4MKFA 4TQ9A 3IPXA 1CR1A 5J40A 2HV8A 1DAFA 1H8ED 2GCOA 2ZANA 4OK5A 2WJHA 3QXSA 1FL9A 4AWXA 1KI6B 4Q9HA 4LOAA 1E9DA 2P6RA 4D81A 3RRYA 5EQTA 1J7KA 2AN9A 4DLVA 1GTVA 4ON9A 4D4KA 1P2TA 3SYLA 4MH0R 3RWMB 2F6RA 3AB3A 4DIDA 2WMNB 3UWKA 1XJQA 5F98A 3TAUA 1XXHA 3RYTC 4S2EA 1ANKA 1MOZA 1N6LA 1S1MA 4NTZA 1AZSC 4KSCA 1ZIOA 2B8WA 1X8KA 2UZ3A 4A8JB 2P6UA 3BRWD 1GG2A 4XWOA 5JMTA 1N6RA 1XXHB 3ZVRA 1E94E 1GM5A 1E9SA 3VHXA 3BH6A 4BFYA 2ZUDA 1SULA 3CF0A 1RRGA 2FSGA 1KJWA 4BFZA 3ZGXA 3CWQA 3UWOA 3OIYA 5BW8A 3H0KA 4US0R 3CX8A 1FUKA 5JI2E 1VYUA 4Z1MD 4DSTA 3L0OA 3TAHA 5FTMA 1GKIA 3THXB 4L15A 3A58B 3CX7A 2F3TA 1RW4A 3CRVA 2WWIA 2Z83A 3QG1A 2N1BA 2BMJA 2KE5A 3MCAA 4IOLA 4KBFA 2HYDA 1XPOA 2NQ2C 2ZE8A 1N0WA 3CIOA 4LC0A 3JZMA 2RKOA 2GBLC 1KI1A 3LX8A 2RGNA 1COWD 4DC9A 4IJMA 4IDNA 1IONA 3UG6A 3THYB 2VIIA 3CO5A 3LWNA 3LV8A 3REFA 1N5LA 4QNMA 5HCIA 2R6CA 1LY1A 2QP9X 2Z5FA 5CK4A 3T35A 1OFHA 1PUIA 1EXMA 1XJCA 3A4NA 1X1RA 2IYYA 4KU4A 4TSFD 3I8XA 1W2GA 4PX9A 3A1VA 2A78A 1HH4A 3I3SR 1Z6XA 4HATA 4MGZR 4M1MA 4YONB 3RWOA 3OFNA 1TMKA 2V55B 1OH5A 4HZIA 1QG2A 2ZRMA 2HLDD 2NG1A 4P33A 3FKSD 4HDOB 2ZPTX 4M1WA 1XCPA 3WMGA 4OBEA 4RCZA 3QE0A 2X2EA 4NBSA 4C3ZA 5K8IA 2NGRA 3TSZA 3EXAA 3I32A 1OB5A 1QVRA 5C18A 5AUOB 4GP7A 2D62A 5JWOA 5EUMA 3AH8A 1I2MA 4LZZA 3ZDQA 4QJ5A 1ESNA 2QPTA 4XD7D 4LYJA 1ZVQA 3K0AB 1G3MA 1ONBA 4WXRA 5CIWA 4QG7A 4EQ6A 4AC9A 1KHTA 3EAQA 3SU8A 1DOAA 2ZRPA 2GCPA 4PZZA 2QAGC 2H8KA 1P7CA 2QMUA 2YWFA 1Z2AA 4RD0A 4LYHA 1KKMA 1PV4A 1Z0KA 5D3MA 3KFVA 1A2KC 4G01B 3FDIA 4WAUA 3X1DA 2IUTA 3FHCB 4Q18A 1IOZA 1EK0A 3KZ1E 1J99A 2A5FA 2J7PD 1VHTA 4JLBA 4Q66C 1LF0A 3TH5A 2OLKA 4FMDB 1AKYA 2ZEJA 4ARZA 2D3WA 3QKTA 4HZUA 4W5HA 3C41J 2DB3A 2JLXA 3AKCA 5JJLA 2C96A 1UJ2A 2GZAA 4TMWA 1OH8A 2FX3A 1RRFA 2J0UB 2D7DA 2A7QA 4I1SA 4IDOA 3N5CA 1IJEA 1NN5A 1X6VA 1Z63A 2KSQA 3DKPA 4JYCA 3EZ2A 2V6JA 2FFBA 4B3BA 3B5JA 3AVOA 1ZM2A 4JBYA 4M9ZA 2QQEA 5EE3A 4KSBA 4Q00A 3T5DA 4V0ME 1E9AA 2HCBA 3MSXA 2WJIA 3OESA 4RZ2A 1YZLA 3AGQA 2Z6VA 4HUQB 4AG6A 4YDSA 2F1HA 3EIEA 1E2HA 4DLTA 4MA4A 3VR2A 3AKYA 4PAOA 2Q21A 3CR8A 3LAWA 3SQWA 4FMBB 5FI1B 3PEUA 5LDDC 2KB0A 2JJ1D 3U3KA 4TLAA 1N2CE 2L0XA 1Z0DA 3QI2A 4C0AC 4Q19A 2OBMA 1T0JB 1NSTA 3QXHA 4TYYA 1NN0A 2QP3A 2O8DB 2ZE6A 4RZUA 5EXSA 3IHWA 3K0SA 3C8UA 5KHOC 5H68A 2DFLA 1Z0FA 3LA6A 1QF9A 2AK2A 3A1UA 3RS2A 4PANA 5KNDA 2B92A 3AVYA 3WNBA 1XJ0A 3EZ6A 3TVDA 4PQYA 4CZ2A 1XD9A 5FFMA 2ORWA 5HKKA 1D2EA 3ECCA 1XEWX 4Q5IA 4A6PA 3WHKA 2WSMA 1JEDA 4LV6A 1OIXA 3MRSA 4M9QA 4XVQA 5G41A 2P65A 2IEYA 2IA5A 1NBME 1NRJB 5FUWA 2NO9A 4L5BA 1Z3IX 4HB2A 4NYIQ 3RRZA 2C78A 1KMHB 4FXPA 2PZGA 3NIBA 5HKKD 4D0NA 1OXTA 2ZRIA 4KO8A 5FH9A 2RGEA 2JLZA 2N42A 3ND8A 1Z0IA 5GJBA 3BWDD 1BYIA 4M53A 1P2UA 2V7QD 3PXGA 1MABA 1KI9A 3GJ6A 4Q03A 3JVVA 4E03A 4ASUD 1D5CA 1YHNA 3A1WA 1K8RA 4R2IA 1X86B 1FTNA 3ZJYA 5AWFC 3HP1A 3IO3A 5FOWA 4D0LB 3AVPA 3WP0A 1N5JA 1W0KD 1ZD9A 4NYJR 2VF8A 3EWAA 4NL4H 5DGXA 2ZXUA 1PZNA 2GAOA 3GLGE 3ICEA 4GPTA 5JS8A 4UJ5A 3AV0B 4LYFA 1G9XA 3CZPA 2ORIA 5BN3A 2JJ2D 2ZJ2A 2BVNA 3X2SA 3AVXA 2IS1A 2ZRFA 1GRNA 3QKSA 3T06B 721PA 5SZHB 5FTKA 1FPMA 1NY5A 3GJ0A 2BWJA 1Q1QA 2BKEA 4I1UA 4WZAE 3SDZA 4POAA 3SC3A 2XZPA 1XTJA 5FUXA 2ZYWX 1BH2A 2GF9A 1SQ5A 2VP5A 4TTQA 4R71A 4QGAA 1IN6A 3B9QA 3FGNA 5AJZA 1F2UB 3VX4A 1R0ZA 3SNHA 5FI0B 3L43A 4AD8A 3GLIA 1E69A 1A5TA 2BBOA 2QRNA 3EPHA 2XOKA 4W5WA 4DCVA 2AFIE 5GJCA 3MWYW 5JCPA 2ZI3A 3OFND 1RE0A 2ASEA 5DE3A 2XB2A 4OI4A 3CRW1 3F0TA 2Q9BA 1HQCA 4YQFA 3V4RA 3W6PA 1EFUA 1VYTA 1GNPA 4HLUA 1XMVA 3ZQJA 4F93B 4P0TA 3QXXA 3GLHB 4US1R 1E2DA 3HU1A 4NCNA 2O8EA 4UXIA 1PLLA 4NYMQ 5KNBA 5JEDA 5BN5A 2H1LA 1GL7A 5K8TA 5FBWB 2CK3A 3VTKA 3WNDA 2R9VA 4OI2A 5K8UA 3SBEA 1D6JA 1P75A 1DAIA 4Q9IA 1DO2A 4NYIR 4UXJA 4OQFA 2ZETA 4BRWA 3G5UA 3I1FA 1KAGA 2X1VA 1MO3A 1N0UA 4LUCA 3K70C 1YRBA 3BB4A 2BIFA 5CK5A 3CONA 4X8OA 2CNWA 2EU8A 1E2NA 2F55A 1ELOA 5J4YA 4JSTA 2OV2A 4NCIA 4B6EA 5A5GA 1GILA 4XVUA 3G0HA 5F9FA 1N3BA 2QTHA 2V8OA 4LJAA 4X8MA 1XF9A 3GLFE 3A6PC 4OK6A 2QGNA 4KLZA 2FV8A 4RJLA 4MGYR 2JA1A 3VQTA 4B75A 4GT1A 3QKUA 1NP6A 4LSGA 3T61A 3V4FA 3OEEA 2PH1A 4NDZA 2CLCX 1GIAA 3KJIA 3THWA 1XWIA 3BB1A 2IWHA 3GLHE 3CPEA 4P3YA 3EWSA 1OV4A 4QJ4A 4Q47A 5AUNB 1YZQA 1D8TA 1ZNWA 5IRCD 3QF4A 3U3JA 5J4KA 1T5LA 3DOEA 4DSNA 4AKIA 3F3YA 3TR5A 2XZLA 2ZU0C 2SHKA 1ZINA 5AJVB 1OH6A 2W0SA 2DWPA 4IDHA 2IX3A 3ZVMA 2QT1A 4BLPA 4EPWA 4PQFA 1NBMD 3SJCA 4TTPA 2GBLA 3RS7A 3OIVA 1FOEB 4XIGS 2IWRA 2XGJA 5F2EA 1ZJ6A 4B3FX 1DAGA 2H57A 4QFMA 4C9BA 4BLRA 4RKFA 4L4UA 5FPKA 2ODBA 4Q9LA 3UKDA 2GWHA 3DMDA 4UNNA 3IKJA 1KSJA 1FX0B 3O8CA 3H84A 4B32A 1KMQA 4YC7A 4IOMA 2JJ8A 1M7HA 4Q9KA 1MKYA 2J45A 4TYPA 5CB6A 5JCZA 1VG1A 4CT5A 3K9NA 4A6XA 2A5DA 2P2LA 2W6JA 2QN6A 8OHMA 2PEYA 4W5JA 4B35A 4QBIA 3REGA 3V9PA 4A8JC 2GHIA 3GJ8A 1QBKC 4LBZA 3A1TA 3WP1B 1KTVA 1W46A 2XTZA 2GNOA 4YDHB 1HUQA 3K09C 4TN1A 4JLNA 4QOSA 1VHLA 1DVRA 2RHMA 4LWZA 2ONKA 2W83A 5C1BA 3IPYA 4B3DA 1L4YA 3NBYC 2NZJA 2JLWA 4CGZA 4PC3A 2HF9A 1K5DA 1IY1A 2AXNA 2NO0A 2Q6TA 1G16A 2VP6A 3QEJA 4Z54A 4G0NA 1TUIA 4HLUC 3Q5EA 3TMKA 4BLSA 1RKBA 2JLQA 4S35A 5DHFA 1G5RA 4XH9B 2IT1A 4JLKA 3TK1A 2IS6A 3PUYA 1P3JA 2E1RA 2ODWA 2HEIA 3KKQA 4FN5A 3HR7A 4N3NA 2O8BB 4TLEA 4NZYA 2B7CA 3QKRA 2ZYTX 1G5PA 3KL4A 2OO7A 2ZJZA 1X8LA 2XTNA 3RABA 1HEIA 1YVDA 3CPHA 1DE0A 3Q8XB 4L16A 3RNLA 5CDFE 3L8ZA 4JVLA 4P4SA 2ONJA 2F43A 3BJIC 4LHVA 4LBYA 2LWIA 4OHVA 3GJ7A 4GOKA 3OEED 2AWOA 2V7QA 1KI3A 4DT1A 3H86A 3KTAB 4XTCS 4UNQA 2YZ2A 2EFEB 5JJKA 3I61A 3P4XA 3N2IA 2OESA 2GXAA 3HU2A 3CW2A 4PAQA 1UDXA 5FOSA 1EFRA 1KO8A 1JBKA 4TMVA 1TAGA 4A8JA 1CR0A 4A2PA 2F1JA 1CBUA 2KBFA 2V1XA 2OXCA 3L82B 2ZJYA 2IW3A 2RAPA 3I72A 2OCBA 4EFNA 3EPKA 4MDFA 4TYWA 3B1VA 2NIPA 1IN7A 1R5OA 5CYPA 2QPOA 3FMIA 1WMSA 3ADCA 1Z47A 5EE1A 1TU4A 2B21A 2CE7A 2QU8A 1R5NA 4IDQA 4JBWA 4A1FA 3U4QB 3BORA 1TU3A 3C15C 2OZEA 2XX3A 3DMNA 3IO5A 2C8VA 4BFWA 5JS7A 2ZVPX 1MH1A 1TUEA 3L0IB 4F7WA 2DFTA 1UDWA 2QAGB 4LV8B 1T91A 4C30A 2ZE7A 3UPUA 2PJZA 3W90A 3CF6R 3PFIA 2QNRA 1Z28A 1E9RA 4XSGA 4RFSA 4BPBA 2VF7A 2ZS9A 3GJ3A 3HR8A 1DAHA 2ZRNA 5DH9A 4UNRA 2PBRA 3QIAA 4JJKA 5E95A 5H1YA 2RGBA 2PCLA 3I5XA 1OF1A 5TARA 1S3GA 3ZQ6A 1CEEA 2H7VA 5EZ5A 3AVWA 4H1UA 1E1RD 3ASYA 3EX7C 3QKRB 1L8QA 4KVAA 3W8RA 3EA0A 2RGAA 4A2WA 2IHYA 1IAQA 2W2VA 3WBKA 1X8JA 4DVGA 1EGAA 1JJVA 2OG2A 4MUBA 3UG7A 4PHFA 2BHRA 3SBDA 4V03A 4LJ4A 4G3XA 4LHWA 2RB4A 3CNNA 2QM8A 2FA9A 1E2PA 2ZREA 3LXXA 2KJQA 4AKHA 4IHQA 4PHHA 3R7WA 1ZUIA 3X1XA 4C0KA 5EP1A 3A1SA 2YOGA 1SVKA 1AS0A 1RPZA 1CRPA 3K0AA 5CJ2A 4KV9A 4Q01A 2AKAB 3HU3A 3PVSA 2DWQA 3BS4A 3IIJA 4OHZA 1HURA 3SJAA 5FR2A 5FTNA 4AKEA 3J81k 2JATA 2GXQA 4GZMA 3GLFB 4V0MA 5FPHA 1M7BA 1BS1A 1R0YA 3IHLA 2J46A 3FYHA 1ZM9A 4NP6A 3HWSA 3WRXC 1H8EA 5GADl 3ZIAD 1TQ4A 3P20A 1P61B 4X8HA 5L3QA 3D7MA 5GVSA 2PX3A 1CP2A 5L8VA 4UQOA 3FE2A 2R62A 2PEZA 4B34A 1UEIA 4NONA 1NVVQ 3T1TA 2CL6X 3AQ4A 4C0BA 1UADA 2GEUA 2ZSDA 3F5FA 1ZP6A 1T3SA 4E5UA 3KUDA 4Z51A 4Q4AB 5KUTA 2EFGA 1VIYA 2WKPA 2FE4A 3U61B 2DFNA 2BMEA 4NCHA 2CJWB 3ASZA 1KK2A 2O8FB 1W5TA 5KDLA 2FJUA 4OYHA 4I1VA 1ZM3A 2GZHA 4OJKA 1JR3A 1MO6A 2QROA 3NKVA 4BZXA 2F9LA 4BE7B 2IF2A 4EPRA 1IN5A 4GFDA 5DYIA 4YMTA 1N5IA 2IS2A 2OCAA 1NL3A 2P0EA 3CBQA 2G77B 2IYSA 2R44A 4D0GA 5BWMA 2G9NA 3Q9LA 3AP2A 1YQTA 5K8LA 5KNCA 4AI6A 2IYVA 4KAXA 1CIPA 2ODEA 2I3BA 1U8ZA 2CHQA 3TSWA 2QG6A 5E7MA 4NKRA 5AJWA 2FH5B 5FUYA 5FL3A 1SVLA 3AVQA 3UMFA 1U81A 3PJRA 4A15A 1AK2A 1PLJA 2KI5A 4TLBA 1KDTA 3MUFA 5G53C 3P32A 2PLFA 1F6BA 3NG1A 2OEPA 4RY2A 2CL0X 4NH0A 2FN4A 1Q1EA 3KXIA 2YJTD 1QHHB 5JBQA 2PLRA 3NHBA 4DBLC 1H65A 1XBTA 1U8YA 5EZ6B 4IRUB 4HI0E 1ZC4A 1MR3F 1Z6AA 2Q9AA 4YLGA 4OHXA 1II0A 1W5SA 2ZRAA 2GKSA 1ZM4A 4V0KA 4YXWD 4A92A 4G5QA 3WMEA 1FNMA 3NEYA 3T5GA 5B30A 4RVCA 2XAUA 2ZJ5A 2GXSA 1W4BA 3CH4B 3GFPA 1KY3A 3AF0A 4QGGA 4E07A 4HUTA 1GZSA 5HPYB 1KJYA 2PZFA 2OLJA 1B0UA 1Z07A 1KI8A 4M1KA 4TYQA 3BBPA 1FQKA 2A3RA 3CH5A 3QOFA 3TKLA 2J0VA 3K70D 3BE4A 3S1AA 4B71A 3OE7D 4ERNA 4TMXA 3R8FA 4TYNA 4I4LA 4D6PA 3I92A 4NMMA 3Q7PA 4V02A 4Q4LA 3IBGA 3TW4A 1ZD8A 1AGPA 3C14C 1D9XA 3ZVNA 1XPUA 1NI3A 4Y0AA 4UNSA 1ZUHA 3GLHA 3DHWC 3RRMA 5IT5A 1VMAA 3K0EA 3U7HB 3R9IA 3BH0A 1W4RA 4ABYA 4CEJA 1XD2A 4A2QA 1LFDB 1R2QA 4RD4A 1EFTA 1OKKA 221PA 3B9PA 1SXJB 4HUQA 3GFOA 1OH7A 2J7KA 1E1QD 4H1VA 4BWYA 2GDJA 3KB2A 1KO1A 4LDJA 5CJPA 2O0JA 1S96A 2JEOA 4TTRA 4ZI3A 3T1VA 2AR7A 2FGKA 4PO9A 1UM8A 1Q0UA 1ZW6A 3K9GA 1NMXA 1X1SA 1XEFA 2GEDA 3KQLA 4JVMA 3RLFA 3U7GA 1N25A 2VEDA 1DG1G 3MWJA 3QVUA 4A4DA 3GMTA 5DIFA 3LX5A 1UKEA 5FTLA 3PCRB 1R8SA 3B7GA 1GKUB 1RVDA 2WJYA 1U0LA 2BDTA 1NF3A 1FMJA 3MD0A 2JLRA 1MV5A 1SVMA 3FKSA 2JIZD 5ANRB 3I8SA 2YKGA 3A8TA 4BLQA 1E9FA 1J2JA 1NMYA 1D2MA 2VSOA 3KKNA 4DLSA 1AQYA 1BMFA 4OI0A 2OCYC 1NLFA 2WKQA 1E2EA 4FWIB 1T8UA 5LB2A 5KDOA 4D25A 2QSZA 2ZYUX 3K9LA 4DLYA 1XRJA 4IOKA 4EJSB 1JECA 3RVBA 3WY9A 1GOTA 2EQBA 2J59A 3AF1A 4R7ZA 4BEJA 1G4UR 4K46A 3CZQA 4IXMA 3ONWA 2EFDB 1UKVY 2JGNA 3U6KA 1O87A 4ILEA 4HLDA 1SKYB 2O8CB 3OEHA 1AIPA 4EJSA 4IOJA 4LJ5A 4B3GA 3RS4A 4YMSA 4JS0A 1T4GA 5P21A 2C9YA 4IKEA 5EUQB 3UANA 1YZKA 5FPSA 1TNDA 1G19A 1XXHE 4JLAA 2QSYA 1NLZA 3AEZA 1HE1C 4BASA 3OIWA 4BLOA 4DCTA 1OPXA 2P5TB 3FVQA 2PT5A 5HCNA 4ZIRB 2WWYA 4A9AA 1Q20A 1BMFD 2CLSA 2F43B 1HE8B 1Q3TA 3ADKA 1KDOA 1Q12A 2VP9A 4BFVA 2I4IA 1NNEA 2HCJB 4Q4HB 2D2EA 4IDPA 5J5CA 4PZYA 4B47A 1SVSA
chains in the Genus database with same CATH superfamily
1DCMA 1E3WA 3EOZA 5MGNA 1NBHA 1GYQA 4RYLA 4NENB 3FVVA 3V2UA 3TZHA 4FC6A 1G3RA 1HWYA 1LVHA 5EYPB 3EVTA 3PC3A 5JQGB 4IRXA 1LTHR 2H5IA 2NUAB 4RPJA 3KLPX 5EVCA 1TKRA 3RIYA 4DHWA 4U8GA 2V6BA 5B1HA 4YCNA 4GOLD 3KHKA 3VFDA 4JLMA 1UT8A 2V97A 4LGCA 4H6XA 5BT8A 3DSRA 3RC8A 1AGRA 2H1CA 3DOOA 2O0MA 3EF0A 4KVZA 2C5GA 3D64A 1ZCBA 2C9OA 1KY5A 2P9EA 3VNVA 3KJXA 5SZIA 2O5EA 3G9XA 1OXVA 1EJ2A 2O2ZA 3SXUA 5EJFA 1TFUA 1Y6ZA 2B4KA 4NK5A 5HTOA 2WYWA 3GEBA 1DWUA 3TQCA 2AJDA 2WD8A 1YCDA 2WTMA 3EXEA 4GRAA 2H59A 2HW8A 2OLEA 1TPYA 4BFSA 4IS3A 4CG2A 3ZCRA 3ZR4B 3VH3A 1G8YA 1PWYE 3NIGB 3I0NA 2PMEA 5U9CA 3BBLA 4Z7QB 5C5IA 2NU9A 1Q84A 3ITKA 3PRJA 4LXGA 2FPGA 5HF8A 3SKVA 3ZWWA 5IPFA 2BCJQ 4HGRA 1OX6A 2VAPA 1U7HA 2O3JA 1KZ6A 3FAKA 4J91A 5JZBA 2YJZA 1E6EA 3E53A 4R1UA 4B79A 3LT2A 3GJ4A 4K6HA 1LWOA 1D9ZA 5L3ZA 4AY6A 4O4IF 3IEVA 2HO4A 3HVIA 4XQ9A 1U28A 1QANA 2D4HA 3EARA 3HV2A 4RUKA 2FMKA 3RQSA 3MAAC 1BIFA 1Y37A 1QJ4A 2LDBA 2GM9A 2R6GA 3DMHA 4P81A 5I8ZA 3RUIA 1Q0TA 1P17A 1TAUA 4HZUB 2WYUA 4Z4GA 4DCJA 2XXAB 3IUYA 2J3KA 3N8NA 1VCOA 4DUGD 2OOKA 2VCYA 3QUQA 1AS3A 1O94A 4X6UA 5HIIA 5A0VA 2DTXA 4WLOA 4EG4A 1MENA 2G67A 2JHGA 3VDMA 2ACWA 2WMOB 4BE9A 2JIBA 1K68A 1G6HA 3I1IA 1WHSB 1CHDA 4L9SA 4QELA 3DVQX 3JQBA 3N6RA 3K15A 3E70C 3L01A 3ADBA 1D6MA 4LRYA 3DO5A 3W2FA 3RHSA 3ZPXA 1C1HA 5C1PA 3K70B 5DF1A 3H11A 5HWSA 3PA6A 3U4DA 3WLLA 1KR2A 1FFDA 4MUYA 1E0DA 4G8JA 3PHBE 3GIDA 4ZVVA 1FJXA 1JN0A 3PDWA 2J07A 2R25B 4Y1RB 3EZ9A 4OJYA 3UEOA 4I9UA 2R6FA 3HMKA 4D4JA 4PXAA 1L7BA 4RZQA 4WQMA 4GL4A 5JD5A 1SOAA 4L74A 1W6RA 4RKRA 1EFPA 4FSDA 3PX7A 4AMZA 3WQHA 1V4VA 3KXKA 5JSZA 3DTNA 3FRIA 3HSSA 4R0NA 5EHNA 1AO3A 2VF4X 3FWYA 2BT4A 2O2JA 2YWDA 4GF5A 4MVJM 5CT9A 2PXAA 3Q2KA 2C5SA 2ZCUA 1Z6ZA 1VFNA 4OU5A 4F2GA 5BMVB 3ZXUB 5F3WB 3TRJA 1PL6A 3NVKI 1YGPA 3PQ4A 2W6OA 3F5DA 2QSUA 1P3DA 3BJEA 4KFRA 4M76B 4GGPA 4UBIA 4POOA 3RC3A 2ZUFA 1Z62A 3AFNA 3PB3A 4URFA 5DDIP 1OTXA 3QU4A 4B4WA 2BSQA 1YJCA 3RAPR 2VDKB 2XYPA 3RFFA 1XCLA 5ALDA 4AYTA 2C5BA 2DC1A 2J9GA 3DWFA 4L4SA 4C6TA 4LDRA 2YY5A 3OPYA 5JE8A 2C77A 2BJWA 4PF1A 5CCDA 4G56A 3V5NA 2OFPA 2VH5R 1U7TA 2F3QA 3H18A 4FEAA 2NXCA 3TJZA 2VZEA 5K3SA 1U8TA 4IJ6A 4INPA 1QRSA 1P7YA 1YIAA 4TLMB 4PG6A 4PQRA 1RYHA 2ZBPA 2EKQA 1ORRA 4MYHA 1CR4A 3GXBA 1P7PA 3MMNA 4LOKA 5FOVA 4AKSA 2D1YA 2YL2A 4HYQA 1FX0A 1QNLA 4TWAA 3TQHA 4YBRA 521PA 1S02A 2A59A 1RRCA 2WD7A 5JVDA 3HU5A 3NIDB 2QY6A 4LNUB 2LVBA 1SIWA 1GKKA 3GK3A 1QZ3A 4H3SA 1KS2A 4XXHA 2RHDA 4C01A 1B8OA 3BCHA 1DAEA 4O4JA 3U4QA 3TBFA 1LLUA 3FVWA 1Z5GA 4BQQA 2DUJA 4Y0NA 2VYQA 1ZOOA 1JIUA 1H5UA 4U2FA 1TYDE 1EK1A 5HFNA 1ZGZA 4PZAA 3NIFB 3JARB 3S44A 4F4DA 1Z38A 1RLUA 3E2IA 2F3RA 4DNFA 5IF9A 4JUCA 4WGGA 2WC1A 3ZI4A 4ESOA 5KU7A 1XMQB 2LCQA 1FQJA 1J2UA 1MO5A 2ZIXB 1RAEA 2C0PA 4QWMA 5LLSA 3ENVA 1ZISA 5HZKA 5L3SA 1Q22A 1MG0A 3KR0A 1KMIY 3M4XA 1N33B 3EVCA 3VRHA 4D4IA 2NU9B 4TLDA 4TL7A 1JJ7A 1R0WA 1ZN8A 3O75A 1Z22A 4HGNA 3DZFA 4ZPJA 3S4YA 4E09A 1N6NA 2ECKA 4KJZA 4G0WA 2G5TA 1NMQA 4P98A 4OUKX 1N5KA 2V03A 2YJ6A 2O0HA 1CETA 2QRMA 3Q9NA 1A8PA 1QIDA 1U5BB 4JEHA 3AHJA 2RHGB 5I9TA 5DM60 5HW0A 2XY4A 3QSYA 4KQKA 1I3NA 1OT3A 1XDDA 1S4QA 2C2HA 1Q0SA 6ADHA 2YNMA 4JITA 1PX0A 2ODQA 2O8BA 4IV8A 1FY2A 4KYVA 1BH6A 4IW3B 2VYFA 3GGPA 5FLKA 3WO0A 3L8FA 3IBSA 3UMCA 5K0BA 1QKKA 4F8EA 3KQKA 5IDQA 2ZJAA 2DR3A 2AN1A 1N8SA 3RYHA 1VGRA 3TDMA 4BQSA 4YI5A 2XGGA 4RPIA 3VNUA 4JN6B 1JZQA 1QXSA 1JBEA 1JYEA 1W44A 2BW0A 2DTDA 2UYYA 2W11A 4L07A 5JECA 4TXNA 1UQTA 2IDJA 5T4BA 1SKQA 4KR7A 4DCTA 4XGKA 4K2HA 1LBEA 4DCNA 3VZCA 5JZVA 3QLVC 3FZQA 3RDPA 3EXIB 1I1NA 3BMQB 2NSDA 3ICWA 2A8YA 1NXVA 4P3XA 1A4RA 5A7GA 4B44A 3KJZA 1RBMA 3KOOA 3LRXA 1ULSA 1KFJB 1L5YA 2OPHA 5J5AA 3RIXA 4DEXA 1ZUD1 3STHA 1UL1X 1SUPA 4H1TA 4KLRA 1MNAA 4NJEB 4OJQA 3O1HB 5EMNA 3O47A 1E9EA 1EUZA 2ZATA 4WOJA 5H59A 4Y67A 1P4AA 5F78A 1R6TA 2GN9A 2MYUA 1N32B 4NBLA 3ZV4A 4NOLA 4UW9A 2ZYVX 4OAPA 2X2FA 4DWVA 4ABTA 2P9JA 4DVJA 4NCAA 4PONA 4GZ5A 3OT1B 4WBSA 1A2BA 4DA8A 2B8TA 3PX2A 2NUPB 4XQGA 2BMDA 2G9UA 2H7XA 2YVQA 2JLAA 4MQBA 2FUKA 1O96B 1Y5RA 1R6AA 5CURA 5IYZB 1XZPA 4UATA 4X6YA 3TRIA 3WGKA 5LUAA 1F2UA 1SELA 1Y34E 4AJOA 5C46F 4AJ9A 4ITRC 4Z0TA 3ABRB 2FFHA 1Q6ZA 3EUEA 3NC1C 3TNFA 3A31A 2O8CA 2VWQA 2P9CA 2D5CA 3KT0A 3GRAA 2PL5A 3LCRA 4R2XA 1R16A 1TZBA 2F1IA 1GPH1 1PJRA 2WPDA 3FFBA 2A3NA 2X9LA 3IQWA 4Q4JB 4AUEA 3CE6A 3QX9A 3M1IA 2V7TA 3H87A 3UMGA 1ODIA 2Y1CA 4AJ2A 1JFSA 3O4VA 1M0WA 4MWZA 3M9XA 1NG1A 4FZ5A 4V0SA 3DS8A 2BL4A 3WRYA 4C78A 1EWKA 1NNI1 1OXBB 3C7DB 3F6CA 2JFZA 2YWRA 3S1LA 2CFRA 3H9GA 4L6AA 2RGXA 2EFHB 1C3JA 3MPUA 5HM6A 3U60B 3WNCA 1WZ2A 4GR5A 4UM8B 3QPBA 4M3NA 4BU0A 4LVOA 4CCSA 2YQ5A 2J0QA 1LV7A 2P67A 5DMHA 2RC6A 5ALFA 1R6DA 2WPDD 3M83A 3DAGA 3GGJA 1V8ZA 4FK8A 1JAIA 1XVVA 2WWXA 3F1LA 3VC3A 2NSHA 4GXRA 3ER9A 4DREA 1PUJA 4FGUA 5IVKA 2UVPB 2M9MA 3HN7A 2EATA 3LKVA 1QZXA 4QXPA 1K4KA 3G2OA 2E82A 3GQBA 4R7GA 1ECBA 5I9LA 1J00A 1VMIA 3IEMA 3EMDA 3I83A 1XIVA 3IALA 2IUUA 4XTRA 3PICA 1HE4A 3DKIA 1GVNB 3D5EA 3E5HA 3WLEA 2QLFA 2C4WA 3FMPB 3TEJA 1IC6A 1E8DA 3DOFA 1WMDA 3B60A 1L7PA 3GGSA 4N8SA 4XZ3A 4Y30A 1KQOA 5IYZF 3WTCA 5IAOA 1M2VB 2HDHA 2OD9A 3C5EA 5CNJA 4I5GA 3T1YB 5H9WA 2G7ZA 4P83A 2RK3A 2WSIA 5IH3A 3R9XB 4GMXA 3DE7X 1MHTA 3PT5A 3RANA 3FHTA 3BDIA 4QFDA 2NZWA 2XADA 1DAMA 1TJYA 1GNTA 1X1AA 2CNWD 2QM7A 2YH2A 2PMCA 1F3OA 2V9CA 4B7ZA 1JPJA 1F1JA 1CDEA 1OXUA 4LNHA 4NMWA 4CV0A 4AK9A 4QRDA 3S1AB 1MEEA 2UYGA 1XAGA 2V4ZA 2O8EB 1Q44A 4Q16A 1M2KA 2CDNA 3L84A 4PYNA 1JXQA 4W8OA 4RMGA 4TMZA 1Z88A 2PA3A 5AR1A 2H1WA 5FI5A 1P9NA 3HDTA 1DNPA 5CB8A 2C9ZA 5BSUA 1HA3A 2ZJ8A 3ONNA 2MSWA 4IMJB 1BG6A 2QF7A 3L06A 1XZEA 2AVDA 2CMHA 1I36A 5D3QA 2UAGA 3VM6A 3BCRA 3KEOA 2M6SA 5FXMA 1G6OA 5H3LA 2Q3EA 3AL0C 2L82A 1XVTA 2CLOB 2OAQ1 2OMEA 1Z34A 2WWGA 4J7XA 1Y8CA 1SHLA 2XEDA 3I5MA 1QTIA 3CR3C 3ONFA 5KWSA 3TRKA 3OE7A 1PGPA 2EJVA 4DZRA 4R7TA 3JR7A 3LBFA 4X65B 3RRJA 4RA6B 1Z4NA 5DM4A 3ELBA 5JDCA 2R0QC 1M1XB 3KFXA 1THGA 2VNHA 2X77A 3FKQA 3O9VA 2NO6A 3U13A 1NQVA 1E5LA 1SUCA 3GRYA 2JLCA 3JU3A 2GJKA 3AUTA 1JSLA 2YJ5A 1Z0JA 4B48A 1U99A 2QPLA 4GR4A 1KJ8A 3OURA 1TW3A 4DLUA 4MVWA 3OLXA 2PUGA 2W9XA 2H63A 1FFWA 3E1SA 3RIMA 1X3LA 3K05A 1MD9A 2CEKA 1IVYA 2I80A 4YRBA 3GNQA 4C7OA 2R6R1 1Z56C 1E59A 1KYIA 5JAMA 2A5JA 5HF9A 4S2UA 5EE5B 2JKYA 1JKXA 2W4IA 5E2BA 2XOEA 1CR2A 1DL5A 1WW3A 3WBBA 5A02A 2NZYA 5C34B 2CCGA 3OY7A 4JZKA 2QYOA 1V3QE 1QKIA 3B9BA 2B83A 1K3UB 4YCBA 2EF1A 1GTJ1 4IZ6A 3C8ZA 3A2LA 4B7UA 2POQX 2IZ6A 1PG2A 4I5EA 3IQEA 3RS8A 1E3MA 3NXSA 1KAMA 1NIPA 1NYRA 2VJKA 4ZHQA 2XB4A 4UQLA 3ZD6A 4D3ZA 4QXOA 3DXZA 1AX9A 3IJEB 1C50A 1UBFA 4OGKA 3HI4A 3TXYA 3F4BA 5KTPA 1NUAA 4MWDA 2I4LA 5MGBA 5H4GA 3TZKA 1W47A 3VPHA 4KR2A 1TYZA 1UBTS 1Z4LA 1MAHA 2GA8A 1CNFA 4KBYA 2IZZA 1BU8A 5ALZA 4L0MA 3TEMA 1MAUA 4WN9A 4X92A 2VJQA 4BLUA 2IX9A 4MGKR 4ZT3A 5B2ZA 4DLNA 4A5OA 2G8LA 3NRCA 3TLXA 2FPMA 2VRWA 5JROA 1D4FA 1UJBA 3BMCA 1C1YA 1G17A 2AG8A 3DZIA 5T7BA 2PLNA 3DLCA 3TAXA 1W36C 1YVUA 4NFLA 1PK9A 4HDQB 2WB2A 5KVVA 1WDKA 2FEAA 1HR0B 1JFVA 3LFTA 3VYRB 4B6GA 2HJVA 1F1BA 2HF2A 3HZOA 3OMWA 1VMDA 4L5AA 4F21A 2OBYA 4XWWA 4YP1A 1F38A 1B3RA 2FOLA 1JZTA 1MGPA 1RXCA 4QBGB 4YUWA 3LM8A 5JAUA 1M1UA 2A1UA 3L0ZA 1SEVA 4U2EA 4YT5A 4ZPXA 4HQFA 4UTPA 1MO4A 1F4PA 2QRKA 4GVPA 1YQEA 3U31A 3QLEA 3K8YA 2OV8A 3JAKA 2C9BA 3CB2A 4HYTA 4WKOA 5EPEA 4BJ5A 1A8IA 4MPTA 1JTVA 2GRJA 4UMEA 4AY5A 1NXWA 2QE7A 1H4VB 2QUIA 3N76A 1F5SA 3WLMA 4AG5A 4PBRA 4IXNA 2E4WA 2RH8A 1JV2B 1PS8A 4RVUA 2NQ8A 4RC9A 3Q3EA 4RSGA 3L0PA 1SXGA 1J8QA 1KDPA 1T2NA 3QWIA 6GPBA 7AT1A 1RHUA 4EENA 4ASUA 5CFRA 1NW4A 3T1OA 5LWHA 2PMKA 2Y4OA 4XM1A 2FSUA 4DJDC 4DM7A 1NBMA 3EFHA 4ENUA 5AVRA 4E5DA 1WB9A 4TMFA 3LBAA 5CAEA 4DR2B 2H1HA 3HKEA 4G4SP 3WIBA 1GRQA 4B17A 4EKDA 2GYYA 1EFDN 1QQBA 1ZMBA 2WSSD 4D6YA 4L5CA 1BW9B 1VB5A 4K3VA 4RLQA 2IYLD 4LMAA 2IYEA 3CUWA 3PHJA 2WNHA 3VYWA 4BMPB 3CISA 4MVJF 3GJQA 3LQQA 2ORYA 2AFHA 1GCIA 1BMTA 2K7ZA 4R9UC 3ZBUA 1J8FA 1ZH8A 1NKSA 4CTOA 4E51A 2EWMA 1CUWA 3M4YA 5FA5A 3EASA 3G8AA 3E8XA 4JD5A 3ZS9A 2YDYA 4JYPA 1UANA 1MF7A 2WT8A 3COSA 1AH2A 1LCIA 4WADA 3L4EA 4YK7A 1G7RA 1TLFA 3P96A 5TVKA 2RKWA 3ZHXA 1DS6A 2APJA 3KJQA 3A3KA 1NVAA 2VSXA 2WLSA 2ZSKA 1FFXA 3D2AA 1E2FA 2BF4A 4AQYB 1CUJA 4OSOA 1BOOA 2EEZA 5J47A 3C87A 4C6RA 2NSYA 4UZSA 4Z5XA 1P31A 1FDUA 3O8QA 2PZEA 5DNEA 1DXHA 3SX4A 2YZKA 1LPSA 3H19A 4KAFA 2W2PA 1GCGA 4IICA 3IL2A 4PG4A 3EPJA 1UZUA 4PS0A 3W5BA 1QFZA 3AJ9A 2H4JA 3TL3A 3ZGOA 4X7PA 4ZVLA 4KR0A 1PLKA 2QTVB 3T12A 3IVXA 5ALKA 4F5WA 4E22A 1QOZA 3PFKA 4ARVA 3BMNB 4CKXA 2IJGX 5F2OA 1PJCA 1RJFA 1WP9A 2A9OA 2ATXA 2QTWB 4MGEA 4XD7A 1M5TA 5DTIA 2HHLA 3W34A 5C5DA 2I2BA 3UATA 1FCJA 5BUCA 2XUOA 1HBJA 1E0JA 2OSVA 5F1PA 2HPHA 4CIYA 1YS4A 2A4MA 2PPLA 4AMBA 3TKYA 3JWEA 2FEPA 1UBJS 1OI2A 1Z12A 3OU6A 5D85A 3D8SA 1A9QA 5G3YA 1N6IA 3K96A 1ZOIA 3TPFA 2V7BA 1MV8A 1KNXA 4JQCA 2V0NA 1P5ZB 4XX0B 3ST7A 4G41A 1E2BA 2QJWA 2FMUA 4K28A 4J6EA 3HO1A 5ALIA 1VI2A 2F3UA 1IHUA 2VYVA 1VJGA 3ESRA 2LCIA 3EVEA 5AKEA 3UK6A 3LIPA 1VI6A 3MB8A 3TSCA 3GEPA 3O2SB 4RD1A 1SCIA 5FR1A 4C7JA 4D9NA 2GSWA 4KFCA 3P9NA 3ZY4A 5KNLA 4MGHA 3W2IA 4TTTS 4KKVA 1F5NA 2BR5A 1NHGA 2E18A 2FMHA 1V5FA 1YQUA 2ZVQX 2IZ5A 1MJGA 2QQFA 3TW6A 4RQTA 5ALNA 1XNQB 1HMYA 4N9QA 5LOVF 1JQEA 3HKCA 3KAJA 4K9KA 1RS0A 5FWAA 2CBZA 4MKGA 3O0DA 5K6AA 2WWRA 1O08A 4DKJA 1PU2A 1LPPA 1J0DA 1P80A 1S5PA 1SK9A 2MYPA 2LKCA 3R20A 4O4HB 1PJBA 1G8MA 2YXBA 3R7FA 1HSOA 1HQYE 3SIPA 5PGMA 1TFRA 4YUXA 4UBKA 2QJTA 1PNVA 1WBJB 3D7KA 4HJRA 3IJRA 1M1YB 2HLNA 2O06A 3B1YA 1TEXA 3B78A 3PFNA 8GPBA 3HDYA 5C5CA 3OM0A 5IM4F 3PJFA 4WVFA 3DMTA 1LNQA 1YK1A 3EQ7A 3FB4A 4QE3A 2PJRA 3I4CA 4QDKA 2HU5A 1Z2OX 3RRBA 4BNZA 2HZBA 3G2LA 3WYBA 3R7SA 3BD6A 4DV6B 1NR7A 1JH8A 4MYTA 3LO5A 4OXYA 1XB2A 4V0NA 4JA2A 1E3QA 3F6SA 4E6PA 4TWIA 1GNSA 1AZTA 3IERA 3FMGA 5G0TA 3LPDA 1F9EA 1L5LA 4ZOEA 4Z8YA 5EP3A 1P7VA 2HF7A 3F97A 4JYBA 2COEA 3UPDA 1U3VA 5L45A 3RFVA 1NVKA 5IF3A 4KXMA 2ZTUA 4U3JB 3OQPA 1JTEA 3PUJA 5DM2A 3VR3A 3ZZ1A 5LN1A 1BWRA 2AI2A 2OORC 3OOHA 3DAOA 3R3WA 5AUQA 3O73A 2HCTA 4L0DA 4LCBA 1U3CA 4B76A 3H1PA 1YV9A 1L7NA 2PRZA 4FFRA 3PGMA 1G38A 2FSHA 4I81A 3P27A 1DQNA 4TSRA 3AV3A 2VRCA 3NORA 5I7FA 1P62B 3SQNA 3DB1A 2Y76A 3V48A 1OAAA 3EUWA 2G63A 2AFHB 2XVZA 3NW9A 4TVSA 2DKFA 3JQ7B 1YNOA 2WHYA 1C3EA 3G0DA 2CMKA 1KI4A 1GUBA 3IRUA 4B09A 1P73A 4KO1S 1VCNA 3TDKA 4UJ3A 1K98A 2JZOA 4YVFA 2DHRA 4UXHA 3KZVA 1I9GA 4GAEA 1QU2A 1HDRA 2C58A 1T8SA 3PIDA 2Q4OA 2GCGA 5DGTA 4QYMA 1IJFA 2X14A 5DHTA 4ETMA 2GN6A 4OQMA 1DOZA 3PYXA 3VU9A 1UAYA 1GGHA 2AW5A 1JZSA 3FLAA 1E2LA 3QELB 4LHZA 4M1EA 1J9EA 1IBSA 2JIDA 2CDRA 3ABZA 2WP0A 4G9EA 4KYIB 2P8SA 3MWDA 2ID9A 1NJGA 2OCPA 3X2EA 3ZE9A 4MJ7A 3WYAA 2J3EA 2JS7A 2P6MA 1W0KA 2PQ6A 2O50A 2R5WA 2XF2A 4YCCA 1FBNA 2X6QA 3AEQB 1D4OA 3MZ0A 4Q4HA 5TEWA 3EEBA 1KBQA 4MV6A 2O7RA 2QL6A 5EHQA 4OHPA 3DL4A 3VR6A 1FYDA 3EVDA 4Z4QA 1LBTA 2VHQA 4ZJUA 1WXQA 1NUQA 1NQXA 5F3RA 5KAPA 1JH9A 1HKUA 1VCHA 3EW7A 3NCHA 4LOIA 1SUFA 4BUCA 1ML4A 2HC9A 3LLVA 4XOUA 4IG9A 1JLLB 2W58A 3K6KA 2XWQA 3INRA 1F8FA 1B6GA 4HK4A 3JQGA 3BB3A 4KGDA 4O2BB 4TRMA 4F86A 1TGVA 3QJGA 3UKOA 1EZ4A 1NVTA 4AZ3B 4G9GA 4EKEA 5HEKA 1TAQA 4EO9A 2ZOSA 3D6AA 5LDHA 4LZWA 2PGAA 3K92A 3KKPA 3ZQKA 4OQPA 3Q40A 4D9JA 2O0KA 5KSOA 4CEHB 3AIOA 1OJ7A 2QW1A 3A6DA 3C7CB 4DQLA 4LCEA 3GLIB 3RTAA 1I1HA 1T3HA 2IXBA 1JXOA 2P11A 2AOVA 2R65A 1N9KA 1SUDA 1T4BA 3SQDA 2NN3C 1RIIA 1P5FA 1NONA 3ZWVA 2RD2A 1V8OA 3RU3A 4YB8A 3KYDB 1JHZA 3D6MA 3HM2A 4JL6A 5LQSA 4EFLA 4YT4A 4OEHA 3FWZA 2QZ4A 2BGGA 1QBGA 1KQGA 3GYGA 1XZCA 1MQ9A 2BKXA 3UYKA 3M8KA 2I33A 3EDMA 1ZSYA 2BP7B 2Z2JA 3Q9SA 2WMDA 1AF4A 3SSMA 3IP8A 1DBRA 5D3KA 3DW1X 1S0UA 1FFXB 3K6RA 1KPHA 1M2JA 4INAA 2G17A 2XWJI 4Z9AA 3S6JA 3SOZA 4DPKA 2QTAA 4Z7OB 5TMPA 2J9RA 4QNRA 4CNBA 4ER3A 1WXIA 5F76A 2Q6KA 1FXSA 2IEZA 3LBIA 1JHRA 1K5PA 1I2DA 1K7SN 5IXSA 1YBFA 3QFCA 3SN6A 4F11A 3H99A 1RJ9B 2DXIA 1TW2A 1Y98A 2PZ8A 3C3EA 3E58A 3MQ4A 1P4JA 3GLQA 4Z9BA 1YB1A 3AI2A 3FXAA 4C03A 3GLGB 3WK9A 4H9GA 1DTWA 4JHXA 5KCZA 5JZOA 1XNHA 2CXOA 1T1IA 4BRZA 3CNLA 2QXYA 2C5LA 2AJ8A 2Q5CA 4PGMA 3IMEA 4QECA 4RMHA 5KJCA 1FMFA 2YDXA 2PTGA 3ZU2A 3F4LA 3MEQA 4GL2A 4JXXA 2IL1A 1WTAA 4P35A 3DUFA 4LMBA 1FS6A 1NVBA 1QM5A 1T9GR 2QTNA 2FUCA 4P92A 4XASA 1GL9B 2J7PA 1SQ0A 4V0LA 4AF8A 2OKGA 2D0OB 1YDFA 2OOSA 3PDUA 2HJ9A 2B4AA 1NPDA 2JIRA 3DUFB 5DMXA 5I51A 1MDFA 1UFRA 4NMHA 4BE4A 1F51E 2C7RA 5FQNA 1SCBA 2ATIA 3KXLA 3OZEA 1L3BA 5A5FA 5I7AA 5IHXA 3AM1A 1HT1E 5JYEA 5KS2A 3JQ8B 4FCVA 4I0WB 5ITVA 3RAFC 3BWCA 3TTVA 1W581 3EMKA 2BFWA 3VSAA 5JNTA 2XNDA 1KIAA 1VB3A 2G04A 1U2DC 4Q9JA 1G20E 2WHXA 1V71A 3AFIA 3C6XA 4Q3NA 5AI5A 5DRYA 1KDYA 4KXNA 3DV2A 1Z68A 1USVA 5C52B 4R69A 1MAAA 3GF4A 4ES6A 2OPBA 3TLCA 5F7OA 4A82A 4Q3KA 2CHUA 3VKUA 1QDLB 2HI0A 3G85A 1JXAA 2RHLA 2GZRA 1RDFA 1TX4B 1VHDA 4KO2S 4WZBE 3RRNA 1FP1D 2J9FA 2JZNA 4PSVA 4PCUA 2B0JA 4OYRA 2JFGA 1V43A 5KSZA 2PXHA 4I46A 3UMSA 3S2SA 3P52A 4LFBB 1EJBA 1RBQA 2A30A 1SR8A 4OK3A 4KNVA 4NBWA 4NG5A 4UPEA 4GECA 4E70A 3VA7A 3D0QA 1OE0A 1OWNA 2VHYA 3A9TA 3PG5A 4RIIA 3KSDO 3RVOA 5TIIA 5FBVB 2JC3A 1EFRD 1Y4SA 4FGLA 4KO3S 4OXIA 5EJAA 4MYUA 5K3DA 2BGNA 1G6Q1 1PWHA 3C8HA 1MU0A 2GO1A 3FNHA 10MHA 1P19A 4MWOA 3I8OA 1DIOB 1Y7IA 2A88A 3ZWBA 5F4BA 1ULBA 1FFCA 4TS1A 2GERA 4R1LA 5K8VA 2HHJA 5A1TA 4GEGA 1SKBA 3JPYA 3IPAA 3PPYA 4LE1A 5FTJA 5NULA 4DLXA 1E5VA 1M76A 4CGYA 4YAIA 4WERA 2EW2A 3AY6A 3TZLA 2C9DA 2Y1WA 5IFLA 4DTIA 1ULAA 4WLUA 3G2PA 3ZTYA 5JYBA 2R97A 1MC1A 3WNZA 1ZBDA 2UVQA 3IV9A 4YJ2F 2ZIZA 3GEGA 4E13A 5F73A 3QVWA 2AG6A 1EINA 1I13A 4NE7A 2BBWA 4JI1B 4E2YA 1IEQA 2YV5A 3G5MA 3OG9A 4RVOA 3EPLA 4NS4A 3ICQB 2XUJA 3A4YA 2CDCA 1J2RA 1VKJA 2ZIFA 3PZRA 3ROFA 2H5JA 1OQAA 2YFYA 4DV1B 1TMGE 1YRQA 2IBMA 3NBFA 7MDHA 1H1DA 3IS3A 1LBQA 3QPUA 4PFQA 2ZK7A 3F98A 2EZUA 4NBNA 3T38A 5LOVA 1U8XX 2HMYB 3EXFA 4JY7A 3W5UA 5CITA 2QZSA 1RTTA 3PJEA 2DKOA 1I3CA 1UPTA 4KYUA 1BHQ1 2CXXA 3STTA 5B57C 4JC5A 1E7MA 2AXEA 2OZLA 2DOKA 2NTYC 3MWDB 3NTVA 4UPDA 5CH3A 2VDWB 3WL7A 2R6JA 3OLVA 5DRTA 3EA4A 3KLNA 4EI9A 3QTBA 3Q8LA 2FXIA 1UC4B 1IY2A 3CPJB 2N0SA 1G7TA 2C82A 1FDVA 4W1QA 1PE0A 4S1WA 3MOGA 3VNSA 2IXFA 1E6KA 1PJ4A 3HJUA 5I4BA 1P60A 3LH5A 3IR6A 2N75A 4DA4A 5LQMA 2BN4A 3IXMA 4HGYA 2GAIA 5F1KA 5TDHA 1B2LA 4LKOA 2OXEA 4Y2VA 5E6RB 4QYTA 3U3ZA 1RP1A 3BD9A 2FLKA 2NX2A 1I0ZA 2GBPA 1B26A 3NUGA 5K6TA 4QT0A 3RVKA 3PPWA 1LU9A 2UZIR 3E05A 1T26A 1PW5A 3D8UA 3BFPA 4QTUB 5AHKA 5JSQA 1K1EA 2DBQA 3D7SA 3RVLA 3PEEA 2IV3A 3MILA 1ONOA 2O52A 2AKYA 5AXBA 3OAAD 3PJGA 4GP6A 4TVOA 4RHFA 3WWOA 1KC3A 3FYUB 4Z1OA 4GICA 3ZCPA 1JG1A 3I28A 4P0QB 1U63A 3AINA 2IDMA 4YCMA 1U0NA 2O8DA 3K9BA 3BKXA 1YI1A 1KK0A 2QA5A 3LRPA 5FWXA 3V6MA 4BUJA 4BQIA 4QDXA 1DEAA 5EIOA 1EE1A 3GLIA 4OREX 4EHBA 3AIIA 3I73A 3AZQA 3L41A 2IYZA 2C7VA 2VPWA 2CSUA 3ETLA 3MERA 4V3BA 3CKYA 3T3MB 2PL3A 2PNFA 1L5RA 1E79D 1RWMA 2Y92A 3HLTA 4WIAA 1JR6A 3JZAA 4W7SA 1W1UA 5BOVA 1F0PA 2V7VA 4TV8F 5D2CA 3UW1A 1CQWA 1KMMA 1S89A 4GNKA 4DLZA 5F4ZA 5L53A 1IU9A 4ENVA 5JZMA 1AC5A 2M6RA 1E79A 1HE5A 3IYLW 4MVJD 3AUXA 1VJTA 4UHHA 3PLNA 3VYVA 4QUEA 4HNTA 3GV0A 1V11B 1Y7LA 4WXYB 2G09A 4E5KA 1TU0A 1HO3A 2BFNA 4PO3X 5DGDA 4E88A 2HA4A 4BAUA 1IM5A 2JAPA 3I34X 3R1IA 4TMKA 1QKJA 2VAXA 4MVYA 3GNTA 4OLJA 5FOUA 3IDQA 1VIMA 1O4VA 2PZMA 3KKEA 5JLAA 1C3VA 1SXQA 4HCJA 3U7QB 1PAUA 1SHKA 2AK3A 4AZVA 5E6RA 1BVYF 1IHOA 2XIJA 4R8RA 4HXYA 3CV3A 4QXQA 1N6HA 2GGSA 2JJ1A 3G82C 1AGYA 4MQEA 5K01A 2BZSA 3KEQA 4KQHA 4CDGA 1CQPA 2LW7A 1PL8A 1T9ZA 3KQNA 1RPTA 2IHNA 3EMBA 4ESHA 5C35A 2VJOA 4LGMA 1TC2A 1ESEA 1UZLA 2KBEA 2YICA 1Q7EA 2HU2A 1XMJA 3E9ZA 4J0GA 3VO2A 1YDEA 2OHXA 1JE0A 3WRXA 4BGDA 5E6UA 3B38A 2CWDA 3HFRA 3OF5A 4RXTA 4XLZA 3KG2A 5AKGA 3D8TA 5DWDA 3CB4A 3L8YA 4HDNB 1CPYA 4D3XA 5IYZA 4DIKA 2FQXA 2PV7A 4QO8A 4UZEA 1SG9A 1RPAA 5LB4A 2B7BA 4ZKDA 1PJ2A 1ULZA 4QARA 4AF6A 3GFFA 1D7OA 2LIVA 4FBMA 1VCMA 3I05A 3NYWA 4WBXC 3T3PB 2VRBA 2BFDA 4I6GA 4NCXA 2CSXA 4ROSA 4B0PA 4CLEA 5KYNA 2CL7X 3M6XA 3GB9A 5F1OA 2YZ7A 3HABA 2GHQA 4TMTA 1QOPB 4RGVA 5FAKA 3ANMA 1CVLA 3GRFA 3UC5A 1BRTA 3LBYA 4JL5A 2E55A 4NFHA 2ZUTA 3TD9A 1B0ZA 2NYRA 1QZZA 3BRWA 4KL8S 5GY7A 4DZZA 1V45E 4C5AA 2JVIA 2Y77A 3HKBA 3WYGA 1VYHA 1OCEA 4M1OA 3OTWA 4KPYA 1UC5B 1FS5A 4MQMA 4MVJH 2XEXA 1IBKB 4Y9TA 1ZU4A 1JEAA 5JG7A 2WZQA 5ECWA 1C14A 3LIIA 3CSSA 4M37A 1A82A 1L2TA 2OQIA 4R3UC 1RMYA 1PJQA 3PS9A 1SZDA 2MTBA 1EFVB 4JKIA 4JT2A 4H0NA 3QWAA 3LCJA 1E8MA 3D3KA 4KDCA 3PZBA 4QUIA 3UBMA 6YASA 3NC0C 1O6ZA 5A7FA 2Z95A 2H1VA 4UOQA 3C7TA 1BXRB 3HRKA 3SYTA 4HL6A 3F8TA 1H5NA 3AM5A 3Q3GE 4ZA2A 5SYNA 1W0CA 3CZMA 1W4CA 3SBOA 3D43A 1QCCA 2I4NA 1NOKA 1ODLA 3G0IA 3LL7A 1EFKA 3BIOA 4F2PA 2JI8A 3M4ZA 3I58A 4RHTA 1JB9A 4MIYA 1NJFA 1SCNE 1ZOPA 3GEHA 4EHHA 4HBGA 3BZUA 4L08A 5A05A 1FNNA 1V47A 1HT2E 4BMZA 3IVRA 3V2HA 4WRRA 2V4MA 1UZMA 1Y8AA 2Q8PA 4GE3A 4ALMA 2CUZA 2FE1A 2NU8B 2OE2A 1XV5A 1WXFA 1HEYA 2VZ9A 3UCFA 2AZDA 4OB8A 4Y6QA 3KKOA 4U6NA 1CUFA 4WK0B 1JI3A 4O25A 2DPYA 3A1DA 1ZUNB 3K4HA 1RC0A 4GM4A 1KZ7B 3E1GA 5L3SB 3B85A 4FCWA 4J43A 4ZT6A 3THXA 5HILA 1J9GA 3MJCA 3DCJA 3P2JA 4H6VA 5CFLA 1UBGA 4CKEA 2IYWA 1EFAA 2X7JA 2NXWA 1T36B 1C41A 4HGQA 4LXYA 3QVSA 2GN2A 5KSYA 4IVRA 4ZK2A 1QMPA 2HU8A 4D3DA 2AGVA 1O95A 3M34A 1TQHA 2VSFA 1E4VA 3RK4A 1SUWA 1RM0A 1OIVA 2I6FA 5BNZA 5JAIA 1UPBA 2DPHA 2F48A 2VH2A 1Y4DE 1C1DA 1KO4A 3MFQA 5LBTA 2QEQA 3NS7A 1XQ1A 2QZ9A 4BJ1A 1ODFA 2KYRA 5AM2A 3HVKA 3LSYA 4P4NA 1VJDA 5CBKA 1E2MA 4MRSA 2VJDA 1SBHA 1SXJC 3EG9A 4IHJB 1OPRA 2GXUA 3G2JA 3QOWA 4LJSA 4MXDA 3K53A 1QGYA 3RO7A 5B12A 1YR3A 3TR6A 5JQWA 1EYZA 1V1RA 3KO8A 4LXHA 3H3JA 5K3FB 3PLAE 3STYA 5GIOE 4HVLA 1QF6A 5CVUA 2BBSA 3KBBA 4CFYA 2Q9UA 1MX5A 4ANFA 2BTEA 4RGYA 5J63A 2ERYA 3HSKA 3MN1A 4IM7A 1ZQ1A 3RBZA 3DNPA 3OJLA 2NZXA 4LHXA 8LDHA 1M8KA 2DWCA 3AF4A 4FOSA 4LRWA 2VTBB 5BQFA 1Q7BA 4IYJA 1ULTA 3GQVA 1SU8A 2ZCVA 4IIBA 3ZXSA 1MQAA 1US8A 4CIDA 5IM4A 5GJVC 5B4VA 5C51B 1JMVA 3T99A 1DWPA 3Q88A 4NK4A 4KRGA 4J29A 4D0RA 2HBZA 3CVWA 1KZGB 4Q1FA 1N2JA 3WWPA 2XYVA 3EZXA 3WQBA 2CFOA