2X19A

Crystal structure of importin13 - rangtp complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
172
structure length
172
Chain Sequence
GEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGLEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear transport
molecule keywords GTP-BINDING NUCLEAR PROTEIN GSP1/CNR1
publication title Nuclear Import Mechanism of the Ejc Component Mago- Y14 Revealed by Structural Studies of Importin 13.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 45
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2009-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2x19A00
1UFQA 3C5HA 3AUXA 5FOVA 4B3GA 5FL7A 1ZP6A 2G6BA 1GNRA 4Q4AA 3AKCA 3B78A 3PR1A 4TL7A 5TXGA 1R10A 5FI1B 3IGFA 4C4PA 3KDSE 3PEVA 5F3WB 3MRSA 3I72A 8OHMA 5FFMA 2I1QA 3GPLA 4D81A 4D26A 3D7MA 3VNVA 4AKEA 4Q18A 4B2IA 3AVPA 6Q21A 5HR5A 4BEJA 4M2LA 3R7WA 1YJ5A 4GOKA 3TR0A 4DSTA 2MMCA 3BFXA 1JEEA 1MABA 4MQBA 2RGXA 2GJ9A 2W2TA 1OT3A 5FL3A 4R2IA 3LRPA 3WNCA 4QC2A 2QM8A 2IUUA 4WAUA 3AVTA 1RIFA 2GETA 3QXXA 5HCIA 1FMLA 3EPLA 4K46A 4TLEA 2EFEB 4EFLA 1OH7A 1DAIA 2D3WA 3DMNA 2CHQA 2KB0A 3EZ7A 4PC7A 1E69A 1HTWA 1KK2A 2Q6TA 2QUZA 1ESNA 3PENA 4M9SA 1Z0DA 1Z8FA 4MA4A 1S0UA 2IYWA 1IOZA 5GJCA 1WE2A 4DIEA 3UWOA 4NBSA 2H7VA 4BLQA 3RYTC 4EJSB 4HAUA 2IYUA 1CRQA 4KFUA 1DAKA 3KTAB 3U2QA 3WHLA 2ZE8A 3KKOA 1DOAA 3SDZA 1YZKA 2Q9CA 2XNSA 1R0WA 1XCGB 5AJXA 2QE7D 1GILA 2VP2A 1SVIA 3QXJA 5KPDA 2JJ2D 4F91B 4Q9LA 2QM7A 1T3HA 3C14C 3TRFA 4JVSB 4OI4A 1Z0KA 3RHFA 1XTRA 1IN6A 1YR9A 3E70C 2YYZA 3DKPA 1RVDA 3HDTA 3RS4A 3SJZA 4LYFA 3CNNA 3D3QA 2VP4A 4BFTA 1D2EA 5L3SA 4G3XA 4M21A 1G1MA 2J87A 2R6DA 3I3SR 5DYIA 4XH9B 5K8IA 2EU8A 5JEEA 1CR1A 4C3ZA 2VPPA 2ORIA 4N1AA 3F3YA 1UBFA 4YDSA 2B92A 2VHCA 1E2GA 3K0FB 4HUQA 5J40A 1QVAA 1X8KA 2ZYTX 4HZUB 4I1VA 3SNHA 2D7DA 1NRJB 2PCJA 3B2EA 1Z83A 5BQ5A 2GHIA 5FPKA 2QAJA 1SXJE 1TUIA 2RKOA 2IK8A 3QPUA 3GLGE 1OFIA 4DDTA 4GZMA 2EWWA 2PMDA 3LQRA 2YOHA 3WYGA 1GKYA 3FHTA 5JWHA 5HKKD 5HZKA 4ASUD 3B1ZA 1FP7A 4Q4HA 1F3OA 2BBTA 2D06A 2DHRA 5KO2A 4KAXA 3FE2A 3OFNA 4MRRA 4TMZA 4NKRA 1ZINA 2FJUA 5JLJA 3M0EA 4RFSA 2A5FA 4TYQA 1KKLA 4KYUA 3Q3JB 2GZHA 3CUEF 1XD2B 5FPTA 521PA 1G18A 1NLZA 2UZ3A 5IK2A 4CYMA 3FOZA 1NY6A 1AA9A 4V0NA 4CEIA 3SBEA 5FTMA 3D6TB 2ZRNA 1J2JA 1UDWA 4OI0A 4TQUS 3EG5A 1Z63A 3B8HA 3W5IA 2O8BB 1G41A 1G7SA 2HJGA 3EA5A 1DAFA 1OJLA 4L8GA 4PQFA 2P6UA 2Z0MA 2ZJBA 4IEEA 1T9HA 1HE8B 2PZEA 1P72A 4MYTA 4BFUA 1Q12A 2HXYA 2PL3A 2V9PA 2QSZA 1EWQA 1Z22A 3CNOA 4LC0A 1F60A 3QKRB 1ANKA 3IILA 3QXCA 4CRWB 3H86A 1OKKD 5H70A 4Q4JA 1EFCA 1I2DA 2JIZD 3LAWA 3U60B 4DUGD 4GPTA 3AF4A 1NLFA 5JCZA 3VU9A 1W5TA 3CF6R 1E96A 3AGPA 2QTVB 3C8UA 5EE3A 4QJ5A 1CP2A 2FMXA 3EAQA 4GNKA 4A8JC 1OIWA 1QHHA 1CTQA 2DBYA 3LX5A 4B48A 2NO6A 2J7KA 1X1SA 1RZ3A 3B7GA 2C04A 4RVCA 4C0AC 5F9HA 1E99A 3W8RA 2C9CA 4P4UA 4OK3A 1FMJA 4UJ5A 3DDCA 3THWA 3LX8A 4OBEA 2YWEA 4DIDA 1GRQA 3WBKA 1P60A 4UNQA 3K0AA 4Q00A 1E0JA 1GFIA 5JS7A 3PJRA 4HAZA 3GJ6A 1R5NA 4CVNA 1OH5A 3DOFA 3AVXA 4U7DA 5GVSA 1J90A 1XB2A 2OXCA 1MR3F 1RRCA 2ZSBA 1LS6A 2REXB 3CPEA 3R20A 3CX7A 5G53C 3BH0A 1E2NA 4L5BA 3BXZA 2MSCB 2C96A 2XX3A 2W2XA 2AFHE 1DELA 4DLSA 1H8HA 5TVKA 4F38A 1G19A 3GEHA 3NKVA 4BASA 3R9IA 4MKHA 4DDUA 3K70D 4G5GA 1M6NA 3RRNA 1YQTA 2VBCA 3FKSA 3FWYA 1KNQA 2ECKA 4PANA 5DIFA 2FA9A 5J4LA 1A4RA 4Q1EA 5LD2C 4NYMR 2ODNA 4BFVA 4FW9A 2PX0A 1J99A 5FPSA 2X2EA 1U81A 1TUEA 4DLZA 2D2EA 2BIFA 4F4CA 4DB4A 1KJZA 1G9XA 3CPHA 3U3KA 3T35A 1D5CA 1R8SA 4WIAA 2ZUDA 4EPXA 4YXWA 1ELOA 2WWIA 1NVVR 3JVUA 3K0CA 4L9WA 4EPWA 4LRWA 2XTZA 3EIEA 1XPOA 4V0KA 5FI0B 2F43A 3AH8A 3KL4A 3SJAA 4CEHA 4FMBB 4TSFA 4WVFA 5JHHB 4DCNA 4LV5B 4M1MA 1R0YA 2AX4A 2BCGY 4OQFA 1ZNWA 1G7RA 4IOMA 1PUIA 1KO8A 2AFIE 4MRSA 1W47A 1EK0A 3NTUA 2ODBA 2FE4A 1XTJA 4AYXA 1VECA 1U0JA 4PHTA 5G41A 2OILA 1W44A 1H8EA 4F7WA 4LJAA 1Q1ZA 1SVKA 4MGYR 4JBWA 1W49A 3PV0A 3SEAA 2GNOA 1TADA 3CW2A 1CXZA 2GEUA 2CJWA 4P4SB 4QL3A 5EE1A 4DEYA 1KKMA 1X8LA 2QBYB 2W00A 3CF0A 3HJNA 4MGZR 3VFDA 4LPSA 2AR7A 4M53A 4IDNA 2FOLA 2WPDD 1A7JA 3UMFA 1G3QA 3QIAA 4Q9HA 5EUMA 1KI8A 4RY2A 3SOPA 5CIQA 4AI6A 3CRW1 3DO6A 2F6RA 1QZXA 3Q8XB 3KJGA 2J0UB 4ILEA 2RGNC 4PO9A 3GJ7A 2VRWA 1O3YA 2G1JA 1MOZA 1E3MA 1OIVA 1ZJ6A 1T8UA 3KX2A 4OJKA 5JFGA 3WY9A 5FR1A 1VIAA 3M6AA 3HR7A 5EE5B 3MWJA 1CBUA 2XTNA 4E5UA 1G4AE 2P2LA 5FTKA 4AG6A 2EW1A 5EP3A 3CRQA 4PQRA 4BFZA 2F1RA 1DEKA 1XZPA 2WJGA 2OAQ1 3A1TA 5FPYA 1ODFA 2ZRBA 1SVWA 3OEHA 4HZIA 1XTKA 2P67A 4QJ4A 1D2MA 3WP0A 5JHGB 2BWJA 4TYYA 1K5DA 2O0JA 2GEVA 5JI2E 5F9FA 4QOSA 3RWMB 3H84A 4HAWA 4DLWA 3ICEA 4P33A 2J0VA 1Y3AA 5CB8A 3PUYA 3EWSA 2C9OA 3I92A 3MSXA 4QHTA 4KVGA 3TUZC 3BH6A 1HT1E 4TLCA 4RCYA 2J9RA 1FW6A 2ZS7A 4KFRA 1Q57A 3MG9A 3S1AB 2SHKA 4LHZA 4B2PA 3AVOA 2BKEA 2FZ4A 3W5JA 4ZV4A 3ZVRA 1L8QA 3MWKA 2BBSA 3HU1A 2V6JA 3QOFA 1C9KA 2CE7A 4M1WA 1GUAA 5DISB 2EYUA 4BZXA 3T1OA 2FEMA 3QBVA 1E2HA 3IIJA 3ADKA 2QN6A 3FB4A 5A4JA 1L4UA 3Q7QA 4FD2A 1FTSA 4W5HA 2N42A 1HURA 4QNRA 2ZAMA 5JJIA 3CRRA 3ICQB 2J7PD 4AD8A 4OJQA 2HLDD 4JBXA 2EFGA 2E87A 1EX7A 3ZVNA 2R6CA 2O0KA 2JLWA 4V03A 2A9KA 2F1HA 1VG9B 3ZIAA 4PTLA 5FOUA 3SE0A 3REGA 1X3SA 1DARA 5IDVA 1KK3A 4OYHA 2O52A 2ZRJA 2OCBA 1SKYB 4M8NE 3X2SA 2VP6A 4PO8A 2NPFA 5FUXA 4E07A 4EJSA 4DLYA 1N0UA 4R7ZA 3A37A 1AKYA 1E1QA 3KTAA 4YQFA 2ZRDA 4ESHA 3FTQA 3EASA 3P4XA 4FMDF 3UWKA 3CZQA 1YZQA 2D7CA 2LKCA 5BYKA 2IWRA 4WXPA 2RAPA 1KO1A 1Z0AA 2OXRA 2OM2A 2WMOB 4JMPA 3A4NA 2G88A 2ZETA 4X8OA 3T12A 2FNAA 2GJKA 3TQFA 1JEDA 5FTLA 1OXTA 2GCNA 1QHSA 3GJXC 4LJ4A 1PLLA 2GZAA 1E9AA 2H18A 3ZJYA 4DB2A 3AV0B 3X1DA 1JAIA 4DLUA 2Y8EA 5EQTA 1IBRA 1AGPA 1WQ1R 5L3QB 4J0QA 2OAP1 1IXRC 1FP6A 1KDPA 1J8YF 4IW3B 2OFXA 1TL7C 4MRPA 3Q5EA 2C5LA 1ZUNB 3LA6A 2GVDC 1HY3A 2ZE7A 3K0FA 2PEZA 4Q48A 2Q0HA 2PT5A 3SJCA 4HZUA 3TW4A 5JWRA 1MT0A 3KXKA 4C2TA 621PA 4D82A 2ZJOA 2JLYA 3EWAA 3N5CA 4I1SA 4K8OA 2ZANA 2YKGA 3EIQA 4PHFA 4XOIA 3QVVA 1JQLB 2WSMA 3DPUA 4YMWA 2V3CC 1KI4A 1YZTA 3OHMA 2BJWA 3BFKA 2XGJA 1NN3A 4BLSA 5HPYB 2FFQA 1JR3D 2O8CB 3SYLA 1MRSA 4HUTA 1T5IA 3NXSA 1D9ZA 3DZ8A 4TYWA 2CXXA 1TU3A 2WIAA 4IOLA 5H8WA 4QM7A 4PZZA 3TGPA 2D2FA 1YKSA 4DCSA 1XD2A 1IAQA 3AEZA 5ANRB 4EPRA 2PCLA 2NG1A 4BEBA 2GRJA 2JLRA 4GSYA 3I8XA 2WSSD 3ZD7A 1KNXA 3LVQE 1B23P 1F2UB 1TNDA 5EXXA 4TTPA 4A82A 1NIPA 3E2IA 2O8BA 1KZGB 4PC3A 3LVRE 2GCOA 5FBRB 1G17A 2WHXA 5EP2A 3AB3A 3WBJA 4CZ2A 3CB4A 2A5YB 5GADl 2IYXA 1S96A 1KJYA 1N6LA 1J70A 2F1JA 1COWA 1X86B 1Z06A 3RRMA 2WICA 1Q22A 3U5ZB 2AKYA 3QKRA 3TMKA 4YONB 4A6PA 5JCPA 4QGGA 3DEFA 5AUNB 1AKEA 1ZU4A 2ZRKA 1LFDB 2LKDA 5HKKA 2ZRAA 1WBDA 1BH2A 2GWHA 1KSJA 2WVJA 1ZAKA 1J7KA 1DADA 1XEWX 1TQDA 2VP5A 3Q85A 4I81A 1JECA 1ZC3A 2WM9B 2BBWA 3RS0A 4QM6A 2YWFA 4A0FA 2Z4SA 3BB1A 1ZVQA 2QY9A 2ZRGA 4Q9KA 2YWGA 1E2JA 5TV2A 2GAOA 3GLHE 1OXUA 3LQQA 4BLRA 4QKQA 1KO5A 3EZ2A 1GAJA 1SXJB 2ZJ2A 2QA5A 1XCPA 3GLGB 4KBFA 5JRJA 2R62A 1GSIA 5KSOA 3E5HA 4DCVA 1EGAA 2HUPA 3TAUA 2D74A 3AP3A 1E9SA 1N3BA 3UMRA 1VTKA 2WJYA 3B1YA 2GBLA 3J81k 2IUTA 3OIWA 4JLOA 4DWJA 3KB2A 3HR8A 1DBSA 4JLAA 1W1WA 3LY5A 4XIGS 2FGKA 2IC5A 4X8MA 4BLTA 1NKTA 2ZYWX 2GJSA 4JIMA 2JLVA 2PX3A 3N2IA 4I4LA 3QQ5A 4MITA 1OKKA 3TH5A 1FQKA 4RFVA 3EX7C 2QROA 2IS2A 1S1MA 1UKEA 4W5WA 1DO2A 1WXQA 5F98A 1UEIA 3HP1A 1KO4A 1OH8A 3I5XA 2FDCA 4DSNA 2REOA 2BHRA 4ERNA 3CKLA 3NH6A 1GL9B 3KKNA 2H8KA 3CLVA 2ZI3A 1YZUA 4ZDIA 3BD9A 4URZR 1F6BA 1Z29A 2A2ZA 1FOEB 1TF5A 3A1WA 5G3YA 2VEDA 1Z5ZA 4HB2A 1YRBA 1XPRA 3AGQA 4OKSA 3LO5A 2Z83A 3K09C 5GJVC 1JJVA 5LB4A 5AJVB 3R8FA 4GRAA 3U44B 2NPIA 5FTJA 4Z54A 1ZM7A 2P0EA 4JJZA 1SKYE 4FN5A 4M1TA 4N0EA 1E2EA 4N0DA 5LDDC 5AUOB 2FSGA 3V9PA 1G3UA 1KTVA 2CEAA 2W6JD 1A2BA 1S4QA 5CLLA 3SYNA 3AF3A 3T5DA 1GOTA 1CR0A 3CWZA 4EFMA 4A4DA 4B76A 1NL3A 3RNLA 1GL7A 4M1KA 4ZCIA 2XB2A 3QJYA 5CB6A 2ZXUA 5CITA 1EFTA 4LBWA 5DN6D 2ZIAA 2OG2A 2W2VA 3OEEA 2F3TA 2VP0A 1TEVA 1S9HA 4QRHA 3BJIC 3TSOA 3SS8A 1NMYA 2RHDA 1JXMA 1LF0A 1OFTA 4QBHA 3VX4A 4B47A 2B7BA 5FUYA 1NY5A 2C8VA 4BZQA 1KZ7B 2NO0A 1EXMA 3VMFA 1XD9A 2IF0A 5DI9A 4Z1MD 4WOPA 3RSLA 1QG4A 3OAAA 3KXIA 3LXXA 5CJ2A 4A0GA 5M04A 3VKGA 1YU9A 4M4SA 1Q1BA 1KI9A 2QMOA 3UANA 4GDFA 2EFCB 4US1R 5BXQC 2ZE6A 3MWLA 4XTCS 3DM9B 1E79A 1T3SA 2J59A 4P4SA 4TT3A 1T4GA 2QBYA 1FTNA 1A82A 4XVRA 1HE1C 1RKBA 1M74A 3QKSB 1ZIPA 3TKLA 3TR5A 3ZVMA 4IRUB 1NVUQ 4R71A 4LJ5A 2J46A 4RD3A 3IO3A 4BRUA 4PAQA 1ZCBA 1OE0A 1NBMD 5BWMA 2J0UA 1Z0JA 1MV5A 1LW7A 1JBKA 3TVDA 1CJUC 1GKIA 5G40A 4DSOA 1Q20A 4UXHA 1XDBA 1N5KA 1N6HA 5JI3E 1FNMA 3IO5A 3VHLB 1ZMXA 4DLVA 5GJWC 3A1VA 4E09A 1HT2E 5C18A 2JLUA 2CK3A 4A0RA 2V1XA 1TPZA 1N5JA 2QMEA 3NHAA 1OXVA 3GD7A 1MKYA 2H57A 1V5WA 1W2GA 2KBEA 4OQXA 3U3OA 2VTKA 1Z0FA 3B1VA 4LX0A 3CONA 3NBYC 2FZLA 5J47A 2BOVA 1KI7A 4DKXA 3GP8A 3X1XA 3SFZA 2F3RA 2KJQA 2GJAA 4IXNA 4ZDJA 1WF3A 4LCBA 3WNDA 3EA0A 4GMDA 4POAA 4XJXA 4QGAA 2BBOA 1W4CA 3ZZ0A 1SHZA 5FUVA 2FN4A 2WOOA 4DRZA 3T15A 1QHYA 4LJ6A 4NDZA 2XZPA 4P4TA 1G8FA 3QVUA 2P6RA 4XVUA 3EPJA 2GXQA 1KI6A 2YNMA 2ATXA 1R4AA 4PPGA 4DCTA 5KNCA 2OO7A 4W5JA 1P9NA 3K09A 5FBQB 1A1VA 2XXAB 1Z6YA 3QE0A 3SC3A 2WTUA 4G5SA 3OE7D 4DXAA 4G5OA 3S1AA 1G6HA 4ZCMA 3AUYA 1JR3E 1MO4A 3WYAA 3T34A 5KTYA 2XJ9A 1G8GA 1R6BX 4BFSA 1II9A 4EIWA 1NSTA 1E2KA 4AYTA 4URWR 1Q1EA 2B8WA 4QBFA 1A2KC 1KHTA 2J0QA 5TDHA 4B6FA 5L8VA 1YR6A 1G6OA 5JZVA 1D8TA 2ZYVX 4LYHA 1ZD9A 4JYBA 4KXFB 4UQOA 1XJ0A 3QG1A 2P5TB 2WIBA 5E3HA 5EZ5A 2RGDA 3IIMA 3VR4A 2WOJA 4NCIA 4DLRA 3U7FB 4O2RA 2JJ1D 4PAMA 4TZ0A 4HATA 3O8DA 1BMFA 2V55B 1GWNA 3IHWA 4EAQA 2NO1A 3NVAA 3R9WA 5AJZA 4LJ8A 1QDEA 3K53A 2JAQA 4RD4A 2G9NA 3O47A 3TUIC 2IF2A 4B6EA 4GBMA 3FGNA 3PQCA 4RJLA 3HYRA 3WXMA 4KO8A 1SQ5A 1D2NA 2IYQA 1TTTA 1KDTA 4JLDA 2OBNA 1Z07A 2XOKD 2W83A 4TMXA 4YLGA 5ELXA 4IEIA 4TWZA 2NO9A 1ZNYA 4PPNA 1AS0A 4FINA 5J4KA 2QMUA 3BK7A 3K0CC 3ND8A 2ODWA 3M1IA 4LBYA 1II0A 1G3RA 3VR2A 3OESA 3Q7PA 3CM0A 2GJ8A 2WKPA 2YOFA 4CT4B 2B6HA 4OI2A 2GCOB 5IHPA 1EG7A 1AJEA 2EYQA 3ASYA 1YR8A 2J7PA 3B13B 3GJ3A 3KJHA 4JT4A 3EZFA 1SULA 3SR0A 2AK3A 4OK5A 3SHWA 1UBGA 2XSZD 3BC1A 4Q5IA 1IY0A 2IUSA 2QENA 2K5UA 2RGGA 5L3QA 3ZH9B 5BW8A 4R98A 5EUQB 1LY1A 2QQ0A 3EC1A 3L0IB 3IHLA 5EXTA 3HPRA 5B30A 1W7AA 1DAEA 3W9YA 3TLXA 1E9CA 2OSBA 2ZJYA 1JR6A 3NBXX 1HV8A 4QJ3A 3ZYCA 2FF7A 4DJTA 1OXSC 1ETUA 1W0JD 5AJWA 3TE6A 1NP6A 1N0WA 1TU4A 3F8TA 3FFBA 2ZVPX 2GESA 2QPTA 4JLJA 2WJVA 4DDVA 2WAYA 3KQNA 2CBZA 3PVSA 4PR0A 2NZ8A 2O5VA 2WJJA 2OHFA 1KOFA 2XNDD 3C4JA 4TYNA 4LBZA 1EFHA 2N1BA 3X1ZA 3DZDA 4QHSA 3T1QA 1E0KA 1N5LA 4IDQA 1Z3IX 4IOKA 2IX3A 2QQEA 1OFUX 4A2WA 2O8CA 2QZ4A 1IONA 1OHHD 1P2VA 1UADA 2IYYA 4RD0A 4PZYA 1E94E 4LWZA 4YMSA 5K8UA 3KB1A 2BMJA 2ZU0C 1M7GA 4PX9A 1XMVA 4NL4H 4H1VA 1S8FA 4G5QA 4P3YA 3K0SA 4HEJA 4AC9A 1XTIA 3GLFB 2P3SA 4URYR 1N25A 1UEJA 5KU1A 4A15A 4PSVA 4JL5A 1F2UA 4NYIQ 3NBFA 1GL6A 1GNQA 3RS2A 3QUSA 3LWNA 4U5XA 1RRPA 3BERA 4G0NA 4KLZA 4G5RA 2GF0A 3O8RA 3ZD6A 3FDIA 5EP1A 4BFWA 2OE2A 4B35A 5KDOA 5E4FA 1UKYA 3B9QA 2J5XA 5DGXA 3U6KA 4V02A 4JSTA 2IXGA 4LC1A 2VYFA 4KODA 2CL0X 3RRYA 3KJIA 3I62A 4MDFA 3U3RA 3O8BA 3AQ4A 4EKDA 4JJKA 1JPNA 2Q3FA 1BOFA 4MDEA 5CK4A 2V7QA 2QPAA 3B85A 4KU4A 1AZSC 2C9YA 1S3SA 1MRNA 1T3LA 4TLAA 3TSWA 1BKDR 2QG6A 3D8BA 2ONJA 2BDTA 3SU8A 4MYUA 3UKDA 4CGZA 4LI0A 5DNYB 2HV8A 2H16A 2IHYA 4OL0A 1E9DA 1KI1A 2F9MA 1F2TB 2MSEB 4UNPA 1FPMA 2VO1A 4GZLA 1ZM4A 1TEXA 1IXSB 2FPKA 3DMDA 1XMIA 5J4YA 2AKAB 5KOYA 4WA7A 1SGWA 1PV4A 2WSSA 3P4YA 2CDNA 4QXAA 1WB9A 3SI7A 4QFMA 1SXJA 2R44A 4FIDA 2H17A 1DAGA 3MCAA 1GRRA 2GKSA 1FUKA 3GLGA 3AVVA 2H1LA 1NBME 2GEDA 3B60A 3AKYA 4DLXA 2OLJA 3K9GA 4ARZA 3K70B 2QGZA 3E1SA 1OB5A 1AIPA 4XWKA 2Q3HA 5JECA 2ZE5A 3LFUA 1QHGA 3X1WA 4BZPA 4BECA 4EJSC 3I73A 2RGAA 1Q21A 2X8AA 3GQBA 4BFYA 2WWFA 2ZYUX 3JZMA 4HB3A 1R0ZA 1RPZA 3B1WA 2XEXA 2CHVA 5CM9C 4Z8YA 3QI2A 1WDTA 1Q44A 2C03A 3FMFA 4PZLA 721PA 2CE2X 3IIKA 2FPMA 1GTVA 1OV4A 3U44A 4LSGA 1EX6A 2G3YA 2KI5A 3B1XA 1I2MA 4TQ9A 1E0AA 2CMKA 2ZTSA 4AIIA 1P9WA 2B21A 1XEXB 4JKYA 1ZC4A 1FL9A 2HYIC 1E32A 2ZREA 2IL1A 4A2PA 1IQPA 2WKRA 1R8QA 3F0TA 3NHBA 4MYHA 3L8ZA 5DI3B 4KVAA 2Q9BA 2ZSDA 1CEEA 3AVWA 1G64A 5DLQC 1G5PA 4B73A 2AN9A 3WP1B 4JLMA 3GLHB 3MGCA 4C0LA 4AKGA 3O8CA 2PZGA 4II7A 2B8TA 1HUQA 1DO0A 4D0NA 2JDID 3FMOB 1KI6B 2WWXA 1Y63A 2WKQA 3ZDQA 3HWSA 1M34E 3IQXA 3TQCA 1E2LA 4LK2A 221PA 3KQLA 2ZJ5A 4KBGA 3WRYC 1U9IA 4K81B 1E9FA 2Q9AA 3IEVA 1E9BA 4JLPA 2P6NA 4C2UA 1CRPA 2ZSEA 1W36D 4OHXA 4R2HA 3THXB 4B44A 2YV5A 1QG2A 1E2PA 3A1UA 1ZYUA 4JBYA 1IN4A 2OBLA 4LYAA 3QKSA 3ASZA 4OI1A 2I1VB 4I99A 5DN6A 2CCKA 1UAAA 4QGFA 1QF9A 2ZR0A 1ZM9A 4CT5A 3T1VA 1P3JA 2CNWD 2NGRA 3CNLA 5FBWB 5C4MA 2R6AA 1G20E 4CEJB 2BEKA 2QGNA 3QF7A 4Z1MA 2WJIA 5EP4A 3TVTA 1N6IA 3TJZA 1DTSA 3V4FA 2YC2C 2QNRA 3HU3A 1W48A 2JA1A 3P1JA 1AS3A 4MKIA 2QORA 1S9DA 3GLFE 4O3MA 3CR7A 1KIMA 2AWOA 1W36B 4PC2A 1UM8A 2NOAA 2QRNA 1E9EA 2YHSA 1KY3A 2Q3MA 2VHJA 2VL7A 4EPTA 3ADDA 5CK5A 2IHBA 3BIFA 3AVYA 3KUCA 2IYLD 4US2R 3W6PA 4XWAA 3DL0A 4L4UA 1BIFA 2ZVQX 2ZAOA 1JAHA 2BMDA 3Q72A 2VF7A 1NI3A 2CCJA 4A9AA 4RD1A 2OLKA 2Q21A 5JRZA 3LBIA 4DEXA 2XXAA 3EIHA 1VG8A 1CF4A 2QT1A 2ZUCA 1W46A 2WV9A 5SZJA 2GBLC 2ZI6A 4KYIB 2D4HA 4AKIA 1K8RA 4EUNA 1NIJA 4AWXA 3WMGA 2I3BA 1OPXA 2FFAA 5H68A 1S1CA 4B3DA 4B74A 2DWOA 4BE7B 4TMKA 2ORVA 5AJYA 4O25A 2XZLA 2YC4C 1X1RA 2IW3A 2DWQA 3VR1A 2PLFA 5JSZB 5DHFA 4D4MA 3L0SA 3W6NA 1CJTC 1GZSA 2IYTA 3UPUA 4IDOA 1GG2A 2VHQA 4FI3C 2ZI7A 4EPYA 4A6XA 1I4TD 1T91A 1XXHE 3C7KA 1VYTA 4JLBA 3LLUA 2QE7A 2RMKA 4PC1A 3GCGA 1WA5A 2JJ2A 4HB0A 3BS4A 4KFSA 4NTZA 5DE3A 1SZPA 2ZM5A 2QTHA 2ODEA 1NN1A 3LW7A 3CH5A 5SZIA 4B43A 4C9BA 2HJVA 3EZ9A 2V54A 1JPJA 3HU2A 1RRGA 1VCMA 1XRJA 4ZIRB 1ZM2A 2QMHA 1H8HD 1OIXA 3HYTA 4Q66C 3THYB 3OE7A 3IPXA 4H9GA 3T06B 4IOJA 2OUKA 4W7SA 3I4LA 4ZI2A 2BM0A 4UNNA 1LB1B 2ZI9A 1VHTA 3GLIE 3KKPA 1PVOA 1W4BA 3HPQA 5CIWA 2G0TA 2VIIA 3AP1A 2ZI4A 4GOJA 1GVNB 2F7SA 1ZD1A 2ZRMA 1AZTA 1ESMA 4P0TA 2ZJAA 2R9VA 4PAOA 2X19A 1QHNA 3CF2A 2HF9A 2C78A 1RYHA 4PSKA 4S35A 1NJGA 1NVXQ 3P32A 4G01B 3QEOA 2DFLA 1KY2A 1Z6GA 2O8EB 5KNBA 4YMTA 2XJ4A 3B9PA 3ETLA 4B2LA 3K70C 1HQCA 1OYWA 2R6GA 1YZNA 2J1LA 1EFRD 4HLQB 5UKDA 1ZD8A 5FOSA 4WBSA 2F55A 1U8YA 4ASUA 1UF9A 3ZGXA 3MMPA 1CJMA 4HI0E 2OESA 4M1YA 1TQ4A 1U8AA 4G1UC 1DPFA 4NMMA 3IKJA 3MLEA 1T8TA 2NQ2C 1Z28A 3A58B 3LXRA 2KSQA 5D3MA 5FTNA 5KDLA 3RS5A 4ABYA 1M7BA 1ZUHA 2XOKA 3UG6A 4MKFA 4P32A 5L3VA 2B7CA 4WXRA 4URVR 3A4MA 2ZU6A 1JXOA 1L2TA 2VHTA 4JT2A 1Z0IA 4E03A 4TQAA 1G7CA 4DZZA 4P31A 3A8TA 1XP8A 4TMVA 3G5UA 4L15A 2ZUBA 1GKUB 2AXNA 2X2FA 3FHOA 4OK6A 4LY6A 3BB4A 1MH1A 1UPTA 3REFA 1V43A 2PJRA 3RAPR 3C16C 1JB1A 4ZDWA 4MUAA 3IPYA 3RC3A 3QNUA 4ARZB 1P62B 1QVRA 1AQYA 1DE0A 1E2DA 1NN0A 1XEWY 4LV6A 4Q02A 2XSZA 2Z5FA 4DVGA 5TARA 1NG1A 2NO7A 3CRMA 3LD9A 1YR7A 3RWOA 4Z51A 3GLFA 1SVOA 1UDXA 1OFHA 2FFHA 2JIZA 1E2FA 4TLBA 3K0EA 1VPLA 2ZRCA 4QNMA 1IY1A 4B3XA 4DUGA 3L2OB 1XFAA 1TMKA 2UZIR 4RZ2A 3VNUA 3GFOA 3JZAA 4C7OB 2JLXA 2ERYA 2GTPA 2G83A 5P21A 4CDGA 2BJVA 2ZROA 1R7RA 2QAGA 4WZ6A 4MYCA 3SFVA 4B32A 4Q1FA 1DAMA 1FZQA 3OEHD 4TLDA 1CJKC 2GXUA 1WRBA 1GDDA 1W4RA 4Q1BA 5FBLB 3X1YA 4B34A 1QRAA 5B57C 4PQYA 3DHWC 1VCNA 1ZW6A 3FVQA 1N6RA 5CLQA 3PITA 3FYHA 4LPKA 5C1BA 4PFSA 4C0HA 5FH9A 3U4QB 1BO6A 1P2UA 1S3GA 1VYVA 4PHGA 4IVQA 4A8JB 2J3EA 2ZRLA 1T0JB 3EW9A 4V0OA 2RCNA 4R9UC 1T6NA 2XAUA 1LTQA 4MKGA 4HAYA 2QPOA 1F2TA 2FGJA 4Y0VA 4NYJQ 4GP6A 3VTKA 1HA3A 4FMCF 2HDNB 1II8B 2LCFA 2WMNB 3FMIA 5C46F 3KQUA 4Q9IA 2GDJA 5K8LA 2IS1A 2X1VA 4F4JA 4N3NA 3CIOA 2OV2A 4TZ6A 4IJMA 1BYIA 1Z2AA 2G0NA 3H4MA 3PUWA 2FEOA 1VMAA 3I1FA 1GRNA 4Q7KA 5E7JA 4C0QC 1KJWA 2DFNA 1QBKC 3VHXA 2GVZC 2BVNA 1P9RA 4XWOA 5JWOA 1NG9A 2C2HA 2GA8A 1NMZA 4OQNA 1VCIA 1YRAA 5AUQA 4FXPA 3RS7A 4JZKA 3KKMA 4YMVA 3RRZA 4NONA 1W0KD 1W5SA 3ZIAD 2EFHB 1DAHA 3ND9A 5EXPA 3EXAA 5GJBA 2E1RA 5JJLA 1G7TA 1SVLA 1Z47A 3QPWA 2AL7A 5AWFC 3RSOA 1LF5A 1KSHA 1XBTA 2W0SA 2CHGA 5LD2B 3SJBA 4IVRA 3ZVLA 1EFUA 4FMDB 5F2EA 1RJ9B 2J0SA 1E1QD 4GL2A 1TQ2A 2WWHA 1E9RA 3A4LA 3CH4B 2P65A 4OHZA 4LHWA 1ZUIA 4EDHA 2AK2A 4A1FA 2V4ZA 1S2MA 3C41J 3GEEA 1G4UR 4ACBA 2EWVA 3GMTA 4BLPA 3BGWA 4UJ3A 1XEXA 1GITA 2E9SA 3THOA 2DCUA 4TL9A 4GMXA 1AGRA 2R8RA 4AG5A 1LS1A 2CVHA 5DI3A 2YWHA 3A1SA 3LW8A 4OQLA 4ESVA 1XMSA 5FOWA 1NSFA 5D3QA 2QU8A 1N6OA 3FHCB 4LJ9A 1GM5A 1YHNA 2OBMA 4B75A 3GLHA 1KGDA 4NYIR 4A0HA 1YZGA 2GXSA 4D2IA 1UKZA 4C30A 1KI2A 2QP3A 2WPDA 2OCAA 3EPHA 1G8HA 2WBLC 2Z43A 1OLOA 4Q01A 3QXSA 4Q9JA 1CJVC 4RKEA 1AQUA 1AK2A 2NZJA 2VQSA 4ZKEA 4D4KA 2V1UA 1VIYA 1Z08A 2ORWA 2FPLA 4O2LA 1IN7A 1KO7A 1Z2CA 1P73A 5DYGA 3SZRA 5E7IA 3THXA 3R9XA 2MSDB 2Z6VA 2QEQA 2DFKB 1E1RD 2BCJQ 1PZNA 4IFBA 5CM8B 5HTKA 4D0LB 3NH9A 2YVUA 5KSYA 3I5YA 1KYIA 1O87A 4NCHA 3T1TA 2JLQA 3WMEA 4B3BA 2PZFA 1L7VC 1P6XA 2KE5A 4GOXA 3TIFA 3ADBA 2ZPTX 3AKEA 4Q1DA 5BN3A 4QBIA 3IQWA 4H1UA 4EFNA 1IN5A 5B58C 3WNBA 2DYKA 4QG7A 3UMSA 5JEDA 4EQ6B 4A2QA 5GVRA 3CX8A 1SHKA 2BV3A 2GF9A 2R65A 1UKVY 2VSOA 3F5FA 4KFTA 3VAAA 2FSIA 4Q47A 5KSPA 2JLZA 4CEJA 2FFBA 2IS6A 2JDIA 3CR8A 1NNEA 3SQWA 5KUTA 1CULC 2OCPA 3BAFA 3ZZUA 2DWPA 2DY1A 4FCVA 2FX3A 5DHAA 2QSYA 2HT1A 3P20A 1N5IA 3G82C 4BGDA 1T5LA 1CS4C 3OIUA 3CZPA 1B0UA 4PXAA 3TUJC 1CKEA 1FX0B 1WP9A 1COWD 2JATA 1JJ7A 2H92A 3RANA 5J4HA 1D6JA 4RZUA 3CO5A 2PT7A 2G77B 5FOXA 2VA8A 4ON9A 2WWGA 4PPFA 3QF4B 1SXJC 1U98A 2GCPA 5E7MA 4W9MC 1K5GA 1KK1A 4IDPA 4NZYA 3W6OA 3VR6A 3L0OA 3C15C 4MGIR 3VKHA 2N46A 3FKQA 3LH5A 2JGNA 2CLSA 3EC2A 1A5TA 2HLDA 1HH4A 3OIVA 4JL6A 1NF3A 4OHYA 3C5CA 4NCJA 2CNWA 3ZLJA 1IJFA 2NIPA 3ECCA 3SHFA 2IA5A 1I4LD 4QHYA 1XPUA 3NDBB 3U3JA 3WYFA 1WBBA 2D62A 4Q7MB 4WZBE 4TMWA 4MUBA 2PMKA 3NBZC 4AURA 2NMVA 5JSZA 4XD7D 1UBEA 1OXXK 1XCMA 3OF5A 2DFTA 1VHLA 3MFYA 3PIRA 4QBGB 3U61B 1X8JA 3NIBA 2BEJA 5D3MB 3EARA 2VF8A 1XX6A 1VCOA 1IN8A 2Z4RA 3T61A 4D0GA 2FV8A 5JS8A 2BMEA 4LYJA 3KQKA 5EE0A 4DCUA 1AS2A 4DHEA 2JASA 3IBGA 2R6FA 1H65A 4EPVA 1Q0UA 1U99A 2ZJZA 5LBIA 2WWYA 3QY0A 1GP2A 5EXSA 3L82B 5HCNA 3CRVA 4D4JA 3PEYA 3A36A 2VH5R 4XVQA 1US8B 2EQBA 3MD0A 4AKHA 3Q9LA 3AM1A 4RD2A 4CW7A 4IKEA 3WMFA 4BRWA 1JQJC 5FUWA 4ZIRA 3FMPB 5KPJA 5JJKA 2CLCX 1XJQA 3THYA 4U00A 4IXMA 3KJEA 5G3ZA 3VQTA 3WHKA 3DOEA 1RRFA 4C0JA 1Q3TA 3ONWA 2O8DB 1U8ZA 2ZS9A 2FSFA 4IFEA 4LDJA 1IM2A 5A0FA 4F93B 4YC7A 2ZRHA 4RD6A 1WCV1 3MWYW 4ZDKA 3CX6A 1X6VA 1MO5A 4DT1B 1G21E 1TAGA 2KWIA 2QAGB 2A5GA 3MJRA 3QEJA 3K1JA 1CIPA 2RGEA 3TAHA 4ZPXA 3ZS9A 2OCYC 2O8EA 5EJEA 3OEED 3L0PA 2WAXA 4FMCB 1HYQA 3AP2A 1LVGA 1U9IC 2HYDA 4I1UA 3UATA 2W6ID 5EE9A 4JVNA 1JR3A 4KSBA 3BWDD 2YINC 2VP9A 1IHUA 2OT3B 1W2HA 4C0KA 5IRCD 1ZM3A 2CLDX 3OAAD 1Z6TA 3QXHA 3P27A 4DDWA 3U4QA 2J41A 3LBHA 4M0LA 5FL7D 4BPBA 3NC1C 3K9HA 3IEUA 4MRNA 4HDQB 2QL6A 1U2RA 2HCJB 2OFOA 1E79D 1XXHB 2IS4A 4TT3D 5BN5A 3PUVA 5CDFE 3UIEA 2O8FB 2JCSA 1NMXA 4PSAA 3LNCA 3D31A 1BS1A 2UKDA 4NE2A 1E98A 2ZS8A 5E95A 3QSYA 1N2CE 1RFLA 1KMHB 4KV9A 1KSFX 4LUCA 3LBNA 4Q21A 2EFDB 3IBYA 1OH6A 4TTQA 2IEYA 2JEOA 1XWIA 1EFRA 2BM1A 1N6NA 1E6CA 4GP7A 4RCZA 3OZXA 2GILA 2CK3D 3GLIB 4JKIA 2DB3A 2P5SA 3TK1A 2XZOA 2R2AA 4KLNA 2ZJ8A 3N70A 4DSUA 4C7OA 4AK9A 2IYZA 3KFVA 2GK6A 3SBDA 2A5DA 1KMQA 3AVQA 4OHVA 4Q1AA 1R2QA 4Q4AB 3NG1A 3BFVA 3T5GA 2VLIA 4US0R 1RE0A 3TNFA 4ITRC 4YMUA 1XJCA 3OIYA 1LNZA 4JVLA 4D25A 1YVDA 3QKUA 4HYYA 2F1IA 1M7HA 1VG0B 2VHUA 2IT1A 2ZITA 3R8CA 1HQYE 3R7WB 5IF9A 1BYUA 2REBA 4LJ7A 4CF7A 4Q7JB 1XTQA 4A8JA 1MABB 1SVSA 4JVMA 3BORA 4Y0AA 3JVVA 1OF1A 3W34A 4LJYA 2O0HA 4M1OA 1KSGA 3AKDA 1XZQA 3VX3A 2A5JA 5LB2A 1P5ZB 1VDZA 2JJ8A 2PBRA 1NKSA 1G8YA 4XSHA 3ZZTA 4BUJA 1II8A 3H0KA 3NWJA 3LDAA 4HDOB 4NH0A 1M8PA 3V00A 3TW8B 3MJHA 4NHOA 4Q03A 5JMTA 1K6MA 3GJ4A 4NU0A 2ONKA 3GEIA 1FUUA 1P75A 5B2ZA 5DO9A 3LLMA 3G0HA 1P7CA 1E4VA 3KZ1E 3NEYA 1F48A 5HE9A 421PA 1IJEA 3BH7A 4ZCLA 4PC6A 5FPHA 1N6PA 2IYSA 5AR1A 3RDPA 1P4SA 1KDOA 5KHOC 3PCRB 3NEJA 1TQ6A 2YOGA 1ZCAA 1AM4D 1BMFD 3UK6A 2QTFA 1T0HB 2V8OA 2RB4A 2ZQ5A 4KI0A 2LWIA 2NTYC 2W6JA 2AD1A 2UVQA 5SZHB 4A92A 2CCGA 1U0HC 1KI3A 5KDDA 4TL6A 4UNSA 2MMGA 3OFND 1GIAA 3I8SA 1DG1G 1SVMA 3KKQA 3W3ZB 3RC8A 4WW0A 4OHWA 4X8HA 5L3SB 3PEUA 2A78A 5IK2D 4RZXA 1QHIA 1RJ9A 5JBQA 3GFTA 4HLUC 2QP4A 3LV8A 5IT5A 2VSFA 2FSHA 1IXZA 1JNYA 1G16A 4NP6A 4TYPA 4V0ME 1XNJA 1UJ2A 3KUDA 4M1SA 5SZKB 5LPNA 4C0BA 2C99A 1P61B 4HUQB 4M9QA 2YZ2A 3KQHA 2PEYA 1FNNA 2XTMA 4C0SA 2ZR7A 4OQMA 4BLOA 4FCWA 4UNRA 4X8LA 4S2EA 2L0XA 1VYUA 4Q19A 3FPAA 3UXMA 4RSGA 2BMFA 3IUYA 3K9NA 4D6PA 1MO3A 3SYKA 5C4GB 1C1YA 4QGHA 3VKWA 1KAOA 4GT1A 1G3MA 1W0KA 1G8PA 1ZNXA 2J45A 4NYMQ 2FH5B 1PJRA 2ATVA 1OW3B 821PA 2IXEA 3RS3A 4JSYA 4B3FX 3ZS8A 1Q1QA 4ZO4A 4LOAA 4M9XA 5CJPA 1G5TA 1R0XA 4ZKDA 4F92B 3UG7A 4Q4HB 5CDFA 1U0LA 1ZRHA 1P2TA 3AF1A 1VKJA 1P2SA 5A5GA 1NVVQ 4RFSB 4LZZA 1E2MA 1NBMA 3W3AA 1EESA 1YZLA 2RGCA 3U7EB 2I4IA 5CYPA 4GI7A 3NDPA 2C98A 2ZRFA 4CEIB 1Z6AA 3CBQA 3KXLA 4PPQA 4RZ3A 1QHXA 121PA 1TX4B 3DVLA 3PEWA 3QG5A 4HLDA 1ZNZA 3K8YA 3W8NA 4V0LA 3L8YA 1CLUA 1CU1A 4LGMA 4E22A 1IY2A 2V6IA 4TL8A 4GFDA 2RGNA 3EZ6A 1KK0A 2C77A 4IVPA 3CWQA 3U3MA 1PUJA 1GNPA 3H1TA 1OSNA 1RW4A 3MAAC 5AK0A 5HE8A 4NYJR 2HF8A 4NCKA 1XF9A 2AXPA 2QAGC 3P26A 4KJZA 4DBLC 4EQ6A 2HCBA 5K8TA 4B71A 4Q7LA 2XITA 4WZAE 3U7HB 4Q4JB 2IBMA 2BC9A 3V4RA 1M1YE 1VG1A 3QENA 4YDHB 1WMSA 2GAAA 3W90A 2WZQA 3K9LA 2IXFA 3DM5A 4ZI3A 1I4DD 4JS0A 4LHVA 3VR5A 2FWRA 3VU9B 5BYJA 1KDRA 1FQJA 3AVUA 4IHQA 4A36A 4M22A 4URUR 4URXR 4MGKR 1XMJA 4JLKA 3SQXA 1QHHB 3PUZA 1FX0A 4AY2A 2H5EA 2QT0A 3FKSD 1SKQA 1E1RA 4D4LA 1DVRA 1JALA 3AF2A 4M9ZA 5TY0A 1MO6A 1CR4A 3BE4A 3THWB 3BRWD 2V7QD 1XD8A 3QF4A 5FR2A 5EZ6B 3RABA 3IDQA 1R5OA 3WRXC 4JLNA 3B82A 3K0AB 4HLUA 2QRZA 4YXWD 1OB2A 2PH1A 1OYYA 4LV8B 3FFAA 4PO1A 1M2OB 1ONBA 2HXSA 3PUXA 4BQSA 2JJ1A 1RC8A 4PHHA 1N6KA 1KAGA 5AUPB 5KNDA 2W0MA 2IWHA 3Q5DA 1ZU5A 2A3RA 4TSFD 1SXJD 1N0VC 4DC9A 2BKUA 2WWWA 2C95A 4BWYA 3I61A 1NLYA 5J4VA 1XEFA 3DKVA 4XSGA 5TMPA 4DLTA 1J8MF 2RH5A 1U94A 4JYCA 1H8ED 3GJ0A 4HB4A 2ANBA 2W58A 2X77A 1G3IA 1U90A 3KFXA 1Z6XA 3GJ8A 4Q4LA 5H1YA 3RLFA 5BN4A 2QP9X 3GJ5A 4FCTA 3U6BA 1ZIOA 1E2QA 2KBFA 2ZRIA 2GK7A 4V0MA 1US8A 2A30A 2RGBA 3CPJB 2CVFA 4HSEA 4NCNA 3BBPA 5FOTA 4U02A 1LV7A 4KCGA 4NPHA 4L9SA 2OFWA 1NN5A 1R5BA 2ERXA 1HEIA 4LBVA 2F43B 1E0SA 3TSZA 3ADCA 1FFHA 3L43A 2ZRPA 2PLRA 3H2YA 4CEHB 3A6PC 1G5RA 4TTRA 2O8DA 4B33A 3N2EA 4D80A 4JL8A 3QKTA 1W4AA 2CL6X 5DH9A 4XD7A 1TF7A 3B6EA 3VR3A 4KITB 2AWNA 3B5JA 4IDHA 1W0JA 3SN6A 2WJHA 3ZQ6A 2CL7X 2DR3A 4FWIB 5J5CA 3PXGA 1AN0A 2IYRA 1Q3HA 1YE8A 1ZBDA 1F5NA 1XTSA 4DT1A 2FU5C 2F9LA 2RHMA 5B64A 2XNDA 2IYVA 1CR2A 4AYWA 1E4YA 5C2JB 3PG5A 2ZEJA 4HAVA 2CJWB 4XTRA 4L16A 3PFIA 3AF0A 3BOSA 4HAXA 3RVBA 4ACAA 2ANCA 1OHHA 2ZR9A 2ZI5A 4HLCA 4FWTA 4O0MA 2ZSAA 4CIDA 3MUFA 5TB5A 2VSXA 2XB4A 4JLVA 3QPVA 1DG3A 5L3RA 1JI0A 4LHXA 4TN1A 3EPKA 3M4YA 2A7QA 5KYKA 2PJZA 4UKDA 2TMKA 4F4IA 3NC0C 2FG5A 5KSZA 1L4YA 1XXHA 2ASEA 1EWRA 2OEPA 3ZQJA 3BB3A 3U7GA 4KSCA 2O8FA 2GZDA 4Z8XA 2AD5A 1G291 1NVWQ 2JLSA 5FBVB 2AHOA 2OZEA 4Q1CA 4LHYA 2G1KA 4B3CA 2YJTD 1KMHA 4TMTA 3GFPA 4I1OA 4UXJA 1XU4A 1NJFA 1DS6A 1PLKA 5CYOA 2GXAA 4KHZA 2HEIA 3QBTA 4BFXA 4HDCA 5DSZA 2DPXA 2W6IA 1PLJA 3TBKA 1TF2A 1W36C 1C4OA 1UBCA 2HT6A 1E2IA 2QI9C 2ZSFA 2EVWX 4RKFA 4UXIA 3GLIA 4MH0R 2IEZA 3I32A 4MRVA 5HZHA 1RYFA 1D9XA
chains in the Genus database with same CATH superfamily
1FRFS 4KVZA 4P4LA 5FOVA 3VSCA 2I6SA 5FL7A 3G1WA 5I5EA 1EB8A 2R1VB 2VPTA 3G2HA 4PYIA 4C7MA 1Z2EA 3T7RA 4X90A 2I3ZA 2GAIA 2VYQA 4M0CA 1R10A 2FAXA 4HRXA 4R1QA 5FI1B 3UYLA 3DAPA 3GH3A 1REQB 3G0OA 3K30A 4OREX 4LZAA 3UHPA 1N2IA 1XNGA 1E18A 2NWQA 3B3FA 1TO2E 1IHYA 4P5EA 1GAQA 5HNKA 3VNVA 5FLXA 2WDZA 1XQXA 4B2IA 4CKEB 4KWHA 3PICA 1A8UA 1W93A 4MS4B 4GXRA 4MW1A 3R7WA 3OJCA 1TCBA 1PR5A 4JJAA 1LLDA 4LDRA 1ZRSA 3RI3A 3TNJA 3TR0A 3ZHVA 4C76A 2DKNA 3GBPA 1DKMA 2GJ9A 3FPHA 3VYVA 5B1YA 5AVWA 1TFRA 2B61A 3OIDA 1RIFA 3QXXA 5HCIA 3VUEA 2UUOA 4YS6A 3EPLA 4ZCSA 4D7AA 4G41A 4JJ6A 1PWEA 1ORWA 1PJAA 2EFEB 1OAAA 4EFLA 1GNLA 5AT1A 1T8WA 4E4TA 1EUZA 4KAFA 2KW5A 3D0QA 4KQEA 1MZVA 2XODA 5A71A 3B20A 2Q0SA 1HTWA 4ZVVA 3OO0A 1ESNA 4M9SA 2XT9A 5FA8A 2CJPA 2JAXA 4N01A 3WKDA 1GY8A 1Q77A 2BELA 1WE2A 3O3MB 4DIEA 2H7VA 4MCHA 3ZDYB 1DMRA 3OY7A 1RI5A 1GCOA 3BGOS 3RJTA 4J8PA 1VMEA 3SHQA 3U4GA 3U2QA 5B7QA 5THQA 2R7KA 2Q9CA 4FW8A 1XCGB 5EJ2A 3HI6A 5BUQA 1GILA 1T24A 2UUCB 4J4TA 3FI0A 4HNUA 4KIGA 4FDVA 4HJRA 4UM7A 4F91B 4Q9LA 3RODA 1T3HA 2O0LA 4GI1A 2RHWA 3CX3A 4JVSB 1ECGA 4OI4A 2WDPA 4I5DA 1D2GA 4ZVNA 4CLEA 1EWTA 4MW9A 1IN6A 1V8ZA 1VMKA 4O02B 3IP8A 2YYZA 3K16A 1RQXA 4BDSA 1MB9A 4CM9D 5AKHA 2EOAA 2FEPA 2QXYA 3ZXUB 2Q2WA 3BEOA 3RHZA 4EZIA 2O23A 2P4QA 4MQEB 2E5LB 4M21A 4ZI7F 1L0BA 2RK3A 4IIGA 4ERXA 4FYPA 3L7OA 3QYJA 1GZ6A 5DYIA 3N75A 3LXMA 2IV2X 5K8IA 3VA7A 4CLRA 1FVFA 4C3ZA 2HWXA 3CW9A 3KJNA 5REQA 4QDUA 4N1AA 4F46A 4BKRA 4OV6B 3HDYA 4FUQA 3FNEA 1KC3A 4HUJA 4WUTA 1SB8A 4YROA 4BO8A 2B92A 2VHCA 5MN6A 4ARBA 1CNFA 3L79A 5DB4A 2ZYTX 2C1ZA 1CZRA 3SNHA 2GBIA 2J6HA 3HZRA 4AP5A 3PLRA 3E48A 4CUJA 2PCJA 3RIXA 1WUTA 2OZPA 1W5EA 3EN0A 4RPLA 8ATCA 4X93A 3ORFA 2IYEA 5FPKA 2JL1A 3TOSA 3A6KA 3UM9A 4LMBA 1A5ZA 1J39A 2P5UA 3QY9A 4DMFA 3E15A 2HI0A 5BO5A 2DOKA 4FVTA 3ELDA 3L6CA 4LY3A 2FTKE 2YOHA 2CW5A 4TMYA 1CP3A 3B5IA 5HZKA 1U0OC 1CUCA 1SBNE 3HA3A 3QUQA 3K2BA 4E1VA 3B1ZA 1DIHA 1DKPA 1F3OA 4FDAA 2BBTA 5KO2A 4KAXA 3OFNA 1QFMA 4HFNA 1HNZB 4NKRA 5A9RA 5JLJA 2PVPA 1P81A 3MTGA 1HT3A 2A5FA 5FWYB 1BXRA 2AMYA 1JHVA 2H4YA 2YJNA 3D0KA 4L85A 3UBTA 2PU5A 5FPTA 1XD2B 3M6XA 4MWSA 521PA 1YA8A 2RI6A 3KEOA 1BWPA 5BV2P 4HXEB 3T5MA 4PZPA 1O6FA 2Z57A 4O4JF 3LK7A 4REQA 1IVSA 3N2GA 4CL0A 2XDQA 2G0AA 1GU0A 2O2YA 1Q84A 3GC6A 2ZWAA 5MF6A 2X42A 3ZE2B 4O0LA 4MR8B 3W5IA 2ZJ4A 3E5MA 5DHUA 1G7SA 1Y5IA 2HJGA 3OKAA 3EA5A 5CTJA 2QY6A 1GQYA 4R7TA 4L8GA 2J3IA 4PQFA 4G09A 4XIYA 4BAUA 2HHJA 2HSJA 4IEEA 4EJFA 1QRTA 4MYTA 1P72A 3SWWA 2HXYA 2PL3A 3BK1A 3T3IA 1Z22A 1R6UA 2AJLI 4UHFA 3R7AA 3VOSA 3KAJA 2YN2A 4BNJA 5K03A 2NU9A 3P19A 3DGFC 2O8DA 3BTSA 3WRVA 5AW3A 2RSLA 3H86A 4HVAA 4YJ3B 1OKKD 3AEQB 4JBIA 2W11A 4IX9A 4PBTA 5L53A 4UE6A 2EEZA 1I2DA 2W6NA 4RXTA 3PZBA 1JG7A 1F3LA 3KZVA 4FEGA 1H2RS 1RTKA 3GOQA 5DGTA 4GPTA 1FRZA 3MN1A 2HO5A 3DR3A 4YJHA 2WYHA 3C3AA 5EMNA 3M6FA 1W5TA 4N5HX 1E96A 1OJ7A 2EL9A 3NTOA 3W5UA 4FS8A 1EFPB 2VKQA 4GZ5A 1CP2A 2JHFA 1GZ7A 3OJEA 4LVUA 1QFYA 1U65A 4UBOA 4V0SA 2Q2VA 4GNKA 1OIWA 4HWRA 1VB5A 3LX5A 3UK0A 4B48A 3RBVA 2ZZKA 4KO2S 4EGSA 3PC6A 1WUJS 2QK4A 2TMGA 2DPLA 3VTZA 3VPDA 1GV1A 2Z8YA 2GO1A 5DM0A 1SM4A 4OA8A 1UDBA 4H3KB 1EUCB 3JQAD 3LFHA 5CVTA 1L5HB 3ND5A 4RPGA 2R87A 4OHUA 1YNOA 1XYVA 3NTRA 4H35A 4LJKA 2AOTA 4L8WB 4GC9A 4MVJD 5ALKA 3WBKA 1N5OX 1SNYA 3PJRA 1MW9X 4IH1A 2PE5A 3DZIA 1OX4B 4TN5A 1BDBA 4B40A 4UU7A 1DT5A 1RQPA 2VNKA 3X2FA 3GJ6A 4R69A 4YLEA 3T5BA 2YRFA 1MQAA 4ARSA 3ZUPA 2FE1A 3DOFA 1YULA 3GWGA 4MKXA 3AVXA 1MR3F 1XA4A 2R6JA 2FRDA 3CTMA 4C88A 2WJZB 5T4BA 3G7UA 1L7OA 3BXZA 3IBSA 2HOQA 2XHZA 3JARA 3JQ8B 5P8WA 3KUKA 4W8HA 1KJIA 4P22A 4DLSA 4MULA 1JAZA 3DTVB 5TVKA 3D7LA 4EL5A 5KYYB 2G08A 3R9IA 4E6PA 4DDUA 2A1UA 2JGEA 4G4JA 1GT6A 3LIPA 5EWJA 3N0VA 4OAQA 1YQTA 3L7BA 1KNQA 3P2JA 3QA3E 5DIFA 2FA9A 1A4RA 4G1BA 3TZKA 2VPYA 4Q1EA 3UW1A 4C4RA 2Q3LA 1NPDA 4ZT2A 3S8YA 5HIKA 4FW9A 4XQ0A 1J99A 3ONNA 2JK0A 3AHGA 2G1AA 1T9CA 2P68A 3FPLA 2GK3A 1EFVB 3QA9A 1ZJJA 3L1HA 1JSLA 1G9XA 2WHYA 3RSCA 1I32A 1RLTA 2HBQA 4O8ZA 3CNHA 2X22A 3ASVA 4YXWA 1ELOA 1QE3A 2H5JA 4ETIA 5BQ3A 3VYUB 1OWOA 1UK9A 2OKGA 5AW7A 4L9WA 4EQZA 3OCWA 3HJUA 1XAIA 3QYPA 1OASA 2XTZA 2Z3ZA 4UOEA 1B8UA 3BREA 4X1KA 2ID9A 2APJA 4AT1A 2BD0A 2QYSA 1H3FA 1E7SA 4TV8A 4Z2AA 4PG4A 4KPYA 2ZJ3A 3KL4A 3SJAA 4TSFA 4J0IA 4IINA 4WVFA 5JHHB 4DCNA 1P1CA 1A98A 3AOGA 3PLAE 1PFKA 4M1MA 3EEYA 4BC0A 5AKYA 1FDUA 1ZNWA 1G7RA 4Y2UA 1WF6A 2H7CA 4M9RA 3GXBA 4EVRA 1VLLA 2A1IA 2C7VA 3NTUA 4H16A 2V65A 4KRXA 1WLYA 1XTJA 2DSTA 1VECA 2BHSA 5AW4A 1RM4A 2C57A 3KOXA 3U4IA 3HDVA 4PHTA 4IF4A 5F7ZA 4AM8A 4XYMA 1SC3A 3QMPA 1T26A 1W44A 3OTWA 4QDZA 5KTRA 1G1AA 1Y4AE 3DYIA 4Q6BA 3P2MA 1ADGA 5EN4A 2WM8A 4CI0B 5GMOA 1OOEA 2JC3A 1UBKS 2JGRA 2QRGA 3M83A 1U0FA 4XR9A 3ZJTA 1TADA 1CXZA 1VA5A 2GEUA 3BWBA 4P4SB 3ESAA 1ECLA 1TMYA 1YU6A 1ZW1A 1CK4A 3FAZA 2C8LA 3K0KA 4WN3A 3CF0A 1P3DA 1W34A 2VAXA 4MGZR 4CLHA 1HETA 1EXWA 4LPSA 1HMYA 1OYVA 3UAZA 1L1QA 3LLSA 4M53A 2O2SA 3VFDA 1TZJA 1NP7A 3QH4A 4XSVA 1G5QA 4ZD6A 5AXAA 4EFDA 1RKVA 1FJHA 5CIQA 4DUZB 1KVSA 4AI6A 1GYPA 1Y1PA 1NOJA 3WLFA 3C1OA 1QZXA 4BNDA 4L5YA 4ILEA 2RGNC 3BTOA 2ZUSA 4IV8A 2ILTA 3Q88A 1OIVA 4M98A 5ULLA 3QU2A 1YQEA 3PPYA 1ZZEA 2HLPA 4UM9D 1DXHA 3O95A 4JU8A 5FR1A 4ZYUA 2NLOA 3ITEA 3MWJA 1CBUA 4WK4B 4OGGA 1NNLA 1Z12A 4MUJA 1V3VA 2XE4A 3Q8LA 2EW1A 5AOCA 4PZDA 5JD5A 3OU7A 3K1ZA 2CZCA 1D4AA 1T36B 5EYPB 5B1EA 1YKGA 3QE4A 4LI3X 5FPYA 2O3TA 4RESA 1I8TA 4HZIA 2PGAA 4QJ4A 1ZSNA 1BEZA 4L9AA 5A7GA 1ODKA 3MJEA 1L7RA 3TVYA 5KYUB 2DH5A 2GEVA 3TXYA 1W94A 5J2UB 3RWMB 3T4PA 1K8ZB 3WB1A 5IX8A 4P33A 5CDUA 3VOTA 1NW4A 1V6AA 2PMEA 4Z7JA 2ICAA 1PSWA 1NFQA 3I92A 1H0SA 1YFKA 1ML3A 3NT4A 4R6XA 5FQNA 4BOYA 3LUFA 2BI4A 3GFVA 3BH6A 4UATA 3ZWKA 4TLCA 4RCYA 2J9RA 4CTKA 4JN6B 4YPOA 1JFVA 1EM8A 3LQ1A 5BSFA 1XZAA 4MEAA 1C3XA 1NVGA 4KFRA 4CT0A 3AQIA 1Q57A 1ORVA 3IUMA 3OZFA 3S1AB 4LHZA 3CB2A 2OCLA 3O4VA 2BKEA 3W5JA 4DGSA 3O03A 4IGIA 3JASB 3MWKA 1UANA 3BJEA 3GVXA 4W6ZA 3QOFA 4EB6A 3WOVA 1NRWA 3L5KA 2CE7A 4M1WA 4C03A 4C4XA 4UUOA 2FEMA 3R3WA 1YB6A 4S1PA 5E4JA 3HVUA 2VJCA 3ADKA 3IIJA 1BVYF 5AKIA 4DV5B 3KP1A 5IM4A 3H8JA 1VP9A 1CVIA 2GI4A 1I5OA 4O5AA 4W5HA 3EZNA 3KQPA 3ROQA 3UMJA 3WWYA 4QNRA 5JJIA 5DN9A 4G9BA 3MERA 2PK3A 4AD8A 3O1JC 5JPCA 4OJQA 4CFSA 3BWEA 3L6EA 4MEBA 4RORA 4PLGA 4AZTA 2YUIA 2R6CA 3JQCA 4JCCA 4QSMA 3P9QA 5EL0A 4PTLA 2VJLA 4X61A 5I8ZA 4C22A 3WL8A 3B3GA 3REGA 1X3SA 5EJ9A 5JPDA 1T9GS 1R9NA 3WK7A 2ZYHA 1KK3A 4OIFA 4OYHA 2ZRJA 3WV5A 2FMTA 3FVWA 2C5AA 4RC9A 1UODA 3RVSA 2X5NA 1CQJB 2VP6A 3GGPA 4PO8A 2WUEA 5FUXA 2H9IA 2D1SA 3Q3EA 4EJSA 4BCDA 1N0UA 2HLNA 3L7YA 5LQMA 1AKYA 2IQIA 5LIRA 4DIMA 1ZH2A 2ZRDA 4YCDA 3FTQA 2BGJA 5E6RA 1O8CA 1C9YA 3EGOA 3HL0A 3P9KA 4GLBA 3IALA 2RAPA 3MJDA 3GLKA 2I6TA 2OXRA 2WMOB 1IN1A 3A4NA 4HGQA 1SHUX 2Z30A 2ZETA 3NW9A 2FNAA 1MPTA 5DNVA 3MRTA 3SIRA 4EW1A 5JXGA 1FIUA 1PLLA 4N3CA 2WA2A 3G2IA 2COUA 3V4VB 5MFZA 2ID8A 1UR5A 1E9AA 2H18A 3L1JA 3PFHA 4W8GA 3GLTA 2FKNA 3E3MA 3JV7A 2Z09A 3JQ7B 3T9BA 4FHDA 1GGHA 4LF6B 3T9CA 1H9CA 1AQ6A 1B0ZA 2BM8A 1IBRA 2FUEA 2HK6A 4Y1FA 4PYJA 2VQEB 3H04A 1I7PA 1WTCA 4QWMA 1NW9B 1YRYE 1FP6A 1BGXT 1N2OA 4DCGA 5KKCA 2AVDA 4GO1A 1TL7C 3GZTB 4Q3DA 3RGWS 4MRPA 2VK1A 4MVJE 1MTOA 3LA6A 2WWVD 3AL0C 2Q1YA 3D0RA 3K0FA 4AQYB 1PW7A 5ILGA 4ZEVA 1V7PC 1AZLA 1E64A 1KJJA 2XMRA 4PIVA 4C2TA 2J4FA 3AFNA 1RWBA 2PLWA 3W0LB 2JLYA 4K8OA 3I64A 5BSGA 3LT4A 3EIQA 1WJGA 2R96A 3PC8C 4FKBA 4NE7A 4PHFA 3HR4A 2ODTX 2RAFA 2GPBA 4D1YA 3RTAA 3DPUA 1N4DA 4ITVA 4LIPD 1LH0A 1Y82A 3I2KA 3OZIA 6NULA 3E35A 3TSCA 5GTDA 4RE5A 2H06A 2HDHA 4RTLA 4DUYB 2XGJA 3B1JA 4AMYA 4BLSA 1HFEL 1B16A 1GDHA 3OM0A 3SYLA 1MRSA 1QK3A 3TCKA 2O8CB 1T5IA 3NXSA 2QLLA 4G5YA 2W2KA 4JP8A 2ONCA 4XQGA 3GJZA 5EZSA 4TYWA 2XIJA 2CXXA 4PZUA 5B1SA 2C84A 3HB5X 4H15A 3GRUA 1KA9H 3IJ5A 4MCAA 5H8WA 1ZA1A 3DMTA 1THZA 3IR6A 4PZZA 1PFUA 5BVGB 4GU5A 4BIIA 1F5SA 2EZUA 1IAQA 1NWCA 3KDAA 3U9SA 1FNCA 4EPRA 4H7FA 1R0KA 1LBEA 3V1UA 4MP3A 5CGQB 4BBPA 4I8XA 3KHTA 5IVHA 2NYVA 2HDOA 4IMPA 3DNFA 3DJYA 4BWGA 3TBFA 1UM9A 5U4XA 5C53B 5ALEA 4X41A 3JWIA 1TNDA 3JYLA 2W42A 1B23P 1T5BA 4TTPA 4PYMA 4AG3A 2WD9A 3IVAA 1BXGA 3UNXA 4E2FA 3T1HB 1KZGB 1RABA 4HTAA 1NUTA 3QEAZ 2ZPUA 5FBRB 2WHXA 1DINA 1NR7A 3VISA 3EQZA 3TRKA 1TUBA 1YJQA 2A5YB 1PIWA 2XNHA 1N75A 2IYXA 4ZVPA 3TL3A 2PSEA 1O54A 1PWXA 4IP0A 1VLZA 3W79A 1BG6A 4YUAA 4ENPA 2AW5A 1Z06A 4RIIA 1E89A 1Q22A 3U5ZB 5JXJA 2AKYA 1UFVA 4YONB 1YS2X 4F8JA 2OHOA 1E1CA 1PR6A 1ZU4A 4WESB 4YEDA 3AR2A 3T0FA 1DZIA 2FZVA 2LKDA 1AC5A 1YCFA 2GWHA 1JS1X 5DBFA 1KSJA 3ZTWA 1GGKA 2WVJA 4LF7B 3PPIA 5TF4A 4X3CA 4I81A 3Q85A 3ZNQA 4YY3B 4ETNA 2QTVA 1KVQA 2YJ4A 1TRHA 3NEPX 3OZRA 2EGUA 4A0FA 1ZVQA 2ZRGA 4FT2A 2YWGA 3LQQA 4MUHA 1OXUA 2HMAA 5I4BA 2R86A 1T6ZA 4QTUB 4OMDA 3IOCA 3W1WA 3HCPA 2Y9PB 3PHHA 1QJ4A 1GAJA 1U8EA 2QA5A 1TT5B 3V6MA 2C3OA 2XMCA 1Z45A 3PGVA 5A7FA 4EHDA 1HRKA 4DCVA 1EGAA 1Z4NA 1SIOA 1KZ9A 4GM4A 4RPHA 5EMLA 1N3LA 3HV2A 3W05A 3SQMA 3E9CA 1B8VA 3RVMA 3IBCA 5ALNA 3RUAA 2FDXA 3FYCA 1JHAA 1Y4SA 3E18A 4DWJA 3HR8A 2FP4A 3TXAA 4DWVA 4F06A 3DHVA 4UHKA 3LY5A 4J94A 2PH3A 1OBFO 1RHQA 3DPSA 2B82A 5K3OA 4X8MA 2IC5A 2X6RA 4OLJA 4YT4A 4L3WA 1NKTA 2DHCA 3B2QA 3U7JA 2JLVA 1IRXA 1Z5GA 2PX3A 1XDSA 1ZQ9A 3GEPA 3QQ5A 2Q1UA 2Q5OA 2CXRA 3G17A 3E4CA 2IS2A 1UPAA 3BCRA 1DO2A 4HHEA 4YBRA 1UEIA 1WPQA 1U6JA 3IHKA 4G0ZA 1M10A 1NI5A 2GBCA 2QQGA 1KO4A 3GQBB 3HCWA 3EDOA 4UHCA 1FU8A 1ODLA 2GR9A 2PFSA 4U63A 4WKCA 5EPEA 3I5XA 4FNMA 4Y6PA 1OC4A 4IXDA 4E5YA 1GL9B 3KKNA 4PZCA 3LT5A 2OFFA 2XVYA 3BD9A 3RIHA 4CKBB 1OD6A 1XQWA 2VFAA 4CR8A 3KLBA 4H6VA 4RO0A 3M4JA 3AGQA 1IEQA 5G02A 2Z83A 3SXJA 3TRIA 1AKNA 1GYQA 1W85B 3WGQA 1BFKA 1N57A 2QTBA 1JJBA 3OE5A 4OHMA 4D3ZA 2WAOA 3IJEB 2ZFUA 3P0IA 4Z4QA 5LDDC 5AUOB 3BZUA 3LT1A 3FOWA 4Z3DA 3ZHZA 4Y2XA 2CEAA 4FYYA 4UREA 4DR2B 3SYNA 1C0LA 4K9SA 3IURA 3ZW9A 4EFMA 1RSZA 2E1PA 2OHJA 5FWAA 5HBGA 1QX3A 1NQWA 1XROA 4LF8B 2B3DA 5K5EA 3IE1A 4JJ7A 4X9XA 2W2OA 1NBAA 1C8KA 2I4OA 1WWKA 1P0QA 4HX9A 4QRHA 3T54A 3L4BA 1DDOA 1PP4A 1LPBB 4O6VA 4PY2A 1NMYA 3ENNA 1JXMA 4XGQA 5KQPA 4B47A 1UEXC 2UUPA 3OQOA 1Y6QA 2XRYA 1NY5A 1Z16A 2C8VA 3CUYA 3H05A 4BZQA 4EB3A 5CA1B 1JXAA 1HE2A 1ZIYA 1RHKA 1XD9A 2ESRA 2JFWA 3E9RA 1AK9A 1Z7GA 2IF0A 3L46A 1BA3A 3LS2A 1EDDA 2QXTA 3HO1A 3OAAA 2PD3A 5M04A 3LXXA 4HNTA 2Y0BA 3VKGA 3NHJA 4XQEA 4PGMA 1V1JA 2EJWA 1OAOA 3N8NA 4UDNA 2VDOB 2QHXA 3UANA 2C9MA 2O7QA 4GDFA 1YCHA 3BKWA 4HMOA 1TVKB 3ZHRA 3OZEA 4JJ4A 1E79A 3NTLA 2HX1A 1T3SA 3BGIA 3GO4A 3GFGA 4MGEA 1Y4UA 3LBFA 4XXHA 4F71A 3C70A 1NPTO 1C81A 3FLBA 3I34X 2QBYA 1HTBA 4MW4A 2IHNA 5DLEA 4EITA 2XEDA 3OETA 2P7IA 1JKJA 1ZVJA 5BSHA 1QANA 4HWKA 3QKWA 4CM1A 4X3OA 13PKA 3KS9A 4IRUB 4OATA 3CLUC 3VNAA 4R71A 1VJ0A 3UAYA 1XDDA 1LTKA 1BCRA 4RK1A 5BN3B 1MHTA 3EIWA 2AFHB 2JEZA 2GCGA 4PAQA 1UXHA 1ZCBA 2HPAA 4BRUA 2Z58A 1EE1A 1NBMD 4NSNA 2UUAB 1A88A 1MV5A 2WU3A 1JBKA 2RHHA 2WZDA 3HWRA 2GERA 1GKIA 3K1AA 3MPUA 4WINA 1Q20A 3HCRA 1GZVA 1N5KA 5DM4A 5KQRA 3VHLB 1ZMXA 1T6BY 2OHGA 1ZRMA 3A1VA 1HT2E 4UDYX 4KXUA 5C18A 3D1VA 4D56A 4GKAA 2V1XA 3FUWA 5FIUA 3Q1KA 4L07A 1E3TA 1OXVA 2E0IA 3W5AA 1MKYA 5AHOA 3R9XA 1FVHA 4OXXA 3FWZA 1BVRA 4M3NA 3CONA 2FZLA 3W7VA 4E6EA 5J47A 2CMHA 1RJWA 4JWKA 5CH8A 3KR9A 1JTFA 4DKXA 1VSQA 3UTDA 1EK2A 1YJBA 4MUNA 3CLSC 2F3RA 4NU6A 4OBWA 5AHKA 5LYJB 3Q15C 3ZXYA 2YXLA 3WNDA 2VBGA 3TM4A 3UZUA 1K8YB 4H2DA 5E2IA 1FDTA 1OFUA 3HWX1 4R01A 4NATA 3GN2A 3MT7A 1QHYA 4MWZA 4NAVA 4ZT7A 4V0RA 3T15A 5JSKA 4E2WA 3LSYA 1P5FA 4HY3A 2Q8NA 3FHLA 4P4TA 1NAIA 5EEHA 1DC5A 5BQOA 1O0BA 1M0EA 3EPJA 3GAFA 3F46A 3TZ6A 1KI6A 3IQHX 2LGJA 2XA9A 2YNMA 1KZYC 4AX4A 2OO7A 3EWIA 1P9NA 3K09A 4W5JA 2AFIB 1A1VA 2YZNA 3R0QA 3SC3A 5JSQA 1IVNA 4XPZA 1C7QA 1P5HA 2AUTA 2H6EA 4Q24A 4ZZ3A 3S1SA 3BIOA 2AG1A 4KPFC 3FD8A 1G66A 1QO7A 3WYAA 2IXDA 3H8SA 4PZ0A 1P1KA 3KE9A 5J2TF 2ON6A 1JIUA 3T34A 2XJ9A 4DV7B 4RY9A 1R18A 1E2KA 4URWR 4N8SA 1Y1SA 2PR7A 2B2CA 2YZKA 4B6FA 2ZQZA 4IQFA 5E1OA 1SURA 1YR6A 2ZJ1A 1TJPB 4CHGA 2FRDC 1T2CA 1P1FA 5CHYA 1ZD9A 2C9ZA 2EBHX 2P5YA 5DM70 5KQSA 2DVMA 4K7JA 3SC2A 2RHGB 4KXFB 4UQOA 4NHEA 3T9FA 1B1AA 2G4LA 1U28C 2H9AA 1HFKA 5EZ5A 3U7FB 1IEWA 4TVKA 4NCIA 2GZSA 3VR4A 1K4MA 1IEVA 2J6IA 2PZ8A 2QE6A 3IC5A 4HATA 5D7BA 4ZGBA 1PR0A 5LMCA 2W71A 1ZOIA 2V55B 1GWNA 1KPGA 4HD8A 5K3FA 4EAQA 2V7GA 5KNDD 1RZRA 3R9WA 5HZMA 1PT6A 4LJ8A 4AY4A 2ADOA 3DL4A 4W6QA 4UUNA 5JT1A 3NR2A 5KTKA 3FGNA 1XPJA 3I6ZA 4OQZA 3AL3A 1GQ2A 2A0FA 3HYRA 4HDAA 1FS4A 4B6RA 4NK4A 1LA2A 3FJOA 1K75A 3WHPA 2HF7A 2IYQA 2XMQA 2ZSHA 4N9WA 2XUDA 3VVBA 1Z07A 4WOBA 4WN9A 3FGPA 4D74A 2I7TA 1CETA 2V7PA 4YLGA 2J5BA 2MSKA 3OLYA 1AS0A 3HDJA 3GEMA 2QMUA 3H2IA 3ND8A 1B14A 4MW7A 5D85A 3PK0A 3BIJA 3DT6A 3Q7PA 5IJ9A 1AZWA 4ZCPA 2IIVA 3R3HA 1D7AA 1Z4KA 4CCYA 4ER6A 2Q5JA 1JQ3A 2BAGA 4OI2A 3C24A 2Y4NA 1SMKA 1T8RA 5IHPA 4MRAA 5ILQA 3ASYA 1YR8A 5KTSA 4HGYA 1U1FA 3IR5A 3PIIA 2JZCA 4OMUA 2FK7A 3EZFA 3W04A 4OPMA 2AK3A 2YY7A 4RHCA 5FHRA 3SR0A 2J6BA 1UBGA 2XSZD 3BC1A 5ITSA 2IUSA 3IS3A 1UOOA 3G5TA 5BW8A 3WKBA 4R98A 2J09A 2P90A 4AN0A 5B30A 4KGXA 5EXTA 5LLTA 3THXA 5A06A 1W7AA 1E9CA 3AZOA 3L41A 3T3NA 4X45A 3Q7EA 5LP6F 1XDWA 1EK6A 2ZJYA 4PYRA 1WD7A 4G8BA 3EEOA 1SA0B 1GN8A 1HV8A 2LPMA 1ABEA 1UJ6A 3ZYCA 2HA3A 3TNYA 1AUQA 4BNNA 4KR2A 3E8XA 1I0ZA 4WPGA 1TU4A 3F8TA 5AJWA 3FFBA 1WZCA 5THXA 4D97A 2EP8A 4B6JA 4N7MA 5AVQA 2HWWA 4WKNA 2E49A 3UWDA 4L27A 4E2ZA 2XNDD 3C4JA 4KKVA 1E3DA 1KDYA 4O8CA 2WT9A 1J0XO 5JFOA 3T1QA 3UICA 3HKEB 4DHWA 5HM8A 2IX3A 1Z3IX 1PGPA 4Z6KA 1EE2A 4EHIA 1DIRA 1OFUX 2DXIA 1N0HA 1PTKA 5DT2A 1SKBA 4A2WA 4JXXA 1I01A 5D87A 1Y81A 1HK7A 3RYCA 2C5BA 2IYYA 4BJ1A 2OCKA 3A1CA 3ZGYA 3IE0A 3ZD8A 1YZYA 4LWZA 2Q2QA 1PR9A 3WO1A 2GM4A 5CXSA 3KB1A 2ZU0C 4L8VA 1U3UA 1M7GA 3STVA 2JB9A 3IUQA 2A35A 4NL4H 3F7NA 4H7EA 4KMMA 3UFXA 3GIWA 3ENKA 4G5QA 5G0TA 4AJJA 4HQNA 5HK9A 5JZ9A 4KBYA 2V0GA 3WIUA 3AHJA 1N25A 2NTEA 5HX7A 1KWKA 2VRCA 2DFVA 4G1CA 1UAYA 1M67A 3J7AC 3AFIA 2CXUA 4I36A 2OY0A 3BT7A 1TKAA 3RS2A 4PEVA 3KHSA 3OA0A 3LF2A 4KG7A 5D6NA 5BP7A 3LBYA 4W5RA 2Q4RA 4YAIA 4M8LA 3T3DA 4N7RA 3UB4A 4RQBA 3VOBA 4G5RA 2GF0A 1AH2A 1Z4PX 2H29A 2E5FA 4BFWA 4N82A 4B35A 5KDOA 2HHLA 3ESYA 3IVMA 1UKYA 3B9QA 5DGXA 3L4SO 5H80A 4LC1A 2XCLA 4KODA 3I62A 1WIWA 4QQKA 3E3LA 3P5BA 5ALDA 3D3EA 1HLFA 4EYKA 3HXTA 1JPNA 4ENRA 5MHTA 2EKQA 1IBCA 3UOAB 5IXSA 4BVLA 2IOFK 2QPAA 3MRXA 2AJ8A 3HEBA 5K0LA 4XUCA 3TD9A 4TLAA 3WMXA 1MRNA 1T3LA 5AW5A 3UWMA 4D44A 9MHTA 1BKDR 1FP1D 2QG6A 4OJNA 1JDUA 2YHAA 4YP0A 5DBOA 2ONJA 3C87A 3FTNA 1CX9B 4J0GA 2H16A 4R2WA 3VU8A 3A4YA 3EEBA 1K1EA 3IBFA 2F9MA 3GT7A 4KXNA 4RYLA 3WLAA 1TEXA 1IXSB 2FPKA 3PUKA 1XMIA 4MMXB 4YT5A 3VJMA 5BOSA 2WVAA 3RQSA 1JKIA 5KOYA 1VZ3A 2DPGA 5T6BA 3SI7A 2BFFA 3OT4A 4YP9A 5IJZA 2H17A 1IM5A 1WABA 2VAVA 4K05A 3ZJUA 2FXVA 3R2JA 4U7HA 3BSSA 5EVJA 3T3OA 4FGJA 1HEYA 3QFCA 5DBIA 1NBME 1O77A 3B60A 1P0MA 3C6BA 2OLJA 1EVKA 3ES9A 2H0RA 3K9GA 3MBKA 2NSHA 4PX3A 1SWWA 1CQPA 4X6UA 4D4HA 5ETJA 1ZIDA 3E22A 4EUEA 2FW0A 4INJA 3FRJA 3DYBA 4KYVA 3VDQA 4XWKA 1AF4A 2D5IA 2GCEA 4BX3A 5IDQA 4MNTA 3U0VA 4QQ8A 2JCYA 2BGGA 1U7OA 1JIQA 3JYPA 4EJSC 1K92A 1IM8A 5IU6A 2RGAA 5AIAA 4F8EA 3ZVKA 1Z5OA 6CHYA 1V96A 1WCYA 1ZD3A 5JJCA 2DEUA 4MHSA 3UCEA 3ZCVA 2CLFB 4NMHA 1MNQA 5JJBA 4MQ5A 1NMSA 3IOMA 3JZMA 1N4AA 1USKA 3ZI4A 2FZ5A 2QN2A 2YWRA 3NFYA 3RYHB 1U9JA 2HSEA 5I6DA 3CKKA 2F59A 1MOSA 3C6YA 4HDNA 2FPWA 1X7WB 2J3DA 1WDTA 1Q44A 3C2QA 3R7BA 3V1YA 2PDAA 2CE2X 3AV3A 1N1EA 2FPGA 5AVZA 4ZO6A 1OT5A 1OV4A 3COWA 3H1AA 1IZZA 4L8LA 1VI6A 3MS4A 4NJOA 2EKDA 4OP3A 3B1XA 4ZYVA 4X95A 1I2MA 3U26A 1JFSA 4I4TF 4E32A 2ZTSA 3LKVA 3QSGA 1L4NA 1QNFA 2BHNA 4TYMA 1SR8A 1XEXB 1PUXA 3BE6A 2OWDA 3EDCA 3P0RA 3P94A 1ZC4A 3E9YA 4A16A 1J07A 3SIWA 3A4VA 4A2PA 4LFAB 1YGPA 5IDYA 1R8QA 3NHBA 4OQYA 4MYHA 4C0XA 4JYAB 5DI3B 1N2JA 4DJDC 2ZSDA 4DF3A 1WVIA 4YRJA 3OMLA 4OXIA 3PPXA 3PPWA 3BSYA 1EVQA 2LE0A 4MKZA 5FD8A 4ZCTA 4ZZ0A 2ZBGA 5K0JA 1NUUA 3DQPA 3LLVA 3WP1B 4JLMA 2X4IA 2ZCJA 3CCBA 3MGCA 4OB8A 3E53A 4NI5A 3JX9A 4YASA 5FUQA 3PUIA 4FHEA 1AGXA 4LQ4A 4C0LA 4UDXX 4AKGA 4YMIA 2HWKA 2PZGA 3DULA 3FNFA 1UZAA 2GPSA 4B4KA 1R12A 4IJKA 1RXCA 3G7NA 5ADHA 1OILA 2C2MA 2QRVB 1Y63A 2WKQA 4YAWA 3HWSA 1JKMA 3KFLA 4KBGA 5JROA 1E9FA 2Q9AA 1E3QA 5ECDA 3IEVA 3MCTA 2O20A 2FOIA 4NFSA 4MVJI 2AXEA 3P9ZA 4ZARA 5SYAA 1O95A 2R47A 3RGGA 4DIBA 2MINB 3KLPX 4KMOA 3HI4A 4OHXA 2RB5A 4R2HA 4RKWA 5ECWA 1LDYA 3DMTC 2XF8A 2BGTA 4LZLA 3ROXA 1SD5A 1CHNA 2YV5A 3LECA 4KQJA 4E70A 2PUAA 3KU1A 4CLOA 1W30A 4ZVMA 4AY6A 4KQ9A 4Y2HA 1TLTA 4HQLA 4JBYA 3AETA 1HDRA 3P2YA 1X1DA 2OBLA 3CLHA 3TLBA 3QKSA 3WX0A 3NWEA 4RTKA 3GUUA 4RL6A 1U5BB 2I1VB 3P2KA 4BLUA 1SVUA 1CLEA 1WB4A 3QWBA 3WKAA 2CJFA 3BHIA 1WNTA 3G0GA 4U9UA 5DN6A 2PM8A 1RLJA 3OT1B 4UULA 4WGFA 3HUEA 3I6YA 4S24A 2X8WA 3ENVA 1QF9A 1NQAO 4LQDA 3G79A 4CT5A 3I8OA 4P7FA 4G56A 5DMHA 4O2AB 3IKTA 5C7OO 3CNLA 4KQ2A 5FUMA 5FBWB 4YRGA 5EUBA 5C4MA 4E0BA 2PU7A 3RV3A 1GNSA 3EIFA 4P7GA 3QF7A 5IP5A 2P9FA 1ZK4A 1OXBB 1TYZA 1T5DX 2Q3JA 4Z1MA 3UEOA 2F67A 4EBFA 1N6IA 4B83A 1XCLA 4UTZA 4R1TA 4PRYA 4DR6B 4HEA1 4O4IA 2YC2C 3DAGA 3HU3A 1UPCA 3GP3A 2PL5A 3CYFA 3W9UA 2HHHB 1W48A 4MVJM 1IBSA 4U7GA 4HKTA 1KY5A 3STWA 4OBXA 1SCNE 3TLZA 3WIVA 1OZ0A 3E0XA 1UM8A 4JLWA 4WDQA 4MUEA 3PNLA 3WA6A 3RSGA 2QRNA 2YHSA 2XWJI 1KY3A 2Q3MA 2VL7A 3AR5A 1QYRA 3C7TA 4MARA 2BUAA 5E9JA 1R9MA 1NBWB 1WW3A 1PFGA 1R3UA 1JDSA 3WK9A 3FFXA 4L4UA 2XLCA 5CA0B 5DT9A 4AJOA 3IOEA 3VPFA 3JAMA 1Z68A 1XFDA 2HADA 4DBLE 2OLKA 3QHQA 2XXAA 1VSUA 3D7KA 2PGJA 1FYDA 1CZKA 1ESDA 2QT1A 3K0BA 3M6UA 1P7PA 3NKLA 4HGRA 4M9UA 4C1NA 4YIHA 2WV9A 1E3EA 3I4FA 1YCGA 3DE4X 3OZBA 4TZTA 4AKIA 4EUNA 4UM5A 1QV6A 4AWXA 2JH9A 3WMGA 3OOYA 2YDYA 5H68A 4D43A 4OQDA 4B3DA 2FHSA 2VDUE 4B74A 5JYEA 4TMKA 2A59A 3AWDA 3T7CA 4QG3A 2XZLA 4NICA 1DX6A 1X1RA 4RKQA 2DWQA 2PXHA 1A96A 1MB2A 2PLFA 4LC9A 5CDGA 4PRZA 4Q7QA 5JSZB 4BTEA 5HJ7A 1UL1X 1GZSA 1UJ4A 4D96A 2L19A 3PGJA 3FNRA 1KEKA 2CY0A 1USGA 3C97A 4JJIA 4JOCA 3LUGA 1A9YA 4WFQA 4EGAA 1T91A 1N2GA 5DZSA 1YL5A 4PS1A