2HHLA

Crystal structure of the human small ctd phosphatase 3 isoform 1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
180
structure length
180
Chain Sequence
QVIPIPSPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CTD small phosphatase-like protein
publication title Structural genomics of protein phosphatases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 180
sequence length 180
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2hhlA00
2OA0A 2I55A 3AR8A 3ZTYA 1Z4PX 4NABA 2EARA 4NWIA 3BA6A 4QQFA 4BX3A 5ALSA 4Y2RA 3R9KA 5AM1A 3MC1A 3ZWKA 2W11A 3QUCA 2R8EA 4OCZA 3W5CA 4YGYA 1RKVA 3FPSA 4EEKA 5AKGA 3QU5A 3ED5A 2ZBFA 4BX0A 4L6CA 3SF0A 4UU1A 5ALZA 2C4NA 3FM9A 4MWOA 5AKJA 2EAUA 5AKYA 3ET4A 3UMGA 4Y2PA 5ALVA 2YJ5A 4HYTA 2JAUA 4CF4A 2ZXEA 1XP5A 2QLTA 2WF8A 4DWOA 2FUCA 3EF0A 5AVYA 1VJ5A 2R8YA 2WF7A 3D6JA 5ALWA 2O2XA 5T41A 2HI0A 3PCTA 2G0AA 3ZI4A 2AUTA 2FPRA 1RKQA 3ZX5A 3SKXA 1TE2A 4JDPA 3L0BA 5ALJA 5ALXA 2FEAA 3I28A 2G08A 4KYTA 5AKXA 4UU0A 5AI6A 2HF7A 4J03A 3PDWA 2Q4RA 1NF2A 3A3YA 2FI1A 1QYIA 3HYCA 5ALYA 2AH5A 4FYPA 4BEWA 3NUQA 3QUTA 3B8EA 3PGLA 2YMQA 5ALNA 3IRUA 1L8LA 2ZG6A 3MPOA 4YCNA 3ZWDA 2C9MA 3F9RA 2Q4TA 2FPXA 2R8ZA 4NAVA 2MSNA 4G63A 2I6XA 3L8GA 1XVIA 1VFPA 1RDFA 1F5SA 2G80A 3QNMA 5AM0A 4CF5A 3HLTA 5AVUA 5ALHA 5AI9A 2CFRA 5ALGA 1RLTA 2JGAA 2YBDA 1RQLA 2WHEA 2G07A 2X4DA 3PGVA 3KDPA 4Y2UA 1O08A 3L8EA 3UM9A 4B6JA 5ALOA 1MH9A 5ALIA 1TJ5A 1NNLA 1Q91A 3N1UA 4UM7A 5ALUA 3WKCA 3AR2A 3QU9A 5AW9A 3WGVA 4XPZA 2R8XA 1LVHA 2HHLA 4HGPA 3KOOA 4ZEXA 5IS2A 4BYGA 2AMYA 1RQNA 4KN8A 1K1EA 4PNHA 5AW3A 1Y8AA 3AR4A 5AKZA 4F71A 3OCXA 1Z4QA 4RETA 2HEGA 2GHTA 2OYCA 2YJ3A 4UASA 3NASA 1QH9A 4BKMA 1ZRNA 3WKBA 2FPUA 3GYGA 4OFZA 3SHQA 2C8KA 3ET5A 3QGMA 1ZJJA 5AHXA 4O8CA 3KBBA 4UARA 2FPSA 2I34A 5A3RA 4G9BA 4UMDA 5AVTA 3AR5A 1ZD5A 2C8LA 3ZVMA 1S2OA 2JAWA 3I76A 5ALQA 2W4MA 4Y2XA 2D2VA 5JJBA 2C88A 5AK5A 2NO4A 2PQ0A 5AVQA 5ALFA 3K1ZA 3KZXA 2VKQA 3WK8A 5AKEA 2YMLA 3B9BA 1L7PA 1U2TA 1J97A 3SMVA 1Z4OA 5AI4A 5AM3A 1RC8A 2DQSA 2YJ6A 3IJ5A 4OD0A 3RFUA 2HOQA 3QU7A 1QQ6A 3A1EA 5AKKA 4C4SA 3L0YA 3NANA 3ONNA 1EK2A 4AP9A 3A1CA 4YCMA 3KD3A 3L8HA 5ALDA 4EZEA 1ZRMA 3DNPA 4UMVA 1S8OA 3E81A 3SKYA 2P69A 4Y2TA 3U7EB 2WF5A 3FZQA 5AVRA 5AVSA 5E0OA 1SWVA 4JB3A 5AW0A 1YJ5A 1L8OA 2YN4A 1RMTA 4KX3A 4GXTA 1Z4KA 4E88A 1U7OA 1YDFA 2NO5A 4HGOA 1Z4MA 1Z88A 4DW8A 4ZEVA 3L1VA 2BDUA 1CR6A 5AW4A 1X42A 2B1RA 3QU2A 2IOHA 5AK3A 3ZVNA 1CQZA 4YH1A 2RAVA 2FUEA 3DV9A 4CE6A 2W43A 3W5AA 4Y2VA 1WVIA 3R4CA 5AESA 1U7PA 4EELA 3NRJA 4KNWA 4MUMA 5AKLA 5AW7A 2IOFA 1N8NA 3OCWA 1TJ4A 1Q92A 4C4RA 4Y2SA 3EF1A 1TJ3A 4HGQA 3R09A 2O9JA 4L57A 5AIAA 5AM2A 5AICA 2WFAA 2ZOSA 2FDRA 2HX1A 3OTQA 1L7NA 3OCUA 3WK7A 1N9KA 4C4TA 3U13A 3ZU6A 2MU1A 5AI0A 2QYHA 3EWIA 3M1YA 1WZCA 1T5SA 3ZX4A 2B30A 2ZBEA 3SLRA 3U7HB 2WF6A 4XQ0A 3RF6A 2HDOA 3MMZA 5AM5A 1Z4NA 5ALMA 3S6JA 3FGOA 3WK5A 4GIBA 5ALLA 3W5DA 3NAMA 3N07A 2HO4A 4BEVA 5ALKA 4BNDB 1T9ZA 4F72A 2YMMA 3VAYA 1Z4IA 1FEZA 3WKAA 3U19A 3A1DA 3CNHA 2HSZA 1L7MA 3I1YA 2IOFK 3QX7A 3WK9A 4H1WA 2P9JA 4HGRA 1KYTA 3WKDA 1L7OA 2WM8A 3FVVA 2ZBGA 2GO7A 3QU4A 2B1QA 4I9GA 4Y2JA 3J7TA 5IT4A 5AKIA 5FP0A 5AW5A 4UATA 4L6AA 1Z4LA 5AW6A 1Z5GA 3WK6A 3ZVLA 4EX6A 1ZD3A 2Q5EA 4FE3A 4J2TA 2B82A 4RESA 4DFDA 1XPJA 5AVVA 3QLEA 4BNDA 4DCCA 3IB6A 3MN1A 2B0CA 3E8MA 2G06A 1SU4A 3ESRA 4EX7A 4EENA 2JARA 4XE5A 1YNSA 5AVWA 2YJ4A 1NRWA 2ODAA 1RLOA 2B8JA 3KC2A 3TLMA 1ZS9A 2GHQA 4CNQA 4IG4A 4ZEWA 2G09A 4QJBA 2BDEA 1YS9A 3WKEA 2FPWA 4UW9A 2PKEA 5AW2A 3P96A 2P27A 1L6RA 2EATA 2I33A 2CFTA 4KX5A 5ALPA 3N28A 2OBBA 4HAIA 4Y2YA 5ALRA 2PR7A 1RMYA 4HGNA 4YIKA 3OPXA 2YFYA 4UM5A 4UMFA 3L0CA 4NFLA 2NYVA 5AK6A 3OCVA 1AQ6A 2YMPA 2RARA 4UMEA 2I54A 4Y3UA 5AI5A 1TA0A 2YY6A 1EK1A 2B8EA 2JAOA 3EPRA 3QUBA 5ALTA 2GFHA 3U7FB 3WGUA 4BBJA 3SD7A 4AS2A 5AVXA 1Z4JA 3B9RA 1LTQA 3CZ4A 5AK4A 4UAUA 3DAOA 4YIHA 2IYEA 4I9FA 4IFTA 4BX2A 4KNVA 1PW5A 3N8GA 5IT0A 1Z5UA 1U2SA 2GMWA 1YMQA 2ZBDA 3FPBA 3W5BA 3I6BA 1RKUA 3M9LA 3UMCA 3QXGA 3L5KA 3L8FA 5AVZA 3WK4A 3AR3A 4YCLA 3L1UA 4FFDA 3BWVA 1QQ5A 1J8DA 5AW1A 1RLMA 1T5TA 1WPGA 1YV9A 2RB5A 1RRCA 2CN1A 2OM6A 2WF9A 5AW8A 2RBKA 4CF3A 1VJRA 1ZD2P 3AR7A 1IWOA 2CFSA 3ESQA 3QYPA 2P11A 3AR6A 4Y2QA 3OCZA 4OHFA 2HCFA 2G1AA 3UMBA 4AS3A 3OCYA 3N5KA 3U7GA 5AM4A 1RMQA 2IA5A 1WR8A 3ZW7A 5ALEA 1JUDA 3ZUPA 3QUQA 1U02A 1O03A 5AI8A 4NV0A 5A3SA 1ZD4A 4UAVA 4XOUA 3U26A 3AR9A 1ZOLA 3DDHA 3ZTWA 3NALA 1QQ7A 5AKHA 1SWWA 2BY4A 2I7DA 5AIBA 2AGVA 3NIWA 3L7YA 1RPZA 3E84A 3E58A 5A3QA 2HF2A
chains in the Genus database with same CATH superfamily
4U5XA 4BTEA 4HFJA 3HN6A 3WLAA 1KDOA 2J3EA 3EMKA 3BMQB 3BSFA 4BB6A 2CYCA 4NWIA 1S1MA 3OM1A 4DR5B 4CLOB 4H3SA 5MFZA 1DNPA 4YJGB 3CO5A 5CPFA 1OOEA 3Q88A 4ZXPA 5LBUA 1H5QA 5LC1A 2IP1A 4RJ2A 2WG0A 3AHCA 4KC0A 1BJTA 1IJBA 2FSFA 3FPJA 1WS6A 5J23A 3AHDA 4CV3A 1HFWA 3GARA 2QM3A 1DBSA 5CEFA 4J16C 1N2JA 4KPEC 1ZX1A 4OSEA 4HVAA 2VPQA 1X7DA 4HMPA 1GIAA 3KS9A 3PE6A 4K7JA 2RKOA 5KTNA 3VZCA 2J6BA 4D99A 2ISCA 4Q3NA 2F8MA 4WD3A 1HSZA 5K6TA 1N57A 3V3KA 2L82A 3D6TB 1AS3A 1H8HD 2V5VA 3MJTA 1R27A 3TJRA 1L5OA 1CUHA 1QHHB 5KOJA 1OREA 1B23P 1C1XA 4R01A 3I58A 4M0EA 5I9SA 3SG0A 2WJZB 4OP1A 4CG3A 5T41A 1UKCA 1G3QA 1ML4A 1OCEA 2DQZA 2F4NA 5A7FA 2XQFA 4WT7A 3GUZA 1UXOA 2W8ZA 3IKVA 1FFGA 1T8SA 3T4XA 2WYIA 1XNHA 4IZIA 2V4MA 3E0QA 4P08A 1LDGA 4RMJA 2IEBA 2QUJA 5IVDA 2QX9A 1JG1A 1M33A 1P1IA 4PGMA 3LYLA 4IMPA 3H9QA 1QAQA 5JNSA 2Q7DA 4TV9B 4PAOA 2D6FA 2OG2A 2QENA 3CR7A 4AKHA 3DZGA 3EGOA 3CH4B 3HL4A 3S2IA 3PDWA 4S1PA 2YIVX 3AEZA 4QVGA 3HDJA 2J0VA 3QPCA 3NT2A 3QM1A 1QU2A 1ADGA 4FYIA 2AUMA 3DVRX 1UJCA 3FUWA 3H2ZA 1KBZA 1VLVA 4ZDIA 1OFHA 2P5SA 2WE8A 2XUZA 3CLRD 3DOCA 3KD2A 4H16A 4RKQA 4IV8A 4I81A 3WO0A 4XSGA 1H5NA 5ALNA 2X8JB 5CHEA 4INOA 2GNPA 2L0XA 1RTKA 4MJ3A 1WD5A 2V9CA 4GPD1 4O4LB 3GT7A 5I6DA 4RIGA 1VHQA 3SZ3A 1I7NA 4MVYA 3LQQA 3WLIA 5CAEA 4DB4A 4G24A 4ZO4A 1DAKA 1QORA 3DGEC 1C8VB 4TWJA 5F2KA 1Z0SA 1HGXA 3H04A 5F12A 3WQQA 1F2DA 2C2YA 2F3RA 4K6CA 5DHUA 3R40A 5FJIA 3H0CA 2QAGC 3EEBA 4ND8A 3PXCX 4IVPA 3T12A 4GP6A 1K7CA 3OOEA 4E30A 3U09A 2QR5A 3KAKA 1DXOA 5DP1A 1K5GA 2VJQA 2X4IA 2ZETA 3EW7A 2IV3A 5K2MA 4QGHA 3EZ6A 3RYFA 2I78A 1QR6A 3ZV3A 1J70A 5IM4A 1P7WA 3N6VA 4BVEA 2VC2B 3M4YA 2O4UX 1YKGA 5GTDA 2XGGA 4CQNA 2A14A 2AA3A 3W8NA 2R6R1 4QXQA 4RLQA 2BEKA 5EEGA 2Y9PB 2UV8A 1NVVR 1KY2A 3NS7A 3ERCA 4TLBA 4BO7A 3Q2OA 3A3OA 3RRFA 2YZNA 4AMGA 3PFFA 5CM8B 1Y9AA 5HFNA 3QU9A 3ROTA 2X8LA 3GAMA 1AQLA 3WMEA 2EBHX 4H4CA 2I3AA 2JLYA 1O96A 2WIAA 3DOHA 5KJ1A 3NWPA 1GGEA 3HA5A 7YASA 2RCNA 4P35A 4BGUA 3IAFA 4BYGA 4OK6A 4BS9A 2VQSA 4RF4A 3DD1A 2C61A 1R0KA 2P90A 3WGNA 2X7XA 5L53A 1C4OA 3MEQA 1F9AA 4JCOA 4UHJA 3SR4A 3K3PA 3NQ41 2YFQA 3EZFA 3KFVA 5JTUA 1MV5A 2HEGA 1HKHA 2AG1A 3RBVA 1JLHA 4HDKA 4F1WA 1RAFA 3ANNA 3C5CA 3FYHA 1ATIA 2OHJA 3ZW8A 1USKA 4X6XA 3IT2A 1CF4A 5ITZB 5A6SB 2IHVA 2JLXA 3LQYA 1OMOA 4GI7A 5DXJA 3PR3A 1T1JA 2QPOA 2VDLB 3FVRA 4TSRA 4Z1MD 3ACDA 1SXHA 1Y1RA 3TDNA 4EB0A 2ZR7A 4LXGA 5IDXA 4LRQA 4XB1A 3WIBA 2JAQA 1B6GA 4KWCA 2A2ZA 4PXAA 2V7PA 3TG2A 2ZS9A 3KKMA 1S5PA 2GK4A 5J5AA 3F46A 4BUJA 4TT3D 2GRJA 3PYMA 2Q46A 1Q57A 4ZP1A 3DR5A 1UMCA 1NLZA 3V1LA 5AK5A 2ERCA 4E12A 3KKOA 4LOJA 4GRIA 1YVPA 4NMWA 1Z4OA 5AI4A 3HY4A 1DOZA 3KDSE 4PE5B 3P2EA 1R0YA 3VZDA 4LZPA 1RBYA 3ICCA 3ONNA 1I01A 2AI1A 3LDHA 2Y4OA 2Z95A 2PVCA 1BH2A 3A06A 1KO5A 3RK0A 2DQYA 3OIDA 3RANA 1RI4A 1I7LA 2PXXA 4JU8A 4QGSA 5JD5A 4W6ZA 3WS7A 1GZVA 2P69A 2C5LA 3D3NA 3MXOA 5FI5A 5L3RA 1JMKC 2VH2A 2NO6A 2X7JA 4NHEA 1IHXA 5H83A 4HB0A 1ONOA 1IVYA 2R87A 5DX8A 5HRAA 1GG9A 3K09C 4KX3A 4RM2A 4GQAA 2PRSA 3W9YA 4RHFA 3FOBA 2QJOA 4AJ4A 2Z5LA 1YDFA 1LPBB 1QKKA 2OCIA 1FNDA 3H05A 3IPLA 4LDAA 1Z4MA 5B1SA 1ANKA 5LYYA 2XUJA 3ZCSA 3H5OA 2LTAA 3EXHA 4LXTA 1UMKA 1KE2A 1ZMRA 1ZU4A 2ZKLA 3KUXA 3BYZA 4DCUA 1JDPA 4D45A 1WM1A 5CXUA 4Z9FA 4L7QA 1ZK2A 2V97A 1HYGA 5JO0A 5IDVA 3T5BA 4QXAA 1NW7A 1WTCA 4HJXA 4B6QA 4BB5A 1N0WA 4MR8A 4E5YA 4IIUA 2QVCA 1R5NA 2HV8A 1E2KA 3I9NA 2OV4A 5ANRB 1ULZA 5KC8A 5KMGB 1YHNA 4XUCA 3EFEA 1U2QA 2WMNB 3HDTA 3QPWA 3VYRB 6Q21A 1RXCA 1C30B 4LHXA 5K8TA 4AMBA 3PIDA 2RHOA 4ZPXA 5ILQA 1Q0PA 3AESB 5IARA 4XW2A 1RRVA 4X1KB 5JE8A 3ILVA 3WO1A 2X0FA 5PNTA 2WBLC 3X1KA 1JW9B 3DZCA 4Y2SA 3SEFA 4CM3A 1TVEA 4IHAA 5IJXA 3KETA 3NOVA 2X9GA 3GGCA 3AYXB 1MF7A 2WFMA 1WZNA 3C87A 3GJ4A 3BZUA 3EIHA 3G2JA 3NB0A 4JOCA 1QP4A 3N59A 3CURA 2FLWA 2XKAA 4J0DA 4EKGA 2A4KA 1VBMA 1J1IA 2WVGA 2PFGA 3VPFA 3BIFA 4WZBB 1D04A 3CRW1 5C8YF 1UFQA 1GTVA 4WSOA 3WHKA 1J2EA 1AQYA 1P2UA 2QXUA 5TPWA 2QUAA 1OX4A 3BICA 1B8VA 1EQUA 3PUHA 3U3MA 4DR2B 1OB2A 1G59A 2QYHA 4J0CA 2H4JA 4W7IA 3FUXA 4F3CA 3STVA 2OO7A 3DVAA 3QJ5A 4PLGA 3H5IA 4PHTA 1KVSA 1ZDMA 2LPMA 3F6YA 2JFGA 3C7AA 3KR0A 3MS7A 4JEHA 2J3KA 5CM9C 3WP1B 1JAZA 4P3NA 4UBIA 4RMNA 4RZSA 2PIDA 5JNRA 3PUVA 1DADA 1ZLYA 3W8EA 3PR2B 5KI6A 2JJ2D 3S2UA 1WBJB 3PCRB 1WXGA 2XMDA 5K20A 2UUCB 1L7AA 4LX0A 4YGXB 3RHTA 4NFYA 4YPFA 4EFNA 2GZMA 1E2IA 1EXMA 4RVOA 1HY3A 2WYVA 3SFVA 2QP3A 5H0IA 1RJ9B 4ZK2A 4MAMA 3AMVA 4RJLA 2Z4TA 2W00A 3OIGA 3CTMA 1P1CA 4HGZA 4MNTA 4CMBA 1MVOA 1V1RB 3PDHA 1IBCA 2GVNA 4RX1A 2H5JA 3DA8A 1JQEA 3Q3IA 3RUAA 3WYNA 5CB6A 1DXHA 3KT3A 1GAXA 4GBMA 2GJ4A 2J6HA 2YYZA 3QLUC 3ENQA 3CVYA 4QTZA 3Q3GE 1CRLA 2FDXA 1KPIA 3FVVA 3NV7A 4KUGA 1CJCA 3A9SA 1XSEA 4QEKA 3U4GA 1MB2A 1ORIA 3MQFA 2Z30A 3OIYA 4PPQA 4MX8A 4RXMA 3WHPA 821PA 3OLQA 2HEIA 2OZEA 4MR9A 3HKEA 3IP8A 2R2AA 3OHSX 3U1BA 5EE3A 3JAWB 2ZJBA 2QBYA 3NDBB 1H2RS 1SXJC 2Y0CA 4YACA 2OOSA 1QOZA 5D86A 1XAHA 3VR2A 1JA9A 1QUFA 3DKRA 2AOXA 1E94E 1XZHA 1G1AA 1WF3A 3WXBA 4AMUA 4DGQA 5AXCA 1XTIA 4OHCA 3VVLA 4J2TA 2B82A 4Q9AA 5TB5A 1Q7BA 1V6CA 4G81A 1WDTA 5HW0A 4C0HA 3E8SA 4DNFA 5AVVA 2WABA 4DR4B 2IXFA 4ND3A 4QPCA 1HQDA 2QIPA 3O26A 3OVMA 1TO1E 2HRRA 2D1TA 1U8AA 3F78A 3FYSA 4FR2A 4I50A 4IV5A 4P6VF 4S12A 5GQSA 5KWVA 1T3ZA 4DLPA 1X92A 4XVCA 1A3CA 2VPWA 1R10A 3IBGA 1QIKA 2QV7A 2RHBA 4XH9B 3I8SA 2I2AA 2BELA 3Q0IA 1PLJA 3AUUA 3GROA 5EFZA 3I09A 3KB2A 4QPJC 4LAFA 1Z68A 2FQXA 2OFOA 4AI6A 4RQAA 1LPMA 2YJ4A 2G82A 4NV3A 3RSOA 3OKAA 5IT9A 4HQKA 1G60A 1UBGA 1V7PC 1QC5A 3OWXA 4GHWA 1VL0A 2GHQA 3N8IA 1I13A 1Y9EA 2FLVA 4JLWA 4RH0A 3EN0A 1H4TA 1ZSVA 1TKAA 4IDPA 3ZYZA 4DCSA 3DCJA 3F9CA 5D2CA 4U7WA 2Z2JA 3RS9A 1E5TA 3B6JA 2ACKA 3A9UA 4R40A 5C35A 2IHKA 1EFLA 2PKEA 3IDSA 4B47A 2ZRGA 5FX2A 4B0OA 3TL6A 3WYDA 4G89A 2IH4A 5H02A 5EWJB 4Q02A 4IL5A 1NVVQ 2UXDB 5JXIA 1TO2E 3KJXA 3GLKA 3PP8A 3E3LA 4U8HA 1UBJS 2ID7A 2YFYA 2O6LA 1T24A 1XHFA 3CX3A 3HN7A 3L0CA 4BVLA 1V8OA 3B2NA 1QGED 2EOAA 2I4MA 4ALLA 4JP1A 2I8AA 1DPGA 3GT3A 2IS6A 3HS3A 1AQ6A 2J0EA 1FXWF 4E7OA 2G0NA 4D3DA 4BAUA 2BEWB 3UV3A 3H84A 1ORHA 2BKXA 2VP2A 1ULUA 2E3JA 1BWRA 2P4HX 2VP3A 3DMDA 3EPRA 4MPPA 2REQA 4FSHA 3T7JA 3LHIA 2F1JA 1TAHA 4EKNB 5SY9A 1TYZA 2J0UA 2JH3A 3N9IA 4QOJA 4YCCA 1E69A 1JQ3A 3B2EA 5HKOA 1C41A 3PFCA 1IHOA 1MABA 2GZHA 2ZP1A 3LP5A 4EPRA 2JIQA 4YRGA 3WRWA 5DLEA 3A25A 4YWHA 5C52B 4WERA 2FG5A 5BT8A 5DOZA 4MV1A 1XELA 2ZQ5A 4MO2A 2Y8EA 5TDHA 1XNQB 4MSUA 1IZ0A 1LV7A 3ROQA 2I4LA 5BN5A 3I23A 1JYSA 1HK7A 3RWOA 3PVZA 4ZN6A 5JT1A 1PO7A 1FUKA 3N8GA 1UDRA 2C04A 3AKCA 2C3YA 3GLIB 2CCGA 2UUAB 1PZMA 2H8GA 5TARA 1TEHA 1H3FA 1V96A 2EF0A 4F4DA 1Y1PA 3R0XA 3KHTA 2AR7A 5TLSA 3W5UA 5AXDA 3FFXA 3KQMA 1I5OA 2R86A 4H1VA 4RIEA 4HNGA 3UJDA 3GNSA 5H68A 1UKYA 4JBYA 4B81A 1TKBA 3HNOA 1JDBC 3PA6A 3R7BA 3GDOA 1P62B 1QWSA 5DBFA 4B2LA 1H9BA 3GLGA 1SCUB 1VGQA 2HO5A 2XDYA 3KK0A 2R6DA 4C76A 4DY6A 3QX8A 4BZXA 4RORA 4HXEB 2GILA 2I2CA 4JV5B 4TUYF 2GASA 2C7BA 2IE8A 3ZHSA 1Z0KA 3MGCA 4ALMA 1IBKB 1JSCA 3FPAA 2BTOA 3C1AA 2I2XB 1QV7A 3ESQA 1AKYA 2FXIA 3AM3A 5HKBA 5BR8B 2GEUA 3ECSA 4BO3A 2Z08A 3MCAA 1LK7A 4AX4A 4RIHA 4G8CA 1XJQA 4G67A 4JSRA 1G4UR 1P31A 2FUG6 5EPOA 2C03A 2J30A 4ME6A 4CWAA 3F90A 3LKBA 1H2EA 3K8YA 5G02A 1XZPA 1I0ZA 4K9PA 3O9MA 3QF4B 5DGCA 1EVIA 1W25A 2X0KA 3T9CA 4R71A 1B2RA 1O03A 2RGEA 2ZPTX 5HR5A 2YTZA 9LDTA 4X91A 4XQCA 1XCMA 2E87A 5EG5A 4ZVRA 3PX2A 5BWBA 1AG9A 2RHGB 1Y8ZA 2JZOA 2QTFA 4DCVA 1JTVA 4L51A 1GGVA 3QHQA 5T4HA 2ZULA 1RWWA 4IIJB 1ZGAA 3SC2B 3V4LA 4OV6B 1KHTA 4RABA 3M4JA 4NE9A 3ZJUA 3E84A 4AG3A 3D7SA 3L2OB 3Q40A 4M37A 5BURA 1A2OA 4WK0B 1BFDA 1F06A 1UMBB 1Z0JA 3RRJA 4XWYA 2CLMB 3K0AA 3AJ9A 4HJRA 4D6XA 5CYGA 5EJEA 3E5RA 2OD9A 3P0FA 1A9XB 2APJA 1AJEA 3SQOA 1KO4A 2CFIA 3C97A 3NDPA 4KREA 1K86A 3MHTA 5JSQA 3IA2A 1GNQA 4OCZA 4PLZA 5AQ1A 1BYIA 1EGQA 2ZYWX 4XDGA 5LXTF 4K5QA 4YV0A 4KUHA 2QQ5A 2PZAA 3ED5A 3WIVA 3MJ4A 3WOVA 4BBZA 2CY0A 4QYTA 3S81A 1JR6A 1U80A 2PO7A 4E94A 3A36A 2XH8A 2PL3A 2GD1O 3I05A 4P83A 4XIJA 4BX0A 1E79A 4WLFA 4K2HA 3FA2A 3AT1A 3KKEA 2XADA 4GUDA 3DTVD 3EXEA 1NVMB 1CW2B 2QPTA 3ET4A 1FNNA 2QVZX 3HXOA 4L8WB 4W5JA 1I2DA 4OHZA 4QUGA 2X5JO 2DBYA 1OAKA 3FZEA 4FEAA 4H60A 1V11B 3IDAA 2QLTA 4GPZA 1E64A 3ZHQA 5HJ7A 1H4SA 5ES4B 4OLAA 4BVGA 2WT4A 3SE0A 4W5OA 3U0BA 1F4VA 1E9RA 4MS3B 3VH2A 3OQ1A 1WVGA 1TT5B 1U04A 1RKQA 2OGUA 1TZBA 2OCKA 3ZX5A 1T15A 1Z13A 4H7FA 5J1SB 3BT7A 4H1HA 4XD7D 4OA8A 1KSHA 3DEHA 3DKPA 1UOPA 1L5WA 1AY0A 2G08A 3IMFA 5ECDA 2Q5OA 3PQ7A 3QXSA 4KYTA 2VWHA 2VP9A 5DTIA 4IJ6A 1PG2A 2GCIA 2HQOA 2Z0MA 5G0UA 1FNBA 5DM0A 5B12A 5K05A 4LXHA 4I9UA 2H16A 4EG5A 4YJGA 3JQFC 4EECA 4F1JA 2BSAA 2J08A 3DZDA 3TK1A 3RIEA 1IY0A 1OASA 1OPRA 2HLDA 2CNWD 2FKNA 2V3WA 4X71A 5A9SB 3LBNA 5BT9A 5F7JA 2ACWA 2PAFA 3GEIA 1EBBA 1K75A 4J7AA 4WINA 5CNIA 5EIHA 5A5GA 3AY0A 3LWNA 1ZONA 3TZLA 4XYGA 1XZQA 1KA9H 5NLLA 5JJIA 3DZ8A 2YWHA 3H2KA 2XT9A 1VIVA 4UPDA 1PJ2A 1K8RA 1PIWA 1K6EA 2Y0EA 5LUBA 4KGZA 3BGDA 3UWOA 2Q4TA 4X92A 1M8KA 4ZOAA 4BLSA 2Z9DA 2C92A 3DSRA 4LC1A 3DMFA 3B2QA 3OCJA 2XNJA 4GOLD 2BZGA 2GN8A 4AUEA 3BIOA 4JKYA 5DP2A 1VFPA 4UTRA 2PJUA 3CUSA 2I91A 4X61A 1V35A 3R0JA 3HCDA 3O73A 2WSMA 4PANA 1WX1A 1FRNA 4JS0A 3ZWXA 5J59A 3WBFA 2XAUA 1NUHA 3H2HA 1KU6A 3OJOA 4ODIA 3PYXA 3VTAA 4O4IB 1MT3A 3NFYA 1HSOA 3O3MB 3Q3CA 4MVJI 5KQLA 1M1XB 2WOOA 5ADHA 3KDPA 1NJ2A 1O08A 2DP4E 2W2NA 3ABSB 4GC5A 1UBEA 5KOIA 1M1YB 2QI9F 4PZZA 2BI8A 2P1DA 4TV9A 4DRZA 1LNZA 4M46A 4ZJUA 2XD9A 2W71A 2Z98A 2VUTA 2O48X 3BULA 2ZSDA 4MVJG 1H5UA 5CCBA 2JLWA 4GYKA 3RYIA 4B2IA 4RCYA 3R3ZA 1L2TA 1OI7A 3BGWA 3BHNA 3R6DA 3HI6A 4N0EA 4QU8A 1GTRA 3H5WA 3UK2A 2XB6A 4HGPA 3I39X 3KYJB 3P2MA 4O08A 3DBVO 2AMYA 3LUAA 3IMCA 2OGWA 3EQ6A 4FS8A 4Q03A 1J0DA 5DYYA 4CG0A 4BECA 3VUFA 4DJTA 1NXXA 4IH1A 2JKYA 3ND9A 1WB6A 2OCXA 3V4OA 5B53A 2X8JA 2G5PA 4BFZA 2OAP1 4O4LA 3JQAD 2H3EA 1IZ9A 3I9LA 2OFWA 4K6GA 1GY8A 4XPIB 5ERXA 1YCDA 3OZUA 1R3UA 4R8MA 5DJ5A 1Q1BA 2JI7A 4CDNA 3FYCA 2PUCA 3FTEA 2GEKA 1MXFA 1U8ZA 3PQ5A 3TW4A 1VJ0A 5CBPB 1TCVA 1VE7A 1ZJJA 4DPLA 5KZMB 3ZGXA 3WRYA 4WL0A 2ZRNA 3LC2O 3CUWA 5GVSA 2XRYA 4XWGA 5H3HA 4CFZA 3F3KA 1WCV1 5HF8A 1ODSA 1WLSA 3O9VA 4X8OA 2N75A 5CXQA 2YC2C 2LE0A 4NE2A 4PWZA 2AUNA 1MAAA 3I92A 13PKA 2WJWA 2GJKA 2WT9A 4TTAA 4B9AA 5K0GA 2GF2A 3HA7A 4JJAA 1JLRA 3UJAA 2AJBA 4UBKA 2E1RA 3KQLA 2GXAA 2C2MA 3PGXA 3NEJA 4XIGS 2BR4A 3QXCA 4RMGA 2OQ2A 2H29A 2ZSHA 2E7ZA 1E1CA 2H2WA 5DNCA 3ME5A 1WSWA 1GL6A 2QSUA 4MQUA 4CYMA 1RC8A 2C4VA 2LNDA 1GL9B 4ABYA 1YCGA 3N70A 2HH9A 4BJ1A 3RFUA 3QRWA 1DJMA 4AMZA 1I32A 3AETB 1CU1A 3OOHA 1M76A 4GOND 1ZAKA 1UP4A 4N0PA 5JWOA 4KLZA 4OJTA 1J22A 1J1ZA 4HAUA 1E1QA 1K5DA 5TE9A 4EHKA 3L6UA 4H7JA 4JI7B 1YUBA 3Q1KA 2FEMA 3VNAA 3LPCA 2Q0QA 2R7NA 2FW7A 3ML1A 2WJ3A 3FNQA 1KS9A 4FNOA 4QQKA 2FOLA 4ZQIA 1U1EA 4FILA 4JB3A 3HXPA 1J20A 4BZZA 2H65A 2O7SA 3RYCB 3GZTB 4PPFA 5DYTA 2P77A 3WJ1A 1L5ZA 3DOUA 4D8WA 5J1TB 1S3SA 3F97A 5ITZA 3RBXA 5A6SA 1LDYA 3MGAA 1HNZB 3IIMA 2BMAA 4NE7A 1W19A 2O23A 3BXPA 3DC2A 2QX6A 2Z3VA 3FR7A 5L3ZA 1M73E 2YDYA 3NC1C 2XCSB 3ZVRA 4AO8A 1A76A 1A9OA 1ZQ1A 1RM3A 1SKBA 2A0KA 4XCXA 4ZA2A 3MD0A 3T3OA 2FPLA 2QYSA 3H2YA 3EGVA 1ZGCA 2VYVA 1ZJYA 2ZE8A 2RAVA 4JR1A 4ZZ2A 4PSKA 2GYYA 3C16C 4EHFA 5JW6A 3A2KA 5BRNA 4ES6A 3UK6A 4CE6A 2B9EA 2JLSA 2MSCB 2O07A 5K3DA 3E5HA 1Y42X 3PQ6A 1P5FA 5LM3A 5E8JA 2I4NA 5IP5A 4JLNA 5AOAA 2CBGA 3QVGA 1Y5NA 1R6VA 4ZQCB 1U7PA 1MOSA 2WWIA 3NOQA 1NM5C 2VLIA 1RACA 1K7EB 2DJ5A 4E11A 1XWWA 3GJ5A 1A0OA 1SD5A 3A11A 3JD4A 4JCCA 5JAZA 5M7EA 1PWYE 1CC1S 3IP7A 3MAAC 4GWGA 3IHTA 2Y71A 2H5LA 2Q3EA 1QRAA 2P9HA 2OHIA 1CG6A 3D3WB 2OZVA 2XW6A 4TLDA 4CL8A 1YGPA 4HLQB 4JJ6A 2WJVA 2Z2KA 4EYEA 5KX5F 2DEUA 2YRXA 1FW8A 3B82A 3JPYA 1LA2A 3KLBA 5L7WA 1J0EA 1O54A 2ETVA 1SG9A 3MWDA 4ECEA 1K0UA 3GRAA 4TKLA 3PXXA 2WKSA 4WZAB 4DUGD 4EZBA 5EEHA 4JYMA 1MGOA 1M2VA 5FO0A 2MIIA 3NIBA 1GPDG 2JD0A 2ZRCA 4I1UA 4JT9A 1XNJA 4M1ZA 4WXRA 1ZUHA 3TN7A 1O94C 3EVAA 3UGTA 3V32A 2PKQP 4EYOA 3LHDA 4PCUA 3PUYA 5LZ2A 3SLRA 3VO8A 1NZFA 1YZNA 1ZINA 4BO0A 2NZ2A 2BFMA 3G7UA 1ZLXA 2I76A 1IOVA 2D0OB 3ABOB 3GLSA 1VB3A 3WAKA 5KVQA 2CE2X 4EFDA 5BW4A 5EZYF 3WLPA 1KEEB 1NY6A 2WD7A 4N0QA 2IT1A 4EF4A 3QEOA 4PONA 3HKBA 2VK1A 3BH0A 4G5GA 3V5NA 5IVHA 1VLJA 1IHUA 1DELA 1XB2A 2B5VA 4ZVLA 1O58A 1XDBA 2Y93A 4RYLA 2FE1A 4L1KA 5T8KC 4MRNA 5KMGA 5BV1A 2D00A 3EISA 3ELUA 4G6ZA 2AXNA 5JVDA 1C30A 2ODPA 3NM6B 3U19A 2QORA 2GXSA 3OETA 3T99A 4AURA 3G9QA 3G17A 3DQQA 1DINA 2FETA 3RUPA 2IUYA 1CZNA 1VCOA 3AESA 5LQAA 2PRYA 4M1KA 3UWKA 1UBOS 3RVPA 5FQNA 2DGDA 4LXUA 1ZXBA 2FRXA 3ZDEA 7MDHA 4B09A 2WM2A 2P9JA 2Q5QA 2Z2YA 3I2YX 4KMSA 4O6VA 4GXQA 5E6UA 1PL0A 5JAQA 4B73A 9ABPA 1NLYA 3EXIB 1L7OA 3HO6A 2O8EB 1L4GA 2IC5A 4PEVA 3RHSA 4RACA 1NTOA 5I5GA 4KCGA 1YZQA 1M8PA 1OTYA 4MLPA 4EPYA 1WY7A 4WZBA 3J7TA 2DR0A 2VQ3A 4H6XA 1CRZA 5CW1A 5HP4A 2ZUTA 1KAMA 5TS2A 1KI9A 4RLSA 1X38A 2BMFA 4FFSA 4FLEA 4LQDA 3GELA 3UW3A 3H9GA 4ZYUA 3PB3A 3X2SA 2R6HA 4MMZB 3K0HA 1E9DA 2JHFA 2B1GA 3L8CA 4ZVVA 2PUDA 1Q1QA 1OY1A 3GCWA 4MYCA 3K2EA 4JOBA 4MQFB 1Q5PA 4PG4A 1YB2A 1MJGA 3IPXA 1R6TA 4FE3A 1U0BB 2YOHA 4Q47A 5DYNA 1QB8A 3PJEA 3U0VA 4CEHB 4PSDA 2BF7A 1IWPB 2J9ZB 2YRFA 1BCSB 2NTJA 3E7DA 3RU2A 4C0AC 2XR1A 4HWTA 1QGYA 4DCCA 1YU9A 3CMMA 3K92A 4YJHA 1Q95A 4EGAA 1GHTA 1CR0A 1U0JA 4JUBA 1TF5A 4CCWA 3I2IA 3DEIA 2NT3A 2BD0A 1WMFA 1PQWA 3QJGA 5CLGA 1XKTA 1EE2A 5KYXB 1KK1A 2P3QA 3CB2A 4TKZA 3CH5A 3I5AA 3MS2A 4ZDKA 1NR5A 3H6HA 2FW6A 4KIFA 2NSHA 3LLVA 1SQFA 1YNSA 3G1UA 4B4DA 4RTLA 3HBLA 4PPYA 2FWIA 5DI3B 8GPBA 5J2TB 2YHIB 4LSZA 1XYGA 2XNDA 3IV6A 4UVEA 2O54A 4IYRA 4Y1EA 3D5QA 3HBMA 3HR4A 1VE1A 1HDGO 3T94A 3UJ7A 3G88A 3HJRA 1PJLA 3WY9A 3LPNA 1WJGA 3WJAA 2FSIA 3GLHB 2OV3A 1DDIA 1IB6A 3DLIA 2JJ8A 3O1HB 4L8VA 4MYSA 2C83A 3DDCA 4ZVUA 3VPAA 5CA1F 4M2LA 1MPXA 3M3HA 3TBKA 5B6IA 5JCZA 4B3MB 5TVGA 3COVA 3WWDA 3AU8A 3DL7A 2REOA 2GHIA 2HCRA 5JD3A 1VMKA 2P35A 3D64A 4EB6A 4G07A 5K3OA 3K5HA 1XTVA 4H0FA 1O6BA 1J90A 1TAUA 2VQDA 2A35A 2XMCA 2P2ZA 1IL0A 3SJCA 3UF0A 4EJFA 5IZCC 3D2CA 2I80A 3DMHA 3L4JA 2JFZA 2PZFA 5KNDH 4DMFA 2RGGA 4OP3A 1OH6A 5HUHA 3NC4A 1TD1A 3MA0A 3ONEA 3ZKAA 1ISMA 3SXUB 4HRAA 4RS4A 1WAMA 3D7RA 4UDOA 3LUKA 1UBMS 2G0TA 4MGIR 4JC8A 4Y3UA 5AI5A 5JROA 3TOZA 4HXGA 2ADFA 2JAOA 3NTVA 1B1AA 2X9NA 3NXSA 3PFGA 3J7AC 3KR2A 4DC0A 5TGTA 3WGUA 2VQEB 1DXYA 1C0IA 3HABA 3PICA 3QELB 3T3GA 1HYBA 4ZEOA 4TYYA 2EP7A 2WYOA 5JALA 3QUSA 3UO8B 2H63A 4U02A 3P9NA 5CT9A 1CUAA 1NMSA 4HAXA 3C6XA 1EWVA 1FJHA 2NUAB 4EHHA 1ZAYA 5I7WA 4EA6A 1T36A 3AV3A 3UV7A 1A77A 2ZAMA 2CJYA 4N65A 1GCUA 1XWIA 3W4IA 5EMNA 4I9FA 4Y8VA 4H7KA 5DGDA 4A6XA 3JQ6A 3LKZA 3ASZA 4I08A 5AXAA 4ZXFA 2OLJA 4OP2A 3L18A 2ZJZA 3ESAA 2DQKA 1PHPA 1G9TA 3HCFA 3E18A 2GDZA 1ZM2A 3GUYA 1E4OA 1Z17A 5NULA 2XXJA 1DEHA 1LUAA 5EE1A 5AVZA 4L5YA 3HZRA 3TLBA 2JIMA 4L08A 4N18A 4OI2A 4ZHQA 5LYJF 1L4NA 4P3KA 2F3PA 3OOJA 3L7IA 4IO0A 4HEQA 1CUBA 1FUEA 3BE4A 1RLMA 2XCIA 1WWKA 3GRYA 4ZOCA 3C85A 4YAGA 4MEAA 1VHWA 1ZYUA 3D43A 4S1VA 4YCSA 2XXAB 3KOWA 1T2FA 4BVKA 3R7LA 3T7EA 5ED4A 2H6EA 2JAHA 3D6VA 2P75A 3TSOA 1QZXA 2BFAA 3IBYA 1SVNA 4ZQBA 1LSUA 1VIDA 2P11A 5JLAA 1KS2A 2IS4A 4NG4A 2JDID 5IVPA 5JCOA 4Z3DA 5B1YA 3UV6A 1ZICA 1VE3A 3RC3A 1RHKA 2QPAA 2UUPA 3LO8A 1WVMA 5KSPA 3ZI0A 4Q7KA 2NTEA 2Q3MA 3ES9A 5EC8A 2NVBA 1D4ZA 1QU3A 3T3IA 1HE1C 4NATA 5A3SA 4NJOA 4C7BA 4MTLA 1GPWB 3M6IA 4M60A 2FPPB 2JLUA 5FI1B 1QK5A 4HVLA 3L6OO 4JBGA 3TFOA 1II8B 4I4LA 2OENG 3CF6R 3FCCA 4PGFA 3IPRA 1E1RD 5CDGA 4QBIA 1D8AA 1OR8A 2OA0A 3FHCB 4DLTA 3A4TA 4LI0A 4KLCA 4LK3A 2HB6A 1E5DA 1PLLA 5DVZA 3IQWA 3OP1A 2WIFA 4HTAA 2N42A 5AJHA 1GPAA 5LLTA 3UCFA 5C7OO 3FJYA 2MTBA 2R00C 3KOUA 3QE3A 1ZJ5A 4YGYA 1X9IA 1Q77A 4KR7A 4DR6B 3P0HA 3W04A 3AZOA 3F7TA 1PE0A 2F64A 2Q2VA 2ZVPX 4TKMA 5FIUA 3KNZA 3SKVA 3ZD8A 5H8WA 1KBQA 3UCEA 4RHEA 3TX2A 4F2HA 1EYZA 1ETHA 1RYHA 4D8YA 2BSXA 3QVJA 4DDWA 3UMGA 3VJLA 4KRYA 1D2NA 5ALVA 4DMHA 3PFWO 2VHCA 2YJ5A 4N39A 1U90A 4PHFA 4XIFA 3PTZA 3HXQA 1HPLA 1XP5A 1GKKA 1T1EA 2QN6A 4Q1CA 2H1HA 2C9DA 4ITRC 2FCAA 3VXKA 1PI3A 2FEKA 2YXBA 2X2FA 3ZDRA 4LWPA 3SOPA 4OI0A 1KRXA 1PEAA 1IN8A 2QP9X 3FI0A 3GJTA 5ADWA 2O2XA 2OK7A 3QKSB 4GM1A 1JHDA 5FOUA 1QRUA 1NIJA 1GTZA 5DHTA 5FBLB 1ULHA 1SELA 3NETA 3CR8A 2QMEA 4MUAA 2DVMA 5AUPB 2J7PA 5DK6A 1M2GA 5KTPA 1E58A 4ROTA 3ELDA 4IIJA 3SC2A 1YJXA 2CHQA 2PO5A 3GJ8A 4B8ZA 4QBHA 4ZCIA 2D5BA 3RRMA 5K3FA 5CIQA 2X8AA 1EP1B 4HSGA 4ZT5A 3IIEA 3DV2A 1W4LA 4G4SP 2R79A 4RA9A 4WY8A 4GXRA 2RHCA 2DJIA 2G70A 3V9PA 1G21E 1A9XA 1WW8A 3O0DA 4BPRA 3WMRA 4A8JB 5EHZA 3LG2A 4J1TA 2HUPA 3FN4A 3OT5A 3REGA 4TXLA 3CM0A 3HSYA 4BYMA 2HM7A 1BNCA 1SXJE 4B7ZA 1KEVA 5KSWB 1LK0A 4MW9A 2FF7A 1XL0A 2YCLA 2BF4A 2CV1A 5K0BA 4OU4A 4TROA 4AT1A 1DQRA 4PLWA 4W5RA 1KZ9A 4KXYA 3EULA 3CR3C 2PE5A 2GH1A 5HCIA 2ZUEA 1ML3A 4G36A 1BW9B 1V11A 4LYYA 5CVTA 1RIFA 2GCGA 3AM5A 3AUSA 5AP9A 3FMVA 3H1AA 3UFXA 2QM8A 2O05A 1B16A 5AI9A 2PEYA 3KPWA 1JXMA 3OOWA 4O2LA 2J6CA 2BW0A 1IY2A 2NG1A 1TT5A 3UG7A 5AYVA 3D8TA 3PIRA 1GGHA 1WOYA 2X5XA 3MWEA 3OT1B 3RFXA 5KWJA 2F3TA 3JR7A 1I9GA 4C29A 5BV7A 1UXJA 5KTYA 2HK8A 3OO0A 5HCNA 4LY9A 2BGWA 3KOXA 2ZROA 3MUNA 2WIJA 4R4JA 4E03A 2P1ZA 4EO4A 5KQPA 2JATA 1W94A 3HQ4O 3NH6A 4MHOA 4Q7JB 4YAWA 5JSZA 1SVUA 3TD6A 3ZEAA 1C7JA 4EA7A 4MXDA 1JWLA 3LOPA 3IKLA 1TYAE 5E9QA 3CZPA 3LNTA 5A9SA 1OJLA 1ZGGA 3O3OB 3GGGA 5B4TA 4I7EA 3PNLA 2AD5A 2OG1A 4MPJA 3EC2A 4M9ZA 4IHJB 2VRWA 2DZDA 2DY1A 4N3GA 1X15A 2DB3A 2DE0X 3GA7A 1Q3TA 2CXUA 4WNCA 3TLGA 3GOHA 2A9VA 3H5LA 1PNRA 2P6RA 3M4ZA 3S2GA 3UKOA 3EGCA 4J3NA 5JHHB 2H1VA 3KB1A 2ATEA 4KP7A 4LY0A 5EZ5A 4B3FX 4DV4B 1HDXA 3R3SA 3CYFA 1N78A 4G1MB 1JR4A 4W5QA 1E3QA 2ABWA 4KQ9A 4ABTA 5A3RA 1HT3A 3BORA 2NMVA 1VGVA 2I1WA 2EEZA 3TIIA 1H6AA 3DVSX 4YHBA 4Q16A 3C6ZA 4O4IA 3I53A 1NF3A 1H3EA 5F5XA 5GOTA 1GL3A 4F85A 5LB2A 3T7DA 1GXSB 2PQMA 1E3LA 1S2OA 3T5GA 3D4IA 3QVVA 2TS1A 1XTJA 1VCHA 3R5TA 5IN5A 3MT7A 2ZZNA 4NPHA 2YRWA 1M1YA 4PY2A 5CU7A 4WUVA 1KZHA 3KZXA 4BO6A 3ZDZB 2IE0A 3NT4A 3TQRA 1RAHA 3EK2A 3ZIUA 4BNLA 5BUSA 3E9MA 1C3EA 2DQSA 3IJ5A 1XLTC 4OD0A 3UK0A 1BSVA 1M6HA 1KJ8A 3NBAA 1IBMB 1DQSA 4ZVNA 1XYVA 3FMPB 1U7XA 3HTXA 5GONF 2NZXA 2DHRA 1YI0A 3FMOB 3LPLA 3VYWA 3IXMA 4IGAA 4YCMA 3S55A 2UVPB 2NQ2C 3A1UA 3GGJA 4EZEA 2ZBUA 2ZWOA 1HT2E 4Q0MA 5IAEA 3VOTA 3VPGA 5LZ9A 3H9JA 3R0IA 3NXKA 3ZE6A 1Y63A 3LX5A 1T2UA 2IYWA 4WBSA 1HLGA 2GA9A 4QAQA 4YN3A 3R75A 5AJZA 1PWXA 2A0UA 2AG0A 3AJAA 4GS5A 4NJEA 3ZGVA 2ZRFA 3GFRA 2NZUG 4AY4A 4D8TA 1RQGA 1X1RA 4UUOA 4XPIA 3ZQJA 4DQUA 3L82B 4OFWA 4ZPJA 2GEJA 4HWOA 4F12A 2JGMA 2JFBA 1V71A 3E35A 3N7TA 2BH9A 3V8QA 4D9CA 5CEEA 1UT5A 4OK5A 3TR5A 4D1YA 3TTVA 4OB6A 1TX4B 1NNEA 4I1IA 1AZWA 4A82A 4OH1A 1A2BA 1OTHA 4GPEA 1N2EA 3WGLA 4X65B 3I32A 2FHPA 3AB8A 5DM60 4XI9A 4B4VA 2MJLA 3Q5GA 2O5EA 2QD3A 1IJKA 2NXCA 4WN9B 1OWLA 5LWHA 4KHPB 3GXOA 2IELA 4LHWA 3JWPA 4Y0AA 3GY0A 3PPWA 5AOBA 5CXSA 4ZV9A 2LKDA 4TKVA 4HNRA 3QQ5A 4LOHA 1KU0A 5TMDA 3L1HA 2WSIA 1A7UA 3ILXA 2YXLA 3Q4GA 3KJHA 3FDFA 1XMVA 3MWGA 4M1SA 2GZAA 1E1DA 1G8JA 2YOGA 3FWYA 4UD2A 3ZXSA 5LNK6 4RK5A 2GPBA 5KSZA 1C9DB 3AETA 2IYYA 3M70A 3L77A 2YNMA 2I2FA 2RI6A 2GEBA 3G9XA 3QBTA 1YUNA 1FLDA 3A70A 3NHKA 5CT4A 3RSFA 2XVZA 3NR2A 1RAAA 3HCNA 1UQUA 4L57A 4UUBA 4DIDA 5JAIA 2BMEA 1OC2A 1QYCA 1SOMA 2HX1A 3ETDA 2R68A 2YW2A 3FMFA 4YO7A 4N3BA 4BQIA 1CRPA 4FK8A 3RREA 4C4TA 2J87A 1DTWA 2QDXA 4BWYA 1EDEA 1NJSA 2C1EA 3TPFA 3BQMB 4MCJA 5LQSA 1FDTA 3KPVA 1K8YB 2YOFA 1BHJA 3SYKA 4RM3A 4B7AA 1BMFD 2HA6A 4F5ZA 1DKPA 3RT1A 1QUEA 3S8MA 1JHRA 1FFDA 1JXQA 2B30A 1QMGA 4IYJA 4WOBA 2ET6A 5FD8A 2JAPA 1QKJA 4XX0B 1JHUA 1I4DD 1ZZEA 4XQ0A 3HEMA 4DHEA 2ZWPA 4E5UA 2QV0A 2WNIA 4ZZIA 3FYTA 1W48A 2Z8YM 4ZIRB 2H52A 1ZKMA 1PS9A 1GWNA 4LJ4A 4ND4A 2W37A 2XE4A 1B93A 2H7XA 3G0BA 4AC9A 2BHNA 3QTTA 2PMWB 4Q01A 3P4YA 4NNPA 1NONA 3PNQA 4F72A 3LQ4A 3UY4A 1F2TA 3E9YA 4DSOA 5HOQA 2J45A 4EYKA 2HJHA 4CKCB 3RVLA 1ABBA 1COZA 1W35A 2OPHA 2YUIA 4A0GA 4L3WA 4YT5A 3DKKA 3OE7A 1SUCA 4DE5A 4V0ME 2VRCD 2QL5A 3IC5A 2PLWA 1W96A 1CUZA 3B51X 1NMZA 3LOUA 4NICA 4Y9UA 2P2LA 5TQ0A 4RHYA 4JODA 3USZA 4C0WA 2OHHA 3ETNA 2H7VA 4XVUA 4O3FA 1DCMA 3HYSA 2NYAA 4GSYA 3ZBQA 1KDRA 2P2DA 4BNZA 2YV4A 1GZHB 3PC8C 3WKDA 4FIDA 3TPCA 4PHCA 2FSPA 5TJ9A 2HJWA 4NXNB 1D6MA 1Z6PA 3D3WA 2CFOA 4CV1A 1QJ4A 1WL8A 3HJHA 3IOCA 5IMBA 4UEKA 1ADBA 2B21A 3I9JA 2Z3WA 3F4BA 3O8BA 4HXFB 4ND5A 4D3ZA 3ZJTA 3BCHA 1GTL1 3BJRA 4TVBA 2IYTA 1S89A 2DLCX 1VJCA 4J75A 5F21A 3ZWWA 5KYTA 5EXEA 4RQTA 2B98A 1GA1A 3U4IA 5LA6A 5I48A 4C0QC 2FWNA 1JFLA 2QTGA 3BEDA 4RZ3A 1Z07A 3O74A 3ZKWB 4B71A 3GNTA 2DFPA 4J9UE 5LVAA 1Y81A 3QBJA 3O6VA 3L0OA 3UJ3X 4QIHA 4RDHA 3D6AA 1IAQA 4PX5A 5DTQA 4RESA 2WILA 1NBMA 3MUEA 3MJCA 3UJPA 1NQAO 4CLRB 4UXIA 3A6GA 5BPFA 2QZJA 3B1YA 1O3YA 3GQBA 3ONDA 3VQTA 2IHNA 1PVOA 4IDHA 5CP8A 3WLHA 4KE6A 3UMJA 2VTKA 4PTZA 4NU6A 5IJAA 2ENWA 1FTGA 1V4VA 3WLLA 1UADA 3RTEA 4X54A 2L42A 1D0IA 1X7WA 3H5RA 1C0LA 3CSDA 4G0MA 2HN9A 2Y1WA 3FRIA 1T8PA 2JARA 4TWZA 3JCZA 1DQZA 2OWDA 2VPYA 5C8DA 2FWMX 1OA0A 2KJQA 5BVGA 5BOSA 1G2OA 3KHUA 3JZFA 3H8SA 2VNIA 2LD4A 4Y6OA 3P4XA 1X77A 3I0ZA 5D3MA 4RD4A 3G8BA 4XFJA 3TIGA 4R83A 3UATA 2YZKA 3A8TA 1PWHA 1O4VA 1V3VA 2D0DA 2IP4A 2VN8A 3AB7A 3EXIA 4XR4A 5FPYA 5KQRA 1R0RE 3BE6A 2EZ4A 1NI5A 2CUZA 1WCXA 3LBHA 3TB6A 1YS9A 3WKEA 2O1SA 1FRZA 2FPWA 1PJBA 2XOEA 2P27A 3C7CB 2V65A 1I6KA 1F7VA 5C5EA 5IAOA 2PL5A 1X7YA 3CZ9A 3BGOS 4PS0A 4F96A 5DE3A 1QRTA 4U1RA 2XQJA 1JHOA 2DPXA 2A1IA 1N0HA 5JCXA 3G2PA 1XCPA 4BIMA 1RQXA 5KKAA 4U7JA 4B5LA 1O7JA 5AK6A 3TW6A 1MPTA 2WFZA 3FOEC 3GLUA 4BLQA 3JW8A 3VR6A 7GPBA 4FPXA 1U8CB 4QUEA 5LQKA 1H05A 6CHYA 1RFLA 3NV9A 4P5EA 5IG2A 2LUOA 2XCRB 2JFOA 1L5HB 4CEHA 3H1BA 1LLFA 4CKBA 1BCSA 2JCYA 3GRRA 1PR3A 2H18A 2EG5A 3GRUA 3KYBA 1GJRA 4KHZA 2DWUA 2EX4A 5DISB 2WTAA 4OBEA 3ZQUA 4DQKA 5L4SA 3QUBA 3ON5A 1XD2A 3I12A 4J0IA 2GFHA 5ER9A 4JENA 5C4GB 4DLUA 5D87A 3ZU3A 3AERB 3VZBA 1S4MA 3GJSA 3MRXA 5T4BA 1G63A 2BGIA 4FHEA 3HRIA 2OFFA 1LLCA 5JMPA 1MLDA 4HEHA 3QEJA 5C51B 4O2BF 1Z08A 1NLMA 2WUVA 3QF7A 3ZQ4A 1EVZA 2FJPA 2B3DA 2KPOA 2VPIA 2CNNA 1IAVA 2H4YA 2BFEB 4MWTA 4BX2A 4BP9A 1SCNE 3GLHA 4JYBA 1PS0A 2YZMA 3O4FA 1KOGA 2D74A 3NHSA 5KQSA 1IOLA 2I7VA 3B6KA 5JJ5A 2QRUA 1QVZA 2I9KA 1Z2NX 1HV8A 1TI7A 2RGNC 1K5PA 3FX2A 1XVVA 3N86A 2ZT7A 1J4AA 1KZ4A 3D3EA 4U5QA 2ZFUA 4ZYYA 5CVCA 4ARVA 3DBLB 5GOZA 3CVVA 2OZLB 3DTTA 4E0BA 4CTOA 4ZOQI 5BN4A 2VHVA 3ZZ0A 1JJVA 1T1GA 2H5IA 4N49A 5CK5A 5AOVA 4EJMA 2OQIA 4EW3A 1Y9JA 1W1WA 2IKSA 1E1KA 4KE9A 1YK0A 3EA0A 4BLVA 1U8UA 3PGA1 1VJRA 1A69A 2X14A 2CFSA 1DRVA 1Z3CA 2HIHA 5IU6A 3W0LB 1JS1X 5FOTA 5EE5B 4LV5B 1AKQA 2Y67A 3OQVA 4MEBA 2IYVA 2G1AA 2WJPA 1YZTA 1BXRB 2ZYHA 1IPHA 1NKVA 1N5LA 1Q0QA 1U11A 2Q3HA 2GNOA 4J90A 4KO8A 4GKKB 2MINB 2ZB7A 3H4VA 4JN6B 1BRTA 3TOXA 4AYXA 2O2EA 5B2ZA 4YYZA 2OWEA 5JH7F 1A4IA 5DASA 4L16A 4FWTA 2ZTLA 3EDYA 1QF6A 2DM6A 5JAHA 1RWMA 3K1TA 1KJWA 3GCDA 3U26A 2NUAA 4Q4LA 1E5XA 1E62A 2PVPA 2CDBA 4U63A 4JBHA 2UYOA 1K5HA 5FUMA 2VSXA 2YXEA 1UBLS 3R7WB 4L85A 6GPBA 1P5HA 5J4HA 3T7KA 2PUJA 1I94B 3VKHA 1EUDB 5CH5A 2ZT5A 3FHJA 4MWSA 1Q7GA 5EKUA 3WLKX 3WLNA 1XRSB 2CCJA 3SYRA 5KOHA 2E5WA 1W8DA 1J33A 4WFKA 5FB3A 3ZR4B 1QRSA 1B73A 3R9KA 3HZZA 4K9MA 2HREA 1MB3A 1W76A 2FJUA 5HF6A 3T06B 2IHTA 5EHNA 3AUYA 1V7CA 3EIFA 4OATA 5DKFA 2RH4A 2BC9A 3L01A 2GO1A 3ZWMA 3QWFA 1ZSNA 2X22A 4HSEA 4RA6B 3FAZA 1B3BA 1EFTA 1NUQA 2ZTUA 3R20A 1JG7A 3R9WA 1XR3A 4K88A 4QVKA 1QYRA 5AK3A 4HQ6A 4LSGA 2GN6A 5GZ1A 3K9BA 2EAUA 2XGMA 2P7HA 3MYYA 4FTWA 5KTSA 3G2IA 5TQJA 1V2HE 4NCXA 1COWA 2I5PO 3H2BA 4JJGA 2ZXEA 2WC1A 2JLVA 5EMLA 1KO8A 3V4PB 1CF2O 2WB2A 1Z3IX 2CHEA 3ETCA 4E5PA 5IK2A 3UA3A 3DLCA 4O59O 3P26A 2VXOA 1P3JA 3UMRA 3SZGA 4MB2A 2NXNA 3MS4A 3COSA 2GYWA 4N8EA 4BKRA 4FFMA 1Z0ZA 5DT2A 1PVVA 4IOJA 4A2QA 1M0TA 2VK4A 4AMYA 1PVDA 1II8A 1FPQA 4C4AA 1Y8CA 3F1KA 5IYZB 4QTTB 3WISA 2HWXA 4IQGA 5ALXA 5BUCA 1ZM9A 1NYQA 2G4CA 5CX4A 2FEAA 3W3ZB 1EGHA 1SHTX 2XSZD 4LV8B 2ZSEA 3R77A 1A71A 1E2JA 2OKCA 4MQMA 4FOTA 2UYQA 1OFIA 5EESA 1M34A 4LQ4A 3HADA 1X1EA 3NFRA 2CW5A 3E70C 4YMLA 2HF7A 2HRBA 2K2WA 2H1FA 5LDGA 1LBQA 1H2ZA 4GX1A 1P1JA 3N5CA 2HK6A 1G8HA 4GBJA 4QUDA 1XO1A 2IEDA 3HHPA 1XALA 1V3QE 1EVKA 3M6UA 4GL4A 1A8IA 5DSXA 4F3YA 3ZU2A 4G0YA 4BQPA 4KXWA 4O4JB 1D2GA 2PA3A 4EG3A 1TZMA 3PGLA 1YO6A 5JZ9A 3K4PA 5F2OA 3WL3A 4J07A 4E21A 4TMZA 4RE5A 1P2GA 2FPXA 2XB9A 4OGWA 1A5TA 2G67A 4FONA 5IBQA 5IKPA 4X1IB 4WESA 1R6AA 1NGSA 2NTVA 2JH8A 3ACCA 2CEKA 4FUQA 5GV7A 4YUZA 1N5DA 3EVEA 4R5MA 1F5SA 4NIMA 3RKRA 4CF5A 1QSGA 4NKRA 3NHJA 4D8XA 2COKA 3Q7TA 1E61A 5H3CA 3VA7A 2RGDA 1QS0B 4RNCA 2JG3A 3LX8A 3PZBA 4M6WB 3I72A 3LL4A 3FWZA 2OXCA 3CWZA 3HP1A 4H7HA 1L7DA 1Z7BA 4RV9A 2C5FA 4YECA 5KSOA 3WLOA 1KDVA 5FQOA 3OM0A 2LCFA 2QGZA 4PXSA 2JFQA 5HRUA 8OHMA 3N2EA 1WPQA 4JQOA 4NZYA 3WC4A 5B58C 1XKLA 1GRQA 3WQRA 4LN1A 3SICE 5A0VA 1GPH1 2FMIA 4R2XA 1LBIA 1X1CA 2HU7A 4UHDA 4LDQA 1TJ5A 1PUXA 3DL2A 3LA6A 4O2AA 4MQ4A 4UM7A 1YQTA 2AWOA 2H4HA 1FSFA 2WA1A 1BFKA 3AR2A 3HB7A 4WFJA 4WHMA 4P33A 2GNAA 2W22A 3MTJA 3AVOA 2EYUA 1HQCA 1RLUA 2XWPA 3EIXA 1GQYA 3EODA 4WY2A 3U4QB 3K8OE 1LY1A 3H0EA 4A8JA 1IDOA 2NV2B 1OAOC 2GXUA 3D0OA 4EGFA 1V2GA 3R8FA 5I3CA 1F0YA 5MN5A 1NLFA 2GPSA 2OSVA 2WINI 4I8DA 1VSTA 2G6BA 1L8XA 2E5LB 3UB2A 1DG9A 1XQ1A 5K6AC 1P4JA 1YQ9A 1VL6A 4GKBA 4JITA 2OYCA 4BNJA 4BZPA 3N2GA 2FN4A 3EX7C 1O97C 2WUDA 1K7SN 3GXBA 4U8GA 4D7AA 4QJ5A 3L1IA 3VYSB 4CI9A 1XZDA 4NH0A 1BW9A 1R15A 1T0UA 1AZTA 2MR6A 4PC2A 3UQZA 4DANA 2R8BA 1E1LA 2VL7A 3O7WA 1WZ2A 1Y1LA 3IEVA 3L05A 1RHQA 4MIOA 1QPZA 3BTVA 1GZ4A 1HYEA 1X3SA 1RC0A 1VKNA 1N34B 1IDN1 3P9SA 3L8DA 1SG0A 2H48A 3MMSA 3T38A 5P8WA 2AC7A 3UAGA 2VTBB 3IKJA 2PYZA 1N3YA 4Z4GA 5LMUB 4Y2XA 3DBIA 3RS3A 4U0JA 3PC2A 4OXKA 3SFZA 1RPTA 2HCTA 4HQNA 3OLXA 2PQ0A 3C41J 2CLLB 5JO9A 3K0SA 3FCYA 4ZI3A 5C1BA 3OZEA 3L06A 3F73A 3R7FA 1LW7A 1QBGA 1YA8A 2YJ6A 3MFYA 3JD0A 4RPIA 5HQTA 2F4VB 3GH1A 4M36A 1NX6A 1MGPA 5JJCA 5KCMA 2EYQA 3UAWA 4M22A 1QWOA 2WAOA 3HCBA 1OX5A 3IMKA 5ICSA 3A1CA 1QK3A 2CL6X 2XPCA 5JASA 2H7YA 1YDEA 5F5LA 3F49S 3SP1A 2UYCA 2MOKA 3VISA 1E6LA 5B37A 1K9SA 4NOKA 4TYPA 4HVCA 5JV5A 1Q0RA 4MQ6A 3EMDA 1VG0B 2WYWA 3AG6A 1A8SA 1NU6A 3U7EB 1Q7TA 2FKAA 3NVMB 4HEA6 4RV5A 4LF8B 1RMTA 3KV1A 1UZAA 3QVUA 3FPGA 3FXAA 1QZTA 4D9IA 4RY9A 3RVDA 3ZHBA 1JG2A 1YZKA 5HVNA 1ZRSA 3UKJA 1NXPA 1OFUX 2C2ZA 2NIPA 2PU7A 3R3XA 3PFBA 3IE0A 5E38A 4DLAA 1WV1A 1TL7C 2FF5A 5THQA 3L9XA 4KAAA 4XX1A 1E3DA 4AL4A 1IY9A 3TQHA 2W2OA 3IAXA 1MXHA 2XRMA 4GOMD 3IPCA 3G5MA 3ZVNA 4XWOA 5BWOA 2LV8A 4NMHA 3NW9A 1E8DA 2R4TA 2HQBA 1R7RA 1GXSA 1LB1B 4HO1X 3M9XA 4QATA 1L5NA 3PQFA 3RC8A 1LQ2A 2WJ6A 1DLIA 4Z1MA 3B3JA 3C5VA 4N6GA 2XYQA 2ZQYA 1FP7A 3OJCA 3D8HA 3QE2A 3C7DB 3T52A 3CSSA 1VIAA 1S9HA 2C20A 3DBRB 5B1IA 2R1VB 1U0FA 3NRJA 2A1TS 3IQGX 1AK1A 2IZ1A 1X7XA 4DDVA 4LY6A 1A72A 1JMYA 4TT3A 5EOVA 1FC0A 3HVJA 4X6YA 1RFGE 4H59A 4PU0A 1K98A 3ORYA 2AYXA 1DO2A 4WQMA 1JQJC 5DW3A 5TGDA 3PUZA 3SPXA 2O5RA 3EF1A 4AVYA 1IXSB 2AMFA 2EKLA 2GETA 4FLFA 4RDCA 1J2UA 3P2KA 1V47A 4ZC8A 1EK0A 4BE4A 2HA5A 3D9QX 1SZJG 3G85A 5IYZF 4WK4B 4R5HA 3QPAA 4OL0A 3EEFA 3K4QA 1M2OB 3GOQA 1D6NA 1ZH8A 3BBPA 3AGQA 5DK4A 1CEYA 4JQZA 3INNA 4ZCQA 4Q9IA 3UXEA 3W2HA 4YBZA 3OFJA 4DLZA 1VE6A 4ON9A 2PLFA 4P8RA 4LECA 3W2FA 2ZVJA 4GECA 1E9CA 1YHZA 1XEFA 3H7AA 2JS7A 3ZX4A 4CDGA 4C4PA 2ORVA 1QVWA 2A5FA 4M21A 5AKIA 2PCLA 4O4JF 5DYWA 4EEZA 1ZMTA 3IQDB 5G2OA 1ZOSA 2YJTD 3F2IA 4IDNA 2VDWB 2AG8A 5LN1A 4IVQA 3PL5A 1NJ1A 1Z74A 3EXFB 3N07A 4FDTA 4WNAB 2NVUA 2ZRDA 3WICA 3UWPA 1Z63A 2VDUE 2DMRA 2JIZD 3FAKA 1N3IA 2OUKA 3SF8B 3ZPXA 4FEGA 1E59A 1LRJA 1GOTA 3KEFA 5KEIA 2HRDA 3UBTA 4QARA 1YT5A 1GDDA 3EGDA 3S1AB 3VAYA 4ZVOA 3ORHA 4IIDA 5P21A 2JA2A 3HN2A 3OZDA 3PV0A 4YJ2B 4ER3A 3BL6A 1GGMA 2C4WA 2ZJAA 1XIVA 2QZZA 1DARA 4DEVA 5HIJA 4B3TB 5JZSA 4K6HA 4FD3A 1CIPA 5JCJD 4RDIA 5KNCA 3L9WA 4FMPA 2QF7A 1XLUA 4K26A 3WK9A 2R8PA 4EF6A 2W48A 1VPEA 1NE7A 3C8UA 1D2HA 2V8BA 4URHA 1KJNA 5EJ7A 1E6UA 1HA3A 5HGJA 3F4KA 1GUAA 1YBFA 3K53A 2FN7A 4KQ1A 2PUVA 2OQRA 3CCCA 1ACMA 2Q3LA 3Q7IA 5ELXA 3OFND 5JSFA 1QIIA 2B4TO 1KF0A 3FTNA 1M7GA 1Z5GA 1E4EB 1OXXK 3QFHA 3SEQA 4PG5A 3AU9A 3H1EA 4LHYA 4DDMA 4EO9A 2J09A 5I9MA 3RSHA 3V1KA 3IDFA 4TMXA 1CF9A 1R5JA 1X74A 3OJ0A 2G77B 1NRIA 4QODA 3ZCUA 2R62A 2OORA 2VXBA 3QXHA 4XX0A 2J5XA 1PT5A 1DAOA 3FH0A 2I6SA 2ZAGA 3BL8A 2Q8PA 4Q21A 3DM9B 4P4TA 1G8YA 1CEEA 1YMUA 1K4KA 2Z1NA 4HX9A 1ACJA 2ILTA 3V80A 4FHDA 5BXQC 4GLFA 5CB0A 4JI1B 3P9PA 4CKCA 3T9DA 1JEOA 2IHUA 2PV0A 2JJ2A 4YPOA 4C03A 3RNOA 3E8MA 1ZH2A 2E49A 1DV1A 2F48A 4M0DA 4CR8A 1W9MA 3THYA 2VKTA 2ZKIA 3DDWA 3M49A 3NBYC 3MJEA 3CE6A 1XEAA 2XT6A 4Z9BA 1U6IA 1YQUA 1IONA 1RXWA 1TMOA 1EX6A 2GCPA 2HSJA 4YFVA 2X9QA 3TIFA 2BTQB 5K0SA 3T1YB 3NHZA 1M6NA 1I3MA 3KYIB 4RTNA 4MUEA 1QNLA 1PK8A 3OC0A 3T3EA 4KLRA 1XK6A 3PITA 4CNQA 4WKGA 1JU4A 2X1VA 2AWNA 2F2TA 2P9TA 3CQ9A 1AQIA 4FHCA 4FUTA 5L3QB 5CHYA 1KJZA 1UWKA 2BDEA 5JUWA 2J5QA 4P58A 2QN3A 2BGUA 2ZIZA 2P5TB 9GPBA 5AW2A 2C59A 3IAM1 3QJYA 4G23A 1MJFA 2X3FA 2PUGA 2AC4A 4RD3A 4ZVTA 3GC6A 3OFVA 4OLJA 5U9CA 1KQOA 4RPJA 1IEXA 4C22A 2XBLA 2IYPA 5ALRA 4R6XA 4GX5A 2VHZA 1OWMA 3AUXA 5I4BA 1USVA 3BEOA 1OIWA 1NQTA 4XR9A 3WAJA 3AUAA 2ROQA 4AKGA 1ZCFA 1CDOA 3R3WA 4PINA 4LGYA 2E37A 4DJJA 3IXLA 3GZNB 1Z5NA 4LA4A 2PUFA 4MUBA 2RARA 4RQBA 4CLRA 4B76A 4K28A 4HDNA 5JC1A 1XJ5A 4UFNA 1VGRA 3A3NA 3BREA 4AX8A 1AB6A 5DT9A 4P3PA 1QP7A 1E7MA 1HKUA 1RQRA 3U7FB 1WBDA 4KYIB 1A82A 1RWBA 2Q3DA 2J3LA 4ZFNA 4MUKA 1F1BA 1E3EA 1DIOB 3P2IA 1PR2A 1UH5A 4M83A 4BNTA 3CU5A 1HQKA 3D8SA 2OXIA 4KE7A 4LDNA 3IUMA 1Y5IA 1IXKA 1AS2A 2XITA 3FNHA 1KE1A 3RFFA 4MUYA 1C7IA 1U31A 2VK8A 4JJKA 3RCBA 5IHPA 1TC1A 2OHXA 2AJDA 2WICA 3ZC3A 1C2TA 2X1HA 3Q8LA 3JQ8B 1Z5UA 1NDUA 2H1LA 2OR3A 2QJRA 5B6JA 3I83A 3X0DA 1T2AA 4UFPA 3CVUA 2HHCA 3UHFA 1FPMA 4UPVA 4CDMA 1RQPA 1PEYA 3O94A 5HG0A 1KMHA 2GAOA 3CB4A 2PAAA 3DWGA 1Z16A 3ZY2A 4HAWA 4ZTUB 2JI4A 3KZNA 1AUQA 3DJYA 1CFJA 2OBFA 1ZFNA 4FCCA 4F2PA 1QIJA 6REQB 2QG6A 3AY7A 2HF8A 1QRRA 2RB5A 2V0NA 5BSEA 3IQEA 2H9AA 2AFIE 4LXIA 2R6AA 5HJ5A 3HR8A 4CM9D 1N32B 3LUGA 4B46A 2HLNA 1GITA 4XWTA 3UAZA 2KWIA 1W36C 3ANSA 4QBKA 1RAIA 5IX8A 1UWLA 5GZ3A 3UMBA 5CDHA 4IUYA 3RC2A 4AS3A 1DAMA 5BYJA 3ZHTA 4CM6A 3HGMA 5AM4A 5E9WA 2IOYA 1SIUA 4TM7A 4WCFB 4DSUA 4E4RA 3NBUA 1QH8B 2CVOA 1R0SA 4MW4A 1BHQ1 2IYFA 2VOEA 3U39A 1Z6ZA 4DOMA 1T5BA 4ATNA 3QUQA 3LLCA 3LM8A 1NPDA 4MO9A 2CV2A 1MMFB 2XOKD 4RJJA 5C2JB 1TLLA 3COZA 4MRAA 121PA 1ZD4A 5A9RA 4D9FA 3AR9A 4CPDA 1GU0A 3GFTA 4Q82A 4I2VA 2VYNA 4Y2GA 5GM1A 2DPMA 4BMNA 2QT1A 1D2MA 5DLPA 3PIIA 4D9EA 2JFFA 1O95C 4R9RA 4EW6A 3KSZO 5BW5A 1YBAA 2DPHA 3NIDB 1GUZA 4TWBA 4DRXB 3AR8A 5LIRA 3DZIA 4PPNA 3ESXA 2OXEA 2W93A 4U7FA 2IY9A 1ONNA 3BA6A 3KSMA 2QL7A 2H1CA 5AJUA 4ZAZA 1KVUA 2IZOA 5HFJA 4L95C 2DFNA 3AY3A 2DR3A 4UNQA 1KVTA 1CVRA 3NWBA 3UKDA 1LF5A 3DBLA 5JAOA 2OZLA 3EVCA 3N53A 4RADA 4BV9A 1YBHA 4C1BA 4XLLA 1N0IA 1Y0BA 3AFOA 2ZIUB 2AQIA 4CHGA 1MO4A 1XV5A 5DLYA 3V34A 3NHAA 1TYEB 3NWOA 4EGJA 3ZH9B 4IRUB 1NYTA 4B6GA 4MWOA 4LZAA 2FY8A 2ZANA 1B6SA 4C07A 5C1PA 1ULTA 3EZNA 5AO9A 1RI3A 1L7EA 3MINB 1NBEA 4Y1GA 3LBFA 4B34A 5JEEA 4UHFA 2WKRA 3DT8A 4KXUA 4YWJA 5K8CA 1BXRA 1GUBA 1JBQA 5KYYA 3DXFA 3FF4A 4DUPA 5B3KA 2X5NA 2R44A 1KEPA 2MINA 3C6BA 3I61A 1VYHA 2G4VA 2PQ2A 3GGPA 3A4YA 2B34A 3CEHA 3JQ7B 5TVKA 2V54A 1H6CA 4CMEA 3AVWA 1VMEA 2F17A 2O7RA 3LUFA 4L75A 2NU9B 4OLBA 4FDLA 3X1YA 2IF2A 1FVFA 3C70A 3UJCA 2C2OA 3SOZA 2R5NA 4RGQA 2C07A 4XSHA 3R7WA 2CXTA 2FP4B 3HRKA 1Z7WA 3MWLA 3K6SB 2PZMA 1YS7A 3G02A 2VSNA 1JHYA 5DB4A 1VRWA 1K8XB 3GRFA 1OU4A 3G9UA 2VHQA 4GVXA 1YMVA 1MW9X 1NVWQ 3AEQB 2RHDA 1X0XA 3DUFA 4KQIA 2NPOA 5EKTA 4X20A 4D4HA 1C3OB 3VPBA 3K15A 5EJ4A 2WVHA 1A4RA 2FVXA 2IDZA 3ULKA 5BYBA 3BXFA 2B61A 8ABPA 1OA1A 4HRXA 4FYPA 5TMBA 4BEWA 1NPTO 3KYCA 4QYIB 1FF9A 4JA2A 4RA6A 1ZRHA 2V7WA 2JZCA 4A36A 3R0QA 3D4LA 3RGGA 4UBMA 5JSHA 1ADCA 4YAOA 4AMVA 1SUAA 3F6RA 5TSDA 3TQQA 1EP2B 3BSYA 1R6XA 2YN2A 2BGNA 4QU0A 4IJ5A 2TMKA 3ISJA 1XLVA 1Y4SA 4KAJA 2FR8C 2EJWA 4KFSA 1YA6A 4KPYA 1M6YA 4GMDA 1BS1A 1RCUA 3DMGA 2AEMA 2V6JA 4RK1A 3U4DA 3BJIC 5B4VA 3HLTA 1E0JA 2BZSA 2Q5HA 3R8XA 5CA0B 5I9TA 2IU3A 2O8CB 2FP3A 4RVUA 3HJUA 3DTVA 4U7DA 1NL3A 1J2RA 2CHUA 3D3QA 2SKEA 3B53X 3EEYA 1KP2A 2I6QA 1FQWA 3IP6A 3P9KA 4O0LA 1A9SA 4PYNA 3AHJA 1TTQB 3B3GA 4UM8B 4DAOA 3BWXA 5DCYA 4EQZA 2YBDA 5IT5A 2PZLA 1B1CA 1U4SA 1P44A 4JLJA 1G21B 4MRVA 5FLEX 3MT9A 4BO9A 3R4VA 4NPCA 1E5VA 1RJWA 2GSDA 3A31A 3IPAA 1RXYA 3MSXA 2IIBA 3OF5A 4KEAA 5FNZA 5G53C 4EW2A 4E70A 4DM7A 3HKCA 1QCCA 1MTOA 1SUWA 1DX4A 1SULA 1SXJB 5E2BA 5DM70 1P2FA 3WGIA 1NBOA 4Z54A 1NZJA 1JSZA 2XCTB 3ZY4A 5LP6B 1KRWA 2WIDA 4OHVA 5EP1A 3IYLW 1GPBA 4Q3DA 1JZSA 4R9NA 4BFCA 3CBQA 1QFZA 3FKQA 2H2HA 4DIKA 2BEVB 2AMVA 3OZTA 3D7MA 4E15A 3AF0A 3DKIA 2WQ6A 3TOSA 3A1VA 3F67A 3G49A 1TGYA 3VC7A 3OCXA 2CNWA 3L84A 1JG3A 3MIIA 1QLJA 4WI1A 3PJRA 3ND8A 1CIVA 2FQWA 2JEYA 2WTMA 3SX4A 1VPVA 3DYIA 1OWNA 5M04A 4ZTZB 1Q0ZA 5HXAA 2LIVA 5KYVA 4Z9XA 3IURA 3U9LA 2J32A 4CM5A 4D02A 4HGYA 4HWPA 5BQ5A 4WKBA 1NQ5A 3K9LA 4IQ0A 5B57C 2GBPA 4QBGB 3ER6A 1W0KD 2WTEA 3UH0A 1NX9A 4QWMA 4HWKA 3PDCA 1XU7A 4IJVA 5JS1A 1LPPA 1CTQA 4J0KA 5I7AA 4Y98A 3O3NB 5I7UA 2PUEA 4F92B 1HFEL 4RW0A 3UN1A 2G9VA 1ZIDA 4OU5A 1Z0UA 2C4HA 2JVKA 3LT1A 1E5QA 4KB5A 4LUCA 1QNFA 1WTAA 4GMFA 4N03A 3KQHA 4IX1A 3L7DA 5H82A 5EMMA 1DRUA 5KCZA 1U2TA 2JVJA 5JSYA 1J97A 1GG5A 4Z8YA 4NMMA 5E4FA 4U2GA 4E2ZA 5GADl 1HE2A 1AGRA 4QBTA 2FWJA 1JFSA 1L4MA 1JVBA 2GBGA 2F62A 4HH1A 3EZYA 2VBCA 4BFVA 2HOQA 2ZSBA 4Z1OA 4MDEA 4C4SA 5FTNA 1GSAA 1FMTA 1WCIA 2YVLA 3NANA 4QSMA 1YJQA 5G0VA 3U4QA 2QVXX 4R41A 3LJKA 1JFRA 5DU2A 4K40A 4DYVA 3WL7A 2XWJI 1YRLA 4FWIB 4GX2A 1J09A 4V0KA 2IH2A 4CM7A 4IBOA 5JARA 3C3KA 2YINC 4R1OA 3VZRA 3E3AA 5E7IA 5H9VA 5IXJA 2HYDA 4YAIA 2BRUA 1SWVA 3ZCXA 5FPQA 1XZLA 2BHLA 2ECPA 2BFBB 2C95A 2GPAA 3R7DA 1H94A 4K1LA 2I65A 1XAGA 1O8CA 4L4XA 5KNDD 1KFKB 1K8QA 2HU2A 4WGFA 2J41A 3R0VA 2IX9A 5DWVA 2H11A 3T4EA 4F3TA 5J4VA 5DNVA 2ZJ4A 3FGZA 1UEJA 3CG0A 2OLEA 3KTFA 4OFXA 8AT1A 3DKVA 3E3MA 1DU4A 1SU6A 3GA0A 3J80A 4YMGA 1WUTA 2BKUA 3ADCA 1QO0D 2IDJA 1GSIA 3G5AA 3P9IA 4KBFA 1CRWG 2H2IA 3DZHA 3A6LA 1WLYA 2AW3A 3Q3HA 1FB5A 1VKHA 2VTBA 5H16A 4XYLA 2G17A 3INGA 4BMZA 5EPUA 3KUKA 1S0UA 3SBEA 4OI4A 2BBOA 3A6PC 1EFKA 4G97A 4ZCLA 1VBKA 3JXEA 3ECCA 5JISA 2O3TA 4XFKA 2VBGA 1XEXA 2CVQA 2ZTSA 3O4RA 4U9UA 3AKDA 1TK3A 1THTA 1W5FA 3REQB 3WB9A 4PCLA 3IS3A 2ZIXB 3K5WA 2P9CA 3OCWA 4FINA 1KC1A 1SRQA 2RDMA 4KR0A 4MI6A 1NW8A 1D7AA 2AN5A 3T35A 3KOYA 5JLJA 4OKIA 5AH0A 3F6CA 3D02A 2OBYA 3N8DA 4UEQA 2JKZA 3VNSA 1ISFA 1P7VA 3M6VA 1TQ6A 5CRIA 1DAGA 1M1ZA 1MAHA 2CL5A 4KN6A 4PICA 2PYIA 3KFXA 2ZSIA 1S02A 4QYWA 1P72A 3OCUA 4EGCB 3IE2A 2HR1A 1JN0A 4GXNA 1J06A 4MARA 4XJXA 2PPVA 3PRHA 1E7QA 2CE7A 4TQ9A 4LISA 4M8KA 4NP6A 3CRRA 5F78A 5FCDA 2D4AA 2QRHA 5IANA 1IZZA 4R3NA 2QU8A 2MMGA 3CZMA 5FI0B 2PEZA 2RH5A 1KKMA 1S8FA 2WY2D 5IN4A 2ZBEA 3PC6A 1SCIA 2H00A 2P9ZA 1EM6A 1QGZA 4Q9HA 2HBYA 5DIFA 4EVQA 3ISTA 2HDOA 3PT9A 1U5AA 3AEUB 4RF5A 3S6JA 2F90A 3F7OA 4GIBA 4PZ9A 3SXPA 1M5UA 2UVQA 1RLJA 5CUQA 2KB0A 1DUVG 2OZPA 1MJ5A 4BLRA 3U7QB 3V7WA 3HPRA 2JI8A 3EXG1 3S1LA 4A0FA 1WMSA 3AF5A 2QY9A 2J3QA 3FDZB 3DFIA 3TSYA 4DVJA 2CBZA 1YGYA 3PXAA 1MFZA 4BLUA 5KWIA 3KLMX 3DBRA 4D9GA 2R1VA 3O8CA 1I6LA 1ZVJA 2HF9A 4WBNF 3EW9A 3G8AA 3LX6A 4PLFA 3GFPA 2DLNA 1Y5LA 3IP3A 5A71A 4JI3B 3JYOA 3PUKA 3K0CA 4ZKEA 4I3GA 5A3JA 3SBDA 4ZGBA 3DOEA 3MBIA 1QH1B 1CE8B 1XHEA 3AHIA 3NBKA 4KKXB 4KTVE 4C14A 2GM4A 1DEXA 4FP9A 3T8YA 5EXPA 3CA8A 421PA 5C4IA 2D1FA 2ZBGA 3V7YA 4JXZA 4KVZA 4ZICA 3VX3A 4TLCA 2F1IA 4CIXA 4TKUB 1GQRA 4K9NA 3IALA 1OF1A 3S29A 3OTIA 3UMSA 2Q1UA 4UATA 3VSDA 2ZM5A 1NC3A 4LYHA 1TMKA 2WWRA 1HQYE 5DPMA 1P0MA 2QD1A 3NHUA 2IL1A 1IEWA 3H3XA 4HZUA 3Q72A 1CEXA 1Z12A 4FMDB 1PQYA 5G40A 3VTFA 1FJGB 5F52A 2C7QA 2EZ8A 3GLVA 2GK7A 5IXYA 1YQGA 2CDNA 5J2UA 3NPAA 2XVMA 3QITA 1AH2A 1TTTA 2WK1A 1MNQA 4N5IX 3DFUA 1RABA 3OJEA 3VUEA 4AZWA 5EIXA 3ECAA 1CUUA 4MLDA 2ZYRA 4H08A 3VVBA 3CLVA 1SPXA 4DUGA 2VDQB 2P41A 3OY7A 5HHTA 1V8BA 1EK5A 1U3UA 4QG7A 4LRXA 5AWFC 4HAOA 4UCQA 3TGPA 4WNAA 4DMUB 4YAUA 3L6BA 3QLEA 2CHVA 1K4YA 5HRCA 4BO2A 3EDMA 1PK9A 4DABA 1NN0A 2RHHA 4KGXA 4OUDB 3SF8A 1QQAA 1F0PA 1TQ4A 1UPXA 1Z34A 2AD1A 3GLRA 3PE3A 2QUHA 4R8SA 5D00A 3S1AA 4DWJA 1P18A 2FE4A 4DMKA 2HU5A 5TMPA 4YJ2A 5I7SA 4TV8A 5I5EA 1X7HA 4FXPA 1CY8A 2BI4A 1II9A 1Z8FA 3GN1A 4KXXA 2F8TA 1GVHA 4WOCA 4NBSA 3HJTA 5DX0A 3HEBA 4TWIA 2NU8B 4Y1RB 4I1SA 1QFJA 5EXSA 1XQ9A 2QUZA 2Z3ZA 3B8HA