2HHLA

Crystal structure of the human small ctd phosphatase 3 isoform 1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
180
structure length
180
Chain Sequence
b'QVIPIPSPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CTD small phosphatase-like protein
molecule tags Hydrolase
source organism Homo sapiens
publication title Structural genomics of protein phosphatases.
pubmed doi rcsb
total genus 50
structure length 180
sequence length 180
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2hhlA00
2FEAA 2EARA 4XOUA 4DWOA 3U26A 5A3RA 1T5SA 2IOFK 3SHQA 3S6JA 1WR8A 3QUBA 1L8LA 3I6BA 1YV9A 3PGVA 2YMQA 2MU1A 3ZTWA 5AW4A 3PDWA 4Y3UA 5ALYA 4C4RA 3OCWA 3RFUA 4Y2XA 2QLTA 3N5KA 1RKUA 1VJRA 2C88A 5AK3A 4PNHA 3KZXA 1ZD4A 1RLTA 2Q5EA 2WF9A 4JDPA 2CFSA 4MUMA 1X42A 3QU4A 2HOQA 2OM6A 1YDFA 4YH1A 4Y2PA 3QU7A 1YNSA 1TJ5A 3HYCA 2G1AA 5AW9A 3N07A 3WKDA 4C4TA 5T41A 3KOOA 5AM2A 5AW3A 1XPJA 1Z4PX 2HF7A 4QQFA 1T9ZA 4UAUA 3CZ4A 4UU1A 5ALKA 1TE2A 2HCFA 4HGOA 4UW9A 3VAYA 2ODAA 3WK9A 5ALJA 3A3YA 3U13A 5ALIA 3U7HB 1L7PA 1Z4OA 2PKEA 3AR2A 2B1QA 4BX3A 3L0YA 3A1DA 4EEKA 4G63A 3UMBA 1S8OA 2G09A 4YGYA 2I7DA 3QU5A 4AP9A 3ZX5A 2ZBFA 3UM9A 3NASA 3NRJA 3MC1A 2G0AA 3I28A 3SMVA 3WGUA 3ZW7A 2X4DA 3ZWKA 3AR3A 5AVTA 1ZOLA 3W5AA 2P9JA 2ZG6A 3J7TA 2OYCA 4FFDA 3ZVMA 2CFTA 4BNDA 2ZBEA 2IOFA 4ZEVA 3R09A 2FPUA 3WK8A 2W43A 3L8FA 4F72A 3EWIA 3AR6A 5AKXA 1KYTA 4RESA 5ALUA 3E81A 4GIBA 5ALFA 3DAOA 2NO5A 4KX5A 1YJ5A 4EX6A 2WF8A 3SD7A 2BY4A 1QH9A 3P96A 3U7FB 2R8XA 5AW1A 5A3QA 4OD0A 3QNMA 1SU4A 1RQNA 3B8EA 2I54A 3M1YA 4EX7A 3FPBA 3QUTA 3B9BA 3DV9A 1NRWA 3FGOA 1K1EA 1XP5A 1CQZA 3PGLA 1U7PA 3U19A 1RMTA 2GMWA 2D2VA 5ALVA 1J8DA 1RKQA 1VJ5A 5ALGA 2PR7A 2HI0A 3QYPA 1WZCA 2HEGA 5AI9A 3IRUA 2DQSA 2WHEA 3KC2A 4DW8A 5AW6A 5AKHA 1TA0A 2GO7A 4CF4A 3ZU6A 2YMPA 4ZEXA 1AQ6A 3TLMA 3QUCA 3EPRA 5ALXA 1YS9A 3NALA 2B30A 5ALMA 4YIKA 3OTQA 5AM1A 3WK7A 3L1VA 4NFLA 5AVQA 3BA6A 3KBBA 2W4MA 3L8HA 3FM9A 1TJ4A 3B9RA 3L1UA 4Y2RA 2HSZA 5IT0A 1QQ5A 1JUDA 4XQ0A 4BX2A 1Z4KA 1NF2A 2HHLA 1TJ3A 5AVRA 5AVUA 1YMQA 1L7MA 4UM5A 5AI6A 1WPGA 4QJBA 2G06A 3WK5A 5AVSA 5JJBA 3QX7A 2OA0A 5ALSA 2EATA 4XPZA 4RETA 2ZBDA 5AK5A 4OCZA 3HLTA 1EK2A 2PQ0A 4KX3A 5AHXA 2FPRA 3QGMA 3E8MA 4GXTA 4EZEA 5AK6A 1RLMA 5AI0A 2GHQA 3OCVA 1MH9A 1XVIA 4MWOA 4UATA 1L7NA 2JAOA 1ZD3A 5AVXA 5AW2A 3W5BA 1CR6A 3AR9A 1Z4LA 2RARA 4FE3A 5AVVA 3RF6A 2YY6A 3AR5A 4I9GA 2JAUA 3UMGA 3KDPA 4IG4A 4C4SA 4YCLA 1WVIA 3NAMA 1ZS9A 2AH5A 2G08A 4BEWA 4EENA 4UMDA 3OCXA 5AW7A 3L8GA 2FI1A 3WK4A 3MN1A 3E84A 4O8CA 1ZD5A 4KYTA 4L6AA 4UASA 5AI4A 4HGPA 4NV0A 3OCYA 4KNWA 3FVVA 4Y2JA 4L6CA 1RQLA 3M9LA 2C8KA 5AM5A 3WGVA 2B8JA 5AKEA 4L57A 1QQ7A 2YMMA 4UM7A 4Y2TA 2YBDA 5AIAA 5AVZA 4BBJA 4CNQA 1U7OA 3IB6A 1RMYA 4YCNA 1Q92A 3SLRA 4UARA 1Z4NA 2ZXEA 4F71A 2GFHA 3D6JA 2WFAA 1Z5UA 4I9FA 3A1EA 1LVHA 1RDFA 3DNPA 2WF6A 2YFYA 1EK1A 1PW5A 4G9BA 2C4NA 3ZTYA 3N8GA 2VKQA 3L5KA 2I55A 5IS2A 3MPOA 3AR7A 4UMEA 1SWWA 1FEZA 3L0CA 2G80A 4NWIA 5AW5A 5AKKA 5ALPA 2FUEA 1U02A 2HF2A 2RB5A 3QUQA 2JGAA 3L0BA 5ALOA 5AKJA 3L8EA 1N8NA 2GHTA 2HDOA 2I6XA 3U7GA 2B82A 2G07A 1T5TA 3WKBA 1L8OA 1ZD2P 1Z4MA 3DDHA 5ALQA 3OCUA 3W5CA 2R8EA 2B0CA 3QLEA 1QQ6A 5AKIA 3FZQA 3A1CA 5AI5A 2RAVA 5ALLA 5IT4A 3OCZA 5AICA 2EAUA 3L7YA 4NAVA 1Y8AA 4Y2QA 2BDUA 4B6JA 4UAVA 4CE6A 2IA5A 5ALTA 4KNVA 2FPWA 4H1WA 3KD3A 2JARA 1Z4JA 2W11A 1L7OA 2QYHA 3NIWA 2ZBGA 2JAWA 2B1RA 2FDRA 2NO4A 3WKCA 2FPXA 2YJ3A 2YJ5A 4DCCA 5AK4A 1RPZA 3E58A 3SKXA 2Q4RA 4HGRA 1U2SA 3AR8A 5AVYA 3R9KA 4JB3A 1NNLA 5ALEA 5AIBA 1O08A 3OPXA 5FP0A 4EELA 3PCTA 4UMVA 4BX0A 2MSNA 2P27A 4NABA 4XE5A 2AMYA 4BNDB 1RRCA 1ZRMA 3NANA 3U7EB 5ALRA 2BDEA 2FPSA 2HX1A 3ZX4A 5AESA 3N28A 4YCMA 1RMQA 1L6RA 5AKYA 1J97A 4J2TA 3ET5A 1Q91A 4BKMA 2YJ6A 5E0OA 3ET4A 2AUTA 2O9JA 2R8YA 3ZVLA 5ALWA 4BYGA 2I33A 2YN4A 3SF0A 1N9KA 2P69A 3EF0A 3QXGA 4OHFA 3ZWDA 2OBBA 4Y2UA 4HAIA 2P11A 2I34A 1ZRNA 2CN1A 4KN8A 3GYGA 5AW0A 3NUQA 4IFTA 2YMLA 2Q4TA 3AR4A 1U2TA 5AW8A 4Y2SA 4AS3A 2IOHA 1F5SA 5AVWA 5AKLA 3I76A 1IWOA 2WF7A 5AI8A 3MMZA 4CF5A 5AKZA 1RKVA 4HYTA 3WKEA 2IYEA 3R4CA 1Z4IA 2AGVA 3I1YA 4AS2A 1ZJJA 4HGQA 4Y2YA 5AM0A 2C9MA 4CF3A 3N1UA 5ALHA 4ZEWA 4HGNA 5A3SA 4Y2VA 2NYVA 3F9RA 1S2OA 2C8LA 3ONNA 1Z88A 2O2XA 2ZOSA 1LTQA 2CFRA 5ALNA 3WKAA 3FPSA 3WK6A 3QU2A 4FYPA 5ALZA 4E88A 3ED5A 2WF5A 2FUCA 3SKYA 2HO4A 1Z5GA 4BEVA 3CNHA 3IJ5A 2YJ4A 2RBKA 5AM3A 2R8ZA 3ZI4A 3ESQA 1Z4QA 3ZUPA 3QU9A 4YIHA 4DFDA 1O03A 5AM4A 3ESRA 4OFZA 3BWVA 3UMCA 3K1ZA 4UU0A 5ALDA 2B8EA 3EF1A 1RLOA 1QYIA 2WM8A 4UMFA 3ZVNA 1RC8A 4J03A 1SWVA 1VFPA 3W5DA 5AKGA
chains in the Genus database with same CATH superfamily
4RL6A 4C01A 3A32A 2OFXA 3REQB 4MJ3A 2F3QA 3U26A 5HQ3B 5K20A 2FWNA 3X1ZA 3WWYA 1SAYA 1KEKA 3VPBA 4OL9A 1LD3A 3A6GA 3BN3A 4XQCA 2NVUA 2O6HA 4XRRA 1SBQA 1L5FA 5TX7A 4F11A 3H9QA 1WU7A 4LDAA 3PQ8A 2YFQA 2IIVA 5IAGA 5BV8A 3EEQA 5FBVB 1PL6A 4FZVA 4TUYB 4GM4A 3KWLA 4Y7CA 3BILA 4UE3S 3RANA 4DTCA 5JS1A 1LDNA 4O02B 2Q2OA 3A26A 4AECA 3IQDB 1ORWA 4NS1A 5DN6A 5ERXA 3EG9B 1DLIA 1ZD4A 2WF9A 1Y3IA 2MT9A 4P31A 1U8AA 3AFNA 1J00A 4N3AA 3O8OB 1F1BA 1FUEA 4LF6B 2C8VA 3KKPA 4KR6A 4DQKA 1C7EA 2A86A 1PFWA 3BH0A 4FZ3A 4WIAA 1V26A 1UBOS 4BQRA 4W8GA 1CJKC 2DF8A 3RVSA 1A2OA 2BM9A 2JFYA 4JP5A 2Y1FA 5LUAA 1B0UA 3ZZUA 1ITZA 1P18A 2XB2A 3AEKB 4UAUA 5EMMA 3WIBA 2QAGC 2WILA 3C2QA 4MJLA 4BNHA 2O8DB 3TL2A 3IYLW 5K3CA 3OA2A 4DXDA 4X90A 4R1UA 4YR9A 3EDCA 4K6KA 3F6CA 3GRZA 4H18A 3PEWA 3EW9A 3OZ7A 4DLUA 1C3OA 5JARA 5GOZA 2YJGA 7ABPA 1L7PA 2RGAA 3CZAA 2H1VA 4W6ZA 5KSOA 5KTYA 5U4XA 1CJUC 1AUOA 3IEKA 4D98A 5IMBA 1S2NA 2GBPA 4BX3A 4LXHA 5AQ1A 3BQ9A 1F0PA 5CA1A 5KHLB 1DAHA 3D7LA 4RX1A 2NUTA 3AZPA 4U2BA 4B84A 1EA7A 2DPHA 3FFBA 3ZS8A 3DL0A 4Q00A 4B2IA 4G36A 5JANA 2PL9A 2ZRLA 3ABSB 5LB4A 1FY2A 1V41E 2XMBA 2NUPA 2BCGY 4MICA 4QT0A 3UM9A 4KQHA 1BQEA 2K4MA 2H0QA 1K75A 1KP9A 3C4QA 1L4FA 2R6ZA 4D0RA 4J76A 4D25A 1DKRA 2GXQA 3FNBA 2EGGA 4F5WA 4A15A 1TTQB 5KMGB 1JVBA 3B7WA 3PL5A 1D6MA 3W06A 4RTPA 2NZUG 4DV3B 1MBZA 1YK0A 1Y4UA 2R4TA 5ECDA 2PXXA 5GVSA 1XMPA 2OCYC 1L4HA 3EXG1 1I2CA 4P08A 3TTVA 4BCCA 3JTEA 5I7UA 3DDUA 2ZIXB 3FKSD 1FFHA 4KE7A 4PS0A 1G5PA 2CFTA 3PDJA 1PHRA 4J1SA 4QOGA 2ROQA 4HI0E 4F3CA 2IOFA 4Q9HA 3SCZA 3WIEA 1JZQA 4E07A 2GRJA 2PFGA 3R09A 4OXKA 4F72A 1PFVA 2FFQA 2IPAB 1HZZC 2IIPA 2Z8XA 1Y8RA 1WW3A 5NLLA 2XD9A 4BNTA 4EW2A 1VFNA 4RPJA 2IYUA 4PV7A 5DBOA 1QVRA 4I3HA 1Z36A 2BGGA 2HZBA 2WJAA 3ZTTA 1WZNA 3UFBA 2E21A 5B64A 4P83A 1P6UA 1MC8A 2WICA 3JWEA 3ESDA 4OKIA 3SJUA 4AG3A 3U7FB 5KNBH 1JSLA 2FDXA 1NA5A 3A06A 3VFDA 2IUEA 3B6ZA 4FUTA 4OSPA 3ZQUA 3SS9X 4MGZR 3BCRA 3GJ3A 1YA6A 1SU4A 2O7NA 3B6JA 4FSXA 2PS9A 1EUQA 1WMAA 2O1XA 3M1YA 4D4GA 3B51X 1FDUA 4O1HA 1QIJA 1MRNA 4JLVA 4O6VA 2HYIC 1U28A 5IBPA 3WL6A 5F23A 3GK3A 1BCSA 3B2NA 3PV0A 4FIDA 1F4PA 1YQGA 3A4VA 4OK6A 2YZGA 3P26A 1LWOA 1VI6A 1N9GB 1YOVB 4OP3A 4QDUA 5JLAA 2JDID 2PX0A 2JHCA 2W6IA 4RFSA 3SLGA 3WWDA 3RIGA 2X8BA 2HEGA 1T9DA 3ESZA 4RH1A 3CVVA 1C4XA 3K09A 3TIIA 1MLDA 4LFBB 3T7SA 5K8CA 1HDGO 3CX7A 4YRZA 1DBVO 1XKTA 3N5CA 1H2XA 1E2EA 2QBYB 5EJ4A 1UEXC 3VRHA 4D9KA 1W25A 1DINA 4OB7A 4B7AA 4KLRA 5C1OA 1TT7A 4R0NA 2R1UA 3HL0A 2BEVA 3CNEA 1PZMA 3ILYA 1DEAA 2ZJAA 4NI5A 3SYNA 2GSWA 1BVHA 4KWIA 3H8WA 1V0JA 1YZQA 5J23A 2AV6A 5C8ZA 4M1QA 4OG2A 3KBBA 5JO9A 2UDPA 5TVGA 4UNQA 1KZYC 3UJ6A 3DR3A 4AMYA 2GBGA 2GBFA 3KSMA 4HXFB 3B9RA 1KQNA 1C3OB 1OKKA 3CF0A 1A5BB 3L6DA 3UHOA 4NK5A 2XVXA 3P2EA 4NJOA 1VA4A 5KI6A 1ANKA 2HHAA 4ZRNA 1Z6PA 4KH1A 3RS2A 1RU3A 1Y1RA 2IHBA 1VL2A 1FNDA 4M37A 5LDDC 1QGYA 3H17A 3T1NA 4LQDA 3WK5A 4WBNF 5AVSA 4QGGA 3SIRA 2V7XA 4QXPA 3UY4A 4CEHB 4XYEA 3TRDA 4HNVA 4GOLD 4EY7A 2QL9A 3N6RA 4UXHA 5ED0A 4AF6A 3R5XA 3KQPA 3QGMA 1KYVA 4FDMA 5H1YA 4WFIA 3RYCB 1GSOA 5KU7A 2HY7A 1QG2A 1D2HA 3RFXA 4L02A 5AI0A 4QPZA 4RLFA 4B2LA 2I3GA 3R7LA 5IHPA 2I4TA 2V5VA 1KAGA 3G6WA 1G7SA 3G5LA 2WTBA 1HT3A 3I9FA 2Y1OA 3NHKA 4E2XA 2IF0A 3REOA 3PKZA 4S35A 3FCYA 3MRSA 4OI1A 1CUXA 3FUVA 1YACA 7ADHA 1IZZA 1FC0A 3N87A 1BMDA 2P2DA 2JAUA 3BD7A 3OPMA 4QEDA 4BB0A 4C7JA 3M6XA 2VQFB 1QPZA 1PGPA 3M1IA 2WYOA 4YCLA 5DF1A 4BLRA 2EWVA 2FX3A 3NAMA 1VOTA 3ANNA 4P3NA 1EWQA 4C6RA 4RCYA 4G8DA 4TS4A 1JHDA 1MPTA 3AHEA 4HH4A 5FLKA 3CX4A 1J0DA 1V9LA 1Z7BA 3CC8A 3H4VA 4BMYA 2A84A 3IUBA 1GNQA 3JAWB 5F33A 1USIA 1X7XB 4FLMA 1N75A 2I71A 3F8WA 4TTVA 4FFVA 3TVYA 3VU1A 4NBUA 3HB1A 521PA 2HRZA 3FSGA 2G36A 3EXHB 4EPTA 4TXNA 4F85A 1IU9A 2YMMA 2XYVA 2IY7A 1JH9A 2PMFA 5C8YA 1O94C 1XTUA 2IYZA 1NXQA 5M2QA 3T1YB 3FIJA 2R00A 4JJFA 4COOA 2WJ4A 2A0YA 1JFLA 1XVTA 4DQ0A 4UVEA 1MAHA 2UYGA 4COKA 1N6IA 2ZXEA 3AW9A 3EAFA 4JLJA 3BF8A 4D9FA 4PRYA 3A4IA 5F35A 2QQFA 2VQDA 4DXAA 1NUPA 4MRVA 5LQMA 3A1EA 3NB0A 4K3UA 4YP9A 4D57A 3AETA 5EWJB 1U3DA 2DKFA 1UKCA 3BSFA 1EFPA 4MX8A 1XCMA 1YF3A 1NURA 3DNPA 5HEKA 5JD5A 1S2IA 1ZGHA 4IV5A 3Q6IA 2VKQA 1MEOA 1VLHA 5IKEA 3VXKA 3H2HA 3EK2A 1OY1A 1OWNA 1J9EA 3UTDA 1LY1A 3FNHA 5DSTA 1GPBA 1SBCA 5DBFA 2X0EA 1KJIA 2Q62A 3ZWMA 1VKJA 1HQCA 1KF0A 1N6KA 2VQ3A 5CLLA 1FB5A 2WYIA 2O50A 4LXTA 1FFXB 5CPBA 3VVBA 4KR0A 4R9RA 1YQUA 1Z83A 4HWKA 3E5NA 2WKPA 4M9XA 1SCIA 4PGMA 4DR5B 1PR3A 2I4OA 3FLAA 3HM2A 1SFRA 2P40A 3MINB 1NVDA 4JYBA 3GPDG 4UDXX 4V0SA 4TRRA 3VZRA 1KJQA 4FWTA 5EIWA 4AJKA 1VHJA 1XRSB 4Q1AA 1VJDA 5DGXA 1P0PA 2C1ZA 1EFKA 1NXPA 5E2IA 4FJ2A 4MGEA 3VNRA 3O73A 2ZQ5A 4YRAA 4C4OA 2GETA 3PUXA 1RRKA 2E7ZA 5JXGA 2VJYA 4JQCA 4GZLA 1PGOA 1KYQA 1YQQA 3QLEA 1BMQA 4NHOA 4S12A 5DWQA 1MVNA 1QQ6A 4FGSA 1CF2O 4JP1A 5CBPB 3A1CA 5CB8A 3GWZA 1QVWA 5ALLA 4ZYTA 2GPSA 4E3ZA 3MGAA 4KR2A 1JSCA 2XEXA 3WB2A 2J3JA 1V16A 4JJAA 4FGKA 1JS1X 2W2QA 5KYYB 3FYCA 2R6AA 3DMTC 3O4VA 2ACWA 3PXUA 2QX7A 2PH5A 3TRHA 3O4HA 3AGPA 2IA5A 4B75A 1V7QA 5AUQA 1NE7A 4FC6A 3RHSA 2QN6A 4BBAA 4YLYA 2G4VA 3HZOA 3TQHA 3FI0A 1PJAA 1KDZA 4J4HA 2QW1A 1USUA 2RH9B 2WUFA 4PPFA 4PAMA 4EHKA 2H29A 1Z13A 4GZMA 1CLUA 2B1RA 1Q19A 4BJ6A 1JLMA 1NBMA 2QRMA 2PU7A 4FQ8A 2HQOA 5IARA 1XHLA 2H07A 1GG8A 3GRCA 1ZM4A 3AUFA 4M9SA 2AOUA 3I8OA 4D9EA 9MHTA 1FVOA 5AVZA 3GZ4A 3BERA 2J5RA 2OO5C 4EEZA 1LVGA 2Z8YA 3HNPA 3LA8A 4GPBA 1MFZA 1F48A 5FNVB 1YONA 3IQWA 3DC2A 3DUWA 4IP0A 1P77A 1P4JA 3TPFA 4DSNA 1POWA 2AK3A 2IHVA 2HDWA 2MJLA 4YJHA 4II3A 3DPUA 1L5QA 1NJFA 1LSSA 4D8YA 4PNZA 2AMYA 4X8OA 2HLDA 6NULA 1CDOA 3NANA 5BO5A 4B71A 2H57A 3FSEA 4E30A 3K4QA 4EG6A 3KSUA 1OX6A 4RSGA 3ZX4A 2H1HA 4AJPA 1JNYA 2D2IA 2XWQA 1V95A 4RVCA 2QMEA 1K7CA 1TK9A 3GI1A 4UHBA 4WGFA 4TXHA 3B70A 4M36A 2AMJA 1PP4A 2I2FA 2W00A 1D0SA 3LW8A 4QOSA 3LDUA 4QVKA 4X1OA 3N76A 2NGRA 2ADFA 1AUQA 3SBDA 3UAWA 2J31A 1CJMA 1LLQA 3FMPB 5JG7A 1VYUA 4PQEA 1Q1QA 1O89A 2XOXA 3WLPA 5JRDS 1UAYA 4KB5A 4ZRMA 4M89A 1GTRA 3MLAA 1L7BA 5G1OA 4DUGD 4ESOA 5L7YA 4I1VA 3H3XA 1ZCBA 4UDNA 5T4EA 1T2AA 4HAIA 1B93A 2FMKA 3HJUA 4C2TA 3COYA 3TBFA 3OQNA 3MQ4A 4V0RA 4AG6A 4E1BA 4LGCA 1TZKA 2DY0A 2PO5A 4MGKR 4EI9A 4IFTA 1C1YA 2QA5A 2ZJ3A 1NWHA 2YHAA 3DT8A 4PEVA 3TB4A 1U2TA 2P1RA 5BPFA 4AS3A 1R6VA 3DFKA 3P97A 4ZANA 1M83A 1L4LA 3PE3A 4BECA 2V6MA 2H9IA 2JIRA 3QLTA 4HMPA 4W5QA 3OOSA 3QKRA 4CT0A 2GN4A 3B6EA 1XZBA 3JQBC 3LZCA 5E9JA 2OYRA 3EEYA 1ZGBA 2WF7A 3WIUA 2XHEA 4YHBA 3GT3A 4YRRA 1Z0FA 1JYFA 3X1YA 4CF5A 5ITZA 5A9SB 1X7WB 4JGGA 5E1MA 1G0NA 5JIBA 4PYNA 2AI2A 2AOTB 2DP4E 4MKXA 2XQKA 5C7YA 2WJIA 1GY8A 4ZTUB 5A04A 5L6MB 4YP6A 1MV5A 4XI9A 2V55B 4M88A 4LYFA 1JG2A 2V6BA 3C6ZA 5IVDA 3ZLUA 4D46A 4LXIA 3S8YA 1CB7A 4F96A 2PQMA 4NQZA 2FG7C 2LXNA 1T2UA 1ODSA 2VJNA 1GPDG 1LBTA 4M0DA 4O1MA 3CEHA 3F9RA 1VE3A 1W6RA 2ZRGA 1E9FA 2CCGA 4DWJA 5FQNA 4LWOA 4Z2YA 5TLSA 3H9EO 4J16C 3Q9NA 4QDTA 1KS2A 4ZARA 4AZ0A 2IXBA 4BQIA 1DGQA 2ENWA 4MQEB 3CZ5A 1VLJA 2FKNA 3RU2A 2JJYA 4EO9A 1ZH6A 4XTCS 3ZGOA 4IDQA 4DVJA 2WF5A 4KQ9A 1RBMA 4OBBA 1RYNA 4BFZA 3CRMA 1ORHA 3CNHA 3PT9A 3IJ5A 2R79A 3HNOA 1UXHA 4BFUA 2LKCA 2QZJA 1OA0A 4JLBA 5J4LA 2R8ZA 3GBSA 3GLIB 1K7EB 3FYHA 1SO8A 2OT3B 3PFBA 1BS1A 3FDZB 1GL9B 3LHFA 1LI5A 1WVGA 3OG9A 4DFDA 3MB5A 1HT1E 3DTVA 3ROTA 5EN4A 4BVHA 3INRA 3TECE 3J81A 3BVPA 3WFIA 2QQ5A 3K1ZA 2YXEA 5M7EA 3L40A 3NV7A 5CUQA 1GUFA 1HFJA 4X61A 1ZM7A 3MXOA 2V4UA 1ZI6A 3PUHA 3SZUA 3PC7A 3TW0A 2PX8A 3U48A 4BO1A 2EF0A 5E9AA 5F64A 5JVDF 1RC8A 1VSQA 4J03A 4F8YA 2XRZA 1LQ2A 4C20A 1SUEA 1J2JA 3K2IA 4CL0A 5A9RA 2AJCA 4G2NA 2X40A 3AJ9A 2AIRA 2NSYA 1AKRA 4RGQA 4R9UC 3BDIA 2WVJA 5CYGA 1F60A 3NTVA 4N8DA 2AQ8A 2WG1A 4J90A 4TS3A 3ACBA 4TMKA 4ERXA 1YS4A 2ZS7A 1A9PA 5CLQA 5T6MA 3CCBA 2XVMA 3FN4A 4PHFA 2C1XA 1FVHA 3VISA 3ZD9A 1ZA2A 2NADA 2NTNA 4BJ3A 4X3CA 4DMGA 4B7UA 1XZDA 3BG5A 4RVHA 1QMGA 3A2NA 3FKSA 1EHYA 3R1IA 1ZEMA 2XMGA 4NQRA 4GOND 3AEQA 4EPXA 4ZD6A 3RS8A 3X2SA 4CLRB 2ZTHA 2SECE 4OKSA 3DEZA 3B12A 3E3LA 4J2OA 3BZWA 1GZHB 3PIIA 2P9EA 2BMWA 1KQOA 2OOKA 1NVMB 2J0SA 4FEYA 1W6UA 4D96A 1FPQA 2H5JA 3LHIA 4XUGB 4CIBA 3RC9A 5T67A 3IDSA 2BKUA 1E2PA 1L6IA 2QMHA 4IDFA 4LCJA 4QG3A 5LOVA 3SI7A 2VP5A 3A6EA 2FFRA 1P4SA 3BXZA 4IUCS 3WWOA 2OTCA 4K7JA 4MJ7A 2MSCB 4OGGA 3RD5A 3TD9A 3PX3A 5ISMA 3IKTA 4MUGA 2FWRA 4PR0A 2GCOB 4RIGA 1ZP6A 5I6DA 4KR3A 2G1AA 2ZBQA 1A97A 1GCAA 3QKTA 4C4TA 4FKZA 5BVHB 1RC0A 5HFJA 5B7QA 1K08A 3NP9A 4KQFA 5GGXA 3JYPA 3P52A 3ZU3A 4LNHA 1O6BA 1JKJB 3GGOA 4IDAA 3H1FA 3OO0A 4F1KA 5L4SA 3IVGA 2ASVA 2ODTX 3IJPA 4WV3A 1HR0B 2Q5CA 4H3SA 3U3JA 5KDOA 5THXA 2WP0A 5LQNA 2PRZA 3EGCA 4TWZA 4DOMA 3L6UA 1IUKA 1IJEA 1I9GA 1KP2A 2C94A 3N0VA 1SA0B 1RJFA 2J3LA 2VVTA 3EDOA 4J9UE 5NULA 1PSDA 1SUAA 3LC2O 4N0MA 1G1AA 5C5CA 3LSTA 4FIZA 1RWBA 5T3YA 8ADHA 2G7MC 3K6RA 2I3DA 1O94A 4ITRC 2BWJA 2GRUA 4OHPA 4GP9A 3HACA 4QHSA 1PVVA 1CQJA 1XDBA 4OJKA 2VJCA 2ZIWB 1Y81A 4DG9A 1N4DA 3T9BA 1CTQA 1A9ZA 2X7HA 4YUXA 2BFOA 2P4SA 4A1FA 4AP9A 1Y6QA 1VGVA 1RSZA 4V0KA 4Y1RB 4DA6A 1CPYA 3F73A 4J9VA 3BAZA 1MX5A 2GZ2A 3FNFA 1PJ4A 1HUQA 4R1NA 3GLIE 1OH7A 2D7DA 2W6ID 4WERA 2FAXA 4HY3A 1N3YA 1E1CB 3F6SA 4J0CA 3TRJA 4B83A 2J6IA 1EWVA 1BDBA 4Y9SA 3W5AA 3BXOA 3T3OA 5B3LA 3FETA 3AEUB 4D3DA 3IL2A 2ORWA 5DI9A 1DSSG 2H6EA 4NDNE 3G2MA 4NU6A 3V7WA 5EJ7A 2PEYA 3M5PA 4KLAA 1NNSA 2QI9F 2PSHA 3OZXA 1NW5A 1J8QA 4JENA 3E70C 3HJAA 4JWTA 4EKGA 2OORC 3H5AA 3BBPA 3UMMA 4IHJB 4OQEA 4QE3A 4DWVA 1EWTA 1HEIA 3VUEA 1LRKA 1TMYA 3JQ8A 3E81A 1XZJA 1E2NA 3HGTA 5DCLA 3TL3A 1B7GO 1FDOA 2C0CA 1J0AA 3DAOA 4NCXA 5JQGA 2LGJA 4OXRA 2AEFA 2GM9A 5KAMA 4M6WB 3VPDA 2ZPTX 1GA1A 3VV3A 4WJLA 1HYGA 4PZ9A 4OUDA 5COQA 4OQPA 3EA4A 3NKLA 1Q2UA 1KDTA 4KMSA 3RHZA 16PKA 3QNMA 2JFFA 2NZ2A 3DXFA 2QOEA 1Y0BA 4WN3A 1Y6JA 3RDPA 1LZLA 1Z75A 2PFKA 5SY9A 1Q57A 2K7ZA 3IA7A 3SC4A 4NV3A 5EHQA 1HQDA 2E9SA 3FGOA 1N5LA 3IJEB 3WB0A 4D99A 1XP5A 2A6PA 5BMVB 3SZGA 4N41A 4C2AA 1JFSA 4UOEA 1S2LA 3R7WA 3T35A 2PKQP 1Z7GA 1Y6RA 3H3FA 4QAQA 2AG1A 5ALVA 1OXSC 2NUBA 2H2IA 3UKDA 5B6IA 1IBRA 1KWGA 3SBXA 1XJQA 2AC2A 3FBTA 5K3AA 4JITA 3F7OA 4DSUA 4MVJE 1KOLA 5ARBA 1G42A 5C51B 4DADA 4JQSA 1KBQA 1D2MA 4HC4A 1BRTA 1R12A 1BFUA 4H0FA 3DLBA 4G97A 4JQZA 4DGQA 2OG1A 2XWSA 3P7MA 5AK0A 1A95A 1NW8A 1YQEA 3FPGA 1KR2A 5E3HA 4KZKA 3C7TA 4YJ2A 1EUYA 5BXQC 1RE0A 5EJGA 1P2VA 4H6WA 2XR1A 3QA9A 4ENVA 1OWMA 1P2SA 2GZMA 4J94A 4DBVO 1EGVB 1YB6A 3AK4A 1OI7A 4GL4A 1NBMD 3IQGX 4A6EA 1FYWA 1I3CA 2I7VA 2PRYA 5DI3B 4RA6B 4FBLA 4Z3KA 2C97A 2YYSA 3QNWA 4K40A 4WFKA 1JT9A 1YJBA 3C16C 4NCHA 1FS6A 1AOXA 3SICE 3UUEA 2VZ8A 4UZFA 1F8XA 2D59A 2XUQA 3MYRA 1MU0A 3KB2A 4PPQA 1DC6A 2WA1A 4R2HA 3EGDB 3LPNA 1R4MA 1RM4A 3KFXA 2E6KA 1TO6A 2GO1A 2PUVA 4CKEB 4OKNA 2KHZA 4IJ6A 4LXQA 3TM5A 2JFNA 4KBYA 3WFZA 1PD0A 4C29A 2G5TA 4MXDA 1XQWA 3FPKA 3T9FA 3V1LA 3STWA 3ZHXA 3LH5A 3VJKA 5EWMB 4ZHSA 2FPRA 2NX2A 1ONBA 1RJWA 4JLWA 1OBCA 4UQPA 1RLMA 2C5FA 1UC9A 4U7PB 1MH9A 4D8TA 3D81A 5L4NA 4R3WA 1LW6E 4JYPA 4JBLA 2PZ8A 4HLCA 3OWXA 3SP1A 4TVKA 3THSA 4Z7NB 4YP1A 2HK7A 3ZY3A 3PDIB 4LGMA 2UYOA 4HSEA 4EB6B 5GZ3A 4JYAB 1G20E 2Y0BA 3JALB 3R6LA 3FJ1A 4FCVA 1S02A 3BRWA 3PGMA 2DLCX 3HVHA 5CFRA 2W2KB 3HBMA 5IUNC 1EB8A 3SR3A 3KAPA 3Q12A 3T5AA 1F7UA 1PX2A 1RXCA 1U5CA 1WHTB 3BQMB 2AH5A 4DCGA 2G08A 5IVPA 1W1IA 4L9AA 4TRJA 4Z8YA 3W3ZB 3HWWA 3KT6A 3L8GA 3W5JA 3JR7A 4NH0A 4U5XA 5KYUA 4BJHB 4Z8XA 1B43A 2WAMA 3LVBA 4CM4A 3E84A 1V71A 4R98A 2DTEA 4R8VA 4HAUA 2P79A 5FR1A 4ZHQB 2QTNA 4GEGA 4GMKA 1F8GA 4NJMA 3FVVA 5DMHA 5JEEA 1BTOA 1O94D 1PDOA 3P2MA 1QQ7A 2QR3A 3Q9UA 3CO0S 221PA 2YBDA 1XCJA 2ZUWA 3QHQA 4HNSA 4PG5A 1KOFA 4Q1DA 2IS2A 5F1OA 1EEHA 2IDZA 8ABPA 4PN3A 3ZJ5A 1NDQA 2BI8A 2C29D 3ZE2B 1VG8A 4M9UA 5KPDA 1CT9A 3PHCA 5BSUA 1M34E 3RUDA 1B26A 1DDGA 3V4PB 2HHHB 1C2YA 1B8VA 3MBIA 3THWB 1XZGA 4EI8A 1E9CA 5HQTA 1RYZA 2GFQA 1IY8A 4I50F 4TXMA 2F9LA 4TYPA 5KTSA 1MVLA 1WHSB 2DCMA 2RGXA 4R54A 4WCFA 3Q7SA 4OQ4A 2ILVA 4OLBA 2BUAA 2KQUA 1FFYA 3MILA 1HL3A 3SXJA 3WWPA 2GUGA 5IFKA 1DELA 1WZUA 3RKSA 5HRAA 4PS1A 1Q7CA 2QUJA 2VYQA 1ECLA 3U3XA 4ER5A 2Q8NA 1MQ8B 1UKZA 1V45E 3MEQA 5IS2A 5BQXA 2ZRQA 4Y67A 3E61A 2D1QA 3SC2A 2AX3A 3ZZ1A 1RWKA 1TEVA 2BAGA 3LO5A 4JP3A 1QSGA 1XWFA 3L9XA 3E82A 3OBIA 1E0DA 1YE8A 1U02A 1JQDA 3HYRA 4GOMD 2BJVA 5DLEA 3OMXA 3UMYA 2QTTA 1U4NA 2NU8A 1Z15A 4G0PA 5ALOA 1K6IA 4P4LA 3L6CA 4EBBA 4MHTA 1B15A 3DMNA 2FUG6 4NYMR 3M6MD 4DRXB 2D0OB 4YV0A 2NNWB 3MERA 1XNQB 3AVVA 4S24A 2WUVA 2ZANA 3L05A 1ZJ6A 4ND7A 3E22A 3PRYA 2O20A 4Q4HB 1M6YA 4HZGA 4GLFA 2B1JA 3DB1A 3CVJA 2NG1A 4RADA 1T4CA 1J49A 2HA7A 1OAOA 4Q5IA 3RLFA 1KPHA 2EKBA 2PWZA 3LFTA 2NZ8A 3C3EA 4C7KA 2F3PA 3GPLA 1QVAA 1N25A 4FYYA 4LZNA 1JJVA 3SM3A 2R84A 3HCDA 1VIAA 2NO9A 4EHJA 4XVUA 1AHNA 4H1WA 1Z18A 1ZBQA 4WBSA 5FF9A 4CJXA 1KRWA 2QI9C 4AJIA 1JKIA 5A7FA 1PO7A 4X97A 1JG6A 2H9AA 2UU9B 5EYPA 4DR6B 1KEUA 2SCUA 5E3JA 4HLUC 4OY3A 1RM0A 3ORRA 4OA8A 5BSMA 1UZNA 1UP7A 3VYSB 1MB9A 1BNCA 3IVMA 2WHXA 5AK4A 1PGNA 1L4KA 2XCQA 2Y92A 1CRQA 2XRMA 3IMCA 1DXHA 4PGAA 1ZMXA 4OUDB 3SE7A 5BN4A 4NG5A 1LV8A 4RHUA 4BB5A 5KWJA 1P1FA 1K3FA 3B38A 4ZO6A 1NVVR 3R9KA 5JQGB 3R23A 4N4AA 4ENPA 2VYCA 3DNFA 3N2GA 5ALEA 1H05A 1KY5A 1P9WA 3ONWA 1C9EA 2YVAA 4H7EA 2ZRHA 3AJAA 5GJCA 5AIBA 1G21B 4RCVA 1XHEA 3Q88A 4OLHA 2VSNA 5D3MA 3UANA 1PQYA 1LBHA 4A16A 4DCSA 2QX4A 4BCBA 2FW1A 2ZLBA 3H9JA 2RKWA 3LT0A 3NBZC 1JV2B 1XP8A 2RB4A 4HJXA 1Y1QA 3BWEA 4IF4A 3WHPA 5ALRA 1NVEA 5IM4A 2QTFA 1E2FA 1G8HA 1DKQA 4IZHA 4OAPA 5H3LA 5ILOA 1SVKA 1M7HA 1C7RA 1QUEA 2NZYA 2RC6A 4PRLA 4B6EA 1U9IC 1KYYA 3QVUA 2IU3A 4ZVLA 3H6KA 4Y0VA 4M60A 4CT4B 3TG2A 4GDFA 3GN2A 5DYTA 5FKJA 4EGJA 1THTA 3AVOA 2YVUA 3OAAA 4XIYA 5JWOA 4D80A 3WMEA 1KVRA 2P2GA 1C7ZA 1B6SA 2E89A 2GT1A 2I33A 4XDYA 5D84A 2QRNA 3SEZA 1QRTA 2BHSA 3JU3A 4J0HA 4TTJA 3VR3A 4EQZA 4MEAA 2YXDA 1FU8A 1ZRNA 1B76A 3U4CA 2Q3DA 3OEED 3RTCA 1O1YA 1QDLB 3EIEA 3KTAA 4PHCA 4RQAA 3SZLA 5A02A 5JWHA 1ST2A 2HU5A 2Q4TA 3ER8A 4WEQA 5B58C 5DM60 1V4BA 1ZJ5A 4PQYA 1L5MA 2NXJA 4LV6A 3ZXIA 2V97A 1BHSA 2GBLA 5A6VA 4OB8A 1E6KA 1NC1A 4QXRA 3SVTA 1BXGB 5DX0A 1SC9A 3EG5A 2UAGA 5JFOA 1ZLXA 2XCLA 5CIQA 3Q2KA 4Q82A 2ZWOA 4X44A 2AKYA 2QUHA 4CL8A 5E6RB 3RK4A 2BR4A 5BNTA 1CETA 1ST3A 2EJUA 4QZVA 2ZIZA 4M38A 1DTEA 1OBVA 1H0RA 2V1XA 4HGQA 1UM9B 3VR0A 1IZ8A 4JLDA 3U3MA 3FVRA 2DY1A 4B7CA 3W77A 1ZQ1A 3QV2A 4B46A 7GPBA 5FLXA 2IEIA 4KHPB 1BAPA 1VKNA 4GZ3A 3ITNA 3TLAA 1TQ4A 4AMBA 1NKVA 2XF8A 1AK9A 2B98A 1AKWA 1BEEA 4E5KA 2CV0A 2O8BA 1P7YA 1GLGA 2AHOA 4ZVKA 2CL0X 2FMFA 1VCHA 3U1VA 1DAPA 2D5LA 1C1DB 5ELXA 1N2JA 2WPDA 4OAOA 4HP8A 2QE7D 4E2FA 4R0MA 1VKOA 2DPXA 1FL9A 1GJRA 3ONDA 1MNQA 4DZTA 4CMIA 4F2HA 1ETHA 3QU2A 1EFTA 3AKEA 2X58A 3ABIA 5FI0B 5ARCA 4B79A 3CZPA 2FF7A 2BZSA 1BE0A 2HA0A 1U0BB 3SKYA 3P9ZA 3VR5A 3FOFC 4M0FA 5BOVA 2VXYA 3AY6A 3LY5A 3PVSA 1ZOIA 4PFJA 4R0VA 1TUBB 1G3MA 2I4LA 1A2KC 5B4UA 1ODKA 2DT5A 4GGMX 1SXJB 4Z54A 1P1RA 2X2PA 1NE2A 2OYSA 3C43A 1H4TA 1NW9B 3ENZA 3LF1A 1TMKA 4M53A 3R4VA 4DEYA 1ZI8A 3AF6A 3U4QB 4NOJA 1LJ8A 3FPFA 3HCBA 2DYKA 4MS1B 3W4IA 6GPBA 4BBPA 1Y9DA 2WTEA 2CC2A 1FOEB 1U1CA 3BFKA 3KQYA 1NG1A 3LBYA 4FMDF 4GQAA 1TK3A 2I2DA 4R2MA 5LB2A 2XCSB 4C3OB 3EEBA 2OHXA 4BNGA 3QP9A 2B8EA 2PUJA 2O7RA 3L8ZA 1W7AA 1YZHA 3AP1A 3TG8A 4CI0B 3EF1A 4CZ2A 2VRNA 2XW6A 2BE7A 3LTEA 1WCV1 2BFPA 4QGSA 3LYUA 3A6JA 1RI5A 2DVMA 1VFPA 5DXFA 3VR4D 1XE3A 1Z34A 2V8OA 2OGWA 4Q9NA 2I87A 1ZQ9A 4J2HA 5TQ2B 1I2BA 4XJVA 5FDFA 2WHRA 4O63O 3LWZA 1MZPA 5E4YA 1XRQA 3HJTA 2Q1XA 4RKQA 5IZ4A 5CG1A 1OMOA 5JLJA 4IXNA 1OX4A 2BSAA 3IBFA 4MPPA 4M8SA 1O6FA 1KY2A 2WDZA 4MKFA 5FPTA 3IKVA 3USZA 4LHXA 4P82A 4WL0A 4RACA 1KO4A 3UXEA 4TYQA 3TTTA 3ESCA 3VAZA 4UCFA 5CJPA 1P0MA 3RREA 1W46A 4J3FA 4RJTA 2H2AA 3MWDA 3NGXA 5DYIA 4DEXA 3EIUA 4OJNA 4IW3B 4B4KA 3PE4A 2O57A 4FU0A 1HFKA 5HF6A 3UH1A 3SEAA 2J7KA 3T1OA 4IEFB 2FK8A 3N5KA 3RSOA 1E0KA 2XQJA 4RD4A 1YD7A 1GILA 1BOOA 2FQYA 2GK4A 2Q5EA 4G37A 4WPGA 4IQFA 3TRFA 2D7JA 4PG6A 5DIFA 2OCGA 3CEJA 4D4LA 4AMZA 5IM4F 4FFWA 2I6GA 4P36A 3P9QA 3EIXA 2YIMA 1NOJA 1R3UA 1RM5A 1T6ZA 3DSRA 3HYCA 3QU7A 4HB4A 1QV7A 1QGDA 3K2BA 3AFGA 3LMKA 4RZHA 2W71A 5EQDA 4BRUA 5LNK1 1V11A 4U7DA 4V03A 3ZJUA 2V4ZA 4M1KA 4AWAA 1PW7A 1QOZA 3RBAA 5AM2A 5CFLA 1Z4PX 5EGSA 3BGSA 3RTEA 5FAKA 1ENYA 2RHJA 2HCFA 4MWDA 4ZXPA 3F90A 2YVLA 3HUDA 3EOZA 3WK9A 5ALJA 2FZKA 1PSZA 5CDSA 3V4LA 3FJYA 3WL4A 1U7UA 1A0OA 3T41A 1OZFA 3C14C 1BE8A 3UA3A 3U6KA 1JIJA 4HYEA 4LV5B 1MO6A 1TXGA 4US1R 3ZW9A 3CA8A 3VO9A 1QS0B 1QCZA 3PEYA 4B43A 1O6CA 2O7QA 1RIIA 3OPYA 4YAKA 1RR6A 2P9TA 2UZ0A 1UOQA 2UZ3A 2ZR8A 4AMVA 4JIGA 3IAM1 3IPXA 4YACA 3W7BA 4YGYA 4IINA 2DJIA 3M9XA 3E9NA 4E33A 3MWJA 1ZSNA 3GDWA 3LDAA 4LYDA 5ADWA 1HH4A 2YW9A 5FRDA 1UXKA 2AD5A 2VYND 1J7KA 1H2YA 1ZSVA 3M5DA 1PLLA 3AZQA 1KAHA 1L5WA 2AOXA 2GZDA 3P2KA 3ZWAA 4CKCB 3PTLA 1GNTA 3DOIA 3K0CC 1NM5C 2B7LA 2X4DA 3KE9A 4UEWA 1MIOB 5DHUA 4EUKA 2P3SA 3ZCVA 4GAEA 2CDCA 2VR1A 3BDVA 3VA7A 3L7KA 1EVZA 3G9UA 3KHKA 2C59A 2KWIA 3QVLA 4RVSA 3ETHA 2BEUB 4OU5A 4AVYA 1KIFA 2VPQA 2QRQA 2ZBEA 3NVDA 3PFFA 3A27A 1UEIA 2YZ2A 1HDCA 4JWKA 4Y6GB 1FUUA 3SK0A 2FW0A 4TTRA 5CH8A 3U80A 3EVFA 4YJKA 4A8JB 1QH8A 2W2LA 1OYWA 2UZ1B 1W75A 3NDJA 3VH3A 1U8FO 1A7KA 3VC7A 1UC4B 1SC1A 1ZVJA 2XNDD 1KYTA 3K35A 5HZHA 1K88A 3FCSB 5HWSA 5L9AA 2AN4A 2YWEA 3K20A 2P0AA 3UZUA 2IU6A 3EAQA 4DYHA 4V1CI 4GXQA 3PP8A 2FSHA 4M21A 3TAUA 4XR4A 4AICA 1I3OA 2AOUB 1J42A 1OLXB 1IK4A 1HI9A 2PLFA 5JJCA 2QSJA 4QGBA 5C81A 4Q18A 3VVMA 3AJEA 2D1FA 3PHJA 1N3BA 4KTTE 2EFEB 1SBTA 4F86A 2DLDA 3LECA 4WY2A 5BWNA 4EX7A 4CU5A 2NSHA 2ZS9A 4UTVA 1IQUA 4CIYA 2AN1A 4L9SA 5HDQA 1EFUA 3CPJB 4KFUA 3U61B 1XMVA 1J0CA 4BNUA 3D8HA 3QJ5A 3VH4A 2RGCA 1GIAA 5AJZA 4MNTA 4RENA 1J21A 1ZMRA 4IIFA 5JC8A 2A9PA 2C9BA 3EBPA 4RE5A 1MW9X 3UH0A 4A1OA 2BC9A 1QP7A 5CBPA 2PD4A 1JZSA 5EE5B 4F6RB 4DJAA 3AESB 2ZFUA 2XKKA 3AGQA 4UNPA 3UPTA 2Q6VA 4GH5A 3G2PA 4XCXA 4Z51A 3N2KB 1ACMA 2QR2A 5H02A 3S2FA 3CX8A 3Q5DA 3ZHYA 4DPKA 2QRVB 5FH9A 1T8TA 4J7CA 5EPOA 3W9BA 1EXMA 1GU1A 2JJMA 2R6JA 4MQFB 4R69A 4DUPA 3BFJA 2NO7A 4TVOA 4MV3A 1S4MA 2A2ZA 4UHHA 5JH7B 2BEJA 3GLFE 2WDPA 3AUUA 2BCJQ 2IYRA 2PXAA 3KQTA 3OCJA 4U00A 3L8YA 4A7PA 3LXXA 4IXMA 4TLBA 4Y0NA 3U1TA 3UFXB 4EHFA 1I5RA 3OJOA 4PIPA 1N8KA 3WB1A 5ADUS 2JJ8A 3P2IA 1Q12A 5IT0A 1LU9A 1IVSA 4EW3A 4DV6B 3CZRA 4MDYA 1VIMA 1RYEA 4JBGA 5BWOA 4NXMB 2HN9A 1BGVA 2VJAA 1XU7A 2XH8A 3OPNA 3A8TA 4YK7A 3B7PA 4MWEA 4XFDA 5E6SB 4ZVNA 3FTNA 1ZKMA 2IDKA 2XECA 1U28C 4UM8B 5JJBA 3MIZA 5E0KB 1VB5A 3WMFA 3V1MA 3AETB 1C4KA 1R6DA 4QRHA 5ELLA 3F2IA 1E6EA 1UK9A 3ZJYA 1H93A 3AONB 5AHXA 2OB2A 1ZG3A 3U4AA 3VYUB 5KWSA 3H2IA 3DBVO 4A0FA 3L7MA 1XNRB 1NPYA 1R6BX 1UDXA 3KJFA 1RD4A 2XNCA 4LF9B 2AXNA 5ENZA 3V1UA 3G2NA 3WLIA 1ZJZA 3EQZA 3IO3A 3NATA 5AVVA 4GPZA 2BMJA 1PKXA 3ICWA 4MMZB 1E6CA 3EXHA 2I4RA 1L1EA 2O2SA 3GUHA 4MI9A 1X1QA 3NU1A 5BSKA 3W5SA 2BSQA 2OZKA 4X6LA 2CEKA 5CLHA 2GR9A 3CKLA 3RUPA 2WT4A 4HLQB 2HQBA 2OC4A 2QRPA 1VHQA 2ZRFA 2PZFA 3DZJA 4P5DA 5E6SA 5TVKA 3KFVA 1ZHHA 4X95A 3RV4A 3K72B 3ZC3A 5FA8A 3TQCA 5JR3A 5K01A 4L6AA 1UQTA 3D2BA 4NCNA 1NF9A 4R3NA 4UTPA 1UWCA 2VBIA 4LISA 2B5WA 2IELA 3OCYA 3NC0C 4F0JA 4O4IF 3LY9A 5G41A 4Y2JA 3ZVKA 1XAJA 1RQLA 1FE8A 4RF2A 4IKPA 3WGVA 4BQFA 4DBLE 4M0LA 1UF9A 3DBHB 4OHKA 2R751 4LMBA 2F00A 4BMNA 1S96A 3KM0A 3HHEA 2FSVA 5EZ6B 4X1IB 3KVOA 5I7VA 1QGED 1JWLA 1GEEA 1S3SA 2FG5A 4QUBA 1RADA 4JKIA 4KXQA 2YZKA 4MGIR 3F6EX 3SNKA 3IBSA 1U8TA 1YFKA 1BKYA 2IY9A 4I7EA 5ADHA 1NTRA 2J3QA 3KSDO 1V2GA 5D3QA 4F6RA 4W5TA 2AFIB 2QUKA 2C3OA 4YJDA 1SRRA 1B8PA 3CKKA 2F8LA 2AFHA 1NLZA 2FSSA 2JHPA 2DM6A 2OGZA 2A33A 2YHBA 1QXSA 3HZHA 2JAPA 3RJTA 1QK5A 5DTIA 1Y8ZA 3VR6H 1YXMA 2MOKA 4DA8A 2J9RA 4N8SA 1FFAA 3X1MA 1ZD8A 3OIYA 4I36A 4EQ6B 4DV5B 3GJQA 1Q74A 2VZ9A 3GNSA 2XDWA 3JAKA 2X0FA 4L0DA 5DTJA 3ILSA 3RVKA 4DARA 2Q07A 1NHGA 4QT4A 1KI6A 2XUKA 2WTXA 2H8GA 2GXUA 1J9GA 4MYUA 4XVQA 2YOFA 1X7ZA 5A2GA 3QEKA 1M8GA 3DE4X 4MR7A 4WZBB 3EA5A 3UHJA 3VU0A 1OAOC 2CHQA 2PSJA 5ALPA 1N5OX 2G1KA 2HFKA 2PT7A 3HUTA 3EN0A 3L8MA 1KEPA 5IBQA 4PSVA 5TMPA 4OQNA 2C57A 4L08A 2FPLA 3UTCA 4EFLA 3DWEX 5D00A 4X63A 4X45A 3D7NA 4D41A 1BCRA 1GG2A 3L1IA 1LPPA 2JZNA 4BO4A 2ID9A 4BNFA 4HADA 5JAUA 3EUAA 1YBMA 2HA3A 4W1QA 1MAAA 1W5BA 3G8YA 4N82A 1CG6A 4GSLA 3NYQA 1UUFA 4GW3A 3BJZA 4V24A 2AE2A 1KMHB 1XZQA 1SUCA 2MMGA 2WZQA 2BEUA 3GOQA 3IT3A 1E8MA 1DX4A 4NYMQ 5JQWA 1JMKC 2EW2A 1U3GA 2OK8A 1X9HA 3CPHA 1C30B 4ME6A 1EUCA 1JWBB 3DBLA 3ROGA 1JFTA 4LBZA 4RPHA 3EIQA 1R9GA 4TS1A 4RZIA 4QHTA 1ZJWA 1PV4A 1FRNA 2QAJA 3QPAA 2GSDA 1WUIS 1Q1AA 3RABA 3UG6A 3DLTA 2IYFA 3PR2B 2G9VA 1AHHA 1Y7HA 2QEQA 3GPCA 1XJ5A 4OREX 2FPXA 2BFDA 2YJ3A 4DCCA 1SOMA 1WMEA 5K0JA 1RPZA 1PG5A 1GPLA 4UUPA 3B3QA 2QTVB 4IHAA 2LZ0A 1G8SA 5J40A 4RVUA 1E2JA 1CUGA 1UOOA 3VOBA 4BYMA 4D74A 4AM8A 4L8LA 5IXSA 2QTVA 3EIHA 4U3JB 4BTEA 2Q6OA 3TW8B 2WD7A 4TSKA 3QBVA 4DLXA 2VXOA 5HK8A 4QUKA 4NOLA 4LN1A 1KMNA 4IVRA 2GESA 4WDQA 4NABA 1US8B 3MT8A 3DC7A 2WJJA 4I46A 4RTQA 1MGOA 3E1GA 3D4IA 1C1XA 2DAPA 3ZLVA 3ZWXA 4B4WA 1NIPA 2QZ4A 1SBZA 1P44A 2D62A 4CG0A 2Y4NA 4E5PA 4HV4A 2CT8A 3VNVA 1KORA 2H3HA 2A88A 2G83A 4RELA 4R41A 1BQ3A 4Y6SA 4Q6WA 1H3FA 1T2FA 3AM4A 2C61A 2ERYA 2M98A 3T54A 1TKBA 1MHTA 4QWMA 3DMTA 3JQDA 4Q7KA 4DDKA 1RP1A 5J5AA 1KI2A 1E1QD 1M6VB 4JBWA 2G4LA 1BD4A 4WJZA 1QHNA 4FX2A 1JBKA 4DIFA 3OICA 3ET4A 2O9JA 1P1CA 3AINA 4E15A 3LQQA 4BX9A 3Q2IA 5DLYA 5PNTA 5FL3A 2YN4A 4QXOA 1OOEA 1G2PA 1A9TA 3QXGA 2AQIA 4U3JA 2XCIA 4FW9A 4CHTA 2A57A 3RUAA 3EFOB 3R6GA 2NUTB 3AO0B 1RLJA 1QONA 1F3LA 2FRXA 3IQXA 5B1EA 4MUYA 2IZ0A 3PC2A 1UIRA 2AX4A 2AR9A 4D8UA 3UJDA 5K3OA 1ODTC 4X7RA 1YZGA 5LYYA 4DLAA 5I4CA 4DSTA 2W6OA 3VPFA 4KPEC 4JL8A 2ILTA 3L0OA 3MBOA 4EY5A 3WZMA 3AUYA 2DXIA 2JF0A 1T36A 3IUNA 1M2VA 4NESA 5I7RA 3MMZA 3GLSA 2H0RA 2H3EA 1T8SA 1XZLA 2C5LA 3PVZA 4EQ6A 4KIJA 2GM4A 4QBGB 4M8IA 1Z7YA 5CCDA 3WKEA 3TOSA 4A6PA 4W5RA 1KH3A 3ELUA 1IZ0A 5EJ8A 3A1UA 1W0KA 5EXPA 4A2PA 1V1RA 3O3NB 3MJHA 4ZI7F 2KM1A 1E3JA 1YZLA 3K16A 4YT8A 1CUAA 4TV8B 4JMPA 4FQ5A 2AFIA 2MYNA 2PAFA 2A0FA 3EC1A 1X8XA 3IB3A 3N0XA 3JZDA 2OV2A 5GONB 4RVNA 2REBA 4RK0A 1V48A 1JGTA 1YHNA 3DWGA 3H7IA 3I2HA 3ANSA 3VR5D 2HFJA 4LOIA 2AS0A 1VG9B 2FZEA 2J0EA 2XY4A 4PAGA 3UKOA 4KMMA 4YRQA 1DC5A 4JY7A 1XFDA 4JVOA 3FHTA 3B1ZA 5A3SA 3QX8A 4AD8A 3JV7A 1M9NA 1RRMA 2IYQA 3BC1A 5CYOA 3VR5H 3ZEIA 4CMHA 4MW5A 3TJZA 1I6LA 2E4AA 4C08A 5L3RA 1YASA 1Z88A 2R00C 3NORA 4AX4A 2ZOSA 4C03A 4BBZA 1OIWA 3PITA 2SHKA 1W5FA 4MR7B 2J1LA 1L7XA 2GCEA 3BSSA 1GGNA 3NRCA 3RQSA 5LLSA 1ZK2A 4K2AA 5CHYA 5JSHA 1JXOA 3ETCA 1QHYA 4FKMA 1MRZA 1YR1A 2IEGA 1VE1A 4RF4A 3CIOA 3N59A 1EP3B 2ATIA 3BUSA 3DULA 4FFMA 3E7DA 3ZDRA 5CT9A 4O8ZA 1F2UA 2P6OA 3E2IA 3HEMA 3HEAA 3GIDA 1CVRA 2ABWA 1BGXT 3AFIA 1IC6A 1W0CA 4XDGA 3OU7A 3TW6A 4KXXA 1LRJA 2VHXA 1GYPA 3IA2A 2HA5A 1CJSA 3TI7A 1LDYA 1I36A 4BN5A 1V7ZA 5LWHA 3JPWA 1E9VA 5EJFA 1WNFA 5EJAA 5DNCA 2V6GA 2ZUTA 2A9VA 8LDHA 4MVJI 1Z68A 9ABPA 2OHFA 3BWVA 4G4IA 4GSKA 2WKSA 2B83A 4FBGA 3RYIB 4HR7A 5CCXA 3OM9A 2E4YA 3PJRA 2J4CA 3E05A 4YASA 2I4IA 1ECPA 4XWGA 2XEDA 4LRUA 1VI5A 1L7VC 3C45A 2C4TA 3AEZA 2W42A 4DM7A 1RAHA 5I01A 2A0XA 4POAA 3DO5A 3HVUA 3R5KA 4AWXA 2PKCA 3AUAA 4QUJA 3ZVNA 1Y9ZA 1DTSA 2L82A 2QXTA 2EHDA 1SWVA 4C7VA 4GX1A 2XUGA 4WKGA 5D86A 421PA 1FNBA 1N0HA 3PPXA 4ZQEA 2WTNA 5BN1A 1MENA 2AI3A 3RAGA 3H83A 4G01B 4ZOQI 1CVIA 2YASA 1R0ZA 1RFGE 3N2LA 4IIHA 4DIOA 2IUTA 3GCGA 2FF5A 2DPYA 3HA5A 4DWWA 4EAQA 2O2CA 3ZDAA 3K8YA 3DT9A 2IRWA 3S6JA 4PO1A 1DC3A 1TFUA 3GDOA 4IMPA 4RH0A 5DNEA 4Q05A 1FX1A 3KL4A 1WWKA 1FTGA 3FPJA 3PGVA 9GPBA 1M6HA 3KEMA 4MRRA 1ZGAA 3PFWO 1QRUA 2AG6A 2YMQA 1DQPA 2P6PA 3PNQA 3GJ8A 5IANA 3U6BA 2CUZA 2E18A 4R1SA 4MUNA 1F0KA 3PDWA 3AL0C 5JH7A 2L42A 2X8AA 2QX9A 5AYVA 1GUBA 1H2BA 5AHRA 2X9GA 1RE1A 3PNOA 4QPJC 3VI4B 1C7QA 1H6DA 3PJDA 3CO5A 1JG7A 5CA0A 3NHBA 1QG0A 4MLPA 2HMWA 1W0KD 3P1JA 1UWVA 1YZNA 5JADA 2WQ7A 5HVNA 2Z09A 2XTJA 1M75A 4HXYA 4AY4A 3JVEA 3ER9A 5LXTA 4EO7A 1TD1A 3Q5GA 4RV4A 2WHYA 3RBZA 3E0QA 1E9RA 2R6R1 3KVRA 2VPWA 5KNCH 1G8FA 3PQCA 4YJ3A 2E87A 5BWBA 2D6FA 3EDRA 4AKGA 1WNTA 1P1BA 3WRXA 5KJCA 1WTAA 4U0JA 3QI7A 1NGSA 1U0GA 1I2MA 2HWKA 4LZAA 1C8VB 3EVZA 4GOJA 3CZ4A 3LUHA 3Q0EA 4TLEA 1AQLA 1TE2A 4DSOA 2AZTA 3MLEA 4YHHB 3NHRA 1J99A 3F6RA 4IY1A 4QNRA 4YAOA 3ZJVA 2AR7A 4BKRA 4H7HA 3WYFA 1G6KA 3GN1A 3KR9A 4L3VA 1GQQA 2H4XA 3B89A 4Q4DA 3O8QA 1AVTA 3LM8A 5IAOA 3H97A 2J0UB 4RVOA 3TLGB 2DETA 5TQJA 2V8BA 2PKEA 3TGLA 4FFNA 4KOAA 2ZDGA 3F5DA 4ZMSA 3DQZA 3KB8A 1OLXA 4EL5A 3AW8A 2AJTA 1UPXA 2OKGA 3KYJB 3LX4A 4L78A 3IV7A 1JEJA 5A0VA 4GVPA 3UJAA 3ZDEA 2ISSD 5IG2A 1P33A 2QLNA 2YRFA 3SYLA 1Q0HA 2GM5A 3B5JA 4JELA 3NHFA 3OIDA 5HM6A 2C7VA 3HVRA 3GA0A 4RPGA 4ACAA 3L4SO 1H9AA 2HYDA 2ZE7A 1IMOA 3ORYA 4AZSA 1D5WA 1U0RA 4XEHA 4EF4A 5A62A 3L6EA 1E2IA 2JGKA 2RHLA 1GRVA 2VXBA 3KL2A 3CWQA 4G67A 1XRNA 3SEFA 5MN6A 4XB2A 2CXRA 1PGJA 2BUBA 1ZOLA 4UU8A 1APBA 3D3JA 3BXFA 3O2NA 5CR9A 3CRW1 2OYCA 4PHHA 1GTL1 3ZVMA 1CFJA 1EX7A 1UP6A 3OPQA 4UNNA 5A3JA 2V54A 3EXEA 1HSZA 4ENQA 2L17A 3ROEA 1JYEA 3H4IA 1PF7E 4TROA 4WN9B 1N33B 3H5OA 2IYOA 2Z3WA 3GF4A 4RYLA 4INPA 4CEJB 2O19A 1U81A 4MTLA 1G5IA 3A2KA 3EPHA 2GVZC 1IM8A 1QRAA 2OXRA 3B1XA 4CMEA 3QKIA 5K05A 1GRNA 2HLDD 2CL6X 3M5WA 4PWZA 3QELA 5SYAA 5BOSB 1U8UA 2W6MA 3KKQA 3DDZX 4HVAA 4U2CA 5D1HA 1O8CA 3GMIA 5KVQA 3CF4G 2UV8A 2ZYTX 3VKVA 5C4MA 3L4JA 5DULA 2QN3A 5LQSA 3WLQA 4CEIA 4NYJQ 1UWKA 2O0MA 1HORA 3AUJB 3AVTA 1EGAA 1B74A 4EABA 3L82B 5JI2E 3OURA 3FJOA 4KH0A 4PZLA 4ZI7A 1CY4A 4GR5A 3TDNA 1HYQA 2I2AA 4JR1A 1E99A 3PNKA 4TM8A 5SZIA 4MYSA 1Y7TA 3V5NA 1NRWA 5KYWA 4EIWA 3MSCA 1TM1E 3OJWA 4O4LB 2V7WA 4YJ2F 1KAMA 3T3DA 1LDEA 1LPMA 3DNMA 2A5FA 3USCS 1Z0KA 3BGIA 2CUKA 3MRVA 3HGQA 4LJ4A 2P78A 3LKZA 4A8JC 4EARA 4RUKA 5K0TA 3HRIA 1GPAA 3B85A 3SHOA 4EKEA 3GELA 4KDFA 3V32A 3WGNA 2SNIE 5DSZA 4ZDJA 5JYCA 3EOAI 1I4WA 5KNLA 1KI7A 5DK6A 2OL4A 2WHEA 3GZNB 1P9LA 3BZUA 3NHSA 9LDBA 4GM1A 2ZYIA 3JD1A 5MFPA 1IBKB 1F2VA 3MWFA 3ORSA 1V1MB 2GWHA 3WWCA 2V6JA 3GAMA 2ECKA 4W5NA 3PNBA 1PYGA 3LHSA 3V2HA 3TR0A 1GCOA 3L2OB 1GYQA 1R5JA 2F4NA 5FORA 1XLTC 4BMZA 1PNQA 1EQ2A 1YQTA 4WMLA 1PS9A 2RHDA 4M49A 3FVWA 1ACLA 3H05A 1A5ZA 4BHTA 4GVXA 2OLKA 5KPJA 1XK7A 3N86A 3PC8A 2ZDHA 1Z2OX 3MOIA 1XDUA 2PMKA 2CLCX 4I1YA 3SX4A 3I3SR 4MPRA 4PZUA 5D5QA 4ZCRA 3KV1A 4S1OA 4GUAA 4XD2A 4CDRA 1G5RA 4MB0A 3KEOA 3BMNB 4TZ6A 2O2ZA 4ZYUA 1INLA 4OFWA 2ARKA 4GZ6A 5IK2A 2NPOA 1SM4A 3IOYA 4PPNA 5J4KA 4IFIA 4XYLA 3FOBA 2HU7A 3ILVA 2YJNA 3HLTA 1G2OA 1M1NA 1QQTA 3K1JA 4ZCTA 1TAUA 4M8KA 4XSHA 2EZUA 5LYJA 4KO4S 3OEEA 3LDHA 4L4ZA 1RQRA 2IT1A 2W6ZA 1O5TA 3ONEA 2FWJA 4MWOA 3JZIA 4UATA 5K9ZA 4DMKA 3AR9A 1WBBA 1PJZA 1I3NA 1EI9A 2GN6A 1GCGA 3D6AA 3DMHA 1ICIA 5IDVA 1X1AA 5J5VA 2O5VA 4A6DA 3ZWPA 3RF6A 2PSSA 1AQIA 3K53A 2R85A 3K5WA 4MQ6A 2P4UA 3RNLA 3RSGA 3VHQA 1M8KA 4AO7A 3DD5A 2JIBA 4CM5A 3M33A 3WAKA 1RHQA 1G9SA 2ES4A 1M76A 5CJ2A 1L5ZA 4LXYA 3ZWBA 4EENA 1YFLA 2NO6A 2O3JA 1HQKA 5I8ZA 4PNEA 2Z8YM 3GUUA 4CGYA 2DQ4A 1Q0UA 3O6VA 2ZITA 3UBMA 4R3UC 3WK4A 1VLQA 3MN1A 2ZRPA 4TZTA 5DNAA 4YMTA 1KJ8A 3FWZA 1U5BA 1KMQA 1FSSA 3OT1B 3W3AA 4WWHA 1A4XA 4I5FA 1AB6A 2OV4A 1OWPA 2C2MA 4GI1A 3QJGA 4FYIA 2CJPA 4NOKA 1E20A 2E2WA 2P5TB 2XNKA 3DVRX 3HYNA 3JATA 2DHEA 4REQA 4B6SA 5L3ZA 3HP1A 3IB6A 3LYLA 3NGMA 3NTQA 2VCHA 2DFKB 3BWXA 3NBAA 3WDMA 4B5LA 1WUTA 3SLRA 2YJTD 4AF8A 3I5MA 4P80A 1JPVA 1OXVA 1ZPDA 4HN2A 4W9RA 3UW1A 4KAXA 1I7QB 4F71A 1K7XB 2IS4A 4CTKA 3ASYA 3O4IA 3BK1A 4BJ5A 5LUBA 3WRYC 2OBMA 1YJXA 3BAFA 1RDFA 4NENA 5KX5A 4NBLA 1JE1A 2D1TA 4BNMA 1OI4A 3LDGA 4NBRA 2X0KA 4YROA 4B6FA 1XTKA 3BMCA 5A5GA 2HCBA 4KQEA 3BRQA 1SUDA 1BA3A 2DT8A 3AY7A 4K9KA 1PNOA 1CF9A 2JI4A 2Z57A 4M9CA 1N2IA 1EZ1A 5AKKA 4F7WA 3EGXA 2A5YB 1J22A 1KARA 4D8XA 1CRLA 4EKYA 1YC5A 1XTZA 1SVLA 2JGFA 3FNRA 1MUUA 2WJ6A 2O8BB 1O0CA 2H65A 3UAXA 3HJFA 3W8DA 4JJGA 4DLKA 4KXUA 5T64A 1JHPA 4TMFA 3FIUA 3DFZA 3T4XA 2RJOA 5ALQA 5EPEA 1KE2A 3GRYA 3HB9A 2XRFA 1V5WA 2WT9A 3EUEA 3QE3A 3N74A 3OLVA 4JBNA 1GQFA 1Z5WA 3BMXA 4MRNA 3KJNA 2JATA 4C6SA 1FP1D 3QTTA 3CZMA 1ZI9A 1NF8A 2BF4A 2JVIA 4MLDA 5JMPA 5ES4B 1P6XA 3L7YA 4XARA 3V4ZA 6Q21A 1T0JB 4EG5A 1Y8QB 5JECA 1N2GA 2RC5A 4ZZ3A 2XODA 1R4NA 3D1VA 4PPYA 1FU4A 3EDMA 2Q9BA 4RHYA 5FPHA 4YRSA 5B2EA 3IESA 2FE4A 4M22A 5INTA 1L7OA 1K6EA 2D8MA 2H31A 1GAQA 3K4HA 2QRJA 2C54A 1BXGA 3D1LA 3ITEA 2V03A 3F7NA 3H0EA 4WKBA 3HY6A 2H1LA 3L7AA 1XNGA 3EXFA 3P2JA 4LSGA 1G21A 1EJBA 4BDTA 3SIWA 2PWYA 3D9QX 5BNWA 1CQJB 1O8BA 4IGAA 3QYFA 4HGRA 1U63A 5EFZA 3U0VA 5J1TB 3N8DA 4R9SA 4GBGA 3FWHA 1SOUA 3CCFA 3CWCA 3KHSA 4ZP1A 4AW9A 1ZCZA 1MEEA 4LYGA 4RQBA 1D4FA 1A4RA 3FYUB 5DHFA 1X15A 5FBWB 3T61A 1WSBA 3CG4A 6YASA 1O2DA 4FHGA 4DLWA 1PZEA 2IEZA 4R9NA 1QHSA 3KQHA 2WWYA 5GJVC 3K4PA 3DBRB 1LJUA 2PZEA 1J07A 4Q3LA 4ZOLA 5GV8A 2EWWA 2G8LA 4HVLA 4P58A 3FZEA 1M2WA 2J3IA 4EJ2A 4U6SA 5IZCC 3CIFA 5K0LA 3WZLA 4BUJA 3W6ZA 1OXKB 3N28A 4UAGA 4KAAA 1UMCB 2W2PA 4MW2A 4AQDA 2Q3JA 5JFGA 5K8VA 1G19A 4GI2A 4F4CA 5HSGA 2P7IA 4OQYA 5FLEX 3BL5A 4LTDA 4I1OA 5KINB 1A8UA 2P2LA 4E32A 4XD7A 4KE6A 1MA3A 4QC2A 1TK2A 1NMZA 5J2TA 1RWVA 3JWGA 4H31A 4D02A 1GKLA 3RAFC 5LLDA 2IFTA 3ETJA 1MXFA 2X9QA 5L4LA 1ESZA 2H5IA 1J39A 5HKKA 1WOYA 2OBBA 1NHWA 2XBUA 2KBEA 1WY7A 2GK3A 4MRMA 3FKQA 1ZIPA 1BMFA 1MC5A 4KO8A 3K09C 1MQAA 4AG5A 4U9IS 3TVTA 4AJ2A 3A1VA 3OSZA 1FSFA 4XYMA 3QWIA 4YRJA 3MHTA 1OIVA 3O92A 1UPBA 1U0NA 5GM2A 4Y1GA 5AVWA 3DA8A 5E7JA 1OFHA 5E6UB 2D5BA 4CIAA 3FG9A 1ZNYA 2PR2A 4W8HA 2Y76A 1OJLA 3D0KA 1EFRA 3KDAA 2Z4SA 5AKZA 1QOQB 2C4MA 1DIBA 1JVNA 2BBSA 1XXHE 2VJMA 2ZUVA 3LAWA 2QP3A 1NOKA 4NCKA 2Y0PA 4OF4A 1X8LA 2CJYA 4QYSA 5DGIA 4UTXA 1J90A 1DMRA 1RYMA 1NOIA 2WU1A 3MRTA 1E1NA 2PY6A 1T1RA 3C41J 2IOYA 3CBQA 3SHWA 4AUKA 4KI0A 1N2XA 4PRZA 3TCKA 4YCCA 1ZVVA 3U4MA 3PL1A 3ZXSA 1YS6A 5JROA 3MT0A 1NC3A 4X00A 4IHQA 1IZYA 4DJTA 2P77A 1IOWA 1J09A 1D6SA 1O97C 1FFDA 3NIGB 1IHXA 4W8OA 1NG9A 3SJCA 3RRFA 3L46A 3ZJTA 1HZZA 5EWLB 2VWHA 3L7OA 1IULA 5FI5A 3GH3A 1EXNA 1S2OA 3JD0A 5KS2A 2QVZX 1M3SA 5ALNA 3E3MA 4TYWA 1RWPA 2OWEA 5FFFA 1XYYA 2P41A 1CUWA 2JGEA 4Z9AA 2X6RA 3QQPA 1ESMA 8GPBA 4JI4B 1XQ6A 5ILGA 1AMOA 1CR2A 1UT6A 1XTJA 3LO8A 4UHKA 1H8HA 1W5AA 1GTZA 3BMQB 2BMVA 3ELYA 4WXEA 1E59A 1AT1A 2V5UA 2PIDA 3NNNA 2CHGA 2FWAA 5EGNA 1OBHA 3T1QA 1J33A 3CV3A 3OZCA 4HFRA 4CF7A 3CJTA 4FDVA 2A1TR 1P3JA 1Q15A 2BEWA 2H48A 3BRSA 1ZUNA 2QM7A 3CGGA 4GI5A 3PX7A 3F1LA 1M54A 3DW3X 4JB2A 5JASA 4YMGA 3RLIA 3EIWA 4CV0A 4PSDA 2CLHB 2QTMA 5ILQA 4UKDA 5FUXA 4ZAZA 2PYZA 4N3CA 3HY4A 2ZE5A 1YS7A 3OBBA 4TQUS 4WJKB 4CR8A 1KETA 5JUWA 3MJVA 5DCWA 4NATA 5CHEA 4HEQA 2PUAA 1E9EA 2EFCB 1STOA 3OZGA 4EVSA 4RSMA 5JCOC 3NVKI 3H7AA 4LE1A 1QYIA 2HDHA 3HKEB 3WMGA 3IO5A 1IVNA 4QGAA 4BLWA 4RGVA 1UT8A 2WUGA 5IVIA 3H9CA 4K03A 1CEQA 3OCCA 5I7WA 1M1YA 4KWCA 4E2YA 2PM8A 3A1WA 3W3AH 3BK2A 5G4KA 5CXUA 4TTAA 4EG8A 4JS0A 1P9NA 3CZQA 4O4LF 3TEMA 3L7DA 3M34A 1U0HC 1UMDA 3NVMB 3HB5X 3G23A 1CK4A 3IEMA 3BMQA 1JHXA 1FNCA 1NJ5A 1QBKC 2WFLB 4UEKA 3B3GA 4YP7A 3EF3A 4J7XA 5LBUA 3TLYA 3EPPA 4H3KB 1AA9A 3V4VB 1DT5A 3GGGA 3KPYA 4G3XA 4LNAA 5DGTA 3CVWA 1SHKA 4H15A 2X8JB 2AG5A 5M34A 3F9CA 2QLLA 3VYVA 1FQWA 3WXBA 4UUNA 1LK5A 3OCWA 3P4YA 4Y2XA 3CLRD 2HJRA 3HMKA 3UYKA 4D97A 2RONA 3FB4A 2C9DA 2YXPX 3JZMA 3IPRA 1YFJA 5TXGA 1M34B 2INGX 4ILEA 1PUIA 3SDBA 1GGVA 4HPXB 1DHTA 2O8FA 3KJIA 4I5EA 4RZ2A 2FW6A 2OM6A 4UXJA 4FQ7A 1QIIA 4GXNA 3GP3A 4YBZA 5DTEA 4Z0HO 4HUQB 1BXZA 1LWNA 1Y3FE 4P2BA 2BF7A 2VP3A 5J2TB 4QUIA 1WXDA 5AW9A 1KSHA 4DV1B 1VDZA 1LPAB 2N0SA 1DUIA 4LX8A 2WNHA 4TL6A 4RTJA 2VJMB 1FJ2A 4G0ZA 3ZHRA 4G0XA 3VMFA 4P5PA 1F9EA 4O4JF 1AKUA 3NFYA 1M8PA 1P7WA 2I2XB 1MTZA 3IUSA 3QNUA 1IJKA 4GUDA 4Q1BA 3U4DA 1YB7A 1GFSA 3R5HA 1LSOA 1KR5A 1FBTA 5CNIA 3T7DA 3EVNA 2VJQA 1E5QA 4KE9A 4WY8A 3RQIA 4AUNA 2CLIB 3C85A 4DREA 1AXGA 4QTYA 4JBIA 5GONF 4BNXA 3L6OO 2B5VA 3D0RA 3M89A 3UMRA 3OAAD 4DNPA 4MDHA 3G5TA 4ZC8A 2ECFA 2WVHA 3A6HA 5BNZA 2B4RO 2GTIA 1UBUS 4G63A 4RMGA 1NX6A 1ZCJA 3LF2A 1VL0A 3BSYA 4GX5A 3DO6A 1UBRS 1A9RA 3IXLA 1AB5A 5DRYA 4FW8A 1C4WA 3NUZA 4ID3A 1QWSA 1YH3A 3T52A 1KOJA 1J0EA 1EM8A 2B99A 3DBOB 3NRJA 5C34B 3MC1A 1XTRA 2WUEA 4ZT6A 2Y1WA 2CZGA 2G17A 2O5RA 3V97A 3DFMA 4IWYA 4P35A 3LYHA 3NEJA 3J7AC 3ZW8A 4OHUA 5J4YA 1DRWA 3CH6A 4RHFA 4RU1A 1N7JA 3ZWCA 4JB8A 3GVCA 4BZXA 4HQLA 4RM3A 3AWIA 1E1QA 1P1IA 4H7FA 3FZYA 1E96A 3PD0A 4YEDA 4D9HA 4O4HF 1R3DA 4TKLA 5FTWA 4BNDA 4PSKA 4ZYLA 1FNMA 3SS7X 5JAIA 3ABZA 5D7BA 3I61A 1EPUA 3DBRA 3WOVA 4CM1A 1ZK4A 1DWPA 1OLSB 2PMBA 4ZT3A 3OZTA 2B9VA 3Q3EA 1RZUA 5EXXA 3F97A 2BEKA 3D0OA 3L4EA 2PJZA 5K3EA 2FZCA 1I9CA 2YUIA 3OTGA 1QMPA 2X0DA 1YJ5A 5HZMA 2BFEA 1HBJA 3QTLA 2QMZA 3ZDCA 4MWCA 2CJWB 3AQ4A 5C7OO 4PY2A 5GADl 2R8XA 1J8VA 4Y6OA 2OXCA 5KNDA 1PJRA 2OUIA 3U3RA 4R2KA 5DTRA 4OD0A 2XDAA 1ZK0A 4LOJA 4L50A 3TLBA 1QOPB 2Y1LA 1PFGA 5IT9A 5CU7A 5CD9A 1TLTA 1GFWA 2XZPA 3C6MA 4O0LA 5D6OA 1H1LB 3KLOA 2R8OA 4QUDA 1DQYA 2G9RA 2ODPA 1BRMA 4CL3A 3GU3A 1DC8A 1JKJA 4MKHA 2BELA 3MPUA 2F59A 4YONB 1GU7A 1K63A 1RWMA 4ROSA 3Q87B 1EG2A 3EH1A 1T1GA 2HHCA 3FPEA 2GPYA 5KX5B 4F93B 2R6HA 4IHJF 4OYHA 4ZO9A 5KQGA 1PNVA 3KZMA 5E1OA 4DDUA 5LZ9A 2OCPA 1GT91 2FE1A 4MKIA 4NZZA 2XF2A 4BASA 2ZIGA 3K8OE 4DL9A 5K0ZA 1DWOA 3L43A 5BYBA 1O95C 1WXIA 5JBQA 2RGYA 3Q41A 4F8JA 5MDHA 2C9ZA 4F1JA 4NXNB 1WF6A 3L9WA 2DFLA 4A0GA 1JDJA 1AQ6A 4AK9A 5HKKD 1VXOA 3QUCA 3JATB 1K8YB 2E48A 2PL5A 4PX3A 4ZU3A 1RLUA 5P21A 3HCWA 2PBFA 5BSEA 2AVDA 4MS4A 1W4ZA 2W4MA 1OTHA 2EYQA 2VRCD 1TJ4A 4B1FA 4AF7A 1FTNA 1KJYA 1U5BB 2WJWA 4DDVA 1VXRA 1YUBA 4OP2A 3UMVA 1C3XA 1FTYA 4GG1A 3MAJA 1QAMA 2ZI5A 4D7AA 4ARCA 1IN1A 4C5BA 4OXQA 4CMKA 4N0DA 3T3PB 1C8LA 1VL6A 1X1DA 1EE9A 3HKCB 4XUCA 1REQA 1H5QA 1L8XA 2MYPA 3USES 5AI6A 5KTNA 4H0NA 3CH7A 4BNNA 2JCVA 3I8XA 2OA0A 1Y9EA 1QCCA 3OHSX 3QBJA 5AOVA 3G8AA 3MFQA 1EK2A 1CUCA 3PI6A 4MQBA 5EXSA 2J9XB 2Q46A 3C3AA 5G40A 5JRJA 3AM1A 2YZNA 3Q9LA 4IPTA 4K9DA 4YS6A 1EGQA 3H42B 4ZQIA 1TF2A 2HWXA 4EMBA 4O2BA 1M34A 1TQHA 4A0HA 1E7YA 1RI3A 1DJLA 2JIPA 3DGFC 4JLPA 4NKRA 2OBXA 3AF1A 3R3VA 4X66B 3DTVB 3IR7A 1OSNA 1JJAA 4BVEA 4PQFA 1W48A 1AKEA 4RVDA 4Q4LA 4QU8A 4ZQGA 4EA6A 4DV2B 1P8AA 4DG8A 1PJCA 3DWIA 3O03A 4FGUA 4ZALA 4BU1A 1NJ6A 1YS2X 4XM0A 3ZHTA 3ETEA 4PBRA 3BMNA 2Q3BA 1WVIA 2W5UA 2HL6A 1I4OA 1AM4D 3BL8A 3I9JA 2CV1A 3U5TA 1O4WA 2HUNA 1JIVA 5THQA 1DWQA 1ZGCA 2FPPB 4S3MA 5EE0A 2XTAA 2D5AA 4QBHA 4D0GA 1GG9A 2HREA 4U39A 4IMRA 3H65A 2VSFA 4HH0A 2CLEB 5F4BA 4ZU6X 1H5NA 4U6QA 3T4PA 5D7NA 5B2ZA 1OI2A 2O48X 4KNWA 1I13A 1QFZA 4FI3F 1Z2NX 13PKA 3N05A 4IDEA 3LLSA 4RXUA 2O8NA 1L4MA 3UCXA 4FOSA 3WMRA 3G8DA 1YA8A 3RSFA 1NVFA 4DGSA 5ENDA 5TR9A 5LIRA 3QX3A 4QPNA 2XUJA 3A3KA 2VHUA 2XSZD 3DEHA 4GPIB 4TLLB 2SKDA 4UM7A 4BMPB 1T1JA 1K2VN 1VI2A 1KFJB 4E5NA 1HLDA 5LC1A 5IUJC 3M2PA 2Q9CA 4FNGA 4JLNA 3WLHA 2PCLA 1IQ0A 1U0SY 4QUHA 1SG6A 4NFHA 4GX0A 4RABA 4XLZA 3K6JA 2C07A 4PINA 4WGGA 1SCQA 5C3MA 2B6NA 5AJTA 2IV3A 1YZVA 2JGDB 3SQXA 1UXGA 3HDVA 1TVEA 2CNLA 2MWMA 3ZY5A 4TWBA 3FDZA 2FMTA 1J2TA 1LNSA 4NVRA 4EG3A 3TN7A 3FROA 2QM3A 5HRCA 4I9UA 3RUCA 5EZ5A 4X62B 6ABPA 4C0JA 6CHYA 2XBMA 3HQ4O 4Z4FA 1UBGA 2QSZA 1TRKA 4DC0A 4LSZA 3RYFB 1N77A 3BFVA 1OH5A 2CEAA 5ITZB 5CDTA 2IZZA 4JUBA 1V6CA 3DHWC 2BR3A 1NX9A 4NF2A 4RKYA 5JJLA 1R18A 3BSWA 5LMZA 3ER6A 5JCJD 1A7UA 4D5GA 1TW2A 4RFLA 4ZI7B 5EIXA 4MWZA 1SRQA 3STYA 1WULS 4FD3A 4B2YA 2GF9A 3OY7A 4X6UA 4ENRA 1YVUA 1S8NA 1Y3BE 1QZTA 2LP4Y 5LLTA 1SC4A 1NXSA 2TS1A 4N3NA 3RW9A 3EE6A 4L7QA 2IZ6A 3ZWOA 1OX5A 1E4OA 1JFFB 2WIFA 3U3ZA 1N8NA 2GHTA 1MJHA 2HDOA 3DZKA 1H8EA 3JQEA 4NDAA 4QULA 3VUFA 4CUZA 3Q8KA 4BQSA 2RD2A 2JBHA 3I6QA 1QE3A 3M7IA 3Q8WA 4KVAA 4Z1MD 3GRAA 2CCKA 1B8NA 1RZ3A 4WN9A 1Q20A 5HFNA 1JDUA 1ULSA 1PR2A 2XYRA 3H84A 4U9UA 4LDPA 3PQ2A 4IZIA 3DZHA 4RVGA 5FL7D 5JTTA 1CZUA 2JK0A 2AOTA 4OBWA 1TO2E 4I5IA 4W82A 4Q9IA 3TD6A 1Z2EA 3AX6A 3OLZA 5IYZA 1KQGA 2PUTA 4MKRA 3IMKA 4QYIB 1S3GA 1GT6A 3TTUA 4UAVA 5DH9A 5K3BA 3N8IA 2WWVD 2PL1A 1H69A 1DUVG 3K5HA 1H8ED 1PTJA 3HYTA 3WAGA 2JIOA 3KKOA 3WSWA 4A82A 2HPAA 2JH3A 2QUIA 3RJ5A 3SDSA 2EFDB 1B23P 3KYDA 1TZCA 3JXEA 3L7IA 3D5QA 1H23A 4MV6A 4BVBA 2DH5A 3D3KA 3IP7A 3E58A 3ODGA 5EINA 3GUYA 3Q15C 3SKXA 3UCEA 4FTWA 2R48A 5FNVA 2AKEA 4B0OA 1U2SA 1WW8A 3NDIA 4MRMB 3F71A 5JCOA 3NUGA 2I76A 3PWTA 2VNJA 4M9RA 3K9HA 3OMLA 4CM9D 3IAS1 4LF8B 5ERGB 5KOJB 1ZIDA 3I1IA 2X14A 1C9JA 4KXYA 3D6FA 5EY5B 1UJBA 5CXQA 1OWOA 1WB4A 2WVAA 3TB6A 4ZHQF 1Y4ZA 2KLBA 3OFSA 5KEIA 2JLCA 3CR8A 4JCOA 1KH1A 2MSNA 4KI7A 4LHSA 5DEOA 4LBVA 3VPHA 2PS0A 3QOFA 2FLWA 1RXSA 3KUXA 1RJ9A 1W4LA 1MJ5A 2ISCA