2HHLA

Crystal structure of the human small ctd phosphatase 3 isoform 1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
180
structure length
180
Chain Sequence
QVIPIPSPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CTD small phosphatase-like protein
publication title Structural genomics of protein phosphatases.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 180
sequence length 180
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2hhlA00
1LTQA 2WM8A 2G09A 4HAIA 1U2TA 4JB3A 3W5AA 5AM0A 3MN1A 2P9JA 3WKAA 1ZOLA 2P27A 3HYCA 4PNHA 1TJ4A 5AHXA 3UMCA 4YCMA 5AK6A 3QLEA 5AESA 3WGVA 4KNWA 4Y2SA 5A3QA 1ZRMA 3B8EA 1Q91A 3I28A 1FEZA 4L57A 3U7HB 3A1EA 5AM3A 3WKEA 5AW7A 4Y2PA 1Z4MA 3K1ZA 3OCWA 1Z4OA 3MC1A 4GIBA 2PR7A 1RMYA 1NNLA 1U2SA 2RAVA 4QQFA 4YH1A 3S6JA 4UW9A 3SKYA 1JUDA 2YN4A 4Y2XA 2O2XA 3GYGA 5ALTA 5ALSA 3KD3A 3E84A 2HCFA 3WK4A 3I1YA 3WKDA 3KDPA 3ZI4A 4B6JA 2HHLA 2B82A 3CZ4A 3QU5A 5AKZA 1TE2A 2NO5A 3KC2A 2RBKA 2YMLA 1VJ5A 2IOFA 5AVYA 2G07A 4NWIA 5ALZA 4UU1A 1WZCA 1RMQA 2I33A 3ZTWA 5AKXA 3AR6A 3EF1A 4FE3A 1QQ6A 2WHEA 2FPRA 2AGVA 2QLTA 2YMQA 5AK3A 3PGLA 5AKHA 3EPRA 2FEAA 2IOHA 4O8CA 4Y2YA 3L0CA 5AVSA 5AKYA 1L6RA 1ZD3A 4G9BA 3SF0A 3W5BA 3ET5A 2OYCA 3QU9A 3SLRA 2MU1A 5ALUA 1RLTA 4IG4A 2ZBEA 4HYTA 4YGYA 4L6AA 1YJ5A 4UM7A 5ALOA 4BX0A 5AM4A 4NABA 5AI0A 4EELA 4UAVA 4EX6A 2CN1A 2GHQA 3BWVA 3U7FB 2JGAA 2HOQA 3N5KA 1RDFA 4Y2VA 4KN8A 4RESA 3R4CA 2GMWA 4DFDA 2R8ZA 3NUQA 3AR9A 5IT0A 3FPSA 3N8GA 3NAMA 2IOFK 2RARA 5AW6A 1IWOA 3F9RA 3U26A 3HLTA 3WKCA 5AI4A 4HGPA 2B0CA 5ALWA 3WKBA 5AW9A 3FPBA 5AVWA 2WF9A 2C9MA 2B8JA 2WF7A 5AW4A 2IYEA 3D6JA 1U02A 3SMVA 2HSZA 3L1VA 1VFPA 1RKQA 3WK7A 1Z5GA 3M1YA 3J7TA 1QH9A 1Z5UA 2B30A 3U13A 5AW5A 1Z4JA 4CF3A 5AM5A 1QQ7A 4Y2UA 3MPOA 3NIWA 3QYPA 3ZX4A 4UASA 3SKXA 4J03A 3ZU6A 3IJ5A 4C4RA 1YNSA 2C4NA 1NRWA 4UMEA 3ONNA 2B8EA 5AK4A 2AH5A 3QNMA 3ZTYA 2BY4A 1Z88A 4HGOA 2R8EA 3EWIA 5AI6A 5ALEA 2EARA 1O08A 4UMDA 2ZXEA 1TJ3A 3ESQA 5ALPA 3A1DA 5AW1A 4HGRA 1WR8A 2YMMA 2JAWA 2B1RA 2ZOSA 4AS2A 5AKGA 5AIBA 3I6BA 4Y2TA 1L7NA 2VKQA 3AR3A 2G08A 1YMQA 5AKJA 1RKVA 3ZVMA 4MUMA 3L8FA 4YCLA 1Z4IA 2I6XA 3NASA 5ALJA 1RQLA 3ZUPA 5ALLA 4UATA 1RRCA 1TA0A 3ZX5A 2WFAA 3ZVNA 3AR5A 2R8XA 2PKEA 3IRUA 3L8GA 4KX3A 2IA5A 3ED5A 2G06A 2FPXA 1RLMA 2GFHA 4DWOA 4Y2QA 2WF8A 3PGVA 1QQ5A 1TJ5A 2CFTA 2ZBDA 5ALRA 2YJ5A 1L7OA 2HEGA 4G63A 3E8MA 2OA0A 3SHQA 3EF0A 2YJ4A 1U7PA 4BX3A 3WK5A 4E88A 1RLOA 2G0AA 1F5SA 1SWVA 5AKKA 1K1EA 3DDHA 4Y2JA 4QJBA 3VAYA 3QUCA 4OHFA 5ALNA 3UM9A 3AR8A 4XPZA 2G80A 1RPZA 1J97A 1PW5A 2AMYA 2I55A 4J2TA 3IB6A 3AR7A 3ESRA 3N28A 1O03A 5ALFA 2Q4RA 1Q92A 2YFYA 3B9BA 1LVHA 1KYTA 2FDRA 2ZG6A 4FYPA 5ALYA 3DNPA 2GO7A 2YJ3A 5AKEA 3WK6A 4RETA 5AI8A 4XQ0A 3ZWKA 2HI0A 5T41A 4EZEA 2WF5A 4BNDB 2C88A 2ZBGA 2JAUA 3OTQA 4AP9A 1L8OA 4JDPA 5A3SA 3UMGA 4OD0A 5ALIA 3B9RA 3BA6A 5FP0A 3KBBA 3ZW7A 4EX7A 4ZEVA 5AVRA 3AR2A 2GHTA 4NFLA 3E58A 4I9FA 5IT4A 4DW8A 2Q5EA 5A3RA 3OCVA 5AW2A 5ALHA 2QYHA 3PCTA 5ALDA 1CQZA 1EK2A 5AVTA 5AVVA 2MSNA 2YMPA 3ET4A 2FUEA 4Y2RA 3SD7A 3U7EB 2JARA 4YCNA 1WPGA 2AUTA 2I54A 3FVVA 4FFDA 2HF2A 2W4MA 4L6CA 2NYVA 1AQ6A 4BYGA 1ZD2P 3CNHA 3WGUA 1SU4A 2YY6A 3NALA 3L8EA 4CE6A 5AVZA 3QU7A 2C8LA 2W11A 3L0YA 1ZRNA 3QXGA 4F71A 3OCXA 2JAOA 4KNVA 2BDEA 1N8NA 2CFRA 2Q4TA 1XP5A 3QUQA 4AS3A 4UM5A 3FM9A 3P96A 4HGQA 3E81A 3FGOA 5AVXA 1CR6A 2BDUA 3A3YA 3NRJA 3DAOA 1NF2A 3W5CA 3QUTA 3RF6A 3QX7A 4Y3UA 1ZJJA 3L0BA 4UMFA 4UMVA 5AW3A 1YV9A 5AI5A 3UMBA 1YS9A 5ALQA 3TLMA 4I9GA 2PQ0A 3OCZA 2I7DA 3W5DA 4OCZA 4NV0A 3NANA 4UAUA 3RFUA 1U7OA 4IFTA 2FI1A 5AVUA 2NO4A 1Z4PX 1S8OA 2C8KA 1S2OA 4BKMA 4BBJA 3WK9A 3U19A 2B1QA 1VJRA 4BX2A 2YBDA 5AW8A 5ALGA 3L8HA 2HO4A 1RKUA 1L7PA 4ZEXA 4F72A 3U7GA 5ALMA 4EENA 1L7MA 2DQSA 4YIHA 2YJ6A 4HGNA 3M9LA 4EEKA 2R8YA 3QU4A 5AK5A 1RC8A 3OCUA 4KYTA 1N9KA 2RB5A 1ZD4A 5ALXA 3N1UA 4ZEWA 1MH9A 4MWOA 1XPJA 1T5SA 2W43A 3L5KA 4BEWA 3I76A 3QGMA 1Z4LA 2O9JA 2ODAA 3WK8A 3OPXA 4CNQA 2WF6A 2HX1A 5AI9A 4XOUA 3R9KA 5IS2A 2D2VA 2OBBA 4C4TA 4CF4A 1Z4QA 1XVIA 5AICA 5AKIA 1EK1A 4XE5A 5ALKA 4UARA 3KZXA 3A1CA 3FZQA 3L7YA 5AM1A 4NAVA 5AM2A 1RQNA 2FUCA 4GXTA 4UU0A 1X42A 2CFSA 3KOOA 5AKLA 5AIAA 3PDWA 4OFZA 3ZVLA 5ALVA 3QUBA 4CF5A 4DCCA 2I34A 2EATA 5E0OA 2OM6A 2G1AA 3R09A 2FPWA 3L1UA 4BNDA 1J8DA 2HDOA 2P69A 2ZBFA 5AW0A 2X4DA 1Z4NA 2FPUA 5JJBA 3DV9A 3MMZA 1T9ZA 3AR4A 3QU2A 4YIKA 4KX5A 3N07A 1ZD5A 1WVIA 1Y8AA 2P11A 1YDFA 1Z4KA 2EAUA 4C4SA 3OCYA 1L8LA 5AVQA 4BEVA 4H1WA 1RMTA 3ZWDA 2FPSA 1SWWA 1ZS9A 2HF7A 1QYIA 1T5TA
chains in the Genus database with same CATH superfamily
3S99A 1PWYE 1QZ3A 2V7UA 3F8TA 3M4NA 2EW2A 5KX5F 4CR8A 4LYEA 1V5IA 3WMWA 4I4TF 4H7EA 3BFPA 3VQTA 1QU2A 3ZCSA 2FSUA 4CKZA 4GKVA 5KVAA 3MS4A 1NYQA 1T24A 1AN9A 2OZVA 2UU9B 2WVHA 2XQVA 4GYKA 1G19A 1W93A 1TGYA 1DRKA 1FZTA 1DLIA 1P2BA 1NPTO 2LPMA 9ATCA 2WOOA 3UOGA 2LD4A 5ER6A 1IZ8A 3IV9A 3I5MA 2CVZA 2IC5A 3Q3HA 1E5LA 3S3TA 3E4CA 4BLQA 4OREX 2YNMD 5IDQA 1XKQA 5IVIA 4YXWA 1C3VA 1SVMA 2TSYB 5JCPA 1NN5A 2GM5A 2WKRA 4WECA 2G17A 4BGDA 4LSZA 1NIJA 3N2LA 2H2GA 2QDXA 3HKCA 4IJUA 3Q72A 2HRCA 5DM1A 4BMPB 1DIBA 4Z9BA 3ZDZB 1I30A 5JSHA 1IB0A 1XEXA 2EDAA 2KBEA 1O87A 4IUYA 3SKYA 1K3TA 2GSDA 4CG0A 2WPDA 3CH4B 4ZD6A 1YUNA 3ZJUA 1II0A 1FS5A 1Q1AA 1ZM2A 2O2XA 1VL2A 3B5JA 3Q8WA 3C8HA 3VZPA 4JLKA 5ALSA 1M9NA 1DIOB 3K9CA 3C8MA 4X7MA 4G5GA 4UVGA 3QPBA 4Y9RA 3D5TA 1L5GB 3NKLA 4UUAA 1E2KA 4GH5A 2FSGA 4LQCA 4MS3A 1AKUA 2GJ9A 3QU5A 5AKZA 1ZJWA 3VR5A 3MCZA 4XQ9A 1VJDA 2IU6A 4G5YA 4ZVPA 3ORHA 3PQ3A 1NF3A 1VJ5A 3PNQA 2QMEA 3NKFA 1MRZA 2CMDA 2WJJA 4RXMA 1WZCA 4N41A 2D8AA 3M6MD 3MINA 2FDCA 2C58A 2NVUB 5AKXA 3D8SA 4WGGA 3R7WB 4D79A 4DV4B 2X9VA 4CGZA 2NADA 3NWOA 1MVOA 3KJIA 4GEKA 4HAVA 4NJOA 5K0EA 1P1CA 3HYTA 2QYSA 1NPDA 1Y4UA 2QLTA 2C1ZA 3A4LA 3LBHA 3MJ4A 3CX7A 4OQYA 1EZ4A 1WDTA 2H29A 3NG1A 1ARZA 3KVYA 2OKGA 2O2GA 4EY8A 1CZRA 1I0LA 4GW3A 4YC7A 2OQIA 1XZCA 4BNKA 5EERA 1SKUA 3QUAA 5BN3B 3TFQA 1Y48E 3DZHA 2EBUA 3K9BA 3R5HA 2ONZA 1T43A 1XWWA 2YJZA 1R9MA 2QGZA 3OQVA 2FE4A 1RLTA 4FLFA 2IGBA 2ZBEA 4AZSA 2YFHA 3G23A 1M34E 4EI7A 1MOPA 3HO1A 4NABA 1P5JA 1DO8A 1Y37A 1WKVA 3ROZA 4MHTA 1JEDA 2VXYA 1VB3A 4ZI7B 3U56A 3PVZA 4NEGA 5ITVA 2AI1A 1TD1A 1SD5A 3KTFA 2ZYDA 2Q3BA 5B2ZA 1RWOA 2P6PA 2X2OA 4COOA 3LDFA 1CIVA 2CEAA 1E7YA 3MLAA 1NSTA 4NNPA 4PQGA 1T5IA 2V3CC 2J9RA 1RAHA 3A04A 3EEOA 3A26A 3IC5A 1DS6A 5DYGA 4ZT6A 3NUQA 1KQNA 4BVJA 2O0JA 4JHLA 4C7JA 4P4SB 4DE5A 1SKYE 4TKUA 1N3IA 2HLDA 1Z3CA 2FP3A 1XPOA 5J23A 3FETA 5M5BA 4F11A 1Q6ZA 3KOWA 3E7WA 1VGVA 6GPBA 4KQKA 1NBME 1W30A 1H4TA 1CZNA 3CIFA 1LNSA 3GYBA 4G37A 2C9MA 2B8JA 3RTAA 1E1NA 4QLAA 2ZR9A 1TIBA 1XVAA 4EHHA 2XLBA 2PLNA 2CC2A 4MRNA 4PBTA 3FOCA 3H5AA 4HNRA 4YMHA 1EI9A 5JD6A 4U0KA 1U3CA 2R1ZA 2R6ZA 2B30A 2J33A 3ISTA 2FH5B 3PNYA 4ZVTA 3D3QA 4H59A 2BLNA 4YMLA 2NN3C 4URYR 3FUVA 2JCBA 5TMPA 1ZUNA 3T1TA 2R9VA 3EXHA 3OWOA 4OLAA 2GZMA 2AR0A 4KQMA 2OBNA 2IUFA 2C7RA 2ZZKA 1R00A 4UNIA 3Q12A 1PVOA 3B20A 4EQ6B 2OMEA 1QC5B 3FXAA 1L1RA 3RGWS 2AI3A 4RCVA 1F06A 1NRWA 2OBFA 3SQDA 1KO4A 3KR0A 1Q6YA 4TWAA 3DE4X 4JLNA 5EUBA 1GTJ1 3MIZA 2FETA 3SR0A 1KEPA 1QRDA 4C29A 3P2MA 1T6BY 1N6KA 2XUPA 3UHFA 2ZXEA 1QH1B 1E6CA 5KSPA 2OXRA 3DVRX 4EKDA 1BFUA 2XUAA 5H16A 5JNUA 3C1AA 1RJEA 1H4VB 2P6OA 3DAPA 5LXTB 5LP6B 2PIAA 3BE8A 2J3KA 2FOIA 3GPLA 1FU7A 4AI6A 1Z12A 1G5RA 3FNHA 4U2FA 3L84A 3WTBA 1QP4A 1BOOA 1YMQA 5JNWA 1HYHA 1UF9A 2OOSA 3DBIA 3EUFA 4U7FA 3OM8A 5F5NA 5DE3A 3MWFA 5SY4A 1KEVA 2P1RA 4RC9A 1MB0A 5I7AA 2AG6A 4D0GA 2X23A 2AMVA 3U3DA 3IDSA 3O0DA 1NUUA 1T5LA 3AM4A 1J42A 3P9XA 1X80A 8ABPA 1FMFA 4KI7A 1R3DA 4KODA 4XWAA 3NHZA 1HTWA 3VVLA 2B7CA 3DBOB 5ARCA 4BZWA 1THZA 1P61B 3ZXXA 1SQ0A 5EJEA 1E1CA 3LPCA 1WSAA 5CW2A 2GFHA 1VL0A 2VPYA 1JG6A 2QR2A 4F12A 4RZ3A 1BCRA 1FSSA 3HMKA 1UBLS 4K26A 4Y2QA 1KO7A 5DTRA 4WBNB 1RW4A 2GBPA 1YZLA 1E3EA 1QGED 2JD0A 3L1HA 1G3UA 1IH8A 1NLZA 2PUHA 1K7SN 1X70A 1ZICA 2XQJA 1L4MA 4IEIA 1YNOA 3VC2A 4D9KA 5B3JA 4F45A 6ABPA 1BS9A 4CLXA 1E9DA 4K9LA 4M9UA 4ENPA 2HA7A 3EXFB 4WXMA 2SKDA 3D7LA 4YMWA 5MN4A 2PMEA 3HXOA 3INTA 2JLYA 3OE1A 1EQ2A 3BMCA 4TTIA 5LMCA 4K9SA 2WWIA 3GVCA 4B4OA 2AWOA 1XAHA 1JBKA 1HEIA 4JYAB 5D84A 2HHHB 3DZKA 3ELYA 2ZEJA 1EWVA 3GCDA 5EP3A 5JY6A 1CUGA 3E9QA 3HJCA 4QUKA 3E18A 3W6PA 4Q21A 2DWPA 1ESMA 3JAKA 3K5HA 2H5LA 3TE6A 5L7YA 4XM2A 4JA2A 3JARA 2V6BA 4JFRA 5CPBA 4M0MA 1RPZA 1R4ZA 1JXOA 3KJXA 3PPYA 4IQGA 2I7VA 1ZN7A 3H5VA 3CZ9A 4NMWA 4E5KA 2FPPB 1KBZA 3QRWA 4DPMA 2CLLB 3L4SO 5ERYA 3WGYA 2IW3A 2JIQA 2Q0HA 3FCYA 4N8EA 1DRWA 3N5CA 4YP5A 3ILYA 4YAOA 1GTRA 3KCQA 3I9JA 2WD8A 4HVLA 1U4NA 3LLMA 4R68A 1RAFA 2PMFA 2P4EA 3TL2A 3BSFA 4ZPXA 5EJIA 2NUBA 3FTCA 2O5CA 3QQ5A 1U4SA 2VPIA 2J9FA 4N0DA 5FX2A 4XQ0A 1TCVA 4TMYA 1MQSA 3WRXC 4R9RA 4EB0A 3AVUA 1EFVB 5L3RA 1JLLA 1LQTA 2HQBA 4ZVVA 4RV5A 2BR5A 4UEOA 3UMGA 1K08A 4BC0A 2WA2A 3MMPA 2CHFA 2JKYA 3HE3A 2BOVA 3VHLB 3ZXIA 3FBWA 3ZW8A 5B2EA 3LCVB 4FNGA 3MLBA 3AVTA 4BWVA 3M6WA 3KBBA 3URMA 3HN7A 4DIKA 2P4HX 5HR5A 4ZEVA 3FMIA 2UYCA 1NR7A 2ZI6A 1DWUA 1YS7A 3HBAA 2JI9A 3H84A 2XOXA 3VZDA 4IXWA 4UTZA 3NO4A 1W1UA 3OZRA 3WIVA 5TPWB 1OU0A 3ZHTA 3OVMA 2JATA 1Z82A 3NJ8A 4M87A 2GWHA 4KOEC 4UJ3A 1M6EX 4LPSA 1T8YA 1AF7A 4A0HA 1E2QA 3TR0A 3LC1O 3ANSA 4B81A 2XB8A 1MRNA 1BJTA 4YCNA 1SXPA 2X8JA 1CZOA 3LUCA 1N33B 5H4GA 3QVMA 2DR2A 1U5CA 2ZUBA 4J94A 2AMLA 4IYJA 3RBXA 1E1YA 2X4GA 1C7JA 4JZKA 3OT1B 2CVFA 4MEAA 2QR5A 5INTA 1T8PA 1OFGA 2IXTA 1TA4A 3NALA 2F48A 3AESB 2X2EA 4CE6A 3U44B 1EVYA 1JR3D 2O3TA 3WS7A 3ZJ5A 2GYYA 3IUYA 4NFHA 2H18A 4EHBA 3WZLA 3BVPA 1DAKA 1FVFA 5JTUA 6CHYA 2O48X 1YJXA 4ZIRB 3LWZA 4ACBA 4E1VA 4DNOA 1UBNA 3NHLA 2UXBB 2ZS8A 3IO3A 1UK8A 1SG0A 1WXEA 3FBGA 1PYOA 2A86A 3C48A 4E11A 4JJGA 5C46F 5JZ9A 2W90A 5D3MA 4MYSA 3VH3A 2ZDHA 5FNVB 3ZJYA 1T1IA 2IPMA 3RKSA 2Q6VA 3SM9A 1YQDA 1M7GA 3GJSA 4LY3A 3TPZA 3VTKA 4EZBA 3ZE6A 4PPQA 5KYNA 1GTL1 3WO1A 4BUJA 3U09A 1WB6A 2KYRA 2BTEA 4NCHA 4KAJA 5AJTA 4C9BA 1Z35A 4RGQA 4ABTA 5AK0A 5MGBA 1U99A 13PKA 1TZJA 3HN6A 3QX7A 4NOMA 3RJZA 3ND5A 3WMGA 3WDKA 4OGWA 1DZ3A 1PR3A 2JFPA 3UJ9A 4NFSA 3JWJA 4CL3A 3DW3X 4HX5A 3K15A 5HG0A 2CKDA 4UMVA 1E8NA 3AKDA 1UBTS 1TTQB 2R3SA 3LUPA 3RE1A 3PXAA 3I6YA 5K09A 3IEPA 3RJ5A 4JGIA 2B2CA 4J16C 2NVWA 5B57C 4G8BA 2FU5C 1HT3A 1IXYA 2XA1A 3QTBA 3X2EA 2WWFA 3T5AA 1FFXA 4R1NA 3V9AA 4KR0A 1AIPA 1Y1TA 2BVNA 1G18A 2GPSA 3QITA 4NF2A 4OVKA 4NYMR 1MW9X 3O9ZA 4IIHA 1V43A 4ZRMA 2NO4A 3PRYA 2OKCA 3PWSA 3VR0A 2AS0A 3FMPB 4WFIA 1IEXA 1M83A 2VH1A 3EZNA 4IXMA 5AHKA 5HJ2A 3ROTA 3VYTB 2QTFA 2WD7A 5JQGF 3DZGA 4K2HA 3IKJA 3D2CA 5A6VA 4JAVC 5A4AA 2RH5A 5HK8A 1GR0A 4DSNA 3L6RA 1U5BA 2PV0A 4ZVLA 4W1QA 3LHDA 1VIYA 3EOZA 3DFKA 4ZMSA 1ZH0A 1QZXA 1RIFA 2C8VA 1W36D 4YIHA 5GOTA 1X8JA 4RTKA 4JI3B 3GEIA 3T7KA 1M8KA 4BUZA 5JLJA 3VA7A 4WL0A 2XMQA 3F5SA 4NYJR 1MB4A 4KAAA 2O3QA 4GBGA 2PSJA 4L3VA 3GMSA 4Z8XA 1K4YA 2D4HA 3DFUA 2I4RA 3EN0A 4F38A 1W47A 4NBVA 2B8TA 3N1UA 3C4QA 1H6BA 4NENA 4MWOA 4B4UA 4TROA 2VAXA 4Z0PA 1T5SA 1WEHA 3A4TA 3OE4A 5B4VA 2FUKA 2A5JA 1SJ9A 4PIPA 4KAFA 1DKPA 1NRXA 4G1CA 4I3FA 4J7XA 5AI9A 3S8MA 4CNQA 4CKCA 3OM9A 1KZYC 4ZAWA 2BBWA 1V25A 2KW5A 3OQPA 2B69A 5E4JA 1TZCA 1QHHB 4DA9A 2IF2A 2ZIAA 3MXOA 3DFIA 4XE5A 2I4IA 1U0EA 2B8NA 3GU3A 1F7VA 1ECPA 3ADCA 3RUDA 1XZLA 3UJ6A 2X9NA 2OD7A 1EMDA 4D9EA 3D7NA 4UDOA 1JPJA 2A92A 3PHCA 4NLLA 4OP1A 5I8ZA 1IQRA 4LZZA 3KBOA 2GCGA 4PSVA 3O8BA 4B6SA 1PGPA 5C8YB 5IYZA 2CV1A 5ALVA 4YPFA 5I9LA 1VZ3A 4US0R 1KZ7B 3LAWA 2W93A 5LN1A 1G2OA 1YE3A 2OM6A 3VNRA 4QGFA 1GN9A 2W9XA 5CHEA 4ZZ1A 1YRHA 2AZDA 3L1UA 3E23A 3TOZA 3CTMA 1QB8A 2W6PA 4X6UA 3T7SA 5J2UF 4FEEA 3I9V1 3GDHA 1DDOA 3O3OB 4AX8A 2VTVA 2OL4A 4C14A 3OA2A 4L8WB 4N5IX 2NSLA 3WNDA 1F6BA 3DYIA 3OE7D 5J4VA 1P7WA 5JSKA 4GGPA 2IDZA 4ZYLA 3K0FB 3EYWA 2F9LA 2VXBA 2G76A 2A33A 1EHYA 2WU8A 3G85A 3L49A 1NSYA 3G2OA 4D98A 4H31A 2F4NA 4GLJA 5DVZA 3VSDA 5F2EA 4CQMD 3PUIA 3RWOA 1PVVA 1GCGA 1LC3A 1IB6A 4PSKA 3KZNA 4PANA 4IHKA 2H5EA 1AKRA 4W82A 3K0EA 2C7QA 5GJBA 3L6DA 1OIWA 4MRMB 3H0CA 3Q9SA 4Z3DA 3CVWA 1UAAA 1JMKC 1YZNA 3L06A 2O54A 1QDLB 2IYAA 1U7TA 4G56A 3RRYA 3DC2A 3KXKA 3Q11A 1ORDA 2VJLA 1VPEA 4INAA 4WXHA 3I04M 4LJYA 1C9JA 3C74A 1MJFA 3S2IA 3VO8A 2FPGA 1RM0A 4YXWD 1QHGA 3ZWWA 4LCBA 4MUBA 1VPLA 3N2KA 4CDRA 2P3QA 3QLUA 1BD4A 2GF9A 2ODNA 4YCMA 4HGZA 1AURA 4EPTA 1V16A 1G8MA 5AESA 5E3IA 2DPLA 3UMFA 2Z1NA 1F2VA 2ZSFA 5DRTA 2AOUA 3EGDA 2WPDD 1A7AA 1S5PA 4QVIA 1TAQA 3H4IA 2Z5GA 1VLLA 5HOEA 3AV0B 4HDMA 3W3ZB 2I76A 1B15A 4A6EA 1P74A 3RANA 3K96A 1R10A 3FTDA 2ZP1A 4LXYA 3V2UA 4UCWA 3U80A 1L9XA 5JCJD 1J9GA 1IDOA 2XMPA 3H6KA 3KXPA 4YJ2B 5IMBA 5BNTA 3ER9A 4MV9A 3AF3A 4DS3A 1XI2A 1XMJA 1UBCA 2WUVA 5EZ6B 5T3UA 1BXRB 1EXWA 3ISJA 2LKDA 3LH5A 3CUSA 4NAHA 4NV3A 1YQWA 3PVCA 1WUTA 1IBLB 3CGGA 2CDAA 1JEEA 4IGIA 3A1FA 3EJ6A 4IDGA 3G49A 3HBFA 4MV4A 1XVUA 4D0RA 4BFWA 2HNAA 2TYSB 5TGZA 4OV6B 5H70A 3U1TA 1BQ4A 1K3UB 3EQ2A 1TVCA 4I4CA 4K03A 4KGDA 5ECDA 3WKDA 2PU7A 4QFDA 3ZYCA 3A4VA 5EHIA 2I3DA 3L7JA 2SECE 3MGAA 3QEOA 3A7DA 4AQDA 2Z3WA 4FE4A 1Z2DA 2PX0A 2RBKA 1N5IA 3T9BA 1E2MA 2VZ9A 1WSBA 4OM8A 3T4XA 1NUSA 2AQHA 2P75A 4B4KA 1FSZA 4UU1A 2C98A 1B1CA 1F2UB 1JB9A 3KB8A 2XCSB 4FE3A 5JANA 2W00A 2XGOA 4WMLA 1UMCB 4QTYA 3QFFA 4ITUA 4MK4A 3GXBA 1Y8QA 3H1GA 2HA4A 3GT3A 4TXHA 1T5OA 2P78A 3CURA 3DMGA 2APJA 3PGLA 4L1KA 3C39A 3G79A 4QVGA 2M6LA 2AX4A 4RD6A 1P0IA 4Q3LA 1UJBA 2WE7A 1JIJA 4NH4A 4MINA 1QORA 2Y1GA 3HI6A 5CDSA 4ETIA 1N5OX 4O2BA 4ARSA 2CJWA 1WQ3A 3I9KA 3DOHA 1NTRA 3ET5A 1QKKA 3FKSA 3Q4GA 2FWBA 2AFRA 3JZMA 5EJ6A 5JYCA 1BO6A 4LX0A 2JIOA 1T35A 4OB6A 1GO2A 4GYYA 4TTQA 2Q0XA 4XQEA 3U7QA 1EVQA 1HO3A 3E53A 4IG4A 2RH4A 4QREA 1YJCA 4YRJA 3HH8A 2D3TA 4KOAA 2I66A 4BX0A 5JRZA 1D2GA 1NVEA 2HLDD 4QO7A 1JR4A 3NWEA 3AHEA 4L7QA 4QELA 3KHSA 3P4UA 5AI0A 1NW8A 5AJYA 5KMGB 2G3YA 4QEDA 3J81A 1TW2A 3AI1A 1LWOA 3DEFA 2ZYIA 3VMFA 1Y9DA 1OILA 2IE8A 1A5ZA 2GPBA 4W1PA 1JNYA 1ZM3A 1G8AA 1LV8A 1PJBA 1S7CA 5LDGA 5SYAA 4A10A 1E5DA 1QG4A 4PYKA 1P0CA 2V4MA 1LPPA 2BWJA 3X44A 2ZT5A 2BIFA 4XTRA 3U4IA 4F0JA 9ABPA 1LSOA 2Y1XA 1R1DA 2DXIA 1CQIB 1TQ8A 4B80A 3NT2A 4WOPA 2CUZA 1IUOA 1W2WB 3L0PA 5ESDA 1NI4A 1NDHA 5K0BA 1JQ3A 3FPBA 4YAGA 2FCRA 2A9PA 2WM3A 4GVPA 1ZEMA 1NJSA 2HCTA 3H8WA 3RQSA 4ZO8A 5LQUA 1SR8A 1WP4A 1W9MA 1IHXA 1U02A 3M70A 1NNUA 2ILVA 2UDPA 5J2TF 1KPGA 4IKEA 2CUKA 1HG1A 2FOLA 1Z5UA 2UZ0A 1DC4A 4OO3A 1MMFB 1GSOA 2C4MA 4R1PA 1RU3A 5AW5A 3UATA 4YA6A 3SMQA 4ZAYA 4DZZA 1QQ7A 4W8GA 5K2MA 1THGA 5A5GA 1HFEL 4CMEC 1SUIA 3EDCA 4UDNA 4UASA 5JEDA 1QMGA 4KR7A 3UIEA 1XGKA 4B3GA 3HDQA 3ZTTA 2FGKA 4HHEA 1YVPA 1T8TA 5JJ5A 3D31A 4MB0A 1WHSA 3DV0B 3IJPA 1YJAA 1ZH8A 2FQQA 5KNDA 3IL2A 1Z45A 2BSXA 1YULA 2R2GA 3BPSA 1M66A 1TC2A 1VFNA 2IXDA 3NORA 5BQPA 5K6AC 2BY4A 1S7GA 3TMKA 2E1PA 4IIGA 4BLVA 1N0WA 2FYTA 5AWFC 2EGHA 2DVMA 1UJ5A 3KTAA 4I2VA 5CVEA 2RGRA 4RA6A 2Y1LA 2IEYA 4P83A 3NWBA 621PA 2ODEA 1JA1A 5B1DA 3H83A 2FUNB 3HZHA 3OIYA 2WWWA 2IPOA 3I6BA 4I6GA 5DU2A 3ZCQA 2V59A 1PS8A 3H5OA 1AK2A 4NCBA 3U5ZB 1UP6A 5EGSA 2IJGX 2O8DB 2ZIVB 4BRSA 1K0FA 3PF8A 1YZ3A 3O4FA 2P35A 4KV7A 3PQ5A 4EKGA 3ZNQA 5BW6B 1HE1C 1DHTA 3HWX1 4H7IA 3S1LA 4ARVA 1KAGA 4RV9A 5AOVA 2V1UA 4DF3A 3FH0A 5U4XA 3EDRA 3UWOA 3FSJX 4PWZA 3EZXA 1R6VA 3PA8A 4IIBA 1PNRA 1K63A 2CLDX 3G8CA 2PD4A 5A02A 3ED5A 4IFIA 1JA0A 5FPTA 5DBIA 1VJGA 3TUJC 3CR7A 4TS1A 3FFXA 1V7PC 1V2HE 4UUPA 2PSDA 2ZRNA 4K6KA 1SXIA 5IJAA 4EWLA 7REQB 5J3JA 2OHVA 5BSMA 3SF8A 4UBJA 1C1DA 3CUWA 1W94A 2OYSA 3O8CA 4M1KA 1E3DA 1WDWB 2ZZMA 2QI9F 5FOWA 3WRXA 4DCMA 4B9AA 4NE2A 1UJNA 2I9PA 2POQX 5KTNA 1Q20A 4URZR 1T0JB 5CD1A 4LYHA 4E2ZA 4KPGA 1VKRA 1XXLA 4KQFA 1REQA 1A77A 4YPVA 1P5ZB 2HRZA 4ZMRA 3ONEA 4JCCA 3ANNA 5KYWB 4BB6A 1F5SA 7YASA 4IG9A 3TNLA 1SVNA 1NLFA 1JIXA 1XD9A 2AR7A 2FX2A 4NZYA 5K0GA 3T1VA 3ETGA 4ALLA 4AY3A 1CUCA 2AYXA 1P0QA 4WT7A 5LQCA 4IO0A 3OZDA 4D9GA 2F3UA 2YR0A 3AIMA 4CM8B 4UTNA 4NU8X 2QUIA 1X1SA 1ZRHA 3NB0A 3QJ5A 4FQ5A 4JL5A 2R00C 4F9EA 3DW1X 1SCKA 4NBWA 3VNSA 1PP4A 1F14A 2BFFA 1IVYA 4BDSA 4BFYA 3RT1A 3GEMA 1U7XA 8ATCA 3PQ8A 2A5GA 2FPIB 2QE6A 3R24A 2FDRA 5I3ZA 1T4GA 1QHXA 4JH0A 2QRKA 1G3IA 1P80A 2C9OA 3UOAB 4UVDA 3V80A 2QTHA 4KDEA 1N7HA 1FL9A 1KRHA 1XAIA 2CDRA 1N6NA 1JWBB 5JYEA 3WHIA 3AUXA 1OTHA 2I6GA 2O2IA 3K1AA 2GEFA 3O90A 5KC9A 1GNSA 4RK6A 4E5PA 1CDZA 1UBMS 2ZBGA 3BGOS 3GGSA 4KH1A 1UDBA 4MWEA 4RK5A 4UCQA 1U6IA 1KERA 3BEDA 3PK0A 2FQYA 1B3RA 2I4TA 3SE7A 3EZ6A 3C6KA 4JUDX 1UMBB 1GGMA 1KP2A 3B9RA 4P82A 4F60A 2L17A 4LW8A 1JBEA 5JRJA 3CS3A 5EKDA 2HR1A 3IQHX 1CNEA 1Q7BA 2W2PA 5HJ7A 4GSLA 5KNCH 4LE2A 2QU7A 1LC0A 4R3WA 1KC1A 1CF4A 1ILWA 5DM70 1AXGA 1TI7A 4I9FA 3ECCA 2HJSA 3UMRA 5ILOA 2L0XA 1PZNA 2VHXA 3L0IB 1PLKA 1LLFA 4O4HB 1R0BA 3MFQA 1YI0A 3RGGA 2AE1A 4B4DA 4RTOA 5CP8A 3F1LA 5M34A 3ZWXA 1K4KA 3JWGA 4KQ6A 3RYIB 2QLFA 4E94A 3RAFC 5LMNB 2Q5JA 3EQ9A 3SQXA 3GZTB 2HJGA 5MHTA 1FDSA 5SYNA 5IANA 4M22A 1PE0A 4G0PA 4MQ4A 3OD1A 4M0CA 4D9NA 3HVJA 2EKDA 4H6WA 1ULAA 3FCSB 4Q37A 4UUNA 4J16A 3BXEA 1WMEA 1BMFA 2UZAA 5JVDB 1CDEA 2YV3A 3AHDA 3CNHA 3VPFA 1O97D 1FDUA 4XUCA 1XXHB 2A1UB 1CY8A 4AJ1A 2FMKA 4F2WA 5JYDA 1QB7A 1UDWA 4I1IA 4C88A 3EBPA 4W5QA 2JGEA 2VHVA 3LWNA 3GBVA 1TZMA 1KYXA 4NH0A 2XBUA 4A7PA 2H4JA 3B48A 2W4IA 4TYYA 5HTOA 4QATA 4KE9A 1N8NA 1ODFA 1BSVA 3AXSA 3C5VA 1R0KA 2BMEA 4FFRA 3VGJA 3ND8A 1XQVA 2CDCA 3IEUA 4HS4A 4IM7A 4U7GA 4B48A 3BMQB 4AQYB 4KWCA 2YZGA 1CJUC 3KALA 1U65A 2HLHA 4HGQA 4OKIA 1PEDA 1GV0A 3LLUA 2RONA 1WD7A 2XKAA 2I03A 1NF2A 1FTYA 1L5YA 4AUMA 1ID8A 3RF6A 4YUXA 3LGXA 5F2NA 3QMMA 2GXSA 4CTOA 3RC1A 4PLHA 2Z8XA 1WF6A 4QHSA 4RAOA 4B3FX 5HQ3A 4ERXA 1CE8A 3REOA 2D5AA 3UEOA 4HNVA 1W0CA 4CLRB 3AHIA 4PLYA 4X61A 2QX7A 1O8BA 3TWOA 4RFSA 5F3RA 1HV8A 3ZGNA 1DO0A 4X6XA 4BMVA 2JHAA 4QNRA 3VPXA 1COZA 4OCZA 4QKQA 1Q7CA 1U4OA 4P4NA 5IH3A 3UC5A 2R6DA 1XDUA 4PZAA 2NG1A 4JELA 2QXYA 4ISBA 5FUBA 2GCNA 3EMKA 5A9TA 1AHNA 2RGDA 4NECA 4EHJA 4LBZA 3BRWA 1KKMA 2YC4C 4RJKA 1L5HB 2I2XB 2FW1A 3R6TA 4JBYA 2GTHA 4L02A 4N5MA 2WSSD 4O25A 3VDMA 2EZUA 2O1SA 2C8KA 5DGDA 2PH3A 3WK9A 4CDMA 4WCFB 1WUKS 1Y1QA 2XCIA 4CHTA 1U3GA 3P2IA 2XNDA 4MS1A 2ZYVX 1IUKA 4V1CA 1I3LA 4P34A 2YIDA 3T4EA 4NIMA 4QXMA 3JZFA 4U2KA 4KXYA 3JZAA 3MTIA 5DHAA 3SXUB 4TS9A 3TLZA 4BLWA 4YRRA 4KE7A 3NFYA 2QNIA 3JAMA 2ZRPA 1LI5A 1L7MA 1NVVR 3MCWA 4W7SA 3U6KA 4G5RA 4LNAA 2UZ1A 4P7JA 3GFSA 4WKGA 1J24A 4EGCB 5D5HA 4UJ5A 2BTOA 1NHGA 4HP8A 2ACWA 2ZIFA 4JJZA 5DCLA 3DGEC 2DY0A 2ZPAA 3IOEA 2O4UX 1TF2A 1F6WA 2PX3A 3W4KA 2W2KB 3BCRA 1J5XA 4B43A 5B6PA 4KRFA 1KQOA 4IILA 4N3GA 1TFUA 3MA0A 5FNZA 3D6TB 2YZ2A 1F2TB 4GC5A 2AW3A 2R8RA 2QG9A 4ND3A 3DTVA 4L72A 4KSCA 4RPLA 1OJ7A 1Z4LA 4EYKA 2O9JA 4D26A 4NPAA 3OT5A 5HPYB 1BE8A 4XOUA 4MB2A 2JGMA 5ER9A 1YZFA 1M1YB 1CUFA 3MT7A 3ZD6A 1N5DA 5CBPA 1V37A 4OKSA 2RI6A 1YA6A 2IH5A 2YWHA 4PC1A 1QQAA 1A4UA 3IVGA 3R6GA 4IRUB 1RXIA 1VSUA 3EFHA 4IWXA 5DHPA 5ALKA 2A5FA 2J3EA 4TTPA 4QODA 1G60A 4Q1EA 1KI6B 1SC3A 3U2QA 1D2HA 1D9ZA 3NKVA 4ZVSA 4KK4A 3V8BA 4CKBA 5MFZA 5K6RA 4PZDA 4AP6A 1Q22A 1YR2A 2F1OA 4R1QA 1D04A 3O1LA 5B1HA 2HQ1A 4D99A 2BL4A 2EQAA 4MH0R 4KPUB 3RASA 2XE7A 1BROA 4I1RA 4K6HA 4MZXA 2O0LA 3ICVA 4R0NA 4DCNA 2XMDA 5FI5A 1ENPA 2DC1A 3MJRA 4GO1A 3BE5A 3IT3A 4P7BA 3C7DB 4HAUA 3JRXA 1X2EA 2OG2A 1B14A 4Q9HA 3C5EA 3LSTA 4XD7D 3OZAA 4OFXA 1ZH2A 3I8SA 3HTXA 3D6AA 2B25A 3PIDA 4TSRA 1LSJA 1ONNA 1W52X 5ELXA 3PFBA 1BTOA 1U9CA 4ZT3A 3WMXA 4M7RA 4LJ7A 1U8ZA 3MMZA 1ZOPA 3KXDA 2YIMA 4EHIA 3QU2A 5JC8A 2G9ZA 1MORA 1PFUA 3KUCA 4HBGA 4YJHA 2QM8A 3TDMA 1Y8AA 4PFJA 2FWRA 4FR2A 1Z4KA 2EAUA 1G291 1Z7EA 1CC1S 1ZBDA 1R4MB 1L8LA 4HTFB 4DV0B 3C3PA 2P2NA 2WHPA 5JNSA 5KOYA 2B3TA 5JS2A 1DOHA 4O3FA 2BEWA 4QD3A 1GL3A 5HKKA 4HPXB 1JPVA 2P2YA 1DWPA 4EYGA 1U1FA 4NDNE 2IUEA 3I83A 3LHSA 1VTKA 1T4CA 4TKMA 1RI3A 2ZAGA 4IZ6A 4YJ3A 4HRVA 3ROEA 3CJRA 4NVRA 3HKBB 2B8WA 1V5EA 3NIFB 4RA9B 5AM0A 1YK1A 2AJLI 4LMRA 1JHQA 2Z57A 4D57A 4W5JA 5FLEX 3KHKA 3WKAA 2RSLA 1P7ZA 2HY7A 1Z56C 1Y42X 1TJ4A 2OBMA 4L5BA 5EHQA 4UUMA 4AZ3A 4V0RA 2AR9A 3WNVA 3NOQA 3L92A 5EWMA 1MENA 4BV9A 4I5GA 4NEQA 4YT8A 4Y2SA 2CFOA 2IYSA 5GJVC 2OFFA 1N2BA 3TW8B 2AG8A 1S8NA 1AKEA 2WYHA 4MVWA 3Q10A 2QAGC 4L57A 5HKBA 2BFNA 2VSYA 2WSIA 4RIFA 2XH8A 5CT6A 2EBHX 2CHUA 4XGNA 4D46A 2GARA 4HUJA 1UQTA 2QJTA 2DUJA 2V7BA 3OKFA 4G36A 1R6DA 4P4LA 4XIJA 3WMRA 3GLUA 5BUQA 3UFBA 5JZMA 1MJGM 3OCWA 3H1EA 3BUSA 4ATNA 3UXHA 1LD3A 5THKA 1YIDA 3OI7A 4L74A 4RWEA 3FUTA 4RM2A 1I3OA 1JXQA 1I1QB 2F9MA 5K8UA 3GFQA 1DXOA 1FS6A 1UBRS 3FUCA 4JLBA 4NJEA 3BHJA 2I3BA 1GZVA 5L7TA 2IXBA 4CCWA 1GG9A 4PG8A 1G7TA 1X0VA 2OVBA 3ON5A 3E84A 1UDCA 3HHEA 4Q9AA 1F4LA 1RQPA 2AD1A 3I1YA 3T7RA 1PBNA 4H1HA 4FD2A 4X62B 2FNAA 3BQ9A 5JD5A 4AY5A 4FCTA 1QYXA 2ZATA 3W5SA 5KQMA 1GFWA 1NBAA 2KX7A 3WJ7A 4QYIA 4FJ1A 1K8XB 2DKNA 3ADBA 3ZY5A 2C7PA 2OECA 4J6EA 4AUEA 5HA5A 3KQHA 3LQFA 3PLAE 1ZW1A 2BELA 3BL8A 4MI6A 3UAGA 3VOAA 3FVRA 1HX7A 1XWFA 3BSYA 3OUZA 4CFYA 2COKA 4FMDB 3HU2A 3IEKA 4N7JA 2HWKA 4HN2A 2V55B 4QULA 3B38A 3NRCA 1JAXA 3U4GA 1MJNA 4KO4S 3JCZA 3EVNA 4DIUA 1D4FA 3OM1A 2BYTA 3NR2A 3FROA 3HJRA 2EGGA 3TDNA 3R76A 4AKHA 1JLRA 1ZLYA 2ZR8A 2W42A 3FOBA 1N8KA 3RSQA 4BVHA 1QF6A 5FOXA 1K7XB 3A6EA 2GZSA 3Q2KA 3ZHZA 2YV5A 2HAEA 2NPIA 2MT9A 3FOEC 2W2LD 1WL8A 2ZSBA 4CMEA 4GPBA 3N9IA 3BQNB 3DZFA 5DISB 4BBZA 3DPIA 2VLIA 4FB5A 3I42A 3B6IA 4YCAA 3THSA 4F3NA 1CUJA 5KOJA 4ZGGA 4DV1B 1TUBA 3UMJA 1L7AA 3OQ6A 4HLDA 5K6AA 1D5CA 1GLNA 2ZYWX 4KN8A 1WB9A 4JI4B 1EG7A 3GEDA 4GP9A 2BGMA 3ZGLA 5A3JA 2YKGA 4YNBA 2JRCA 4EL0A 5FBVB 1E2LA 2PYZA 1UMKA 1CJTC 2X1MA 1W0JD 3CNLA 3DEYX 3OMLA 4HVTA 3ANYB 4OJQA 3S2GA 4HDAA 5L6LB 3AVYA 4TL7A 4B6OA 4CLOB 1SKQA 3WGNA 1S4MA 2TRSB 4OUDA 5I01A 4PN3A 4PRYA 1JAZA 1X86B 1ZC3A 4MKHA 5DSXA 3RVDA 1DAEA 3C3MA 4BN0A 1FPQA 1Q2UA 1E89A 1XZMA 1TF7A 3GJ3A 4QUIA 1K27A 1PBTA 3PEUA 4R01A 1GZSA 5TMDA 3RJTA 3VC3A 3JYQA 1NV8A 2QAIA 3L1VA 5GONB 2PZLA 1QXSA 2Z1MA 1AMNA 1N2CA 1UKZA 5KNDD 3AP2A 4KQ2A 5KHLB 1MO6A 1OLXA 7AT1A 1RP7A 5HUJA 2CV0A 1MA3A 2C4TA 2P5TB 4HYQA 3GRZA 2WU3A 4IH9A 4TRRA 1S01A 1X3LA 3SPXA 3DBHA 2HZBA 5CYOA 3DL4A 3ER6A 4L6IA 4X00A 2D3WA 4R69A 2GVDC 5EHNA 1H3NA 2WIGA 3C7TA 2RHLA 4Z9XA 3EY4A 1I7PA 1JJFA 2PGAA 5HZMA 3ZBQA 4JD5A 3BHMA 3FIUA 4DR7B 5BQ3A 2RBGA 3N2YA 4KXMA 4MV3A 4BP3A 4CPDA 3N39C 3AGPA 1C3LA 4R9UC 4I9UA 1CSEE 2ILTA 5B58T 1T1GA 4MGZR 1L4HA 3GQVA 4AJOA 1XMQB 4IZOA 1X3SA 5AI6A 4E4YA 3HKEB 1URPA 3DMDA 2G1UA 5IABA 1NC3A 1OXSC 4I4IA 1CPYA 2H4YA 4X1IB 1IBCA 5FPHA 2ZE8A 2IPNA 2HA6A 4FK8A 5JI3E 5JNTA 2ZLBA 2O0KA 2MTBA 1E2DA 1FU4A 4OMUA 1Z7WA 2X1HA 3ZBTA 9LDTA 2PO5A 2FK8A 3D7MA 1LZLA 4MJ7A 5KTTA 3M4XA 1JLMA 3T41A 3TSWA 3EVFA 4L7VA 2BZ0A 1GPWB 1L7NA 3AR3A 2IVFA 1KOJA 1E62A 1UDXA 2PQ6A 1E3IA 4MUMA 1IONA 1O5IA 1QYWA 3MNFA 2ZIXB 2QIPA 2QM0A 3OX1A 2OCYC 3CEMA 1K0UA 2I4NA 1G9TA 3CPHA 1YA8A 2EKPA 4GG1A 3ZUPA 3NYRA 4JKIA 1TEHA 4LCEA 2FA9A 2XRMA 1RRCA 4MO9A 3IPAA 6LDHA 2R00A 1E6WA 3PVSA 4EA7A 1TZBA 3LTNC 2QTGA 3FDXA 3HXKA 3PD7A 4MEBA 3EGOA 1BEUB 2QE7D 4JENA 4O2AB 4C4AA 4LVCA 1OQAA 1DQNA 3THWA 3L01A 4MO2A 4V1CI 2WJYA 1JSZA 3MJFA 3EHDA 3ZQ4A 5L3ZA 4RCYA 3QE2A 3B70A 4O08A 1XN1A 3CW2A 5PNTA 4K3VA 3GXOA 4IKPA 3VSAA 4YRGA 2HEGA 1AGYA 1P45A 2O6HA 3IURA 3E8MA 1VXRA 3R23A 2C94A 2X19A 4JSRA 4M0DA 4RKEA 4X84A 4YVFA 2BHTA 2YOHA 3OHPA 2PWYA 5FJJA 5G1OA 5KWIA 1OLSA 3KM0A 4G23A 4MV1A 2OV3A 1F0PA 2HHCA 4X94A 3RFTA 4EG8A 4MQBA 5MN5A 2I7CA 2QMZA 2WRZA 3GZ4A 4A92A 2AD5A 1RLOA 2C42A 3KFLA 1I5OA 1GZHB 3T7TA 5AKKA 3DULA 1NBHA 2CJPA 2JL1A 1RWKA 3EVGA 4MLZA 3FTEA 4QJBA 5F9FA 2BCGY 4V0LA 1QOZA 1FMTA 2W48A 3QELB 4Z9AA 1USUA 5EKXA 3G8DA 3VPCA 4A0SA 2DBQA 4WLEA 4RTJA 3EEIA 4OQZA 2P2ZA 3VU9B 5K03A 5JPDA 2E87A 2FPLA 2A3NA 2GASA 4FYHA 4A4DA 4AZVA 4E0BA 1N6LA 2VJOA 2RIRA 3PUXA 4XSGA 4KR3A 4LWQA 2AG5A 4WK2B 4RQTA 3VC1A 1UXOA 1XBTA 2Y71A 5B2FA 3F9IA 2RH8A 1IXSB 4MUHA 4ALNA 4EY7A 4XAQA 2CBXA 4PNPA 3WIOA 4PLCA 3T54A 3OC6A 5H81A 4ZP1A 4D9CA 1XZFA 1NTOA 4OP3A 4QNMA 5IUNC 1XRJA 3OMWA 3OHMA 4NC9A 4CCAA 2Q6IA 5ELLA 1JFRA 3JQ6A 4G81A 3WZMA 2H7YA 3VPDA 1GTSA 3BG5A 2UVPA 1ZPDA 4TLLB 2Y9MB 3QWBA 5F78A 3O4RA 1TADA 3OM0A 1T5HX 3W8DA 2CWWA 2G36A 4II7A 4NJMA 2SKCA 3F78A 3TRDA 1GZUA 1ADYA 4ROTA 2FDXA 3RFXA 1NUAA 2A58A 4TMTA 2GQ0A 3PUJA 1PJLA 4AP9A 2QVXX 3PFNA 4EMUA 5A3SA 3LL4A 4CR7A 1WTAA 1YKSA 2IZZA 3NDPA 3QKWA 1R4NA 4HRYA 1XTBA 3KQPA 3N8DA 5CNIA 4O4IA 2EOAA 5IYZF 4HVCA 1FRZA 1JXAA 4LGMA 1BDIA 1K06A 1MF7A 4GVLA 3E1GA 1LPBB 3AR2A 1S9DA 3PQ6A 5TEVA 3RR2A 1KH3A 3OQOA 1E1RA 3QFCA 5TY0A 1LF0A 3IPYA 5LQMA 2AKEA 3IP6A 4BFUA 2H4ZA 1OA1A 2QL9A 2ZULA 2RI1A 3VJRA 1HDXA 1QGZA 1J0EA 3S1AA 2VF7A 3UK7A 2K2WA 5T4HA 2DYKA 4TT8A 4G97A 1CQZA 1GNVA 4I1PA 4HUQA 5AVTA 2XNKA 1EGAA 3I9OA 5L3VA 4W5TA 5DPMA 4HB0A 1XL0A 2H57A 2JFNA 1GCAA 2ZM5A 1VECA 4E5UA 1UT5A 1YRWA 4S1OA 1E6KA 2Q3FA 3H1TA 1JFFA 1DT5A 5CT5A 4OQPA 5IN5A 1N0IA 2W4MA 5JYBA 4IYRA 3HFRA 3V4ZA 1UM9B 1JH9A 1E5XA 3FCEA 5DBFA 2H07A 4IDDA 1XALA 1K6XA 3Q3VA 1DG9A 4C7VA 4RH0A 3K35A 3ZDAA 4RV4A 1ZN2A 3S7ZA 1T9BA 2VNKA 1Q15A 2BFCB 3W9BA 1F8GA 2ZCJA 3BFXA 1O58A 3LWBA 4OMFG 1AGXA 5E2BA 5ANRB 1WCXA 1JGTA 3KYCB 4AF6A 5JHHB 1T36B 3IXLA 1CZKA 2VBCA 2HFKA 3HCWA 4MXDA 1W2HA 5GOZA 4C6TB 3PE6A 4ER6A 3R44A 5EMJA 3WWZA 1PVDA 3T5PA 3CVYA 2CLCX 4FEGA 3K9QO 3OQIA 4Q7JB 5CCDA 3RSFA 4AS3A 1GV1A 1MP0A 3P96A 4MVXA 1MW8X 1A69A 4MV5A 4Y18A 1FNSA 1AKWA 2CBZA 1FK8A 2WJVA 4K5QA 4TTJA 5EN4A 4CU5A 1H0HA 3BJEA 1RJ9B 3GFOA 4LVNA 3FLAA 2OBXA 3RRFA 2W6OA 3RODA 3UAVA 4V0SA 4WKNA 3L3BA 4OUKX 1GZ6A 2XIJA 1U3VA 2YXNA 3Q7TA 3T4UA 2E0IA 3ZIUA 2ZQZA 1E4EA 4BO0A 3B1FA 3KAJA 3NWJA 3K70C 1Q3HA 3DUFA 2F9FA 3NIBA 1S2MA 4INPA 1A50B 1K5GA 1P4JA 4IIFA 5EXDA 5FUMA 5LVAA 1YR8A 3G0CA 1I32A 2QJOA 2QSZA 4U8GA 5LUAA 1SZDA 2NLOA 4Q66C 5K1ZA 3UYKA 3OCZA 5LMUB 1NP3A 5HRAA 1MDFA 4LY0A 3V1MA 4EHAA 4X66B 3X1WA 1PFYA 4BJHB 1IWBB 3A2KA 2Z9DA 2ZBVA 4O0LA 3HCAA 1H1LB 4D92A 3S2EA 1NQTA 1Z22A 1KAHA 2V7PA 2PS0A 4RHTA 4UVIA 3HB1A 3ZN2A 5TS3A 1FQKA 3H99A 4FC6A 4LK3A 1AS2A 5LNK6 4O1IA 4LMAA 2AXPA 2YBDA 4LXIA 2VYVA 1UKBA 4HQFA 5HZHA 4ENRA 1LDYA 4QDTA 1QS0A 4D1YA 2G71A 1UWLA 1WOYA 4P4TA 4RJTA 4IJMA 4CW7A 3L9XA 4BMYA 4EABA 1XO1A 3R0XA 2XXBA 4YWHA 3DTVD 4LRQA 3NMUF 4EENA 4LHSA 5REQB 1RYFA 4UC0A 3OC0A 2JVIA 4CQLB 3F4LA 4KN5A 3N7AA 1KU6A 3PHGA 1E1KA 4O1MA 1NAIA 4UBLA 4BVBA 4DNPA 1M5UA 4O2BF 3DOJA 3R9XA 3SYKA 4IQ4A 5E4FA 2FZ4A 2PNFA 3BXPA 4WGFA 1ZD4A 4NZNA 5EWJA 1BOFA 2YTZA 2IS2A 2IXFA 2X6QA 3L7AA 4JR1A 1ZX1A 4KQHA 1N1DA 5JT1A 4YMGA 3GRRA 4YYZA 1OIXA 1V5GA 2JLCA 1JTVA 1KIAA 1PZXA 2XJ4A 2WF6A 1GZ7A 3CEPB 4DRYA 1LSUA 2JGLA 1YB1A 4ESVA 2X2PA 3UH1A 1YS6A 4X6YA 4CF4A 6REQA 3UV6A 1EWQA 4BFCA 1J8VA 2D7CA 3I5AA 4GPZA 4PONA 3VTAA 5JMWA 2D0PB 4MHOA 1YKGA 4XSHA 4YRFA 1ZK3A 1ATIA 4BNUA 2Q1YA 4O1HA 4X6LA 4LFBB 2CUNA 1YR6A 2I2DA 2Y1CA 1WKBA 4TVBA 2C92A 3DDZX 3CZRA 5CPFA 3MJEA 3KJQA 1AUXA 3FBTA 3FYUC 3HNOA 3PDWA 3EG9A 1DIAA 3EVAA 4JUAA 5IH7A 1NJ8A 2Q45A 3DBVO 1T0BA 3LFTA 3K32A 4J6FA 1MLDA 5KJCA 2HIGA 5E0OA 3ZWNA 1IM2A 4XD2A 3HXPA 5KTSA 3TBHA 3R09A 1VHJA 3B3GA 4XW2A 2FPWA 3FSEA 2FZGA 5AW0A 2P69A 3ADKA 2IYUA 5GIOE 4PQEA 3CW9A 1QPBA 2DP4E 2QAGA 2VUSA 2QMYA 5CDHA 1B8VA 3JQAB 1VKHA 5D3KA 4YT5A 1JIKA 3DV9A 3UZUA 1AU9A 2QRMA 3ITEA 2H1WA 3UVEA 1MQ9A 3RS5A 3QUSA 3D0OA 1P77A 3ABRB 4ZOLB 3DDWA 1T0UA 2IYQA 1N7IA 2EKZA 4ARZA 2ZJ2A 1FP6A 2YY7A 3LPLA 3UPTA 3I92A 2O0MA 1ISIA 1XZJA 2G04A 1E2NA 1U9JA 1IG3A 5COBA 1UFOA 5TR9A 3WNCA 4FB4A 5A5DA 1S3SA 1SQGA 2Z9BA 1VCOA 1JG3A 5CIWA 3RHSA 1U0LA 1OXVA 2HF7A 2W2MA 2XYPA 1QCDA 3ZHQA 1GSIA 2CB0A 4JKYA 5JBNA 3GCZA 3MHPA 3IMKA 3UMYA 4JLPA 1NQUA 1VP3A 1Q12A 4JJFA 3B5EA 2PCLA 2WJIA 4TRNA 4PPGA 2Q5CA 4OOFA 4HTAA 2BI7A 4IF4A 3LUGA 4QUAA 1CQJA 1P7VA 3FCCA 1EVEA 2NACA 4D45A 4O63O 5AJUA 3A37A 3HKDA 1KA9H 4GX0A 1N6IA 5E6SB 4D8XA 4QUHA 5G53C 1A4IA 1I24A 1RVV1 1JQKA 3AY0A 4JB0A 4CFSA 2WB2A 1N0UA 1JL3A 3EXIB 4YYEA 3GLKA 1W88A 4EGJA 3D43A 3S8EA 1R0XA 1SEPA 2MMGA 2R5FA 5C0OE 2F59A 1UODA 3EWSA 3IDFA 3PC2A 4Z49A 5AW7A 1ZCFA 2H17A 4X1OA 1DCFA 3M7IA 2PLFA 4HWSA 1P1RA 2BFMA 4KSBA 1YJ8A 2DCUA 2O3UA 4QWMA 5KSOA 3L93A 3OJWA 3V6LA 3IAAA 3ZQ6A 1JQ5A 5BN5B 3ZYZA 1EZZA 5F7OA 3RRXA 4GIBA 1NKTA 2ZB4A 4I4NA 1JIIA 3HCRA 1UKVY 4Y6OA 4UW9A 1J2RA 3NPAA 4TTVA 4IIJF 1CEXA 1OE0A 2X6TA 4IO1A 1MD9A 3GNQA 4BDTA 2PGLA 1JNXX 2J9XB 4L3OA 4GGMX 4NZOA 4WN9A 5JDCC 1CUIA 4P33A 4DC0A 2CNOA 4QXQA 1G7CA 1T9KA 3D3KA 4B6JA 5JU6A 3NBZC 5I4BA 3HJGA 2VQEB 1MIOA 3HSSA 3VKUA 3KC2A 3OLZA 2BGUA 3IGFA 2Z4SA 2IPXA 4NBNA 2W2TA 1UR5A 2JZNA 4DDMA 5ALZA 4N6GA 1Q0QA 1HOTA 5FORA 2VJYA 3R1IA 3JQEA 3EF1A 1QM5A 1UBJS 2AXEA 4KXFB 4G1BA 1NVWQ 5DTMA 3O8RA 4FYJA 1OFUX 1KFKB 2AK3A 3H7IA 4U7TB 1JSRA 1POXA 1TZKA 4XUDA 4AIRA 2QLBA 2YVKA 3EPRA 821PA 4K9NA 2XZPA 4ALMA 3H19A 3NTUA 3WGLA 1VE9A 4PXAA 4WLOA 5EJGA 3TVTA 1ELOA 4X65B 4JGBA 4W1SA 1G42A 2VHTA 4P1ZA 2FWAA 1P2TA 1QIMA 4M6WA 4Q39A 5CW1A 4BB5A 1V6AA 4J75A 4DEYA 3LTEA 3PGMA 3H05A 4DIDA 1KPIA 2E6UX 3GELA 3ENQA 1D4AA 2EFHB 3GOQA 4N18A 2P3LA 1JF8A 3GUYA 4RACA 4WY5A 5TX7A 1JTEA 3WL4A 5K4GA 4QOSA 2AHOA 4RVSA 2O7NA 1RLIA 3WB0A 2GNAA 5HKAA 5IT5A 4G0UA 3KZCA 5T8KC 3HUTA 1DBWA 4HDSB 1NDUA 4EX6A 5B4TA 3PNLA 1KEEA 1B8OA 4U8HA 3NYQA 2VUIB 5JNRA 2ZTUA 3OLYA 1DCTA 1BFDA 3N5KA 4URFA 1WOMA 4H17A 3SGLA 2FW6A 4PCAA 4F5EA 4X93A 1QVRA 4Y2VA 2BJVA 4QC2A 4E5DA 4RESA 1JXMA 1VJCA 2VNAA 1NXTA 4WXRA 2E4ZA 4B0PA 1J49A 2GYVA 2HDWA 3VPBA 5FKJA 3HO6A 3PNBA 4OB8A 2OFXA 4NCNA 2VCHA 3UANA 1ETHA 3CH6A 4UM9B 2RJOA 1CYEA 4KRXA 4MUAA 4US1R 1TQ4A 4W99A 2D59A 2VDWB 5EWLA 2ZE6A 5B37A 5C1OA 2C9BA 5AI4A 2C5FA 5K0FA 5FUYA 3KVNA 4O2LA 2CD9A 3WKBA 2GN9A 1XKTA 4NYIR 4RK0A 3GLHB 3UF0A 5H8WA 5SY9A 2I65A 2KJQA 3KV3O 5I8WA 4HS9A 2N1BA 2MJLA 4ZTBA 3VXKA 5JLAA 3BWXA 4BQFA 3DVAB 3ES9A 4KQXA 5TQ0A 3LDAA 1D3AA 3I0NA 4FPXA 3SMVA 3HV2A 3IDZA 3T7AA 1AQYA 2GERA 2WYIA 4LISA 4G3XA 3ZDDA 2GZRA 1G5PA 3VM6A 1QO0A 4LYFA 1P29A 2BM1A 1P1KA 2Q6TA 1Q1NA 4M0LA 2DR3A 1FTWA 5CJ2A 5EVCA 1K8ZB 2HU7A 4LJ5A 4HNSA 1XNRB 3I8XA 2QPAA 3SEZA 3BWEA 3KT3A 5LIRA 4JROA 3BHNA 1RXEA 1WPXA 2C77A 2XJ9A 5BYBA 3K3PA 3SG0A 4C87A 3OY2A 1BYIA 2GBCA 2Q4EA 2P9FA 4R8RA 1FS4A 3TTSA 5KNBD 3AM1A 3I2GA 4GS5A 3QA3E 5IW8A 1RHQA 1DBSA 3DZIA 3P9NA 4MB6A 1ADBA 3CO0S 3MJSA 1U0SY 3NHUA 1C9MA 4KACA 1I6KA 3MSXA 2P9CA 4HGOA 1JIVA 5IBCA 2P91A 1A4XA 1LW6E 4DA0A 1R5JA 1RFLA 3TZKA 1A8QA 1ECBA 3SC2A 4M36A 4GSYA 4HH0A 1U0RA 4ZQIA 4WRRA 4IEFB 4DMLA 4MIOA 3W2TA 4G0ZA 3A6PC 3L46A 4C6HA 1X0XA 4LC1A 2G4CA 1II9A 1SXGA 5TRTA 2AX3A 3OOJA 4B7AA 5AMXA 3W5HA 2XSZA 1KDOA 1SQ6A 3H3FA 4IV8A 4TKVA 3N59A 2DUMA 1Y9ZA 4KYUA 2QQEA 2JH3A 4QGHA 3B6KA 3KJZA 2NTJA 5F9HA 3TM4A 4HVAA 3C5HA 3QK7A 2IXGA 4IX9A 1M1XB 3W2FA 4DCGA 1T8SA 4I8XA 3V33A 1AUQA 1YB2A 1R7RA 1X7XB 2WYVA 3HRKA 2ZREA 4MYCA 2PMDA 5KCZA 3ESDA 2OCLA 5EMLA 4URUR 4WXPA 4E5SA 4FFPA 1QTIA 3GGDA 1ZOOA 4IGAA 4AXXA 4P80A 3NIGB 3O6VA 4JXZA 2YJGA 1BH2A 4IUDS 5IXJA 1UFVA 1XDGA 2QL5A 5IJ0A 1CFZA 2J6BA 3VO9A 1BC5A 1HMPA 3KB1A 1RE1A 1YIOA 3LYLA 4UZFA 4NHOA 3GVIA 4EEXA 4UCXA 1MAWA 1WZUA 3AHCA 5B1SA 2P30A 1RAAA 1W19A 4RKWA 4C1BA 1EJBA 1H23A 1EJ6A 1V3TA 3SSNA 1X94A 2YQ4A 3MMXA 1RCFA 3FJYA 4JT9A 1JPNA 5BYKA 3ED1A 3P32A 4WDRA 2PX5A 3L2OB 2D54A 4I1SA 4ARCA 3PXXA 2Z0MA 4NZZA 4OBEA 1JEQA 4IIXA 4Y30A 2BKLA 2JGIA 1G0OA 3CLTC 2VHWA 1RTKA 2ZVQX 3OJLA 1YU9A 5CA1A 3AZOA 1K6IA 1XJCA 5DM2A 1XZBA 1NVTA 1ZVKA 2REOA 1BKDR 3VI3B 3N75A 2C2BA 1KGSA 1R4AA 2AHRA 3RW9A 2GF2A 4RUKA 1WUJS 4DDWA 2Z8YA 3FPKA 4G0NA 1YTLA 2ZUDA 1SUPA 2ZS7A 3GRAA 4IOLA 4K6MA 1V11A 3AFMA 4RENA 1PR4A 4OHFA 3PCRB 5B53A 4KLZA 1A3CA 1USVA 4D3YA 5U9CA 5TMBA 3AVPA 3FRJA 4A0QA 2M2IA 2P77A 5EMHA 4AJKA 1PS9A 4P35A 2OSBA 5JAIA 5LBIA 5CK4A 1JG4A 4FGZA 3KQVA 1EFAA 4KDRA 3WA7A 3DMRA 4N65A 2IWHA 5C18A 4NHEA 4MKXA 5EXPA 2ZROA 4OSEA 1Y98A 2H54A 4ND1A 5CDFA 4R2IA 4HK4A 1GAJA 2OWEA 1BHO1 4YK7A 4YUYA 1EWKA 3KSRA 4MW5A 4RQBA 5EXTA 4BCCA 1YE5A 4FHFA 5BP7A 4M2LA 3D3WB 3JWPA 1EFDN 4OIFA 5E1DA 4NESA 2V6GA 5JWHA 1P3JA 2HB6A 5BVGB 1SKBA 1KJZA 2D0OB 1WO8A 4V2IA 2I0FA 4H7PA 4NU5A 4C3UA 1KC3A 5BWCA 2ZJFA 5FFNA 4ENVA 4Z4IA 5JW6A 2O2ZA 2VP2A 2JVKA 4QTUB 4RVOA 1L5RA 1EIWA 1OZFA 2CCKA 2V6IA 5JS8A 4M0PA 1YJQA 1QYVA 3ZV6A 3THYA 4K2AA 3ILXA 4HYEA 2GX6A 4BNGA 3CWZA 3KVOA 1G8KA 2J07A 1NURA 4JS0A 5CLHA 3UJNA 1QNFA 3DEKA 3BZBA 3PJFA 1JU4A 2HXYA 3WLSA 4C0BA 2YDXA 2VFAA 1L3CA 1YZKA 1WWKA 2ETVA 3DPUA 1TEVA 3ILHA 3KLOA 3PR1A 2NZYA 3OEED 3H2KA 3R0JA 5FR2A 4DCPA 4EVRA 4FHGA 1ECGA 3PDIB 3BK7A 2QYHA 3TTUA 2PRKA 2QVYX 3WNZA 4TT3A 4TLEA 5D01A 1ZL2A 3WFIA 4C43A 5IF3A 2IZ0A 5JJKA 1CUWA 2V3VA 3GRPA 5AVVA 4Q18A 5KZMB 3DHYA 2RGNA 5A0FA 2MSNA 3ET4A 1B6GA 1WCIB 3CUVA 2ICAA 3A36A 3D4BA 3HY6A 4HXFB 1M2VA 3C16C 3NBAA 3NVDA 4KXXA 4NBRA 4OQNA 3SYMA 5L4SA 3ZNOA 4R3NA 2JHFA 3G1WA 4FT4A 2OLKA 3DONA 1NQ5A 3ZQUA 3YASA 4LGVA 4GM0A 2NNWB 3ENWA 1YO6A 4V0MA 5A5EA 4WOJA 1WW8A 1M2JA 5LKAA 2QMUA 1FYDA 1Q11A 1V8PA 1IY8A 1LBEA 3IJRA 3JQ9C 4JY7A 1S1MA 3W1VA 3ZVRA 5CEJA 3F3KA 4UULA 1Q1BA 4YJ3F 2YWRA 2YWEA 2GYUA 1IVSA 5E1MA 2BI8A 1FE8A 3AY7A 1DL5A 3NT5A 1X6VA 3IH5A 4DDTA 1HSZA 3H13A 1KKUA 1ZO8A 2CFRA 3FJ1A 4WESB 5JI2E 3EDOA 4FFMA 2AT1A 1GKIA 2ZWAA 3AB3A 3IUJA 3N6XA 1B0ZA 1Z06A 4KLCA 2Q3MA 2I22A 3FGOA 4NATA 4E46A 1CR6A 3RG2A 3VKWA 1SBCA 1EAMA 4M60A 4MYRA 4GOOD 4C07A 3UO8B 2F3PA 5G1NA 5EJ5A 4TWRA 2X3UA 3BL5A 2MYNA 1G6OA 3QUTA 3W5CA 1SKYB 5A4FS 3UJHA 1GGEA 1R0ZA 1W0KD 2UAGA 1T6NA 4UU7A 1ZJJA 2C96A 5TJ9A 4L2IA 2WWXA 3VHRA 4E3ZA 2IXAA 1JHXA 4XEHA 3V46A 4CF7A 3FNBA 5FBHA 2GN0A 1A9YA 2WHYA 2HMWA 1JILA 1XTKA 3IHWA 3ZHRA 1YB4A 2ZTVA 2X14A 2X5XA 2PQ0A 2XAUA 3A14A 3K6KA 4I9GA 3WBBA 4BVFA 2VYVD 2EFGA 2OGTA 3H2GA 4GT1A 4C2AA 4C0XA 1O6GA 3TW4A 4CEJB 1N8TA 2PGIA 5E8JA 2HMVA 1FPMA 1LLQA 3O8OA 4UAUA 5E7MA 3V8EA 5BV0A 3L7BA 2HKIA 1U7OA 3FY4A 4CM4B 4WH0A 1NG1A 4EG5A 1FFDA 4X60A 4CT5A 1UKEA 5CAEB 1ZK2A 1S2OA 3E3MA 2XHEA 1XEWY 2OUKA 2MSKA 1J07A 1O6FA 1IN6A 1XDDA 2P7HA 4K9PA 2HMUA 3C70A 3CZAA 4YWJA 3AH8A 2JDIA 3BFKA 4M8NE 1IEQA 1DRUA 2FRDC 5EOVA 3HP7A 3L9WA 3ZJVA 3FYUA 3R7LA 3IVCA 1U2DC 1L7PA 2O2EA 3ZOZA 4ADSG 2GXUA 5AHWA 2WSYB 1U8FO 1ZVQA 2Q07A 4H18A 2ZJ3A 4PYLA 3ZZMA 5D1NA 1A88A 4JBIA 4U63A 1PYGA 5KOHB 1RC8A 4HMPA 5F1OA 2UUBB 3GIDA 5KCMA 3LQRA 4WNAA 3DVQX 5CB6A 5KDDA 2MMCA 4QRDA 1A5AB 1RRGA 1VDMA 1CR0A 4Z9YA 3L07A 4FHZA 4EFNA 1XPJA 3R3UA 2JGJA 2ATEA 3A25A 3FR8A 4QFMA 4D3ZA 3I1IA 4BEWA 2ZYHA 1LNQA 2CXOA 3FWHA 4CI9A 2WJGA 4DDUA 1LGYA 3IOBA 3Q5DA 1EWTA 4MWGA 2GBGA 3TF5A 3DEZA 5FL7A 4Y0AA 1X15A 4RORA 2OZLB 1C41A 4F96A 4FWBA 2PE5A 4RZXA 1ORIA 3IEIA 3N0TA 4KQIA 4JBLA 5DXAA 1ZD8A 3FGNA 2V6MA 1INLA 2BGTA 1B4DA 3FWYA 3RSSA 2BP7A 3L0OA 2RGEA 3L7YA 4ZEMA 3CUUA 3CE6A 4PXSA 3TOXA 4GWGA 5T67A 1CRWG 1Y9EA 2P9TA 1I4OA 3D5QA 3HB4X 4HNAB 3R8XA 3F74A 2FKAA 5EMKA 1J4AA 4R9VA 3VX3A 3IQDB 1OIVA 4HLQB 3V00A 4Z6KA 4OFZA 3SBEA 5KQSA 1PEYA 4HO1X 4QAQA 4Z4CA 4IOMA 1N77A 1JFSA 1DADA 2NU6B 3OAAD 2HRDA 3WY9A 3P94A 1I36A 3WLNA 4Q9DA 4X3CA 3BD6A 4H9GA 3PHJA 4X41A 4CLHA 1ZNQO 3C3EA 4M49A 2VK1A 2B92A 1E3LA 5NLLA 3RTCA 4S1TA 4G5SA 3TW0A 3UXYA 2WWRA 1NJFA 3KKNA 2WHQA 2C2GA 3HBMA 3SJBA 4GKBA 3DBRA 3R5KA 4MITA 1J1UA 2VH2A 5EQFA 4Z0TA 3T9EA 1UPCA 5KX5B 3VO2A 2EZTA 1O6BA 5I7EA 2QROA 1ZD5A 3DDCA 4I4TB 1DFIA 2H1VA 4PYRA 4QDOA 5F51A 1ZZGA 2IZ5A 4GRIA 3CC8A 3KQOA 3G0OA 3OY7A 1V6SA 3MGCA 2I62A 3ZWDA 1N1GA 1YMVA 3QBTA 4GM1A 5JDCA 3GLIA 4ZOQI 1OXMA 1QJCA 5DF1A 1ZS9A 4RZ2A 1Z7GA 4WBSA 2UVQA 4UEJA 2WM8A 3KEMA 1X1DA 2DSTA 1L2TA 3JSXA 2XCQA 5K3SA 2D5BA 4ZAZA 3W5AA 2CXQA 1KMMA 3G2JA 4JEUA 3GJ6A 4YMUA 4LXQA 1TK3A 2O3JA 2Z5LA 3CWCA 3QFTA 3NVAA 1YB5A 1NYTA 2D13A 1JWLA 2D0DA 5HEKA 3MBOA 1MG0A 4V38A 1GUFA 3BULA 3QLEA 3WGKA 4ACAA 4LV8B 4N0PA 2WYWA 1J0AA 1B00A 1MIHA 3PNPA 2BGKA 1JEAA 3RROA 4EB6A 3OJFA 3WR5A 1GY8A 3HCCA 5CM2Z 1KFCB 4DL9A 1GD1O 4F9FA 3U4QA 3R3JA 2RHBA 4I9NA 4AURA 3AIKA 2CCGA 1QBKC 4JNCA 1SOUA 2HBQA 4GX1A 1KP3A 3LPDA 5D1HA 2DFKB 2GA9A 5KWEA 3IKTA 2HIMA 5B12A 1GU0A 3I4LA 2XWPA 4MARA 3KEFA 1ZL0A 4QVKA 4GWKA 1KI1A 3VR2D 1QR2A 3ZLJA 1PX0A 1DOAA 1OX4A 2FP4A 2I4OA 1U2SA 2GA8A 1YU6A 3BGDA 1FLDA 1U7ZA 2P4SA 5TDHA 2GKSA 2PIDA 4EUKA 3FF4A 1JPUA 5TF4A 5E6RB 4EVIA 1VKJA 2YN4A 4OHCA 4MLPA 4Y2XA 4Z1MD 5T8KA 3NM5A 3CNOA 4MX8A 1NMXA 3UB2A 3OZUA 3P2EA 4DT1A 3WK4A 1VXOA 4TSFA 3JYOA 4YDHB 3I32A 4I2NA 5FOSA 3ZI4A 1WZNA 3REGA 1H5QA 3IKVA 3TXXA 1BA2A 1K8YB 4GOND 2JVJA 4J7CA 3D8TA 3HGQA 3IT0A 5FR1A 2Q28A 4UBOA 2XODA 5EYPB 3V8MA 4MDEA 4A8TA 1EHCA 3O9MA 2XRZA 5UKDA 3IAUA 1DWOA 2AC2A 3HS3A 1SPXA 3E70C 4WI1A 3GNTA 4ZU6X 1PZGA 3SQOA 4NMLA 1AHPA 4JJ4A 4MWTA 3PUYA 2H48A 2IHJA 3H3XA 4HADA 2ZAYA 4NNJA 5AK3A 2VK4A 3OP4A 4DANA 1BH6A 3GAFA 2NM0A 3JASB 3JVEA 2RKOA 2Q27A 4O8CA 1ABEA 2YHIA 2P41A 3S8YA 3RRJA 1C7RA 3IBSA 4URXR 1Z28A 3G2IA 3ELBA 5DHQA 1M2NA 1NMSA 1W4RA 1XYGA 2LNDA 3IQFA 1VG8A 1Z07A 2QZZA 3VOTA 7ADHA 3W77A 4S12A 2PXXA 1MX1A 1ISHA 1ZI6A 2HNBA 3VGPA 1R0YA 4ZT2A 1YQEA 3U1VA 3SI7A 2J30A 1GILA 4R05A 5ALOA 4GUDA 3UT5A 2XCRB 4DJFC 5FO0A 2I78A 2O8VA 4EYQA 3OESA 4LUCA 4OK6A 4KE8A 2DH5A 2R1UA 1HNNA 3A0RB 1H2WA 1S02A 2PPLA 3JR7A 1GT91 3L82B 4BU0A 2HA5A 3NM6B 1NX6A 1DLJA 3OECA 1QHNA 1CY2A 1NUPA 5IUKC 3RYHA 1XZ8A 1RM5A 4FNMA 4HAWA 1CIPA 1RAEA 2VQDA 3P0IA 1RWNA 4DQLA 3C3KA 2BFEA 5F3WB 2A9JA 3B1XA 5KAPA 2GMWA 1QAOA 2PBLA 1EUQA 1IN4A 1DIHA 1T1JA 2C4HA 5DGHA 3BOSA 3ZS9A 4O4IF 5T6MA 1UUFA 1D6JA 2QQ0A 4JT2A 4AMBA 5DDIP 4ND5A 5A4KA 3G8BA 2J5KA 3GPIA 4EMSA 4E30A 3U31A 3CVVA 1B7GO 3WKCA 3QVXA 1PJ8A 5AOAA 1ZUWA 2Y4NA 1NXPA 3CRQA 3PBKA 3R3YA 4GQAA 1QIGA 4HDQB 4DR6B 2QRVA 2YWDA 4RSHA 4OFWA 3U1BA 5D8DA 5L3SB 4M8SA 2WF7A 4UBKA 4IOJA 2Q99A 4QHYA 3SP1A 3MUNA 3PL1A 1N5KA 4OAPA 3GAAA 3GLTA 2XWJI 4HDNB 4TYPA 3SIRA 5CFZA 7MDHA 3QV2A 4HI0E 2R87A 1EUCB 1E3QA 1KJIA 4A0RA 4CMIB 1KI2A 3V4VB 4XYEA 1JHPA 4LV6A 1SOAA 3K1JA 2ZJ1A 4Y2UA 1YOVB 4WAUA 1MCZA 2BHNA 4Y0NA 3DR3A 5ENVA 2WP0A 2QRJA 4WZAA 4NEHB 2VJMA 4YR7A 1CJBA 1VE5A 2VJKA 4UMEA 4XI9A 2B8EA 3OQ1A 5AK4A 3VYUB 3ZE1B 5FBZA 3JQ8A 1TIPA 4C01A 1Q3TA 1YZYA 2PUTA 5DNDA 4BVLA 5EPOA 2IW1A 3NTVA 3LOUA 4F06A 5FOVA 4EITA 2OILA 3FB4A 2FK7A 3GRVA 1EJ2A 1TPYA 1FXUA 3OICA 4FBGA 4G67A 1LRKA 3AETA 1DKRA 3PQ7A 5K9ZA 4GX5A 2BH2A 1T2EA 5JJIA 3E9NA 4YEDA 4BE4A 1DC3A 3EMBA 4FP9A 2GAIA 4P3XA 1YKFA 4F4JA 4ZYTA 5LZ9A 1RYEA 1U1GA 3A7EA 3PDCA 3KQMA 3OX2A 4FHEA 4D6YA 4E5YA 2XI4A 4XSVA 5AYVA 3WRWA 4YR9A 1UPTA 3V55A 4WZ6A 1RKVA 1A9TA 4KIUA 1G66A 5EE9A 2C61A 2PLWA 5BN1A 3IQGX 3OX4A 1SK9A 2FZKA 3E5HA 1SG9A 4FSDA 4LNHA 4PS0A 4IMPA 1FNNA 2J67A 5CH8A 3O1HB 3O74A 4AKEA 4OHYA 4Y1GA 1Z6ZA 2PYDA 2FXIA 1DQZA 3MT9A 1J20A 1V1MA 3ESCA 4UFPA 3ZVNA 3EMVA 2YV4A 1D1TA 1GTG1 1N2CE 3I2YX 3T0FA 3IRUA 5C1BA 3ZWMA 1VBMA 2I99A 4GRAA 2P0YA 2QMQA 5EY5B 1C9YA 3EGVA 3HA7A 1OJLA 4EHLA 1V2GA 1J09A 3DMYA 5F4ZA 4E13A 2V0GA 2WF8A 3BJZA 4IDAA 3HHPA 3CZMA 4LJKA 2O8EB 4QXOA 5BRNA 4XUGB 1WZEA 2QK4A 1U1DA 2YJ5A 2J6IA 2Q7XA 4NK4A 1F4VA 4ONEA 2GLUA 5HIIA 1IZYA 1KEKA 4G01B 1APBA 4P0QB 3EWAA 1XU7A 2C7BA 3D1JA 4BAZA 1WXWA 4ZZIA 4PE5B 1L4EA 2FAXA 1EA7A 1ONOA 3TB4A 4N47A 3B89A 1QF7A 1SEVA 2QN7A 4G5FA 1SU7A 5L51A 2XVXA 4EYOA 4D3DA 1FYXA 2HU5A 1XVLA 4H15A 4N1AA 4BHTA 4E88A 1AM4D 2JJ8A 5L9AA 4EY3A 2A57A 3COWA 4UE2A 1NW6A 4AYTA 1JI0A 1XZNA 2BFDB 4YCBA 4ENQA 3V7WA 3VR4D 4BVEA 1BA3A 3IIIA 3NHYA 5HGXA 4GMXA 1TQDA 3VAYA 1EVLA 2VQ6A 2WUDA 4JOBA 4FSHA 4YRSA 2DPYA 1TK2A 2ORVA 1L1EA 3PI7A 4Y9TA 4P3NA 3EPKA 4HSEA 1OB5A 1AZWA 2RHTA 5BV2P 2XV1A 3MW8A 1PW5A 4WIAA 1DBRA 2W71A 4YCJA 2QTCA 3EGXB 3PEFA 1IK4A 5DBGA 3T7CA 4UTVA 1EDZA 4JLVA 3WL7A 3HCPA 4Q9JA 1IPFA 1I10A 1RNLA 3AEKA 1NVUQ 4QBHA 5ESWA 1ZN8A 3GUVA 3SHTA 1RWPA 1Z62A 1G3MA 1EXMA 3EXAA 1X7GA 4JBGA 1D1QA 2QMHA 1E92A 3ORRA 2C3UA 2NO6A 2VYQA 3A6FA 5AXBA 4ZV9A 5KU1A 1YC2A 3JQ9A 3CBQA 2O3SA 3B1JA 3E03A 5T41A 1B76A 2GS9A 1LVGA 3UMSA 4CM6A 5BOSA 3CCBA 4S0XA 4D9JA 3ZQKA 3KJEA 4OD0A 1TDJA 3LXMA 4PX3A 4GQIA 4EPRA 2DHRA 3BXHA 1PDOA 1EM6A 4RJIA 1VPDA 1J9ZA 1ESCA 1GJRA 2H1LA 3CX3A 4DLPA 1TAGA 2RCNA 5BSWA 3K70D 5AVRA 1WQ1R 5TQ2B 1P7YA 2CMFA 2NU8B 1ABBA 5HQJA 4RVFA 5KREA 4WX2B 4QOIA 2ZRCA 2VF8A 4KZKA 4GFDA 4NQRA 2C0PA 5LPNA 3OCVA 2C2ZA 2QX9A 1ND6A 1M0TA 2ZDGA 4HMQA 4NX2A 4MW6A 4QRHA 5FAXA 2VRNA 2X9QA 3H9BA 3HJFA 5ALHA 4EB8A 1SURA 3BIJA 1L3IA 5FCDA 2OTCA 1KMHA 2ZTMA 1LBSA 1D8AA 4MVJA 3KZKA 4JP3A 4L8FA 2B0JA 4G41A 4UZSA 3D02A 3LUKA 3H9GA 4G8CA 2VTDA 3NAZA 2V97A 1M8GA 3NYWA 2R4TA 2BZ1A 4RFVA 1VIMA 1RZVA 3WGTA 1ISMA 3EX7C 1T8WA 4IJWA 1Y81A 4P7KA 5CIYA 2XOKA 3VAAA 2BMJA 3QWIA 5DZSA 1IIBA 1QSGA 4ZT4A 3TJMA 1QLJA 5C1IA 3WGUA 1YWGO 2BI4A 1WETA 2YY6A 2PH5A 1CKEA 3ZLBA 3AILA 3L8EA 3AY6A 4Z54A 2J59A 3GLFA 4DUPA 3DXXA 4CEIB 1JQLB 1XQYA 2HADA 5KNDH 3WOVA 3TM5A 3DLCA 1IFXA 2ZWVA 3IBYA 4DLRA 1SQ5A 4H7KA 4EYSA 2Z2YA 2JB9A 3OOWA 4F71A 3Q1LA 4OHPA 2IGTA 2IYZA 4BFVA 4NCJA 4ZHQF 3K0AA 2M1ZA 4L15A 1HE4A 2JAQA 4YUZA 3ZDCA 4JP8A 3U9TA 3RV3A 4I9HA 2YWGA 1N6HA 1Z16A 4YUAA 1J8MF 1E1QA 2FMIA 2FRDA 4G07A 1JFVA 2RHMA 4L9RA 3PYLA 1U2DA 2ORIA 3PCXA 4NXMB 5K0TA 3SZMA 5FV4A 2PUFA 4Q4AA 1DEOA 3OCJA 2XB2A 2XE6A 4MR9B 2V6JA 3U49A 5J47A 4TGLA 3RVQA 4Z7OB 1J70A 1T4BA 2YRFA 7MHTA 4F5WA 3ZWAA 3QLVC 4DY6A 3I01A 4MR7A 2QRLA 5HF8A 4NICA 5JS1A 2V4ZA 1WDMA 3SYTA 1V7ZA 2A0FA 2BGWA 1IY0A 1E61A 4ZI5A 1CR4A 1WSWA