2HHLA

Crystal structure of the human small ctd phosphatase 3 isoform 1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
180
structure length
180
Chain Sequence
QVIPIPSPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CTD small phosphatase-like protein
publication title Structural genomics of protein phosphatases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 180
sequence length 180
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2hhlA00
5AKIA 1RQNA 5ALIA 2IA5A 3AR3A 1CR6A 5AW1A 4BNDB 1T5SA 3HLTA 4I9FA 1T5TA 2IOFK 3WKBA 1QQ6A 3U7FB 2YJ3A 2R8EA 4I9GA 3FPSA 2OBBA 1TA0A 2FPWA 2JGAA 5JJBA 2VKQA 3R4CA 1QH9A 2B1QA 1Z4KA 3I76A 3QU9A 4IG4A 1WPGA 1ZOLA 3ZI4A 5AVRA 5AESA 3U13A 2YMMA 4UAUA 1XPJA 2X4DA 1FEZA 5FP0A 1O08A 2FPXA 3A1EA 3N1UA 2CFRA 4DFDA 4J2TA 4J03A 4BX2A 4PNHA 1RRCA 4KNWA 3WKDA 4BNDA 3S6JA 2RBKA 2GFHA 5A3QA 4HGPA 4YH1A 2MSNA 1RPZA 3QGMA 4BKMA 4UU0A 4HGNA 3AR2A 4H1WA 2YMPA 3PDWA 3K1ZA 3HYCA 2B1RA 2GHQA 4CE6A 3FZQA 5ALEA 4XQ0A 3L7YA 2EAUA 3A1DA 4UAVA 3MC1A 3OCZA 2CN1A 4NABA 2I54A 4BEWA 3B9BA 2GHTA 2YY6A 4L57A 1XVIA 4EELA 1Z4OA 4GIBA 3UMCA 5AK3A 5AVQA 2R8XA 5ALLA 2WM8A 3OCWA 4BEVA 1RC8A 3WK6A 3DNPA 3QUBA 3ZW7A 3VAYA 5E0OA 4KX3A 5ALGA 4BX0A 1Z4MA 3P96A 2R8ZA 4EX6A 1N9KA 3NAMA 3M9LA 2G0AA 3ZX4A 3R9KA 2CFTA 1PW5A 1QYIA 2W11A 2WHEA 2PKEA 3CNHA 3L0CA 4YIHA 1L7MA 1U7OA 4EX7A 3WGVA 1Q92A 2WF9A 1ZD5A 3EF0A 1CQZA 4Y2JA 5AVUA 1L7PA 2JAWA 5ALQA 4JB3A 2I34A 2FDRA 1RMYA 2HCFA 1Z4JA 4YCLA 1Z4LA 3BWVA 4ZEWA 3FPBA 3B8EA 1J97A 3ZU6A 2AUTA 3E84A 1EK1A 3R09A 5AKXA 2YJ5A 5ALWA 3W5CA 3ZUPA 4YGYA 1WZCA 2EARA 1SWVA 3IB6A 2NO5A 3PGVA 3OTQA 4UU1A 5AKEA 3ZVMA 4Y2SA 5ALNA 3OCVA 4HAIA 2FUEA 5AKZA 4HYTA 2OYCA 1TJ5A 4KYTA 3KC2A 4EEKA 5AW3A 5ALKA 4Y2RA 5AKGA 4F71A 2C8KA 1T9ZA 4QJBA 2GMWA 4O8CA 1Z5GA 1Z4IA 3J7TA 3QUTA 5AKJA 4G63A 2I33A 3L1UA 2G07A 1O03A 4C4SA 2C8LA 1RLMA 3M1YA 4QQFA 4DW8A 1AQ6A 2G1AA 1NF2A 2BDEA 3UMGA 3ZWDA 3I6BA 2ZBDA 2WF8A 2D2VA 2Q4RA 3NIWA 5ALDA 4GXTA 5IS2A 3QU4A 4UW9A 3OCXA 2MU1A 3N07A 4Y2VA 4Y2UA 3RF6A 3ESQA 1L8LA 2JAOA 3CZ4A 4BYGA 1K1EA 2Q5EA 5AVXA 3QUQA 2P11A 1WVIA 3I28A 5AIAA 5ALTA 2ZG6A 5AI5A 1YNSA 3MN1A 1QQ7A 1YS9A 1YMQA 3B9RA 4HGQA 3FVVA 2HDOA 3QU7A 3EWIA 4BBJA 2HF7A 5AIBA 1U7PA 2EATA 1ZS9A 4ZEXA 5IT0A 3OCYA 4FYPA 3WK9A 3KOOA 3WGUA 3AR7A 4MUMA 3E8MA 2ZBFA 2PQ0A 5AW5A 5AM2A 5AW4A 4YIKA 4CF5A 3L1VA 2WF6A 4UMEA 3DV9A 5AICA 3L0BA 3EPRA 1QQ5A 5AW6A 4KNVA 2PR7A 3ZTWA 1RMQA 3WK8A 4CNQA 3U7HB 5AK6A 4RETA 4BX3A 3PCTA 3KBBA 2B8EA 5AM5A 3OCUA 3IRUA 2YBDA 3WKEA 5AKLA 4HGRA 3NANA 4F72A 5ALOA 5AK4A 3U19A 4E88A 3SMVA 5ALXA 2I6XA 3D6JA 3QX7A 4UATA 3N8GA 3L8EA 3QU5A 2FUCA 1Z88A 4UMDA 5ALHA 5AVSA 1RLTA 2NYVA 3ET4A 5ALMA 2QYHA 3NUQA 5AVYA 5AK5A 2OA0A 5AVWA 4L6AA 2I55A 1NNLA 4Y2PA 1L7NA 4CF4A 5AW9A 4XOUA 3UM9A 2C9MA 4UMFA 3DAOA 2O2XA 5AW2A 5ALZA 3AR5A 2P27A 5AW0A 2WFAA 5AW7A 5AKYA 1L7OA 4OHFA 1S8OA 3ET5A 5ALRA 1RKQA 4XPZA 1TJ4A 5AI9A 2YJ4A 5ALYA 2YFYA 4AS2A 1VJ5A 1J8DA 3U7EB 3TLMA 3SKXA 2ZXEA 3MMZA 2G09A 3E58A 4FFDA 2OM6A 1L6RA 5AI6A 3A3YA 2C88A 2FPRA 3WKCA 1KYTA 2WF7A 3F9RA 4UARA 3EF1A 1L8OA 4C4RA 1U2TA 2HX1A 2FEAA 4HGOA 4NFLA 4XE5A 2P69A 3QXGA 2CFSA 3QU2A 1Z4NA 4JDPA 3KDPA 1N8NA 2B30A 2C4NA 2IOFA 1ZRMA 1ZRNA 1TE2A 2HSZA 2HHLA 4UMVA 4KN8A 4OFZA 3GYGA 3WKAA 3KD3A 1RMTA 3L8GA 5ALPA 3ZVNA 1U02A 5AI4A 5AVZA 1LTQA 2YMQA 3AR8A 2YJ6A 3U26A 5AI8A 2RAVA 5AHXA 3NRJA 1F5SA 3N28A 2HOQA 3ED5A 2ZBGA 5AKHA 5AM4A 4EENA 1XP5A 3BA6A 3SHQA 3QYPA 3FGOA 1Q91A 4UASA 2GO7A 2B82A 4AS3A 2ZOSA 2P9JA 1Z5UA 1VJRA 2RARA 2O9JA 3IJ5A 3QUCA 1Z4PX 2B8JA 2BY4A 3ZTYA 4DCCA 5AW8A 3L8HA 2G06A 3L0YA 1YDFA 2G80A 3SKYA 1EK2A 3WK4A 3QLEA 3W5BA 4UM7A 4KX5A 2DQSA 2B0CA 2G08A 5AM1A 3U7GA 1RQLA 3E81A 3ZWKA 5ALFA 2AH5A 2FPUA 1RLOA 5ALJA 3I1YA 1SWWA 1S2OA 4ZEVA 2R8YA 2AMYA 2HO4A 3ONNA 2FPSA 4FE3A 5T41A 5IT4A 2JARA 4YCNA 4DWOA 3AR9A 3SD7A 2FI1A 3W5DA 1WR8A 5A3RA 3WK5A 4L6CA 1IWOA 4AP9A 1SU4A 2HI0A 5A3SA 3ZX5A 2I7DA 3NALA 3DDHA 1X42A 5ALSA 3SLRA 3PGLA 2HF2A 3WK7A 1ZJJA 2JAUA 5AI0A 2BDUA 2YMLA 3OPXA 4C4TA 4IFTA 3ESRA 2RB5A 4EZEA 3L5KA 3W5AA 4OD0A 1LVHA 1RKVA 4Y2TA 1ZD4A 4UM5A 4CF3A 1Y8AA 5ALVA 2ZBEA 3A1CA 5AKKA 2NO4A 1VFPA 5ALUA 3SF0A 3RFUA 3AR4A 5AVTA 4Y2XA 3MPOA 1RDFA 1YV9A 2W43A 3L8FA 4NAVA 3KZXA 3NASA 4RESA 1U2SA 3UMBA 3FM9A 4Y2YA 4Y3UA 1RKUA 1NRWA 2WF5A 3QNMA 4MWOA 5AM3A 1Z4QA 2IOHA 2Q4TA 4NWIA 2QLTA 2YN4A 4G9BA 1MH9A 5AM0A 3N5KA 1ZD3A 2AGVA 4YCMA 4B6JA 4OCZA 1YJ5A 5AVVA 4Y2QA 3ZVLA 1TJ3A 1ZD2P 2ODAA 2W4MA 2HEGA 3AR6A 2IYEA 1JUDA 4NV0A
chains in the Genus database with same CATH superfamily
4GG1A 2ZIAA 4G0PA 4OXNA 4V0SA 4HSEA 3THXB 5HEKA 1JA1A 3IUNA 3BK2A 3FBWA 4W6ZA 2VTVA 1GGNA 2VJMA 2Y92A 5I7UA 5LBIA 2WV9A 4RVGA 1GHTA 1VC2A 1NN1A 1XO1A 2JW5A 2R8EA 2FN3A 3P0EA 16PKA 1MVNA 1Z38A 3BSYA 2VSFA 2UVQA 3QKWA 2OVFA 3LYUA 4NS1A 3EVBA 4DQDA 1WSAA 4BO7A 5GZ6A 1RWOA 3AK4A 3R24A 5GTDA 1C30B 1EUDA 1KP2A 3G0HA 1X7DA 3KTOA 5JASA 4D9GA 4EA8A 1ZLXA 5ED0A 4DCSA 4LOJA 4TMKA 3S2EA 1XZLA 3HXKA 5FP0A 8ATCA 3FTNA 4S1OA 1PFYA 2E82A 2AOUA 1JHDA 4QAQA 1F20A 3M4JA 2QRZA 4J16C 4MYUA 2C2ZA 2GARA 2QNRA 3I72A 4HYEA 2ECOA 4DFDA 1VJ0A 3HDTA 3VZRA 5KS2A 4NTZA 3MM4A 3KJXA 4UVIA 5BYJA 2X22A 3VR6A 3ZLUA 4RHFA 2HHAA 3DKPA 1WX1A 2YQ5A 3Q40A 4Q7MB 5JQGA 4NULA 1NN5A 1XTJA 1ADFA 2XMSA 5FH9A 1BCSA 3O84A 2RHCA 3QSYA 4W7HA 2G71A 1XDZA 1SUEA 2VTBA 1T8SA 3TW8A 3PFHA 1U4SA 3C8DA 4FHDA 3WNDA 3D02A 1SXJC 2GYUA 3NDIA 4NOMA 1II8A 3RUIA 2H59A 1TU0A 4F04A 3I8SA 5CVTA 1ZJ4A 4P0QB 1KAQA 2VCHA 4LBVA 1JPNA 1OVMA 4KYUA 3CKMA 4FNGA 1OIWA 2PG3A 2C78A 2DSTA 2Q27A 2FY8A 4H31A 2V97A 4MEBA 4XDGA 3ITEA 1UCFA 4Z51A 3X2FA 2AI2A 2J9YB 3SJCA 4AJJA 3H1EA 4GLBA 1SO8A 4CM8B 4AZ3A 1LK5A 4H9GA 1D03A 3VOAA 1E1CB 4XR4A 1C4KA 1R6DA 1RVDA 2P0AA 2XE7A 4YNBA 4ABYA 5CT6A 1FXWF 1NMQA 1E9CA 2YASA 4ZOAA 3LWBA 3HB7A 4BO0A 2O2SA 2PUAA 4OYYA 2OGTA 5L3SB 4QDUA 1HDIA 3VA7A 2VJPA 1PJ8A 5GWXA 4JJ6A 4JLMA 1UXKA 2ZTMA 2ZSEA 1TKBA 3E23A 1JWLA 2EWVA 3BORA 1Y7HA 2ES4A 3KJIA 4L78A 4C2UA 2ZXFA 1XNHA 4TMTA 3FE2A 1SU7A 1YR1A 1ZC3A 2AJTA 4HH4A 4H7JA 4J3JA 4AKIA 1C1DB 1DIOB 1GNRA 2RH4A 5FT9A 3WQRA 4BWGA 5JC8A 1FFDA 3L79A 2R0QC 2X4IA 5IMBA 5DIFA 1T4CB 5DX1A 4DWWA 2DUNA 4RGQA 4V39A 5K0LA 5LQUA 2AXNA 1LC0A 5C8XA 1P6XA 3R5XA 4O4IA 2RBGA 4NICA 2HQ1A 2GBCA 3KAJA 3ROMA 3VSBA 2NVBA 1VLZA 3DO6A 2H4FA 1WM1A 4REQB 5JDIA 1GILA 3MYYA 4YHHB 4BLVA 5ALVA 4QPJC 1TYDE 1E3MA 4JBGA 3ZHZA 4MVJG 3IDZA 1J97A 4P7GA 1YA4A 4LVNA 1MOZA 3BEDA 2GF2A 4FBMA 3AL3A 2C9CA 4Q3KA 5CFOA 3AF0A 2AFVA 1ZM3A 2W83A 3KOMA 1SXQA 1LW7A 4MKIA 4Y1RB 2Z2YA 4H3KB 5FNZA 5KSPA 5C7OO 3AT1A 1C7IA 2RCYA 3IQFA 4HADA 5AKEA 4MUGA 2FPOA 3HJGA 4I4IA 5G0UA 3CO0S 3RSFA 3ITDA 1YDWA 4HAIA 1A7AA 1Q74A 1L4FA 2NYUA 3FTCA 3ZR4B 5AW3A 5K8JB 1C9JA 1TX4B 3D7SA 1TM7E 3TPFA 3B1XA 1AMOA 2G5PA 2XCLA 1G0NA 1RWKA 1QU3A 2GHRA 2HV9A 2PD6A 3VUEA 3HM9A 2QMUA 1UBNA 1BNCA 4JWKA 4OHYA 4NAHA 4JX8A 1JSLA 4KMMA 3SR0A 4YAFA 3PNMA 4KFTA 4R8KA 3A32A 1B6RA 3FMPB 2QM0A 3AO0B 4CIWA 1Z0JA 4OI0A 1AZLA 4GZ5A 4IHJA 3ZUGA 3KDSE 3S2YA 1CJBA 4J29A 4DG9A 4KO3S 4Z2YA 2BONA 3EF3A 1UMKA 3EIOA 5AJXA 2FZVA 2IYLD 3DOJA 3CN7A 3BRSA 4MQMA 4ARIA 3HU3A 1CJCA 2AN1A 5F3WB 2IXBA 4GYJA 1XKXA 3D4NA 2CMFA 1WKCA 3HSYA 4LI0A 3GXOA 5M5BA 4HFJA 1QO7A 2DZDA 3ACCA 3C3KA 3D6UA 4HZGA 5ED4A 2UZ4A 3LDGA 5BSVA 1UJNA 4HNAA 4H15A 1GLVA 4PC3A 4CCYA 4JKIA 3E61A 4WKPA 1W88B 3JQFA 5EOVA 2W2LD 3LUPA 1QIGA 1N7GA 1OWOA 3QF4A 2QLBA 2ZB7A 1DOHA 2C03A 3P0HA 5F1OA 5PNTA 2OXIA 4MR7A 5I5GA 4OAQA 1M1ZA 3PQ7A 3UK1A 1QB7A 2PX6A 3WWOA 2BTQA 4E4TA 1C7FA 2AX4A 1FW8A 2GEBA 1U0EA 1T34A 3EMKA 1P44A 3OM9A 4YX9A 1Q50A 3T4EA 5FTNA 3T3HA 3TTUA 4JBYA 1NMYA 3QU7A 2W2MA 2ZWIA 2DPLA 1A4RA 5K0JA 4ENRA 2B5WA 5M34A 1GD1O 3DP7A 5K45A 2VH1A 2AX3A 3INYA 4K2HA 1T4BA 3OCYA 1SCIA 2QQ5A 3ZV4A 3WK9A 3UT0A 4C9BA 5T7BA 1BMDA 2G5TA 2ZAGA 1E0SA 1F6DA 3TXXA 2ADFA 1GSOA 4X1KB 2AG0A 2DCUA 1KOGA 4LFBB 5BOSA 3PGKA 4UUOA 5CB4A 2YOFA 1NYLA 4CGZA 3SN6A 4DUGD 4RTRA 4QO7A 5H5JA 4J75A 4G0UA 5GPBA 3TGPA 1RRGA 1H6CA 1THTA 4XW2A 2ANCA 2L42A 2WILA 3ZHCA 5DHTA 3IEMA 1IPFA 1XXHE 3IC5A 2JLWA 1SG6A 2EKLA 1SUDA 3WIDA 5BYAA 1M2EA 3WYBA 3MJHA 4QDKA 1JMKC 3OD1A 1IAVA 4CLRA 2J1LA 4CKWA 3OPNA 4Z3OA 3U4QB 3FR8A 3C3MA 4PBRA 3WL5A 1NASA 1O95C 5LYYA 3RARA 1ZHOA 3QVVA 3RYTC 2WABA 1E58A 3VR4A 3MSCA 4RHTA 4RM2A 5KNDD 4MQ4A 4GSLA 1DJPA 4O29A 3P45A 4OQYA 3A10A 1V5WA 5EINA 2W42A 3LCRA 4AI6A 2XUQA 4BATA 1ESMA 1SKYB 3BJMA 3EEQA 4JL8A 4PSKA 3L05A 3R6GA 4F72A 5BV1A 4PYKA 1B73A 1UKAA 4HDKB 4LYJA 2J6BA 4E88A 1UC8A 4GOJA 3SQXA 2VYCA 5EIWA 3JALA 2ZT5A 1Q95A 2IW1A 5ALHA 1JIJA 2V98A 3PWKA 5DU2A 3R5TA 2D74A 1K3FA 2IYZA 4EI9A 1I3CA 1C9YA 1XDUA 1UOOA 2GNOA 1WBBA 2BM0A 5K0SA 5KWIA 1V2HE 2ZE7A 4EI2A 2N1MA 2EJTA 3R1IA 1QPBA 2P35A 2UZAA 2V0NA 3UB3A 1BA2A 3BFXA 1QCCA 2EIXA 3I58A 4CM7A 1QYRA 1DCFA 3OJEA 5B6JA 3AVXA 4LJAA 4MR9B 1NBEA 1K6EA 4AY3A 3TFQA 4OGGA 3P5BA 1UK9A 3I5AA 5BVHA 3KXLA 1VG9B 2DM6A 1XV5A 4OHMA 4GPEA 1P81A 3LPCA 3IAFA 4KJXA 3V4PB 1TVEA 1TLLA 1K7EB 4QXPA 3T1TA 5TQ0B 4LZJA 2C61A 1V25A 2XOKD 3B82A 1S89A 1WVGA 3K5HA 4U9UA 5FA8A 5A2QA 3QEMA 4I4TB 3S28A 1EP9A 1TYEB 4K1LA 4HDAA 5HOEA 2FWJA 3C16C 1NM5A 2J31A 1VDZA 3A3NA 1ZK4A 2I1QA 2IEIA 2ALJA 2YFYA 1N33B 1FDRA 1U2EA 2D0DA 4FGKA 4R9NA 3NTVA 4INZA 2H1CA 5F5NA 1PWXA 3CIFA 1D4OA 1H9CA 2MHCA 3GGOA 1GZ5A 2QJTA 1GZ4A 1U2QA 3D3NA 4JKOA 5HM8A 3B7PA 3ZJUA 5A0VA 2BFEA 3UAYA 1FZTA 3V8VA 3NQ41 4B17A 5BW4A 3UUFA 4I8XA 3WKCA 1U8AA 3P32A 4LSZA 2WP8J 3AYZB 1O8CA 3NVMB 3OTIA 4J0FA 4JEHA 4FINA 2WSSA 4JGBA 4OSOA 4DC0A 1ANKA 6NULA 5KINB 1Q0LA 1AKMA 5I7VA 1TW3A 3L49A 1QBKC 5EHZA 1WZUA 4ZQIA 2VQ6A 1P9RA 2ZRAA 3QXGA 3G9QA 4ZCLA 5JSZA 5CA0B 1L3CA 1XJ5A 3GJRA 5EEGA 3KTDA 4RF3A 4Y6GB 3AI7A 4Z4HA 2DF8A 2OHIA 5E4YA 2DE0X 4PNZA 3KZKA 1YZHA 3WADA 2EQBA 3RUCA 5L4NA 1STOA 4HB2A 3A1WA 5BORA 5L4LA 2DKOA 3PDCA 4N5HX 5HTKA 2O3UA 2B69A 4R05A 5B36A 4Z4QA 5CX4A 1KNQA 1LRLA 1RJDA 4C43A 1XTZA 2VAMA 4WKBA 3FETA 1NZDA 1RC1A 3TLBA 3KQSA 1LZLA 3UW3A 3U4DA 4WCVA 3MUOA 4ABTA 4XM0A 3ILVA 3FCYA 4FHZA 2IS4A 4FEAA 4ZTUB 1U1CA 2VQ3A 1UBHS 2RI6A 4RLFA 3NHUA 5EKXA 3CLVA 5K0GA 1SPBS 5CFNA 3GLIB 1VKOA 1QOZA 3VNRA 1FJXA 2OORC 1E2IA 1R6VA 1M6YA 5IW8A 3EQZA 4NBKA 2CZQA 2BC9A 5K03A 4AO6A 5EE5B 3ROQA 4MJ3A 3BMOB 4DR4B 1JSCA 1X13A 4I5IA 3MXTA 4Q7LA 1JWAB 2G9VA 4J4HA 2B82A 4HN9A 2F43A 2Y0EA 1XRNA 1Z5UA 4FMCF 4G2TA 5EZYF 5FX2A 3Q6NA 2XDQA 2ZM6B 2VJLA 4JSRA 4BVFA 1KEKA 3JWEA 1U3VA 4Q24A 3WMXA 4ZREA 5B2ZA 2JLXA 2YNMC 3EXIA 4D7AA 1YDFA 3VTAA 4LHYA 5AP9A 3FFAA 1DTEA 1ORDA 4PHFA 3VHLB 4JNKA 3B6KA 2BM8A 1A8HA 2TMYA 3BB1A 4D4KA 1XALA 5DW3A 4DBLC 2WB2A 3PUXA 2P8SA 2AG5A 2CKMA 2FAXA 3DG9A 3UB4A 4CPDA 4JI2B 1QWSA 3OE7A 1K4KA 4L5YA 1FA9A 1M8PA 4FZ3A 4IM7A 3C5EA 1E1RA 1NL3A 3DCYA 4D6PA 3MWEA 2F4NA 4G4IA 2X8JA 3WS7A 4OLBA 3VKUA 3RANA 1X1TA 2AH5A 1QFXA 2YFHA 1QR2A 2JFNA 4JFRA 2OCAA 3G2OA 4HDRB 5TGTA 3KSMA 1ZNQO 1I24A 3MGKA 2FWBA 2IZ1A 1LF0A 1S2OA 2H4JA 2L0XA 1W96A 3L0ZA 1A9ZA 2AMYA 3L4BA 2WTUA 3DYBA 1RWWA 3L7AA 4JH0A 4KQ2A 2CHFA 3UC9A 2O0HA 3ZGOA 4B74A 1DBQA 1PZNA 1YRBA 1J25A 3ND5A 3BJEA 3S2FA 2R3SA 1GPUA 2XMPA 1YR9A 4X62B 1U5BB 2ZYSA 3UJHA 4NEHB 1UBSB 5FPSA 1QHGA 3V33A 3ZXUB 2RC6A 2Z0MA 1V8PA 2I91A 3IA2A 3BB3A 2IH2A 1J24A 2AQIA 3B6IA 3FHLA 3T1QA 1G2OA 3SNKA 3W77A 1GU1A 3MLEA 3AVWA 1SUBA 5L3VA 2I2XB 1G17A 3D8RA 1KL7A 1UBEA 1YI1A 2WTMA 3HMKA 4YXWA 4DREA 1DELA 1EVEA 4KK3A 4CEJB 5CYGA 2HF2A 4F4HA 1VKZA 3CVWA 4I1IA 1FP4B 1DRJA 1CQJB 2QTHA 1HZZA 3D3QA 4O2LA 3NGXA 4YJ3A 1X87A 5A06A 4Y30A 5DTRA 1ZVMA 4G1MB 2IGTA 1GQFA 2X41A 3FAKA 4FE4A 1GTZA 3RYIB 4E2ZA 1SB9A 3JZDA 4XLLA 5GJWC 1G6HA 3H9UA 4U1RA 4PRYA 4WLNA 4KR7A 1JR6A 4FOOA 2AC4A 3PRYA 4K9DA 2Y93A 3TX6A 2AK2A 1E3QA 4RPGA 2X5KO 4CT4B 3DE7X 1C3OA 3KHSA 1WXQA 1Z35A 3GLGE 2FWAA 4AECA 1SCNE 5HKKD 5LOVA 1Z0AA 1PLKA 1Q17A 1SXJE 4C4OA 3ZGYA 2F1RA 1IOWA 1THZA 2H4HA 4WGGA 1NV8A 1NOIA 4ND4A 2P2YA 3AZQA 2GSWA 1KDOA 4Y2XA 2JASA 2JHCA 5L3QA 1YL7A 1GKIA 2CVHA 3EQ2A 3UEOA 2ZRQA 4CIXA 3T7CA 1L5QA 4W5QA 1ICEA 2BKEA 3KFXA 4H4EA 3K70B 3AFMA 1UXGA 4BMPB 3BMNB 2V7PA 2R6GA 2BGTA 5HOQA 3CRZA 3P0RA 3OP1A 1DQRA 2Q28A 2PZKA 4YQEA 1M6NA 4Y3UA 5B12A 3H8WA 4N8SA 5H16A 2V7BA 4Y9TA 1RYDA 1R2QA 1NW5A 1V4VA 1JX6A 2ZU0C 3DMDA 3DZCA 3EXHA 5IVHA 1ONPA 4NMHA 3A4YA 3G8YA 1U80A 2HK7A 4C87A 2IJGX 4BRZA 1G4UR 1QE5A 1TQ6A 2PK3A 2V59A 3M3DA 1EDZA 2JATA 5FL3A 1L5LA 2WE8A 4PCAA 1NOJA 4J0KA 4HNGA 2J4FA 4K46A 4Y2QA 1RWXA 1TW2A 4MWSA 3ISTA 3ZVLA 4B4UA 1Q0QA 2CHVA 5JIBA 3PICA 2ODEA 1C3XA 2IYEA 4RDCA 4DQUA 3HBFA 3HPRA 4Q3NA 4I8DA 5DLPA 4A5OA 5CH5A 4CTKA 3KQPA 5E9QA 1DAMA 1CVIA 1X8LA 2LRHA 5KVQA 3N7TA 2O4CA 3PWZA 1H8HA 1KI3A 2A0XA 3AR3A 4GPZA 4V0MA 5FNVB 4A27A 4E1VA 2C95A 4EP1A 2UU9B 2NX2A 4GOND 2Q4OA 5E9JA 4GZ3A 2XYQA 4L15A 3WBBA 2RH5A 2XQFA 1QVZA 3OE1A 4KQ1A 1XZMA 3B7GA 3SQNA 1ENOA 3W3AD 2PYIA 3DGFC 4K6CA 3FOWA 1KYYA 1B0AA 1HH4A 1Y3DE 4C2TA 3FHJA 3VO9A 2HU7A 3PS9A 4A0HA 3CVYA 1OX6A 1M2WA 4V38A 5AOVA 4YR9A 1Z8FA 3QP9A 2OV8A 3OF5A 3VH2A 1M9NA 2EL7A 1ZOLA 2BMAA 1XMVA 5AESA 2C2WA 5J4HA 1K6MA 2ZPTX 5CTJA 5C8VA 3KXDA 1SBQA 3GLFE 1FEZA 2VZEA 1YS2X 4OBWA 4N6OA 1UOQA 5H4GA 2CL0X 1ATIA 2H2HA 2VAWA 1P17A 3V4ZA 5JT1A 1T9CA 1NU6A 1P4HA 4P1ZA 2BFPA 2CFRA 3KWLA 4J03A 1XLUA 4TXHA 1M3SA 4L0MA 5DNWA 2I1VB 2GJ4A 5DT9A 2BD0A 1N0IA 3IB3A 3HXMA 2DGDA 3JD4A 5ER9A 3U9LA 1UMBA 3E9MA 1FNDA 4HGNA 1LRKA 4WN9B 5CP8A 4DJ5X 4ETNA 1JHYA 4H1WA 2PH1A 4LUCA 5IJWA 3N8NA 3DZFA 3LZCA 3CMCO 4AMBA 1XYGA 2WSIA 3D3WA 5B1SA 4DARA 1F0PA 2XGMA 3DPSA 3WL8A 4CKZA 2FSIA 3KAQA 1LDNA 1ZOIA 4EYOA 1J7KA 3Q0EA 3L7YA 1KAMA 1MHPA 1WMEA 3MC1A 4J7AA 1RJGA 2PMEA 1EX6A 1PTKA 1DDOA 3BKXA 1JFFA 3R0JA 1ULBA 4K6MA 4W8HA 2FW1A 4FYIA 4BO1A 5CB0A 3CVVA 1L7XA 1ZBQA 4HGYA 2WIGA 1G6OA 4Q01A 1NDUA 1W94A 2PD4A 2CCGA 5CFLA 4FW9A 2XXBA 1ZM9A 1D0VA 2AF3C 3UQYS 1FPMA 4XIIA 5AOAA 1UP6A 1CZRA 1QHNA 2ETXA 3OQJA 4G0YA 3QV2A 3KZCA 1GEGA 4KDRA 1ZH4A 3SIWA 2IXTA 4BV9A 1QFZA 2C9DA 3SS9X 3DLBA 3SOPA 1NZFA 2QWXA 3WK6A 5LXTA 3T9DA 2CE2X 3VR5H 2I8AA 4AM8A 2RHOA 1JKFA 2I4OA 3E82A 1RWPA 5KB3A 3HUDA 4BNTA 3LSTA 2QGNA 1N9KA 1SU8A 1L9XA 1SC1A 4RADA 5F7OA 1NKTA 1WDLA 4DSAA 1QYIA 2WHEA 3LUKA 2NU8A 1O58A 2PT7A 3LBNA 3SYNA 3L1JA 5D3KA 4KGXA 2HREA 4X1YA 5HIIA 5D51S 4IEFB 5CXQA 4EX7A 4JDUA 1JEDA 1JJAA 2XKAA 1JKJB 3OX3A 4J3NA 1F5NA 2P4UA 3U31A 2TECE 1L5GB 5JRZA 4U39A 4WADA 3HNOA 3R6DA 1TF7A 4WXPA 4J6EA 4KUEA 3R7AA 2I2AA 3BREA 2PGLA 3PQ3A 3QVGA 3VZBA 3RLFA 5G0TA 3RE1A 1IQUA 5DVZA 3TGWA 4E5DA 3EAGA 1QIKA 4YRCA 1C3EA 1WXWA 2P9CA 3BOSA 3FWYA 3TZHA 3RHSA 3V7UA 4BQSA 1P62B 5CBPA 4RKYA 3IUBA 5JATA 3KAKA 4G07A 1COZA 4DR6B 1FFXA 5JJLA 3GL9A 3R8XA 2BZGA 4AIIA 2ACEA 4DR5B 3C3PA 1F0KA 2OYCA 2CD9A 3WI7A 2PMCA 1F7VA 2FW6A 1TJ5A 3FYUB 5JXJA 3QVWA 2X7HA 4I1PA 1QYDA 2EGHA 1K5PA 2CVQA 1FSPA 3ACDA 3L7CA 3QG1A 2ZUWA 4O4LB 1BXRA 4P5EA 1XCJA 4RVUA 4RXTA 4KFCA 4RD6A 3O94A 2OPBA 4KE9A 5KNCD 3LHDA 2Z4SA 1KJNA 1L5KA 4QKQA 4ZV7A 2BELA 1W1UA 3A9CA 3WWDA 4AK9A 1CUUA 3LDHA 4BLWA 4O8CA 4U8HA 4DJEC 1BFKA 3KYJB 3LV8A 4GLFA 1XD2A 3D6AA 4OP1A 5AXDA 4RF5A 1HORA 1WLSA 3TLYA 4BU0A 2ZUBA 4EMSA 5KHLB 1ADGA 1A7KA 2BCGY 4R2IA 1U0HC 3GMIA 4CR6A 2NMVA 1X8KA 4LVOA 3W4IA 3I3SR 2Y1XA 2Q5LA 4GQBA 4WT7A 4XD7D 3TLZA 2NXWA 3OF2A 2B2NA 3MLAA 5BNFA 4LWZA 4FT4A 1NC3A 2FQQA 3ZE2B 5KYYA 2R751 3UT5A 1CS0B 1GTRA 2X1MA 1DWUA 2OZEA 4DRXA 4KXQA 2PXAA 3HB5X 5K8VA 4DMCA 3EZ2A 1V16B 4ITRC 5E2IA 2WJGA 1R88A 3ZKWA 1JTFA 1CY1A 2P9YA 1J2RA 1W2HA 2ZBDA 3PC4A 5AOCA 4IZHA 5EPEA 3VOBA 4E22A 2YDXA 4MKRA 4HLDA 4PLZA 5IYZF 2Q3MA 3PNOA 4YACA 5KAMA 3VOSA 1I3KA 5IANA 2RGEA 4WXMA 2XF8A 4RLQA 1OHHD 2WMOB 1RADA 1EWTA 1VXRA 5DBGA 2JRLA 4F3TA 4YJKA 4KKVA 3NWPA 1T5DX 5B3JC 3R6LA 3OFND 4INOA 4C2AA 1VB5A 1ZIPA 3QWIA 4G4JA 2BEVB 4ARCA 2COEA 1X70A 4BECA 1HTBA 1GG8A 2N3ZA 3B9QA 3CKKA 3ANNA 3OIDA 4HDCA 2WIDA 4WXHA 2Q5FA 3MN1A 3INGA 3ZIAD 4NZOA 4ZAVA 3SQDA 1OIXA 1S2MA 3JQPA 3LPNA 1VG0B 3SYLA 1NLUA 2D4HA 2RHRA 4P58A 5JXWA 3FDXA 3GDFA 4N1AA 3WLOA 3QXHA 4EVSA 5C5DA 4RQUA 3BGVA 2EFYA 4WAUA 4FP9A 1OTYA 1QONA 4RVHA 3UKOA 1YRQA 2FEOA 2UYHA 1H2YA 2BL4A 3ODPA 2OBXA 3VPBA 4UTPA 2HR1A 3OIWA 2UUAB 5U9CA 3GNLA 3ZDBA 1ISJA 1ZVKA 1H3FA 5C32A 1BDHA 3RB8A 2GN4A 1G5QA 4KWIA 3WR5A 1OFIA 4F96A 1C8KA 4RL4A 2ZJ8A 1A4UA 1GPWB 3L7MA 1T1JA 3MXOA 2W8ZA 3N8KA 4QUJA 2CBGA 1L4KA 5JPIA 2IP2A 4KLRA 3F71A 1XF9A 3H04A 4MDHA 1ZBDA 3C87A 4GZLA 5IC6A 3BXOA 3HA2A 2VPTA 2HMAA 2XQVA 4ZTBA 4O4HF 2Q45A 3IRUA 3IKLA 3KNZA 1ECFA 2GKOA 2P6RA 1WB9A 3ROFA 3WIBA 2ZJYA 3SQWA 3BX1A 1EWYA 3QEOA 2VUHB 3C7AA 4GMHA 4DEVA 1RJ9B 5JH7F 5TPWA 2K4MA 1N1DA 4EUSA 3IMKA 4FFOA 3V8PA 3NONA 1AQLA 1LQTA 1YC5A 4YAEA 4DJTA 2Q5HA 3FCUB 3Q4GA 4GP7A 1N6PA 4EY3A 1W25A 4H7EA 4LF7B 4NNJA 4LXXA 1ZWLA 2VCYA 4POAA 1QO9A 5LU9A 1DO2A 1MLDA 3BQNB 3GRFA 1VMEA 4HB3A 3B2NA 5D6OA 2D7CA 1GZ3A 3HZOA 2CXQA 4CF4A 5ABPA 1L5YA 1CY7A 1MDBA 3K9CA 3I8XA 5IM5A 1V41E 2HDNB 3IQWA 1DOZA 2X2PA 3N2ZB 5DEIA 1DKRA 1G60A 2W6JA 4MV8A 1YZYA 2JIMA 4P4LA 1LBEA 4BGVA 1MUUA 4ZI7F 4LOAA 5AW7A 5CURA 3JRXA 3TNLA 4RM3A 4TXMA 1H4QA 3IFSA 1QYXA 3CB2A 1JTEA 2J7PA 1IJEA 2WKWA 1LBIA 2FF7A 3MJSA 4WESB 3WNZA 5K0BA 4XQGA 3EOBI 1GCIA 1XKQA 4I08A 4G0NA 5DTIA 5JAMA 3ZH9B 2F3SA 2BAGA 2X77A 1U0GA 4PPFA 2OWEA 5KMGA 3DL2A 4EA6A 1N78A 2GESA 5LLDA 1E3LA 1PX0A 3ZY2A 1HT3A 4ARAA 4ON9A 1C0IA 4RZXA 2AL7A 1A8UA 3B51X 3GP3A 3ROEA 4QTUB 5CH8A 3E7XA 2YV1A 1AK1A 4GPAA 3N70A 3F9RA 1R8JA 2EKPA 2GD1O 2HX1A 2HRQA 1EGAA 3NWOA 5FTLA 1I8TA 2PSSA 3H4IA 3UWPA 4LBYA 1FMFA 4IDAA 3B85A 1GN9A 1M0TA 4HXGA 1SHUX 4HNRA 1NTOA 3IEPA 2OB1A 1E7QA 1FP7A 2P90A 4DS3A 3O95A 4JKYA 2GN6A 5TDHA 3C1OA 3VNBA 2DUJA 2A30A 1XXHA 3GJ5A 1JB1A 1ZRMA 4J1TA 5F9HA 4KQ9A 3ZXXA 2VIIA 4DV0B 3DCIA 4TLLB 1JQJC 4CGYA 1AB6A 2FE1A 1CERA 2K2WA 2J08A 2PRYA 4Q7JB 1W1IA 3GYGA 5CNMA 2WHQA 5AD1A 1ZEJA 2CXTA 2RKBA 3EGEA 3L8GA 2VQFB 3L7JA 3QPCA 1JDZA 2ZLBA 2OPHA 4FZVA 3TSYA 2Q6LA 1J2JA 4IR7A 3VSEA 1US8B 2YJ6A 1P5FA 1NX6A 1NVAA 1EM6A 3R3SA 5CM9C 1GT91 3AUFA 3QVJA 4HWOA 1FP6A 3T4PA 3N28A 3H5TA 4K03A 4ALLA 2ZBGA 4PZYA 3ZQKA 5L6LB 1EK0A 2FJ0A 2WJPA 3GK3A 3KX2A 5EWMB 1Y8QA 2P9GA 4FQ5A 2XMDA 1Q91A 1R0ZA 3P5SA 4RKRA 4YQFA 5JCJD 2G36A 5FPTA 1OH6A 2PX2A 2DUMA 2PDAA 4IKOA 4COOA 3B6JA 1UKVY 3COYA 3GBVA 4MMYB 1TEXA 4TWIA 3LJKA 4NYIR 1Y7PA 2XR1A 4KVZA 3BQ9A 3SZLA 2A2ZA 2BKXA 4RE5A 3UJBA 2O19A 2PSHA 4PHGA 2CHQA 5EY5B 4MS4B 4JCOA 4D9HA 2G06A 3L0YA 4JR2A 4RSRA 1NWHA 3G8BA 3ZGZA 4NPCA 2P7HA 1RRFA 4ILEA 3WOHA 1B26A 2VEDA 3B5EA 3IHWA 1NQUA 2ZWOA 2VZ8A 4UHKA 3N9IA 5JO9A 3SZRA 2VDOB 4BVKA 2QAGC 3F9IA 1MP0A 4TQAA 4ER5A 4XOIA 4BFLA 3F7TA 3GMDA 1B42A 4QSMA 1WXIA 4WVLA 4K26A 1BXKA 3OO0A 4H7PA 3ZZ1A 1NFQA 3VPCA 5HPYB 3E81A 1P18A 2Y9PB 2MT9A 4RA6B 4WK2B 2FPUA 2CMHA 2V54A 3HLYA 1TJYA 4LMAA 2NPIA 4NSNA 5CUQA 3HU1A 3DM9B 2HN9A 1DEXA 4I1VA 1I94B 4BMYA 2H06A 4ICIA 4NYMR 1GRVA 1UJ4A 1KBZA 1MTZA 2B94A 5DTJA 3WFJA 4CMEA 4YRJA 4M9CA 2FN9A 5T41A 3WB1A 5K99A 3OBBA 2UUPA 5BV8A 4NI5A 1P8JA 3AYXB 2WVGA 3QBEA 4XCVA 4OXIA 4BKPA 3OTWA 3QE4A 1S1CA 1T13A 1UBJS 1XPRA 3QOFA 1FX0A 1GPH1 3DHEA 2AE2A 4HZIA 3W5DA 2F1JA 3T99A 3GELA 3LCJA 1Q3KA 2YIVX 3B3QA 5HCIA 3LQKA 1UWVA 1P2VA 1I1QB 5HFNA 2BJVA 2R6FA 2C0PA 1R5JA 3RYFA 3V8RA 2HSWA 3IIJA 4RZIA 3I1JA 3ZX5A 2ZR7A 4LJLA 3GB9A 3UK2A 3OQBA 1VLQA 2IZZA 3F8WA 3FYDA 1S3FA 1Z7BA 2WG1A 3ENWA 1Z34A 2EW2A 4HH3C 3DE1X 4KWHA 4CV1A 4IV5A 2FSGA 4RLHA 3WRYA 2XB6A 2ZJ5A 3VX4A 1J07A 2VDWA 2P4SA 3SQOA 4PN3A 1Z26A 4Q3DA 3OPXA 3DEAA 1W36B 3HJBA 4P86A 1I9CA 4IFTA 1T8WA 2B8NA 1IIRA 3QI7A 4I6GA 5FORA 2LDBA 1M5TA 4EHFA 2QTVB 9LDTA 2ZRFA 4Q34A 4QHSA 5G3ZA 1YACA 1RCUA 1F17A 1BQ3A 2OO7A 1TYZA 1KDZA 1QPGA 1BXGA 5TQ2B 4KMRA 1MVLA 3ANSA 1IZ0A 2VNHA 1YKSA 3LUAA 3SQMA 1O5TA 1XNJA 1P0MA 2GN0A 1ECGA 4O2AF 3O73A 1JIVA 1SY7A 5GP1A 1SRRA 2CLDX 2OCYC 1Q19A 3DUFA 3X3HA 1PQPA 5CA1A 4I0WB 3S81A 4MHOA 1G20E 1KA9H 4ZKEA 3NHMA 1OJLA 2C84A 5IT5A 3AEKA 1WIWA 4HDMA 5JYBA 1UPBA 2FX3A 1AHIA 3VR3D 4JR0A 4RKWA 5ELMA 1FSGA 2ZRGA 3ZDRA 5IABA 4BU1A 1SIBE 2Q4DA 4NMMA 4CQNA 1TEZA 4AJKA 4C01A 1EU1A 2WPNA 1IHYA 4LA4A 3THRA 1JDBB 1Z4QA 2VJDA 1EQ2A 2CUTA 5B1EA 1H5UA 3FYSA 3TW4A 2C1XA 1GY8A 2PZJA 4FKMA 4G5RA 1Y8CA 4LYYA 1AT1A 1EUDB 5F64A 2O7SA 5IP5A 5SY9A 2JHPA 3GOHA 5T3YA 3TNFA 3I37X 3UMSA 3H6GA 4G9GA 3BFPA 2HCTA 4K6GA 4QLOA 4JYAB 5TXGA 4MIYA 1EFHA 3TSZA 1DRKA 2IHJA 2QQEA 1Z4KA 3ENQA 4ECEA 5HQ3A 5KZMB 2AOUB 5EESA 1Z5OA 4EFMA 3Q9NA 5KOHB 2J4DA 4IYRA 1YCFA 4OFXA 4CM4A 4PAMA 1QG4A 1USWA 3I9V6 4G1EB 1I6KA 1XJQA 3LLSA 1YIOA 3RVNA 1PL8A 1GWNA 3K4QA 4DE5A 3PUWA 3N0VA 3AHHA 1U2RA 4I9GA 1MB0A 1O94A 4A8PA 2JGAA 3CWZA 4KE7A 3TW8B 3I0NA 5BN5A 2AYYA 3UO8B 3FLBA 1E9SA 1II8B 2D62A 2Y66A 2LCFA 3C14C 3KOUA 3AY3A 4LPKA 1L8QA 1G4HA 3M4XA 2DP4E 2FMUA 3QVMA 4LPSA 3ZY3A 4RZ3A 3BRWA 2WM3A 3KB8A 3K31A 3KQLA 3OUUA 1IK4A 1WB4A 2FUNB 1X80B 3H86A 5CLJA 2E3JA 1OLSB 3PGA1 1LJ8A 4AZ3B 3ZHYA 3HI4A 1TQHA 4J16A 3DE2X 3RASA 4M1ZA 5CK4A 2CXHA 1XL1A 2PSFA 3F6EX 2REQA 1KXZA 4ZT5A 3G9UA 1PJCA 4YJ2B 5HJ2A 2H65A 3OKFA 5C8YB 2BN4A 3DTNA 4BYMA 4Q4HA 2GN9A 2G25A 5AO9A 4DBVO 2X6TA 4IBOA 3RRYA 3DVAA 2NVOA 1F2DA 3CJQA 3NBFA 3GLGA 1R8SA 3AY7A 1SXJA 3RG2A 4K28A 4D3XA 5KOIA 1GCUA 1XTRA 3I23A 4XQ0A 2AMVA 2YDYA 2IP1A 3HO6A 1JYSA 2X40A 3D0KA 1ETUA 5UKDA 4IGFA 2WT4A 4JX9A 3CZ9A 1S6YA 1WB6A 3QHQA 1KIMA 2H63A 2HCBA 2YICA 1PTJA 2RHMA 3R0XA 1E6WA 1EGVB 4GP6A 4RORA 2DVMA 4GR4A 4O4IB 4F5WA 1HZJA 1DX6A 2ZIXA 1YZVA 3VR6D 1Z45A 1Q5PA 3KJGA 1LUAA 2FMTA 4MP3A 3EVDA 4HRAA 1KI8A 3ETJA 1E7RA 3U9SA 3R44A 5ALLA 2IL1A 3RODA 4CI9A 5F77A 1CUCA 1I6WA 3SEZA 5C81A 2Z2KA 2VPPA 4BEVA 3HA3A 5BR4A 4QNRA 2CLKB 2WPDD 3PA6A 3IUMA 2QYSA 1UMDA 2X3YA 3PENA 3QUBA 2WWGA 4MYDA 1G64A 2WWTA 1BRTA 3DLPX 1Z0IA 3A8TA 4BV2A 2NXCA 4DHWA 1Y33E 1NBHA 2OMEA 1QLHA 1H93A 4ZALA 1C2TA 2YNMD 4B80A 1QIJA 2IYAA 2OY0A 3JYOA 1II9A 4LOIA 4WNIA 1U8XX 2QVXX 4J76A 3W79A 4B3CA 4CQMA 5JW6A 2OHVA 4TQUS 3HCDA 4HFMA 4KSBA 2WJWA 2YTZA 4ZPJA 1C14A 5BYBA 4MUKA 3U61B 4HX2A 4EB6A 1NR1A 1A5BB 1I0ZA 4I4LA 2WK1A 4ARVA 1NJGA 2PUWA 4ZVSA 1MTOA 4JB3A 1XLWA 2H4WA 3ISJA 3O8RA 3PGJA 4UNNA 2DFKB 5EJMA 2VHVA 4BAGA 2EX1A 2CYCA 4BLUA 4C0WA 1CHNA 3CPHA 4L73A 5D1NA 4IHJB 1JXQA 3BYZA 3CINA 4XJVA 3W3AH 2OGWA 3TD9A 2YJ5A 1A88A 3Q2IA 4R41A 5A4JA 1C8BA 4I55A 2H1SA 2O5RA 4K05A 5C5CA 3GLFA 3RROA 3IEKA 5DM1A 5JAIA 2IODA 4XLZA 3RKSA 2IZ6A 5AKZA 4E7OA 1DMSA 1OB2A 3DJFA 5DEOA 4KAJA 3RUDA 1ZAYA 2HUNA 5A5DA 4CMIB 4D26A 1NA5A 1EJ0A 4U9IS 4F71A 2FQWA 2ZZMA 1EJ2A 3EG9B 2FZCA 3ILYA 1QHXA 1UFVA 3BD9A 3SJZA 1RQ7A 4K9SA 3E03A 3C4JA 4N3NA 1WEHA 4TT8A 3ZC3A 1XFDA 4FYKA 4LMPA 2PT5A 5FXMA 1JZSA 1BS2A 3ANXA 1AE1A 1FP1D 3QF4B 4BJ1A 4I4CA 2D13A 4F0JA 1C3VA 2ADMA 1FL9A 4MR7B 4DAOA 1PX2A 1YS4A 4LDRA 1RQ2A 2BTQB 3HV0A 4QICA 5KSYA 2OB2A 1VPDA 1G9SA 1U7HA 3G0OA 1RLMA 3V6LA 3Q98A 5EAIA 1Z9BA 1EK6A 2GCIA 4DG8A 5C7IO 5EQTA 1YRWA 1PJZA 2VEOA 4QYIB 1EBBA 4JJ4A 4JOBA 2DLDA 1IY1A 2EFHB 4UFNA 3O91A 3MFYA 3TFWA 4XYMA 3C1AA 3B6ZA 2NAPA 3FUXA 4DZZA 1RC0A 2H31A 3ZE8A 3JWPA 4HLCA 5CB4B 3RAFC 4DANA 4IWNA 2E49A 3C7KA 3IAXA 2VP0A 3BFKA 4NBNA 4QUKA 2BF4A 2ZIGA 4KDEA 2O50A 4NS4A 4HNQA 4DMLA 1PCXA 4KIGA 3DEZA 4WH0A 3X1KA 3ZS9A 4D4MA 1L7RA 4BYGA 4B6EA 4R6WA 4P83A 1QXSA 1FXSA 3OX4A 4HH1A 4OQLA 4R69A 2CXPA 1ORRA 1ZC4A 2R2GA 1B6TA 4OGLA 5ALTA 1E0JA 1V7CA 1KMHB 3FSEA 3GEMA 1IY2A 2PGAA 2VQSA 4PTLA 4BVHA 3PUHA 1YMQA 1NIJA 2NP6A 2O4UX 5CG2A 1F8UA 3EYWA 1PQUA 4TXJA 4AY5A 1Y3CE 3DT9A 2PSDA 4TLDA 1PJQA 2I78A 3VJKA 3I61A 3FKSA 3NBXX 3ZWYA 2ZYHA 5JSQA 4G5FA 3HBNA 1QOQB 2PQ0A 5K3FB 2EKQA 3QPAA 1BVUA 3VC3A 3M81A 4BVEA 4COKA 1ZFNA 1VG8A 1TO2E 1W48A 2QN6A 4D41A 1QGUB 1MC5A 3W2HA 2F62A 2A1UB 2WTBA 3BD8A 4F4IA 1MXHA 2EQ5A 5IFKA 3UFBA 4OA5A 5B3LA 4Q3LA 2IOQA 4YC7A 1WXGA 4C0KA 5CJ2A 3A11A 4BQFA 4JELA 4R2KA 3Q5GA 1Z8HA 3G0IA 3RS8A 4MAAA 5HP4A 1U11A 4JVLA 1HE3A 4C7OB 3F9CA 3UJNA 1F2UA 1YBFA 4CNQA 4JLPA 1JQBA 4ZYWA 4HAOA 3H11B 4RETA 1KH1A 1TMKA 3LI2A 1G21E 1C4XA 4YMVA 3R9IA 1U8FO 3FOBA 1EJ6A 3GT3A 3PC6A 1FXWA 3AVVA 4JXZA 4FHEA 3DXZA 4Z4CA 1SIUA 2XYRA 3D4BA 3G59A 1BDIA 2SKCA 2F3TA 2QG4A 1P2TA 4F06A 3H87A 1KDYA 1JQKA 3ZNQA 2E5WA 4HEA6 4R3UC 1N25A 3SC2A 3PDIA 2PBFA 4HNSA 4KUGA 3QU5A 1IQRA 3OP4A 2R1VA 1DAEA 1RJWA 1NLFA 1NMEA 1YAHA 1FB5A 4WLOA 4BLSA 1HLDA 3CLSD 3X1XA 4B45A 1ZUNB 3V1NA 3UV7A 4DV7B 2RH9B 3DE4X 3KZMA 1NUQA 3U80A 4PXSA 4C0HA 5MN4A 4G26A 2BFEB 3R8CA 3MAGA 1VMKA 1ZGCA 3W3ZB 1PK9A 3IBYA 4RLSA 3K3PA 1CR1A 2QVGA 1O6ZA 3CVOA 3GRUA 1Q83A 1T3ZA 2ZAIA 1VMDA 1RSZA 1YSCA 3C3WA 4J43A 3G2NA 4CIAA 4GM1A 2CJPA 1E4OA 2I1WA 1B76A 1V6AA 4K9QA 5I9LA 1U98A 1XRLA 4EECA 5K7SA 3PTAA 1QG6A 1Z3IX 4BTEA 2WUVA 3BL8A 4AG6A 4CHTA 5JSZB 1D6MA 3LW8A 2ZUEA 5AI9A 1ZJYA 2MSDB 1JAXA 4US0R 1QP7A 1U2DA 2CLHB 3AF1A 4G65A 2IXFA 4CCWA 4KDFA 1MJ5A 2AV6A 5HMMA 3QYAA 2YUTA 4BFWA 5KDOA 1E61A 4OM8A 4WA7A 3SKXA 2GTIA 2PRSA 4BOYA 5BN1A 3LT0A 4M87A 4P54A 3K9WA 3UW1A 4BP8A 2RGGA 1D09A 2C5EA 4FU0A 4KE8A 2FK8A 2N75A 5FI0B 1VMAA 2EL9A 1Q20A 2R00A 3B1KA 2C8VA 3OFJA 4FFLA 5CPFA 2P3OA 2F3QA 2OV2A 3ZQUA 1OQAA 4EKYA 2OD2A 1XN1A 1ZMRA 5DGDA 5I4CA 1XR3A 1TAQA 4MUHA 2OCLA 5DYWA 1DG3A 3JD2A 3LFUA 3ORQA 4GUDA 3TSCA 5EI5A 4M0MA 1UDAA 1JYEA 2WSYB 3DVQX 3NU1A 1RRVA 4PZAA 3TECE 2AQ8A 5KX5F 2HWXA 1JDUA 2VBIA 1PT6A 2I6SA 4QREA 3W6ZA 3OY7A 4J07A 4P3YA 1UDXA 4H2DA 3KD2A 3ODGA 5TS3A 2PAAA 3KKQA 3L8CA 4DT1A 2YZMA 4HL6A 3BBPA 1OYVA 1KDPA 3OURA 2FG7C 2ZTLA 3C3DA 4AKTA 1OYYA 2FWPA 4GVPA 1VKJA 1Z0KA 1CFZA 2JIZA 2WSSD 4US1R 1CNEA 4GVLA 3GLKA 1U94A 5CNIA 3HGQA 3TLGA 3ORRA 5DN9A 3U26A 2GCNA 2IKQA 3GAFA 3VMFA 4NE2A 1P5JA 1F5SA 2FG5A 1PSZA 4GNRA 3PQ2A 4R8VA 3ED5A 1Q2XA 4CQLA 3C0KA 1W75A 3PFKA 3EXG1 1VB3A 1XP5A 1XZCA 3SHQA 5K3EA 1G291 2RAUA 3L7OA 3MCVA 2QLLA 1JFVA 4OFBA 5AXBA 4ZOQI 5JPDA 5L7WA 4YRDA 4MVJP 1TJNA 1SD1A 1TYCA 3I6YA 4Z0TA 2BP7A 4BX9A 3TEFA 1PL0A 2ISSD 2VF5X 2ZRHA 4G25A 4W5HA 1J33A 2FSSA 1VSTA 3QH4A 3QXCA 1PNOA 1NQTA 4JB2A 4P0TA 4YN3A 5FPYA 1XI2A 3SDSA 3MB5A 3U6KA 2Q2WA 4JJGA 4RVSA 2XCOA 4FR5A 3HFSA 4UBOA 4W8GA 2JFGA 5DMXA 2WD9A 5I9NA 3P2KA 4UQOA 1Z7EA 2A9RA 1M2JA 5B64A 3D7NA 3MJTA 2QL9A 1CX9B 1PFGA 3CF4A 3Q88A 1E6LA 3G9TA 2GCOA 2ZUCA 5M3BA 5AUOB 3C6YA 4I9NA 2IV7A 2X14A 4LCJA 5KOYA 1MX1A 2IZ0A 3DBOB 2CB9A 3N6VA 5CLHA 2W4IA 1WXDA 3LYLA 1KJZA 421PA 2V9PA 1NT4A 2C0QA 4N65A 4WY8A 2BFMA 4DAEA 2H5LA 1Z83A 4B75A 4ALKA 4IVPA 3KSAC 1H69A 2EU8A 3GGPA 1KH2A 3F67A 3WLKX 1RLOA 4ZCTA 1WG8A 4O5AA 4AWXA 3K4HA 1L7BA 1Q0UA 3F3SA 3I6MA 1HRDA 4RCVA 4CRWB 5HK9A 1RHQA 4YJ3B 2VBCA 2GOYA 1HLPA 3PNPA 4XVRA 5MN5A 3CISA 2PFSA 2FPSA 3ITKA 4ESOA 4OXXA 1QQTA 2JARA 3LUHA 2FKAA 4CL3A 3PQ4A 3T7DA 3TR6A 2PH5A 4ALJA 1KMIY 4FGUA 4PZEA 2I4LA 5BQPA 4MB6A 3AETA 1GN8A 2IEDA 1C3OB 1F6BA 1YRHA 2ZR8A 2KI5A 4MINA 5FADA 4ZZ3A 2HWKA 4RGBA 3VH4A 1WJGA 3A7EA 3HB4X 4Y6SA 1E1RD 5LOVB 10MHA 3MCWA 4GMDA 3EYAA 4EPTA 2C7OA 1XRJA 4C20A 1JU9A 1PR9A 5L3QB 4LV8B 4NZMA 3S8YA 4F5DA 5DYIA 3KQTA 2WU3A 3AWDA 4TKUA 5TC4A 4HDNB 1E9RA 3R75A 1NP3A 3CF6R 2ZSBA 1SBZA 1EEXB 4ZVQA 2FSVA 1USKA 2VF7A 4JP8A 5K4AA 5FOTA 4GBJA 2QX9A 1KI6B 3I4CA 3DFZA 1AZSC 3FD8A 3FFWA 3NJRA 4QRHA 3CX7A 5EJ5A 3W5AA 1K8ZB 4FFMA 5BN3A 4ZJUA 5P21A 2DFTA 2X3FA 2TMGA 3R3ZA 4IV0A 1KFKB 1LPBB 3AKEA 4XGIA 5BVGA 2LTAA 4QXOA 3D54D 4S1WA 4UFOA 5JBQA 5B30A 2A1IA 1Y8AA 3V48A 2ZBEA 1W6RA 2WA1A 4FGWA 1V37A 4TLCA 1WE2A 2ID8A 3I9V1 4KQ6A 1JDSA 2XMQA 1FRVA 4Q9IA 2OESA 1WNTA 3LQQA 4YXWD 5I8PA 4KRFA 2J9XB 3NKFA 4FBGA 2EJVA 4NYJR 1LPSA 4FYJA 2WQ7A 4JXKA 4BC0A 1QTQA 2MCFA 3PX3A 2Q2OA 2H1FA 3KZXA 4N3CA 1M75A 2BV3A 3KDAA 1U2SA 1MB9A 2QY6A 2R4UA 4M0FA 2X3UA 1Z12A 3RC9A 5JR3A 1V1RA 3TO5A 2AOWA 4B48A 3AESB 2BF7A 2AC7A 2O23A 3TLAA 3TUZC 3M3HA 1M2OB 5DNVA 2WQZA 1MO5A 5EXSA 2WF5A 1G5TA 2QPOA 2BR3A 4LJ4A 1Z8DA 4XRGA 2GZDA 2I2BA 1EAMA 4KRYA 5CHYA 1IVSA 4HMPA 3QHPA 3QXXA 1Z3CA 1GDDA 2NAFA 5EIXA 5HDQA 1N5DA 4RTOA 2FFQA 1QV6A 3BUSA 4L5CA 4YCBA 5DP1A 4HH0A 5HR5A 4LXTA 3GHHA 4ND7A 3VBCA 2IYWA 1GRRA 4MO9A 1GPJA 4RD3A 4L3VA 1DJQA 4EW6A 4ER3A 3JAKB 1XZNA 3LA8A 4DPMA 1PZEA 1OH5A 3EVAA 5ALIA 2DKFA 1HX7A 1FUYB 1OD6A 2BFNA 3FKJA 2SCUA 2Z04A 3LK6A 3QLTA 3RTEA 2PAFA 3OA2A 5BW8A 4GS5A 1T5SA 3TW6A 1JEYA 3W1EA 2IYQA 4U3JA 1QHHA 3WKBA 1ZU5A 2WMNB 2X2OA 1CUIA 1QV9A 2OBBA 3EZFA 2O3RA 3ZWAA 4NOKA 1E6EA 3OT1A 4TVOA 4W8OA 2I03A 4OX9B 1RBMA 2PBRA 1RI3A 5HIAA 3K15A 4EFKA 1XNGA 1UZUA 3BTSA 1PJ3A 5T67A 3VAZA 3W1VA 2BDTA 2BGNA 3U13A 2WFZA 4PGAA 2DTXA 1APBA 4TXLA 5EZYA 4V02A 2IBSA 3HCNA 1LB1B 3ZBUA 1YU9A 1VCMA 1UWLA 1N2CE 3GVXA 5JVDB 2O8EA 3DOIA 5FUBA 1P4JA 4KNWA 1WD7A 1THGA 3AUYA 2CUZA 3TSWA 1D1PA 2JFXA 1JP7A 3L6CA 3IUQA 2YHIA 2WUGA 4NXNB 3HJFA 5GM2A 3AEZA 2BSXA 2D59A 3TL6A 1XCLA 5CDYA 5K09A 2JFWA 2V6FA 3V2HA 3SGLA 3SSOA 1H2EA 5J5VA 4DLPA 4DCMA 3U7QA 4CQJA 2IIPA 2Q4EA 3BVPA 3GFQA 1KMMA 3FPHA 4NK4A 3GFGA 4PHTA 4XM2A 4EG7A 3ESCA 1OFHA 1UOPA 4YAUA 1EVIA 1G20A 2IUEA 2HT1A 2ATIA 1R0KA 1MV5A 1CE8B 3LG2A 1O97D 4F97A 3DDOA 2EERA 2NU8B 4YJFB 4GKJB 3USZA 2GZ2A 5ETJA 4MKHA 5TEVA 1TO6A 3LUGA 1H85A 4NBUA 1EFPA 2WYVA 4X1YB 1PUXA 4Z54A 7YASA 3QITA 2P9EA 3LNTA 4J6FA 4BLOA 5DM2A 3OLWA 2DEUA 4B7AA 3G85A 4GIBA 3L18A 2JL1A 1K3TA 1ZHFA 3JD0A 3HEMA 3QVGB 3GP8A 1E4EA 2HIAA 1J6UA 1GTG1 3DMTC 1WCYA 1COWA 3GUUA 3VU0A 1WVMA 4OK6A 3OCWA 5CD9A 4EYGA 5A6VA 1DXHA 2EFJA 1P80A 5HW0A 4QRDA 2UXCB 1UZNA 3VU9A 4PLVA 1N75A 1QX3A 3QKRA 5ALGA 3MTQA 5KU7A 3P96A 4RANA 3TIXB 1Z15A 3MCTA 3X1MA 5CBPB 4QYMA 4OHVA 4QQ8A 2ACVA 4M1SA 4RIIA 4E21A 1G8JA 2BIFA 3R7SA 3IX7A 1PZHA 3Q3EA 2DH6A 3MGAA 2Q9CA 1H1TA 1K9SA 3CW8X 2YVQA 4DV4B 1CDEA 1L7MA 2EW8A 3EH1A 4TV8F 1EH5A 4HJXA 5EEHA 3FWNA 3WGVA 4P3PA 1W85A 1ILWA 3IT1A 4FPXA 1V35A 1U9ZA 1WF6A 1L1FA 3RQSA 1WEKA 4B9EA 4R0VA 2QUAA 3ROPA 3NR2A 3GFRA 2DWQA 3K0SA 1XEXA 3DD1A 1Z18A 2GLTA 5EXPA 3K1TA 1MOPA 4MI6A 2ZBPA 3VKWA 1XD2B 2AMJA 2QD2A 4IHQA 1NLMA 4IGIA 4EUFA 3E84A 1JDPA 2QE6A 5H02A 1H2AS 2EJWA 3EHDA 1U8ZA 1N2OA 2ZBVA 2ZRCA 3ND7A 1R50A 1TL7C 1TQ4A 5KYYB 5G0VA 2VUSA 3G5LA 3UT5B 5DOZA 1UP4A 2B34A 2XHZA 3LIIA 3MJEA 4WZ6A 4DRXB 1MH1A 1WTCA 1Y3FE 4G56A 4Y2SA 3OCVA 3RBXA 5J2UF 4DZRA 4M1WA 1IC6A 1RAHA 1SHTX 3KC2A 4PRLA 5EQDA 2CLSA 5LA6F 4EEKA 2Y6UA 1MA3A 1MO4A 4EF6A 3HXPA 1H0HA 5BR7A 1CUGA 3LZ6A 1F8GA 5A6SA 3T0IA 5EKSA 5BNWA 2IDJA 1PJAA 2Z3WA 4F7WA 1ENYA 5KI6A 4ZYXA 1B3RA 5JFGA 3QE0A 4YCJA 1YJXA 1CFJA 1H2BA 2NUPB 4FWTA 5H70A 3P2EA 5LZ5A 3WO0A 3NBZC 3FUTA 3WGTA 1E8MA 4LYHA 5ITWA 4BTLA 2ODWA 1ZI6A 4BZQA 5KWEA 1I01A 1LBSA 2WUWE 2ZRLA 3PLRA 1T8PA 2IV3A 3PYLA 4QA9A 1MT3A 2P7IA 3O4HA 1E2FA 1T2DA 3CSUA 2BDEA 2C2KA 4CV2A 2D5AA 3DLCA 5TQJA 5CB6A 5CFPA 1O89A 2X5XA 5K05A 4YJGB 2X5JO 3QXJA 1AB5A 3IVAA 3TIVA 2IX3A 2YRFA 4N48A 3GEEA 2ZVJA 1JN0A 2ODQA 2R66A 2NV0A 2OXFA 1JG6A 1HV8A 4DC1A 1JYFA 1SQGA 1PF7E 1ZXBA 2VT7A 4IKPA 3F3YA 5HCNA 4DSNA 4A16A 1DKQA 1ZKDA 1XD9A 3AQIA 1JEQA 3BTOA 3UHFA 4I7EA 4L0CA 5AH0A 3ESQA 3EDOA 5JMPA 5TEWA 4HRXA 1U0SY 4INPA 1AQNA 4EG8A 2HJSA 1RLUA 5B3JA 3L46A 2CE7A 3HCBA 5FFNA 1MDFA 1JAYA 4Y6RA 2R7AA 2Z09A 1H23A 2J7KA 3TQCA 2A57A 4PEVA 1O2DA 4H7DA 4XVCA 3KWMA 4PPGA 1IHOA 2XYPA 1J99A 3IBCA 3PKIA 4L0DA 4I50B 1V8DA 3NOQA 2X7XA 2UDPA 3F8SA 4MI1A 5E4JA 3SFVA 3SPXA 1GFWA 3AKDA 4HEA1 1JFRA 3U4CA 4RABA 5IT0A 3DKRA 4FWBA 4D42A 3I2YX 3O2JA 1EE1A 1J56A 4JK3A 1BWQA 5DGXA 5T6BA 1E98A 2W6OA 4RGYA 4FYHA 1AURA 3PNLA 4Q1EA 5JE8A 3SX0A 2QPLA 1YCGA 4NDNE 4E12A 5KTSA 4OIMA 1VBMA 4IIDA 3RU2A 3OZRA 3ZXIA 5C5EA 3MWKA 5CLLA 2OFPA 2O3SA 2ODNA 3OJCA 3LPDA 4EUKA 4F3YA 2H2WA 2FP4A 1MQ9A 1NBOA 4LF4B 3BXXA 1TIPA 3GH1A 3L0BA 1LS1A 2E87A 4HWSA 3T34A 3U1VA 3A37A 3MW8A 3VJLA 1EI9A 2RAFA 2BFFB 2ZJ4A 4G1CA 2ZETA 4GOMD 5BRNA 3X1WA 4B76A 4Z2AA 3ZVKA 4UE6A 3U7HB 1QSGA 3G7NA 5AK6A 5HSGA 2DETA 4PCVA 3OG9A 3HO1A 1JDVA 3EWAA 3I01M 1YBHA 4ML3A 4BX3A 1GPLA 3RNOA 2CWDA 2VSNA 4EG1A 3OVMA 4PPQA 4ZN6A 2QTFA 4B3RB 4I4NA 3OCUA 1RAFA 4URHA 3LC2O 1E0DA 3H2GA 1O4VA 4HGRA 2YXEA 3TB4A 3GGSA 1TOAA 3AP1A 3F4BA 4C6TA 1CJMA 2A4MA 4X24A 4J4TA 5JYEA 2IEAA 1T5BA 4MS1A 4WA8A 2O8EB 3N8GA 4C3ZA 1JJ7A 5MGBA 3V7WA 4FZ5A 4LZPA 4UMDA 5JU6A 3AVYA 3MS4A 4EJ0A 4N40A 4EPVA 3DC2A 5KMGB 1KS9A 4C5AA 3ABZA 3TDMA 1QLWA 3JQAA 1W5TA 3M70A 1XF1A 5AVYA 3U7RA 4CKCA 4YTEA 4Y6QA 3O0DA 1O96A 2J46A 1O6FA 2XRYA 1LA2A 3NWJA 1TC2A 2AOTA 2CD7A 3P27A 3D4PA 4JB8A 1DLIA 2B83A 3EXEA 3FNHA 3GG2A 3WMGA 4M1MA 1D07A 1ADJA 3IP1A 3M49A 1AHNA 4I5FA 4QNMA 3AR5A 3CRW1 3M33A 2XY4A 4ND2A 3RNLA 5L7TA 2XCSB 1Y80A 2C58A 3E5RA 2FQ1A 2VC2B 4HEJA 4J1SA 3SWWA 5CLGA 3HYNA 3SIRA 2VF4X 4LRTB 4HQNA 5KYXA 3L6RA 4KFUA 2IUYA 4GKAA 4XUGB 4HV4A 1JHZA 2GUGA 1U63A 3D1VA 5E8RA 3ECAA 2HRZA 4KCGA 4N18A 4I9UA 4XQ9A 5CFMA 4AFNA 3CBGA 6ADHA 2XLCA 4PIVA 3UVEA 3FOAA 3ZCUA 3E35A 2YCBA 2X4GA 4KR6A 1XZIA 4R1LA 3P9XA 3KT3A 1P2BA 3OAAD 5ECYA 2MINA 5CT5A 3T3EA 3C39A 3QKSA 4UD2A 3A3YA 1E2HA 1PGNA 2VLIA 4M37A 3A4VA 2WKQA 3CVJA 2BEJA 3A1TA 1Y7IA 1MQAA 2C3MA 1A9XA 3F73A 1ZH6A 2JA2A 2W6JD 3PC2A 5H9WA 4Z9AA 3TJMA 4XJSA 1J2UA 3CLRD 3JSAA 4HGOA 5BNTA 1AKWA 1FJ2A 1QHEA 5EP2A 3ZBQA 3NIDB 5GOZA 4JJFA 4XE5A 3RK1A 3GYBA 2CFSA 4P4NA 3A3KA 4JDPA 4FFVA 4YT5A 4DKXA 5ADVA 3VYSB 2IX9A 3IIEA 4L85A 3C8ZA 3OU7A 4IGAA 4DDMA 1U7ZA 1DO8A 4QXMA 2P5YA 5FL7D 1RLIA 1KP3A 3MD0A 3E48A 5IJZA 3EUAA 3HKCA 1NUSA 2HHLA 3M6VA 6PFKA 2CSUA 4RA9A 2EZUA 4RH1A 4D8XA 4BWFB 4INAA 4KN8A 1JDNA 1T4GA 1G21A 4KZKA 4MW2A 4NP6A 5FLYA 5FFMA 3IP5A 2NT4A 5ALPA 3OTOB 3LYAA 3CSSA 3KZ1E 1DT5A 2V7EA 3EIFA 5C37A 5C46F 5ES4B 3AEYA 3AR8A 4LYDA 3PHJA 5AI8A 4MTCA 1XT6A 2A5DA 3U37A 3KZOA 3C4QA 1OI4A 3MTAA 2ZRJA 1OBHA 4GW3A 1OF1A 1O5IA 3T0FA 2F00A 1ISHA 3PD7A 4EENA 4D96A 4NH4A 1YCDA 3PQFA 1W7AA 1JKXA 4NEGA 1XDGA 2DPXA 3S44A 3SSAA 5ARBA 1JBKA 1PGOA 1DKUA 1XMSA 3TEJA 1OVGA 5K6AA 1FTGA 4AS3A 4I14A 2GZSA 4QEZA 4MMZB 4LDNA 1B6SA 1Z2CA 4BVGA 5KDLA 2YVLA 3OQHA 4KQKA 3MJDA 4KWTA 4BCCA 1EHCA 1LLUA 1T3HA 1E3EA 4LCBA 3DLTA 2NSHA 1BRMA 121PA 3Q6IA 3NWEA 3KFVA 1ZD1A 1OXTA 1T0UA 4P6VF 1D6JA 2QQFA 2AYXA 3H97A 4Q03A 4BMNA 3B53X 4J2HA 3P9ZA 1FUKA 1FX0B 3DBIA 1P7PA 3A70A 3GJZA 3PKZA 2NPOA 2TRSB 5EUMA 1RI4A 2VP5A 1J42A 5ECGC 5I9IA 2BBSA 1V6SA 4QTXA 4Z0NA 3RUHA 3VR4H 4BRWA 3B5JA 1R5BA 3LRTA 3AERA 3ZLBA 3BULA 2HTEA 3JD1A 1DFHA 2COKA 4ZA2A 2EBWA 1TVKB 5J58A 3OIUA 2V3WA 4RCZA 5IJAA 3OUZA 5TSDA 5IAGA 3KPVA 3T1OA 4LKOA 1FOEB 4F60A 1JBQA 3B7WA 1M5UA 3DBHA 5A9SB 3EHEA 1VPTA 3BXEA 4I1UA 1H5NA 3LO8A 2WJYA 5CK5A 1P5ZB 3SDBA 3CTPA 1Q16A 4EITA 2Q49A 1P2SA 1NN0A 1U0OC 2W2VA 3WZMA 2C29D 3ONNA 4W5JA 4UPVA 1E9AA 4S24A 5T4EA 4ASUD 1TRKA 2ZCVA 3NGMA 4KFSA 4ARBA 4MZXA 4BKOA 4ZYUA 1BXGB 1JAIA 5AVOA 2FI1A 3MUNA 5IF9A 3K5WA 4H3HB 4ZZIA 2GASA 2IP4A 2OMKA 1HXHA 4LRQA 3JRWA 4BO6A 5JH7A 1RQGA 4ESVA 2P9TA 2VVTA 2BJWA 3DUFB 4LRXA 3U2QA 5CA1B 4RAQA 3HCFA 2ZIFA 2Q8QA 4GMGA 3UJ6A 3H1TA 2Q3JA 4HDMB 1XU7A 1C7QA 1QP0A 2C9OA 2QUJA 3D2CA 1CY0A 3FVTA 3GLHB 4TMXA 1Z2EA 4YRTA 3QV1A 3EGVA 4F9TA 1FRFS 1N3LA 1P1BA 2BZ1A 3LDFA 1YULA 3IH5A 4YDQA 3E9CA 4XDYA 3HVKA 4R1UA 4NEQA 2IS1A 1IN4A 1F1BA 1G42A 1QM5A 1ZM7A 4ZQEA 3LT1A 3PV0A 4BUZA 2HQOA 3VQTA 3DMRA 4DR2B 1SBTA 1IZ8A 4GXRA 4WK4B 3EZGA 2C31A 3MRXA 4LVUA 4MSUA 3BXGA 1Q14A 3IOMA 3TNYA 5LQCA 1LDYA 1V0JA 4BMDA 4Z7QB 1N2XA 1NSFA 3CUVA 3NO4A 3GIDA 1E2GA 3EVTA 4G89A 4P22A 5ANRB 3WOVA 3LOUA 5HQ3B 3COWA 3C74A 1Y1QA 4HXEB 4AJ1A 1SRQA 4IH4A 3ENVA 4K9PA 4PANA 1YL6A 1YQUA 4KJZA 2G40A 2GI4A 4U6NA 3C5HA 4W9NA 4RD4A 3UENA 3W2IA 4CM4B 4YCSA 3TIIA 1UKZA 4JYCA 1YJBA 2C2XA 4R01A 2G7ZA 4QIHA 5LN1A 3BPSA 3JQ9C 3O93A 1Z5ZA 3FAZA 3OQ1A 3VOTA 1PEKE 5EP1A 4K6FA 2G63A 2C1EA 1PS0A 5LQJA 1VKRA 2Z8XA 4NU5A 4RY2A 3ZWWA 4C6HA 1FLNA 4DKJA 5JWRA 1FDTA 1X3SA 4FGSA 4OQXA 5G4LA 1H4SA 4KK4A 4LWPA 5IAEA 3VHQA 4V1CI 4YP6A 1YJ5A 4P80A 1NFFA 1L4YA 4RWZA 1NP7A 1TJ3A 4DV5B 4R2JA 3EY4A 2LIPA 1PYDA 4KC0A 1OGJA 4GHWA 1V2GA 3AHEA 3EVNA 1HYEA 3P94A 1P3Y1 3WFZA 3AILA 1EA7A 2GXQA 1OAOC 3C1TA 3EEFA 4NJOA 4F4FA 1Y4AE 2EKBA 2F17A 3O4JA 3EZNA 1QO0A 1IDOA 1LRJA 4DF3A 3CXRA 2PGNA 1VIMA 2AZTA 3A4TA 3IA7A 2V7TA 2R4TA 3MGGA 1FQKA 2ONJA 2UXDB 2F67A 4Q4HB 2WW8A 4WVFA 4DXHA 4G37A 3QLUC 2HEIA 4H3SA 4GFDA 5EHGA 3DVAB 1IAQA 1OA0A 2XT0A 3IE0A 3KR2A 4CHGA 3OOJA 1HEIA 2CHUA 2PU5A 2PQMA 1SXJB 4LYAA 3DLIA 1II0A 4M1KA 4IG4A 3AIIA 3FOZA 1QQBA 1JALA 4B44A 5IVPA 1UANA 2IYVA 5JNUA 2HQSA 3DH0A 2JJ2A 1TI7A 1QFJA 1SKYE 3H83A 3W34A 4C03A 1NVTA 1D2MA 1MU0A 1K9VF 1F12A 3QFCA 4J4BA 1M2FA 1NI3A 4BEJA 1G8GA 1TECE 4MUJA 5AQEA 2QM3A 3OZWA 2ZIXB 4DJAA 1J8FA 2FZKA 4EHDA 4WKNA 5KNBH 1BW9A 3VUFA 4BGIA 2C77A 3OECA 4Q4DA 3KLOA 3QVUA 1X7XA 2A0KA 2J3QA 4BKMA 4M0EA 1O9BA 3KOWA 4LGMA 2Y1DA 2K87A 1XYVA 5ESRA 4DNPA 5EFOA 2H1LA 4EVQA 3AEQA 2CCKA 1H65A 4HT3B 2ETVA 4FCTA 1VGQA 2GLXA 4DIEA 1OUMA 4ZRMA 1NBME 4OXRA 5ALEA 1G8PA 3T8YA 4UBJA 4UAVA 2G82A 1WMSA 2XUGA 4V1CB 2QDKA 2DWOA 4D92A 1EINA 3BRWD 4UXIA 3IXMA 1MPTA 4X5OA 2A67A 4WK0B 4ZAGA 1NNEA 2IDZA 3DV2A 2I6TA 2AJDA 2Z4RA 3DDZX 4KLNA 4Z8XA 2IPOA 3BMQA 5FOSA 2GK4A 3LO5A 2GAJA 4ZGGA 1CP3A 2NTYC 5DRYA 2IPMA 1EVQA 3UFXB 4EB6B 1DP4A 3CG4A 3VZCA 3GDOA 3GRYA 4DUZB 2C2BA 3MTJA 4ZVPA 3J81A 4NKRA 3TKYA 4WOJA 1ZONA 1R4NA 1G5FA 2C59A 2BI4A 1HFEL 1I33A 2A3RA 4MPTA 3URMA 1Z13A 1Z4MA 5BO5A 3AJ8A 5T64A 3RTDA 2R79A 4A7PA 4PN7A 3DLHA 4LGCA 5B4VA 4DLVA 2BFCA 2KLHA 1U0LA 2IEBA 3BRCA 2CFTA 4ZCIA 4X9XA 3KKNA 1ESEA 2DU8A 1G3MA 3L0CA 4IXMA 2I9PA 1T25A 4LXIA 4QGAA 4EYKA 3CBQA 4MLDA 4Y8VA 2QRVA 3A1SA 3KHTA 4L02A 2I7XA 1CF9A 2XD4A 3K6JA 3OM1A 3ZCRA 2Q6KA 2DHEA 3EZ7A 3PFWO 3N76A 3TZKA 2J0VA 1TM4E 3WYNA 4BRSA 1T2NA 3PXCX 1ZIOA 3REGA 2MYUA 4NLLA 4E6PA 4Y18A 1ZVJA 1BOFA 2VHYA 1A72A 1UPFA 2BM1A 4UBMA 5TT1A 2C99A 3TKAA 1RMYA 4I3GA 2V7WA 1AZWA 2FR1A 5ENVA 4YCLA 3F49S 3JYPA 3P9PA 3KUXA 3L04A 1RWVA 5DM60 1GG5A 4DLUA 5TARA 4RK6A 4ALIA 1PJRA 5BP7A 1YZLA 3I4LA 3BGWA 1SZCA 2JFUA 4MUAA 4HY3A 2C97A 4IFBA 2HC9A 2O8FA 1QK3A 2JI6A 1D7OA 1N2CA 1X7ZA 1XQ6A 1U7DA 2X1VA 4O6VA 4CQMD 4EY7A 3GLIE 4QJ5A 1YI0A 1G38A 2FUEA 3I9KA 3ZJ4A 1NW8A 1ZIYA 1EFCA 2H0RA 4IOLA 1G66A 2CFOA 2DPGA 2PL9A 5KQLA 5ALKA 1T35A 3FDZA 2OV3A 3GFOA 3KUCA 4RYDA 5AKGA 3FR7A 1I7SB 5TF0A 4CG0A 5F98A 3FTFA 5T8KA 3MLBA 1RVV1 2NO1A 1N4DA 4HYQA 2BGUA 5G2OA 1ZRSA 2EFCB 1B41A 2FE4A 3DBVO 2XDWA 5ESDA 2R6AA 1WD5A 3UPTA 2NXEA 1TM2A 2E5LB 2A5JA 5CEEA 4MCHA 2GBLA 3WA7A 2PMFA 3Q7SA 4OQEA 4CV0A 3SY8A 3QTLA 2G07A 1T2AA 1TMGE 1CUAA 1NULA 2ESRA 4L9RA 4C4SA 4UFPA 1U28A 3L6BA 3ND8A 3M1LA 1ZPDA 5BV0A 5I48A 3CWCA 2OXRA 3GPCA 4LWQA 5D3QA 1X3LA 1X19A 4NYIQ 5L7YA 4CWAA 2F8SA 3D3KA 4IXTA 4OQPA 1VHDA 5B57C 1RXVA 1NONA 2D2VA 1MEJA 3NIWA 1D2HA 2XF2A 3SXJA 4TSFA 5B1IA 4CLHA 4E33A 3THWB 3QU4A 4DV6B 3DKVA 2DFNA 4RAOA 4V0QA 3W2EA 4KXMA 4ZANA 1N5OX 2C9ZA 1TTQB 4YLYA 1QUEA 1LJLA 5JQWA 5FUXA 3ZWCA 5BWBA 3AJEA 2D1YA 3B38A 4M46A 1YZNA 1XPUA 3RK4A 4DV3B 1WRBA 2GN8A 3AJAA 5FHRA 1JQ5A 5EIHA 3W2FA 1EWQA 1WVIA 3DPIA 3L2OB 4JZYA 4PBSA 4YJHB 2C5GA 1ZCZA 2OHXA 2XVAA 3PT5A 1HE8B 4X8OA 1YS9A 4UQPA 5G3YA 1GZVA 2P2SA 2Q3DA 4QUDA 1VRCA 1XWIA 1MO6A 1MIOA 1C0PA 1NVFA 1PK7A 2P2GA 4OY3A 1QGOA 1VSBA 2ZIUB 1N1GA 4NYMQ 4XUCA 5CVUA 3IKTA 4GKKB 1I9GA 1NP6A 2QLFA 2WM2A 2JGJA 1C7JA 3GGDA 4QDJA 3FRJA 4P32A 4BMXA 3MQFA 3DUWA 4DA9A 5A03A 3I9MA 3SC2B 3FVRA 4MRVA 4C29A 4MICA 5HDBB 9ATCA 4YALA 2J3LA 4QYSA 2HMUA 2QD5A 2R1VB 3BDIA 3R41A 1MIHA 3AKZA 4LJ9A 2QZ4A 2QTRA 3PTZA 1I6LA 4DJDC 1IN5A 1EGQA 3CZMA 4YASA 2QZ9A 3DOHA 3WB9A 1NVGA 3JD3A 2GILA 3QE2A 3HPQA 3UK6A 3PVCA 4RZUA 4ZVVA 3R23A 1BJKA 1RWMA 1X7HA 1XCGB 3GR6A 4WW0A 3RUAA 4E94A 2XUOA 3VX3A 4ZO8A 3O2SB 1GP2A 1W44A 2B8EA 3FKSD 3U3MA 1XQYA 3I9FA 3STUA 5BWOA 2ERXA 4AJIA 1NVXQ 5JZ9A 2JVIA 2XVMA 4WWHA 4TRJA 3AX6A 1YD7A 3IAM6 4WNAA 4F8EA 4F8JA 3QX7A 1LQUA 3MCAA 4IAOA 2BGKA 2A35A 4PG7A 3S1AA 2FUCA 3NOXA 1SHJA 2D6FA 3G8DA 5C8YF 5HILA 2FVYA 1R5NA 3QFRA 4A2PA 1E18A 4KYIB 4FEEA 4TMVA 3EZYA 3R74A 4II2A 3PPWA 2DQKA 2IY7A 4BFCA 1GTMA 2OA0A 4B40A 1CRPA 3FPEA 3KSUA 3FCXA 4B7ZA 4L74A 4V24A 1JAHA 4PO9A 5CTAA 1CJKC 1R00A 4FW8A 2V74B 3FG9A 4OHPA 1G8MA 1FUIA 2ATEA 3LX5A 3GLQA 2PLWA 3ORFA 3RREA 2Q0QA 4NCAA 2GT1A 2HF8A 1HC7A 2HPZA 3VR5A 4IXNA 3WNBA 2VKTA 4N8DA 1EIWA 1YXMA 2NPFA 4AN4A 3NB0A 4IQ8A 5ALYA 3CIOA 4P92A 5BY2A 1CNMA 3U40A 1VJ5A 4DMHA 2WQ6A 5EUQB 1IXRC 1BG6A 3PQ5A 2H1WA 1Y1SA 3TOCA 3DE6X 3WV5A 1EUCA 2HA5A 3NV9A 4R9RA 1QUFA 1IB6A 5CBKA 1DG9A 1GPAA 4D46A 2RONA 1OT5A 2ISQA 1RYMA 4QODA 4EGFA 1KQ3A 2WF7A 2VNJA 4N5DA 1JV2B 3NWBA 4BVBA 5C1OA 2IGBA 4LG1A 5G4KA 2R4QA 3TLGB 2NU7B 2FEAA 4UTXA 5FBLB 4PLPA 3UA4A 1Q21A 2H2DA 4LN1A 4LC9A 3BWEA 3ADDA 3COPA 4DLWA 3HEAA 1YVDA 1Z4NA 3QF7A 2PE5A 1Z7YA 4EG3A 1PW7A 1UMCA 3FW1A 2DUUA 2PKQO 1DMRA 5LQAA 1DO0A 4PC1A 4Q4LA 3EIWA 2QBYA 2QEQA 5IBQA 2YWXA 1OFUA 1PFQA 4LXUA 3EEBA 4JSYA 3OKAA 1QJCA 3M6IA 1OZ0A 3TOZA 3WLSA 4DQVA 4OGKA 4LBZA 3GQVA 2QJFA 3GJQA 4KN9S 4YMSA 5D5HA 2FPKA 4IDBA 1J21A 2OFFA 3ZHBA 3CF0A 2WSMA 1EXNA 1J2YA 2PVPA 2Y76A 4DLYA 3GRVA 1OFTA 2IYFA 3FUUA 3LUFA 1N36B 4OMDA 2H3HA 3K0CA 1J1UA 2JI7A 3LF1A 1YCHA 4LXQA 4BO8A 5FJIA 1MAAA 2D5LA 1Y4SA 2EGGA 3BJRA 1CD5A 3HZHA 1PDVA 3PIRA 3PFFA 1Y3IA 1SJ9A 3BGSA 3SBXA 4ZHSA 1QYWA 1SVSA 4ZXFA 2Q3HA 3DKIA 5AM4A 2HBRA 3REQA 4UM9B 1S8NA 1FTYA 2HBZA 1GRCA 2ZKLA 3KLBA 4MHTA 3A06A 1E3TA 3ANYB 3EB9A 1TA4A 4BJHB 1RHJA 3C45A 2XRMA 3CW9A 1CZHA 4X41A 2B4RO 2BOVA 5F5XA 2VBGA 2YOHA